Você está na página 1de 126

Universidade Federal de Ouro Preto Ncleo de Pesquisa em Cincias Biolgicas Programa de Ps-Graduao em Cincias Biolgicas

Varredura de uma biblioteca de cDNA da aranha Lasiodora sp utilizando-se de antisoro policlonal anti-veneno total e clonagem das seqncias codificantes para LTx1 e LTx3 no vetor de expresso bacteriano pET-11a
Andr Luiz Gomes Vieira
Orientador: Dr. Ieso de Miranda Castro Co-Orientador: Evanguedes Kalapothakis

Dissertao apresentada ao programa de psgraduao do Ncleo de Pesquisa em Cincias Biolgicas da Universidade Federal de Ouro Preto, como parte integrante dos requisitos para a obteno do ttulo de mestre em cincias biolgicas. rea de concentrao: Biologia Molecular. Ouro Preto Maro 2005

Este trabalho tem sido desenvolvido com o apoio financeiro das seguintes instituies: Fundao de amparo Pesquisa do Estado de Minas Gerais FAPEMIG Conselho Nacional de Desenvolvimento Cientfico e Tecnolgico CNPq Coordenao de Aperfeioamento de Pessoal de Nvel Superior CAPES Universidade Federal de Ouro Preto - UFOP

Do trabalho das tuas mos comers, feliz sers e tudo te ir bem. Salmos 128:2

Ana Luza Vitria Daniel

II

Agradecimentos

A Deus, pela fidelidade inabalvel e pela certeza de que, mesmo quando estou dormindo, o melhor tem sido planejado para mim. Aos meus pais (Jos Clio e Elza Gomes), meus irmos (Helen, Jaqueline, Neemias e Tiago), meus sobrinhos (Ana Luiza, Vitria e Daniel) e meus cunhados (Ronald, Patrcia e Glauciene), razo de tudo isso. Amo vocs! Ao professor Dr. Ieso de Miranda Castro, pelo exemplo de seriedade e compromisso com a pesquisa. Muito obrigado pela orientao e oportunidade de realizao deste trabalho. Ao co-orientador deste trabalho, professor Dr. Evanguedes Kalapothakis pela indispensvel participao na construo da biblioteca de cDNA e discusso dos resultados obtidos. Ao professor Dr. Rogelio Lopes Brando pelo empenho em fazer do Programa de Ps-graduao em Cincia Biolgicas da Universidade Federal de Ouro Preto um programa de destaque. Ao professor Dr. Helio Hideo Bab pela amizade e pelas dvidas cientficas esclarecidas. Aos professores Dr. Luciano Fietto e Dra. Juliana Fietto, pela amizade e pela boa vontade e prontido com que compartilham seus conhecimentos cientficos. Muito Obrigado por tudo! minha colega de graduao que se tornou amiga e que se tornou irm, Michelle Bueno de Moura Pereira. J estou com uma saudade! Cida, como difcil expressar a gratido por toda sua simpatia e competncia. Ningum que passa por aqui te esquece! Maria Jos Trpia (Zez), simpatia do LBCM. Aos colegas de trabalho do LBCM: Maristela, J Boechat, Ktia, Pilar (saudades), Michele Barbi (saudades), Tiago, Fernandinha, Raquel, Giovana, Matheus, Fred (Saudades), Ana Paula (saudades), Mr. Totola, Val, Lis, Aninha, Xisto, Murilo, Mnica, Lucas, Dani Mel, Ramon, Patrick e Sr. Brs. No temos rdio, mas damos boas risadas...rs... Milene, pela ajuda fundamental na realizao deste trabalho e por me aturar nos momentos difceis.

III

amiga Danizinha, pelo empurro cientfico. Obrigado. s amigas Ins e Mariinha pelo referencial de famlia que se tornaram para mim em Ouro Preto. Aos amigos da repblica Brejo, Paulo Schermack, Vincius Hermani e Wagner Couto pelo convvio e pelas risadas. Aos meus tios e primos que torceram e no se esquecem de mim. A todos que, direta ou indiretamente, contriburam para a realizao deste trabalho.

IV

Resumo

Venenos de aranhas so sistemas de multicomponentes que podem ser agrupados em 3 classes qumicas principais: molculas orgnicas de baixo peso molecular, peptdeos e protenas de alto peso molecular. A grande maioria de toxinas de aranhas identificadas at o momento composta de polipeptdeos com uma massa molecular de 3000-8000 Da altamente reticulados por pontes dissulfeto. A purificao de peptdeos txicos de venenos de aranhas nos propicia um arsenal de ferramentas moleculares para estudos eletrofisiolgicos, farmacolgicos e estudo de canais inicos. Este trabalho descreve o resultado da varredura de uma biblioteca de cDNA, utilizando-se da tcnica de ELISA, com o objetivo de identificar protenas imunognicas. A biblioteca de cDNA foi construda a partir do mRNA isolado de glndulas de veneno de Lasiodora sp. Anti-soro contra o veneno total foi usado na varredura. Os clones positivos foram caracterizados por seqenciamento de DNA. Nossos resultados mostram que os precursores das toxinas descritas apresentam um peptdeo sinal caracterizado por um alto contedo de aminocidos hidrofbicos, um propeptdeo interposto entre a seqncia sinal e a toxina madura, e a seqncia de aminocidos da toxina madura. Os cDNAs que codificam as toxinas LTx1 e LTx3 foram inseridos no vetor de expresso pET-11a, gerando plasmdeos com a

capacidade de codificar as toxinas maduras. O sistema pET-11a-LTx1 produziu a toxina LTx1 recombinante na forma solvel.

Abstract

Spider venoms are multicomponent systems that can be grouped into three major chemical classes: low molecular mass organic molecules, polypeptides and high molecular mass protein. The vast majority of spider toxins identified up to date are polypeptides with a molecular mass of 3000-8000 Da, highly reticulated by disulfide bridges. Purification of peptides toxins from spider venoms gives an arsenal of molecular tools for electrophysiological, pharmacological and structural studies of ion channels. The present work describes the results of a screening carried out using ELISA and a cDNA expression library for identification of immunogenic proteins. The cDNA library was previously constructed with mRNA isolated from Lasiodora sp venom glands. Antibodies against the whole venom were used in this screening. Positive clones were characterized by DNA sequencing. The sequences revealed that the precursors of proteins contain signal peptides characterized by a very hydrophobic core, an intervening propeptide region, and the mature toxin. The cDNAs encoding the LTx1 and LTx3 toxins were inserted into the expression vector pET-11a, generating plasmids with coding capacity for mature toxins. The recombinant toxin LTx1 was found primarily in soluble fraction of the host cell.

VI

ndice
Resumo Abstract 1 2 3 4 4.1 4.2 4.3 4.4 4.5 4.6 5 5.1 5.2 6 6.1 6.2 6.3 6.4 6.5 6.6 6.7 6.8 6.9 6.10 6.11 6.12 6.13 6.14 6.15 6.15.1 6.15.2 6.15.3 6.15.4 6.15.5 V VI VII IX X 1 2 4 5 12 14 15 18 19 19 20 21 23 23 24 24 27 27 28 29 30 30 31 32 32 32 33 35 35 36 38 38 39 40 41 41 42

Lista de Figuras Tabela Abreviaturas Introduo Aspectos gerais Composio de venenos de aranhas Utilizao de toxinas de venenos no estudo de canais inicos e em neurobiologia Atividade bioinseticida de venenos de aranhas Atividade bactericida de venenos de aranhas Bioqumica e biologia molecular de toxinas da aranha Lasiodora sp Objetivos Objetivos Geral Objetivos Especficos Materiais e Mtodos Construo da Biblioteca de cDNA Dosagem do mRNA Preparao do fago auxiliar M13 Titulao do fago auxiliar M13 Exciso em massa do fagemdeo pBK-CMV Preparo do estoque de bactrias recombinantes Preparo do extrato livre de clulas ELISA (Enzyme Linked Imunosorbent Assay) Extrao do DNA plasmidial Preparo do gel de agarose Eletroforese do DNA em gel de agarose Seqenciamento do DNA Purificao dos produtos de extenso Anlise das seqncias de nucleotdeos obtidas Clonagem das seqncias codificantes para LTx1 e LTx3 no sistema de expresso bacteriano pET-11a e pET-21b Novagen Amplificao da regio correspondente s toxinas maduras LTx1 e LTx3 para clonagem em sistema PCR 2.1 TOPO TA Cloning Invitrogen Preparo de gel de poliacrilamida 6 % Purificao do produto de PCR em gel de poliacrilamida Clonagem das seqncias codificantes para LTx1 e LTx3 em PCR 2.1-TOPO TA Cloning Invitrogen Preparo de clulas E. coli Top 10 Fcompetentes (Mtodo CaCl2)

Transformao de clulas de E. coli Top 10 F com o produto de ligao em PCR 6.15.6 2.1-TOPO Reao em cadeia da polimerase de colnias provenientes da transformao de E. 6.15.7 coli Top 10 F com o produto de ligao em PCR 2.1-TOPO Extrao do DNA plasmidial de colnias provenientes da transformao de E. coli 6.15.8 Top 10 F com o produto de ligao em PCR 2.1-TOPO Digesto dos plasmdeos PCR 2.1-TOPO -LTx1 (e LTx3) com as enzimas Nde I e 6.15.9 BamH I para clonagem do fragmento liberado no sistema de expresso pET-11a (Novagen ) 6.15.10 Purificao dos produtos de digesto Digesto do vetore de expresso pET-11a com as enzimas de restrio Nde I e 6.15.11 Bam H I

6.15.12 Purificao do vetor de expresso utilizando papel Whatman DE81 Clonagem dos fragmentos que codificam as toxinas LTx1 e LTx3 no vetor de 6.15.13 expresso pET-11a Transformao de clulas de E. coli Top 10 F com o produto de ligao no vetor de 6.15.14 expresso pET-11a Reao em cadeia da polimerase de colnias provenientes da transformao de 6.15.15 clulas de E. coli Top 10 F com os produtos de ligao no vetor de expresso pET11a Transformao de bactrias de expresso (E. coli linhagem BL-21 DE3) com a 6.15.16 construo pET-11a-LTx1 e pET-11a-LTx3 Induo da expresso da toxina recombinante LTx1 clonada no vetor de expresso 6.16 pET-11a 6.16.1 Produo da LTx1 recombinate e solubilidade da protena 6.16.2 Eletroforese em gel de poliacrilamida SDS-PAGE 6.16.3 Colorao pelo mtodo da prata 6.16.4 Western Blot 6.17 Gentipos das linhagens de bactrias hospedeiras utilizadas neste trabalho 6.18 Meios de cultura 6.19 Reagentes e material de uso 6.20 Solues 6.20.1 Solues utilizadas na ELISA 6.20.2 Solues utilizadas no gel SDS-PAGE 6.20.3 Colorao pelo mtodo da prata 6.21 Equipamentos utilizados no laboratrio 7 Resultados 7.1 Varredura dos clones provenientes das excises em larga-escala Anlise das seqncias nucleotdicas dos cDNAs dos clones que apresentaram 7.2 similaridade com toxinas de aranhas 7.2.1 Traduo dos cDNAs que codificam para as toxinas LTx1, LTx2 e LTx3 7.2.2 Anlise estrutural das toxinas LTx1, LTx2 e LTx3 Alinhamento das seqncias peptdicas das toxinas das aranhas Lasiodora sp 7.2.3 (LTx1, LTx2, LTx3), E. Californicum (ESTx), B. smithii (BsTx), L. parahybana (LpTx1 e LpTx2) Alinhamento das seqncias peptdicas completas das toxinas LTx1, LTx2, LTx3 e 7.2.4 HwTx-II (Ile) 7.3 Clonagem das toxinas LTx1 e LTx3 em PCR 2.1-TOPO TA Cloning Invitrogen 7.4 Clonagem das toxinas LTx1 e LTx3 no vetor de expresso pET-11a 7.5 Induo da toxina LTx1 recombinante Anlise da seqncia nucleotdica dos cDNAs dos clones (16-19) que apresentaram 7.6 similaridade com a toxina Magi 7 da aranha Macrothele gigas Anlise das seqncias que apresentaram similaridade com outras protenas 7.7 depositadas no GenBank 7.7.1 Anlise da seqncia do DNA complementar do clone 20 7.7.2 Anlise da seqncia do DNA complementar do clone 21 Anlise das seqncias dos clones que codificam para peptdeos que no 7.8 apresentaram similaridades, quando submetidos anlise pelo BlastP 7.8.1 Anlise da seqncia do DNA complementar do clone 22 7.8.2 Anlise da seqncia do DNA complementar do clone 23 7.8.3 Anlise da seqncia do DNA complementar do clone 24 8 Discusso 9 Concluses 10 Perspectivas 11 Referncias Bibliogrficas Anexo

42 44 46 46 48 48 49 50 50 51 52 52 53 54 55 56 57 58 59 60 62 64 66 69 70 71 73 75 78 82 82 85 88 89 93 94 95 106 109 111 119

1- Lista de Figuras

Figura 1 Figura 2 Figura 3 Figura 4 Figura 5 Figura 6 Figura 7 Figura 8 Figura 9 Figura 10 Figura 11 Figura 12 Figura 13

Foto de um espcime do gnero Lasiodora Estrutura tetramrica da latrotoxina LTX Modelo de poro da toxina LTX Mecanismos de ao da LTX Localizao de VDSC em clulas GH3 e co-localizao de manchas AF568TiTX- com AF488-TsTX Construo da molcula de cDNA Ligao do cDNA no vetor ZAP Express e exciso em massa do fagemdeo pBK-CMV Mapa do vetor de clonagem PCR 2.1-TOPO TA Cloning Invitrogen Mapa esquemtico do vetor de expresso bacteriano pET-11a Novagen

3 7 7 9 11 22 26 37 45 63

Alinhamento dos cDNAs dos clones que apresentaram similaridade com toxinas de aranhas S. huwena, E. californicum, B. smithi e Lasiodora parahibana Traduo das seqncias nucleotdicas que codificam para as toxinas LTx1, LTx2 e LTx3 Predio do ponto de clivagem entre os peptdeos sinal e peptdeo intermedirio na seqncia dos precursores das toxinas LTx1, LTx2 e LTx3 Grfico de hidropaticidade das seqncias de aminocidos traduzidas a partir dos cDNAs dos clones que codificam os precursores das toxinas LTx1, LTx2 e LTx3 Alinhamento das seqncias de aminocidos das toxinas das aranhas Lasiodora sp (LTx1, LTx2 e LTx3), E. Californicum (ESTx), B. smithii (BsTx), e L. parahybana (LpTx1 e LpTx2) Alinhamento das seqncias de aminocidos das toxinas das aranhas Lasiodora sp (LTx1, LTx2 e LTx3) e Selenocosmia huwena (HwTx-II) PAGE dos produtos de PCR de colnias obtidas na transformao de clulas de E. coli linhagem TOP 10 F com os produtos das ligaes das seqncias codificantes para as toxinas LTx1 e LTx3 com o vetor PCR 2.1-TOPO PAGE dos produtos de PCR de colnias obtidas na transformao de clulas de E. coli linhagem TOP 10 F com produto de clonagem das seqncias codificantes para LTx1 e LTx3 nos vetores de expresso pET-11a e pET-21b Gel SDS-PAGE da induo da expresso de LTx1 recombinante

65 67 68

Figura 14 Figura 15

69 70

Figura 16

72

Figura 17

74

Figura 18

76

Figura 19

Western Bloting da toxina LTx1 recombinante

77

Figura 20

Traduo do cDNA que codifica a toxina LTx5

79

VII

Figura 21

Alinhamento das seqncias peptdicas dos pr-peptdeos Magi 7 (Macrothele gigas) e LTx5 (Lasiodora sp)

79

Figura 22

Predio do ponto de clivagem entre os peptdeos sinal e intermedirio na seqncia do precursor da toxina LTx5 Grfico de hidropaticidade da seqncia de aminocidos traduzida a partir do cDNA dos clones que codificam o precursor da toxina LTx5 Alinhamento da seqncia peptdica codificada pelo cDNA do clone 20 com a cadeia -1 da hemoglobina de Mus musculus, cadeia -2 da globina de Rattus norvegicus e hemoglobina quimrica humano/camundongo (zeta 2/beta 2) Alinhamento da seqncia peptdica codificada pelo cDNA do clone 21 com as protenas CG7580-PA da mosca Drosophila melanogaster, agCP10691 do mosquito Anopheles gambiae e Qpc-pending do camundongo Mus musculus Predio do ponto de clivagem entre os peptdeos sinal e intermedirio na seqncia do peptdeo LsC3a

80

Figura 23

81

Figura 24

84

Figura 25

87

Figura 26

91

Figura 27

Grfico de hidropaticidade dos aminocidos traduzidos a partir do cDNA dos clones que codificam o precursor do componente clonado LsC3a

92

Figura 28

Perfil molecular de peptdeos de venenos de 55 tarntulas utilizando espectrometria de massa MALDI-TOF

99

Figura 29

Alinhamento das seqncias peptdicas das toxinas maduras das aranhas Lasiodora sp e Lasiodora parahybana Alinhamento (ClustalW) de toxinas de tarntulas

100

Figura 30

102

Figura 31

Alinhamento dos precursores das toxinas da aranha Lasiodora sp LTx1, LTx2, LTx3, LTx4 e LTx5

103

Figura 32

rvore filogentica das toxinas da aranha Lasiodora sp baseada no programa de alinhamento ClustalW

104

VIII

2- Tabela
Tabela 1 Resultados do teste de ELISA e similaridade utilizando o programa BlastP 62

IX

3- Abreviaturas
ATP: adenosina trifosfato Blast: Basic Local Alignment Search Tool BsTx: toxina do veneno da aranha Brachypelma smithii cDNA: cido desoxirribonuclico complementar DL50: dose letal mediana DMSO: Dimetil sulfxido DNA: cido desoxirribonuclico dNTP: desoxirribonucleotdeo(n)trifosfato, n= adenosina, citosina, guanosina ou timina DO: densidade tica EDTA: cido etilenodiamino tetractico ELISA: Enzyme Linked Imunosorbent Assay ESTx: toxina do veneno da aranha Eurypelma californicumi GABA: cido -aminobutrico HPLC: High-Performance Liquid Chromatography HwTx-(I e II): toxinas I e II do veneno da aranha Selenocosmia huwena IgG: imunoglobulina G IPTG: isopropil-tio--D-galactosdio LpTx : toxinas da aranha Lasiodora parahibana LsC : componente do veneno da aranha Lasiodora sp LTx: toxinas da aranha Lasiodora sp MCS: Multiple Cloning Site (stio mltiplo de clonagem) mRNA: cido ribonuclico mensageiro NRX: Neurexina OPD: O-fenilenodiamino PBS: tampo de salina fosfato PBST: tampo de salina fosfato tween 20 PCR: Polymerase Chain Reaction (reao da polimerase em cadeia) PEG: polietilenoglicol PLC: Fosfolipase C X

PMSF: fluoreto fenilmetilsulfonil PSA: persulfato de amnia rATP: ATP reativo RNA: cido ribonuclico Rnase: ribonuclease ssDNA: single strand DNA (DNA fita simples) SDS: dudecil sufato de sdio SDS PAGE: Eletroforese em gel de poliacrilamida com SDS TAE: tampo tris acetato EDTA TE: tampo tris EDTA TEMED: N, N, N`, N` tetrametiletilenodiamino TiTx-: Tityus Toxina Gama Tris HCl: tris(hidroximetil) aminometano acidificado com cido clordrico TTX: tetrodotoxina VDSC: Voltage Dependent Sodium Channel X- Gal: 5-bromo-4-cloro3-indolil--D-galactosdio

XI

4- Introduo 4.1- Aspectos gerais


A aranha Lasiodora sp conhecida popularmente no Brasil como caranguejeira. Assim como outras aranhas da famlia Theraphosidae (subordem Mygalomorphae), a aranha caranguejeira pertence a um grupo de aranhas tambm conhecidas mundialmente como tarntulas. Das 37.972 espcies de aranhas descritas at o momento (totalizando 3526 gneros), apenas 860 espcies pertencem famlia Theraphosidae (composta por 107 gneros) (Escoubas & Rash, 2004). As tarntulas podem ser encontradas em reas tropicais e semitropicais, savanas, desertos, florestas midas ou ambientes semitemperado. Essa diversidade de nichos ecolgicos, associada diversidade de comportamentos de captura de presas, contribui para a grande diversidade de seus venenos. Assim como outras aranhas, as tarntulas so predadoras e se alimentam de uma variedade de animais vertebrados e invertebrados. A grande habilidade das tarntulas para capturar presas grandes e fortes sem a ajuda de teias (as tarntulas so aranhas errantes) implica no apenas em fora fsica, mas tambm em venenos altamente eficientes que agem rapidamente sobre o sistema nervoso central e perifrico de suas presas. Esta caracterstica sugere que estes venenos sejam fontes promissoras de compostos a serem utilizados no estudo de receptores e canais inicos de vertebrados. Dentre as inmeras espcies de tarntulas conhecidas podem-se citar Cithariscius crawshayi, Scodra griseipes, Hysterocrates Hercules (encontradas na frica), Selenocosmia Lyra, Haplopelma lividum, Cyriopagopus paganus (encontradas na sia), Brachypelma smithi, Avicularia magdalena, Aphonopelma texense (encontradas na Amrica Central e do Norte) e Lasiodora parahybana, Grammostola spatulata, Paraphysa manicata (encontradas na Amrica do Sul) (Escoubas & Rash, 2004). A toxicidade do veneno das aranhas, na maioria dos casos, no est diretamente relacionada com o tamanho corporal. Dados recentes sobre picadas de aranhas da famlia Theraphosidae da Amrica do Sul (48 casos), sia/frica (4 casos) e Austrlia (9 casos) sugerem que essas aranhas so inofensivas a humanos (Escoubas & Rash, 2004). Dentre os sintomas decorrentes de picadas de tarntulas em humanos esto dor local moderada a severa, coceira forte, edema, eritema, inchao, ardncia e cibra. Nos casos mais severos so observados cibras fortes e

espasmos musculares, os quais podem persistir por vrias horas (Escoubas & Rash, 2004). A dor decorrente da picada pode estar relacionada a uma combinao de injria mecnica (provocada pelas grandes quelceras), baixo pH do veneno (tipicamente pH 5), efeitos das aminas biognicas (serotonina e histamina), adenosina e ATP (Escoubas & Rash, 2004). No entanto, at mesmo venenos de baixa toxicidade para humanos podem ser fontes muito importantes de molculas que podem ser usadas como ferramentas bioqumicas para estudos de processos farmacolgicos, fisiolgicos e neurolgicos de vertebrados. A figura 1 ilustra um representante do gnero Lasiodora.

