Você está na página 1de 76

índice

BM&FBOVESPA/Divulgação

4 EDITORIAL/CARTAS
6 LIMITE
10 DISTÂNCIAS E METAS
20 REGULAMENTAÇÃO
24 LINHA DE CHEGADA
32 TÉCNICOS
37 GUIA DO TÊNIS 52
51 MURAL SA

Divulgação
52 TROFÉU BRASIL
56 REEBOK 10KM
58 VOLTA DO LAGO
59 COLUNA NUTRIÇÃO
60 MIZUNO 10 MILHAS
61 ASSINANTE SA 64
62 CORRIDA DAS PONTES
63 MINHA HISTÓRIA

Tião Moreira/ZDL
64 VOLKSWAGEN RUN 66
65 COLUNA MEDICINA ESPORTIVA
66 MARATONA DE SÃO PAULO
67 PERGUNTE AO TREINADOR
68 RECORDAR É CORRER
70 CALENDÁRIO
74 COLUNA RICARDO D’ANGELO
Foto da capa: Shutterstock

A SuperAção é uma publicação mensal da Editora Multiesportes. Circula em todo o território nacional. Edição nº 77/Julho de 2009.
EDITORA MULTIESPORTES
Depto. Administrativo, Comercial e Redação - Av. Nossa Senhora de Fátima, 95 - Taquaral - Campinas/SP - CEP: 13076-000
Fone/Fax (19) 3254-3144 / 3252-2609 / 3251-0349 - Assinaturas: (19) 3294-4290
E-mail: superacao@interesportes.com.br - www.interesportes.com.br
DIRETORES: Sergio Luis Coutinho Nogueira/Carlos Eduardo M. C. Nogueira - EDITOR: Rafael De Marco - REPORTAGEM: Fernando Evans/ Julianne Cerasoli
FOTOS: Fernanda Paradizo (colaboradora)/Sergio Carvalho (colaborador) - PRODUTORA: Joyce M. Francia Cerasoli - PROMOÇÃO: Emerson Gonçalves da Silva
CIRCULAÇÃO, ASSINATURAS e SAC: Nathália Franco (19) 3294-4290 - EDITORAÇÃO/ARTE: Priscila S. Belavenute
TRATAMENTO DE IMAGENS: Marcos Antônio Marquezin - IMPRESSÃO: Gráfica Igil
DEPTO COMERCIAL - Fone (19) 3254-3144 / 3252-2609
ADVERTÊNCIA - As informações contidas nesta revista são para fins educacionais e de informação. Qualquer mudança no seu estado de atividade física e nas dietas deve ser
supervisionada por um profissional habilitado, desde que você tenha liberação médica. A revista não se responsabiliza pela utilização inadequada das informações aqui veicu-
ladas e nem pelas opiniões de colaboradores.
editorial
TÊNIS, TÊNIS, TÊNIS, TÊNIS, TÊNIS...

D
izer que corredor é apaixonado por tênis é ruas. Mas você sabe qual é o melhor estilo de técni-
chover no molhado. Por outro lado, trazer co para cada perfil de atleta? Saber escolher a pessoa
informações atualizadas sobre modelos con- que comandará parte de sua vida pode fazer toda a
sagrados e as novidades no mercado é mais que diferença para o sucesso da empreitada. Existem
obrigação para uma revista especializada na moda- corredores que só funcionam com alguém falando
lidade. Assim, nosso Guia do Tênis procura propor- na orelha, dando ordens; outros, não suportam pres-
cionar dados relevantes sobre os produtos que as são e precisam mais de um professor amigão que de
principais marcas esportivas oferecem ao consumi- um ditador. Por tudo isso, SA traz reportagem que
dor. O trabalho consumiu esforços de toda a equipe ajuda a conhecer e dá dicas sobre como escolher o
da redação de SuperAção e o resultado pode ser treinador ideal.
conferido nas 14 páginas, a partir da página 37, des- Para quem já tem o seu treinador, ou ainda vai
ta edição. Certamente o caro leitor encontrará mode- buscar orientação, fundamental também é definir
los que se encaixam perfeitamente as suas necessi- exatamente qual a meta dentro do esporte. É claro
dades, sejam elas referentes a pisada, amortecimen- que correr 10km ou uma maratona exigem esforços
to e até mesmo design e cores. bastante diferentes e reconhecer como encarar cada
Se os tênis são uma necessidade para proteger o distância ajuda a definir que tipo de corredor é cada
'instrumento de trabalho' e auxiliar na performance, um. Mesmo que as pessoas migrem de uma prova
o papel dos treinadores especializados em corrida para outra e evoluam para desafios maiores ao lon-
segue a mesma linha, salvo as devidas proporções, go do tempo, é importante alertar que, até chegar a
óbvio. São eles os principais responsáveis por pla- esse ponto, sempre com segurança e qualidade de
nejar e colocar em prática um cronograma de ativi- vida, informação e disciplina para não exagerar na
dades cujo resultado será a satisfação de cruzar a dose são fatores primordiais. Isso é corrida com res-
linha de chegada com saúde e, de preferência, den- ponsabilidade para com o próprio organismo, sem
tro do tempo estipulado previamente. O trabalho abrir mão do prazer da superação.
desses profissionais tem sido valorizado com o cres-
cimento do interesse das pessoas pela modalidade. Boas corridas!
Basta observar o movimento nos parques, praças e Rafael De Marco, Editor

cartas
Tribuna feliz por ter sido o escolhido pela equipe da Revis-
“Olá, amigos da SuperAção. Eu participei pela ta SuperAção. Obrigado!”
terceira vez consecutiva da 10Km Tribuna FM, Artur Magno Fernandes
em Santos, e adorei. Queria parabenizar a todos Belo Horizonte (MG)
pela belíssima organização, que a prova continue
crescendo nas próximas edições e, ano que vem, Calendário
estarei lá. Valeu!” “Oi, SuperAção. Precisava escrever para agra-
Valter decer o cuidado de vocês para com nós leitores.
Uberaba (MG) Só quem necessita de informações precisas para
se inscrever em uma prova sabe o quanto é bom
contar com um calendário correto e completo
Kit como o da SA. Continuem assim. Parabéns.”
“Quero me parabenizar pelo kit Nike e também Eduardo F. Sartanelli
pela matéria feita pela revista, pois fiquei muito São Paulo (SP)

Envie sua carta para Av. Nossa Sra. de Fátima, 95 - Taquaral - Campinas - SP- Cep: 13076-000,
8 ou envie um e-mail para superacao@interesportes.com.br
PATROCINAR É ACREDITAR NO ATLETA
DO COMEÇO AO FIM. OU MELHOR,
DO TIRO DE LARGADA À FAIXA DE CHEGADA.

CAIXA. Patrocinadora Oficial do Atletismo Brasileiro.

SAC CAIXA
0800 726 0101 - informações, reclamações, sugestões e elogios
0800 726 2492 - para pessoas com deficiência auditiva
Ouvidoria: 0800 725 7474
caixa.gov.br

AN-CX-MKTEsp-GPBRASIL205x275.indd 1 6/18/09 3:13:19 PM


limite

Recorde no deserto
O ultramaratonista Carlos Dias entrou para o livro dos Corrida dos famosos
recordes pela segunda vez por ter sido o sul-americano Promovida pela Rede Globo, a competição en-
que completou a Copa do Mundo dos Desertos (Racing tre famosos do Rio e de São Paulo foi uma atra-
The Planet) em menor tempo. Ele correu nos desertos ção à parte na Maratona de São Paulo. A equipe
de Gobi, Saara, Antártida e Atacama, considerados os Vida Corrida, do Rio de Janeiro, levou a melhor
mais extremos do mundo. A empreitada durou quase sobre a paulista Fôlego. O time carioca, orien-
um ano (de junho de 2008 a abril deste ano, quando cor- tado por Lauter Nogueira, contou com Clayton
reu no Atacama, no Chile, etapa que considerou a mais Conservani, Tande, Adriana Samuel, Mariana
difícil de todas). “A Antártida exigiu muito pelo peso da Brochado, Fabíola da Silva, Smigol, Fernando
neve e ventos fortíssimos, mas o deserto do Atacama, Fisher, Tiago Gomes, Tico Santa Cruz, Rodol-
pela troca constante de piso e a altitude aliada ao sal, me po Mattheis e Olivier Cozan. Já os represen-
deixou exausto todos os dias da prova”, relembra. A pri- tantes de São Paulo, treinados por José Rubens
meira ocasião em que teve seu nome gravado no Guin- D’Elia, foram Gustavo Borges, Hortência, Feli-
ness foi por ter percorrido o Brasil de norte a sul em 100 pe Diniz, Cafu, Caio Ribeiro, Rogério Sampaio,
dias. O próximo desafio é cruzar os Estados Unidos de Marcos Gomes, Juliana Didoni, Guilherme Be-
São Francisco a Nova Iorque pela Rota 80, percurso de 5 renguer, Juninho Paulista e Flávia Freire.
mil quilômetro que pretende completar em 60 dias.
Divulgação

Track&Field
Run Series
A Track&Field Run Series atraiu cerca de 1.200
atletas em Curitiba (PR), na manhã de 14 de
junho. A corrida do Shopping Mueller contou
com percursos de 5km e 10km, com vitórias de
Jorge Damascena Paim, com 34min44, e Letícia
da Silva Salto, com 39min18 nos 10km; e Sergio
Rodrigues da Silva, que marcou 15min50, e Julia-
na Veras, que fez 20min43, na menor distância.

Figura Promoção
Cinco brasileiros terão a chance de participar da
O ex-padre irlandês que agarrou o maratonista brasi- Maratona de Amsterdã, na Holanda, viajando com
leiro Vanderlei Cordeiro de Lima quando este lidera- passagens, translados e hospedagem pagos pela
va a maratona olímpica em Atenas-04 e invadiu a pista Mizuno. A cada R$ 300,00 gastos em produtos da
de Silverstone durante o Grande Prêmio de Fórmula marca nas lojas Centauro, entre os dias 29/06 e
1 da Inglaterra em 2003, foi aprovado na primeira 17/07, vale um cupom, que deve ser depositado na
fase de um programa de calouros na Inglaterra. Neil urna de qualquer loja da rede. Se a compra for fei-
Horan, que largou a batina em 2005, apresentou- ta com Cartões Bradesco, o consumidor ganhará
se no “Britain’s Got Talent” mostrando uma dança cupons em dobro. O sorteio será realizado dia 31
folclórica irlandesa. Os produtores do programa, o de julho, e a prova, dia 18 de outubro. Mais infor-
mesmo que revelou a cantora Susan Boyle, afirma- mações nos sites da Mizuno (www.mizunobr.com.
ram que não sabiam do passado do candidato, que br), Centauro (www.centauro.com.br) e Cartões
166 acabou não passando para as finais do programa. Bradesco (www.bradescocartoes.com.br).
limite

No topo do mundo

Para quem acha que correr uma prova 42km nas ruas da cidade onde mora já é tarefa das mais dasafiadoras,
tem gente que se reúne todo dia 29 de maio para disputar aquela que é a maratona realizada em maior altitude
de que se tem notícia. Trata-se de uma maneira, no mínimo dura, de homenegear os primeiros homens, Tenzing
Norgay Sherpa e Edmund Hillary, a chegar ao topo da montanha mais alta do mundo, o Everest, justamente em
29 de maio de 1959. A largada acontece a 5.356m de altitude e a chegada ocorre a 3.446m, no Nepal. Nesse
ambiente hostil, não é de surpreender que conhecer o terreno ajuda. Prova disso é que nada menos que os
22 primeiros colocados neste ano são nepaleses. Mas ninguém segurou Furba Tamang, de apenas 21 anos, que
marcou 3h40min47 e conquistou, nesta sétima edição, a vitória e o novo recorde da prova. Para se ter uma ideia
da façanha do garoto, o segundo colocado, Ram Kumar Tamang, completou o percurso em 4h07min02.

Alphaville Running Domínio brasileiro


Como de costume, os brasileiros dominaram o Campe-
O final de tarde do sábado de 6 de junho foi o
onato Sul-Americano de Atletismo, disputado no Peru,
momento escolhido para a largada da segun-
entre os dias 19 e 21 de junho. Os atletas tupiniquins
da etapa do Circuito de Corridas Zarro Brasil
conquistaram ao todo 16 medalhas de ouro, 20 de
2009 – Alphaville Running – ATC. Disputada
prata e 17 de bronze, deixando a Colômbia na segun-
num percurso totalmente plano, foi a chance
da posição e a Argentina na terceira. Fabiano Peçanha
para os participantes tentarem suas melhores
(1min47s82) e Kleberson Davide (1min49s33) prota-
marcas. Como a edição marcou a estreia de
gonizaram uma dobradinha verde-amarela nos 800m,
um novo percurso, a aferição da distância mos-
enquanto Damião Ancelmo de Souza foi o grande des-
trou que um possui 9.950m e, o outro, 5.050m.
Correndo um pouco menos ou um pouco mais, taque da equipe de fundo, com o ouro nos 10.000m
quem se deu melhor foram Ana Cláudia Empe- (29min23s57) e o bronze nos 5.000m (13min57s94).
rador, com 19min20, e Jaciane Barroso Arau- No feminino, Sueli Pereira da Silva somou uma prata
jo, com 39min, no feminino, e Valdir Bueno de na distância menor ao fazer 16min14s95 e um bronze
Camargo (15min44) e Edinaldo Caetano Vilela nos 10.000m (33min47s15), prova que teve ainda Cruz
(31min36), entre os homens. Nonata na segunda colocação (33min36s60). Fabiana
Murer venceu no salto com vara.
treinamento

Sim,
você pode!
Está em dúvida se consegue encarar, e vencer,
o desafio nas ruas? Acompanhe as dicas dos
treinadores selecionados por SuperAção e
descubra como cruzar a linha de chegada
inteiro, seja após 10km, 21km ou 42km

10
16
Julianne Cerasoli

D
HYRUDU TXLO{PHWURV ¿FD DLQGD PDLV JRVWRVR TXDQGR VH
tem um objetivo que, ao mesmo tempo em que testa os
OLPLWHV HVWi GH DFRUGR FRP VXD SRVVLELOLGDGH GH FRP-
SURPHWLPHQWRFRPRHVSRUWHHQtYHOGHFRQGLFLRQDPHQWRItVLFR
(DFRUULGDGHUXDWHPµQDSUDWHOHLUD¶RSo}HVSDUDWRGRVRVJRV-
WRV 4XHP WLYHU FHUFD GH K VHPDQDLV SDUD D PRGDOLGDGH VR-
PDQGRWUHLQRVHVSHFt¿FRVHFRPSOHPHQWDUHVSRGHVHSUHSDUDU
WUDQTXLODPHQWHSDUDXPDSURYDGHNPHQTXDQWRDTXHOHTXH
WLYHUI{OHJRSDUDGHGLFDUKSRUVHPDQDSDUDDFRUULGDSRGHVHU
SUHVHQWHDGRFRPXPDPDUDWRQD

!
2EYLDPHQWH DV FRUULGDV QmR GLIHUHP DSHQDV HP GLVWkQFLD
2 WUHLQDPHQWR QmR p WmR VLPSOHV GR WLSR µVH HX FRUULD NP
HTXHURSDVVDUSDUDNPEDVWDGREUDURVORQJRV¶&DGDSURYD
WHPVXDVSUHUURJDWLYDVHPUHODomRjSUHSDUDomR3HQVDQGRQLVVR
SuperAçãoSURFXURXHVSHFLDOLVWDVSDUDWUDoDUHPRSHU¿OGHWUHL-
QDPHQWRSDUDTXHPTXHUWHUPLQDULQWHLURXPDSURYDGHNP
PHLDPDUDWRQDRXPDUDWRQD&RQKHoDRFDPLQKRGDVSHGUDVSDUD
FKHJDUOi

11
SUPERAÇÃO
treinamento

u lha r
se o r g
p ar a
1 0k m
$PDLVSRSXODUGDVFRUUL-
GDVGHUXDDSULQFtSLRQmRH[LJHPXLWR
1mR p QHFHVViULR XP ODUJR WHPSR GH H[SH-
ULrQFLD SDUD FRQVHJXLU HQIUHQWDU NP HP
ULWPR PRGHUDGR &RQWXGR QHJOLJHQFLDU D
SUHSDUDomR HVTXHFHQGR GH WUDEDOKDU D YHOR-
FLGDGHFRPWLURVHDUHVLVWrQFLDPXVFXODUFRP
WUDEDOKRVGHVREUHSHVRSRGHID]HUFRPTXHR
SUD]HUGRLQtFLRVHWRUQHGRUHPGHFRUUrQFLD
GHDOJXPDOHVmRRXHVWDJQDomR
/RJRTXHPDOPHMDWHUPLQDUEHPXPDSUR-
YD GD GLVWkQFLD GHYH SDVVDU SRU XP SHUtRGR
GHDGDSWDomR³*HUDOPHQWHHQWUHVHLVPHVHVH
XPDQRSDUDDGDSWDUDURWLQDHFULDUXPDERD
EDVHIRFDQGRGLVWkQFLDVPHQRUHVHQWUHNPH
NP´ UHFRPHQGD R WUHLQDGRU 'LHJR /RSH]
GDHTXLSH7ULORSH](TXHWDPEpPHVWHMDGLV-
SRVWRDHQJDMDUQRPi[LPRKSRUVHPDQD
±LVVRQRSLFRGDSUHSDUDomRHLQFOXLQGRFRU-
ULGDHPXVFXODomR±SDUDDWLQJLUVHXREMHWLYR
$TXLFRQVLGHUDPRVRVUHTXLVLWRVQHFHVViULRV
SDUDFRPSOHWDUDSURYDHQWUHHPLQXWRV
RTXHpXPDERDPDUFDSDUDDPDGRUHV
'H DFRUGR FRP /RSH] D TXLORPHWUDJHP
VHPDQDOFKHJDDRVNPDLQGDFRQVLGHUDQGR
RPRPHQWRHPTXHRFRUUHGRUWHUiPDLVµWUD-
EDOKR¶(PPpGLD¿FDQRVNP,VVRGLYLGL-
GRHPTXDWURGLDVQDVHPDQD&RQVLGHUDQGR
TXHGRLVGLDV¿FDPOLYUHVSDUDDPXVFXODomR
H RXWUR SDUD GHVFDQVR R WUHLQDGRU SURS}H D
VHJXLQWHGLYLVmR³2LQGLYtGXRWUHLQDFRUULGD
WHUoDTXLQWDViEDGRHGRPLQJRPXVFXODomR
VHJXQGDHTXDUWDHGHVFDQVDQDVH[WD´
8P GRV GLDV GH FRUULGD p UHVHUYDGR DR
ORQJR ³(OH GHYH ¿FDU HQWUH NP GLVWkQ-
FLDGDSURYD HNP XPSRXFRPDLVTXHD
GLVWkQFLD PDLV D PHWDGH GHOD ´ UHFRPHQGD
/RSH]$RVLQWHUYDODGRVSRUVXDYH]¿FDP
UHVHUYDGRV GRLV GLDV 6HJXLQGR D SURJUDPD-
omRDQWHULRUWHUoDHTXLQWDSRUH[HPSOR³2
FRUUHGRU GHYH ID]HU EDVWDQWH DTXHFLPHQWR H
VpULHV GH YHORFLGDGH DWp P  WRWDOL]DQGR
PLQ(DVpULHSULQFLSDOQDVGLVWkQFLDVHQWUH
PHNPFRPLQWHUYDORHUHSHWLo}HVµ[¶

12
16 GHSHQGHQGRGRDWOHWD´LQGLFDRWUHLQDGRU
int ei ro
che gar
para
21km
2SUy[LPRSDVVRjSULPHLUDYLVWDEDVWDQWHGLV-
WDQWHPDVTXHQDYHUGDGHpXPDHYROXomRQDWXUDO
SDUDRFRUUHGRUDVVtGXRGHNPpDPHLDPDUDWR-
QD'HDFRUGRFRP0DUFHOR2UWL]WUHLQDGRUGD%5
(VSRUWHSURIHVVRUGHSyVJUDGXDomRHP¿VLRORJLD
GRH[HUFtFLRRSHU¿OGHTXHPSDUWLFLSDGHHYHQWRV
GRWLSRpEDVLFDPHQWHHVWDUWUHLQDQGRUHJXODUPHQWH
HVHPLQWHUUXSo}HVKiPDLVGHXPDQRHPHLR³1R
HQWDQWRDRFRQWUiULRGRTXHPXLWRVLPDJLQDPSDUD
FRPSOHWDU XPD PHLD PDUDWRQD FRP VXFHVVR FKH-
JDQGRLQWHLURVHPPDLRUHVSUHRFXSDo}HVFRPGH-
VHPSHQKR pQHFHVViULRFRUUHUHQWUHNPHNP
QDVVHPDQDVPDLVLPSRUWDQWHVGRWUHLQDPHQWR,VWR OLPLDUGHODFWDWR±DWLQJHQRSLFRGDSUHSDUDomRGH
SRGHULDVHUH[HFXWDGRFRPXPWHPSRGHDKRUDV NPDNP³/RJLFDPHQWHSDUDDTXHOHVTXHQmR
GH FRUULGDV VHPDQDLV DFRPSDQKDGR SRU GXDV VHV- WrPWHPSRSDUDGHGLFDUVHPDLVDRVWUHLQRVGHFRU-
V}HVGHPXVFXODomR$IUHTXrQFLDVHPDQDOPtQLPD ULGD HVWD p XPD VXJHVWmR PtQLPD QHFHVViULD SDUD
GHYHVHUGHYH]HVQDVHPDQDGHFRUULGDHPGLV- FRPSOHWDUDPHLDPDUDWRQD6HQGRDVVLPQRVGRLV
WkQFLDVHLQWHQVLGDGHVDOWHUQDGDV´UHFRPHQGD D WUrV PHVHV TXH SUHFHGHP HVWD SURYD R FRUUHGRU
0DV HVVH YROXPH QmR p XP Q~PHUR IHFKDGR SUHFLVDGHGRLVDWUrVWUHLQRVORQJRVQRPrV´
GHSHQGHQGR GD IDVH GR WUHLQDPHQWR ³$ TXLORPH- (PUHODomRDRVLQWHUYDODGRVRWUHLQDGRUGHIHQ-
WUDJHP VHPDQDO GHYH VHPSUH YDULDU FRPR VH IRV- GHTXHVHMDPUHDOL]DGRVQDLQWHQVLGDGHGRžOLPLDU
VHXPDHVFDGDVXELQGRVHPDQDDVHPDQDVHPSUH DQDHUyELR SRGHQGRFKHJDUjYHORFLGDGHGR92-
DFRPSDQKDGDGHXPDVHPDQDGHUHFXSHUDomR1R 0i[³&RPRDFLPDGHVWDVLQWHQVLGDGHVWHPRVXP
HQWDQWRHPDOJXQVSHUtRGRVGHWUHLQDPHQWRHOHJH VDOWR H[SUHVVLYR GRV KRUP{QLRV GR HVWUHVVH DGUH-
VHXPPDLRUYROXPHVHPDQDOHHPRXWURVSHUtRGRV QDOLQD QRUDGUHQDOLQD H FRUWLVRO  VXJHUHVH SDUD
IRFDVHPDLVDLQWHQVLGDGH(VWHMRJRHQWUHYROXPHH HVWD FRQGLomR TXH R DWOHWD UHDOL]H XPD VHVVmR GH
LQWHQVLGDGHpXPDDUWHGHWHUPLQDGDSHODSHULRGL]D- WUHLQDPHQWRLQWHUYDODGRVHPDQDO´LQGLFD³4XDQGR
omRGRWUHLQDPHQWR2DWOHWDTXHQmRSHULRGL]DVHXV UHDOL]DPRVRVWUHLQRVLQWHUYDODGRVXWLOL]DPRVQRV-
WUHLQRVGHSRLVGHDOJXPWHPSRFRPHoDDREVHUYDU VDUHVHUYDGHJOLFRJrQLRDUPD]HQDGDQRP~VFXORH
TXHVXDSHUIRUPDQFHSRXFRVHDOWHUDHjVYH]HVPH- ItJDGR&RPRHVWDUHVHUYDpOLPLWDGDDVRPDWyULD
OKRUDGHPDQHLUDPXLWRWtPLGD´DOHUWD2UWL] GRWHPSRGRVWLURVQmRGHYHXOWUDSDVVDUDWpQR
%DVLFDPHQWHDSUHSDUDomRSURSRVWDSHORWUHLQD- Pi[LPRPLQXWRV'HQWURGHVVDGXUDomRRDWOHWD
GRU SDUD TXHP TXHU FRPSOHWDU XPD PHLD FRQVLVWH SRGHFXPSULUSRUH[HPSORWLURVGHPLQXWRV
HPNPDNPQDVGXDVDRLWRVHPDQDVTXHSUH- RX  WLURV GH  PLQXWRV RX  WLURV GH  PLQXWRV´
FHGHPDSURYD³$QWHVGLVVRRDWOHWDGHYHULDHVWDU H[HPSOL¿FD
WUHLQDQGRSHORPHQRVNPDNPQDVHPDQDHP $YHORFLGDGHTXHHOHLUiFXPSULUDSURYDpSUD-
GRLVDWUrVWUHLQRVMiKiYiULRVPHVHV2PDLVLP- WLFDPHQWH D PHVPD GR ž OLPLDU ³3RU H[HPSOR
SRUWDQWHpTXHSHORPHQRVXPWUHLQRVHPDQDOWHQKD TXHP WLYHU R ž OLPLDU HP NPK D WiWLFD SHUIHL-
GLVWkQFLDGHNPDNPHRVGHPDLVSRGHPVHU WDSDUDHOHID]HUHVWDGLVWkQFLDpMXVWDPHQWHQHVWD
PDLVFXUWRV NPDNP (VWHpRYROXPHPtQLPR YHORFLGDGH QHP DFLPD QHP DEDL[R$WOHWDV SUR-
0HQRV TXH LVVR SURYDYHOPHQWH HOH WHUi TXH ID]HU ¿VVLRQDLV FKHJDP D WHU HVWH tQGLFH HP NPK H
DOJXPDVFDPLQKDGDVGXUDQWHDSURYD´ NPK´ H[SOLFD 6HJXQGR R WUHLQDGRU XPD GH
2V ORQJRV UHDOL]DGRV QXPD LQWHQVLGDGH PHQRU VXDVDOXQDVTXHHVWUHDYDQDGLVWkQFLDXWLOL]RXHVWH
±RWUHLQDGRUWUDEDOKDFRPPHGLomRSRUPHLRGHOL- VLVWHPDGHWUHLQDPHQWRHFRPSOHWRXD0HLDGH6mR
PLDUHVVHQGRRLQGLFDGRSDUDHVWHWLSRGHWUHLQRR 3DXORHPK

13
SUPERAÇÃO
treinamento

u s to s
s em s
42k m

&RUUHUXPDPDUDWRQDGH¿QLWLYDPHQWHQmRpSDUD TXHHQIUHQWDUXPDPDUDWRQDVHPWUHLQRHVSHFt¿FR
TXDOTXHUXP3HORPHQRVFHUWDPHQWHQmRpSDUDRV UHVXOWDUiQXPVRIULPHQWRDLQGDPDLRU±HFRQFHQWUD-
PDLV LPSDFLHQWHV $ SURJUDPDomR GHYH VHU IHLWD GRGXUDQWHNP±JHUDQGRDWpDYHUVmRjGLVWkQFLD
VHPDWURSHORVFRPXPVHPHVWUHGHDQWHFHGrQFLDH ³6HFRQVHJXLUFRPSOHWDUDGLVWkQFLDVHPWUHLQRYDL
DH[SHULrQFLDQRPXQGRGDVFRUULGDVGHYHVHUGHQR VHUHPFLPDGHPXLWDGRUHRDWOHWDSRVVLYHOPHQWH
PtQLPRXPDQRVHQGRTXHRLGHDOpUHDOL]iODDSyV QmR YDL TXHUHU PDLV SDUWLFLSDU GH PDUDWRQDV SRLV
WUrVDQRVGHWUHLQRVVHPLQWHUUXSomRSDVVDQGRSRU YDL OHYDU PXLWR WHPSR SDUD VH UHFXSHUDU 6LWXDomR
GLYHUVDV SDUWLFLSDo}HV HP FRPSHWLo}HV PHQRUHV GLIHUHQWHGDTXHOHDWOHWDWUHLQDGRTXHHVWDUiLQWHLUR
LQFOXLQGR PHLDV PDUDWRQDV ³4XDQWR PDLV H[SH- DSyVXPDVHPDQD´
ULHQWHHWUHLQDGRIRURPDUDWRQLVWDPHOKRUIDUiVHXV $ SUHSDUDomR EiVLFD SURSRVWD SRU 0LULDP p
UHVXOWDGRVSRLVDSURYDH[LJHPDWXUDomRRUJkQLFD FRPSRVWDGHVHLVPHVRFLFORVGLYLGLGRVHPSHUtRGR
¿VLROyJLFD GH UHVLVWrQFLD SVLFROyJLFD H PXLWD H[- GHEDVHULWPRGHFRPSHWLomRFRPSHWLomRHDSURQ-
SHULrQFLDQDDGPLQLVWUDomRGDGLVWkQFLDSDUDRERP WHTXHYDULDPHPUHODomRDRYROXPHHLQWHQVLGDGH
GHVHPSHQKR DWOpWLFR VDXGiYHO´ IULVD D WUHLQDGRUD VHQGR TXH DV ~OWLPDV  VHPDQDV GH WUHLQDPHQWR
0LULDP&DOGDVVR HVSHFt¿FRVmRSULPRUGLDLV³$TXLORPHWUDJHPPt-
3DUDTXHPVHDQLPRX0LULDPDYLVD³2GLItFLO QLPDGHYHVHUGHNPVHPDQDLVVHQGRTXHDFDGD
14
16 p UHDOL]DU WRGR R WUHLQR GD PDUDWRQD H QmR FRUUHU
DSURYD´(PFRQWUDSDUWLGDDSUR¿VVLRQDOVDOLHQWD
VHPDQDGHYHVHDFUHVFHQWDUXPSRXFRGHTXLORPH-
WUDJHP FRPR SRU H[HPSOR NP DWp D WHUFHLUD
VHPDQD GH FDGD PrV EDL[DQGRD QD TXDUWD VHPD- PXOWLSOLFDUDPDUFDGDPHLDSRUGRLVHVRPDUHQWUH
QD SDUD VHGLPHQWDomR GR WUHLQR SRGHQGR FKHJDU HPLQXWRV3RUH[HPSORTXHPID]RVNP
D NP GHSHQGHQGR GR FRQGLFLRQDPHQWR ItVLFR HP K IDULD D PDUDWRQD HQWUH K H K RX
$VVLP GHYH VHJXLU D PHVPD SURJUHVVLYLGDGH DWp VHMDQXPULWPRHQWUHPLQHPLQNP³(VVH
FKHJDUGLDVGHDQWHFHGrQFLDjSURYDTXDQGRVH FiOFXORpyWLPRSDUDGHWHUPLQDURULWPRTXHRDWOHWD
GLPLQXLDTXLORPHWUDJHPSDUDFKHJDUQRGLDGDPD- GHYHODUJDUSDUDDPDUDWRQDVHPRULVFRGHTXHEUD
UDWRQDEHPGHVFDQVDGR´H[SOLFD &ODUR TXH LVVR EDVHDQGRVH HP XP FRUUHGRU TXH
2 LGHDO VHJXQGR D WUHLQDGRUD p GLVSRU GH VHLV WHQKD UHDOL]DGR R WUHLQDPHQWR HVSHFt¿FR GD SUR-
GLDVGHWUHLQDPHQWRSRUVHPDQDRTXHQR¿QDOGDV YDTXHDDGPLQLVWUDomRGHULWPRVHMDQHVVDPpGLD
FRQWDV UHVXOWD HP FHUFD GH  KRUDV VHPDQDLV GH HFRPWRGRVDTXHOHVFXLGDGRVGHHVWDUDOLPHQWDGR
GHGLFDomRQ~PHURTXHDXPHQWDSURSRUFLRQDOPHQ- KLGUDWDGRHWF´
WHHPUHODomRDRUHQGLPHQWRTXHVHEXVFDQDSUR-
YD&DVRQmRGLVSRQKDGHWDQWRWHPSR0LULDPYr
FRPRRPtQLPRSRVVtYHOTXDWURGLDVGHWUHLQRSRU
VHPDQD
$VURGDJHQVGRFDQGLGDWRDPDUDWRQLVWDYDULDP
EDVWDQWHPDVJHUDOPHQWH¿FDPHQWUHHNPGLD
± R TXH DFRQWHFH JHUDOPHQWH DRV GRPLQJRV ³(P
DOJXQV GLDV R LPSRUWDQWH p URGDU R WHPSR GH GX-
UDomRVHPVHLPSRUWDUFRPDGLVWkQFLDSHUFRUULGD
,VVR SRGH VHU IHLWR SRU K D K HP ULWPR OHYH
FRP IUHTXrQFLD FDUGtDFD DEDL[R GH ESP SDUD
DGTXLULUUHVLVWrQFLDPXVFXODUORFDOL]DGDDGDSWDUR
VLVWHPD¿VLROyJLFRHDGDSWDUDUHVLVWrQFLDSVLFROy-
JLFD´ LQGLFD 0LULDP TXH UHFRPHQGD HVWH WLSR GH
WUHLQRXPDYH]SRUVHPDQD
1R WUHLQR GRPLQLFDO DV GLVWkQFLDV SRGHP YD-
ULDU 3RU H[HPSOR QR SULPHLUR PrV GR WUHLQD-
PHQWR HVSHFt¿FR NPNPNPNP QR
VHJXQGR NPNPNPNP QR WHUFHLUR
NPNPNP DWp FKHJDU D FRPSHWLomR 2V
LQWHUYDODGRV ¿FDP FRP GXDV VHVV}HV VHPDQDLV
SRGHQGRVHUVHSDUDGRVHQWUHLQWHUYDODGRVGHULWPR
PDLVORQJRV HPXPGLDHGHYHORFLGDGHHPRXWUR
$ WUHLQDGRUD OHPEUDTXH PDUDWRQDp ULWPR GDt
DLPSRUWkQFLDGRVWUHLQRVLQWHUYDODGRV2VWLURVSR-
GHPVHULJXDLVRXSURJUHVVLYRVHUHVSHLWDURVLQWHU-
YDORV p IXQGDPHQWDO ³&DGD DWOHWD GHYH FDOFXODU R
WHPSRGRVWLURVDWXDLVVREUHDPpGLDGRWHPSRGD
H[HFXomRGRVWLURVGR~OWLPRWUHLQRSDUDVHUYLUGH
EDVHDRSUy[LPRWUHLQR´LQIRUPD0LULDP
$ SULQFLSDO UHIHUrQFLD SDUD VDEHU TXDO D PHWD
SDUDRVNPpDPHLD³2WHPSRYDLVHUUHODWLYRDR
ULWPR TXH HOH FRQVHJXH URGDU RV IXQG}HV NP 
DRVWHPSRVTXHH[HFXWDRVLQWHUYDODGRVDRVHXPH-
OKRU WHPSR QRV NP QD PHLD PDUDWRQD HWF 2X
VHMD GRLV RX PDLV DWOHWDV SRGHP ID]HU R PHVPR
WUHLQR GD SODQLOKD H DWp D PHVPD TXLORPHWUDJHP
SRUpPFDGDXPFRUUHQGRHPVHXULWPRHJUDXGH
FRQGLFLRQDPHQWR´ SRQGHUD 0LULDP 3DUD FDOFXODU
RULWPRDVHUDGRWDGRQDSURYDDWUHLQDGRUDLQGLFD

15
SUPERAÇÃO
treinamento

GA R LÁ
CHE
COMO
LSRGH
XWD UG HWH UPLQDGRW UDU
H[H F VXSH
DUWLFXODUHP SUR¿VVLRQDLV SDUD
OGD GHS V KR H
Y R UH VWD  GL¿FX DOHP DV GLFDV GR UH o DP  SHOR FDPLQ
UDRREMHWL HLQR Y TXH DSD WUiV
LVVDV SDUDFKHJD GHDOpF ODUR WU LVTXHU REVWiFXORV GDVRVµQmRV¶SDUD
P L D
,GHQWL¿FD
GDVDVSUH DUDLVVRR XH¶ TX DYH]SRU
WR
DPmRQDPDVVD3  PDVFDVRµHPSDT  GHL[DUGHXP
U V D
DJRUDERWD PWRGRVRVVHQWLGR XVLQWDTXHWHPXP
DOKDU H H QWRR
pWUDE RWUHLQDP
DVSHFWRG
HPDOJXP

16
17
SUPERAÇÃO
treinamento

POR QUE OS TREINOS NÃO SÃO


IGUAIS PARA TODO MUNDO?

4XDQGR VH IDOD TXH p QHFHVViULR EXVFDU DMXGD 2 - Sobrecarga progressiva: p


GH SUR¿VVLRQDLV SDUD SUHVFUHYHU H DFRPSDQKDU R DXPHQWR JUDGXDO H VLVWHPiWLFR GH WHQVmR RX
RV WUHLQRV GH FRUULGD QmR p XPD TXHVWmR GH IRUoD DSOLFDGD VREUH R VLVWHPD ¿VLROyJLFR RX
SUHFLRVLVPR&DEHDHOHVDQDOLVDUDVYDULiYHLVTXH VREUHXPyUJmRD¿PGHHYLWDUULVFRVGHOHVmR
GLIHUHQFLDPXPFDVRGRRXWURDYDOLDQGRGHVGH RXGHIDGLJDFU{QLFD([DJHUDUQROHYDQWDPHQWR
FDUDFWHUtVWLFDVItVLFDVDWpWHPSRGLVSRQtYHOSDUD GH SHVRV RX QDV FRUULGDV SRGH DXPHQWDU R
DDWLYLGDGHSDVVDQGRSHORKLVWyULFRQRHVSRUWH ULVFR GH OHVmR 6XEPHWHU R FRUSR j VREUHFDUJD
REMHWLYRV HWF ( LVVR GHYH VHU HQFDL[DGR QRV PXLWR UDSLGDPHQWH UHSUHVHQWD JUDQGH DPHDoD
SULQFtSLRVGRWUHLQDPHQWRHVSRUWLYRGHIRUPDD DR RUJDQLVPR HP WHUPRV ¿VLROyJLFRV 0HVPR
QmRXOWUDSDVVDUROLPLWHHQWUHSUHSDUDURFRUUHGRU TXH R DWOHWD FRQVLJD HYLWDU SRVVtYHLV OHV}HV
SDUDVXDPHWDHHYLWDUOHV}HVHVREUHFDUJDV6mR PXVFXORHVTXHOpWLFDVDLQGDDVVLPSRGHSDVVDUD
HVVHVSULQFtSLRVTXHYmRGLIHUHQFLDURWUHLQRGH VRIUHU GH IDGLJD FU{QLFD 2 LGHDO p DXPHQWDU D
XPDSHVVRDSDUDRXWUDSHVVRD FDUJDGRVSHVRVSURJUHVVLYDPHQWHRTXHUHGX]
DDPHDoDGHOHVmRSRLVSHUPLWHRGHVFDQVRHD
1 - Sobrecarga: pDDSOLFDomRGHHVWUHVVH UHFXSHUDomRDGHTXDGDGRVP~VFXORV
RX GHPDQGD PDLRU GR TXH D QRUPDO VREUH R
VLVWHPD¿VLROyJLFRRXVREUHDOJXPyUJmRTXH 3 - Adaptação: p D FDSDFLGDGH GH XP
UHVXOWDHPDXPHQWRGDIRUoDRXGDIXQomRGRV VLVWHPD RX yUJmR SDUD VH MXQWDU DR HVIRUoR
PHVPRV (VWH SULQFtSLR H[SOLFD R PpWRGR SHOR RX VREUHFDUJD DGLFLRQDO D SDUWLU GR DXPHQWR
TXDOYRFrPHOKRUDRVHXFRQGLFLRQDPHQWRItVLFR GH IRUoD RX IXQomR 2 FRUSR KXPDQR DGTXLUH
$R ÀH[LRQDU R DQWHEUDoR UHSHWLGDPHQWH RV PDLRU FRQGLFLRQDPHQWR ItVLFR SRUTXH VH
P~VFXORVGREtFHSVVRIUHPSRXFDRXQHQKXPD DGDSWD jV H[LJrQFLDV TXH OKH VmR LPSRVWDV 6H
PXGDQoD 3RUpP DR ÀH[LRQDU R DQWHEUDoR R FRUSR GHVHPSHQKDU UHSHWLGDPHQWH R PHVPR
UHSHWLGDPHQWH FRP XP SHVR DGLFLRQDO RX XPD WLSRGHH[HUFtFLRFRPDPHVPDFDUJDGHSHVR
IRUoD µPDLRU GR TXH D QRUPDO¶ RV P~VFXORV R H[HUFtFLR YDL VH WRUQDQGR PDLV IiFLO SRLV R
UHVSRQViYHLV SRU HVWH PRYLPHQWR JDQKDUmR FRUSR YDL VH DGHTXDQGR j VREUHFDUJD 3DUD
IRUoD 6H YRFr GHVHMD PHOKRUDU D IXQomR RX D DXPHQWDU R GHVHPSHQKR GHYH KDYHU DXPHQWR
IRUPDItVLFDGHYHVREUHFDUUHJDUDTXHOHP~VFXOR QDFDUJDSDUDTXHRFRUSRVHDGSWHDFDGDQRYR
RX VLVWHPD 2 PpWRGR PDLV FRPXP SDUD GHVD¿R
VREUHFDUUHJDU R VLVWHPD PXVFXORHVTXHOpWLFR
p R WUHLQDPHQWR GH UHVLVWrQFLD 2 XVR GH 4 - Especificidade: pRSULQFtSLRTXH
SHVRV HOiVWLFRV UHVLVWLGRV RX R XVR GD SUySULD UHFRPHQGD R WUHLQDPHQWR H[FOXVLYR GD SDUWH
UHVLVWrQFLD GD iJXD KLGURJLQiVWLFD  REULJDUi GR VLVWHPD RX GR FRUSR TXH HVWHMD UHFHEHQGR
RVP~VFXORVWUDEDOKDGRVDID]HUHPXPHVIRUoR D VREUHFDUJD $ DGDSWDomR ¿VLROyJLFD VHUi
DLQGDPDLRUUHVXOWDQGRQRDXPHQWRGHIXQomR HVSHFt¿FD SDUD HVWD SDUWH GR FRUSR RX VLVWHPD
RX GH IRUoD 2 VLVWHPD FDUGLRUUHVSLUDWyULR HQYROYLGR
WDPEpPGHYHVHUVXEPHWLGRjVREUHFDUJDFRP
R SURSyVLWR GH PHOKRUDU DV VXDV IXQo}HV 2 5 - Variabilidade/Treinamento
SULQFtSLRGHVREUHFDUJDSRGHVHUXWLOL]DGRDLQGD cruzado: p D YDULDomR GD LQWHQVLGDGH GD
SDUDGHVHQYROYHUDÀH[LELOLGDGH
18
16 GXUDomR RX GR HVWLOR WUHLQDPHQWR FUX]DGR 
GDV VHVV}HV GH H[HUFtFLR QD EXVFD GH XP HPUHDGTXLUtORHPUD]mRGRVGLYHUVRVIDWRUHV
PHOKRUHTXLOtEULRPXVFXODUHGHXPDH[FHOHQWH DVVRFLDGRVjPHPyULDGRP~VFXOR
IRUPD ItVLFD $XPHQWDU D GHPDQGD VREUH RV
GLYHUVRVJUXSRVPXVFXODUHVRXVREUHRVLVWHPD 7 - Diferenças individuais/
¿VLROyJLFRSRVVLELOLWDXPSURFHVVRGHDGDSWDomR Individualidade biológica:
PDLV DPSOR SDUD R FRUSR $ GLYHUVL¿FDomR PXLWRV IDWRUHV FRQWULEXHP SDUD D YDULDomR
p QHFHVViULD GHYLGR j OHL GD HVSHFL¿FLGDGH LQGLYLGXDO HP UHVSRVWD DR WUHLQDPHQWR 'H
)D]HQGR VHPSUH R PHVPR WLSR GH H[HUFtFLR FRQVLGHUiYHO LPSRUWkQFLD p R QtYHO GH DSWLGmR
RV UHVXOWDGRV DOFDQoDGRV VHUmR VHPSUH RV UHODWLYD GD SHVVRD QR LQtFLR GR WUHLQDPHQWR
PHVPRV 0XLWDV SHVVRDV HQIUHQWDP SUREOHPDV e LUUHDO HVSHUDU TXH SHVVRDV GLIHUHQWHV
FRPRVSURJUDPDV GHH[HUFtFLRV9DULDU RWLSR HVWHMDP QR PHVPR ³HVWDGR´ GH WUHLQDPHQWR
GH WUDEDOKR ItVLFR SURYDYHOPHQWH GDUi D HVVHV DR PHVPR WHPSR e FRQWUDSURGXWLYR LQVLVWLU
DWOHWDVDPRWLYDomRWmRGHVHMDGDSDUDFRQWLQXDU TXH WRGRV RV PHPEURV GH XPD PHVPD HTXLSH
SHUGHQGR SHVR RX DOFDQoDU VHXV REMHWLYRV GH WUHLQHP GD PHVPD PDQHLUD RX FRP R PHVPR
PHOKRU FRQGLFLRQDPHQWR TXH OKH p LPSRVWR ULWPR UHODWLYR RX DEVROXWR GH WUDEDOKR 2V
$FLPDGHWXGRDYDULDELOLGDGHpXPGHYHUSDUD EHQHItFLRV GR WUHLQDPHQWR VmR DPSOLDGRV
DVD~GHHSDUDRWUHLQDPHQWR TXDQGRRVSURJUDPDVVmRSODQHMDGRVGHIRUPD
D VDWLVID]HU DV QHFHVVLGDGHV H FDSDFLGDGHV
6 - Reversibilidade: pRSULQFtSLRTXH LQGLYLGXDLV GRV SDUWLFLSDQWHV 8P LQGLYtGXR
FRQVWDWDDUHYHUVmRJUDGXDOGRFRUSRDRHVWiJLR p R UHVXOWDGR GD VRPD GR JHQyWLSR EDJDJHP
GH SUpWUHLQDPHQWR TXDQGR Ki LQWHUUXSomR JHQpWLFD WUDQVPLWLGD DR LQGLYtGXR   IHQyWLSR
GRV H[HUFtFLRV 2 FRQGLFLRQDPHQWR QmR SRGH H[SUHVVmR GRV JHQV GHWHUPLQDGD SHOD KHUDQoD
VHU LQWHUURPSLGR 4XDQGR LVVR DFRQWHFH DV JHQpWLFD 2VJHQyWLSRVSRGHPVHUFODVVL¿FDGRV
IXQo}HV ¿VLROyJLFDV H D IRUoD UHWRUQDP DRV FRPR ELyWLSR FRPSRVLomR FRUSRUDO SURYiYHO
QtYHLVLQLFLDLVGHFRQGLFLRQDPHQWR$UHYHUVmR IRUoD Pi[LPD SRVVtYHO SURYiYHO SHUFHQWXDO
pRSULQFtSLRPHQRVDSUHFLDGRSHORVSUDWLFDQWHV GH ¿EUDV PXVFXODUHV ( RV IHQyWLSRV FRPR
GHH[HUFtFLR2XYRFrWUDEDOKDRFRUSRRXSHUGH QtYHO GH GHVHQYROYLPHQWR PXVFXODU QtYHO GR
R FRQGLFLRQDPHQWR 8P IDWR TXH SRGH VHUYLU FRQVXPR GH 2ð 92ð Pi[  SHUFHQWXDO UHDO GH
GHFRQVRORpDFDSDFLGDGHGRFRUSRDUPD]HQDU ¿EUDVPXVFXODUHVHIRUoDPi[LPD$OpPGHVVDV
XPD ³PHPyULD PXVFXODU RX FRQGLFLRQDGRUD´ FDUDFWHUtVWLFDV LQGLYLGXDLV FDUDFWHUtVWLFDV
3HVTXLVDV LQGLFDP TXH LQGLYtGXRV TXH FROHWLYDVFRPRUDoDLGDGHVH[RHRQtYHOVyFLR
PDQWrP XP ERP QtYHO GH FRQGLFLRQDPHQWR HFRQ{PLFRFXOWXUDO LQÀXHQFLDUmR QD IRUPDomR
SRU XP ORQJR SHUtRGR SHUGHP RV EHQHItFLRV GDLQGLYLGXDOLGDGH
¿VLROyJLFRV PDLV OHQWDPHQWH 4XHP Mi WHYH
XPERPFRQGLFLRQDPHQWRWHUiPDLVIDFLOLGDGH Elaborado por Miriam Caldasso