Figura 1: Foto de um espcime do gnero Lasiodora. (Disponvel em: www.bioterium.com)

4.2- Composio de venenos de aranhas


Tal como venenos de outros animais, como serpentes e escorpies, venenos de aranhas so uma rica fonte de toxinas, incluindo peptdeos de baixo peso molecular, neurotoxinas, toxinas dermonecrticas (que so um grupo de protenas com intensa atividade sobre a matriz celular), poliaminas livres, ATP, ADP, AMP, sais inorgnicos, aminocidos livres, nucleotdeos, acilpoliaminas (que em venenos de aranhas do gnero Nephila agem como neurobloqueador com atividade letal), polipeptdeos com mais de 1000 aminocidos (principais componentes letais do gnero Latrodectus, causadores de uma liberao macia de neurotransmissores de uma diversidade de terminais nervosos), fatores que podem modificar vrios componentes da circulao sangunea (tal como as esfingomielinases, s quais se tem atribudo aes hemolticas que podem causar anemia, insuficincia renal aguda bem como ulceraes cutneas) e neurotransmissores, dentre os quais pode-se citar o glutamato, aspartato, cido -aminobutlico (GABA), histamina, dopamina, serotonina e epinefrina (Tambourgi, e cols., 2004; Horni e cols., 2001; SavelNiemann, 1989; Chan e cols., 1975; Kalapothakis e cols., 2002; Turkov e cols., 1997; Escoubas e cols., 2000; Atkinson & Wright, 1992a; Rash & Hodgson, 2002). Nem todos os componentes encontrados em glndulas de venenos de aranhas so produzidos por clulas desse rgo. A presena de nucleotdeos de adenosina (ATP, ADP e AMP) em venenos de aranhas foi demonstrada em 1975 por Chan e cols. no veneno de Dugesiella hentzi e da tarntula Aphonopelma sp. Demonstrou-se que o composto adenosina 5`-trifosfato (ATP) relativamente pouco txico para ratos comparado com a necrotoxina purificada do veneno de D. hentzi, com uma DL50 (ATP) de 2.4 mg por grama de peso corporal. A necrotoxina de D. hentzi apresentou uma DL50 de 8,5g por grama de peso corporal. No obstante, a toxicidade da necrotoxina foi notavelmente aumentada pela presena de ATP. Os nucleotdeos presentes em venenos podem ser produzidos diretamente em glndulas de venenos, embora no haja evidncia experimental da presena de nucleotdeos em glndulas de venenos de tarntulas. O ATP, um composto rico em energia, pode ser necessrio para a liberao do veneno, sendo secretado juntamente com outras substncias quando a aranha excitada (Chan e cols., 1975). Considerando-se as concentraes relativamente altas encontradas nos experimentos de Chan e cols. (1975), o

ATP pode ter uma funo especial no veneno de D. hentzi e Aphonopelma sp, agindo como potenciador da toxicidade de fatores necrticos do veneno. provvel tambm que os grupos fosfatos liberados a partir da hidrlise do ATP sejam usados para fosforilar um ou mais resduos de aminocidos de peptdeos txicos do veneno, tornando-os mais ativos. Em 1984, Geren & Odell observaram tambm a presena de fluidos digestivos em venenos de aranhas. Tais enzimas digestivas no so produzidas nas glndulas de veneno, mas, como sugerido por Atkinson & Wright (1992a), decorrem de uma contaminao natural do veneno com fluidos digestivos. As enzimas colagenases so os principais responsveis pela ao necrtica de muitos venenos (Atkinson & Wright, 1992a).

4.3. Utilizao de toxinas de venenos no estudo de canais inicos e em neurobiologia


Os canais inicos so protenas integrais de membrana que formam poros capazes de permitir a passagem de ons atravs da bicamada lipdica e, desta forma, possibilitam a alterao do potencial de membrana de uma clula. Este fluxo de ons atravs dos canais inicos presentes na membrana celular gera os chamados potencias de ao, que so os sinais eltricos responsveis pela conduo do impulso nervoso. Alguns peptdeos txicos de baixo peso molecular de venenos animais agem especificamente sobre canais inicos incluindo canais de Ca2+ , canais de K+ , canais de Na + e canais de Cl- , (Atkinson & Wright, 1992b e Rash & Hodgson, 2002). Atualmente, muito se tem estudado a respeito das neurotoxinas. Os modos de ao dessas substncias tm permitido aos pesquisadores estudar os mecanismos envolvidos na neurotransmisso uma vez que essas toxinas, ao interagir de forma especfica com receptores de membranas neuronais, podem estimular ou inibir a liberao de neurotransmissores, tais como o glutamato (Barral e cols., 2001), bem como afetar a transmisso colinrgica. Peptdeos txicos de venenos tm contribudo tambm com estudos de caracterizao e funcionamento de canais inicos (Arajo e cols., 1993 e Rash & Hodgson, 2002). Ushkaryov e cols. (2004) determinaram a estrutura tridimensional de uma toxina presente no veneno de uma aranha pertencente ao gnero Latrodectus e conhecida popularmente como viva negra. As toxinas presentes no veneno da aranha viva negra

(latrotoxinas) tm sido extensivamente usadas no estudo de mecanismos moleculares envolvidos em neurosecreo em vertebrados, insetos e crustceos. Recentes avanos nas anlises estruturais e funcionais das latrotoxinas, sobretudo da toxina LTX, tm permitido entender os mecanismos envolvidos na liberao de neurotransmissores e tm revelado o grande potencial desses peptdeos txicos como ferramentas para compreender fenmenos neurobiolgicos. exceo da toxina LIT, todas as demais latrotoxinas agem somente sobre clulas neuronais e a LTX apresenta forte afinidade por receptores de membranas neuronais de vertebrados (Ushkaryov e cols., 2004). A estrutura tridimensional da LTX formada por um complexo que consiste em quatro monmeros (complexo tetramrico) arranjados ao redor de um eixo central assemelhando-se a uma hlice de quatro lminas com um dimetro de 250 e uma espessura de 100 (Figura 2 a-d) (Ushkaryov e cols., 2004). Esse tetrmero possui uma regio composta por aminocidos hidrofbicos que, provavelmente, interage com a membrana (Ushkaryov e cols., 2004). Somente atravs da determinao da estrutura quaternria da toxina LTX pde-se explicar como essa molcula capaz de se inserir na membrana tornando-a permevel a ons Ca2+. A caracterstica mais relevante do tetrmero LTX um canal central rodeado pelos monmeros da toxina (Figura 2c e 2d). O tetrmero formado pela LTX anfiptico sendo, portanto, capaz de se aderir em superfcies hidrofbicas. Dessa forma, o tetrmero LTX inserido na membrana tornaria a bicamada lipdica permevel a todas as substncias que pudessem passar pelo canal central (pequenas molculas e ctions hidratados) (Figura 3). O entendimento desse mecanismo de ao (mecanismo do poro) tem contribudo para a identificao de seus efeitos especficos sobre a liberao de neurotransmissores e tem ajudado no estudo das aes da LTX mediadas por receptor (Ushkaryov e cols., 2004).

Figura 2: Estrutura tetramrica da latrotoxina LTX. Viso inclinada (a e b) e viso do lado que se liga superfcie da clula (c e d). O canal central rodeado pelos monmeros da toxina indicado pelas setas vermelhas. (Adaptado de Ushkaryov e cols., 2004).

Figura 3: Modelo de poro da toxina LTX. O tetrmero est seccionado para permitir a visualizao do poro. A base do tetrmero penetra profundamente na membrana. Estruturas em forma de asas prendem-se no lado de fora da membrana. Ctions podem entrar no citosol atravs do poro, como mostrado pela seta. (Adaptado de Ushkaryov e cols., 2004).

Embora as aes da LTX sejam complexas, elas podem ser divididas em duas vias principais. Aps a ligao a um receptor neuronal especfico, a LTX pode desencadear uma sinalizao intracelular ou se inserir na membrana levando formao de um poro. Ambas as vias podem estimular a liberao de neurotransmissores, embora seus mecanismos sejam diferentes. Os mecanismos de ao da LTX so mostrados na figura 4. Como pode ser visto na figura, a interao de LTX com receptores especficos da membrana neuronal, tais como latrofilinas (LPH) ou neurexinas (NRX), desencadeia um influxo de Ca2+ atravs do poro formado pelo tetrmero. Esse Ca2+ age sobre as vesculas sinpticas desencadeando a liberao de neurotransmissores (via 1). A via 2 da figura 4 mostra um mecanismo de liberao de neurotransmissores independente de Ca2+, onde a interao do tetrmero com receptores especficos permite a sada dos neurotransmissores atravs do poro formado pelo tetrmero. A terceira via mostra a interao do dmero LTX com seus receptores especficos. Essa interao ativa uma protena G que, por sua vez, desencadeia uma cascata de reaes envolvendo uma fosfolipase C (PLC) e fosfotidilinositol (PIP3), culminando na liberao de Ca2+ de reservatrios intracelulares e, conseqentemente, na liberao de neurotransmissores das vesculas sinpticas. Um quarto modo de ao da toxina LTX na liberao de neurotransmissores independente de Ca2+ tem sido proposto, no entanto, o mecanismo envolvido nessa liberao ainda no foi completamente esclarecido (Ushkaryov e cols., 2004).

Figura 4: Mecanismos de ao da LTX. Em 1, influxo de Ca2+ atravs dos poros formados pela toxina aps sua ligao a LPH ou NRX. Em 2, sada de neurotransmissores atravs dos poros formados pela toxina. Em 3, sinalizao mediada por receptores dependente de Ca2+ levando liberao de Ca2+ de reservatrios internos. Em 4, uma interao direta hipottica da LTX com a maquinaria de exocitose dependente de Ca2+. (Adaptado de Ushkaryov e cols., 2004).

Um tipo especial de canal de Na+ (dependente de voltagem) tm sido alvo de muitos estudos neurobiolgicos devido ao fato desses canais apresentarem mltiplas funes na gerao de potenciais de ao em muitos tipos de neurnios do sistema nervoso central. Alm de produzir uma grande corrente transiente responsvel pela mudana no potencial de membrana, os canais de sdio afetam a durao e a freqncia de disparos neuronais repetitivos (Massensini e cols., 2002). A distribuio diferencial dos canais de Na+ dependentes de voltagem (VDSC) crtica na determinao de propriedades funcionais distintas de um neurnio. Embora haja vrias tcnicas para a localizao de VDSCs (patch-clamp, immunostaining, marcadores especficos de canais inicos e etc) nenhuma delas capaz de determinar a distribuio de VDSCs funcionais em toda a extenso da membrana de clulas vivas (Massensini e cols., 2002). Contudo, toxinas de venenos animais tm sido usadas como potentes ferramentas para distinguir as vrias isoformas de canais inicos dependentes de voltagem presentes nas membranas celulares. Algumas dessas toxinas so conhecidas por interagir especificamente com VDSCs e portanto, esto sendo utilizadas como ferramentas no estudo de funes de canais inicos e de excitabilidade celular em tempo real. Massensini e cols. (2002) localizaram canais de Na+ voltagem-dependentes (VDSC), em clulas vivas, utilizando-se de toxinas do veneno do escorpio Tityus serrulatus marcadas com fluorescncia. A visualizao da distribuio espacial dos VDSCs em clulas GH3 foi revelada utilizando-se derivados fluorescentes das toxinas TiTX- marcada com Alexa Flor 568 (AF568-TiTX-) e TsTX marcada com Alexa Flor 488 (AF488-TsTX) (Molecular Probes Inc., Eugene, OR) do escorpio Tityus serrulatus juntamente com tcnicas de microscopia confocal de varredura a laser (LSCM). Esse mtodo permitiu uma localizao precisa de grupos individuais de cada toxina marcada, AF568-TiTX- e AF488TsTX. Sobreposies de manchas fluorescentes das toxinas marcadas utilizadas tambm foram visualizadas, indicando regies de co-localizao de VDSCs em partes especficas da clula (Figura 5).

10

Figura 5: Localizao de VDSC em clulas GH3 e co-localizao de manchas AF568-TiTX- com AF488-TsTX . (A) DIC de clulas GH3. (B) O canal vermelho corresponde marcao com AF568TiTX-. A fluorescncia indica a localizao de VDSC na membrana da clula. Manchas caractersticas so observadas como pontos concentrados sobre as clulas. (C) O canal azul corresponde fluorescncia conferida pela marcao com AF488-TsTX . Pontos concentrados nas projees isoladas indicam a localizao de VDSC agrupados em regies celulares especficas. (D) Canais marcados de vermelho e azul, aps segmentao, indica regies de co-localizao (amarelo) tanto de AF568-TiTX- (vermelho) quanto de AF488-TsTX (azul). S1-S35: seces pticas consecutivas segmentadas de (B) e (C) mostram a co-localizao (amarelo) de VDSCs distribudos pela membrana da clula em diferentes seces focais. Oito das 35 seces so mostradas. Escala = 10 m. (Adaptado de Massensini e cols., 2002).

O uso de toxinas fluorescentes para localizar VDSCs tem a vantagem de permitir o uso de clulas vivas ao invs de clulas fixadas, necessrias nos mtodos de imunofluorescncia, permite resoluo em tempo real (o que apropriado para a investigao de um grande nmero de fenmenos envolvidos na excitabilidade neuronal), um mtodo aplicvel a tipos diferentes de estudos envolvendo a distribuio de VDSC na transduo de sinal alm de permitir que medidas simultneas sejam realizadas usando diferentes sondas fluorescentes em uma mesma clula. Finalmente, essa tcnica complementar e compatvel com os mtodos j existentes usados no estudo de protenas envolvidas na comunicao celular e transduo de sinal (Massensini e cols., 2002).

11

4.4- Atividade bioinseticida de venenos de aranhas


Os mecanismos de ao dos peptdeos txicos, em insetos e mamferos, tm sido estudados tambm com o intuito de se desenvolver novas drogas, tendo em vista as diferentes atividades farmacolgicas potenciais das neurotoxinas. Por outro lado, a perspectiva de se descobrir, dentre os vrios componentes de venenos de aranhas, algum peptdeo que possa ser utilizado na produo de bioinseticidas, tem impulsionado vrias pesquisas com o objetivo de conhecer os mecanismos de ao envolvidos na paralisao e morte de insetos atacados por aranhas. O controle de pragas utilizando inseticidas qumicos tem submetido diversas populaes de insetos seleo darwiniana, ocasionando um inevitvel desenvolvimento de resistncia. Estima-se que desde 1992, mais de 500 espcies de insetos adquiriram resistncia a uma ou mais classes de inseticidas qumicos, incluindo 56 mosquitos do gnero Anopheles e 39 do gnero Culex e nove espcies de carrapatos (Tedford e cols., 2004). Dentre os componentes de venenos de aranhas envolvidos na paralisao de insetos esto as poliaminas e polipeptdeos. As poliaminas so inibidores ps-sinpticos capazes de bloquear reversivelmente canais de clcio, sensveis ao glutamato, de msculos locomotores de insetos o que leva paralisia dos mesmos (Atkinson & Wright 1992b). J os polipeptdios txicos agem pr-sinapticamente de maneira essencialmente irreversvel induzindo ou inibindo a liberao de neurotransmissores (Atkinson & Wright 1992b). Atualmente mais de 60 peptdeos txicos tm sido descritos. Muitos deles parecem agir essencialmente sobre canais inicos podendo bloquear a liberao de neurotransmissores, por afetar a exocitose de vesculas pr-sinpticas, e induzir modificaes anormais da transmisso sinptica, resultando em paralisia flcida. Outros peptdeos podem provocar paralisia excitatria induzida pela excessiva despolarizao da membrana (Escoubas e cols., 2000). Trs polipeptdios txicos com ao inseticida, isolados do veneno da aranha Segestria florentina, causaram paralisia completa da larva Heliothis virescens (Ordem: Lepdoptera/Famlia: Noctuidae). Uma toxina com atividade inseticida denominada SIT, isolada do veneno da aranha Segestria florentina induziu tambm paralisia irreversvel em

12

baratas (Lipkin e cols., 2002). A comparao da estrutura primria desses peptdeos com peptdeos txicos de outras aranhas sugeriu que essa famlia de toxinas compartilha relaes estruturais e funcionais com outras neurotoxinas de aranhas, vrias delas com aes agonistas e antagonistas sobre diferentes canais de clcio voltagem-dependentes (Lipkin e cols.,2002). Figueredo e cols. (1995) isolaram um componente neurotxico denominado Tx4(61) da frao PhTx4 do veneno da aranha Phoneutria nigriventer, que parece ser especfica para insetos. A seqncia completa de aminocidos da Tx4(6-1) indica que se trata de um polipeptdeo de cadeia simples contendo 48 aminocidos com um peso molecular de 5251Da, e ensaios de atividade mostraram que a frao capaz de agir sobre mosca domstica e barata. Uma das principais vantagens do uso de inseticidas biolgicos a sua alta especificidade em relao praga alvo, no afetando outros insetos, plantas e animais (Bergmann & Pinedo 2001). Portanto, vrios peptdeos neurotxicos com atividade inseticida tm sido clonados a fim de se elucidar seus modos de ao sobre canais inicos, o que pode revelar a eficcia de tais peptdeos no controle de pragas agrcolas. Uma estratgia que tem sido testada com sucesso consiste na utilizao de baculovrus geneticamente modificado para expressar neurotoxinas. Os baculovrus so patgenos usados como inseticidas biolgicos que agem especificamente em insetos. No entanto, os baculovrus agem lentamente, permitindo, em muitos casos, que a praga destrua grande parte da lavoura. Zlotkin e cols. (2000) clonaram uma neurotoxina do escorpio Androctonus australis, denominada AaIT, em vetor de baculovrus e mostraram que o vrus atua como um vetor da toxina recombinante dirigindo-a ao sistema nervoso central do inseto, o que produz um aumento da toxicidade.

13

4.5- Atividade bactericida de venenos de aranhas


A perspectiva de se encontrar peptdeos de glndulas de veneno de aranhas com atividade bactericida tem sido impulsionada pelo surgimento, cada vez maior, de bactrias resistentes a antibiticos. O mecanismo de ao desses peptdeos, mais bem conhecido, atravs de sua insero na membrana celular causando destruio ou permeabilizao da mesma, levando o microrganismo morte. Alternativamente, os peptdeos antimicrobianos podem se ligar a um receptor de membrana levando a uma perda especfica de sua funo. Alm disso, ao se translocarem atravs da membrana, essas molculas com propriedade antibitica podem atuar intracelularmente, impedindo a sntese de metablitos importantes para o microrganismo (Lohner, 2001). Em 1989, Xu & Qu encontraram um peptdeo antibitico no veneno da aranha Lycosa singoriensis. Recentemente, Yan & Adams (1998) descreveram a existncia de peptdeos com ao inseticida e bactericida no veneno da aranha Lycosa carolinensis, denominados licotoxinas. Kuhn-Nentwig e cols. (1998) publicaram a estrutura de um peptdeo com ao inseticida e bactericida, denominado CSTX-4, do veneno da aranha errante Cupiennius salei. Dois anos depois, Haeberli e cols. (2000) caracterizaram com maiores detalhes a atividade microbiana dos peptdeos do veneno desta mesma aranha. Cinco diferentes peptdeos foram isolados do veneno da aranha Cupiennius salei e suas atividades bactericidas foram testadas contra cinco diferentes espcies de bactrias, tanto gram-negativas (Escherichia coli, Pseudomonas putida, Paracoccus denitrificans) como gram-positivas (Staphylococcus epidermidis e Bacillus subtilis). Todas as cinco bactrias foram susceptveis a todos os cinco peptdeos em concentraes que variaram de 0,18 a 18M e o veneno bruto causou 100% de inibio no crescimento em diluies at 1:55.000 (Haeberli e cols., 2000). Belokoneva e cols. (2004) descreverem a estrutura de dois peptdeos catinicos lineares denominados Pandinina 2 (Pin2 24 resduos de aminocidos) e Oxyopinina 1 (Oxki1 48 resduos de aminocidos) isolados do veneno bruto do escorpio Pandinus imperator e da aranha Oxyopes kitabensis, respectivamente. Ambos os peptdeos mostraram exercer efeitos inibitrios sobre o crescimento de bactrias tanto Gramnegativas quanto Gram-positivas e atividade hemoltica sobre eritrcitos contendo

14

quantidades abundantes de fosfatidilcolina na membrana. Os peptdeos Pin2 e Oxki1 ligamse a fosfocolinas de membrana desencadeando a formao de poros na bicamada lipdica (Belokoneva e cols., 2004). Os peptdeos antimicrobianos parecem fazer parte de uma famlia de peptdeos catinicos, -helicoidais, anfipticos e sem resduos de cistenas. Os membros desse grupo de peptdeos so amplamente distribudos em uma mirade de venenos animais e fazem parte de um mecanismo inato de defesa contra diferentes tipos de patgenos (Moerman e cols., 2003).

4.6. Bioqumica e biologia molecular de toxinas da aranha Lasiodora sp


Embora vrios estudos tenham sido realizados com venenos de outras aranhas, pouco se sabe a respeito das aes das toxinas presentes no veneno da aranha Lasiodora sp. Todavia, estudos recentes com venenos desta aranha identificaram algumas das aes farmacolgicas deste veneno, tais como, bloqueio do canal de clcio do tipo-L e modulao da cintica e voltagem de canais de Na+ (Kushmerick e cols., 2001). Os experimentos realizados demonstraram que, quando o veneno da Lasiodora sp foi administrado a clulas GH3 na presena de TTX (tetrodotoxina), que bloqueia canais de Na+ sensveis TTX, as oscilaes de Ca2+ foram rapidamente abolidas, reduzindo assim o nvel basal de Ca2+ intracelular. Quando administrado na ausncia de TTX, o veneno causou um lento aumento do Ca2+ intracelular, o que sugere que, substncias tais como neurotransmissores ou outras molculas pequenas presentes no veneno bloqueiam canais de Ca 2+ Tipo-L (Kushmerick e cols., 2001). Como a nica diferena experimental foi a presena ou ausncia de TTX, os autores concluram que, alm de seus efeitos sobre canais de Ca2+, o veneno age tambm sobre canais de Na+. Kushmerick e cols. (2001) tambm observaram que quando o veneno foi administrado em altas concentraes (500g ml- de protena) ou aplicado na presena de nifedipina ou Cd2+ , ambos bloqueadores de canais do Tipo-L, no ocorre aumento do Ca2+ intracelular, o que sugere que este aumento depende da disponibilidade de canais de Na+ e Ca2+ do Tipo-L. Os autores sugeriram ento, que o veneno causa o aumento de Ca2+ intracelular via abertura de canais de Na+ causando, portanto, despolarizao da membrana 15

e entrada de Ca2+ via canais de Ca2+ voltagem-dependentes. Assim sendo, os efeitos observados pela administrao do veneno da aranha Lasiodora sp demonstraram que o mesmo uma fonte de toxinas ativas em canais inicos, possuindo, portanto, um valor inestimvel para a caracterizao dos mesmos. Kalapothakis e cols. (2003) obtiveram dados que sugerem que o veneno da aranha Lasiodora sp ocasiona, em corao de rato, um aumento na liberao vesicular de acetilcolina na extremidade de nervos parassimpticos por ativar canais de Na + resistentes TTX. Uma dose equivalente a 100g do veneno da aranha Lasiodora sp causou bradicardia, distrbios rtmicos e parada cardaca transitria no modelo experimental utilizado. Os resultados sugerem que o veneno dessa aranha parece agir sobre canais de Na+ resistentes TTX uma vez que 200nM dessa substncia no foram suficientes para inibir o efeito do veneno sobre o corao. O fracionamento do veneno total parcialmente purificado da aranha Lasiodora sp atravs de cromatografia de filtrao molecular em coluna Sephadex G50 Fine (Pharmacia) foi realizado por de Deus e cols (2003). Os autores obtiveram trs fraes denominadas P1, P2 e P3. A atividade txica de cada pico foi avaliada tanto em insetos quanto em mamferos. de Deus e cols. (2003) observaram que as trs fraes possuam atividade sobre mamferos, enquanto que somente as fraes P2 e P3 possuam atividade sobre o sistema nervoso de insetos. Moura e cols. (2004) realizaram a varredura de uma sub-biblioteca de cDNA da glndula de veneno da aranha Lasiodora sp utilizando-se de antisoro anti-P3. A frao de IgG de coelho anti-P3 purificada a partir de IgGs totais foi utilizada como primeiro anticorpo na varredura de sub-bibliotecas para identificar clones que codificam toxinas presentes na frao P3 do veneno total, utilizando-se a tcnica de ELISA como descrito por Kalapothakis e cols. (2001). Na varredura, os autores encontraram sete clones que codificam para a toxina LTx1. Essa toxina foi previamente descrita em nosso laboratrio (Vieira e cols., 2004) e idntica toxina LpTx1 descrita por Escoubas e cols. (1997). Outros quatro clones encontrados codificam uma toxina denominada LTx4 , similar s toxinas Magi 1 e Magi 4 (Corzo e cols., 2003), isoladas da glndula de veneno da aranha Macrothele gigas, Conotoxina Vx-VIb (Wang e cols., GenBank: ANN71750 [gi: 25140450), isolada do molusco marinho Conus vexillum e neurotoxina Tx3-2 (Cordeiro e

16

cols., 1993), isolada da aranha Phoneutria nigriventer. Ensaios biolgicos utilizando as toxinas Magi, realizados por Corzo e cols. (2003), demonstraram que a Magi 1 no possui ao txica em larvas da lagarta do tabaco ou em camundongos. A toxina Magi 4 induz paralisia flcida nas larvas podendo lev-las a morte, e letal para camundongos na DL50 de 0,15 pmol/g. Cordeiro e cols. (1993) demonstraram que a neurotoxina Tx3-2 produz efeitos motores e paralisia flcida em camundongos seis horas aps a injeo intracrebroventricular da toxina, e Kalapothakis e cols. (1998) demonstraram que a toxina Tx3-2 purificada bloqueia canais do tipo L em clulas GH3, sugerindo que a toxina um novo peptdeo que atua em canais inicos do tipo L. Embora nenhum ensaio de atividade tenha sido realizado com a toxina LTx4, Moura e cols. (2004) inferiram, baseados em ensaios de atividade das toxinas com as quais LTx4 apresentou similaridades, que LTx4 possa tambm possuir ao sobre o sistema nervoso de vertebrados. Tendo em vista o vasto espectro de atuao das molculas presentes em venenos de aranhas, sobretudo sobre os canais inicos, bem como a relao destes com distrbios neurolgicos, faz-se necessrio conhecer no s a estrutura e a funo desses canais para a identificao de outros distrbios ligados aos mesmos, mas tambm a descoberta de novos frmacos com eficcia teraputica. Assim sendo, a utilizao de neurotoxinas ativas para esses estudos de suma importncia. Contudo, o fracionamento do veneno em seus componentes txicos um processo rduo e oneroso. Frente a isso, a clonagem de toxinas surge como ferramenta fundamental deste trabalho, pois alm do conhecimento molecular, a obteno em grandes quantidades das toxinas recombinantes ser de enorme valor em investigaes neurobiolgicas. Neste trabalho, propomos a caracterizao de clones de cDNAs utilizando-se de uma biblioteca de cDNA produzida a partir do mRNA extrado da glndula de veneno da aranha Lasiodora sp bem como a clonagem, em vetores de expresso, de genes que codificam para toxinas presentes no veneno da aranha em questo.