Prerrequisitos
10km 21km 42km
([SHULrQFLD  PHVHVDDQR  0DLVGHDQRHPHLR  7UrVDQRV
.PVHPDQDO  NPHPPpGLD  DNPHPPpGLD  NPHPPpGLD
7HPSRVHPDQDO  0i[K  DKHPPpGLD[PXVFXODomR KHPPpGLD
'LDVGHWUHLQR  [VHPDQD  0tQLPR[VHPDQD  D[VHPDQD

19
SUPERAÇÃO
vida corrida

Fotos: Shutterstock

TUDO NOS
CONFORMES?
NEM TANTO!
20
16
Estudo da Federação Paulista de Atletismo mostra
que 23% das corrida de rua do estado ainda são
realizadas de forma irregular

Julianne Cerasoli

G
rande centro da corrida de rua no Brasil, sultado da análise de toda a infraestrutura, desde o
São Paulo aposta cada vez mais em quali- percurso, passando pelo acompanhamento de téc-
dade. Pelo menos é para isso que a Federa- nicos especializados, postos de água e presença de
ção de Atletismo Paulista (FPA) trabalha. Dados da equipe médica, por exemplo. Apesar de o número
entidade revelam que, em 2008, foram disputadas de competições ilegais preocupar, pode-se observar
282 provas no estado, com total de 372 mil ins- XPDPHOKRUDVLJQL¿FDWLYDQRFHQiULR8PH[HPSOR
critos. Números impressionantes, sem dúvida. No está na estatística de que, em 2001, quando a pre-
entanto, o dado que tem merecido maior atenção é sidência da federação implantou o Departamento
o de 65 corridas, ou 23%, realizadas sem o devido de Corridas de Rua, só 11 documentos foram re-
alvará de regulamentação e autorização do evento gistrados.
esportivo. Porém, o objetivo é se aproximar o máximo
O documento, expedido pela federação, é re- possível de 100%. “Vejo a tendência a uma maior

A importância de regulamentar
- O alvará emitido pela FPA é o documento que credencia o evento quanto a sua estrutura organizacio-
nal e técnica, desde a quantidade de água disponibilizada até, e principalmente, o material humano.

- Em São Paulo, capital, sem o alvará emitido pela FPA, a Companhia de Engenharia do Tráfego – CET
não acolhe, por questão legal, o pedido para a realização de um determinado evento.

- Os custos para se obter o alvará, bem como os relativos aos trabalhos de supervisão da FPA, são
definidos de acordo com as particularidades e objetivos de cada evento.

- Os benefícios do alvará para o promotor de eventos são vários. Ele estará cumprindo a lei e, assim,
poderá mostrar a todos os seus parceiros e patrocinadores que sua realização está credenciada pelo
único órgão responsável pela atividade no Estado de São Paulo, que é a FPA. Aos participantes, ficará
clara a transparência do evento, bem como a aplicação das normas de segurança devidas.

- A obtenção de alvará tem, como primeiro passo, o preenchimento, por parte do organizador, de for-
mulários específicos. O conteúdo será analisado pelo Departamento de Corridas de Rua da FPA, que
levará em consideração a estrutura apresentada, tendo a prerrogativa de vetar os eventos que possam
trazer prejuízos à sociedade.

21
SUPERAÇÃO
vida corrida

compreensão dos organizadores no sentido de fa- departamentos de trânsito das cidades e das secre-
zer eventos melhores, em condições mais adequa- tarias municipais de esportes. “Devido a esses re-
das para os atletas de performance e para a popula- sultados, encaminhamos nossa preocupação quan-
ção em geral. Isso, ressalto, é uma tendência. Mas, to à segurança transmitida pelo alvará ao secretário
ainda, alguns deles fogem para não pagar as taxas, de Esportes, Lazer e Turismo, Claury Santos Alves
que são relativamente baixas para a supervisão do da Silva, para que faça uma carta de intenções e
evento. Costumo dizer aos organizadores que a um fórum com os secretários municipais para dis-
responsabilidade de quem faz provas para 50 ou cutir a melhor forma de participação dessas cida-
5.000 pessoas é a mesma. Por isso temos de seguir des. Muitos deles não sabem sequer que existem
as normas. O custo para cumpri-las é muito mais normas. E até permitem que organizadores menos
baixo do que fazer uma prova irregular em que as esclarecidos realizem competições sem a devida
FKDQFHVGHDOJRGDUHUUDGRVmRVLJQL¿FDWLYDVHDV organização e sem cumprir as regulamentações.
consequências bem piores do que pagar um sim- Para que haja crescimento sustentado, precisamos,
ples alvará de supervisão”, observa o presidente da a cada ano, aperfeiçoar o nível de eventos. Assim,
FPA, José Antonio Martins Fernandes. haverá mais participantes disputando com plena
O dirigente salienta que este é um trabalho con- segurança e não fazendo de sua corrida uma aven-
junto da entidade com o governo do Estado, dos tura”, considera o presidente.
22
16
Outra parte importante desse processo, o corre-
dor pode exercer seu direito de participar de eventos Custos
que lhe deem a devida segurança. “Eles devem pro-
curar participar das provas supervisionadas pelos Confira a Norma nº 07 de reconhecimento e
yUJmRVR¿FLDLVIHGHUDo}HVHVWDGXDLVFRQIHGHUDomR homologação de Corridas de Rua, que traz os
em que todas as normas de segurança, que são regu- valores máximos estipulados pela Confederação
lamentadas, estejam sendo cumpridas pelos organi-
Brasileira de Atletismo:
zadores, como distribuição de água, ambulâncias,
ambulatório, percurso aferido, trânsito controlado
pelo órgão municipal, hospitais em alerta.” “CBAt - NORMA nº 07 - Reconhecimento e
Homologação de Corridas de Rua
Crescimento
Mesmo atingindo uma certa estagnação no es- # 1º - As solicitações devem ser acompanhadas
tado, o número de corridas de rua continua cres- do pagamento da respectiva taxa de
cendo. Para Fernandes, a chave da ampliação da reconhecimento, conforme abaixo:
quantidade de provas está no interior. “A tendência
segue sendo de alta. Na capital, a Prefeitura, por - Prova Classe A-1: R$ 5.000,00 (cinco mil
meio do Secretário de Esportes, Lazer e Recrea-
reais), devendo a CBAt ser consultada sobre a
ção, Walter Feldman, faz provas nas regionais da
cidade, aumentando a estatística em cerca de 20 melhor forma para o seu pagamento.
corridas na capital, juntando-se a outras 60 anuais.
Apesar do crescimento, vejo que em alguns locais - Prova Classe A-2: R$ 4.000,00 (quatro mil
o limite de capacidade já atingiu o máximo, como é reais), devendo a CBAt ser consultada sobre a
o caso da capital paulista. Por outro lado, o número melhor forma para o seu pagamento.
de provas realizadas em 2008 atingiu cerca de 50
municípios de São Paulo, que tem cerca de 650 ci- - Prova Classe B: valor a ser definido pela
dades. Concluímos, então, que muitos municípios respectiva Federação Estadual, ficando limitado
ainda não têm corridas, ou, se têm, não dão conhe-
ao máximo de 50% do valor da taxa da CBAt
cimento à FPA ou à Secretaria Municipal de Espor-
tes. Portanto, vejo, ainda, um potencial de cresci- para prova Classe A.
mento.” Os números revelam que pouco mais de
70% dos corredores paulistas são homens, o que # 2º. - A taxa prevista no parágrafo 1º. acima
também indica um potencial de agregar ainda mais é exclusivamente para a emissão do Permit ou
o público feminino. Alvará pelas entidades respectivas, cumpridas as
Mesmo que o crescimento já não seja tão ace- exigências técnicas das normas, não englobando
lerado, ele certamente é qualitativo. “Vale salien- a prestação de serviços ou de apoio adicionais
tar que, nas provas, as inovações estão cada vez a serem prestados pelas Federações Estaduais
mais presentes e a organização está melhorando.
aos organizadores, sem prejuízo do pagamento
Assim, os organizadores conseguem agregar mais
dos árbitros conforme determinado nestas
patrocinadores e pessoas envolvidas neste esporte
IDVFLQDQWH´UHD¿UPDRSUHVLGHQWH normas, os quais devem ser objeto de acordo
Tão fascinante que, citando um relatório não- específico para cada prova entre a entidade
R¿FLDO IHLWR SHOR FDQDO GH WHOHYLVmR D FDER 6SRU- estadual e o organizador.”
79 )HUQDQGHV D¿UPD TXH D FRUULGD KRMH p D PR-
dalidade mais praticada no Brasil, ultrapassando o De acordo com o presidente, a FPA cobra
futebol. Muito em virtude da facilidade de acesso valores de acordo com o tamanho de cada
ao esporte, assim como à proliferação das provas. competição. E estes valores são acertados com
Por isso, mais do que nunca, é hora de apostar em os organizadores.
qualidade.

23
SUPERAÇÃO
linha de chegada

FILA NIGHT RUN – 2ª ETAPA 2ª RECIFE TE QUER SAUDÁVEL/FARMÁCIA BOMPREÇO


30 DE MAIO – BRASÍLIA (DF) – 10KM 31 DE MAIO – RECIFE (PE) – 10KM

Masculino Masculino
SA Elite SA Elite
1º Israel Barbosa de Deus 31:23 1º Edison Vieira da Silva 31:21
2º Paulo Braz da Silva 31:58 2º Frank Gomes de Oliveira Corre Plantando o Futuro 31:57

SA Nível Ouro SA Nível Ouro


3º Jose Rocha Garcia 32:40 3º Severino Ramos dos Santos Usina São José 32:08
4º César Francisco da Silva 32:50 4º Alexandre Jose dos Santos 32:26
5º Adelmo dos Santos Alves 32:52 5º Rojario Dias da Silva Usina São José 32:38
6º Rildo Pereira da Silva Photo Shop 33:18
SA Nível Prata 7º Jan Eric Lira Corre 33:43
6º Márcio Vieira de Freitas 34:19
7º Antonio Bezerra Soares 34:33 SA Nível Prata
8º Adiel Pereira de Souza 34:56 8º Eraldo Ribeiro Monteiro Usina São José 34:17
9º Nildomar Valadares Passos 35:27 9º Ronaldo Justino Alves Grupo Hi 35:44
10º Elias Souza do Nascimento 35:29 10º Jailson dos Santos Silva 36:16
11º Francisco Felix de Souza 35:33 11º Deuson Nelson Santos Corre 36:16
12º Lucas Pinheiro Beserra 35:57 12º Manoel Jose de Oliveira Corre 36:41
13º Flavio Fernandes Vieira 36:49 13º Ailton Gomes de Veras 36:46
14º Adriano Severino da Silva 36:49
SA Nível Bronze 15º Wellington da Silva Rapidão Cometa 36:51
14º Alvane Ferreira Martins 37:07
15º Marcelo Granato 37:39 SA Nível Bronze
16º Expedito Marques da Fonseca 38:06 16º Luiz Carlos Xavier 37:02
17º Lucas Gualberto Andrade 38:12 17º Armando Johnson da Silva Diários Associados 37:36
18º Gustavo Castro Araujo 38:19 18º Misael Martiniano de Souza Grupo Hi 37:56
19º Cleber Marcos de Toledo 38:26 19º Luciano Luis da Silva 38:04
20º Wellington Moura e Silva 38:30 20º Jose Henrique Coutinho Filho 38:10
21º João Evangelista Vieira 38:32 21º Cristiano José Irineu 38:12
22º Aurelindo de Souza Primo 38:40 22º Gerson Xavier de Oliveira Corre 38:13
23º Carlos Alberto Guimarães 39:08 23º Davi Honorato de Melo Corre 38:19
24º Leonardo Schwindt 39:39 24º Haziel Nascimento Batisia Avançar 38:35
25º Rafael Silva da Rocha 39:41 25º Jose Hilton Barros da Silva Corre 38:42
26º Kleber de Araujo Parussolo 39:48 26º Antonio Laurindo Mota 38:52
27º José Carlos Sousa Costa 39:48 27º Jose Cavalcante de Andrade Cmne 38:54
28º Mauricio R Delmondes 39:50 28º Luciano Ferreira de Souza Corre 38:57
29º Fábio Alves de Oliveira 39:54 29º Eraldo Santana da Silva ADC BomBril 39:09
30º Levi Marques Silva Acorja 39:13
Feminino 31º Jose Aldo da Silva Filho 39:35
SA Elite 32º Wedson S do Nascimento 39:39
1º Odineide Felix de Amorim 37:20 33º Allan Gregorio da Silva Corre 39:50
34º Isaac de Souza Assunção Cepere 39:50
SA Nível Prata
2º Regina Matias da Silva 41:02 Feminino
3º Mirela Albrecht 41:57 SA Elite
4º Jackeline Silva Mendes 43:50 1º Mery Emanuella Oliveira Corredores do Futuro 36:24
2º Waldir Silvestre dos Santo 36:30
SA Nível Bronze 3º Maria de Lourdes Ferreira Multsport Clube de Corredores 37:02
5º Cristina Oliveira 44:04
6º Gleise Fonseca Botelho 44:27 SA Nível Ouro
7º Joelma C. S. Barbosa 46:32 4º Fernanda Maria da Silva 38:00
8º Lilian Silva Freitas 46:46
9º Angelina T Grangeiro 47:08 SA Nível Prata
10º Simone Neiva 47:52 5º Conceição Margarida Gomes Banco BMG 40:17

10K 15K MEIA MARATONA MARATONA


Masculino Masculino Masculino Masculino
*Recorde (27min48) a 31’59” - SA Recorde (42min15) a 49’59 – SA *Recorde (59min33) a 1h09’59” - SA *Recorde (2h06min05) a 2h19’59”-
Elite Elite Elite SA Elite
32min a 33’59” - SA Nível Ouro 50min a 54’59 – SA Nível Ouro 1h10 a 1h13’59” - SA Nível Ouro 2h20 a 2h29’59” - SA Nível Ouro
34min a 36’59” - SA Nível Prata 55min a 59’59 – SA Nível Prata 1h14 a 1h21’59” - SA Nível Prata 2h30 a 2h39’59” - SA Nível Prata
37min a 39’59” - SA Nível Bronze 1h a 1h04’59” – SA Nível Bronze 1h22 a 1h27’59” - SA Nível Bronze 2h40 a 3h19’59” - SA Nível Bronze

Feminino Feminino Feminino Feminino


*Recorde (32min06) a 37’59” - SA Recorde (48min38) a 59’59 – SA *Recorde (1h04min50) a 1h21’59” *Recorde (2h27min41) a 2h44’59’’
Elite Elite - SA Elite - SA Elite
38min a 39’59” - SA Nível Ouro 1h a 1h09’59” – SA Nível Ouro 1h22 a 1h27’59” - SA Nível Ouro 2h45 a 2h59 - SA Nível Ouro

24
16 40min a 43’59” - SA Nível Prata
44min a 47’59” - SA Nível Bronze
1h10 a 1h19’59” – SA Nível Prata
1h20 a 1h29’59” – SA Nível Bronze
1h28 a 1h34’59” - SA Nível Prata
1h35 a 1h43’59” - SA Nível Bronze
3h00 a 3h20 - SA Nível Prata
3h20 a 3h40 - SA Nível Bronze
6º Quiteria Feliciano Barbosa Corre 42:00 44º Daniel Gaspary Teixeira 1:05:15
7º Pamela Moura Cavalcante Acorja 43:02 45º Luiz Guilherme da S Furtado 1:05:32
8º Rizonete Martiniano Corpore Sano 43:03 46º Jose Pinheiro Fernandes 1:05:57
47º José Carlos Rodrigues 1:06:14
SA Nível Bronze 48º Hernando Teixeira Garcia 1:06:14
9º Ana Catarina Siqueira Dias 44:37 49º Ben Ysaac Cohen da Silva 1:06:28
10º Cristiane Alves Xavier 45:00 50º Leonardo Cunha Pimentel 1:06:30
11º Juliana Iob de Oliveira Acorja 46:36
12º Maria Gorete Barbosa Gomes 46:50 Feminino
13º Emanuela Teodozio da Silva ADC BomBril 47:33 1º Gisele Barros de Jesus 1:01:11
14º Joselene Rodrigues de Lima 47:37 2º Elaine Nohra Simões 1:01:37
15º Daniele Carvalho Teixeira ADC BomBril 47:52 3º Raimunda Maria da Fonseca 1:04:27
4º Andreia de Andrade Lengruber 1:04:38
MIZUNO 10 MILHAS 2009 5º Silvia Moreira Lopes Ribeiro 1:04:42
31 DE MAIO – RIO DE JANEIRO (RJ) – 16,09KM 6º Renata Moreira Pereira 1:05:54
7º Andrea Folegatti de Souza Melo 1:06:17
Masculino 8º Claudia Michelle Graeff Cannes 1:08:30
1º Lourival do Nascimento Libanio 51:09 9º Marcela Lemos Barcellos 1:09:23
2º Adair José Henrique dos Santos 52:51 10º Fernanda Corrêa Fernandes 1:10:22
3º Weder Dias Ferreira 54:08 11º Maíra Vendrame 1:11:09
4º Francescole Leonardo Rodrigues 54:56 12º Vanessa Ameixoeira de Seixas 1:12:20
5º Gleiciomar Perreira dos Santos 55:13 13º Gabriela Queyroi Chaves 1:13:03
6º Adriano Ferreira Sanches 55:28 14º Regina Maria Lima Fernandes 1:15:16
7º Carlos Silva 57:05 15º Márcia Moreira Ferreira 1:15:18
8º Flávio Roberto C. dos Santos 57:21 16º Meirian dos Santos 1:15:19
9º Thiago Martins da Silva 58:11 17º Denize Alves da Costa Pires 1:15:24
10º Breno dos Santos 58:20 18º Katia Fuhro de Oliveira 1:15:31
11º José Antonio Souza Silva 59:07 19º Claudia Warrak 1:15:59
12º Fabio Mattos dos Santos 59:13 20º Hellen Rose dos Santos Noel 1:16:14
13º Alex Carvalho dos Santos 59:16 21º Adriana Lutosa Gaspar 1:16:55
14º Renato de Arruda Coradelo 59:31 22º Marilda Gonçalves 1:17:33
15º Carlos Magno da Cruz 59:42 23º Claudia Webber 1:17:35
16º Roberto Dantas Couto 59:44 24º Vera Lucia Reis e Albuquerque 1:17:35
17º Gilson da Rocha Venãncio 59:48 25º Andrea Maria de Freitas 1:17:47
18º José Hilton Cavalcanti 1:00:17 26º Maria Carolina Martins 1:18:10
19º Bruno Gonçalves Rangel 1:00:46 27º Lucia Maiolino 1:18:19
20º Ronald Máximo 1:00:47 28º Glacy Diamantino Leao 1:18:36
21º Antonio Carlos F. da Silva 1:00:54 29º Salete Faria Campos 1:19:37
22º Percy da Silva Justino 1:00:55 30º Suelene das Graças Vieira 1:19:47
23º Ronaldo Veloso Acacio 1:01:25 31º Ricardo David Ibiapina 1:19:54
24º Fabio de Jesus Duarte 1:01:28 32º Juliana de Miranda Vieira 1:20:04
25º Frank Land Pereira Torres 1:01:47 33º Ana Cristina Nunes 1:20:09
26º Pedro Antonio Madalena 1:01:52 34º Fernanda Vale 1:20:19
27º Lindenberg da Costa 1:02:02 35º Maria das Graças Soares 1:20:29
28º Gustavo Luz Tavora 1:02:02 36º Vivian Assis de Oliveira 1:20:59
29º Marival Amaral 1:02:04 37º Rada Skenderija Carvalho 1:21:21
30º Sergio Chibante 1:02:54 38º Hanna Schteinberg 1:21:23
31º Luis Felipe de M Wright 1:03:04 39º Nadia Teixeira de Siqueira 1:21:28
32º Paulo Sergio Pereira 1:03:11 40º Patricia Lima 1:21:28
33º Antonio Munerato Diegues 1:03:24 41º Ana Luiza de Faria Matos 1:21:34
34º Jose Luiz Bruno 1:03:27 42º Letícia Barreto Wermelinger 1:21:42
35º José Carlos Barreto da Silva 1:03:37 43º Maria Beatriz Saade 1:21:55
36º Genivaldo Rosa 1:03:39 44º Cristiane Sousa Braga 1:22:03
37º Jussandro Teles Vieira 1:03:47 45º Inge Penido 1:22:12
38º Josue Soares da Silva 1:04:09 46º Marise Crivelli 1:22:30
39º Gilmar Nogueira de Azevedo 1:04:09 47º Marcia Martins 1:22:52
40º Eduardo Guilherme Sanchez 1:04:13 48º Cláudia Paes Muro 1:22:53
41º Reginaldo Câmara 1:04:20 49º Rosemary Portella 1:23:14
42º Renaldo Avelino Frotté 1:04:22 50º Rosangela Pimentel da Silva 1:23:16
43º Gerlan Campos de Souza 1:04:28
linha de chegada

MARATONA INTERNACIONAL DE SÃO PAULO 63º Jose Feitoza Filho Nova Equipe 2:57:12
31 DE MAIO – SÃO PAULO (SP) – 42KM 64º Misael Nery BarbosaJockey Club de São Paulo 2:57:14
65º Edson Pinheiro dos Santos Hercules/Npn 2:57:36
Masculino 66º Genair Vitor Rezende Ascorb 2:57:39
SA Elite 67º Claudio Banin Jacutinga/Bioleve 2:57:57
1º Elias Kemboi Chelimo 2:13:59 68º Sebastião Roberto da Silva Rest.Kiloucura 2:58:28
2º Franck Caldeira de Almeida Cruzeiro Esporte Clube 2:17:22 69º Irismar Bento de Castro Morro Acima 2:58:38
3º Jose do Nascimento Souza Facitec/Supercei/Rebook 2:19:17 70º Adriano Palmeira de Araujo Jesus 2:58:48
71º Rildo Santana E.C. Tavares 2:59:07
SA Nível Ouro 72º Gilson Vicente da Silva Santos Brasil – Tecon 2:59:32
4º Giomar Pereira da Silva Cruzeiro Esporte Clube 2:21:36 73º Jorge Laurindo Terra 2:59:49
5º Tola Ketema Nigusse 2:22:37 74º Jose Dias de Souza 3:00:12
6º Domingos Nonato da Silva Asics/Adauto Domingues 2:23:21 75º Ronaldo dos Santos Nova Equipe 3:00:31
7º Celio Falcão Acrimet/Top Spin/Runtech 2:26:37 76º Jose Nilson dos Santos Semes Cubatão 3:00:38
8º Marcelo H. Rocha MhrRunnersTeam/LeiteHercule 2:27:58 77º Josenildo Galdino da Silva E.C. Tavares 3:00:40
9º Jose Pereira da Silva Cruzeiro Esporte Clube 2:29:01 78º Renato Modesto Grêmio Penha 3:01:14
10º Jose Rubens da Silva Graficos Sangar 2:29:45 79º José Roberto Bastos Santos E.C.Tavares 3:01:40
11º Ricardo de Melo Rodrigues Limpebras Eng. Ambiental 2:29:57 80º Jailton Pereira da Silva 3:02:07
81º Antonio Marcos Pereira Fr Sports/Itanhaem 3:02:20
SA Nível Prata 82º Edson Epifanio dos Santos Aes Eletropaulo/Race 3:02:22
12º Joseph Kipkemei Talam Fila 2:30:24 83º Jose Miranda Silva 3:02:23
13º Joseph Kiplagat Cheruiyot Fila 2:33:26 84º Charles Eduardo Moura 3:02:29
14º Matusalen de Lima Ubp Pref Frutal 2:33:48 85º Donizete A. da Cunha Extrema Atletismo 3:02:38
15º Genildo Ribeiro Fernandes Pão de Açucar 2:36:20 86º Luis Carlos Silva Ratinho Rotama 3:02:46
16º Divinomar B dos Santos Praia Clube/Avel 2:37:00 87º Rogerio Ramos Tigre Em Ação 3:02:56
17º Geraldo da Silva 2:37:54 88º Luiz Alberto Lopes dos Reis 100 Limites/Suzano-Santanna 3:03:09
18º Antonio Marcos Ventura Laces/Alegre Es 2:38:00 89º Vilmar Comerlatto Correios 3:03:18
19º Jose Nildo Ferreira Passos Parseca 2:38:03 90º Francisco Expedito Almeida Fluir Run 3:03:31
20º Vanderley Santos Pereira Acrimet/Top Spin/Runtech 2:38:18 91º Edivaldo B. do Nascimento Accord Atletismo 3:03:39
21º Edvaldo Pereira de Souza Branca Esports 2:39:59 92º Carlos Francisco Junior Sesi Garanhuns 3:03:51
93º Ricardo de Abreu Adc Continental do Brasil 3:04:06
SA Nível Bronze 94º José João Chaves Walter Tuche 3:04:12
22º Edson Gonçalves de Oliveira Amizade 2:41:15 95º Antonio Carlos dos Santos Semes Cubatão 3:04:23
23º Paulo João 2:42:24 96º Alexandre Garcia Cesar Medley Triathlon 3:04:32
24º Vladimir da Silva Caoa Hyundai 2:42:41 97º João Barboza de Souza Rodar Aclimação 3:04:32
25º Jorge Celestino da Silva 2:43:18 98º Rodrigo Lobo da Fonseca Lobo - Assessoria Esportiva 3:04:39
26º Osvaldir Fernandes da Silva Sagrado Coração 2:44:19 99º Jorge de Carvalho Cbmerge 3:04:40
27º Ismael de Jesus Eq. Amantes da Natureza 2:44:19 100º Everaldo M. dos Santos Força e Vida 3:04:56
28º Hefer Cardoso de Freitas Garças Brancas/Guaratinguetá 2:45:04 101º Raimundo de Vasconcelos Bradesco Vida e Previdência 3:05:01
29º Adalcio Ferreira dos Santos Prefeitura M Itupeva 2:45:36 102º Esdras Veras Oliveira Atlas Brasil 3:05:07
30º Edevanil Candido Noronha Edelson Esp. e Perf. 2:45:43 103º José Luiz de Moraes 3:05:15
31º Rodeval Santos da Silva Acústica Dan 2:46:36 104º Andre M. de Deus TerraNetworksBrasil–Reebok 3:05:32
32º Reinaldo da Silva Diqbem 2:47:36 105º Renato F. de Oliveira Calhas Pontes 3:05:44
33º Antonio Soares Filho E.C. Tavares 2:47:49 106º Sergio Callipo Junior Sejelp 3:06:29
34º Albano Alves dos Reis Seme/Loja Esportiva Itu 2:47:55 107º Claudomiro dos Santos A.D.C.C.Mercúrio 3:06:31
35º Daniel Faustino dos Santos Rumo Certo Uehara Imóveis 2:48:19 108º Arivaldo Sousa Leite 3:06:45
36º Ires de Oliveira e Silva 2:48:30 109º Agnaldo José Monteiro 3:07:05
37º Francisco dos Santos Silva Osasco 2:49:05 110º Claudio Roberto Macedo 3:07:16
38º Oraldo Romoaldo da Silva Nutriplus 2:49:22 111º Vanderlei Silva Soares Lemier Jeans 3:07:21
39º Basilio Cordeiro da Rocha Basilio e Familia 2:49:40 112º Benedito Jose Lutosa Neto 3:07:26
40º Jose Evandro J SouzaMpr 2:50:11 113º Ailton Fonseca de Oliveira Acorg-Guarujá 3:07:32
41º Segio Jesus do Nacimento 2:50:31 114º Luciano Nagliatti Boainain 3:07:39
42º Manoel Januario da Silva 2:50:36 115º Sergio Santos B. Junior Café Árabe 3:07:42
43º Ronaldo Ribeiro de Miranda Gelo Pro-Lar 2:51:47 116º Aristides Jeronimo Silva Gold Nutrition Industria e Com 3:07:54
44º Edvaldo Oliveira de Souza 2:52:36 117º Carlos Pereira de Rezende Fuga Couros Moto X Smect Já 3:08:03
45º Sergio Pinheiro de Souza Magnesita Refratários S.A. 2:52:44 118º Ivan dos Reis PradoCorlam 3:08:16
46º Harrisson Ramos Dajuda 2:53:12 119º Carlos Soares dos Santos Auto Posto Torres e Reilux 3:08:16
47º Leonildo Jose de Almeida 2:53:13 120º Amarildo Batista Campari 3:08:23
48º Daniel Silva da CostaAfac 2:53:25 121º Julio Cesar Dotti Limite Team 3:08:40
49º Jose Nildo da Silva Bruxinha Produtos Naturais 2:53:37 122º Edjair Cavalcanti da Silva 3:08:55
50º Adalberto Pereira Santos Igreja Bíblica da Paz 2:53:38 123º Valdete Aparecido de Souza 3:09:10
51º Josivaldo da Costa Silva Borghi 2:53:39 124º Luis Railson Filho Jesus em Breve Voltará 3:09:11
52º Ednaldo de Andrade Felix 2:53:41 125º Jose Cassio dos Santos Run For Life 3:09:16
53º Joao Pereira Brandao Filho 2:53:46 126º Manoel Reis de J. Santos 3:09:23
54º Jose Ivanilson da Silva Depósito Apore 2:53:49 127º Fernando Soares da Cruz Morada Imóveis 3:09:26
55º Alex Sandro Tavares Barbosa Afc Cosipa 2:54:01 128º Genilson M. dos Santos Find Yourself 3:09:29
56º Raimundo dos S. Mourao Meta Nutrição Esportiva 2:54:20 129º Antonio Nunes da S. Neto Coca Cola 3:09:30
57º Angelisio Silva dos Reis 2:54:35 130º Luciano Santos Lima Sme/Jpa-Jandira-SP 3:09:39
58º Adimilson de Freitas 2:55:08 131º Menoti Di Paschoal Acústica Dan 3:09:40
59º Claudio Jose Roque Rumo Certo/Caixa 2:56:18 132º Carlos Caltabellotta Caltas 3:09:41
60º Eduardo Silverio Calisto 2:56:21 133º Ivanildo Cassimiro da Silva Piquesporte Academia 3:09:47
61º Carlos Eduardo Rodrigues Cae Personal 2:56:45 134º Almir dos Santos Seme 3:10:00
26
16 62º Cícero Edson Dias da Silva Fabio Fernandes 2:57:00 135º Marinaldo da Costa Santos 3:10:04
136º Benedito da Silva Castro Bosch/Enfa – Lapa 3:10:19 173º Miguel Angelo Duarte Cuca Fortitech 3:15:25
137º Raul Batista Lima 3:10:21 174º José Alves Duarte Secret.Esport.Salto 3:15:28
138º Luiz Antonio Relva Saude & Performance 3:10:22 175º Joabe Heleno de Souza Pelotão Geral 3:15:30
139º Joseni da Silva E.C. Tavares 3:10:35 176º Cicero Aparecido Lima Raça Metais 3:15:34
140º Joaquim Felicio de Souza Bamaq 3:10:36 177º Ivanildo Pinheiro Maciel Flavio Freire A. Esportiva 3:15:38
141º Leandro Mario da Silva Playteam 3:10:43 178º Andre Gustavo Santos Pizzinato Personal 3:15:39
142º Reinaldo R. de Moraes Aasp Sorocaba 3:10:45 179º Amaro Paulo dos Santos Mc Equipe de Corredores 3:15:48
143º Maciel Feitoza de Lima Maciel 3:10:52 180º José Vicente de S. Filho 3:15:50
144º Tiago Kerr Martinez Desbravadores/Hd 3:11:01 181º Pedro Valdelino Rodrigues Pedrinho Iron Man Sorocaba 3:15:59
145º Reinaldo de Souza Lima Sindifícios 3:11:09 182º Benedito Lima Filho Acosm/Sapucaí Mirim 3:16:01
146º Giovani Aparecido Camilo 3:11:20 183º Carlos Martins Franco Metrus-Metro/SP 3:16:29
147º Alexandre Batista Pinto Alex Ironman 3:11:22 184º Hugo R Gonzalez Sfd Services 3:16:30
148º Edgar Pereira de Souza Adriano Bastos Treinamento 3:11:42 185º Carlos Alexandre Lira Drastosa 3:16:37
149º Janilton Carlos Alves Estão Roubando A Mega Sena 3:11:53 186º Jose da Silva Ribeiro 3:16:44
150º Wagner Flavio da Costa HrBolsas/CalçadoseAcessórios 3:11:54 187º Paulo Cizicov Nc Assessoria Esportiva 3:16:51
151º Itamar Jose Zampieri Zampieri 3:11:56 188º Rubens Francisco da Silva Heart Training 3:17:04
152º Ivanildo Jose da Silva Eco 3:11:59 189º Marcelo Costa Souza 3:17:05
153º Adair Jose Silva 3:12:03 190º Geadiel Luiz de Sales Acad.Reentry/Playteam/Prainha 3:17:24
154º Agnaldo Amorim Salvador Taboão da Serra 3:12:03 191º João Lopes Nunes Vo2 3:17:25
155º Edson Soares Ribeiro Tavares 3:12:10 192º Gervásio Araújo Filho 3:17:29
156º Adilson A. do Nascimento Semes Cubatão 3:12:26 193º Erivaldo Nunes de Andrade Quality Life 3:17:35
157º Marcos Rogerio Gomes Usina Moreno 3:12:36 194º Eronildes Rocha dos Santos 3:17:35
158º Jose Paulo dos Santos Acora 3:12:38 195º Odair do Nascimento Posto Arvore Grande 3:17:47
159º Adriano Ricardo Sevilla Aon 3:13:06 196º Samuel Ferreira Magalhães Taboão da Serra 3:17:47
160º Sebastiao Vidal Nery Vidal/C Dutra/Safra 3:13:13 197º Francisco de Araujo Beds Colchões 3:17:48
161º Marco Aurelio de Moraes Churraskinhos 3:13:14 198º José Edmicio dos Santos 3:17:49
162º Jair Gomes da C. da Silva Jesus 3:13:19 199º Jose Rinaldo da Silva Corra Orientado 3:17:57
163º Carlos Alberto V.de Salles 3:13:22 200º Ernani B. dos Santos Neto Pacerribeirão Preto 3:18:02
164º Adao Miranda da Silva Amvv Ass. Esportiva 3:13:44 201º Geraldo R.de Oliveira Jesus Salvador 3:18:05
165º Jose Carlos da Costa 3:13:55 202º Mauro Rosa 3:18:07
166º Jose Nilton Soares Rota da Geografia 3:14:04 203º Nei Carlos Gomes Borghi 3:18:15
167º Gilmar Jose Soares Help Express 3:14:13 204º Haroldo Alves Flores Carlos Eugenio 3:18:18
168º Leonildo da Silva 3:14:15 205º Cesinha Antonio Pires Corredolatras 3:18:20
169º Antonio Derivaldo Alves Bb Tecnologia 3:14:36 206º Alberto Bogliolo Sirihal 3:18:22
170º Ezio Fachini 3:14:42 207º Antonio Sergio N. Moreira Carrefour 3:18:23
171º Rogerio Queiroz e Silva Renovebens/Batalha 3:14:47 208º Joao Theoto Junior Corredólatras 3:18:30
172º Joatas Macena da Silva Fort Diesel e Mecevoks 3:15:11 209º Antonio Aparecido Gomes Bruxinha Prod. Nat. 3:18:39
linha de chegada

210º Benedito Mariano da Silva 3:18:39 15º Vinicius Alves e Santos 39:07
211º Marcos Sanches Bezerra Corpo de Bombeiros do Estado 3:18:41 16º Leonardo Moreno Barros 39:48
212º Antonio Olivio da Silva 3:18:41
213º Jorge Jose da Costa Educa Seela Guaruja 3:18:42 Feminino
214º Paulo Afonso da Silva Correndo Com Jesus 3:18:58 SA Elite
215º Dionizio M.de Oliveira 3:19:00 1º Odineide Felix de Amorim 37:43
216º Pedro Osmar de Almeida Syngenta 3:19:07
217º Adalberto Pessoa de Araujo 3:19:08 SA Nível Prata
218º Elenito Libanio Novaes Oxente-Bahia 3:19:08 2º Mirela C. Albrecht 42:02
219º Valdecir Santos Canuto Cubtao/Projeto Crescer 3:19:08 3º Marlene do Nascimento 43:30
220º Erick Mayer Reis Franca 3:19:15
221º Jose Roboa de Luz Atletas do Bem 3:19:15 SA Nível Bronze
222º Mauro Wedson dos Santos Estilo de Vida 3:19:16 4º Andrelina Cardoso 44:37
223º Jose Carlos de Oliveira 3:19:21 5º Cristina Oliveira 44:58
224º Carlos Alberto F. Lopes 3:19:24
225º Marcos Aurelio G de Souza MG Run/Logos 3:19:33 ECO RUN SÃO PAULO
226º Aureo Adriano Silva 3:19:34 07 DE JUNHO - SÃO PAULO (SP) – 10KM
227º Jose Antonio Caporrino Supermercado Chibana Ltda. 3:19:59
Masculino
Feminino SA Elite
SA Elite 1º Jose Rodrigues dos Santos 30:36
1º Marizete Moreira dos Santos Facitec Supercei Caso DF 2:41:43 2º Claudio J Ferreira 31:37
2º Marizete de Paula Rezende Mizuno 2:44:56 3º Adriano Bastos 31:55