17

5. Objetivos

5.1. Objetivo Geral


Proceder a varredura de uma biblioteca de cDNA, preparada a partir de glndulas de veneno da aranha Lasiodora sp, com o objetivo de identificar toxinas.

5.2. Objetivos Especficos


Preparo de uma biblioteca de cDNA a partir de mRNAs obtidos da glndula de veneno da aranha Lasiodora sp; Varredura da biblioteca de cDNA utilizando a tcnica de ELISA; Seqenciamento e anlise dos fragmentos gnicos que codificam para protenas imunognicas; Clonagem, em vetores de expresso bacterianos, de fragmentos gnicos que apresentarem similaridade com seqncias codificantes para toxinas depositadas no GenBank; Expresso e purificao de toxinas recombinantes.

19

6. Materiais e mtodos 6.1- Construo da Biblioteca de cDNA


A biblioteca de cDNA da glndula de veneno da aranha Lasiodora sp foi construda no Laboratrio de Biotecnologia e Marcadores Moleculares do Departamento de

Farmacologia da Universidade Federal de Minas Gerais (UFMG) pelos professores Dr. Evanguedes Kalapothakis, Dr. Ieso de Miranda Castro e Dr. Elio Hideo Bab. As glndulas de veneno das aranhas foram extradas manualmente, pulverizadas em presena de nitrognio lquido usando pilo e pistilo e lisadas na presena de tiocianato de guanidina, segundo o protocolo de Chirgwin e cols. (1979). O mRNA foi purificado atravs de uma coluna de oligo (dT)-celulose usando Poly (A) Quick mRNA Isolation Kit (Pharmacia) e o mRNA foi eludo de acordo com as recomendaes do fabricante. A sntese do DNA complementar foi realizada usando o Kit sntese ZAP-cDNA (Stratagene). A figura 6 ilustra os passos de obteno da molcula de cDNA. As molculas de cDNA foram inseridas direcionalmente entre os stios Eco RI e Xho I do vetor Uni-ZapTM e subseqentemente empacotadas em partculas de fago Lambda ZAP usando o Kit Gigapack III Packaging Extracts (Stratagene) (Figura 7).

21

Primer
5`GAGAGAGAGAGAGAGAGAGACTCGAGTTTTTTTTTTTTTTT 3` AAAAAAAAAAAA

mRNA
5`

dATP, dGTP, dTTP, 5-metil dCTP e MMLV-RT


5`GAGAGAGAGAGAGAGAGAGACTCGAGTTTTTTTTTTTTTTT 3` AAAAAAAAAAAA

CH3

CH3

CH3
5`

RNase H, DNA polimerase I dNTPs e DNA ligase


5`GAGAGAGAGAGAGAGAGAGACTCGAGTTTTTTTTTTTTTTT 3`CTCTCTCTCTCTCTCTCTCTCT GAGCTC A AAAAAAAAAAA

CH3

CH3

CH3
3` 5`

Adapitadores Eco RI DNA ligase T4


5`GAGAGAGAGAGAGAGAGAGACTCGAGTTTTTTTTTTTTTT 3`CTCTCTCTCTCTCTCTCTCTCT GAGCTC A AAAAAAAAAA

CH3

CH3

CH3
3` 5`

Xho I
5`GAATTC GAGAGAGAGAGAGAGAGAGACTCGAGTTTTTTTTTTTTTT 3`CTTAAG CTCTCTCTCTCTCTCTCTCTCT GAGCTC A AAAAAAAAAA

CH3

CH3

CH3

Eco RI
GAATTC 3` CTTAAG 5`

Enzimas de restrio Xho I e Eco RI

CH3
5 CTCGAGTTTTTTTTTTTTTT 3` C A AAAAAAAAAA

CH3

CH3
G 3` CTTAAG 5`

cDNA

Figura 6: Construo da molcula de cDNA. A transcriptase reversa catalisa a reao de sntese da primeira fita de cDNA usando como molde o mRNA isolado da glndula de veneno da aranha e um iniciador oligo(dT) contendo o stio Xho I. O 5-metil dCTP usado para adicionar grupos metil primeira fita do cDNA. Uma RNase H cliva o mRNA molde permitindo assim a ao da DNA polimerase I e a sntese da segunda fita do cDNA. Com o auxlio da DNA ligase T4, adaptadores EcoR I so ligados s extremidades cegas do cDNA e em seguida so digeridas por suas respectivas enzimas de restrio (Xho I e Eco RI) (Figura adaptada do manual do fabricante Stratagene).

22

6.2- Dosagem do mRNA


A quantificao do mRNA purificado foi realizada atravs de leitura no espectrofotmetro a 260nm. O fator de converso de densidade ptica (DO) = 1 corresponde concentrao de RNA de 40 g/ml, de acordo com o protocolo descrito por Sambrook e cols. (1989). As razes entre as leituras A260/A280 nm foram estimadas para verificar a pureza do mRNA. A amostra foi considerada pura quando as razes acima apresentaram valores entre 1.8 e 2.0.

6.3- Preparao do fago auxiliar M13


Inoculou-se 15l de clulas E. coli, linhagem XL1-BLUE, em 10ml de meio superbroth contendo tetraciclina na concentrao de 12,5g/ml e incubado a 37C por uma hora. Em seguida, adicionou-se s clulas 2l de fago e o sistema foi incubado a 37C por 2 horas. Aps esta incubao, as clulas foram transferidas para 500l de meio superbroth contendo tetraciclina na concentrao de 12,5g/ml e incubou-se sob agitao temperatura de 37C por 14-16 horas. No dia seguinte, as clulas foram centrifugadas por 15 minutos a 2500 g. O sobrenadante foi incubado por 20 minutos a 70C e ento novamente centrifugado. Aps a centrifugao, o sobrenadante foi estocado em volumes de 50 l a 4C, em presena de DMSO 7% (v/v).

23

6.4- Titulao do fago auxiliar M13


Cerca de 1l de diluies seriadas do fago M13 (10-9, 10-10, 10-12, 10-38, 10-39, 10-40 e 10-42) em meio LB foram adicionados a alquotas de 100l de uma cultura de bactrias XL1-Blue (DO600 = 1) e incubadas durante 30 minutos temperatura de 37C. Aps a infeco, 5ml de meio top gar foi adicionada mistura que foi ento semeada em meio superbroth gar. As placas foram incubadas por 16 horas a 37C. O ttulo da preparao em unidades formadoras de colnia por ml (pfu/ml) foi obtido atravs da frmula:
Nmero de placas de lise (pfu) X fator de diluio X 1000l/ml Volume plaqueado

6.5- Exciso em massa do fagemdeo pBK-CMV


Inicialmente, as clulas XL1-Blue e XLOLR, provenientes do estoque, foram crescidas em meio LB-gar tetraciclina (50g/ml) com objetivo de se obter clulas novas. No dia seguinte, uma colnia de cada bactria foi novamente inoculada em 3 ml de meio LB-caldo contendo tetraciclina na mesma concentrao anterior, e procedeu-se o crescimento por aproximadamente 3 horas a 37C. Em seguida, as clulas foram inoculadas em 25 ml de meio NZY contendo maltose 0.2% e MgSO4 100mM. As clulas XL1-Blue e XLOLR foram ento centrifugadas a 1.000g durante 10 minutos e suspensas em Mg2SO4 10mM de forma a obter suspenses com DO igual a 5.0 e 0.75, respectivamente. O passo seguinte consistiu na incubao de 100l de biblioteca com 200l de XL1-Blue e 1l de fago auxiliar M13 a 37C por 30 minutos. Decorridos os 30 minutos, foi acrescentado 1 ml de meio NZY e o tubo foi incubado por 2 horas a 37C. Em seguida, o sistema foi incubado por 15 minutos a 70C. Aps a incubao, as clulas foram centrifugadas a 1000 g por 15 minutos. Aps a centrifugao, uma alquota de 200l de sobrenadante foi recolhida e adicionada a 200l de XLOLR que foram ento incubados por 30 minutos a 37C. Transcorrido o tempo de incubao, foram adicionados 300l de meio NZY e o sistema foi incubado por 45 minutos a 37C sob agitao (shaker). Em seguida, alquotas de 100l foram plaqueados em meio LB-gar contendo canamicina (50g/ml) e X-Gal, totalizando 7

24

placas. placa controle, adicionou-se 100l de XLOLR, apenas. Como a XLOLR usada na placa controle no passou pelo processo de infeco, e portanto no possui o DNA recombinante, ela sensvel canamicina, e portanto no capaz de crescer. As placas foram incubadas a 37C durante a noite. As placas contendo colnias de bactrias recombinantes foram estocadas a 4C, por no mximo uma semana. A figura 7 ilustra a insero do cDNA dentro do genoma do fago Lambda, bem como sua posterior exciso e recircularizao na forma de fagemideo pBK-CMV contendo o inserto clonado.

25

Figura 7: Ligao do cDNA no vetor ZAP Express e exciso em massa do fagemdeo pBK-CMV. O cDNA (DNA insert) inserido unidirecionalmente no sitio mltiplo de clonagem (CMV), flanqueado pelos promotores T3 e T7, do vetor ZAP Express, entre os stios de restrio Xho I e Eco RI e posteriormente empacotado em partculas viveis de fago (biblioteca). A exciso do fagemideo pBK-CMV contendo inserto, bem como sua infeco em clulas E. coli (linhagem XLOLR), foi realizada com o auxilio de um fago helper (fago auxiliar). (Fonte: http//www.stratagene.com).

26

6.6- Preparo do estoque de bactrias recombinantes


As colnias de bactrias provenientes da exciso em massa foram coletadas usando-se um palito e inoculadas em tubos contendo meio LB-canamicina. Procedeu-se o crescimento em um agitador rotatrio (shaker) a 37C por 14-16 horas. No dia seguinte, as culturas foram transferidas para tubos de microcentrfuga (1,7ml), identificadas, estocadas em presena de glicerol (30% v/v final) e armazenadas temperatura de 80C.

6.7- Preparo do extrato livre de clulas


As bactrias recombinantes foram crescidas em LB-caldo contendo canamicina (50g/ml) e IPTG (50g/ml) por 14-16 horas, a 37C, sob agitao. No dia seguinte, as culturas foram centrifugadas em tubos de vidro por 5-8 minutos a 1.000g e o sobrenadante foi desprezado. As clulas foram suspensas em 500l de gua Milli-Q e submetidas a uma nova centrifugao. O sobrenadante foi desprezado e as clulas suspensas em 400l de uma soluo de tampo carbonato (Na2CO3 15mM, NaHCO3 35mM pH 9,6) contendo PMSF 0.5mM. As clulas foram rompidas com prolas de vidro (aproximadamente 1/3 do volume de soluo de tampo carbonato) com o auxlio de um agitador de tubos. Aps a lise, procedeu-se nova centrifugao por 5 minutos a 1.000g e os sobrenadantes fora transferidos para tubos de 1,5ml, devidamente identificados com o nmero do clone, e estocados a 20C para posterior anlise (ELISA).

27

6.8- ELISA (Enzyme Linked Imunosorbent Assay)


A varredura da biblioteca de cDNA da glndula de veneno da aranha Lasiodora sp foi realizada atravs da tcnica de ELISA, como descrito por Kalapothakis e cols (2001). Placas de ELISA com 96 poos foram sensibilizadas durante 16 horas com 100l de extratos celulares a 4C. No dia seguinte, as placas foram lavadas por 4 vezes com uma soluo de NaCl 0,15M - Tween 20 - 0,05%. Os poos foram bloqueados com 100l de soluo de casena 1% preparada em PBS 1x - Tween 20 - 0,05% e a placa mantida a 37C por 1 hora. Aps o bloqueio, as placas foram lavadas 4 vezes com NaCl 0,15 M - Tween 20 - 0,05%. Aos poos foram ento adicionados 100l de IgGs de coelho (anti-veneno total) diludo 1:5000 (2l para 10ml de PBS 1x - casena 0,2% - Tween 20-0,05%). Incubou-se novamente a placa, a 37C por 2 horas. Transcorrido o tempo de incubao, os poos foram lavados 4 vezes com NaCl 0,15M - Tween 20 - 0,05%. Aps a lavagem, adicionou-se a cada poo 100l de anti-IgG de coelho-peroxidase diludo 1:4000 (2,5l em 10ml de PBS 1x -casena 0,2% - Tween 20-0,05%). Incubou-se por mais 1 hora temperatura de 37C e em seguida lavou-se 10 vezes com NaCl 0,15M - Tween 20 - 0,05%. A cada poo foram adicionados 100l de OPD 0.2mg/ml solubilizado em tampo citrato (Na2HPO4 50mM, cido ctrico 24mM pH 5.0) mais H2O2 (30%v/v) 0,2l/ml. A reao foi incubada na ausncia de luz por 25 minutos e em seguida, interrompida com 20l de H2SO4 diludo 1:20. A leitura da placa foi feita a 492nm usando-se um leitor de placas de ELISA (Molecular Devices Emax Spectrophotometer). Os clones que se mostraram positivos foram confirmados em um segundo ensaio imunolgico. Como controle negativo da reao, ns utilizamos extratos de bactrias XLOLR no infectadas.

28

6.9- Extrao do DNA plasmidial


Os clones que se mostraram positivos no teste de ELISA foram crescidos a 37C por 16 horas em 3 ml de meio LB-caldo contendo canamicina na concentrao final de 50g/ml. No dia seguinte, duas alquotas de 1,5 ml de cada clone foram centrifugadas em tubos de microcentrfuga (1,5 ml) por 3 minutos a 3000 g. O sobrenadante foi desprezado e as clulas foram suspensas em 200l de STET e 5l de lisozima. Procedeu-se ento uma incubao por 5 minutos temperatura ambiente e posteriormente a 95C por 60 segundos. A mistura foi centrifugada por 10 minutos a 10.000g. Aps a remoo dos restos celulares, adicionou-se 8l de CTAB e procedeu-se nova centrifugao, a 10.000g, por 10 minutos. Aps desprezar o sobrenadante, o precipitado foi suspenso em 200l de uma soluo 1,2 M de NaCl. Os tubos foram levados rapidamente ao vortex e em seguida, adicionou-se 400l de fenol/clorofrmio a cada tubo. O contedo dos tubos foi agitado vigorosamente por 2 minutos com o auxlio de um agitador de tubos. Em seguida, os tubos foram submetidos centrifugao por 10 minutos a 10.000g temperatura ambiente. Aps a centrifugao, a camada superior foi transferida para outro tubo de microcentrfuga e tratada com 5l de RNase por 30 minutos temperatura ambiente. Decorridos os 30 minutos, o DNA foi precipitado pela adio de etanol 100% (2,5 vezes o volume da soluo de DNA) e incubao por 1 ou 2 horas a 20C. Aps a incubao, o DNA foi obtido por centrifugao por 10 minutos, a 10.000g e o sobrenadante desprezado. O DNA foi lavado (1 ou 2 vezes) com 400l de etanol 70% e novamente centrifugado por 10 minutos a 10.000g. O etanol residual foi eliminado por evaporao usando-se um bloco trmico (40C) ou o sistema speed vac.

29

6.10- Preparo do gel de agarose


Pesou-se 1g de agarose e adicionou-se a 100ml de TAE 1x (40mM de Tris-acetato, 1mM de EDTA, pH 8,0 ajustado com cido actico). A soluo foi aquecida em forno de microondas at completa solubilizao da agarose.

6.11- Eletroforese do DNA em gel de agarose


Com o objetivo de quantificar o DNA plasmidial extrado, procedeu-se a eletroforese de uma alquota do DNA em gel de agarose 1% (p/v) durante 1 hora a 100mV. A um volume de 3l de DNA acrescentou-se 6l de gua e 1l de tampo da amostra (0,25 % de azul de bromofenol, 0,25 % de xilenocianol e 30% p/v de glicerol). Aps a aplicao da amostra e o desenvolvimento da eletroforese, o gel foi corado em soluo de brometo de etdio (0,5 mg/ml) diludo em TAE 1X, por 15 minutos. O gel foi visualizado em um transluminador a 356 nm e fotografado por um sistema Sony (Modelo SSC-M 370CE) acoplado a um visor e a uma impressora. No processo de quantificao utilizamos como referncia o padro de DNA (1Kb - Invitrogen)

30

6.12- Seqenciamento do DNA


Os clones que se mostraram positivos aps varredura utilizando a tcnica de ELISA foram seqenciados de acordo com o mtodo descrito por Sanger e cols. (1977) utilizandose do kit de seqenciamento DYEnamic ET Dye Terminator Cycle Sequencing Kit for Mega BACE DNA Analysis System (Amersham Biosciences). O seqenciamento foi feito em ambas as fitas utilizando-se os iniciadores BK reverse e o T7 primer, que se anelam no vetor pBK-CMV.

A reao de amplificao foi preparada como descrito abaixo: 4l de Mix (kit seqenciamento) 1 l de iniciador (5 pMol) direto ou reverso 4 l de DNA (200ng) 1 l de gua

As reaes foram conduzidas em um termociclador (Mastercycler, Eppendorff), conforme o programa descrito a seguir:

1. Rpida elevao da temperatura a 95C 2. 95C por 25 segundos 3. 50C por 20 segundos 4. 60C por 1 minuto O ciclo foi repetido por 30 vezes. Abaixamento da temperatura a 4C.

As seqncias dos iniciadores utilizados nas reaes de sequenciamento encontram-se descrita abaixo.

Iniciadores BK-reverse T7 primer

Seqncias
5`-ACAGGAAACAGCTATGACCTTG-3` 3`-CGGGATATCACTCAGCATAATG-5`

31

6.13- Purificao dos produtos de extenso


Adicionou-se 80l de isopropanol (75%) a 10l do produto da reao de sequenciamento. Aps 15 minutos, temperatura ambiente, procedeu-se uma centrifugao por 30 minutos a 1.000 g e desprezou-se o sobrenadante. Em seguida, lavou-se o precipitado com 250l de isopropanol a 75% e procedeu-se nova centrifugao por 5 minutos a 1.000 g. Desprezou-se o sobrenadante e secou-se o precipitado temperatura ambiente por 1 hora. Aps a secagem, suspendeu-se o DNA em 10l de tampo da amostra (azul de bromofenol 0.25%, xilenocianol 0.25% e glicerol 30). Uma alquota do DNA a ser seqenciado foi submetida eletroforese em gel de agarose com o objetivo de estimar a concentrao de DNA obtida. Aps a quantificao do DNA, procedeu-se anlise do DNA em um aparelho de seqenciamento automtico Mega BACE 500.

6.14- Anlise das seqncias de nucleotdeos obtidas


Todas as seqncias nucleotdicas dos clones que se mostraram positivos em dois ensaios imunolgicos de ELISA foram submetidas a anlises pelos programas Blastn, Blastx, BlastP (Basic Local Alignment Search Tool Altschul e cols., 1990 disponvel em http//:www.ncbi.nlm.nih.gov), SIXFRAME (disponvel em http//:workbench.sdsc.edu), SignalP e ProtScale (disponveis em http//:www.cbs.dtu.dk) .

6.15- Clonagem das seqncias codificantes para LTx1 e LTx3 em sistema de expresso bacteriano pET-11a Novagen
O procedimento de clonagem foi desenhado com o intuito de inserir apenas a seqncia que codifica as toxinas maduras dos clones selecionados na varredura da biblioteca de cDNA da aranha Lasiodora sp no vetor selecionado. O sistema de expresso pET um poderoso sistema desenvolvido para a clonagem e expresso de protenas recombinantes em clulas E. coli. Os vetores de expresso pET apresentam um sistema de

32

induo baseado no promotor da T7 RNA polimerase, desenvolvido por Studier e cols. (1990). Nesses vetores de expresso, o operador Lac encontra-se inserido entre o promotor T7 e seqncias de iniciao de traduo, o que permite desrepresso, mediada por IPTG, do promotor T7 em adio induo mediada por IPTG da T7 polimerase do promotor lac UV5 em cepas de bactrias DE3. As etapas da clonagem das toxinas, no sistema de expresso pEt-11a, esto descritas a seguir.

6.15.1- Amplificao da regio correspondente s toxinas maduras LTx1 e LTx3 para clonagem em sistema PCR 2.1 TOPO TA Cloning Invitrogen

Com o objetivo de proceder a clonagem, apenas da regio que codifica as toxinas maduras LTx1 e LTx3, no vetor de expresso bacteriano pET-11a (Novagen), desenhamos pares de iniciadores contendo os stios de restrio Nde I e BamH I. As seqncias dos iniciadores utilizados nas reaes de PCR para a amplificao das toxinas maduras LTx1 e LTx3 encontram-se descritas abaixo:

Iniciadores Forward Reverse

Seqncias
5-CCATATGTTTTTCGAATGTAC-3 5-GGGATCCCTAAAACTTCAAAC-3

33

Para amplificar a regio correspondente as toxinas maduras LTx1 e LTx3, procedeu-se a reao em cadeia da polimerase utilizando-se o DNA plasmidial extrado previamente como molde da reao (DNA template). O volume dos reagentes utilizados na reao de PCR est descrito a seguir.

1l de DNA plasmidial 3.0l de dNTP (soluo estoque 2.5mM) 3.0l de tampo Taq 10x 1.5l de MgCl2 (25mM) 1.0l de iniciador F (20 pmoles) 1.0l de iniciador R (20 pmoles) 0.5l de Taq DNA polimerase 19l de gua Milli-Q estril

Aps a adio de uma gota de leo mineral, procedeu-se a reao, em um termociclador, conforme o programa descrito abaixo.

1. 95C por 4 minutos 2. 92C por 1 minuto 3. 43C por 1 minuto 4. 72C por 1 minuto 5. Etapas 2 a 4 (34 vezes) 6. 72C por 5 minutos 7. Abaixamento da temperatura a 4C, at purificao.

34

6.15.2- Preparo de gel de poliacrilamida 6 %


Para o preparo de gel de poliacrilamida 6%, procedeu-se mistura dos seguintes reagentes.

1.5 ml de acrilamida 40% 1.0 ml de TAE 10x 7.5 ml de gua Milli-Q 75l de persulfato de amnio 10% 5.0l de TEMED

6.15.3- Purificao do produto de PCR em gel de poliacrilamida


Aps a reao de amplificao da regio correspondente s toxinas maduras LTx1 e LTx3, o produto de PCR foi submetido eletroforese em gel de poliacrilamida (tampo Tris-acetato 1X) por 50 minutos a 100 volts. O gel foi corado com brometo de etdio por 5 minutos sob baixa agitao. As bandas correspondentes s toxinas maduras LTx1 e LTx3 (aproximadamente 170 pares de bases) foram extradas com o auxilio de uma lmina de bisturi e transferidas para um tubo de microcentrifuga (1.5ml) contendo 500l de soluo TE 1X NaCl 1M. O contedo do tubo foi agitado com o auxilio de um agitador de tubos e imediatamente incubado a 37C por 2 horas. Aps incubao, procedeu-se uma centrifugao por 10 minutos a 10.000g. O sobrenadante foi transferido para outro tubo de microcentrifuga ao qual adicionaram-se 400l de fenol/clorofrmio alcalino. Aps agitao do contedo presente no tubo com o auxlio de um agitador de tubos, procedeu-se nova centrifugao por 10 minutos a 10.000g. A suspenso aquosa (contendo o DNA) foi transferida para outro tubo de microcentrifuga ao qual adicionou-se 2 volumes de etanol 100% e 1l de tRNA (concentrao estoque 10mg/ml). O contedo do tubo foi mantido a 80C por 40 minutos. Aps a precipitao, procedeu-se nova centrifugao por 15 minutos 35

a 10.000g. Descartou-se o sobrenadante e adicionou-se 400l de etanol 70%. Procedeu-se nova centrifugao por 10 minutos a 10.000g. O sobrenadante foi desprezado e o DNA foi mantido a 65C por 15 minutos em um bloco trmico. Aps a secagem, o DNA foi suspenso em 20l de gua Milli-Q estril.

6.15.4- Clonagem das seqncias codificantes para LTx1 e LTx3 em PCR 2.1-TOPO TA Cloning Invitrogen

A clonagem dos fragmentos (produtos de PCR) que codificam as toxinas maduras LTx1 e LTx3 em sistema PCR 2.1-TOPO TA Cloning Invitrogen foi realizada como uma estratgia para facilitar a clonagem das toxinas maduras no vetore pET-11a. A figura 8 ilustra o mapa do vetor PCR 2.1 TOPO TA Cloning Invitrogen utilizado. Aps a purificao dos produtos de PCR, correspondentes aos fragmentos que codificam as toxinas maduras (LTx1 e LTx3), como descrito em 6.15.3, os mesmos foram inseridos no vetor PCR 2.1-TOPO conforme protocolo descrito a seguir:

2l de DNA (produto de PCR) 1l de salt solution 1l de vetor TOPO 2l de gua milli-Q estril

A reao foi mantida temperatura ambiente por 10 minutos.

36

Figura 8: Mapa do vetor de clonagem PCR 2.1-TOPO TA Cloning Invitrogen (Disponvel em: www.invitrogen.com)

37

6.15.5- Preparo de clulas E. coli Top 10 Fcompetentes (Mtodo CaCl2)


Clulas de E. coli, linhagem TOP 10 F, foram pr-inoculadas em 3ml de meio LB caldo contendo estreptomicina (10g/ml) e tetraciclina (10g/ml). As clulas foram crescidas sob agitao constante (200 rpm), por 14-16 horas, temperatura de 37C. Aps o crescimento, as bactrias foram transferidas para um erlenmeyer contendo 100l de LB sem antibitico. Procedeu-se nova incubao a 37C, 200 rpm por um perodo de 2-3 horas at que as clulas atingissem uma densidade tica entre 0.6 e 0.8. Atingida a densidade tica tima, as bactrias foram submetidas centrifugao por 8 minutos a 1.000g em centrifuga refrigerada (4C). O sobrenadante foi desprezado e as clulas suspensas em 40 ml de CaCl2 0.1M gelado. Incubou-se em gelo por pelo menos 1 hora. Aps incubao, procedeu-se nova centrifugao por 5 minutos a 1.000g em centrifuga refrigerada. Desprezou-se o sobrenadante, e as clulas foram suspensas em 1ml de CaCl2 0.1M. Alquotas de 100l foram estocadas em tubos de microcentrfuga, contendo 30% de glicerol, e mantidas a temperatura de -80C.

6.15.6. Transformao de clulas de E. coli Top 10 F com o produto de ligao em PCR 2.1-TOPO

Clulas de E. coli (linhagem Top 10 F) competentes foram descongeladas e mantidas em gelo. Adicionou-se 6l do produto de ligao (PCR 2.1-TOPO mais fragmentos) ao tubo contendo 100l de clulas competentes. Incubou-se em gelo por 15-30 minutos. Aps a incubao, a mistura foi submetida a um choque trmico a temperatura de 42C por 2 minutos. Imediatamente aps o choque trmico, um volume de 1 ml de meio LB foi adicionado mistura. Procedeu-se nova incubao por 50 minutos a temperatura de 37C. Aps incubao, procedeu-se uma centrifugao por 4 minutos a 3.000g. O excesso de sobrenadante foi desprezado e as clulas foram suspensas em aproximadamente 100l 38

de meio LB restante no tubo. As clulas foram semeadas em placas contendo meio LB ampicilina com o auxilio de prolas de vidro e incubadas a 37C por 14-16 horas.

6.15.7- Reao em cadeia da polimerase de colnias provenientes da transformao de E. coli Top 10 F com o produto de ligao em PCR 2.1-TOPO

Colnias de bactrias provenientes da transformao foram submetidas reao em cadeia da polimerase para confirmar a presena dos fragmentos que codificam as toxinas maduras LTx1 e LTx3 no vetor PCR 2.1-TOPO. Os iniciadores utilizados na reao foram:

Iniciadores M13 Reverse Primer M13 Forward Primer

Seqncias
5-GTCCTTTGTCGATACTG-3 5-GACCGGCAGCAAAATG-3

Para amplificar a regio correspondente s toxinas maduras LTx1 e LTx3, procedeu-se a reao em cadeia da polimerase utilizando-se 0.5l de cultura dos clones provenientes da transformao como molde da reao (DNA template). O sistema da reao de PCR encontra-se descrito abaixo:

0.5l da cultura (clone) 3.0l de dNTP (soluo estoque 2.5mM) 3.0l de tampo Taq 10x 1.5l de MgCl2 (25mM) 1.0l de iniciador F (20 pmoles) 1.0l de iniciador R (20pmoles) 0.5l de Taq DNA polimerase 19.5l de gua Milli-Q estril

39

Aps a adio de uma gota de leo mineral, procedeu-se a reao em um termociclador, conforme o programa descrito abaixo.

1. 95C por 4 minutos 2. 92C por 1 minuto 3. 43C por 1 minuto 4. 72C por 1 minuto 5. Etapas 2 a 4 (34 vezes) 6. 72C por 5 minutos 7. Abaixamento da temperatura a 4C, at purificao.

6.15.8- Extrao do DNA plasmidial de colnias provenientes da transformao de E. coli Top 10 F com o produto de ligao em PCR 2.1-TOPO

As colnias que se mostram positivas na reao de PCR (apresentaram uma amplificao de aproximadamente 374 pb) foram inoculadas em 5 ml de meio LB caldo contendo ampicilina na concentrao de 10g/ml e incubadas por 14-16 horas a temperatura de 37C sob agitao de 200 rpm. A extrao do plasmdeo PCR 2.1-TOPO contendo inserto foi realizada utilizando-se o kit de extrao de DNA plasmidial Wizard Plus SV DNA Minipreps Promega.

40

6.15.9- Digesto dos plasmdeos PCR 2.1-TOPO-LTx1 (e LTx3) com as enzimas Nde I e BamH I para clonagem do fragmento liberado no sistema de expresso pET-11a (Novagen)

Vetores PCR 2.1-TOPO contendo insertos que codificam para as toxinas LTx1 e LTx3 foram digeridos com as enzimas de restrio Nde I e Bam H I para a posterior clonagem do produto de digesto no sistema de expresso pET-11a, conforme protocolo a seguir.

7.0l de DNA plasmidial 3.0l de tampo K (Amersham) 0.3l BSA 0.7l de Nde I 1.0l de BamH I 18.0l de gua Milli-Q estril

Incubao por 2 horas a 37C.

6.15.10- Purificao dos produtos de digesto

Os produtos de digesto foram submetidos eletroforese em gel de poliacrilamida por 50 minutos a 100 volts com o objetivo de purificar as bandas correspondentes aos insertos que codificam as toxinas maduras LTx1 e LTx3 (aproximadamente 170 pb). A purificao da banda de interesse foi conduzida conforme protocolo descrito em 6.15.3.

41

6.15.11- Digesto do vetores de expresso pET-11a e pET-21b com as enzimas de restrio Nde I e Bam H I
Vetor pET-11a (Novagen) (Figura 9) obtido a partir de mini-preparao de DNA plasmidial como descrito na seco 6.9, foi digerido com as enzimas de restrio Nde I e Bam H I para a posterior clonagem dos fragmentos que codificam as toxinas maduras LTx1 e LTx3 seguindo o protocolo descrito abaixo.

7.0l de pET-11a 3.0l de tampo K (Amersham) 0.3l BSA 0.7l de Nde I 1.0l de BamH I 18.0l de gua Milli-Q estril

A mistura de reao foi incubada por 2 horas a 37C. Aps a digesto, procedeu-se a defosforilao do vetor com o objetivo de evitar a sua recircularizao. Ao produto de digesto, adicionou-se 3l de tampo e 0.5l de CIP (calf intestinal phosphatase). A mistura foi incubada a 37C por 30 minutos. A inativao da enzima procedeu-se a 75C por 10 minutos.

6.15.12- Purificao do vetor de expresso utilizando papel Whatman DE81


Aps a digesto do vetor de expresso pelas enzimas de restrio, todo o volume da reao foi aplicado em gel de agarose 1% e submetido eletroforese por 1 hora e 120 volts. O gel foi corado com brometo de etdio e as bandas visualizadas em luz ultravioleta com o auxlio de um transiluminador. Com o auxlio de uma lmina de bisturi, procedeu-se um corte no gel frente da banda correspondente ao DNA digerido. Introduziu-se no corte meio disco de papel Whatman DE81. O gel foi novamente submetido eletroforese por 10 minutos e 120 volts para propiciar a ligao do DNA ao papel Whatman DE81. O gel foi 42

novamente levado ao transluminador para certificar que todo o DNA havia se ligado ao papel. Com o auxlio de uma pina, o papel foi transferido para um tubo de microcentrfuga (1,5 ml) ao qual adicionou-se 500l de TE 1X NaCl 1M. Agitou-se por 30 segundos com o auxlio de um agitador de tubos e incubou-se por 2 horas em estufa a 37C. Aps incubao, centrifugou-se por 5 minutos a 10.000g e o sobrenadante foi transferido para um novo tubo de 1,5ml. Adicionou-se 400l de fenol/clorofrmio alcalino e o contedo do tubo foi agitado vigorosamente com o auxlio de um agitador de tubos. Procedeu-se nova centrifugao por 10 minutos a 10.000g. Aps a centrifugao, o sobrenadante (fase aquosa) foi transferido para outro tubo de microcentrfuga ao qual adicionou-se 2 volumes de etanol 100%. O tubo foi mantido por 40 minutos temperatura de -80C para permitir a precipitao do DNA. Aps a precipitao do DNA, procedeu-se nova centrifugao por 15 minutos a 10.000g. Desprezou-se o sobrenadante e adicionou-se 400l de etanol 70%. O tubo contendo o DNA foi submetido a uma nova centrifugao por 10 minutos a 10.000g. Aps desprezar o sobrenadante, procedeu-se a secagem do DNA em um speed-vac. O DNA foi suspenso em 20l de gua Milli-Q estril e estocado a -80C.

43

6.15.13- Clonagem dos fragmentos que codificam as toxinas LTx1 e LTx3 no vetor de expresso pET-11a

Aps a digesto dos plasmdeos PCR 2.1-TOPO, contendo as seqncias codificantes para LTx1 e LTx3, e dos vetores de expresso pET-11a (Figura 9) com as enzimas de restrio Nde I e BamH I, ambos os fragmentos foram submetidos a reao de ligao no vetor de expresso utilizando-se a enzima T4 DNA ligase, conforme o protocolo descrito abaixo.

3l de DNA vetor pET-11a 5l DNA inserto 0.7l de T4 DNA ligase Promega 10l de Tampo da ligase 2x 1.3l de gua Milli-Q estril Incubao por 14-16 horas a temperatura de 16C em um bloco trmico (Termomixer Eppendorff) mantido a 4C em cmara fria.

44

Figura 9: Mapa esquemtico do vetor de expresso bacteriano pET-11a Novagen. O sistema pET11a possui um sistema de deteco e purificao da protena recombinante baseado em uma pequena seqncia T7-Tag.

45

6.15.14- Transformao de clulas de E. coli Top 10 F com o produto de ligao no vetor de expresso pET-11a

Aps a ligao dos fragmentos que codificam para as toxinas maduras LTx1 e LTx3 no vetor de expresso pET-11a, como descrito em 6.15.13, procedeu-se a transformao de clulas de E. coli Top 10 F utilizando-se todo o produto das ligaes. Os demais passos da transformao foram conduzidos conforme descrito na seco 6.15.6.

6.15.15- Reao em cadeia da polimerase de colnias provenientes da transformao de clulas de E. coli Top 10 F com os produtos de ligao no vetor de expresso pET-11a
Colnias de bactrias provenientes da transformao descrita em 6.15.14 foram submetidas reao em cadeia da polimerase para confirmar a presena dos fragmentos que codificam as toxinas maduras LTx1 e LTx3 no vetor de expresso pET-11a. Os iniciadores utilizados na reao foram.

Iniciadores
PET-F PET-R

Seqncias
3-TATAGGGGAATTGTGAGCGG-5 3-CTTTCGGGCTTTGTTAGCAG-5

46

Para amplificar a regio correspondente s toxinas maduras LTx1 e LTx3, procedeu-se a reao em cadeia da polimerase utilizando-se 0.5l de cultura dos clones provenientes da transformao como molde da reao. O sistema da reao de PCR encontra-se descrito abaixo:

0.5l de cultura 3.0l de dNTP (soluo estoque 2.5mM) 3.0l de tampo Taq 10x 1.5l de MgCl2 (25mM) 1.0l de iniciador F (20 pmoles) 1.0l de iniciador R (20 pmoles) 0.5l de Taq DNA polimerase 19.5l de gua Milli-Q estril

Aps a adio de uma gota de leo mineral, procedeu-se a reao, em um termociclador, conforme o programa descrito abaixo.

1. 95C por 4 minutos 2. 92C por 1 minuto 3. 50C por 1 minuto 4. 72C por 1 minuto 5. Etapas 2 a 4 (34 vezes) 6. 72C por 5 minutos Abaixamento da temperatura a 4C, at purificao.

47

6.15.16- Transformao de bactrias de expresso (E. coli linhagem BL-21 DE3) com a construo pET-11a-LTx1 e pET-11aLTx3

Clulas competentes E. coli linhagem BL-21 (DE3) foram descongeladas em gelo e transformadas com as construes pET-11a-LTx1 e pET11a-LTx3, como descrito em 6.15.6.

6.16- Induo da expresso da toxina recombinante LTx1 clonada no vetor de expresso pET-11a
Um volume de 20l de clulas E. coli linhagem BL-21 transformada com a construo pET-11a-LTx1 foi inoculado em 4ml de meio LB-caldo contendo ampicilina (100g/ml) e incubado a 37C, 200 rpm por 14-16 horas. No dia seguinte, o pr-inculo foi vertido em 100ml de meio LB-caldo contendo ampicilina (100g/ml) e incubado a 30C, 200 rpm, at que a DO600 atingisse um valor entre 0,6-0,8. Ao atingir a DO600 desejada, uma alquota de 100l de clulas (correspondente ao tempo zero de induo) foi centrifugada em uma microcentrfuga por 2 minutos a 10.000g. Descartou-se o sobrenadante e as clulas foram suspensas em 100l de tampo da amostra (SDS-PAGE 2X) contendo agente redutor para posterior anlise em gel SDS-PAGE. A expresso da LTx1 recombinante foi induzida pela adio de IPTG (0,6mM concentrao final) cultura e incubao temperatura de 30C sob agitao (200 rpm) por 5 horas. Aps diferentes tempos de induo (1h, 2h, 3h, 4h e 5h), alquotas de 100l de clulas foram centrifugadas e tratadas com o tampo da amostra (SDS-PAGE 2X) como descrito acima. A quantificao da protena de cada alquota foi realizada pelo mtodo de Bradford. As alquotas suspensas em tampo da amostra (SDS-PAGE 2X) foram submetidas temperatura de 95C por 5 minutos e um volume contendo 20g de protena foi analisado em gel SDS-PAGE.

48

6.16.1- Produo da toxina LTx1 recombinante e solubilidade da protena

Aps 5 horas de induo (como descrito em 6.16), a cultura (100ml) foi centrifugada por 15 minutos, 4C, 1.000g. O sedimento celular foi suspenso em 10ml de soluo de lise (50mM Tris pH 8.0, 300mM NaCl e 10mM imidazol) contendo 80l de lisozima (soluo estoque 50mg/ml), 1l de aprotinina (soluo estoque 10mg/ml), 1l de pepstatina (soluo estoque 10mg/ml) e 200l de PMSF (soluo estoque 50mM) e mantido em gelo por 30 minutos. Aps incubao, as clulas foram submetidas sonicao (200 a 300 w) por 6 vezes com pulsos de 10 segundos e intervalos de 10 segundos em gelo. Aps a sonicao, adicionou-se soluo 0,1% de Triton X100. As clulas sonicadas foram submetidas centrifugao por 30 minutos, 1.000g, a 4C. O sobrenadante foi transferido para um tubo falcon (15ml) e concentrado para anlise em SDS-PAGE. Para testar a produo da protena sob a forma de corpos de incluso, o sedimento proveniente da sonicao da cultura de clulas induzidas por 5 horas foi submetido a 2 lavagens (20ml cada) com tampo de ligao 1 (50mM Tris, 500mM NaCl, 10mM mercaptoetanol e 2M uria). Aps as lavagens e centrifugao por 5 minutos, a 4C, 1.000g, o precipitado foi suspenso, com o auxlio de uma pipeta, em 375 l de tampo X (50mM Tris, 500mM NaCl, 10mM -mercaptoetanol e 8M uria). Um volume de 35ml de tampo de ligao 2 pH 8.0 (50mM Tris, 500mM NaCl e 5mM imidazol) foi vagarosamente adicionado ao tubo contendo o precipitado suspenso em tampo X e incubado por 24 horas temperatura de 4C para permitir a renaturao das protenas eventualmente presentes nos corpos de incluso. No dia seguinte, procedeu-se nova centrifugao por 15 minutos, 1.000g, a 4C. O sobrenadante (35ml) foi concentrado para anlise posterior.

49

6.16.2- Eletroforese em gel de poliacrilamida SDS-PAGE

Para a eletroforese das fraes contendo, eventualmente, a toxina LTx1 recombinante, adotou-se o sistema de gel desnaturante (SDS-PAGE) descrito por Laemmli e cols. (1970). As concentraes dos gis foram de 4% para o gel de concentrao e 18% para o gel de separao. As amostras (30g) foram tratadas com o tampo da amostra SDSPAGE 2X contendo o agente redutor -mercaptoetanol, fervidas durante 5 minutos, e aplicadas no gel. A eletroforese procedeu-se verticalmente a 100V, em tampo Tris 0,025M pH 8,3 contendo 0,96M de glicina e 0,1% de SDS. Aps a eletroforese o gel foi revelado em soluo de nitrato de prata. As solues usadas encontram-se descritas no final deste captulo.

6.16.3- Colorao pelo mtodo da prata


Aps a eletroforese, o gel foi transferido para uma cuba contendo soluo fixadora e procedeu-se a incubao por 1 hora. Em seguida o gel foi lavado com etanol 50% (soluo de lavagem), por 3 vezes, por 20 minutos. Aps as lavagens, o gel foi tratado com uma soluo de tiossulfato de sdio (0,4g/ml) por 2 minutos. Em seguida, procedeu-se nova lavagem com gua destilada, por 3 vezes, 20 minutos. Aps as lavagens, procedeu-se a incubao do gel por 20 minutos em soluo de impregnao. Aps a impregnao, o gel foi incubado em soluo de desenvolvimento at o aparecimento das bandas. A reao foi interrompida pela adio da soluo de parada. A composio das solues utilizadas nesse mtodo de colorao encontra-se no final deste captulo.

50

6.16.4- Western Blot

As protenas separadas eletroforeticamente em gel de poliacrilamida-SDS 18% foram transferidas para um filtro de nitrocelulose (Amersham, poros de 0,45 m), com o auxlio de um sistema de transferncia Pharmacia LKB-PhastSystem, por 40 minutos, 5 v, 50mA. O sistema foi montado fazendo-se um sanduche com 3 folhas de papel de filtro 3mm, 1 folha de membrana de nitrocelulose, o gel contendo amostras a serem transferidas e mais 3 folhas de papel de filtro 3mm, todos embebidos no tampo de transferncia contnua descrito no manual. Aps a transferncia, a membrana foi bloqueada, durante 1 hora, com leite em p 5% em 0,05% Tween/PBS (PBS-T). Aps o bloqueio a membrana foi lavada 3 vezes com PBS-T por 10 minutos e incubada com antisoro policlonal anti-veneno total diludo 1:2000 em leite em p 5% PBS-T por 1 hora. Procedeu-se nova lavagem como descrito acima. A membrana foi incubada com anti-IgG de coelho-peroxidase diludo 1:20000 em leite em p 5% PBS-T, lavada conforme descrito acima e revelada com ECL reagente (Amersham).

51

6.17- Gentipos das linhagens utilizadas neste trabalho

de

bactrias

hospedeiras

Linhagem XL1-Blue MRF`: (mcrA)183 (mcrCB-hsdSMR-mrr) 173 endA1 supE44 thi-1 recA1 gyrA96 relA1 lac[F`proAB laclqZM15 Tn10(Tetr)]

Linhagem XLOLR: (mcrA)183 (mcrCB-hsdSMR-mrr) 173 endA1 thi-1 recA1 gyrA96 relA1 lac[F`proAB laclqZM15 Tn10(Tetr)] Su- (nonsuppressing) r (lambida resistent).

Linhagem TOP 10F: F, mcrA, (mrr-hsdRMS-mcrBC), 80lac-M15, lacX74, deo R, recA1, ara139, (ara, leu), 7697, galU, galK, -, rslp,endA1, nupG. Linhagem BL-21 (DE3): F-ompT hsdSb(r-B m-B) gal dcm.

6.18- Meios de cultura


LB Broth: 10g de NaCl, 10g de bactotriptona e 5g de extrato de levedura. O pH foi ajustado para 7,5 com NaOH e o volume acertado para 1 litro. Autoclavar a soluo.

LB-gar: Possui a mesma composio do LB Broth, acrescido de 20g de agar por litro de soluo. Autoclavar a soluo.

LB-gar canamicina: Possui a mesma composio do LB-gar acrescido de kanamicina na concentrao de 50g/ml.

LB-gar tetraciclina: Possui a mesma composio do LB-gar acrescido de tetraciclina na concentrao final de 12,5g/ml.

LB top gar: Possui a mesma composio do LB-broth acrescido de agarose 0,7% (w/v).

LB XIA: LB agar contendo 20g/ml de ampicilina e 1mM de IPTG 52

2xYP: 16g de bactopeptona, 10g de extrato de levedura, ajustar o pH para 7.5 e o volume para 1 litro. Autoclavar a soluo.

6.19- Reagentes e material de uso


Tetraciclina: A tetraciclina foi dissolvida em H2O estril na concentrao de 15mg/mL e estocada a 20C. A soluo foi utilizada na concentrao final de 12,5 g/mL.

Canamicina: A canamicina foi dissolvida em H2O estril na concentrao de 50mg/mL e estocada a 20C. A soluo foi utilizada na concentrao final de 100g/mL.

Ampicilina: A ampicilina foi dissolvida em gua deionizada estril na concentrao final de 100mg/ml (soluo estoque 1.000X concentrada) e estocada a -20C.

Estreptomicina: A estreptomicina foi dissolvida em gua deionizada estril na concentrao de 20mg/ml (soluo estoque 1.000X concentrada) e estocada a -20C.

IPTG: O IPTG foi dissolvido em gua Milli-Q estril na concentrao de 500mM e estocado a -20C.

Maltose: Dissolveu-se 20g de maltose em 100 ml de gua (soluo 20%). Autoclavar a soluo.

PMSF: O PMSF foi dissolvido em isopropanol na concentrao final de 100mM e estocado a 4C

X-Gal: O X-Gal foi dissolvido em dimetilformamida na concentrao de 20mg/ml e estocado a 20C.

-Mercaptoetanol 700mM: 5 l de -mercaptoetanol 14 M e 95 l de gua deionizada.

53

6.20- Solues
TAE (Tampo Tris-acetato): Soluo estoque 50X: 242g de Tris, 57,1mL de cido actico glacial e 100mL de EDTA, pH 8,0. Completar o volume para 1 litro.