SA Nível Ouro SA Nível Ouro


3º Marily dos Santos 2:45:46 4º Odair Costa 32:25
4º Edielza Alves dos Santos Cruzeiro Esporte Clube 2:51:51 5º Eliano Conga de Lima 32:32
5º Tolla Aberash Tesfaye Fila 2:53:28 6º Tarcisio Fernandes Eloi 32:56
6º Marluce Queiroz Borges Phyto Exências 2:55:30 7º Adailtom Lima 33:50
7º Sandra Aparecida Caporal Santa Constancia 2:56:26
8º Caroline Jepchirchir Fila 2:56:58 SA Nível Prata
9º Yeshanbel Simegn Abnet 2:57:49 8º Abel de Souza 34:01
10º Maria Sandra Pereira Silva Obcursos-Caixa 2:59:40 9º Agostinho dos Santos Lima 34:15
10º Carlos Silva Manoel 34:39
SA Nível Prata 11º Jamirez Assis 34:49
11º Maria Helena de Oliveira 3:09:52 12º Adinaldo Nunes Gadelha 35:06
12º Vivian de Oliveira Adriano Bastos Trein. 3:11:37 13º Moises Monteiro da Silva 35:08
14º Robson Santos 35:37
SA Nível Bronze 15º Rogério Soares da Silva 35:37
13º Michelle Seignier Univ. São Marcos/ Nova Acad. 3:26:50 16º Laercio da Rocha 35:47
14º Rosemeire Ferreira Silva Tavares 3:29:25 17º Ricardo Santos 35:55
15º Luciane Losso 3:31:29 18º Edivaldo da Graça Batalha 36:09
16º Ana Maria Ferreira Duarte Ouro Fino 3:31:43 19º Jose Cicero dos Santos 36:17
17º Maria Marlene B. Lima Taboão da Serra 3:32:08
18º Cleuma Caitano Marques 3:32:18 SA Nível Bronze
19º Maria Cilene da Rocha E.C. Tavares 3:38:11 20º Marcos Ferreira de Mello 37:06
20º Daniela Barcelos de Souza MG Personal Training 3:39:21 21º Gustavo Ayres Netto 37:07
21º Jane Tolentino Futel 3:39:54 22º Itamar José Zampieri 37:07
23º Jorge Silva 37:30
TRACK&FIELD RUN SERIES - BRASÍLIA 24º Arlindo R Santos 37:31
07 DE JUNHO – BRASÍLIA (DF) – 10KM 25º Adao Mariano Aparecido 37:35
26º Acácio Gomes Barbosa 37:56
Masculino 27º Alberto de Oliveira dos Santos 38:11
SA Elite 28º Marco Antonio Oliveira 38:47
1º Paulo Braz da Silva 31:40 29º Fernando Pires Teixeira 38:48
2º Israel Barbosa de Deus 31:58 30º Adriano Gusmao 39:02
31º Fraser Pelvin 39:54
SA Nível Ouro 32º Guilherme de Abreu Gaia 39:55
3º Gilson William dos Reis 32:37 33º Maurício Gomes Florenço 39:57
4º Damião Gomes a Silva 33:27
5º Jurandir Luiz dos Santos 33:43 Feminino
SA Elite
SA Nível Prata 1º Tatiele Roberta de Carvalho 35:37
6º Raimundo Onato de Lima 34:06 2º Shirleide da Silva 37:33
7º Paulo Cesar da Silva Cruz 34:06
8º Joel Rufino da Silva 34:19 SA Nível Ouro
9º Francisco José de Deus Lima 34:44 3º Jaciane Barroso Araujo 38:32
10º Elionaldo Barbosa Santana 35:24 4º Estela Rosa 38:51
11º Lindomar Pereira Cardoso 35:49 5º Vivian de Oliveira 39:47
6º Lindinalva Saraiva da Silva 39:58
SA Nível Bronze

28
16
12º Wesley do Nascimento 37:28 SA Nível Prata
13º Aurelindo de Souza Primo 38:23 7º Paloma Barbosa Vasconcelos 40:17
14º Roberto do Nascimento 38:39 8º Ariane Monticeli 40:40
9º Claudine de Almeida 41:24 6º Maria Luiza Santana 46:08
10º Joelma da Silva Gomes 41:47 7º Joci Pereira dos Santos 46:08
11º Patricia Ribeiro Baezo 42:08 8º Márcia Maria do Nascimento 46:17
12º Renata Bittar 43:11 9º Nelli Rodiani da Costa Mafuz 46:18
10º Ana Lúcia dos Santos Morais 47:07
SA Nível Bronze
13º Ana Lucia Flores 45:09 UNIMED RUN 10K
14º Dulce Melim 46:06 21 DE JUNHO – SÃO JOSÉ DOS CAMPOS (SP) – 10KM
15º Elzioneide Araujo de Souza 46:11
16º Katia Ronise Tedeschi 46:45 Masculino
17º Erika Andrea Izidio Szpektor 47:05 SA Elite
18º Julia do Vale Bargieri 47:27 1º Claudio Jose Ferreira 31:18
19º Márcia Akemi Terashima 47:36
20º Paula Godinho da Silva 47:56 SA Nível Ouro
21º Luiza Helena Tamada 47:59 2º Adailton Miguel de Lima 32:21
3º Jota Junior Pereira Cia Athletica World 32:32
REEBOK 10KM 4º Abel de Souza Cidade de Mogi 33:21
20 DE JUNHO – SÃO PAULO (SP) – 10KM 5º Dario Jose da Rocha Pro Runner –Rocco 33:58

Masculino SA Nível Prata


SA Elite 6º Eder Nunes da Silva Acorj 34:03
1º Adriano Bastos 31:36 7º Higino Miranda Filho Adc Cta 34:07
2º Fabio Nascimento 31:48 8º Jamirez Alves de Assis 34:12
9º Frediano Seni Venino 34:29
SA Nível Ouro 10º Laercio da Rocha Cebel 35:07
3º Caio da Rocha Silva 32:13 11º Leonardo Hebert Lopes 35:19
4º Carlos Moreira dos Santos 32:20 12º Simei Nogueira dos Santos Amigos do Bosque Maia 35:46
5º Alan Wendell Bonfim 32:29 13º Luciano Marcos de Oliveira Acosm/Sapucaí-Mirim 35:50
6º Antonio Fernandes Arruda 33:07 14º Benedito P. de Oliveira Garças Brc/Guara 35:57
7º Tarciso Fernandes Eloi 33:32 15º Diego de Morais Rovida Defreitas 36:16
16º Valdir Oliveira da Silva Amigos do Bosque de Maia 36:39
SA Nível Prata
8º Raimundo Barbosa dos Santos 34:27 SA Nível Bronze
9º Ricardo Antonio de Rezende 35:40 17º Valmir dos Santos Araujo Perfect Body Fitness 37:14
10º Moises Monteiro da Silva 36:14 18º Rogerio Raimundo 37:17
11º Jose Fernando Alvez Barbosa 36:44 19º Altair Alves Andrade 37:33
20º Vander Maciel Vinac 37:37
SA Nível Bronze 21º Daniel dos Santos Acosm/Sapucaí-Mirim 37:45
12º Acácio Gomes Barbosa 37:20 22º Geraldo Aparecido Ribeiro 37:47
13º Arnaldo Aparecido Ferreira 38:06 23º Rogerio dos Santos Fonseca Adc Cognis 37:57
14º Aelson Oliveira Machado 38:36 24º Luis Enrique Gutierrez Ericsson Run&Fun 38:00
15º Clismacleiton da Silva 38:44 25º Cícero Alves dos Santos Cisa Trading 38:05
16º Adriano Gusmão 39:18 26º Jose Geraldo de Souza Petrobras/Un-Revap 38:14
17º Eduardo Ortolan 39:49 27º Armando Ramos Gouveia Inpe – Cocta 38:26
28º Johanlemberg Almeida Fadenp 38:26
Feminino 29º Jose Carlos Pereira Atibaia 38:29
SA Nível Ouro 30º Aluizio Vila Nova Brito Amigos do Bosque Maia 38:54
1º Beatriz Nascimento 38:14 31º Robson de Paula 38:58
2º Rosangela Figueiredo Silva 39:16 32º Paulo Henrique Nogueira Coiotes 38:59
33º Izaias Souza Macena Amigos do Bosque Maia 39:01
SA Nível Prata 34º João Batista Maria Leite Atibaia 39:01
3º Silvia Moreira Lopes Ribeiro 40:03 35º Carlos Shiroshi Kawasaki Ericsson/Run&Fun 39:18
4º Fabiana Roque 40:54 36º Mario Sergio Molica Iserbem 39:19
37º Raimundo de Jesus Amigos do Bosque Maia 39:22
SA Nível Bronze 38º Reinaldo Costa Equipes do Bosque Maia 39:31
5º Juliana Pegurari Cometi 46:04 39º Ailton Carvalho Lima Johnson Clube 39:36
linha de chegada

40º Wilson Pereira Arantes Monsanto Qualidade 39:53 35º Andre Alves de Amorim E.C. Tavares 20:33
41º Eduardo Lopes Fernandes Trainer 39:54 36º Vladimir da Silva Caoa Hundai 20:33
37º Abimael Alves Ribeiro Cmse 20:34
Feminino 38º Jose Fernandes Batista E.C. Tavares 20:35
SA Elite 39º Rogério Soares da Silva RML Training Life Style 20:36
1º Maria Cecilia Severiano 37:49 40º Angelisio Silva dos Reis E.C. Tavares 20:37
41º Edivaldo da Graça Batalha Flavio Freire 20:44
SA Nível Prata 42º Jose Ivanilson da Silva Hosp Dante Pazzanese 20:44
2º Islene dos Santos Souza 40:08 43º José Sérgio Vieira Vo2/Gatorade/adidas 20:51
3º Celia Regina Bittencour Academia Trainer 43:24 44º Henrique Correa dos Santos Pro Runner Team 20:54
45º Delfino Barbosa da Silva Equipe Lobo 20:54
SA Nível Bronze 46º Jesuino Jose dos Santos E.C. Tavares 20:56
4º Beatriz Leonila Moreno Adc Inpe 45:31 47º Valderi de Sousa Lima Jbs 20:59
5º Rebeca Leitao Angeli Cia Athletica World 45:51 48º Admilson dos SantosSEME-Santa Barbara D’Oeste 21:09
6º Sabrina Caires de Jesus Amigos do Bosque Maia 46:57 49º Edson Epifanio dos Santos Montevérgine 21:12
7º Maria Luiza Ribeiro Correia Bosque Maia 46:58 50º Horacelio Paulo da Silva AR4 Running Team 21:12
8º Claudia Simone da Silva Espaço Atlético 47:16 51º Adimilson Santos de Freitas Viação Cidade Dutra 21:15
52º Jose Milton de Lira Corpore/Ibirapuera 21:18
3ª CORRIDA HEBRAICA MACABI BRASIL 53º Josenildo Galdino da Silva E.C. Tavares 21:23
21 DE JUNHO – SÃO PAULO (SP) – 6KM 54º Anderson Jovino da Silva Medial Clube 21:27
55º José Pedro da Silva Bradesco Vida e Previdência 21:28
Masculino 56º Fabio Cardoso de Sena 21:29
1º Sivaldo Santos Viana M Calçados/Diadora 17:58 57º Paulo Henrique S. Lara 21:30
2º Adriano Bastos Pão de Açúcar/BM&F/New Balance 18:01 58º Jose Naldo de Lira Asfaltolokos 21:30
3º Marildo José Barduco Montevérgine 18:09 59º Ivanildo Dias de Souza VO2/Stefanini 21:33
4º Adriano da Silva Soares Vo2 18:17 60º Fábio Keiti Nathanson Pro Runner Team 21:33
5º Naval Freitas M Calçados/Diadora 18:25 61º Jose Ivan Barbosa de Souza Metrus-Metrô/SP 21:34
6º Benedito Donizetti Gomes Calçados/Diadora 18:36 62º Arnaud Martins da Silva Equipe Yoki de Corrida 21:35
7º Ronicesse Felix de Lima Calçados/Diadora 18:37 63º Francisco V. Mergulhão 4any1 21:37
8º Carlos Moreira dos Santos Albino Advogados Associados 18:59 64º Jose Maria dos Santos PlayTeam 21:37
9º Antonio Soares Filho E.C. Tavares 19:11 65º Geraldo Nascimento Oliveira PlayTeam 21:37
10º Oseias dos Santos Ztrack/Clínica Paulista 19:15 66º Douglas Fernando Passarin SEME-Santa Barbara D’Oeste 21:41
11º Gilmar Souza de Almeida 19:19 67º Ozias Cabral Nascimento E.C. Tavares 21:42
12º Evandes Costa dos Santos Dio’s Running Team 19:25 68º Gilberto Brixner 21:48
13º Ricardo de Oliveira Silva E.C. Tavares 19:29 69º Sildeni Costa Rezena Yoki Alimentos 21:49
14º Joseni da Silva E.C. Tavares 19:32 70º Antônio Aparecido Gomes SESC-Interlagos 21:51
15º Giorgio Marques Minc Seguros/Adriano Bastos 19:42 71º Fabio Luis Vasconcelos E.C. Tavares 21:53
16º Jose Carlos da Silva Calçados Casa Eurico 19:43 72º Thiago Felipe Cipriano Painel Musical 21:54
17º Ivaldo Rodrigues Sampaio Medley Triathlon 19:50 73º Reynaldo Costa Painel Musical/Guia de Motéis 21:55
18º Cristojésus Silva Garcia Metrus-Metrô/SP 19:52 74º Reginaldo Maciel Belarmino Espaço Árabe 21:56
19º Barnabé Gomes de Lima SEME-Santa Barbara D’Oeste 19:54 75º Reginaldo dos Santos Ilário PlayTeam 21:57
20º Severino Candido de Araujo FGB Assessoria Esportiva 19:55 76º Thiago Rodrigues Silva Selva Aventura 21:58
21º Fabiano Vieira de Barros Benicio Adv/Correios 19:55 77º Moacir Costa Filho E.C. Tavares/Sindicato 21:59
22º Luciano Alves de Souza E.C. Tavares 19:57 78º Rafael Candido de Oliveira E.C. Tavares 21:59
23º Diego Gonçalves Ferraz Amil 20:02 79º Sebastião Roberto da Silva Marcasinal 22:00
24º Jose Francisco Ramos Dio’s Running Team 20:05 80º Levi Torres dos Santos Sandro Performance 22:02
25º Cicero Edson Dias da Silva Fábio Fernandes 20:10 81º Alexandre Joaquim da Silva pn Treinamento 22:02
26º Diego da Silva Oliveira Pro Runner Team 20:16 82º Adriano Gusmão Comar Adriano Bastos Treinamento 22:05
27º Vanderlei Silva Soares Lemier Jeans/Adriano Bastos 20:17 83º Jose Edmicio dos Santos 22:06
28º Joel Oliveira Santos IronMan Assessoria Esportiva 20:21 84º Adilson Bezerra da Silva 22:06
29º Jose da Silva Xavier PlayTeam 20:25 85º Jose Antonio Caporrino Supermercado Chibana Ltda 22:06
30º Genildo Alcantara de Lima Fábio Fernandes 20:27 86º Jonatas Roger Freitas Pro Runner Team 22:08
31º Carlos Goncalves Costa 20:27 87º João Batista dos Santos 22:09
32º Marcos Pacheco 20:29 88º Carlos Henrique Carvalho Pro Runner Team 22:12
33º Ronaldo dos Santos Nova Equipe Ass Esportiva 20:30 89º Marco Antonio de Oliveira PlayTeam 22:12
34º Edmilson Chaves Ribeiro M Calçados/Diadora 20:32 90º Marcos Aurelio Gonsalves Mg Run 22:14
91º Leandro Mario da Silva PlayTeam 22:15 45º Maria Jose da Silva Garcia 28:56
92º Cláudio Augusto da Silva Hosp. Israelita Albert Einstein 22:17 46º Marcela Menegatti 28:58
93º Pedro A. Pereira E.C. Tavares 22:19 47º Nadia Noriko Harada AES Eletropaulo/Ativida 29:01
94º Mauricio de Andrade Ztrack/Clínica Paulista 22:20 48º Silvia Helena da Cunha 29:04
95º William Masterson Belo Amigos do Bem 22:21 49º Greice Kelly Romão Santos Pro Runner Team 29:06
96º Luciano Elias Lacerda Limit Academia 22:22 50º Elaine Barbosa Gonçalves Corredores 100 Futuro 29:07
97º Jairo Homar Marques Equipe Yoki de Corrida 22:23 51º Fabiana Heleno Toledo ACM-Alphaville 29:09
98º Valdir Raulino Junior Metrus-Metrô/SP 22:26 52º Irene Dias de Andrade Fábio Fernandes 29:11
99º Milton Vieira Vanderley 22:27 53º Luiza da Silva Brito 29:13
100º Gilberto Magalhães Jose Luis Corrida Pedestre 22:29 54º Mayara Silva dos Santos Pro Runner Team 29:13
55º Maria Fernanda de Toledo E.C. Tavares 29:14
Feminino 56º Mônica de Souza Faria Jbs 29:14
1º Janaina Pinto Fernandes VO2/Stefanini 22:44 57º Celina Lucas Melchiori 29:17
2º Vivian de Oliveira Adriano Bastos Treinamento 22:55 58º Luciana de Nigris Garritano pn Treinamento 29:22
3º Olivia de Fatima Fernandes VO2/Stefanini 23:45 59º Natasha Namie Nakagawa 29:23
4º Liane Schwarz Buchman Hebraica 23:57 60º Valdenise Aparecida de Souza Adriano Bastos Treinamento 29:23
5º Maria Margarida Gomes 24:00 61º Tatiane Fernandes 29:24
6º Anarley da Conceição Brito Turma do Peninha 24:38 62º Regina de Cassia Santana Corredores da Cuesta-Botucatu 29:24
7º Jessica Messias Levadinha PlayTeam 24:58 63º Anacir Felix Laureano Anasp 29:26
8º Sofia Mazon Gonçalves T3team 25:07 64º Joana José Alves Osasco 29:32
9º Suzana Christina Gottlob Itaú Unibanco 25:12 65º Fernanda Rabello de Souza PlayTeam 29:34
10º Daniela Barcelos MG Personal Training 25:22 66º Kelly Simões de Lima 29:34
11º Vivian Feher Radomysler 25:40 67º Renata Corrêa Morishita ACM Guarulhos 29:37
12º Patricia Maria Resende Pinto Acrimet/Top Spin/Run Tech 25:50 68º Katia de Freitas Hosp Dante Pazzanese 29:40
13º Nair de Souza N. Carvalho Flavio Freire/Sport Life 25:51 69º Fatima Helena Gentil Equipe 100 Limites 29:41
14º Daniela Micheletti Mucciolo Konex 26:00 70º Matilde Matiko Kussano Diebold Procomp 29:43
15º Maria José Andriola 26:09 71º Silvia Helena Contri Shohet Itaú Unibanco 29:44
16º Marcia Maria do Nascimento Adriano Bastos Treinamento 26:31 72º Teresa Midori Setoue Metrus-Metrô/SP 29:55
17º Tania Rosa da Silva Medial Clube 26:41 73º Aparecida de Fátima Prado Flavio Freire/Na Ativa 29:57
18º Aline Cristine Canavezi 26:43 74º Aparecida Fátima dos Santos 29:58
19º Rosana Maria Cabral E.C. Tavares 26:44 75º Juliana Scalissi Martins Adriano Bastos Treinamento 29:59
20º Andreia Fernandes Martins 26:46 76º Margarete Rose Rodrigues E.C. Tavares 30:00
21º Cristina Toloto Nova Equipe Assessoria 26:53 77º Beatriz Ragazzi Pauli Simão AR4 Running Team 30:00
22º Edeni Ferreira da Silva E.C. Tavares 26:55 78º Vivian Salazar 30:05
23º Maria Cristina Novaes Rosa 26:58 79º Maria Aparecida Plantier Diebold Procomp 30:06
24º Mirian Rodrigues dos Santos MG Run 27:07 80º Marinete da Conceição Lima Medial Clube 30:13
25º Edineuza Araújo Ferreira Medial Clube 27:28 81º Thaís Castro de Oliveira 30:19
26º Sandra Maria de Amorim Corre Rafael 27:29 82º Patricia Lobao Peres 30:19
27º Maria Rita de Jesus Dio’s Running Team 27:36 83º Ryoko Sato Nakao Flávio Freire Asses. 30:20
28º Débora Carla Freitas Barros Ultimate Running 27:41 84º Yassuko Maruo Fairchild E.C. Tavares 30:25
29º Ana Lucia Barbosa Meira Pro Runner Team 27:42 85º Marisa Takahashi Hashimoto Quality Solution 30:27
30º Cleonice Correa Barbosa E.C. Tavares 27:46 86º Silvia Shimabukuro E.C. Tavares 30:33
31º Nara Melo 5 Ways/Bio Running 27:50 87º Carolina Spera Paiva MG Personal Training 30:37
32º Simone Dantas Gutierrez MG Run 27:51 88º Gabriela Novaes Nelson Evêncio Asses. 30:42
33º Fatima Maria N.de Souza Sinsaudesp 27:52 89º Sonia Ap Facas da Silva Marcasinal 30:43
34º Ana Carolina Ferreira 27:58 90º Sueli de Freitas Verissimo C.A.Paulistano 30:43
35º Silvia Moreira Lopes 28:01 91º Cristiane Oliveira da Silva SEME-Santa Barbara D’Oeste 30:45
36º Zelita Frese Pro Runner Team 28:06 92º Marisa Sack 30:45
37º Melissa Luiz de Melo Pro Runner Team 28:07 93º Maura Ioshiko Takemiya Ztrack/Clínica Paulista 30:49
38º Eugenia Maria de Almeida 28:12 94º Luzia Maura Paduim Silva 30:52
39º Alexsandra S. Brito Lazam – Mds 28:24 95º Regina Kiomi Takahira Corredores da Cuesta-Botucatu 30:55
40º Katia Emilia dos Santos 28:27 96º Adesilde Souza Pereira E.C. Tavares 30:58
41º Sylvia Amelia Mantovani AR4 Running Team 28:31 97º Cristiane Guilherme da Silva Crayz 30:59
42º Thais Wagner 28:40 98º Eleazar Cavalcante de Souza 30:59
43º Joyce Pires Lopes Mendes 28:44 99º Ana Cristina Osório Michel Lazam – Mds 30:59
44º Silvana Cole Equipe Básica 28:47 100º Sherida Giannie Boetius PlayTeam 31:00
seu treino

Aescolha
Fotos: Shutterstock

é sua

32
16
Optar pelo treinador que se encaix e melhor no seu
estilo é um dos diferenciais para atingir objetivos na
corrida, sejam eles unicamente esportivos ou
por uma vida mais saudável

Julianne Cerasoli cresce muito. “Além disso, é o melhor momento


para ensiná-lo a técnica e impedir problemas no
IXWXUR´RSLQD
$tFRPHoDRXWURSUREOHPDFRPRHVFROKHUHVVH