TE (Tampo Tris-EDTA): Soluo estoque Tris-HCl 1M, pH 8,0 e EDTA 0,5M (pH 8,0). Juntar as solues estoque nas concentraes Tris-HCl 10mM pH 8,0 e EDTA 1mM pH 8,0 de acordo com o volume a ser preparado. Autoclavar e guardar temperatura ambiente.

Soluo de MgCl2: Soluo preparada em duas concentraes, 100mM e 10mM. 10x sample buffer: Tris-HCl 10mM (pH 7.5), EDTA 1mM, NaCl 5M.

Corante: 0.25% de azul de bromofenol, 0.25% de xilenocianol FF e 30% de glicerol.

STET: 8% p/v de sacarose, 0.1% v/v de Triton X-100, 50mM de EDTA, 50mM de TrisHCl. Ajustar o pH para 8,0.

Lisozima: A lisozima foi diluda em gua deionizada para uma concentrao de 50mg/ml.

CTAB: Cetil trimetil brometo de amnio diludo em gua deionizada para uma concentrao de 50mg/ml.

Soluo saturada de fenol/clorofrmio: 500g de fenol (Sigma-P1037) so aquecidas (68C), at a completa dissoluo. Hidroxiquinolina adicionada na concentrao de 0,1%. Ao fenol dissolvido adiciona-se 1 volume de tampo Tris-HCl 0,5M, pH 8,0. A mistura mantida sob agitao por 15 minutos e depois em repouso at ocorrer a separao completa das fases. A fase aquosa ento removida e adiciona-se 1 volume de soluo Tris-HCL 0,1M, pH 8,0 repetindo o procedimento acima, at obteno da soluo final com pH> 7,8. Aps o equilbrio da soluo e remoo da fase aquosa, adiciona-se 0,1 volume de Tris-HCl 0,1M, pH 8,0 contendo 0,2% de -mercaptoetanol. A est mistura adicionou-se igual volume de clorofrmio (MERCK). Armazenar a 4C, protegido da luz.

54

6.20.1- Solues utilizadas na ELISA


PBS pH 7,4: 0,05M Na2HPO4 e 0,15M de NaCl. Tampo de ligao: Na2CO3 1,59g, NaHCO3 2,93g pH 9,6. Diluir em gua q.s.p 1L. Estocar a 4C.

Soluo de bloqueio: Casena 2%, diluir em PBS 1X. Estocar a 20C.

Tampo de incubao: Casena 0,25%, Tween20 0,05%, diluir em PBS 1X. Estocar a 20C.

Soluo de lavagem: NaCl 9,0g, Tween 20 0,5ml, diluir em gua q.s.p. 1L. Estocar a 4C.

Soluo reveladora: 10ml de tampo citrato, 4mg de OPD, 2l de gua oxigenada 30%.

55

6.20.2- Solues utilizadas no gel SDS-PAGE

Soluo A: 39g de acrilamida, 1g de bisacrilamida, gua q.s.p. 100ml. Filtrar a soluo e armazenar em frasco escuro a 4C.

Soluo B: 18,15g de Tris, ajustar o pH para 8,8 com HCl concentrado, gua deionizada q.s.p. 100ml. Armazenar a 4C.

Soluo C: 6g de Tris, ajustar o pH para 6,8 com HCl concentrado, gua deionizada q.s.p. para 100ml. Armazenar a 4C.

SDS 10%: 10g de SDS diludos em gua deionizada q.s.p. 100ml. Armazenar temperatura ambiente.

PSA 10%: Persulfato de amnio dissolvido em gua deionizada na concentrao de 0,1g/ml.

Tampo da amostra (sem agente redutor 2X concentrado): 1ml de soluo C, 0.8 ml de glicerol, 1.6ml de SDS 10%, 0.2ml de azul de bromofenol 0.2%, 0.4ml de gua deionizada. Armazenar temperatura ambiente.

Tampo da amostra (com agente redutor 2X concentrado): Substituir a gua do tampo sem agente redutor por 0,4ml de -mercaptoetanol.

Tampo de corrida (5X concentrado): 4,5g de Tris (0,125M), 21,6g de glicina (0,96M), 1,5g de SDS (0,5%), gua deionizada q.s.p. 300ml. Acertar o pH para 8,3. Armazenar a 4C.

56

6.20.3- Colorao pelo mtodo da prata

Soluo fixadora: 50ml de metanol, 12ml de cido actico, gua deionizada q.s.p. 100ml.

Soluo de lavagem: 50ml de etanol e gua deionizada q.s.p. 100ml.

Soluo de tratamento: tiossulfato de sdio diludo em gua na concentrao de 0,4g/l.

Soluo de impregnao: 0,1g de prata, 75l de formaldedo e gua deionizada q.s.p. 100ml.

Soluo de desenvolvimento: 6g de carbonato de clcio, 50l de formaldedo, 2ml da soluo de pr-tratamento e gua deionizada q.s.p. 100ml. Preparar a soluo no momento do uso.

Soluo de parada: 50ml de etanol, 12ml de cido actico e gua deionizada q.s.p. 100ml.

57

7- Resultados 7.1- Varredura dos clones provenientes das excises em largaescala

Neste trabalho, realizou-se a varredura de aproximadamente 500 clones provenientes de excises em massa de trs diferentes sub-bibliotecas. Para a realizao da varredura utilizou-se a tcnica de ELISA (Enzyme Linked Imunosorbent Assay) conforme descrito em materiais e mtodos. O anticorpo primrio foi obtido a partir da imunizao de coelhos com o veneno total da aranha Lasiodora sp. A reao foi revelada utilizando-se de o-fenilenodiamino (OPD). Um total de 43 clones mostrou-se positivo em dois ensaios imunolgicos. Dezenove clones apresentaram similaridade com toxinas, 2 clones apresentaram similaridade com outras protenas e 22 clones no apresentaram similaridade significativa com protenas depositadas no banco de dados quando suas seqncias nucleotdicas traduzidas foram submetidas a anlise pelo programa BlastP (tabela 1). A reao de seqenciamento dos insertos clonados nos plasmdeos e a posterior anlise de suas seqncias nucleotdicas revelou que alguns cDNAs apresentam similaridade com seqncias de protenas depositadas no GenBank, que vo desde peptdeos txicos como BsTx, ESTx, HwTx-II, Magi 7 e LpTx (1 e 2) das aranhas Brachypelma smithii, Eurypelma californicum, Selenocosmia huwena (atualmente conhecida como Ornithoctonus huwena), Macrothele gigas e Lasiodora parahibana, respectivamente, assim como similaridade com algumas protenas como a cadeia beta da hemoglobina de camundongo (Mus musculus). Todas as seqncias nucleotdicas dos clones que se mostraram positivos em dois ensaios imunolgicos de ELISA foram submetidas a anlises pelos programas Blastn, Blastx e BlastP (Basic Local Alignment Search Tool Altschul e cols., 1990 disponvel em http://www.ncbi.nlm.nih.gov). A anlise pelo Blastn foi realizada com o objetivo de se detectar a presena de seqncias de vetor de clonagem (vetor pBK-CMV). Aps a eliminao dessas seqncias, apenas a seqncia correspondente ao inserto clonado foi submetida anlise pelo Blastx, que compara uma determinada seqncia nucleotdica, traduzida em suas seis possveis janelas de leitura (frames), com seqncias depositadas no GenBank. A anlise inicial das 60

seqncias utilizando o programa BlastX faz-se necessria porque essa anlise permite a deteco de similaridades mesmo quando as seqncias nucleotdicas so de baixa qualidade. Aps a anlise pelo programa BlastX, as seqncias dos cDNAs foram traduzidas em suas seis possveis janelas de leitura utilizando o programa SIXFRAME (disponvel em http://workbench.sdsc.edu). As seqncias peptdicas obtidas a partir da traduo das seqncias de cDNAs dos clones positivos foram submetidas anlise pelo BlastP. A anlise pelo programa BlastP compara uma seqncia peptdica com outras seqncias depositadas no banco de dados de protenas. As seqncias peptdicas que apresentaram similaridades com toxinas de outras aranhas depositadas no banco de dados foram designadas pela sigla LTx (toxina de Lasiodora sp). Os clones cuja seqncia nucleotdica apresentou similaridades com outras protenas ou que no apresentou similaridades com protenas depositadas no GenBank mas apresentou pelo menos uma matriz aberta de leitura (ORF), foram designados pela sigla LsC (componente clonado da glndula de veneno de Lasiodora sp). A tabela 1 apresenta os resultados obtidos na varredura utilizando o teste de ELISA bem como o resultado da anlise de similaridade (BlastP).

61

Tabela 1: Resultados do teste de ELISA e similaridade utilizando o programa BlastP.


Clone 1 a 15* Similar a BsTx ESTx LpTx1/LpTx2 HwTxI/HwTxII 16 a 19* 20 Magi 7 Cadeia -1 de hemoglobina Cadeia beta-2 de globina Hemoglobina quimrica humano/camundongo(zeta 2/beta 2) CG7580-PA Identidade 80% 80% 95-100% 69% 32% 98% 92% 100% 62% Drosophila melanogaster Anopheles gambiae Mus musculus Organismo Brachypelma smithii Eurypelma californicum Lasiodora parahibana Selenocosmia huwena Macrothele gigas Mus musculus Rattus norvegicus Referncias Kaiser e cols., 1994 Savel-Niemann e cols., 1989 Escoubas e cols., 1997 Shu & Liang, 1999 Satake e cols., 2004

21

Protena agCP10691 58% Protena Qpc-pending 46% Sem similaridade 22 a 43 significativa * Clones 1-12, 13, 14-15 e 16-19 correspondem, respectivamente, s toxinas LTx1, LTx2, LTx3 e LTx5.

7.2- Anlise das seqncias nucleotdicas dos cDNAs dos clones que apresentaram similaridade com toxinas de aranhas

Dos 19 clones que apresentaram similaridade com peptdeos txicos de outras aranhas, 15 codificam toxinas pertencentes a uma mesma famlia (LTx1, LTx2 e LTx3), sendo que 12 clones codificam a mesma toxina, denominada nesse trabalho LTx1. O clone que codifica a toxina LTx2 foi encontrado apenas uma vez e dois clones encontrados codificam a toxina LTx3. A anlise das seqncias dos cDNAs desses 15 clones (utilizando o programa SignalP disponvel em http://www.cbs.dtu.dk/services/signalp/) revelou a presena de um peptdeo sinal, um peptdeo intermedirio e um peptdeo maduro respectivamente por 23, 27 e 49 resduos de aminocidos. A figura 10 apresenta apenas as seqncias nucleotdicas alinhadas dos cDNAs que codificam para as toxinas LTx1, LTx2 e LTx3. compostos

62

LTx1 LTx2 LTx3

LTx1 LTx2 LTx3

LTx1 LTx2 LTx3

LTx1 LTx2 LTx3

LTx1 LTx2 LTx3

LTx1 LTx2 LTx3

LTx1 LTx2 LTx3

LTx1 LTx2 LTx3

LTx1 LTx2 LTx3

LTx1 LTx2 LTx3

1 60 ggcaccag------c------------------ttcgtagtatctgaactt-caggagaa ggcaccag------cgcaaatagcagatttcattccgtagtatctgaactt-caggagaa ggcacgagtattttcgcaaataccgagatttcattcgtagtatctgaactttcaggagaa ***** ** * * **************** ******** 61 120 tttcaagcaaaagATGAGATCTTTGACGTTGGCTGCTCTTCTGCTATGCAGCTTGCTGTT tttcaagcaaaagATGAGATCTTTGACGTTGGCTGCTCTTCTGCTATGCAGCTTGCTGTT tttcaagcaaaagATGAGATCTTTGACGTTGGCTGCTCTTCTGCTATGCAGCTTGCTGTT *************...******************************************** 121 180 AGTTTTTCACACTTCAGCAGCTGCAGAGCTTGAAGCTCAGGAAGGCCATCTGATGATCCC AGTTTTTCACACTTCAGCAGCTGAAGAGCTTCAAGCTCAGGAAGGCCATCTGATGATCCC AGTTTTTCACACTTCAGCAGCTGCAGAGCTTGAAGCTCAGGAAGGCCATCTGATGATCCC *********************** ******* **************************** 181 240 CGGTGATACTGACACCGCCCTAGAAACTGTCGATGATGAAAGATTTTTCGAATGTACTTT CGGTGATACTGACACCGCACTAGAAACTGTCGATGATGAAAGACTTTTCGAATGTACTTT CGGTGATACTGACACCGCCCTAGAAACTGTCGATGATGAAAGATTTTTCGAATGTACTTT ****************** ************************ **************** 241 300 TGAATGCGACATTAAAAAAGAAGGCAAACCATGCAAACCCAAGGGATGCAAGTGTAAGGA TGAATGCGACATTAAAAAAGAAGGCAAACCATGCAAACCCAAGGGATGCAAGTGTGACGA TGAATGCGACATTAAAAAAGAAGGCAAACCATGCAAACCCAAGGGATGCAAGTGTGACGA ******************************************************* * ** 301 360 CAAGGATAACAAGGATCACAAGAAATGTTCTGGTGGATGGAGATGTAAGCTCAAGCTCTG CAAGGATAACAAGGATCACAAGAAATGTTCTGGTGGATGGAGATGTAAGCTCAAGCTCTG CAAGGATAACAAGGATCACAAGAAATGTTCTGGTGGATGGAGATGTAAGCTCAAGCTCTG ************************************************************ 361 420 TTTGAAGTTTtagtatgaaaactggccaggtgctgccatcactacgagaaaactcaccat TTTGAAGATTtagtatgaaaactggccaggtgctgccatcactacgagaaaactcaccat TTTGAAGTTTtagtatgaaaactggccaggtgctgccatcactacgagaaaactcaccat ******* **************************************************** 421 480 aacatgcacacgaagagctattcttggtgatgctgtagcaaatgtattaacatgttagcc aacatgcacacgaagagctattcttggtgatggtgtagcaaatgtattaacatgttagcc aacatgcacacgaagagctattcttggtgatgctgtagcaaatgtattaacatgttagcc ******************************** *************************** 481 540 agaaatgttgtttgaattatattatgtatctgaaaaatcgttaataaaatagtttcaacagaaatgttgtttgaattatattatgtatctgaaaaatcgttaataaaatagtttcaacagaaatgttgtttgaattatattatgtttctgaaaaatcgttaataaaatagtttcaaca *************************** **************.......********** 541 570 ctttcaaaaaaaaaaaa ctttcaaaaaaaaaaaa ctttcaaaaaaaaaaaa *****************

Figura 10: Alinhamento dos cDNAs dos clones que apresentaram similaridade com toxinas de aranhas S. huwena, E. californicum, B. smithi e Lasiodora parahibana. As regies 5 e 3 no codificantes so mostradas em letras minsculas. Em vermelho aparece a seqncia que codifica para o peptdeo sinal seguida da seqncia codificante do peptdeo intermedirio (verde). A seqncia nucleotdica correspondente regio da toxina madura mostrada em azul, enquanto o cdon de parada mostrado em rosa. O cdon de iniciao e o sinal de poliadenilao esto indicados por pontos (.). Asteriscos (*) indicam regies consenso a todas as seqncias.

63

7.2.1- Traduo dos cDNAs que codificam para as toxinas LTx1, LTx2 e LTx3

A figura 11 mostra a traduo das seqncias nucleotdicas dos cDNAs que codificam para as toxinas LTx1, LTx2 e LTx3. As regies das seqncias nucleotdicas destacadas em vermelho, verde e azul, codificam para o peptdeo sinal, peptdeo intermedirio e toxina madura, respectivamente. A traduo das seqncias nucleotdicas foi obtida pelo programa SIXFRAME (http://workbench.sdsc.edu).

64

Toxina LTx1
ATG M TTT F ATC I TTC F CCC P TCT S AGA R CAC H CCC P GAA E AAG K GGT G TCT S ACT T GGT G TGT C GGA G GGA G TTG L TCA S GAT D ACT T TGC C TGG W ACG T GCA A ACT T TTT F AAG K AGA R TTG L GCT A GAC D GAA E TGT C TGT C GCT A GCA A ACC T TGC C AAG K AAG K GCT A GAG E GCA A GAC D GAC D CTC L CTT L CTT L CTA L ATT I AAG K AAG K CTG L GAA E GAA E AAA K GAT D CTC L CTA L GCT A ACT T AAA K AAC N TGT C TGC C CAG Q GTC V GAA E AAG K TTG L AGC S GAA E GAT D GGC G GAT D AAG K TTG L GGC G GAT D AAA K CAC H TTT F CTG L CAT H GAA E CCA P AAG K TTA L CTG L AGA R TGC C AAA K GTT V ATG M TTT F AAA K TGT C

Toxina LTx2
ATG M TTT F ATC I TTC F CCC P TCT S AGA R CAC H CCC P GAA E AAG K GGT G TCT S ACT T GGT G TGT C GGA G GGA G TTG L TCA S GAT D ACT T TGC C TGG W ACG T GCA A ACT T TTT F AAG K AGA R TTG L GCT A GAC D GAA E TGT C TGT C GCT A GAA E ACC T TGC C GAC D AAG K GCT A GAG E GCC A GAC D GAC D CTC L CTT L CTT L CTA L ATT I AAG K AAG K CTG L CAA Q GAA E AAA K GAT D CTC L CTA L GCT A ACT T AAA K AAC N TGT C TGC C CAG Q GTC V GAA E AAG K TTG L AGC S GAA E GAT D GGC G GAT D AAG K TTG L GGC G GAT D AAA K CAC H ATT I CTG L CAT H GAA E CCA P AAG K TTA L CTG L AGA T TGC C AAA K GTT V ATG M CTT L AAA K TGT C

Toxina LTx3
ATG M TTT F ATC I TTC F CCC P TCT S AGA R CAC H CCC P GAA E AAG K GGT G TCT S ACT T GGT G TGT C GGA G GGA G TTG L TCA S GAT D ACT T TGC C TGG W ACG T GCA A ACT T TTT F AAG K AGA R TTG L GCT A GAC D GAA E TGT C TGT C GCT A GCA A ACC T TGC C GAC D AAG K GCT A GAG E GCC A GAC D GAC D CTC L CTT L CTT L CTA L ATT I AAG K AAG K CTG L CAA Q GAA E AAA K GAT D CTC L CTA L GCT A ACT T AAA K AAC N TGT C TGC C CAG Q GTC V GAA E AAG K TTG L AGC S GAA E GAT D GGC G GAT D AAG K TTG L GGC G GAT D AAA K CAC H TTT F CTG L CAT H GAA E CCA P AAG K TTA L CTG L AGA R TGC C AAA K GTT V ATG M TTT F AAA K TGT C

Figura 11: Traduo das seqncias nucleotdicas que codificam para as toxinas LTx1, LTx2 e LTx3 utilizando-se o programa SIXFRAME. A seqncia correspondente ao peptdeo sinal, peptdeo intermedirio e toxina madura so mostrados em vermelho, verde e azul, respectivamente.

65

7.2.2- Anlise estrutural das toxinas LTx1, LTx2 e LTx3


A figura 12 mostra o grfico gerado pela anlise das seqncias peptdicas das toxinas maduras de LTx1, LTx2 e LTx3 no programa SignalP, que prediz o stio de clivagem de peptdeos sinal. A figura 13 mostra o grfico de hidropaticidade bem como o alinhamento das seqncias peptdicas das regies correspondentes ao peptdeo sinal (vermelho), peptdeo intermedirio (verde) e protena madura (azul) das toxinas LTx1, LTx2 e LTx3 encontradas neste trabalho. O grfico de hidropaticidade gerado pela anlise das seqncias peptdicas das trs toxinas, quando submetidas ao programa ProtScale (disponvel em http://www.cbs.dtu.dk/services/signalp/), revelou uma regio inicial da seqncia composta predominantemente por aminocidos hidrofbicos, caracterstica de peptdeos sinal, comum em toxinas. A regio do peptdeo intermedirio rica em aminocidos hidroflicos e concentra a maior parte dos resduos de glutamato (E) do prpeptdeo. A toxina madura apresenta um perfil predominantemente hidroflico.

66

Figura 12: Predio do ponto de clivagem entre os peptdeos sinal e peptdeo intermedirio na seqncia dos precursores das toxinas LTx1, LTx2 e LTx3. O pico em vermelho indica o ponto de clivagem entre os peptdeos sinal e intermedirio (SAA-AE). O pico em azul escuro indica o carter hidrofbico comum aos peptdeos sinal. Os picos verde e azul claro indicam as regies N- e Cterminais do peptdeo sinal, respectivamente.

67

Peptdeo sinal
MRSLTLAALLLCSLLLVFHTSAA MRSLTLAALLLCSLLLVFHTSAA MRSLTLAALLLCSLLLVFHTSAA ---------23-----------

Peptdeo intermedirio

Toxina madura
FFECTFECDIKKEGKPCKPKGCKCKDKDNKDHKKCSGGWRCKLKLCLKF LFECTFECDIKKEGKPCKPKGCKCDDKDNKDHKKCSGGWRCKLKLCLKI FFECTFECDIKKEGKPCKPKGCKCDDKDNKDHKKCSGGWRCKLKLCLKF -----------------------49------------------------

AELEAQEGHLMIPGDTDTALETVDDER EELQAQEGHLMIPGDTDTALETVDDER AELQAQEGHLMIPGDTDTALETVDDER ------------27-------------

Figura 13: Grfico de hidropaticidade das seqncias de aminocidos traduzidas a partir dos cDNAs dos clones que codificam os precursores das toxinas LTx1, LTx2 e LTx3. Neste grfico esto representados o peptdeo sinal hidrofbico (23 aminocidos), o peptdeo intermedirio (27 aminocidos) e a toxina madura (49 aminocidos). As regies acima e abaixo do ponto 0 (seta vermelha) indicam a presena de aminocidos com caractersticas hidrofbicas e hidroflicas, respectivamente.

68

7.2.3- Alinhamento das seqncias peptdicas das toxinas das aranhas Lasiodora sp (LTx1, LTx2, LTx3), E. Californicum (ESTx), B. smithii (BsTx), L. parahybana (LpTx1 e LpTx2)

A figura 14 mostra o alinhamento das seqncias peptdicas das toxinas da aranha Lasiodora sp (LTx1, LTx2 e LTx3) com toxinas das aranhas E. Californicum (ESTx), B. smithii (BsTx), e L. parahybana (LpTx1 e LpTx2).

LTx1 LTx2 LTx3 LpTx1 LpTx2 ESTX BsTx

FFECTFECDIKKEGKPCKPKGCKCKDKDNKDHKKCSGGWRCKLKLCLKF LFECTFECDIKKEGKPCKPKGCKCDDKDNKDHKKCSGGWRCKLKLCLKI FFECTFECDIKKEGKPCKPKGCKCDDKDNKDHKKCSGGWRCKLKLCLKF FFECTFECDIKKEGKPCKPKGCKCKDKDNKDHKKCSGGWRCKLKLCLKF FFECTLECDIKKEGKPCKPKGCKCNDKDNKDHKKCSGGWRCKLKLCLKF IFECVFSCDIEKEGKPCKPKG----------EKKCSGGWKCKIKLCLKI IFECVFSCDIEKEGKPCKPKG----------EKKCSGGWKCKIKLCLKI

Figura 14: Alinhamento das seqncias de aminocidos das toxinas das aranhas Lasiodora sp (LTx1, LTx2 e LTx3), E. Californicum (ESTx), B. smithii (BsTx), e L. parahybana (LpTx1 e LpTx2). Os resduos completamente conservados entre as seqncias so mostrados em azul. Em verde so mostrados os resduos altamente conservados enquanto aqueles pouco conservados so apresentados em vermelho. Em preto mostrada uma regio onde no h consenso com as seqncias dos peptdeos ESTx e BsTx.

69

7.2.4- Alinhamento das seqncias peptdicas completas das toxinas LTx1, LTx2, LTx3 e HwTx-II (Ile)
A figura 15 mostra o alinhamento das seqncias peptdicas das toxinas da aranha Lasiodora sp (LTx1, LTx2 e LTx3) com uma toxina composta por 37 resduos de aminocidos, com atividade inseticida, encontrada na glndula de veneno da aranha Selenocosmia huwena.