M
uito se fala sobre a importância HVSHFLDOLVWD"'HQWUHRVWUHLQDGRUHVFXMDIRUPDomR
de contar com o apoio de um é direcionada ao atletismo também há diferentes
SUR¿VVLRQDOGH(GXFDomR)tVLFD QtYHLV HVWDEHOHFLGRV SHOD ,$$) $VVRFLDomR ,Q-
para orientar os treinamentos de WHUQDFLRQDO GDV )HGHUDo}HV GH $WOHWLVPR  LQGR
corrida. Contudo, na hora de es- GHVGH,  DWp9  3DUDFDGDQtYHORWUHLQDGRU
colher, o que parece simples pode se tornar uma deve preencher determinados requisitos e partici-
PLVVmR PLVWHULRVD VHMD SHOD JUDQGH RIHUWD VHMD SDUGRFXUVRFRQGX]LGRSHODHQWLGDGH(TXDQWR
pela falta de conhecimento acerca do que é neces- mais voltado para a performance é o treinamento,
sário para ser um treinador especializado. Até por- PDLVLPSRUWDQWHLQYHVWLJDUDVFUHGHQFLDLVGRSUR-
que, como em qualquer área, há os bons e os maus ¿VVLRQDO
SUR¿VVLRQDLV3RUWDQWRTXDQWRPDLVLQIRUPDomRD Mas há ainda outros aspectos a atentar-se. O
UHVSHLWR GD IRUPDomR QHFHVViULD H GH TXDLV VXDV JHUHQWH GH GHVHQYROYLPHQWR GD &%$W &RQIHGH-
REULJDo}HVPDLVIiFLOVHUiHVVDWDUHID UDomR %UDVLOHLUD GH$WOHWLVPR  H WUHLQDGRU ,$$)
7HFQLFDPHQWHRIDWRGHRSUR¿VVLRQDOVHUIRU- QtYHO,9/i]DUR3HUHLUD9HOi]TXH]KiDQRVQD
PDGRHP(GXFDomR)tVLFDHSUHIHUHQFLDOPHQWHUH- PRGDOLGDGH OLVWD RV VHJXLQWHV LWHQV D VHUHP RE-
JLVWUDGRQRVFRQVHOKRVUHJLRQDOHQDFLRQDOGDiUHD VHUYDGRVQDKRUDGHHVFROKHUXPWUHLQDGRUFDUDF-
MipXPERPLQtFLRSRLVHVWHVyUJmRVUHVSRQGHP WHUtVWLFDV GH SHUVRQDOLGDGH KLVWyULFR GH UHVXOWD-
SHOD¿VFDOL]DomRGDSUR¿VVmR GRVHVSRUWLYRVKLVWyULFRGHWUDEDOKRFRPDWOHWDV
&RQWXGR TXDQWR PDLV HVSHFt¿FR VHX WUHL- DPDGRUHV UHODo}HV LQWHUSHVVRDLV YDORUHV pWLFRV
QDPHQWR PDLV LPSRUWDQWH p D HVSHFLDOL]DomR SRQWXDOLGDGHHJUDXGHFRPSURPHWLPHQWRFRPRV
em atletismo e experiência na área. “Quem está alunos. “É muito importante ter uma ideia clara
aprendendo a desenvolver a prática da corrida, de qual tipo de personalidade tem o treinador es-
na fase de conhecer o corpo, pode, teoricamente, FROKLGRMiTXHDVIRUPDVGHFREUDQoDVWrPPXLWR
ser orientado por um personal ou pelo instrutor DYHUFRPLVVR´DYDOLD
GHPXVFXODomRSRUH[HPSOR´DYDOLDRWUHLQDGRU 'HVFREULUWXGRLVVRORJRGHFDUDREYLDPHQWHQmR
&OiXGLR&DVWLOKRGD6D~GH 3HUIRUPDQFH$WLYL- é fácil, por isso, muitos corredores recorrem ao bom
GDGH)tVLFD³0DVYHMRYiULRVSUR¿VVLRQDLVWUDQ- HYHOKRERFDDERFD³%DVHDGRHPQRVVDDVVHVVRULD
VLWDQGR HQWUH RV GRLV FDPSRV GH DWXDomR FRQWL- o relato de nossos alunos nos mostra que a indica-
nuando a orientar essa pessoa quando ela passa a omRHVWiHPSULPHLUROXJDU0DVRTXHQRVGiFUH-
correr na rua e a participar de provas e creio que dibilidade é o fato de estarmos desenvolvendo um
VHMD SHULJRVR SRLV p MXVWDPHQWH QHVVH PRPHQWR WUDEDOKR QD PHVPD HPSUHVD Ki GH] DQRV LVVR ID]
TXHRDOXQRSUHFLVDGHDOJXpPPDLVHVSHFLDOL]D- com que a facilidade do aluno em encontrar uma
GR´,VVRSRUTXHQDUXDPXGDVHFRPSOHWDPHQ- DVVHVVRULD DXPHQWH´ DFUHGLWD $QGUp &DPSRV GD
te a maneira de correr e a importância da técnica $QGUp&DPSRV3HUIRUPDQFH

33
SUPERAÇÃO
seu treino

Saber o que quer HQWUDHPVLQHUJLDFRPRDOXQR´LQGLFD&DVWLOKR


$OJR TXH IDFLOLWD HVVD GHFLVmR p VH SHUJXQWDU Assim como há alunos diferentes, a personalida-
TXDORVHXSHU¿OFRPRDOXQRHRTXHHVSHUDGRWpF- GHGRWUHLQDGRUWDPEpPLQÀXLQDPDQHLUDFRPRHOH
QLFR³2WLSRGHWUHLQDGRUHVWiOLJDGRGLUHWDPHQWH WUDEDOKDHSRUTXHQmRQRVSUySULRVFRUUHGRUHVTXH
DRJUXSRTXHHOHSRVVXLHDOLQKDGHWUDEDOKRDGR- HOHDWUDL(QWUHWDQWRDWHQGrQFLDpTXHPHVWiYHQ-
WDGDDMXGDDGH¿QLUHVWHSHU¿O(VVDLGHQWL¿FDomR GHQGRRVHUYLoRVHDGDSWDU³'HIRUPDJHUDOSHQVR
poderá ser observada pelos resultados, forma de que o método de trabalho varia de aluno para aluno,
SODQHMDPHQWRGHXPDWOHWDTXDQWLGDGHGHWUHLQD- SRLVREMHWLYRVGLIHUHQWHVJHUDPWUDEDOKRVGLIHUHQWHV
PHQWRVUHDOL]DGRVHWF´D¿UPD&DPSRV H XWLOL]DomR GH PHWRGRORJLDV GLIHUHQWHV e VDELGR
2So}HV QmR IDOWDP$SHQDV HP 6mR 3DXOR Ki que, para se prescrever um determinado treina-
quase 400 assessorias esportivas e, dentro de um mento, é importante você obter um conhecimento
mercado cada vez mais competitivo, a busca é por PXOWLODWHUDO´D¿UPD&DPSRVRTXHVLJQL¿FDVDEHU
LGHQWLGDGH³+RMHVHWHPGHWXGRTXHPDWHQGHD PRQWDUXPSURJUDPDSDUDXPSUDWLFDQWHUHJXODURX
corredores de baixa renda, mulheres, quem quer XPµDWOHWDGH¿PGHVHPDQD¶³0HVPRVHRIRFRp
performance, cardiopatas. Tem que pesquisar, ver DTXDOLGDGHGHYLGDDFUHGLWRTXHDDERUGDJHPPDLV
VH R SHU¿O VH HQTXDGUD DR REMHWLYR H VH R JUXSR H¿FD]pDTXHODTXHGHL[DVHXFOLHQWHVDWLVIHLWR´

34
16
As obrigações dele GRUTXHIXMDGRVSDGU}HVQRUPDLVQmRID]HUWUHLQRV
2SDSHOGRWUHLQDGRUQmRGHYHVHUDSHQDVSUHV- H[WUDVRXPXGDQoDVVHPFRQVXOWDUVHXWpFQLFRDYH-
crever um treinamento fechado e procurar o aluno ULJXDURWHPSRGHXWLOL]DomRGRWrQLVVHDDOLPHQWD-
QR¿QDOGRPrVeLPSRUWDQWHHVWDEHOHFHUXPGLi- omRpUHDOL]DGDGHIRUPDHTXLOLEUDGDGHDFRUGRFRP
ORJRSDUDTXHDPEDVDVSDUWHVHVWHMDPFDPLQKDQGR suas necessidades e prescrita por um nutricionista.
MXQWDV SDUD R PHVPR REMHWLYR 6DEHU SRU TXH WHP ³0LQKDVXJHVWmRGHIHHGEDFNpTXHVHMDGLiULRRX
TXHFXPSULUGHWHUPLQDGDVHVVmRPHVPRTXHIRUXP VHPDQDO´
GXURLQWHUYDODGRDMXGDQDPRWLYDomRHFRQVFLHQWL]D 8PD VDtGD TXH SRGH GDU DOJXP WUDEDOKR PDV
o corredor da necessidade de trabalhar passo a pas- FXMRE{QXVpPDLRUTXHR{QXVpPDQWHUXPGLiULR
so. “O papel do treinador na vida de qualquer aluno de treino, em que o corredor relata dados do trei-
DPDGRU RX SUR¿VVLRQDO HVWi QD RULHQWDomR H SUHV- QRFRPRIUHTXrQFLDFDUGtDFDGLVWkQFLDSHUFRUULGD
FULomR GR VHX WUHLQDPHQWR GH IRUPD TXH DWHQGD j WHPSRGRWUHLQRPpGLDGHYHORFLGDGHSHUFHSomRGH
necessidade do cliente. Ao direcionar as atividades HVIRUoRFOLPDXPLGDGHKRUiULRGHWUHLQRDOLPHQ-
elaboradas, o treinador facilita o processo de apren- WDomRHKLGUDWDomR DQWHVGXUDQWHHDSyVRWUHLQR 
GL]DGRGRDOXQR´DYDOLD&DPSRV estado emocional antes do treino e fatores de es-
Castilho vê como problemática o que chama de a WUHVVHGRGLD$VVLP¿FDPDLVVLPSOHVJXDUGDUDV
PDLVQRYDµPRGD¶HQWUHRVWUHLQDGRUHVDFRPSDQKD- LQIRUPDo}HVHDYLGDGRWUHLQDGRUpIDFLOLWDGD
mento quase exclusivamente por e-mail. “A planilha
p DSHQDV XP JXLD SDUD UHJLVWUDU HWDSDV HOD QmR VH Os alunos
UHVROYHVR]LQKD$FKRDWpSHULJRVRQmRWHUHVVHFRQ- Contudo, assim como há diferentes tipos de
WDWR 1mR DEUR PmR GH DFRPSDQKDU RV WUHLQRV GRV WUHLQDGRUHVKiFRUUHGRUHVSDUDWRGRVRVJRVWRV³2
PHXVDOXQRVVHPDQDOPHQWHRXVHSRVVtYHOWUrVYH- DOXQRWHPTXHHQWHQGHUTXHTXDQWRPDLVHVSHFt¿FR
zes por semana, principalmente nos trabalhos mais RREMHWLYRPDLVGLItFLOSDUDVHDGHTXDURVSDUkPH-
GLItFHLVFRPRGHWpFQLFDHIRUoD´RSLQD³6R]LQKR tros do treinamento e melhor tem que ser essa co-
R DWOHWD SRGH ID]HU WUHLQRV UHJHQHUDWLYRV RX DTXH- PXQLFDomR´ VXEOLQKD R WUHLQDGRU &DPSRV 0DV R
OHVFRPFRQWUROHSRUIUHTXrQFLDFDUGtDFD(TXDQWR que ocorre muitas vezes, de acordo com Castilho,
PDLVLQLFLDQWHPDLVLPSRUWDQWHYHUGHSHUWR´ pRGHVJDVWHDRLQYpVGDFRQVWUXomRGHVVDUHODomR
Além do acompanhamento dos treinos, deve ser 1RLQtFLRRVDPDGRUHVWHQGHPDDFHLWDUPDLVRTXH
IHLWDXPDDYDOLDomRSHULyGLFDFRPHQFDPLQKDPHQ- R WUHLQDGRU IDOD 'HSRLV ³&RP R WHPSR YmR VH
WRDH[DPHVPpGLFRVODERUDWRULDLVHWHVWHVItVLFRV WRUQDQGRDXWRGLGDWDVHFRPHoDPDGLVFXWLUFRPR
uma vez que, mesmo que o rendimento nos treinos SUR¿VVLRQDO(FRVWXPRGL]HUTXHHVVHpRFRPHoR
FRQWLQXHRPHVPRKiSDWRORJLDVTXHIRUoDPDWpD GR¿P+RMHKiPXLWDLQIRUPDomRQD,QWHUQHWHP
LQWHUUXSomRWRWDOGDFRUULGDHLVVRPXLWDVYH]HVVy revistas, mas, por mais que ele se informe, ainda
DSDUHFHQHVVDVDYDOLDo}HV precisa do treinador para interpretar esses dados e
$SHVDU GD LPSRUWkQFLD GRV GDGRV FLHQWt¿FRV VRPiORVDVXDUHDOLGDGH´RSLQD
nada substitui uma boa conversa, de preferência, Outro problema percebido por Castilho é o ime-
PHVPRTXHQmRVHMDSHVVRDOPHQWHGHSRLVGHFDGD GLDWLVPR³4XDQGRRDOXQRQmRFRQVHJXHPDLVEDL-
VHVVmR$tHQWUDDSDUWHGRFRUUHGRUQHVVDUHODomR xar o tempo para uma determinada distância, por
(OHGHYHSUHVWDUDWHQomRjVUHDo}HVGRFRUSRHVDEHU H[HPSORFRPHoDDIDOWDUQRVWUHLQDPHQWRVHDLQGD
UHODWiODVDRWUHLQDGRU³7RGDVDVVHQVDo}HVGXUDQWH TXHUPHOKRUDUSRLVQmRDFHLWDRXYLUTXHHVWiTXH-
RWUHLQRHKRUDVGHSRLVVmR~WHLV&RVWXPRXVDUD EUDQGRRWUHLQR0DVQmRKiIyUPXODPLODJURVD´
SHUFHSomRVXEMHWLYDSHQGLGRQRWDVGHDDOpP 3DUDQmRFKHJDUQHVVHµ¿P¶&DPSRVDSRVWDQR
GHGDGRVGLUHWRVFRPRGDIUHTXrQFLDFDUGtDFDPDV GLiORJR³1RVSUHRFXSDPRVFRPRUHVXOWDGRVHP
WXGR R TXH R DOXQR UHODWD p UHOHYDQWH (QWUHWDQWR HVTXHFHUTXHQRVVRVFOLHQWHVVmRVHUHVKXPDQRVH
pOyJLFRTXHHVVHGLiORJRpDOJRTXHVHHVWDEHOHFH QmR PiTXLQDV VHQGR DVVLP TXDQWR PDLRU R FRQ-
FRPRWHPSR´UHVVDOWD&DVWLOKR tato entre ambos, maior será a facilidade de feed-
3DUD &DPSRV RV VHJXLQWHV SDUkPHWURV GHYHP EDFNHPHQRUVHUiDSUREDELOLGDGHGHXPDHYHQWXDO
VHUREVHUYDGRVFDQVDoRItVLFRRXPHQWDOTXDOTXHU FRQWXVmR´

35
SUPERAÇÃO
seu treino

Encontre um treinador que combine com você

36
16 Elaborado por Lázaro Pereira Velázquez, gerente de desenvolvimento da CBAt
(Confederação Brasileira de Atletismo) e treinador IAAF Nível IV
equipamento

GUIA
DO
TÊNIS
Grande objeto de desejo de 10 entre 10
corredores, os tênis, assim como os atletas,
passam por transformações de tempos em
tempos. Enquanto você ganha segundos,
minutos preciosos a cada prova, os calçados
incorporam novas tecnologias, tecidos, cores
e design a cada coleção. Para mostrar o que
tem de mais novo no mercado, SuperAção
entrou em contato com as principais
marcas e transformou suas páginas em
verdadeiras prateleiras dos sonhos. São
mais de 50 modelos, muitos inéditos,
alguns reformulados, e com certeza
um deles vai conquistar você. Conheça,
compare e corra às compras!

Todas as informações foram fornecidas pelos fabricantes de


materiais esportivos e/ou suas assessorias de imprensa

37
SUPERAÇÃO
equipamento

Adidas
SAC: (11) 2161-2961 São Paulo / 0800 55 62 77 (demais estados)
www.adidas.com.br

ADISTAR RIDE
Preço sugerido: R$ 449,90
Tipo de pisada: Neutra/supinada
Categoria: Amortecimento, controle de movimento, competição e caminhada
Cores: Running white, phantom s09, sun; running white, black 1, red s09
Tamanhos: 34 ao 39 (fem) / 37 ao 45 (masc)
Peso: 290g (fem) / 345g (masc)
Indicação de uso: Pessoas que treinam com frequência e para corredores mais pesados
Tecnologia: Possui as tecnologias formotion, geofit, adiprene, adiprene +, no seam, torsion
system, adiWEAR e blown rubber. O cabedal permite maior respiração e o forro tem calce
anatômico. A palmilha permite melhor adaptação e a entressola proporciona estabilidade
do centro à ponta do pé. Permite o controle dos movimentos e adaptação ao terreno. O
solado de borracha expandida oferece aderência e durabilidade em áreas de muito desgaste

ADISTAR SALVATION
Preço sugerido: R$ 449,90
Tipo de pisada: Pronada/pronada excessiva
Categoria: Amortecimento, estabilidade, competição, controle de movimento e caminhada
Cores: Running white, black 1, red s09
Tamanhos: 34 ao 39 (fem) / 37 ao 45 (masc)
Peso: 305g (fem) / 351g (masc)
Indicação de uso: Treinos frequentes e para corredores mais pesados
Tecnologia: Formotion, pro-moderator, geofit, adiprene, adiprene +, no seam, torsion system,
adiWEAR e blown rubber. A unidade formotion 3D progressiva reduz a velocidade da pronação
na região do calcanhar. As ranhuras longitudinais no solado ajudam a reduzir a velocidade
de pronação na parte frontal. Blown rubber na parte frontal e adiWEAR no calcanhar
proporcionam conforto e durabilidade

SUPERNOVA SEQUENCE
Preço sugerido: R$ 349,90
Tipo de pisada: Pronada/neutra
Categoria: Amortecimento, estabilidade, competição, controle do movimento e caminhada
Cores: Black 1, dark steel met. f09, tin met. F09; running white, metallic silver, red s09
Tamanhos: 34 ao 39 (fem) / 37 ao 45 (masc)
Peso: 295g (fem) / 350g (masc)
Indicação de uso: Treinos de velocidade, provas de média e longa distância
Tecnologia: Formotion, pro-moderator, geofit, adiprene, adiprene +, no seam, torsion system,
adiWEAR e blown rubber. O cabedal tem tecnologia de suporte sem costuras. A palmilha
é construída com base dupla e antimicrobiana. A entressola garante maior propulsão e
eficiência, além de oferecer absorção de choques, estabilidade, adaptação ao solo e suporte
ao arco do pé. O solado oferece maior durabilidade em áreas de muito desgaste

ADIZERO TEMPO
Preço sugerido: R$ 299,90
Tipo de pisada: Pronada
Categoria: Estabilidade, leveza e competição
Cores: Neon yellow s09, black 1, cobalt; running white, black 1, pure red f09
Tamanhos: 34 ao 39 (fem) / 37 ao 43 (masc)
Peso: 280g
Indicação de uso: Uso diário e competição
Tecnologia: Adiprene, adiprene +, adiWEAR, torsyon system e blown rubber.
16
38 Calçado com maior amortecimento, com estrutura para corridas longas
Asics
SAC: 0800 722 7427
www.asics.com.br

LANÇAMENTOS: AGOSTO

GEL-NIMBUS® 11
Preço sugerido: R$ 499,90
Tipo de pisada: Supinada/neutra
Categoria: Amortecimento
Tamanhos: 5 ao 13 (fem) / 6 ao 16 (masc)
Peso: 294,7g (fem) / 351,4g (masc)
Tecnologia: I.G.S.® (Impact Guidance System), que auxilia o movimento natural do pé; Space Trusstic System®,
sistema de estabilidade que permite a deformação controlada da entressola; entresola em Solyte®,
material mais leve do que os convencionais EVA e SpEVA® da Asics, traz melhorias no amortecimento
e durabilidade; cabedal com Biomorphic Fit™, que garante a superioridade do conforto e do calce,
reduzindo o atrito do tênis com o pé; Dynamic Cradle™, um componente moldado da
entressola elaborado para tipos de pés específicos, que melhora o calce e a pisada;
e cabedal com design assimétrico de amarração, que segue o contorno
anatômico do pé

GEL-CUMULUS® 11
Preço sugerido: R$ 359,90
Tipo de pisada: Supinada/neutra
Categoria: Amortecimento
Tamanhos: 5 ao 13 (fem) / 6 ao 15 (masc)
Peso: 274,9g (fem) / 328,7g (masc)
Tecnologia: I.G.S.® (Impact Guidance System), Space Trusstic System®,
entresola em Solyte®; P.H.F.®, espuma que compõe a região do colar do
contra-forte e possui efeito de memória, moldando-se ao tornozelo do atleta,
no intuito de criar um calce personalizado

GEL-PULSE™
Preço sugerido: R$ 299,90
Tipo de pisada: Supinada/neutra
Categoria: Amortecimento
Tamanhos: 5 ao 13 (fem) / 7 ao 16 (masc)
Peso: 272,1g (fem) / 337,2g (masc)
Tecnologia: Possui perfil relativamente baixo e as tecnologias Trusstic System®,
entressola em SpEVA®; sistemas de amortecimento em GEL® (nas regiões traseira
e dianteira do calçado) e cabedal Open Mesh

GEL-STRATUS® 3
Preço sugerido: R$ 329,90
Tipo de pisada: Supinada/neutra
Categoria: Amortecimento
Tamanhos: 5 ao 13 (fem) / 6 ao 15 (masc)
Peso: 276g (fem) / 324g (masc)
Tecnologia: Trusstic System®, entressola em SpEVA®, sistemas de amortecimento em GEL®
(nas regiões traseira e dianteira do calçado), capazes de atenuar o impacto do pé
durante as fases de impacto e propulsão; e cabedal Open Mesh, tecido do cabedal
que oferece conforto e respiração

39
SUPERAÇÃO
equipamento
MODELOS COM NOVAS CORES

GEL-KAYANO® 15
Preço sugerido: R$ 499,90
Tipo de pisada: Neutra/pronada
Categoria: Estabilidade
Tamanhos: 5 ao 13 (fem) / 6 ao 16 (masc)
Peso: 300,4g (fem) / 368,4g (masc)
Tecnologia: A novidade é o Design Assimétrico de Amarração e a nova plataforma de entressola. Possui
as tecnologias I.G.S.® (Impact Guidance System), que visa auxiliar o movimento natural do pé;
Space Trusstic System®, entressola em Solyte®, que traz melhorias no amortecimento e
durabilidade; palmilha ComforDry™, que garante desempenho e amortecimento otimizados;
solado DuraSponge®, que garante durabilidade e amortecimento com menos peso

GEL-1140™
Preço sugerido: R$ 299,90
Tipo de pisada: Neutra/pronada
Categoria: Estabilidade
Tamanhos: 5 ao 12 (fem) / 6 ao 17 (masc)
Peso: 266,4g (fem) / 320,2g (masc)
Tecnologia: Entressola em SpEVA®, que oferece durabilidade da entressola e atenuação de
impacto; sistemas de amortecimento em GEL® (nas regiões traseira e dianteira do calçado);
Trusstic System®, DuraSponge®; sistema de suporte DuoMax® e cabedal Open Mesh

GEL-DS TRAINER® 14
Preço sugerido: R$ 399,90
Tipo de pisada: Neutra/pronada
Categoria: Leveza
Tamanhos: 5 ao12 (fem) / 6 ao 15 (masc)
Peso: 246,6g (fem) / 289g (masc)
Tecnologia: Traz a atualização da construção da entressola e nova geometria do cabedal. Possui as tecnologias
I.G.S.® (Impact Guidance System); cabedal com design assimétrico de amarração; Space Trusstic
System®, sistema de amortecimento em GEL® (nas regiões traseira e dianteira do calçado);
Gilled Mesh, uma engenharia específica da lateral do cabedal otimizada para ainda mais ventilação;
sistema de suporte DuoMax®

GT-2140™
Preço sugerido: R$ 359,90
Tipo de pisada: Neutra + pronada
Categoria: Estabilidade
Tamanhos: 5 ao 13 (fem) / 6 ao 17 (masc)
Peso: 277,7g (fem) / 340g (masc)
Tecnologia: I.G.S.® (Impact Guidance System), entressola em Solyte®, Space Trusstic System®;
sistemas de amortecimento em GEL® (nas regiões traseira e dianteira do calçado); sistema
de suporte DuoMax®, que ajuda no suporte adequado do pé durante o momento de transição
(do contato do tornozelo até a propulsão); palmilha ComforDry™, que garante o calçado
fresco e seco

GEL-HYPER SPEED™ 3
Preço sugerido: R$ 259,90
Tipo de pisada: Neutra
Categoria: Competição
Tamanhos: 4 ao 14 (unissex) Peso: 195,5g
Indicação de uso: Treinos e competições
Tecnologia: Sistema de amortecimento em GEL® (na região traseira do calçado);
entressola em SpEVA®, que oferece durabilidade e atenuação de impacto; componente
da sola AHAR® (situado na parte do calcanhar), que acentua a durabilidade da sola,
principalmente na fase de contato; Magic Sole™, que minimiza o peso e maximiza a
40
16 respirabilidade; e cabedal Open Mesh
Athletic Sports
SAC: 0800 109 867
www.athleticsports.com.br

FLASH 2
Preço sugerido: R$ 129,90
Tipo de pisada: Sub-pronada
Categoria: Performance
Cores disponíveis: Preto/laranja
Tamanhos: 37 ao 43
Peso: 230g
Tecnologias: Triple Density (tecnologia desenvolvida por da variação de densidade dos materiais
confeccionados no solado). Esta variação proporciona o alto desempenho do atleta em diversos
tipos de terrenos, estabilizando a pisada. Desenvolvido em material impermeável, com dupla
e tripla densidade para apoio adicional, evita a pronação leve; Nova ATH Non Torsion, placa
estabilizadora e ponte de transição que proporciona estabilidade; ATH Pró Grip, que deixa o
solado antiderrapante; maior ventilação com o novo nylon Dupla Frontura.

ADVANCED
Preço sugerido: R$ 119,00
Tipo de pisada: Pronada/neutra
Categoria: Style
Cores disponíveis: Preto/prata, chumbo/prata, prata/preto/azul royal, branco/prata/vermelho,
branco/preto e preto
Tamanhos: 37 ao 44 Peso: 427g
Tecnologia: ATH Non Torsion; Pronation Sys, sistema de ângulo de pronação que permite melhor
rolamento do pé no toque ao solo. Evita dores na região lombar e articulações; ATH Pró Grip;
Oxisys, alta tecnologia de amortecimento de impacto através de cápsula de ar; Triple Density

NEW SPIRIT
Preço sugerido: R$ 99,90
Tipo de pisada: Sub-pronada Categoria: Running
Cores disponíveis: Branco/prata/vermelho, preto/prata/vermelho, branco/champagne, prata/chumbo/royal
Tamanhos: 38 ao 43
Peso: 354g
Tecnologia: ATH Non Torsion; ATH Max, solado em camada única de EVA, garantindo
amortecimento e leveza; ATH Pró Grip; Oxisys; Triple Density

Diadora
SAC: (51) 3065-9900
www.diadora.com.br

MYTHOS IMPERIUM II W
Preço sugerido: R$ 337,90
Tipo de pisada: Neutra
Categoria: Leveza
Cores: Prata/vermelho
Tamanhos: 34 ao 39
Peso: 400g (fem) / 450g (masc)
Indicação de uso: Corridas curtas
Tecnologia: A estrutura rígida oferece estabilidade para a parte traseira e protege contra ferimen-
tos no arco do pé. Cria reação a cada flexão do pé, oferecendo maior projeção, impulso e veloci-
dade. A distribuição do peso diminui a pressão da planta do pé. A estrutura em Tech Alloy, uma
liga de aço flexível na entresola, devolve a energia de flexão do pé, aumentando a propulsão

41
SUPERAÇÃO
equipamento

Fila
SAC: (11) 3818-1699
www.fila.com.br

FUTURE
Preço sugerido: R$ 299,90
Tipo de pisada: Neutra
Categoria: Performance
Cores: Laranja
Tamanhos: 37 ao 44 (masc)
Peso: 380g
Indicação de uso: Competição
Tecnologia: Cabedal desenvolvido com materiais sintéticos de alta qualidade, proporcionan-
do conforto. Possui tecnologias SuperAction e Flow, que geram amortecimento e troca de ar

FLEX
Preço sugerido: R$ 159,90
Tipo de pisada: Neutra
Categoria: Competição
Cores: Branco Iron/Khaki
Tamanhos: 37 ao 44 (masc)
Peso: 320g
Indicação de uso: Treinamento
Tecnologia: Modelo feito com materiais sintéticos e metal mesh, garantindo qualidade e
durabilidade. Entressola com a tecnologia SuperAction, para amortecimento e absorção de
impactos. Solado de borracha 100% natural

SPORT
Preço sugerido: R$ 149,90
Tipo de pisada: Neutra
Categoria: Competição
Cores: Prata/preto
Tamanhos: 37 ao 44 (masc)
Peso: 350g
Indicação de uso: Treinamento
Tecnologia: Calçado desenvolvido com a combinação de materiais sintéticos e peças apli-
cadas, propiciando conforto e durabilidade. Entressola com tecnologia SuperAction e placa
estabilizadora. Solado de borracha natural

Ironman Track & Field


SAC: (11) 3048-1238
www.tf.com.br

IRONMAN RACING
Preço sugerido: R$ 199,00
Tipo de pisada: Neutra/neutra com leve pronação
Categoria: Competição, treino
Cores: Detalhes em amarelo, cinza e azul
Tamanhos: 39 ao 44 Peso: 256g
Indicação de uso: Atletas de peso leve, com arcos normais
Tecnologia: Possui a Ironshield (estabiliza as passadas e dá suporte à transição da pisada); na região
traseira o Vibelock Rear permite que cada movimento tenha tratamento específico e
variado de acordo com a pisada; na região posterior o Vibelock Forefoot absorve a energia
de impacto e proporciona a flexão natural dos pés, evitando esforços desnecessários; o
42
16 Vibelock Innersole não permite que a vibração das passadas chegue ao pé do atleta
K-swiss
SAC: (11) 3062-8103
www.kswiss.com.br

RUN ONE MISOUL


Preço sugerido: R$ 599,00
Tipo de pisada: Neutra a pronadora
Tipo de pé: Plano e neutro
Categoria: Amortecimento e/ou competição Cores: Branco/ouro/vermelho; azul/prata
Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 350g (nº 40)
Indicação de uso: Pode ser usado tanto em treinos e provas rápidas, como em corridas de médias e longas
distâncias devido ao sistema de palmilhas, que podem ser trocadas de acordo com o tipo de treino
Tecnologias: A palmilha indicada para curtas distâncias é constituída de material superleve,
o K-Eva, associado ao SUPERFOAM™, que promove alto retorno de energia para os pés
durante a passada. Uma placa de fibra de carbono também melhora a propulsão. Para mé-
dias e longas distâncias pode-se optar pela palmilha constituída de materiais que priorizam o
amortecimento. O principal deles é o gel SI 18™, que protege contra impactos

K-ONA
Preço sugerido: R$ 439,00
Tipo de pisada: Neutra a pronadora
Tipo de pé: Plano e neutro
Cores: Branco/ouro/vermelho; azul/prata/vermelho
Categoria: Leveza
Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 255g (nº 40)
Indicação de uso: Triathlon
Tecnologias: Tênis oficial do IronMan no Havaí, apresenta a associação das tecnologias de
amortecimento Super Foam Tecnology™ e SI 18™. O solado traz cânulas de escoamento
de água. Cabedal com sistema Flow cool system™ em toda a extensão, mantendo a tem-
peratura dos pés estável e secos e cadarços com exclusiva tecnologia Stay Tied Laces™,
desenvolvidos para agir como ‘garras’, mantendo os laços ou nós firmes

KONEJO
Preço sugerido: R$ 399,00
Tipo de pisada: Neutra a pronada
Tipo de pé: Plano
Categoria: Estabilidade
Cores: Prata e cinza c/ laranja e cinza e branco c/ azul Royal (masc); prata e cinza c/ laranja e prata e
branco c/ azul claro (fem)
Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 574g o par (nº 40)
Indicação de uso: Corridas, caminhadas e fitness
Tecnologia: Amortecimento Superfom™, com tripla densidade. Solado em borracha
Aosta II™, com sulcos para aumento de flexibilidade e frenagem, superfície grande para
aumento da estabilidade

KEAHOU
Preço sugerido: R$ 399,00
Tipo de pisada: Neutra
Tipo de pé: Cavo e neutro Categoria: Amortecimento
Cores: Branco c/ vermelho e azul claro c/ branco (fem); prata e cinza c/ marinho e azul Royal c/ amarelo (masc)
Tamanhos: 34 ao 39 (fem) / 38 ao 46 (masc)
Peso: Aproximadamente 600g o par (nº 40)
Indicação de uso: Corridas, caminhadas e fitness
Tecnologia: Cabedal com tela mesh que proporciona respiração para os pés e couro sin-
tético moldado, proporcionando leveza. O solado possui borracha AOSTA II para mais
estabilidade e amortecimento, que também é garantido pelo GUIDEGLIDE™ peças
com tripla densidade. O sistema SUPERFOM™ proporciona conforto

43
SUPERAÇÃO
equipamento

Mizuno
SAC: São Paulo - (11) 3045-5522 / Outras localidades - 0800 70 70 566
www.mizunobr.com.br

CREATION 10
Preço sugerido: R$ 549,99
Tipo de pisada: Neutra/supinada Categoria: Amortecimento
Cores: Branco/laranja/prata, branco/verde claro/grafite, branco/azul/marinho, prata/verde/cinza e branco/rosa/
cinza (fem); branco/azul/prata, preto/prata, prata/azul/laranja, branco/vermelho/prata, branco/amarelo/chumbo
e prata/marinho/vermelho (masc)
Tamanhos: 34 ao 40 (fem) / 38 ao 46 (masc), com meio ponto Peso: 340g (nº 36) / 400g (nº 40)
Indicação de uso: Provas de 10km
Tecnologia: Gender Engineering (elaborada a partir do biótipo do homem e da mulher). A placa
Wave Infinity, responsável pelo amortecimento, sofreu alterações, tornando o calçado mais macio
e com a mesma durabilidade (500km sem perder as propriedades iniciais de amortecimento). A
nova palmilha anatômica, de dupla densidade, oferece conforto extra aos corredores.

NIRVANA 5
Preço sugerido: R$ 499,99
Tipo de pisada: Pronada (leve a moderada) Categoria: Amortecimento
Cores: Branco/azul claro/marinho, branco/lavanda e branco/vinho/prata (fem); prata/vermelho/laranja,
prata/preto e preto/vermelho/prata (masc)
Tamanhos: 34 ao 40 (fem) / 38 ao 46 (masc), com meio ponto
Peso: 310g (nº 36) / 365g (nº 40)
Indicação de uso: Treinos leves e corridas até 10km
Tecnologia: Possui a Gender Engineering. Nesta versão, apresenta pequenas modificações na
placa Wave, proporcionando um produto mais leve e confortável

PRO RUNNER 12
Preço sugerido: R$ 399,99
Tipo de pisada: Neutra
Categoria: Amortecimento
Cores: Prata/cinza/rosa, branco/rosa/preto e branco/preto/roxo (fem); branco/azul,
prata/laranja/preto, prata/vermelho e prata/azul/laranja (masc)
Tamanhos: 34 ao 40 (fem) / 38 ao 46 (masc), com meio ponto Peso: 260g (nº 36) / 320g (nº 40)
Indicação de uso: Provas até 10km
Tecnologia: Possui a Gender Engineering; Dynamotion Fit, que permite a interação dos movimentos do
pé com o calçado; AP (Acceleration Polymer), que minimiza o tempo de transição; Mizuno Intercool
(reduz a concentração de calor e umidade) e VS-1 (absorve o impacto e prolonga a duração do
amortecimento do calçado de corrida). Cabedal construído em AIRmesh, para maior ventilação
e conforto, e solado com borracha carbonada X10, que permite o uso prolongado do calçado
em áreas de alto impacto e proporciona mais tração na batida do calcanhar

INSPIRE 5
Preço sugerido: R$ 379,99
Tipo de pisada: Levemente pronada
Categoria: Amortecimento
Cores: Branco/verde/prata, branco/rosa/cinza e branco/roxo/amarelo (fem); prata/preto/amarelo, branco/azul/
marinho e branco/vermelho/chumbo (masc)
Tamanhos: 34 ao 40 (fem) / 38 ao 46 (masc), com meio ponto
Peso: 260g (nº 36) / 320g (nº 40)
Indicação de uso: Provas até 10km
Tecnologia: Possui a Gender Engineering. É ecologicamente correto, já que parte do material da
placa Wave, local do amortecimento do calçado, foi substituída por outra com propriedades
biodegradáveis. Também possui a tecnologia Dynamotion Fit, que permite a interação dos
movimentos do pé com o calçado por meio de uma construção especial que minimiza o estresse
44
16 causado no calcanhar
AERO 7
Preço sugerido: R$ 349,99
Tipo de pisada: Neutra
Categoria: Leveza, amortecimento
Cores: Branco/Pink (fem); branco/marrom (masc)
Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc)
Peso: 195g (nº 36) / 245g (nº 40)
Indicação de uso: Treinos de velocidade e competições até maratona
Tecnologia: Desenvolvido para corredores que buscam ganhos de performance. O sistema
Wave auxilia na distribuição do impacto das passadas uniformemente por toda a sola. O
material do cabedal é confeccionado em tecido especial para melhor absorção de água e
transpiração dos pés

ELIXIR
Preço sugerido: R$ 349,99
Tipo de pisada: Pronada
Categoria: Competição
Cores: Branco/azul/marinho (fem); branco/vermelho/preto (masc)
Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc)
Peso: 240g (nº 36) / 260g (nº 40)
Indicação de uso: Maratona
Tecnologia: O solado do tênis tem pontos especiais de tração na parte frontal, item que garante maior
rapidez e estabilidade na transição do movimento das passadas. A sola é constituída pela borracha
carbonada X10, que permite o uso prolongado do calçado em áreas de alto impacto e propor- r
ciona maior tração na batida do calcanhar. A tecnologia Dynamotion Fit, aliada à placa Wave de
amortecimento, disponibiliza maior maciez e um melhor encaixe dos pés

MUSHA
Preço sugerido: R$ 299,99
Tipo de pisada: Neutra ou com pequeno grau de pronação
Categoria: Leveza, amortecimento
Cores: Amarela/preta/laranja
Tamanhos: 38 ao 43 (unissex)
Peso: 220g (nº 40)
Indicação de uso: Maratona
Tecnologia: Muito utilizado por atletas profissionais, é uma das melhores relações peso/
amortecimento do mercado de running, de acordo com o fabricante. O solado possui deta-
lhes estratégicos de borracha com carbono para proporcionar maior tração com o solo

New Balance
SAC: (11) 2196-2401
www.newbalance.com.br

MR 1063 CU / WR 1063 WB
Preço sugerido: R$ 499,00
Tipo de pisada: Neutra/supinada
Tipo de pé: Normal ou cavo
Categoria: Amortecimento
Cores: Branco/prata/azul (fem); branco/prata/amarelo e branco/prata/azul (masc)
Tamanhos: 34 ao 39 (fem) / 39 a 44 (masc) Peso: 345g (masc) / 270g (fem)
Indicação de uso: Treino em rua ou esteira
Tecnologia: Possui a Total Fit, que identifica 88 ‘points of fit’, resultando na construção de mo-
delos cuja fôrma, design e tecnologias de cabedal, entressola e solado proporcionam o me-
lhor fit do mercado, segundo o fabricante. A Conona Phanton Liner é a forração interna
e sem costuras em tecido à base da casca do coco. O Abzorb DTS 2.0 é a tecnologia de
amortecimento e absorção de impacto desenvolvida especialmente para corredores

45
SUPERAÇÃO
equipamento

MR 750 WR / WR 750 WB
Preço sugerido: R$ 279,00
Tipo de pisada: Neutra
Tipo de pé: Normal
Categoria: Amortecimento
Cores: Branco/prata/azul (fem); branco/vermelho (masc)
Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc)
Peso: 257g (fem) / 328g (masc)
Indicação de uso: Treino
Tecnologias: Total Fit, cabedal com Air Mesh, Dual Density Collar (tecido leve e com trama aberta),
N-Lock (sistema de amarração que envolve o pé, aumenta a firmeza e o conforto e minimiza a
movimentação interna), Phanton Liner, Sure Lance (atacador que não desata durante
a corrida) e Lightning Dry (facilita a transferência de suor e da umidade), além de
entressola com Abzorb SBS

MR 769 SB / WR 769 ST
Preço sugerido: R$ 349,00
Tipo de pisada: Pronada leve
Tipo de pé: Plano
Categoria: Estabilidade
Cores: Branco/prata/vermelho (fem); branco/prata/azul (masc)
Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc)
Peso: 270g (fem) / 340g (masc)
Indicação de uso: Treino em rua ou esteira
Tecnologias: Total Fit, cabedal com refletivos em 360, Air Mesh, Dual Density Collar, N-Lock,
Phanton Liner e Sure Lance, além de entressola com Abzorb (planta do pé), Abzorb DTS
1.0 (calcanhar), Stability Web (evita a flexão medial do calçado) e TS2 (minimiza a rotação
exagerada do pé)

MR 904 LW / WR 904 LW
Preço sugerido: R$ 349,00
Tipo de pisada: Neutra
Tipo de pé: Normal
Categoria: Leveza
Cores: Branco/laranja (fem); preto/amarelo (masc)
Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc)
Peso: 230g (fem) / 280g (masc)
Indicação de uso: Treino e competições
Tecnologias: Possui a tecnologia Total Fit, cabedal com Lightweiight Air Mesh,
Dual Density Collar, Lightning Dry, N-Lock, Phanton Liner e Sure Lance, além de
entressola com Abzorb (calcanhar), Stability Web e TS2

MR 827 SR / WR 827 SB
Preço sugerido: R$ 249,00
Tipo de pisada: Neutra
Tipo de pé: Normal
Categoria: Leveza
Cores: Branco/azul turquesa (fem); branco/vermelho (masc)
Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc)
Peso: 217g (fem) / 277g (masc)
Indicação de uso: Treino e competições
Tecnologias: Possui a tecnologia Total Fit, cabedal com Air Mesh, refletivos em
360, Dual Density Collar, Lightning Dry, N-Lock e Sure Lance, além de entres-
sola: Abzorb (calcanhar + planta do pé) e Stability Web

46
16
Nike
SAC: Grande São Paulo – (11) 5504-6644 / Outros Estados: 0800 703 6453
www.nikevoce.com.br

VOMERO+4 (masculino)
Preço sugerido: R$ 499,90
Tipo de pisada: Neutra/supinada
Tipo de pé: Cavo ou normal
Categoria: Amortecimento
Cores: Cinza e azul; cinza e laranja; cinza e vermelho
Tamanhos: 6 ao 15 Peso: 351g (nº 42)
Indicação de uso: Treinos e provas de 5km a maratonas
Tecnologias: A entressola em cushlon foi retrabalhada para oferecer maior estabilidade. Me-
lhor relação ‘amortecimento x estabilidade’. O painel elástico do cabedal oferece maior ajuste
ao pé do corredor. Cabedal em mesh; entressola em cushlon com sistema de amortecimento
zoom air no calcanhar e planta do pé; BRS1000; Solado Waffle; compatível com sistema Nike+

VOMERO+4 (feminino)
Preço sugerido: R$ 499,90
Tipo de pisada: Neutra ou supinadoraa
Tipo de pé: Cavo e normal
Categoria: Amortecimento
Cores: Cinza com lilás, cinza com azul. A partir de FA09, três cores: cinza com amarelo, cinza com rosa, preto
Tamanhos: 5.5 ao 12
Peso: 277g (nº 38)
Indicação de uso: Treinos e provas de 5km a maratonas
Tecnologia: Semelhante ao modelo masculino