LTx1 LTx2 LTx3 HwTx-II

FFECTFECDIKKEG-KPCKPKGCKCKDKDNKDHKKCSGGWRCKLKLCLKF LFECTFECDIKKEG-KPCKPKGCKCDDKDNKDHKKCSGGWRCKLKLCLKI FFECTFECDIKKEG-KPCKPKGCKCDDKDNKDHKKCSGGWRCKLKLCLKF LFECSFSCEIEKEGDKPCK-------------KKKCKGGWKCKFNMCVKV

Figura 15: Alinhamento das seqncias de aminocidos das toxinas das aranhas Lasiodora sp (LTx1, LTx2 e LTx3) e Selenocosmia huwena (HwTx-II). Os resduos completamente conservados entre as seqncias so mostrados em azul. Em verde so mostrados os resduos altamente conservados enquanto aqueles pouco conservados so apresentados em vermelho. Em preto so mostradas as regies onde no h consenso com a seqncia do peptdeo HwTx-II.

70

7.3- Clonagem das toxinas LTx1 e LTx3 em PCR 2.1-TOPO TA Cloning Invitrogen

Com o objetivo de facilitar a clonagem dos fragmentos que codificam as toxinas LTx1 e LTx3 no vetor de expresso pET-11a Novagen, os fragmentos obtidos por PCR utilizando iniciadores contendo os stios de restrio Nde I e Bam H I foram primeiramente clonados em vetor PCR 2.1-TOPO TA Cloning Invitrogen. Essa estratgia faz-se necessria devido dificuldade apresentada por varias enzimas de restrio, por exemplo Nde I, em digerir stios localizados nas extremidades de fragmentos de PCR. A figura 16 mostra o produto da amplificao dos fragmentos correspondentes s toxinas maduras LTx1 e LTx3 clonadas em vetor PCR 2.1-TOPO TA Cloning Invitrogen. As amostras foram submetidas eletroforese em gel de poliacrilamida 6%. Na canaleta 1, aplicou-se 6l de padro de peso molecular 1kb da Invitrogen. Nas canaletas (2 e 3) e (4 e 5), so apresentados os produtos de PCR (aproximadamente 350pb) dos fragmentos que codificam para a toxina LTx1 e LTx3, respectivamente.

71

Canaletas
1 2 3 4 5

400pb 300pb 200pb

100pb

Figura 16: PAGE dos produtos de PCR de colnias obtidas na transformao de clulas de E. coli linhagem TOP 10 F com os produtos das ligaes das seqncias codificantes para as toxinas LTx1 e LTx3 com o vetor PCR 2.1-TOPO. Canaleta 1: Padro 1Kb DNA. Canaletas 2 e 3: LTx1. Canaletas 4 e 5: LTx3.

72

7.4- Clonagem das toxinas LTx1 e LTx3 no vetor de expresso pET-11a

Aps a digesto de DNAs extrados dos clones obtidos com o sistema PCR 2.1TOPO, com as enzimas de restrio Nde I e BamH I, os fragmentos que codificam as toxinas LTx1 e LTx3 foram purificadas como descrito em Materiais e Mtodos. Procedeuse ento a clonagem no vetor de expresso pET-11a. As colnias selecionadas na

transformao foram submetidas a uma PCR para verificar a presena do fragmento clonado (Figura 17). O produto de amplificao correspondente clonagem das toxinas LTx1 e LTx3 no vetor pET-11a de aproximadamente 240 pb (canaletas 2 e 3).

73

400pb 300pb 200pb

100pb

Figura 17: PAGE dos produtos de PCR de colnias obtidas na transformao de clulas de E. coli linhagem TOP 10 F com produto de clonagem das seqncias codificantes para LTx1 e LTx3 no vetor de expresso pET-11a (canaletas 2 e 3). Na canaleta 4 foi aplicado o produto de amplificao do vetor pET-11a vazio.

74

7.5- Induo da toxina LTx1 recombinante


Aps a expresso da toxina LTx1 recombinante em diferentes tempos de induo (1, 2, 3, 4 e 5 horas) como descrito em materiais e mtodos (6.16), os extratos celulares foram submetidos eletroforese em gel SDS-PAGE. A anlise da expresso de LTx1 revelou uma induo basal (tempo 0) e um tempo timo de induo em torno de 5 horas aps a adio de IPTG 0.6mM (concentrao final) e incubao a 30C (200 rpm) (Figura 18). Alquotas de aproximadamente 20g de protenas provenientes do veneno bruto, da frao solvel e da frao insolvel (corpos de incluso) foram submetidas eletroforese em gel SDS-PAGE. As protenas presentes no gel foram transferidas para uma membrana de nylon e analisadas por western bloting usando o antisoro contra veneno total como anticorpo primrio. A figura 19 mostra o reconhecimento de protenas do veneno bruto de Lasiodora sp (canaleta 1) e da toxina LTx1 recombinante (canaletas 2). Como pode ser observado, a toxina LTx1 recombinante foi encontrada, sobretudo na frao solvel, sugerindo que no h formao de corpos de incluso uma vez que no foi observada a presena mensurvel de LTx1 no precipitado da sonicao (canaleta 3).

75

Tempos de Induo (h)


0 1 2 3 4 5

LTx1

Figura 18: Gel SDS-PAGE da induo da expresso de LTx1 recombinante. Os tempos de induo so indicados acima de cada canaleta. A toxina LTx1 recombinante est indicada pela seta. Uma induo basal pode ser observada (0 hora de induo).

76

Canaletas
1 2 3

Figura 19: Western Bloting da toxina LTx1 recombinante. Uma frao do veneno bruto e as eluies de LTx1 (sobrenadante e corpos de incluso) foram aplicados nas canaletas 1, 2 e 3, respectivamente. A toxina LTx1 recombinante, presente no sobrenadante est indicada pela seta.

77

7.6- Anlise da seqncia nucleotdica dos cDNAs dos clones (1619) que apresentaram similaridade com a toxina Magi 7 da aranha Macrothele gigas
Dos 19 clones que apresentaram similaridades com toxinas de outras aranhas, 4 apresentaram similaridade com o peptdeo precursor da toxina Magi 7, descrito por Satake e cols. (2004), composto por 124 resduos de aminocidos, presente na glndula de veneno da aranha Macrothele gigas. O cDNA dos 4 quatro clones que apresentaram similaridade com o precursor da toxina Magi 7 foi traduzido no frame +2 (utilizando o programa SIXFRAME) e originou uma janela aberta de leitura que codifica 116 resduos de aminocidos (Figura 20). A figura 21 mostra o alinhamento do peptdeo precursor de LTx5 com o peptdeo precursor de Magi 7. O novo peptdeo encontrado foi designado pela sigla LTx5. A anlise do peptdeo LTx5 pelo programa SignalP (disponvel em http://www.cbs.dtu.dk/services/signalp/) revelou a existncia de um peptdeo sinal composto por 17 resduos de aminocidos, com o stio de clivagem entre o peptdeo sinal e o peptdeo intermedirio localizado entre os aminocidos das posies 17 e 18 (AVA-TW) (Figura 22). O peptdeo intermedirio apresenta 28 resduos de aminocidos, com o ponto de clivagem localizado no resduo de arginina (R) da posio 45 (Arg45). A anlise do peptdeo LTx5 pelo programa BlastP revelou 32 % de similaridade com o peptdeo precursor da toxina Magi 7. A figura 21 mostra o alinhamento das seqncias peptdicas de Magi 7 e LTx5 obtido na anlise pelo programa ClustalW. A figura 23 mostra o perfil de hidropaticidade bem como as regies correspondentes ao peptdeo sinal (vermelho), peptdeo intermedirio (verde) e protena madura (azul) da toxina LTx5. O grfico de hidropaticidade gerado pela anlise da seqncia peptdica da toxinas LTx5 quando submetida ao programa ProtScale (disponvel em

http://www.cbs.dtu.dk/services/protscale/) revelou caractersticas similares s seqncias LTx1, LTx2 e LTx3, isto , uma regio inicial composta predominantemente por aminocidos hidrofbicos, uma regio rica em aminocidos hidroflicos e concentrando grande parte dos resduos de glutamato. A toxina madura apresenta um perfil predominantemente hidroflico.

78

gaattcggcacgagcagaaacaaatattgctggaatttcactcaagATG AAG CTG AGC ACT TTT ATC M K L S T F I ATA ATG ATA AGT CTG GCT GTG GCC GTT GCT ACC TGG CCT TCA GAG CAC ATT GAA I M I S L A V A V A T W P S E H I E GGA AGT GAT TCT GAA ACC AAA CTG AAT GTG GAA CTC GGG CCA TAT GCA TTA GCT G S D S E T K L N V E L G P Y A L A GAT CGT GCA GAA AAG GGA AAA AAG GAC TCC CTT AAC AAA GGA GAG CCA TGC CAA D R A E K G K K D S L N K G E P C Q TTT CAT TGC GAG TGT CGT GGT GCT AGT GTT CTC TGC GAA GCT GTT TAT GGA ACA F H C E C R G A S V L C E A V Y G T AGA AGT CCG ATG TAT AAA TGC ATG ATC AAA AGA TTA CCT ATT TCG GTA TTG GAC R S P M Y K C M I K P L P I S V L D ATA ATG TAT CAG GCA GAG CGT GCT TTA GAA AAA CTT GCT TCT TCA TTT CGG TGT I M Y Q A E R A L E K L A S S F R C GAGTAAataaggttaactcgttcagggcaacgaatgactgaatgttacataacaatgcataatacttctgtaa E * aatctgtattggcaaaagaattcgtttagaaaaaaacaataaagcgagatatatgcagaaaaaaaaactcgag

Figura 20: Traduo do cDNA que codifica a toxina LTx5. As regies 5 e 3 no traduzidas so mostradas em letras minsculas enquanto a regio codificante aparece em maisculas. As regies que codificam para os peptdeos sinal, intermedirio e maduro so mostrados em vermelho, verde e azul, respectivamente.

Magi_7 LTx5 Magi_7 LTx5 Magi_7 LTx5

MKLSALVFVASVMLVAASPVKDVEEPVETHLAADLKTIEELAKYEEAAVQKRSCIVGSKN MKLSTFIIMISLAVAVATWPSEHIEGSD----SETKLNVELGPYALADRAEK-GKKDSLN IGETCVASCQCCGATVRCIGEGTKGICNNYQTNNILGQILLYAKDTVVNTAGLLVCAQDL KGEPCQFHCECRGASVLCEAVYGT---RSPMYKCMIKRLPISVLDIMYQAERALEKLASS SEYE FRCE

Figura 21: Alinhamento das seqncias peptdicas dos pr-peptdeos Magi 7 (Macrothele gigas) e LTx5 (Lasiodora sp). Os resduos completamente conservados entre as seqncias so mostrados em azul. Em verde so mostrados os resduos altamente conservados enquanto aqueles pouco conservados so apresentados em vermelho. Em preto so mostradas as regies onde no h consenso com a seqncia do peptdeo.

79

Figura 22: Predio do ponto de clivagem entre os peptdeos sinal e intermedirio na seqncia do precursor da toxina LTx5. O pico em vermelho indica o ponto de clivagem entre os peptdeos sinal e intermedirio (AVA-TW). O pico em azul escuro indica o carter hidrofbico comum aos peptdeos sinais. Os picos verde e azul claro indicam as regies N- e C-terminais do peptdeo sinal, respectivamente.

80

Peptdeo Sinal
MKLSTFIIMI SLAVAVA ----17----

Peptdeo Intermedirio
TWPSEHIEGSDSETK LNVELGPYALADR ------28------

Toxina Madura
AEKGKKDSLNKGEPCQFHCECRGASVLCEAVYGTRSPMYKCMIKRLPISVLDIMY QAERALEKLASSFRCE

------------------------71-----------------------

Figura 23: Grfico de hidropaticidade da seqncia de aminocidos traduzida a partir do cDNA dos clones que codificam o precursor da toxina LTx5. Neste grfico esto representados o peptdeo sinal hidrofbico (17 aminocidos), o peptdeo intermedirio (28 aminocidos) e a toxina madura (71 aminocidos). As regies acima e abaixo do ponto zero (seta vermelha) indicam a presena de aminocidos com caractersticas hidrofbicas e hidroflicas, respectivamente.

81

7.7- Anlise das seqncias que apresentaram similaridade com outras protenas depositadas no GenBank
Em uma primeira anlise (BlastN e BlastX apenas), dos 43 clones que apresentaram reao positiva no teste de ELISA 22 apresentaram similaridades com outras protenas depositadas no GenBank. Esses clones foram posteriormente analisados utilizando os programas SIXFRAME (workbench.sdsc.edu) e BlastP. A seguir so apresentadas as anlises apenas dos clones que apresentaram uma ou mais janelas de leitura abertas e cujo peptdeo codificado apresentou alguma similaridade com protenas depositadas no GenBank quando submetidos anlise pelo BlastP.

7.7.1- Anlise da seqncia do DNA complementar do clone 20

A seqncia do cDNA do clone 20 apresenta 629 pares de bases. Os stios de restrio Xho I e Eco RI so mostrados em vermelho. O cdon de iniciao e o de parada so mostrados em rosa e verde, respectivamente. A traduo do cDNA do clone 20 utilizando o programa SIXFRAME procedeu-se no frame +2 e originou uma protena composta por 109 aminocidos denominada LsC1, cuja seqncia mostrada a seguir. cDNA
GAATTCGGCACGAGCAGAAACAGACATCATGGTGCACCTGACTGATGCTGAGAAGGCTGCTGTCTCTGGC CTGTGGGGAAAGGTGAACGCCGATGAAGTTGGTGGTGAGGCCCTGGGCAGGCTGCTGGTTGTCTACCCTT GGACCCAGCGGTACTTTGATAGCTTTGGAGACCTATCCTCTGCCTCTGCTATCATGGGTAATGCCAAAGT GAAGGCCCATGGCAAGAAAGTGATAACTGCCTTTAACGATGGCCTGAATCACTTGGACAGCCTCAAGGGC ACCTTTGCCAGCCTCAGTGAGCTCCACTGTGACAAGCTGCATGTGGATCCTGAGAACTTCAGGCTCCTGG GCAAATGATCGTGATTGTGCTGGGCCACCACCTGGGCAAGGATTTCACCCCCGCTGCACAGGCTGCCTTC CAGAAGGTGGTGGCTGGAGTGGCCGCTGCCCTGGCTCACAAGTACCACTAAACCCCCTTTCCTGCTCTTG CCTGTGAACAATGGTTAATTGTTCCCAAGAGAGCATCTGTCAGTTGTTGGCAAAATGATAAAGACATTTG AAAATCTGTCTTCTGACAAATAAAAAGCATTTATTTCACTGCAAAAAAAAAAAAAAAAAAAAACTCGAG

82

LsC1
MVHLTDAEKA AVSGLWGKVN ADEVGGEALG RLLVVYPWTQ RYFDSFGDLS SASAIMGNAK VKAHGKKVIT AFNDGLNHLD SLKGTFASLS ELHCDKLHVD PENFRLLGK

A anlise da seqncia do cDNA do clone 20 revelou alta similaridade (98%) com a cadeia -1 da hemoglobina do camundongo pertencente espcie Mus musculus. A cadeia -1 possui 146 aminocidos. Uma elevada similaridade (92%) com a cadeia -2 da globina do camundongo Rattus norvegicus tambm foi detectada. Esta cadeia apresenta 147 resduos de aminocidos. A seqncia do cDNA do clone 20 apresentou uma terceira similaridade (100%) com uma hemoglobina quimrica humano/camundongo (cadeias zeta 2/beta 2) de 146 aminocidos. A figura 24 mostra o alinhamento da seqncia peptdica codificada pelo cDNA do clone 20 com as protenas com as quais apresentou similaridade.

(a)

Cadeia -1 da hemoglobina do camundongo Mus musculus

Score = 210 bits (535), Expect = 3e-54 Identities = 106/108 (98%), Positives = 107/108 (99%)

Query:1 Sbjct:1

MVHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAK 60 MVHLTDAEKAAVS LWGKVN+DEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAK MVHLTDAEKAAVSCLWGKVNSDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAK 60

Query:61 VKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLG 108 VKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLG Sbjct:61 VKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLG 108

Query: clone 20 Sbjct: -1 hemoglobina

83

(b)

Cadeia beta-2 da globina do camundongo Rattus norvegicus Score = 202 bits (515), Expect = 7e-52 Identities = 100/108 (92%), Positives = 103/108 (95%)
Query: 1 Sbjct: 1 MVHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAK 60 MVHLTDAEKAAV+GLWGKVN D+VGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGN K MVHLTDAEKAAVNGLWGKVNPDDVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPK 60

Query: 61 VKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLG 108 VKAHGKKVI AFNDGL HLD+LKGTFA LSELHCDKLHVDPENFRLLG Sbjct: 61 VKAHGKKVINAFNDGLKHLDNLKGTFAHLSELHCDKLHVDPENFRLLG 108

Query: clone 20 Sbjct: -2 globina

(c)

Hemoglobina quimrica humano/camundongo(zeta 2/beta 2)

Score = 211 bits (537), Expect = 2e-54 Identities = 107/107 (100%), Positives = 107/107 (100%)
Query: 2 VHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKV 61 VHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKV Sbjct: 1 VHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKV 60 Query:62 KAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLG 108 KAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLG Sbjct:61 KAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLG 107

Query: clone 20 Sbjct: Hemoglobina quimerica

Figura 24: Alinhamento da seqncia peptdica codificada pelo cDNA do clone 20 com a cadeia -1 da hemoglobina de Mus musculus (a), cadeia -2 da globina de Rattus norvegicus (b) e hemoglobina quimrica humano/camundongo (zeta 2/beta 2) (c). Os resduos altamente conservados so mostrados em azul enquanto os grupos fortemente conservados aparecem em verde. Em preto so mostrados resduos que no apresentam consenso.

7.7.2. Anlise da seqncia do DNA complementar do clone 21

84

A seqncia do cDNA do clone 21 apresenta 434 pares de bases. Os stios de restrio Xho I e Eco RI so mostrados em vermelho. Os cdons de iniciao e parada so mostrados em rosa e verde, respectivamente. A traduo do cDNA do clone 21 realizada pelo programa SIXFRAME procedeu-se no frame +2 e originou uma protena de 82 aminocidos denominada LsC2, cuja seqncia mostrada a seguir.

cDNA
GAATTCGGCACGAGTGATTTAGTTGTTCCGATCGGGAAGTACTGGAATAAAGGAAGCAATGGGTAAACAG TTTGGACAGCTAGCAAAAATGAGGGGCATTGTACAATTCAGAATATCACCGTATGAGCAAAATCCACTTG CTGGAATAATTTCTAAAGGGTTTCCAAATATGATTCGACGTATTCGTTCCAATATATTTTCCATGGCTCC ACCATTTGTCCTTGGATATCTCGTTTATGATTGGACTGAAAAAGAACATGCCCGTCTGCAGAGGAAGAAC CCAGCTGATTATGCAAATGATGAATGAATGATATTTGTTTACATAGAAAATTCTGTAGTTCAGTTATTCT GTACATTTTTGTAGTTCATTATTGAAATAAATATAAGAAAAATAAAGAAGTGATTCTGGTTTCTAAAAAA AAAAAAAACTCGAG

LsC2 MGKQFGQLAK PPFVLGYLVY MRGIVQFRIS DWTEKEHARL PYEQNPLAGI ISKGFPNMIR QRKNPADYANDE RIRSNIFSMA

A anlise da seqncia do cDNA do clone 21 apresentou uma similaridade de 62% com uma protena de 89 aminocidos da mosca Drosophila melanogaster, denominada CG7580-PA. Uma similaridade menor (58%) foi verificada entre o peptdeo codificado pelo cDNA do clone 21 e uma protena de 88 aminocidos do mosquito Anopheles gambiae, denominada agCP10691. A seqncia do cDNA do clone 21 apresentou uma terceira similaridade (46%) com uma protena de 88 aminocidos denominada Qpc-pending do camundongo Mus musculus.

A figura 25 mostra o alinhamento da seqncia peptdica codificada pelo cDNA do clone 21 com as protenas com as quais apresentou similaridade.

85

(a) Protena CG7580-PA da mosca Drosophila melanogaster

Score = 115 bits (289), Expect = 1e-25 Identities = 51/81 (62%), Positives = 65/81 (80%)
Query: 2 Sbjct: 9 GKQFGQLAKMRGIVQFRISPYEQNPLAGIISKGFPNMIRRIRSNIFSMAPPFVLGYLVYD 61 G+ FG LAK+ GIV +++SP+EQ AG ISKG PNM+RR RSN+F + PPF++GYL+YD GQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFRSNVFIVTPPFIVGYLIYD 68

Query: 62 WTEKEHARLQRKNPADYANDE 82 TE++H L RKNPADYANDE Sbjct: 69 LTERKHTALLRKNPADYANDE 89

Query: clone 21 Sbjct: CG7580-PA

(b) Protena agCP10691 do mosquito Anopheles gambiae Score = 103 bits (257), Expect = 6e-22 Identities = 47/81 (58%), Positives = 63/81 (77%)

Query: 1 Sbjct: 7

MGKQFGQLAKMRGIVQFRISPYEQNPLAGIISKGFPNMIRRIRSNIFSMAPPFVLGYLVY 60 MG FG+LAK+RGIV +ISP+EQ A +ISKG PN +RRIRS +F +APPFV+GY+VY MGHGFGELAKVRGIVTHKISPFEQRAFANVISKGVPNTLRRIRSQVFIVAPPFVMGYMVY 66

Query: 61 DWTEKEHARLQRKNPADYAND 81 ++ E H ++ RKNPA++ ND Sbjct: 67 NYIENLHTQMNRKNPAEFEND 87

Query: clone 21 Sbjct: agCP10691

(c)

Protena Qpc-pending do camundongo Mus musculus

86

Score = 84.0 bits (206), Expect = 4e-16 Identities = 38/82 (46%), Positives = 56/82 (68%)
MGKQFGQLAKMRGIVQFRISPYEQNPLAGIISKGFPNMIRRIRSNIFSMAPPFVLGYLVY 60 MG++FG LA++R ++ + +SP+EQ SKG PN++RR R I +APPFV+ YL+Y MGREFGNLARIRHVISYSLSPFEQRAFPSYFSKGIPNVLRRTRERILRVAPPFVVVYLIY 60

Query: 1 Sbjct: 1

Query: 61 DWTEKEHARLQRKNPADYANDE 82 W +E + +RKNPA Y ND+ Sbjct: 61 TWGNQEFEQSKRKNPAMYENDK 82

Query: clone 21 Sbjct: Qpc-pending

Figura 25: Alinhamento da seqncia peptdica codificada pelo cDNA do clone 21 com as protenas CG7580-PA da mosca Drosophila melanogaster (a), agCP10691 do mosquito Anopheles gambiae (b) e Qpc-pending do camundongo Mus musculus (c). Os resduos altamente conservados so mostrados em azul enquanto os grupos fortemente conservados aparecem em verde. Em preto so mostrados resduos onde no h consenso.

7.8- Anlise das seqncias dos clones que codificam para peptdeos que no apresentaram similaridades, quando submetidos anlise pelo BlastP

87

Dentre os clones que apresentaram alguma similaridade com protenas depositadas no GenBank, quando submetidos a uma anlise geral utilizando os programas BlastN e BlastX, alguns no apresentaram qualquer similaridade quando os peptdeos codificados por eles foram submetidos a uma anlise mais detalhada pelo BlastP. A seguir so apresentadas as anlises apenas dos clones que apresentaram uma ou mais janelas de leitura abertas (ORFs) e cujo peptdeo codificado no apresentou similaridade com protenas depositadas no GenBank quando submetidos anlise pelo BlastP.

7.8.1- Anlise da seqncia do DNA complementar do clone 22

88

A seqncia nucleotdica do clone 22 apresenta 1403 pares de bases. A traduo dessa seqncia utilizando o programa SIXFRAME revelou a existncia de uma janela de leitura no frame +2 (vermelho) e +3 (azul). A traduo nos frames +2 e +3 originou peptdeos compostos por 72 e 67 resduos de aminocidos, respectivamente.

cDNA
CCCCCTCTGTCTGGGGNTTGGCCCCACNNGGTTGTATGTGTGTGTCTNCTCGCCTCTGCCAATATGGCTG GTTGTCTNGCCGNTGGGGGNTTTTTTATCCGGCCGCGTGTTTGTGTTCCCTTNTGNTTCCGTTGTCCCGC GNTTTCCGTGTTGGGTTTGGTCCTTCATTGGGCCCCCCNGGCTTGTCCAAGTGTGTATACTTTCCGGCTN CGTTGATTNATTGTGGGGGGATTCTGTGATCCTGGGTTAACCCTATTGTTCNAGTCANCCAGGGGGCTCC GACTGTTTGACCCTTTGGNTTTACCGCCCCATANGCCTCGGGTAGTTNTAGCCCCGTNCACTTTATAGAG GGGANCCAANATAGGCCTGTGGGGATGGCTTNACAGGCGCCGCCCCATTGTCCAAGGGTTNGNACAACTT TAACGGTTGGGATTCCCNCAAAGTAATGTTCGGTGGGCAAACGGTGAGNCCAATGCTAACTCCCAAAATG TAATGTTGCGCCGTGGGGAAATTTTTCAACCGTCCAGAAGTATGTGATAGCTGGAGCCCAACTTTGTTAA TCAATTNAATTGGGATTACAGGNTCCATGGGTCTATGGTTGCCCNCAGTGTGTTGCGCTGTTACCCACTT GGGCCCATTCCTAANGGAAGGCCAACCAAGTTTTGGAAACGGGAAAAGTGCTGGCATNTTTCCTGGTAAA TNNACCCCATTGCCTGTGGGTAAATGGTTGTGGAAACCCTTCCGGGCGCGCCAATTAAATCGNGCCAATG TTAAGGCCCTTGGGTATTTCGTTGGCAGGNCATAAAAGGGGGGCACAAATAATAGGGTAACTTCCCNNNG TGNTGAACCACAAACAGGGTAGNGACCCAATGTCCCAAAAGTGTTCAATGTGGCGGGAANGTTGNTTCGT TGGGGTTGTCACTTAGGTGTTTCCTCCTTGCGGAAAGGCCGTGTTTNTATTGGGAAACAATGGAAAGGTT CCCGAATGGTTTANTAAAGTGCCAATTGGAATGCCACTAAAAGGAATGTTTACCCTATTTCGGGTATTTG GACATAAATGGTTAATCAGGCCAGAGCGTGGCCTTTAGTTAAACGTTGCCTTCGTTCAGTTTCGGCTGTG AGTANATTAAGGTTAACTCGTTCAGGGCATACGATATGACTGAATGTTACATAACNAAGTGCATAATACT TCTGTAAAATCTGTATTTGGCAAAAAGAATTCGCTTTAGATATTGGTACATATTATAGCCGAGATATATG CAATGATTTGGAAGCTGTGAGTAGTGATACTCGAGAGTACTTCTAGAGCGCCCGCGGGCCCATCGATTTT CCACCCGGGTGGGTTTACAGCTAAGTACCCTATTCGCCTATAGTGAACTCATGGATTCATGCACACGTTC NAA

LsC3a (Traduo no frame +2) MGLWLPXVCCAVTHLGPFLXEGQPSFGNGKSAGXFPGKXTPLPVGKWLWKPFRARQLNRAN VKALGYFVGRX LsC3b (Traduo no frame +3) MCVSXRLCQYGWLSXRWGXFYPAACLCSLXXPLSRXFRVGFGPSLGPPGLSKCVYFPAXLI XCGGIL A anlise da seqncia peptdica de LsC3a pelo programa SignalP revelou a provvel existncia de um stio de clivagem para peptdeo sinal (Figura 26). O carter hidrofbico do peptdeo sinal pode ser visto com maior clareza no grfico de

89

hidropaticidade gerado pelo programa ProtScale para a seqncia peptdica de LsC3a (Figura 27). A anlise da seqncia peptdica LsC3b pelo programa SignalP no revelou existncia de um provvel stio de clivagem para peptdeo sinal.

90

Figura 26: Predio do ponto de clivagem entre os peptdeos sinal e intermedirio na seqncia do peptdeo LsC3a. O pico em vermelho indica o ponto de clivagem do peptdeo sinal. O pico em azul escuro indica o carter hidrofbico comum aos peptdeos sinais. Os picos verde e azul claro indicam as regies N- e C-terminais do peptdeo sinal, respectivamente.

91

Figura 27: Grfico de hidropaticidade dos aminocidos traduzidos a partir do cDNA dos clones que codificam o precursor do componente clonado LsC3a. As regies acima e abaixo do ponto 0 (seta vermelha) indicam a presena de aminocidos com caractersticas hidrofbicas e hidroflicas, respectivamente. A regio inicial hidrofbica (~20 a.a.) sugere a existncia de um peptdeo sinal na seqncia peptdica de LsC3a.

92

7.8.2- Anlise da seqncia do DNA complementar do clone 23


A seqncia nucleotdica do clone 23 apresenta 722 pares de bases. A traduo da seqncia do cDNA do clone 23 utilizando o programa SIXFRAME revelou a existncia de uma janela de leitura no frame +1 (azul) e +2 (vermelho). A traduo nos frames +1 e +2 originou peptdeos compostos por 46 e 42 resduos de aminocidos, respectivamente. A anlise desses peptdeos pelo programa BlastP no revelou identidade com seqncias proticas depositadas no GenBank.

GAATTCGGCACCAGAGAAAGCTCAACTTGCAGTGCCCGGGAGGGGACAGCTGTTTTTGGAAAAATCCTCC GATGGTGAAATACCATGTCAAGTATATCTATGGAGAGTATGATCAATGTGTGGCCTTTACATGATGTAAA CCCTTCAGTCTCCATACTCATTTCTCTAGGTGATCCCACNAAAGCCCATTTCTCANTTAAGATACCTCTG AACGAGGAGGAGTGACCAAGATCTTTAGGTCACTCTGACTGTTCTGTGGCAGCAGAAGGTTGCCAATGGC AGCAAGGCACTGAGTAAGGGATTTCGTCTTGTGGATGAACTGATGGACCCCATGGTTGTCAGTCTGTTTA TCACTTGCACATCCATGTTTTGGTGGAAGGCAGATGGGCTGGCCACCTGGCTAAGGATAAAAAAACAGGG CCTGTTAGTTTCACTGGATCACTGCTTGTGAATCCTGCTTGACCAGAACTTATAGGGGTTGTAACTAATG ACACACTTATAATACAAAATCTCTTGTTATACTGGCAACTTTTTCTGGGAAGCATTTGTTTTGTTTGATA TTCAAATCAAATTTAGATTTGGCCCGTAACCAATGCCAATTACCAAAACTTATTGCTTTGTTCATGAAAA TACATACATGTATGTGTACTTACCTTTTCTTTTTGTTTGCCTGTTTTGAATAAACCAAACTTTAAGCAAA AAAAAAAAAAAAAAAACTCGAG

LsC4-a (Traduo no frame +1) MSSISMESMI NVWPLHDVNP SVSILISLGD PTKAHFSXKI PLNEEE LsC4-b (Traduo no frame +2) MDPMVVSLFI TCTSMFWWKA DGLATWLRIK KQGLLVSLDH CL

93

7.8.3- Anlise da seqncia do DNA complementar do clone 24


A seqncia nucleotdica do clone 24 apresenta 893 pares de bases. A traduo do cDNA do clone 24 realizada pelo programa SIXFRAME procedeu-se no frame +1 e originou um peptdeo de 62 aminocido denominado LsC5. A anlise desse peptdeo pelo programa BlastP no revelou identidade com outras protenas depositadas no GenBank.

AAAATGTCGCGNCAATCCCTTATCTGATGCCCCAGGGTACCTGNCTCCGAATATTTCCAAGNCCCCAGGT GTGGGCCATAAAGANGTCAAAGTTGTCTTGATCCNAAACAAGAGGGCTTAATGTCAATAGGAAAGGAATG TGAGNNCGTCTTCAATCCCCCGGGGACCGAGAAGGTTTTTTCGTCACCCCGGATATTTAATTTTGGCCCC TTCAGAATATGGAAAGATATTTTGTGGGATAGTCCTTGTGTGTTGCGCCCAGAAATTAATGACGGGAGGG GTTATCCAACAGGCCGTGCATTTCAATAAAGATGGCTCCCTGGGGTTTTCCGTTTGACCAAAAATGATCG TTAAGAAATTAAAATGAAAATTGAAGACGAGTTGAATGAGGACTTATTCCACAAGTCATTCTAGAAACTA AGGGAATACCATATAACCTCACAGGCAAGAAACTGGAAAAGTTGTTTCCAAAGATCATTGATTACAATCA GATTCCAGAAGTGAACAATGTGAAAAATCCGTATTGCCNGAAATCTTTCCTGAATATACCTGAACTTCAG AACTTCTAGGTGAAATGAAATGAGAAACGGGACTTGTTTATTTCTGAATTTTCTTGTTTTCTAATTGTAA CACACGTGATATCCATCTCTGTCGATAGCGAGCTTCAATGAACAGGAATTTTCAAAAATTAGGCCATTGG AGTAACTCAGTGGCATAAAAAAAACAATAATATGCTAAACCCCAAGATAAATAAAAGAATAATAATTTAA GNTGAGATGGAAAACTCGAGAGTAGCTTCTTAGAGCGGCCCGCGGGCCCATCGATTTTCCACCCGGTGGG TTACACAGCTAAGTTACCCATTCGCCTATATCANCGTATGCATCATGGCANTG

LsC5 MSIGKECEXVFNPPGTEKVFSSPRIFNFGPFRIWKDILWDSPCVLRPEINDGRGYPTGRAF Q

94

8- Discusso
Os estudos realizados com venenos de aranhas mostram que a maioria das toxinas de aranhas descritas at o momento tem ao sobre receptores neurais, canais inicos ou protenas de membranas pr-sinpticas envolvidas na liberao de neurotransmissores. Embora haja poucos estudos envolvendo componentes txicos do veneno da aranha Lasiodora sp, sabe-se que o veneno capaz de inibir canais de Ca2+ do tipo L e modular a cintica de canais de Na+ bem como a entrada de ons para dentro da clula (Kushmerick e cols., 2001). Os estudos realizados por Kalapothakis e cols. (2003) sobre os efeitos do veneno da Lasiodora sp em corao isolado de rato sugeriram que o veneno dessa aranha possa estar envolvido no aumento da liberao vesicular de acetilcolina da extremidade de nervos parasimpticos. Os peptdeos compreendem a principal classe de componentes txicos dos venenos de aranhas, e apresentam uma massa molecular geralmente entre 4 e 10kDa (SavelNiemann, 1989). O isolamento e a caracterizao funcional desses peptdeos tm sido descritos em vrios trabalhos, contudo, informaes acerca da estrutura primria desses peptdeos ainda so escassas e limitadas a poucas espcies. Este trabalho foi desenvolvido com o objetivo de se poder inferir a seqncia de aminocidos de componentes do veneno bem como expressar as protenas utilizando-se de diferentes sistemas, dado a dificuldade de se obter grandes quantidades de veneno bruto.

96

Para a realizao da varredura dos clones provenientes da exciso em massa do fagemdeo pBK-CMV adotou-se a tcnica de ELISA. Esta tcnica foi escolhida devido a sua sensibilidade e especificidade na deteco da presena do antgeno. Esse sistema de varredura foi utilizado na identificao de protenas imunognicas de venenos de outros animais, como por exemplo, os escorpies Tityus bahiensis e Tityus serrulatus, podendo gerar uma grande quantidade de informao em um curto perodo de tempo bem como contribuir no s para projetos genomas como tambm para projetos proteomas, por meio da identificao de protenas e toxinas importantes, e para o desenvolvimento de antivenenos para uso clinico (Kalapothakis e cols. 2001). O seqenciamento dos clones que apresentaram similaridade com toxinas de veneno de outras aranhas forneceu a seqncia completa de nucleotdeos que codificam para as toxinas denominadas LTx1, LTx2, LTx3 e LTx5. Todos os peptdeos precursores

apresentaram a mesma organizao estrutural: peptdeo sinal, um peptdeo intermedirio e uma cadeia polipeptdica correspondente toxina madura. Essa organizao tem sido encontrada em polipeptdeos txicos de venenos de outras aranhas e parece ser uma caracterstica estrutural comum a toxinas de aranhas (Cardoso e cols., 2003; Kalapothakis e cols., 2002; Penaforte e cols., 2000). Doze clones codificam seqncias de aminocidos idnticas seqncia da toxina LTx1, um clone apresentou a seqncia codificante para LTx2, dois clones mostraram codificar para a toxina LTx3 (Vieira e cols., 2004) e quatro clones codificam a toxina LTx5. O fato do cDNA que codifica a toxina LTx1 ter sido encontrado 12 vezes sugere uma maior imunogenicidade para LTx1 ou mesmo que o nvel de expresso dessa toxina seja maior, e que a mesma possa desempenhar um papel importante na paralisao e/ou morte das presas. Essas hipteses tm sido reforadas ainda mais pelos achados de Moura e cols. (2004). Utilizando anticorpos anti-P3, Moura e cols. realizaram a varredura de outras sub-bibliotecas de cDNA da aranha Lasiodora sp e encontrou 11 clones com similaridade com toxinas de aranhas, sendo que sete deles codificam para a toxina LTx1. Os precursores das toxinas LTx1, LTx2 e LTx3, deduzidos a partir das seqncias de cDNAs apresentaram um peptdeo sinal hidrofbico, um peptdeo intermedirio rico em resduos de glutamato e um peptdeo maduro, composto por 49 resduos de aminocidos muito similares entre si diferindo-se em apenas 1-3 resduos de aminocidos. A

97

comparao das seqncias de aminocidos das toxinas maduras LTx1 e LTx2 mostra que elas se diferem em trs resduos de aminocidos (posies 1, 25 e 49 F/L, K/D e F/I). As toxinas LTx1 e LTx3 diferem-se apenas no resduo 25 (K/D). Entre as toxinas LTx2 e LTx3 foram observadas discrepncias nos resduos 1 e 49 (L/F e I/F). As toxinas LTx2 e LTx3 provavelmente exercem funes similares uma vez que os aminocidos discrepantes compartilham as mesmas caractersticas qumicas (no polares). A discrepncia observada no resduo da posio 25 (K D) pode conferir s toxinas LTx1 e LTx3 diferentes modos de ao, sobretudo no que diz respeito a alvos (canais inicos e/ou receptores) ou mecanismos de ao dessas toxinas. Estudos realizados com peptdeos de venenos de tarntulas utilizando espectrometria de massa MALDI-TOF tm revelado que a diversidade farmacolgica dos peptdeos txicos est baseada em peptdeos de tamanhos pequenos e com um nmero limitado de modelos estruturais (Escoubas & Rash, 2004), de tal maneira que mesmo diferenas sutis (como a troca de um nico aminocido) na estrutura primria dessas toxinas podem resultar em diferentes estruturas tridimensionais e conseqentemente, em diferentes funes. Isoformas que se diferem em 1 ou 2 resduos de aminocidos encontradas em venenos de aranhas tm sido descritas por outros autores. HaTx1/HaTx2 (Swarts & MacKinnon, 1995), HnTxIV/HnTxV (Liu e cols., 2003; Xiao & Liang, 2003) e ESTx1/ESTx2 (Savel-Niemann, 1989) so exemplos de isoformas que se diferem em apenas 1 resduo de aminocido; LpTx1/LpTx2 (Escoubas e cols., 1997) diferem em 2 resduos de aminocidos. O tamanho das toxinas descritas neste trabalho, 49 (LTx1, LTx2 e LTx3) e 71 (LTx5) aminocidos, est de acordo com dados obtidos a partir de estudos de evoluo molecular utilizando espectrometria de massa MALDI-TOF realizado com venenos de 55 tarntulas (Escoubas & Rash, 2004). Esse estudo mostrou uma distribuio bi-modal de pesos moleculares, onde 57,8% dos peptdeos apresentaram pesos moleculares entre 35004500 Da e 6,9% dos peptdeos possuem massa entre 6500-7000 Da (Figura 28). Isto significa que a maioria dos peptdeos de venenos de tarntulas possui um tamanho que varia em mdia de 31-40 resduos de aminocidos (Escoubas & Rash, 2004).

98

Classe Principal

Classe Secundria

Figura 28: Perfil molecular de peptdeos de venenos de 55 tarntulas utilizando espectrometria de massa MALDI-TOF. A curva representa a freqncia de distribuio de pesos moleculares em classes de 500 Da para as 1516 massas de peptdeos analisados, mostrando a distribuio bi-modal (setas). As linhas representam nmeros tericos de aminocidos para as classes de pesos moleculares correspondentes (Adaptado de Escoubas & Rash, 2004).

A figura 29 mostra o alinhamento das seqncias de aminocidos das toxinas maduras da aranha Lasiodora sp com a seqncia de duas outras toxinas (LpTx1 e LpTx2) da aranha Lasiodora parahybana, tambm de 49 resduos de aminocidos, previamente descritas por Escoubas e cols. (1997). Uma elevada similaridade foi obtida entre as toxinas isoladas do veneno da aranha Lasiodora parahybana (LpTx1 e LpTx2) e as toxinas descritas neste trabalho (LTx1, LTx2 e LTx3). A toxina LTx1, descrita neste trabalho, idntica LpTx1 descrita por Escoubas e cols. (1997). Contudo, LTx2 apresenta diferena em trs resduos de aminocidos em relao LpTx1 (posies 1, 25 e 49) e em 4 resduos quando alinhada com LpTx2 (posies 1, 6, 25 e 49). A toxina LTx3 difere de LpTx1 apenas no resduo da posio 25 e difere da LpTx2 em dois resduos de aminocidos (posies 6 e 25). Escoubas e cols. (1997) mostraram que as fraes do veneno da aranha Lasiodora parahybana txicas para insetos contm peso molecular que varia entre 5000-

99

6000 Da. A alta similaridade entre as toxinas descritas neste trabalho e as toxinas da Lasiodora parahybana descritas por Escoubas e cols. (1997) poderia levar especulao de que se trata da mesma espcie de aranha. Contudo, a espcie Lasiodora parahybana no tem sido descrita no estado de Minas Gerais, sendo nativa da regio Nordeste do Brasil em reas como Campina Grande no Estado da Paraba. Alm do mais, pequenas diferenas ou at 100% de identidade tem sido descrita na literatura entre toxinas de aranhas de espcies distintas. Esse o caso da toxina -Aga-III isolada do veneno da aranha Agenolepsis aperta (Skinner e cols., 1989) que idntica toxina CT-II, purificada da aranha Hololena curta (Stapleton e cols., 1990). As toxinas GsMTx2/PaTx2 (Grammostola

spatulata/Phrixotrichus auratus) (Diochot e cols., 1999; Oswald e cols., 2002) e TxP1/ESTx2 (Brachypelma smithi/Erypelma californicum) (Savel-Niemann, 1989; Kaiser e cols., 1994) tm seqncias idnticas, mas foram descritas em diferentes, embora relacionadas, espcies de aranhas.

LTx1 LTx2 LTx3 LpTx1 LpTx2

1 6 25 49 FFECTFECDIKKEGKPCKPKGCKCKDKDNKDHKKCSGGWRCKLKLCLKF LFECTFECDIKKEGKPCKPKGCKCDDKDNKDHKKCSGGWRCKLKLCLKI FFECTFECDIKKEGKPCKPKGCKCDDKDNKDHKKCSGGWRCKLKLCLKF FFECTFECDIKKEGKPCKPKGCKCKDKDNKDHKKCSGGWRCKLKLCLKF FFECTLECDIKKEGKPCKPKGCKCNDKDNKDHKKCSGGWRCKLKLCLKF

Figura 29: Alinhamento das seqncias peptdicas das toxinas maduras das aranhas Lasiodora sp e Lasiodora parahybana. Em azul so mostrados domnios conservados em todas as cinco toxinas. As posies conservadas dos resduos de cistena (em vermelho) nas diferentes seqncias sugerem que todas podem compartilhar semelhanas na estrutura tridimensional. Os aminocidos que se diferem em pelo menos uma delas so mostrados em preto.

100

As toxinas LTx1, LTx2 e LTx3 apresentaram aproximadamente 65% de identidade com a seqncia de aminocidos da toxina TXP1, uma neurotoxina descrita por Kaiser e cols. (1994) purificada do veneno da tarntula mexicana red knee (Brachypelma smithii), e ESTx, uma toxina presente no veneno da aranha Eurypelma californicum descrita por (Savel-Niemann, 1989). A elevada similaridade compartilhada pelas toxinas LTx1, LTx2, LTx3, TXP1 e ESTx est relacionada, provavelmente, com o fato dessas aranhas pertencerem mesma famlia, Theraphosidae. A maioria das seqncias primrias de toxinas de venenos de tarntulas identificadas at o momento possui em mdia 31-41 aminocidos, reticulados por trs pontes dissulfeto (Escoubas & Rash, 2004). O alinhamento das lasiotoxinas (LpTx1 e LpTx2) descritas para L. parahybana com as toxinas ESTx e HwTx-II (Figura 30) indica que elas podem adotar uma conformao tridimensional parecida, modificada por um trecho de 10-13 aminocidos extras e uma ponte dissulfeto adicional. A conservao dos resduos de cistena sugere que ao longo da evoluo muitos domnios proticos tendem a ser conservados, e que pequenas modificaes de resduos de aminocidos observadas nas seqncias dessas protenas so suficientes para conferir atividades diferentes. A estrutura de protenas txicas de escorpies e serpentes tende a conservar o arranjo das pontes de dissulfeto e modificar as seqncias peptdicas que esto expostas na superfcie da molcula (Menez e cols., 1992). Ao que parece, os peptdeos txicos de aranhas apresentam a mesma tendncia evolutiva. O mecanismo evolucionrio envolvido no aumento da diversidade de toxinas animais parece estar relacionado com mutaes pontuais seguidas de rpidas duplicaes gnicas e recombinaes. Modificaes ps-traducionais do produto gnico tambm levam ao aumento de peptdeos e protenas txicos (Mebs, 2001). Um fenmeno paradoxal que venenos animais podem ter em comum o fato das regies no codificantes de genes de toxinas (regies 3 e 5-no traduzidas e ntrons) apresentarem elementos estruturais altamente conservados enquanto que partes codificantes (xons) freqentemente exibem grande variabilidade, contrrio ao que ocorre normalmente em outros genes (Mebs, 2001; Afifiyan e cols., 1999; Chuman e cols., 2000; Kuch e cols., 2003; Chang e cols., 2003; Tani e cols., 2002).

101

Figura 30: Alinhamento (ClustalW) de toxinas de tarntulas. As provveis interaes entre os resduos de cistenas das toxinas HwTx-II (Ile/Gln), ESTx1, ESTx2/TxP1, LpTx1 e LpTx2 so mostradas pelos algarismos romanos (Adaptado de Escoubas & Rash, 2004).

A anlise da expresso de LTx1 revelou uma induo basal (tempo 0) e um tempo timo de induo em torno de 5 horas aps a adio de IPTG 0.6mM e incubao a 30C (200 rpm). A toxina recombinante foi tambm analisada por western bloting juntamente com uma frao do veneno bruto de Lasiodora sp. A toxina LTx1 foi encontrada sobretudo na frao solvel sugerindo que no h formao de corpos de incluses uma vez que no foi observada a presena mensurvel da mesma no precipitado da sonicao de clulas induzidas. Quatro clones positivos em ensaios imunolgicos de ELISA codificam o precursor da toxina LTx5. A toxina LTx5 sintetizada na glndula de veneno da aranha Lasiodora sp inicialmente como um pr-peptdeo contendo um peptdeo sinal hidrofbico composto por 17 resduos de aminocido, um peptdeo intermedirio contendo 28 resduos de aminocidos e o peptdeo maduro composto por 71 resduos de aminocidos. De acordo com o perfil molecular do veneno de 55 tarntulas obtido por Escoubas & Rash (2004), LTx5 pertence segunda classe de peptdeos encontrados em glndula de veneno de tarntulas, com peso molecular variando em torno de 7000-8000 Da (Figura 28). O alinhamento das toxinas da aranha Lasiodora sp LTx1, LTx2, LTx3, LTx5 (descritas neste trabalho) e LTx4 (descrita por Moura e cols., 2004) (Figura 31) sugere (baseado na similaridade entre as seqncias), a existncia de pelo menos trs famlias de

102

protenas de baixo pelo molecular codificadas na glndula de veneno da aranha em questo (Figura 32).

Figura 31: Alinhamento dos precursores das toxinas da aranha Lasiodora sp LTx1, LTx2, LTx3, LTx4 e LTx5. Os resduos destacados em roxo so comuns a todas as seqncias. Os resduos conservados nas seqncias de LTx1, LTx2 e LTx3 (azul claro) sugere que essas toxinas compartilham a mesma famlia de protenas. A ausncia de domnios conservados entre LTx4 (Moura e cols., 2004 dados no publicados), LTx5 e as trs primeiras toxinas sugere a existncia de pelo menos trs famlias de protenas de baixo pelo molecular codificadas na glndula de veneno da aranha Lasiodora sp.

103

Figura 32: Dendograma das toxinas da aranha Lasiodora sp baseada no programa de alinhamento ClustalW. Pelo menos trs famlias de protenas parecem ser codificadas na glndula de veneno da aranha em questo.

A anlise do peptdeo codificado pelo cDNA do clone 20 apresentou elevada similaridade com cadeias de globinas de diferentes organismos. Embora a probabilidade de contaminao, no momento da construo da biblioteca de cDNA, com RNAs de animais utilizados na alimentao das aranhas no seja descartada, fragmentos de hemoglobina com atividade antimicrobial tm sido descritos. Fogaa e cols. (2000) identificaram um fragmento da cadeia da hemoglobina bovina referente regio compreendida entre os resduos 33 ao 61, com propriedades antimicrobianas. Esse peptdeo, com massa molecular de 3.205,6 Da, foi inicialmente isolado do intestino do carrapato Boophilus microplus. Observou-se que o fragmento da cadeia da hemoglobina bovina age em concentraes micromolares apenas contra bactrias Gram-positivas e contra fungos, no tendo sido ativo contra bactrias Gram-negativas (Fogaa e cols. 2000). Cadeias de hemoglobina tm sido descritas como uma fonte de peptdeos bioativos endgenos. Froidevaux e cols. (2001) tm obtido diferentes peptdeos a partir da hidrlise

104

peptdica de hemoglobina bovina. Esses autores obtiveram um fragmento correspondente aos primeiros 23 resduos de aminocidos da extremidade N-terminal da cadeia da hemoglobina bovina e testaram sua atividade contra Micrococcus luteus. A inibio do crescimento das clulas microbianas foi obtida a uma concentrao de 1,5mg/ml (671M) de peptdeo 1-23. A clivagem das subunidades e de hemoglobina (inclusive a humana) utilizando-se brometo de cianognio tem fornecido fragmentos com atividade antimicrobial mensurveis (Parish e cols., 2001). Regies especficas da molcula de hemoglobina humana, responsveis por atividade antimicrobiana, tm sido mapeadas. Os trinta aminocidos da extremidade carboxila da subunidade , responsveis pela formao de uma -hlice catinica baseada na estrutura cristalina do tetrmero intacto, apresenta atividade contra Escherichia coli, Staphilococcus aureus e Candida albicans (Parish e cols., 2001). Os autores postulam que, em adio sua funo no transporte de oxignio, a hemoglobina age como um importante agente antibitico contra um amplo espectro de microrganismos. A anlise da seqncia do cDNA do clone 21 apresentou 62% de similaridade com a protena CG7580-PA da mosca Drosophila melanogaster, 58% de similaridade com a protena agCP10691 do mosquito Anopheles gambiae e 46% de similaridade com a protena Qpc-pending do camundongo Mus musculus. Nenhuma atividade txica tem sido descrita para os peptdeos com os quais o cDNA do clone 21 apresentou similaridade.

105

9- Concluses
A varredura da biblioteca de cDNA, utilizando-se da tcnica de ELISA, permitiu o isolamento de clones que apresentaram insertos que codificam seqncias com similaridade com toxinas das aranhas Brachypelma smithii (TxP1), Eurypelma californicum (ESTx), Selenocosmia huwena (HwTx-II), Lasiodora parahibana (LpTx1 e LpTx2) e Macrothele gigas (Magi 7).

As seqncias primrias dos peptdeos precursores para LTx1, LTx2, LTx3 e LTx5 apresentaram a mesma organizao: um peptdeo sinal hidrofbico localizado na extremidade N-terminal, um peptdeo intermedirio e uma regio correspondente seqncia da toxina madura.

O tamanho das toxinas descritas neste trabalho, 49 (LTx1, LTx2 e LTx3) e 71 (LTx5) resduos de aminocidos, est em acordo com dados obtidos a partir de estudos de evoluo molecular realizados com venenos de aranhas.

A anlise das seqncias peptdicas de LTx1, LTx2 e LTx3 sugere uma estrutura organizacional que compreende a presena de quatro ligaes dissulfeto, enquanto a toxina LTx5 deve apresentar apenas trs pontes dissulfeto.

O cDNA que codifica a toxina LTx1 foi encontrado em 12 clones, em um total de 19 clones positivos com similaridades com toxinas de outras aranhas. Esse resultado sugere que LTx1 seja mais imunognica ou mesmo que LTx1 tenha um nvel de expresso maior.

107

As toxinas LTx2 e LTx3 provavelmente possuem atividades similares uma vez que os aminocidos discrepantes entre as toxinas (posies: 1 e 49) compartilham as mesmas caractersticas qumicas, enquanto que a discrepncia observada entre as toxinas LTx1 e LTx2/LTx3 (K D) pode conferir LTx1 uma atividade distinta.

Uma elevada similaridade foi obtida entre as toxinas isoladas do veneno da aranha Lasiodora sp (LTx1, LTx2 e LTx3) e as toxinas LpTx1, LpTx2 descritas para L. parahybana, sendo a toxina LTx1 idntica LpTx1.

O alinhamento das toxinas da aranha Lasiodora sp LTx1, LTx2, LTx3, LTx5 e LTx4 sugere a existncia de pelo menos trs famlias de toxinas no veneno da aranha.

Os experimentos de induo da toxina LTx1 recombinante revelaram um tempo timo de induo em torno de 5 horas e produziu a toxina na sua forma solvel.

108

10- Perspectivas
Pouco se conhece sobre a composio qualitativa e/ou quantitativa do veneno da Lasiodora sp. Neste sentido, pretendemos:

Expressar em outros sistemas as diferentes toxinas identificadas.

Purificar as toxinas recombinantes.

Produzir anticorpos especficos contra as toxinas que se mostrarem ativas. Estes anticorpos podero ser usados para monitorar processos de purificao, desenvolvimento de vacinas ou na varredura de outras subbibliotecas.

Proceder estudos funcionais: ensaios farmacolgicos e eletrofisiolgicos.

Estudar a ao das toxinas recombinantes em insetos

Realizar mutaes stio-dirigidas em aminocidos que possam ser crticos do ponto de vista toxicolgico ou imunolgico.

110

11. Referncias Bibliogrficas

AFIFIYAN, F.; ARMUGAN, A.; TAN, C. H.; GOPALAKRISHNAKONE, P.; JEYASEELAN, K. (1999). Postsynaptic -Neurotoxin gene of the spitting cobra, Naj naja sputatrix: Structure, Organization, and Phylogenetic Analysis. Genome Research 9: 259-266.

ALTSCHUL, S. F.; GISH, W.; MILLER, W.; MYRES, E. W.; LIPMAN, D. J. (1990) Basic local alignment search tool. J. Mol. Bio. 215:403-410.

ARAJO D. A. M., CORDEIRO M. N., DINIZ, C. R.; BEIRO S. L. (1993). Effects of a toxic fraction, PhTx2, from de spider Phoneutria nigriventer on de sodium current. Nauyn-Schmeidebergs Arch. Pharmacol. 347: 205-208.

ATKINSON R. K. & WRIGHT L. G. (1992a). The involvement of collagenase in the necroses induced by the bites of same spiders. Comp. Biochem. Physiol. 102(1): 125128

ATKINSON R. K. & WRIGHT L. G. (1992b) The modes of action of spider toxins on insects and mammals. Biochem. Physiol. 102c, No. 3, pp., 339-342.

BARRAL, J., POBLETTE, F., MENDONZA, E., PINEDA, J. C., GALARRAGA, E.; BARGAS, J. (2001). High-affinity inhibition of glutamate release from corticostriatal synapses by -agatoxin TK. European Journal of pharmacology. 430: 167-173.

BELOKONEVA, O. S., SATAKE, H., MALTSEVA, E. L., PALMINA, N. P., VILLEGAS, E., NAKAJIMA, T.; CORZO, G. (2004). Pore formation of phospholipd membranes by the action of two hemolytic arachnid peptides of different size. BBA 1664(2): 182-188.

112

BERGMANN, M. R.; PINEDO, F. J. R. (2001). Baculovrus recombinante para controle de pragas. Biotecnologia 22: 50-58.

CARDOSO, F. C.; PACFICO, L. G.; CARVALHO, D. C.; VICTRIA, J. M. N.; NEVES, A. L. G.; CHVEZ-OLRTEGUI, C.; GOMEZ, M. V.;

KALAPOTHAKIS, E. (2003). Molecular cloning and characterization of Phoneutria nigriventer toxins active on calcium channels. Toxicon 41: 755-763.

CHAN, T. K., GEREN, C. R., HOWELL, D. E.; ODELL, G. V. (1975). Adenosine Triphosphate in tarantula spider venoms and its synergistic effect with the venom toxin.. Toxicon 13: 61-66.

CHANG, L. S.; CHUNG, C.; LIOU, J. C.; CHANG, C. W.; YANG, C. C. (2003). Novel neurotoxins from Taiwan krait (Bungarus multicinctus) venom: purification, characterization and gene organization. Toxicon 42: 323-330.

CHOMCZYNSKI, P. & SACCHI, N. (1987). Single-step method of RNA isolation by acid guanidinum thiocyanate-phenol-Cloroform extraction. Anl. Biochem. 162: 156159.

CHUMAN, Y.; NOBUHISA, I.; OGAWA, T.; DESHIMARU, M.; CHIJIWA, T.; TAN, N. H.; FUKUMAKI, Y.; SHIMOHIGASHI, Y.; DUCANCEL, F.; BOULAIN, J. C.; MNEZ, A.; OHNO, M. (2000). Regional and accelerated molecular evolution in group I snake venom gland phospholipase A2 isozymes. Toxicon 38: 449-462.

CORDEIRO, M. N., FIGUEIREDO, S. G., VALENTIN, A. C., DINIZ, C> R., VON EICKSTEDT, R. D., GILROY, J.; RICHARDSON, M. (1993). Purificationand amino acid sequences of six Tx3 type neurotoxins from the venom of the brazilian armed spider Phoneutria nigriventer (Keys.) Toxicon 31: 35-42.

113

CORZO, G., GILLES, N., SATAKE, H., VILLEGAS, E, DAI, L., NAKAJIMA, T.; HAUPT, J. (2003). Distinct primary structuresof the major peptides toxins from the venom of the spider Macrothele gigas that bind to sites 3 and 4 in the sodium channel. FEBS Letters 547: 43-50.

DE DEUS, A. D. T. (2003). Caracterizao do veneno bruto da aranha Lasiodora sp. Dissertao de mestrado Instituto de Cincias Biolgicas da Universidade Federal de Minas Gerais.

DIOCHOT, S., DRICI, M. D., MOINIER, D., FINK, M. AND LAZDUNSKI, M. (1999). Effects of phrixotoxins on the Kv4 family of potassium channels and implications for the role of Ito 1 in cardiac electrogenesis. Br. J. Pharmacol. 126: 251263.

ESCOUBAS, P. & RASH, L. (2004). Tarntulas: eight-legged pharmacists and combinatorial chemists. Toxicon 43: 555-574.

ESCOUBAS, P., CELERIER, M. L., ROMI-LEBRUN, R.; NAKAJIMA, T. (1997). Two novel peptide neurotoxins from the venom on the tarantula Lasiodora parahibana. Toxicon 35: 805-806.

ESCOUBAS, P., DIOCHOT, S.; CORZO, G. (2000). Structure and pharmacology of spider venom neurotoxins. Biochimie 82: 893-907.

FIGUEREDO, S. G., GARCIA, M. E., VALENTIM, A C., CORDEIRO, M. N., DINIZ, C. R.; RICHARDSON, M. (1995). Purification and amino acid sequence of the insecticidual neurotoxin Tx4(6-1) from the venom of the armedspider Phoneutria nigriventer. Toxicon 33: 83-93.

114

FOGAA, A. C.; SILVA, Jr. P. I.; MIRANDA, M. T. M.; BIANCHI, A. G.; MIRANDA, A. P.; RIBOLLA, P. E.; DAFFRE, S. (2000). Antimicrobial activityof a bovine hemoglobin fragment in the tick Boophilus microplus. J. Biol. Chem. 274: 25330-25334.

FROIDEVAUX, R.; KRIER, F.; NEDJAR-ARROUME, N.; VERCAIGNE-MARKO, D; KOSCIARZ, E.; RUCKEBUSCH, C.; DHULSTER, P.; GUILLOCHON, D. (2001).Antibacterial activity of a pepsin-derived bovine hemoglobin fragment. FEBES Letters. 491: 159-163.

GEREN C. R. & ODELL G. V. (1984). The biochemistry of spider venoms. In insects poisons, Allergens, and other vertebrate venoms. Handbook of natural toxins (Edited by Tu A. T.), Vol. 2, pp. 441-481. Marcel Dekker, New York.

HAEBERLI, S., KUHN-NENTWIG, L., SCHALLER, J.; NENTWIG, W. (2000). Characterisation of antibacterial activity of peptides isolated from the venom of the spider Cupiennius salei (Araneae: Ctenidae). Toxicon 38: 373-380.

HORNI, A., WEICKMANN, D.; HESSE, M. (2001). The main products of the low molecular mass fraction in the venom of the spider Latrodectus menavodi. Toxicon 39: 425-428.

KAISER, I. I., GRIFFIN, P. R., AIRD, S. D., HUDIBURG, S., SHABANOWITZ, J., FRANCIS, B., JOHN, T. R., HUNT, D. F.; ODELL, G. V. (1994). Primary structures of two proteins from the venom of the mexican red knee tarantula

(Brachypelma smithii). Toxicon 32 1083-1093.

115

KALAPOTHAKIS, E.; PENAFORTE, C. L.; LEO, R. M.; CRUZ, J. S.; PRADO, V. F.; CORDEIRO, M. N., DINIZ, C. R,; ROMANO-SILVA, M. A.; PRADO, M. A. M.; GOMEZ, M. V.; BEIRO, P. S. L. (1998). Cloning, cDNA sequence anlysis and pach clamp studies of a toxin from the venom of the armed spider (Phoneutria nigriventer). Toxicon. 36 (12):1971-1980.

KALAPOTHAKIS, E., JARDIM, S., MAGALHES, A. C., MENDES, T. M., DE MARCO, L., AFONSO, L. C. C.; CHVEZ-OLRTEGUI, C. (2001). Screening of expression libraries using ELISA: identification of immunogenic proteins from Tityus bahiensis and Tityus serrulatus venom. Toxicon 39 679-685.

KALAPOTHAKIS, E., KUSHMERICK, C., GUSMO, D. R., FAVARON, G. O. C., FERREIRA, A. J., GMEZ, M. V.; ALMEIDA. A. P. (2003). Effects of the venom of a Mygalomorph spider (Lasiodora sp) on the isolated rat heart. Toxicon 41 23-28.

KALAPOTHAKIS, E., SIMONE, C. A.,CIBELE, S. C., TAHIS, M. M., MARCUS, V. G., OLDEMIR, C. M., IDA, C. G.; CARLOS CHVEZ-OLRTEGUI. (2002). Molecular cloning, expression and imunolgical properties of LiD1, a protein fron dermonecrotic family of Loxosceles intermedia spider venoms. Toxicon 40: 1691-1699.

KUCH, U.; MOLLES, B. E.; OMORI-SATOH, T.; CHANHOME, L.; SAMEJIMA, Y.; MEBS, D. (2003). Identification of alpha-bungarotoxin (A31) as the major postsynaptic neurotoxin, and complete nucleotide identity of a genomic DNA of Bungarus candidus from Java with exons of the Bungarus multicinctus alphabungarotoxin (A31) gene. Toxicon 42: 381-390.

KUHN-NENTWIG, L., SCHALLER, J., STRB, B., KAMPFER, U.; NENTWIG, W. (1998). CSTX-4, a novel bactericidal and insecticidal peptide in de venom of Cupiennius salei. Toxicon 36: 1276-1277.

116

KUSHMERICK, C., CARVALHO, F. M., MARIA, M., MASSENSINI, A. R., ROMANO-SILVA, M. A., GMEZ, M. V., KALAPOTHAKIS, E.; PRADO, M. A. M. (2001). Effects of a Lasiodora spider venom on Ca2+ and Na+ channels. Toxicon 39: 991-1002.

LAEMMLI, U. K. (1970). Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature, 227 (259): 680-685.

LIPKIN, A., KOZLOV, S., SOSYREVA, E., BLAKE, A., WINDASS, J. D.; GRISHIN, E. (2002). Novel insecticidual toxins from the venom of the spider

Segestria florentina. Toxicon 40: 125-130.

LIU, Z., DAI, J., CHEN, Z., HU, W., XIAO, Y.; LIANG, S. (2003). Isolation and characterization of hainantoxin-IV, a novel antagonist of tetrodotoxin-sensitive sodium channels from the Chinese bird spider Selenocosmia hainana. Cell. Mol. Life Sci. 60:972-978.

LOHNER, K. (2001). The role of membrane lipid composition in cell targeting of antimicrobial peptides. In Development of novel antimicrobial agents: Emerging strategies. Lohner, K. (ed), Horizon Scientifc Press, Englend. Pp 149-165.

MASSENSINI, A. R., SUCKLINK, J., BRAMMER, M. J., MORAES-SANTOS, T., GMEZ, M. V.; ROMANO-SILVA, M. A. (2002). Tracking sodium channels in live cells: confocal imaging using fluorescetly labeled toxins. Journal of Neuroscience Methods. 116: 189-196.

MEBS, D. (2001). Toxicity in animals. Trends in evolution? Toxicon 39: 87-96.

MENEZ, A.; BONTEMS, F.; ROUMESTAND, C.; GILQUIN, B.; TOMA, F. (1992). Structural basis for functional diversity of animal toxins. Proc. Royal Soc. Edinburgh 99b: 83:103.

117

MOERMAN, L., VERDONCK, F., WILLEMS, J., TYTGAT, J.; BOSTEELS, S. (2003). Antimicrobial peptides from scorpion venom induce Ca2+ signaling in HL-60 cells. BBRC 311: 90-97.

MOURA, M. B. (2004). Varredura de uma biblioteca de cDNA de Lasiodora sp utilizando-se de anticorpos contra a frao P3 do veneno e caracterizao de toxinas. Dissertao de Mestrado. Ncleo de Pesquisa em Cincias Biolgicas Universidade Federal de Ouro Preto MG- Brasil.

OSWALD, R. E., SUCHYNA, T. M., MCFEETERS, R., GOTTLIEB, P.; SACHS, F. (2002). Solution structure of peptide toxins that block mechanosensitive ion channels. J.Biol. Chem. 277: 34443-34450.

PARISH, C. A.; JIANG, H.; TOKIWA, Y.; BEROVA, N.; NAKANISHI, K.; McCABE, D.; ZUCKERMAN, W.; XIA, M. M.; GABAY, J. E. (2001). BroadSpectrum Antimicrobial Activity of Hemoglobin. Bioorganic & Medical Chemistry 9: 377-382.

PENAFORTE, C. L., PRADO, V. F., PRADO, M. M., ROMANO-SILVA, M. A., GUIMARES, P. E. M., MARCO, L., GMEZ, M. V.; KALAPOTAKIS, E. (2000). Molecular cloning of cDNAs encoding insecticidual neurotoxic peptides from the spider Phoneutria nigriventer. Toxicon 38: 1443-1449.

RASH, L. D & HODGSON, W. C. (2002). Pharmacology and biochemistry of spider venoms. Toxicon 40: 225-254.

SAMBROOK, J.; FRITSH, E. F.; MANIATS, T. (1989). Molecular cloning: A laboratory manual, 3 eds. Vol 1, 2, 3. Press Cold SpringHarbor, N.Y.

118

SANGER, F.; NICKLEN, S.; MANIATS, T. (1977). DNA sequencing with chain termiation inhibitors. Proc. Natl. Acad. Sci. USA. 74 5463-5467.

SATAKE, H.; VILLEGAS, E.; OSHIRO, N.; TERADA, K.; SHINADA, T. ; CORZO, G. (2004). Rapid and efficient identification of cysteine-rich peptides by random screening of a venom gland cDNA library from the hexathelid spider Macrothele gigas. Toxicon, 44: 149-156.

SAVEL-NIEMANN, A. (1989). Tarntula (Eurypelma californicum) Venom, a Multicomponent System. Biol. Chem. Hoppe-Seyler 370: 485-498.

STUDIER, W.; ROSEMBERG, A. H.;DUNN, J. J.; DUBENDORFF, J. W. (1990). Use of T7 RNA polimerase to direct expression of cloned genes. Methods of enzimology, 185: 60-89.

SHU, Q. & LIANG, S. P. (1999). Purification and characterization of huwentoxin-II, a neurotoxic peptide from the venom of the Chinese bird spider Selenocosmia huwena. J. Peptide Res. 53: 486-491.

SKINNER, W. S., ADAMS, M. E., QUISTAD, G. B., KATAOKA, H., CESARIN, B. J., ENDERLIN, F. E.; SCHOOLEY, D. A. (1989). Purification and characterization of two classes of neurotoxins from the funnel web, Agenolepis aperta. J. Biol. Chem. 264: 2150-2155.

STAPLETON, A., BLANKENSHIP, D. T., ACKERMAN, B. L., CHEN, T. M., GORDER, G. W., MANLEY, G. D., PALFREYMAN, M. G., COUTANT, J. E.; CARDIN, A. D. (1990). Curtatoxins: neurotoxic insecticidal polypeptides isolated from the funnel-web spider Hololena curta. J. Biol. Chem. 265: 2054-2059.

SWARTS, K. J., & MACKINNON, R. (1995). An inhibitor of the Kv2.1 potassium channel isolated from the venom of a Chilean tarantula. Neuron 15: 941-949.

119

TAMBOURGI, D. V., PEDROSA, M. F. F., VAN DEN BERG, C. W., GONALVESDE-ANDRADE, R. M., FERRACINI, M., PAIXO-CAVALCANTE, D., MORGAN, B. P.; RUSHMERE, N. K. (2004). Molecular cloning, expression, function and immunoreactivities of members of a gene family fosphingomyelinases from Loxoceles venom glands. Molecular Immunology 41: 831-840.

TANI, A.; OGAWA, T.; NOSE, T.; NIKANDROV, N. N.; DESHIMARU, M.; CHIJIWA, T.; CHANG, C. C.; FUKUMAKI, F.; OHNO, M. (2002). Characterization, primary structure and molecular evolution of anticoagulant protein from Agkistrodon actus venom. Toxicon 40: 803-813.

TEDFORD, H. W., SOLLOD, B. L., MAGGIO, F.; KING, G. F. (2004). Australian funnel-web spiders: master insecticide chemists. Toxicon 43: 601-618.

TURKOV,

M.,

RASHI,

S.,

NOAM,

Z.,GORDON,

D.,

KHALIFA,

R.

B.,STANKIEWICZ, M.,PELHATE, M.; GUREVITZ, M. (1997). In vitro folding and functional analysis of an anti-insect selective scorpion depressant neurotoxin produced in Escherichia coli. Protein Expression and Purification 10: 123-131.

USHKARYOV, Y. A., VOLYNSKI, K. E.; ASHTON, A. C. (2004). The multiple actions of black widow spider toxins and their selective use in neurosecretion studies. Toxicon 43: 527-542.

VIEIRA, A. L. G., MOURA, M. B., BAB, E. H., CHVEZ-OLRTEGUI, C., KALAPOTHAKIS, E.; CASTRO, I. M. (2004). Molecular cloning of toxins expressed by the venom gland of Lasiodora sp. Toxicon 44: 949-952.

XIAO, Y. C. & LIANG, S. P. (2003). Purification and characterization of hainantoxin-V, a tetrodotoxin-sensitive sodium channel inhibitor from the venom of the spider Selenocosmia hainana. Toxicon 41: 643-650.

120

XU, K., JI, Y. & QU, X. (1989). Purification and characterization of an antibacterial peptide from venom of Lycosa singoriensis. Acta Zoologica Sinica 35: 300-305.

YAN, L. & ADAMS, M. E. (1998). Lycotoxins, antimicrobial peptides from venom of the wolf spider Lycosa carolinensis. Jornal of Biological Chemistry 273: 2059-2066.

ZLOTKIN, E., FISHMAN, Y.; ELAZAR, M. (2000). AaIT: From neurotoxin to insecticide. Biochimie 82: 869-881.

121