Rainha
SAC: São Paulo - (11) 3045-5522 / Outras localidades - 0800 70 70 566

RAY
Preço sugerido: R$ 99,99
Tipo de pisada e de pé: Neutra / Neutro
Categoria: Amortecimento
Cores: Prata/roxo, branco/roxo, prata/vinho, preto/prata, branco/rosa/cinza, preto/azul (fem); cinza/
chumbo e preto/prata (masc)
Tamanhos: 34 ao 39 (fem) / 38 ao 43 (masc)
Peso: 300g
Indicação de uso: Caminhadas leves e corridas de baixa intensidade
Tecnologia: Cabedal em tecido aerado e sobreposição de tela metalizada nas laterais

RADIANT
Preço sugerido: R$ 99,99
Tipo de pisada: Neutra
Tipo de pé: Neutro
Categoria: Estabilidade
Cores: Preto/lilás, prata/violeta, chumbo/pink/prata, prata/lilás, preto/prata, prata/azul claro, prata/branco/azul,
prata/chumbo/azul, preto/azul, branco/prata/vermelho
Tamanhos: 34 ao 39 Peso: 265g
Indicação de uso: Caminhadas leves e corridas de baixa intensidade
Tecnologia: Tênis exclusivamente feminino com fôrma especial. Seu cabedal aerado facilita a
respiração dos pés. Possui sistema de amortecimento com combinação de EVA de densidade
diferenciada com uma placa estabilizadora que se estende até o meio do tênis

47
SUPERAÇÃO
equipamento

Olympikus
SAC: 0800 728 2010
www.olympikus.com.br

TERÁ ONE
Preço sugerido: R$ 249,00
Tipo de pisada: Neutra Tipo de pé: Neutro
Categoria: Amortecimento, performance
Cores: Branco e rosa; branco e lilás (fem); branco e verde; branco e ouro;
branco e vermelho e preto; prata
Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 392g
Indicação de uso: Provas de 5km até meia maratona
Tecnologia: Utiliza a exclusiva tecnologia Tube Tech, que tem como principal característica o
amortecimento de impacto, presente no calcanhar e na planta do pé

Reebok
SAC: (85) 3336-0819 / 3336-1442
www.reebok.com.br

SELECTRIDE
Preço sugerido: R$ 599,90
Tipo de pisada: Neutra
Tipo de pé: Neutro
Categoria: Amortecimento
Cores: Cinza/roxa; branco/verde (fem) / preto/vermelho (masc)
Tamanhos: 34 ao 39 (fem) / 37 ao 44 (masc) Peso: 290g (nº 36) / 340g (nº 40)
Indicação de uso: Corridas de 5km a 10km
Tecnologia: Possui sistema de amortecimento que funciona da seguinte forma: optando por RUN, após
algumas passadas o atleta sente o tênis inflar, aumentando assim a capacidade de amortecimen-
to. Se preferir TRAIN, o tênis fica mais baixo e adequado para treinos rápidos e laterais – evita
torções e garante conforto

PREMIER SMOOTHFIT CUSHION


Preço sugerido: R$ 399,90
Tipo de pisada: Neutra
Tipo de pé: Neutro
Categoria: Leveza, conforto
Cores: Azul claro; azul escuro; preto
Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 290g (nº 36) / 390g (nº 40)
Indicação de uso: Corridas de 5km a 10km
Tecnologia: SmoothFit (acabamento sem costura, o que reduz o atrito com a pele). Possui
tecnologia de amortecimento DMX FOAM. A entressola em IMEVA proporciona mais
conforto e o solado em borracha DMPRTEK garante durabilidade e tração

PREMIER TRINITY III


Preço sugerido: R$ 399,90
Tipo de pisada: Pronada moderadaa
Tipo de pé: Plano
Categoria: Estabilidade, amortecimento
Cores: Verde; verde água
Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 290g (nº 36) / 340g (nº 40)
Indicação de uso: Corridas de 5km a 10km
Tecnologia: Conta com sistema ajuste KineticFit que oferece conforto, suporte e flexibilidade,
além de material 3M Scotchlite, que garante maior segurança nas corridas noturnas. O forro
interno é confeccionado com a tecnologia PLAY DRY para controle de umidade; palmilha de
48
16 PU removível; amortecimento DMX FOAM e solado 3D Plus - tração e amortecimento
PREMIER ULTRA KFS VI
Preço sugerido: R$ 369,90
Tipo de pisada: Neutra/supinada Tipo de pé: Cavo
Categoria: Amortecimento, leveza Cores: Azul; verde água; rosa
Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 290g (nº 36) / 390g (nº 40)
Indicação de uso: Corridas de 5km a 10km
Tecnologia: Conta com o sistema de ajuste KineticFit; possui memória ativa com função de ajuste perfeito do
calçado ao formato do pé. O cabedal é desenvolvido em malha sintética ideal para as corridas noturnas.
Conta ainda com as tecnologias de amortecimento DMX SHEAR e DMX FOAM, forro interno
em PLAY DRY, que controla a umidade; a entressola em CMEVA (maior estabilidade), palmilha
de EVA removível e solado de borracha DMPRTEK que oferece maior durabilidade e tração

PREMIER ROAD PLUS


Preço sugerido: R$ 369,90
Tipo de pisada: Pronada Tipo de pé: Plano
Categoria: Estabilidade Cores: Laranja
Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 290g (nº 36) / 390g (nº 40)
Indicação de uso: Corridas de 5km a 10km
Tecnologia: Sistema KineticFit, tecnologia que fornece conforto, apoio e flexibilidade em áreas
críticas do pé. A forma em EVA de comprimento integral acrescenta conforto e amortecimento.
Espuma DMX para ajudar no amortecimento

PREMIER VERONA KFS


Preço sugerido: R$ 369,90
Tipo de pisada: Neutra Tipo de pé: Neutro
Categoria: Leveza Cores: Vermelho/amarelo
Tamanhos: 34 ao 39 (fem) / 38 ao 44 (masc) Peso: 290g (nº 36) / 340g (nº 40)
Indicação de uso: Corridas de 5km a 10km
Tecnologia: DMX FOAM, que garante amortecimento e estabilidade. O sistema KineticFit oferece
conforto, suporte e estabilidade. O cabedal é desenvolvido em malha com trançado aberto –
suporte e ventilação. A palmilha de PU ajuda no amortecimento e conforto. O forro interno em
PLAY DRY controla a umidade. As ranhuras frontais garantem flexibilidade e a parte traseira do
tênis é desenvolvida em borracha de carbono – maior tração e durabilidade

Saucony
SAC: (11) 3897-8808
www.saucony.com.br / info@saucony.com.br

GRID FASTWITCH 3
Preço sugerido: R$ 399,90 Tipo de pisada: Pronada
Tipo de pé: Plano Categoria: Competição Cores: Laranja/marinho
Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 176g
Indicação de uso: Corridas de 5km a meia maratona
Tecnologia: A construção do cabedal é feita com o tecido tecnológico Dry-lex, que consis-
te em três camadas, pelas quais o suor do pé é conduzido e dissipado. Possui amortecimen-
to Dual Density SSL EVA e solado com borracha de carbono, que melhora a tração

TYPE A2
Preço sugerido: R$ 349,90 Tipo de pisada: Neutra
Tipo de pé: Neutro Categoria: Performance
Cores: Branco/azul
Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 167g (fem) / 196g (masc)
Indicação de uso: Corridas de 5km a meia maratona
Tecnologia: Com solado baixo, amortecimento em EVA e sistema drenante na sola que elimina
a água. Material da sola produzido em borracha expandida de carbono, leve e com melhores
propriedades de tração que não comprometem a durabilidade. Entressola em EVA

49
SUPERAÇÃO
equipamento

PROGRIDTM PARAMOUNT
Preço sugerido: R$ 729,00 Tipo de pisada: Neutra / levemente pronada
Tipo de pé: Neutro
Categoria: Leveza, estabilidade
Cores: Branco/prata (fem); branco/dourado (masc)
Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 280g (fem) / 373g (masc)
Indicação de uso: Corridas de todas as distâncias
Tecnologia: Flexion Plate, plataforma de TPU (Poliuretano Termoplástico) resistente a impactos, que
guia o movimento de transição do calcanhar até os dedos. O sistema de amortecimento é feito
através do Full Length ProGrid™, um entrelaçado de Hytrel (um tipo de elastômero super
resistente) por toda a extensão do solado. O cabedal tem tecido que regula a temperatu-
ra interna e a tecnologia Arch-Lock™, que mantém o pé firme na posição da entressola

PROGRIDTM TRIUMPH 5
Preço sugerido: R$ 499,90
Tipo de pisada: Neutraa
Tipo de pé: Neutro
Categoria: Amortecimento
Cores: Prata/azul claro; branco/dourado (fem); preto/vermelho; azul/branco (masc)
Tamanhos: 34 ao 39 (fem) / 39 ao 44 (masc) Peso: 268g (fem) / 323g (masc)
Indicação de uso: Corridas de todas as distâncias
Tecnologia: Sistema de absorção de impacto ProGridTM por toda a extensão do solado, que
proporciona uma transição de passada mais suave. Aliado a isso, a combinação de EVA
de dupla densidade na sola minimiza o choque na fase de ataque e maximiza a pro-
pulsão no final da passada. Possui o sistema Arck-LockTM, um arco na parte interna
do cabedal que proporciona maior estabilidade e sustentação do pé

TOPPER
SAC: (11) 3045-5522 / 0800 70 70 566
www.topper.com.br

FAST
Preço sugerido: R$ 139,99
Tipo de pisada: Todas
Tipo de pé: Todos
Categoria: Amortecimento
Cores: Branco/marinho/verde; chumbo/prata/vermelho; preto/prata/vermelho
Tamanhos: 34 ao 43 Peso: 300g (nº 40)
Indicação de uso: Eventual
Tecnologia: Confeccionado em náilon e laminado. Possui sistema de amortecimento
Dynatech, que contribui na performance e estabilidade. A placa estabilizadora protege
o atleta contra lesões

IRON
Preço sugerido: R$ 149,99
Tipo de pisada: Neutra
Tipo de pé: Neutro
Categoria: Caminhada/corrida casual
Cores: Branco/lilás/roxo e prata/azul (feminino) e branco/marinho, prata/chumbo/vermelho e preto/prata
(masculino).
Tamanhos: 34 ao 43
Peso: 300g (nº 40)
Indicação de uso: Corridas eventuais
Tecnologia: Possui microperfurações para proporcionar maior conforto, respiração e
ventilação dos pés, além do sistema de amortecimento Dynatech, que oferece leveza e
50
16 estabilidade, resultando na melhoria da performance
mural sa
Fábio Ura/ZDL

O ex-jogador de futebol
Cafu e atletas cadeirantes
na Maratona de São Paulo

Fábio Ura/ZDL

Integrantes da Equipe
Fôlego na Maratona
de São Paulo: Felipe
Diniz, Rogério Sampaio,
Juliana Didone, Flávia
Freire, Cafu, Marcos
Gomes, Gustavo Borges,
Hortência, Caio Ribeiro,
Juninho Paulista e José
Rubens D’Elia

Equipe Garra,
do Professor
Daniel Biscola

Fábio Ura/ZDL

A Equipe Vida Corrida:


Tande, Rodolfo Mattheis,
Olivier Cozan, Mariana
Brochado, Smigol,
Adriana Samuel, Tico
Santa Cruz, Tiago Gomes,
Fabiola da Silva e Clayiton
Conservani

51
SUPERAÇÃO
troféu brasil

ATLETISMO EM

52
16
ALTO NÍVEL
BM&F Bovespa conquista o oitavo título consecutivo do
Troféu Brasil, que teve, na edição 2009, recordes
e grandes desempenhos dos atletas

BM&FBOVESPA/Divulgação

A
forte disputa entre as equipes BM&F Bo-
vespa e Rede Atletismo elevou o nível e
garantiu a quebra de recordes na 28ª edição
do Troféu Brasil, disputado entre maio e junho, em
Bragança Paulista (SP) e no Rio de Janeiro (RJ).
Destaque para a saltadora Fabiana Murer, que con-
quistou, no Estádio Olímpico João Havelange, o
Engenhão, o novo recorde sul-americano e melhor
marca internacional do ano até então. Junto dela,
outros oito atletas melhoraram tempos e distâncias,
sendo um recorde brasileiro (Júlio César de Olivei-
ra, no dardo) e sete do evento. No meio de tanta
competitividade, melhor para a BM&F Bovespa,
campeã pela oitava vez consecutiva.
Rei das provas de fundo do Brasil já há algum
tempo, Marílson Gomes dos Santos juntou mais
dois ouros para sua galeria de medalhas no Troféu
Brasil, além do título de melhor atleta masculino do
torneio. Mesmo com os treinos focados na mara-
tona, não faltou velocidade para o brasiliense, que Classificação geral por equipes
quebrou o recorde do evento para vencer os 5.000m
com 13min34s79, superando a antiga marca que já 1º BM&F Bovespa 777 pontos
durava 16 anos, de Ronaldo da Costa (13min37s37, 2º Rede Atletismo 720 pontos
em 1993). O atleta ainda conseguiu o índice para o 3º EC Pinheiros ASICS 114 pontos
Mundial em agosto, mas deverá disputar apenas os 4º ORCAMPI UNIMED 51 pontos
42km na Alemanha. “Estou muito feliz com o resul- 5º Santa Mônica Rio 39 pontos
tado. Foi a primeira vez que competi no Engenhão 6º Futuro Olímpico 38 pontos
após os Jogos Pan-Americanos. Esperava fazer uma 7º Metodista São Bernardo 33 pontos
boa prova e bater o recorde da competição, além 8º UNISC 28 pontos
de ajudar minha equipe na pontuação.” O segundo 9º ASA-Sertãozinho 27 pontos
colocado, Ubiratan dos Santos, cruzou a linha de Estrela Guarulhos 27 pontos
chegada quase 20 segundos depois (13min52s34),
deixando o terceiro posto para Damião de Souza, forte”, destacou. Damião de Souza, em seu primeiro
com 13min56s20. Troféu Brasil, conseguiu melhorar uma posição em
O bicampeão da maratona de Nova Iorque ain- relação aos 5.000m e foi segundo (28min28s94). Da-
da viria a vencer a prova dos 10.000m, novamente niel Chaves da Silva foi o terceiro (28min49s42).
com ampla vantagem e melhorando o recorde do No feminino, Cruz Nonata da Silva ultrapas-
TB, que já era seu. Marílson marcou 27min58s83 sou Luzia de Sousa Pinto, que liderou grande par-
após fazer a passagem dos 5.000m num ritmo forte, te dos 10.000m, na última volta para vencer com
em 13min57s32. “Terminar os 10.000m abaixo dos 33min02s65. “Todos os dias eu dizia para mim
28 minutos, no Brasil, mostra que a prova foi muito mesma que, depois da segunda colocação em 2008,

53
SUPERAÇÃO
troféu brasil

eu iria vencer este ano. Treinei muito e alcancei importante tê-la na pista, uma eleva a performance
meu objetivo”, contou Nonata, que dedicou a vitó- da outra”, concluiu. A atleta ainda terá pelo menos
ULDDRV¿OKRV-RVp$OH[DQGUHH$OHVVDQGUDGHH mais duas chances para garantir a vaga.
13 anos. Luzia teve que se contentar com a prata Sabine não pôde se queixar, contudo, de falta de
(33min06s10). “Não deu para acompanhar a chega- concorrência nos 1.500m, quando teve que se esfor-
GDGD&UX]PDVHVWRXIHOL]SRUTXH¿]XPDERDFRUUL- çar para superar Christiane Ritz na última volta. “A
da”, ressaltou. Sueli Pereira Silva, com 34min18s22, prova foi bem concorrida e já tinha me dado por ven-
completou o pódio. cida quando pensei melhor e decidi tentar mais uma
Cruz voltaria a repetir o resultado nos 5.000m, vez; foi quando consegui superar Christiane,” admi-
completando o percurso em 16min21s41 para bater tiu a campeã com o tempo de 4min22s71. A Chris-
Fabiana Cristine da Silva, que fez 16min34s15. Lu- tiane coube se contentar com a prata (4min22s99),
zia de Souza Pinto foi outra que voltou ao pódio ao com Zenaide Vieira em terceiro (4min23s65).
terminar em terceiro, com 16min38s85. Nos 3.000m com obstáculos masculino, melhor
Nas distâncias de 800m a 3.000m com obstácu- para Fernando Alex Fernandes, que venceu após
los, destaque para Sabine Letícia Heitling, vencedo- 8min44s32, numa disputa acirrada com Gladson
ra dos 3.000m e dos 1.500m, e Fabiano Peçanha, Barbosa, prata com 8min44s64. Celso Ficagna tam-
que levou os 1.500m e conseguiu a prata nos 800m. bém chegou próximo, com 8min45s32.
A campeã pan-americana se mostrou pé-quente no Fabiano Peçanha, por sua vez, não apenas ven-
Engenhão e se tornou bicampeã do TB. Ela venceu ceu os 1.500m, como também foi o responsável por
com 10min05s93 e, apesar da grande vantagem para uma das grandes zebras da competição ao superar
a segunda colocada, (Patrícia Fernanda Lobo fechou Hudson de Souza, dono dos recordes sul-americano,
com 10min30s08 e Michelle Barreto da Costa com brasileiro e do TB na prova. Peçanha ultrapassou
PLQV  ¿FRX EHP DFLPD GR tQGLFH SDUD R Hudson na última volta para cruzar a linha de chega-
Mundial - 9min40. “A Zenaide Vieira, minha maior da com 3min46s22, enquanto o medalhista de prata
adversária, não participou da prova devido a uma marcou 3min46s59. “Está sendo o melhor ano da
contusão. Isso acabou diminuindo o meu ritmo. É minha carreira”, comemorou o vencedor. O terceiro

Resultados de fundo e meio-fundo


10.000m masculino 2º Fabiana C. da Silva (BM&F Bovespa) 3min46s59
1º Marilson dos Santos (BM&F Bovespa) - 16min34s15 3º Eder Uillian O. da Silva (Rede Atletis-
- 27min58s83 3º Luzia de S. Pinto (Rede Atletismo) - mo) - 3min46s71
2º Damião de Souza (Pé de Vento- 16min38s85 1.500m feminino
Petrópolis) - 28min28s94 3.000m com obstáculos mascu- 1º Sabine Heitling (UNISC) - 4min22s71
3º Daniel da Silva (BM&F Bovespa) - lino 2º Christiane Ritz (Rede Atletismo) -
28min49s42 1º Fernando Fernandes (Rede Atletis- 4min22s99
10.000m feminino mo) - 8min44s32 3º Zenaide Vieira (Rede Atletismo) -
1º Cruz Nonata da Silva (BM&F Boves- 2º Gladson Barbosa (EC Pinheiros 4min23s65
pa) - 33min02s65 ASICS) - 8min44s64 800m masculino
2º Luzia de S. Pinto (Rede Atletismo) - 3º Celso Ficagna (BM&F Bovespa) - 1º Kléberson Davide (Rede Atletismo) -
33min06s10 8min45s32 1min46s42
3º Sueli Silva (Jataí) - 34min18s22 3.000m com obstáculos feminino 2º Fabiano Peçanha (EC Pinheiros
5.000m masculino 1º Sabine Heitling (UNISC) - ASICS) - 1min46s82
1º Marilson dos Santos (BM&FBovespa) 10min05s93 3º Fernando da Silva (Rede Atletismo) -
- 13min34s79 2º Patrícia F. Lobo (EC Pinheiros ASICS) 1min47s63
2º Ubiratan dos Santos (Rede Atletismo) - 10min30s08 800m feminino
- 13min52s34 3º Michelle B. da Costa (Rede Atletis- 1º Josiane Tito (Rede Atletismo) -
3º Damião de Souza (Pé de Vento) - mo) - 10min34s44 2min03s85
13min56s20 1.500m masculino 2º Christiane Ritz dos Santos (Rede
5.000m feminino 1º Fabiano Peçanha (EC Pinheiros Atletismo) - 2min04s94
1º Cruz N. da Silva (BM&F Bovespa) - ASICS) - 3min46s22 3º Perla dos Santos (BM&F Bovespa)
16min21s41 2º Hudson de Souza (BM&F Bovespa) - - 2min06s16

54
16
BM&FBOVESPA/Divulgação
Oliveira, que superou o recorde brasileiro do lan-
çamento de dardo, que durava quase nove anos, por
FP2DWOHWDDOFDQoRXPHDLQGDVHFODVVL¿-
cou para seu terceiro Mundial adulto.
Também caíram nada menos que sete marcas do
Troféu Brasil: além de Marílson nos 5.000m, Fábio
Gomes da Silva conseguiu 5,55m no salto com vara;
Gisele de Oliveira saltou 14,16m no triplo; Lucina-
na França fez 55s90 nos 400m s/ barreiras; a equi-
pe da BM&F do revezamento 4x100m conseguiu
a marca de 43s35; José Alessandro Bagio marcou
1h26min31 e Tânia Regina Spindler fez 1h37min31
na marcha atlética de 20km.
Todas estas provas foram realizadas no Enge-
nhão. O decatlo, heptatlo e lançamento de martelo
¿]HUDPSDUWHGDSULPHLUDIDVHGRHYHQWRGLVSXWDGD
entre 30 e 31 de maio, em Bragança Paulista (SP).

Equipes
Além das disputas dentro da pista, esta edição do
TB contou com um ‘pega’ emocionante pelo título
foi Eder Uillian da Silva, com 3min46s71. por equipes entre BM&F Bovespa e a Rede Atletis-
Nos 800m, a disputa foi também intensa, com PR1R¿QDOD%0 )YHQFHXSRUSRQWRVD
a vitória de Kléberson Davide (1min46s42), segui- Para se ter uma ideia da intensidade da ‘briga’, a ter-
do de perto por Peçanha (1min46s82), após os dois ceira colocada, Pinheiros, marcou apenas 114. Com-
terem corrido juntos o tempo todo. O terceiro foi pletaram os cinco primeiros colocados as equipes
Fernando da Silva, com 1min47s63. No feminino, Orcampi Unimed (51) e Santa Mônica Rio (39).
vitória para Josiane Tito, que marcou 2min03s85, A alta competitividade foi comemorada pelo
contra 2min04s94 de Christiane Ritz dos Santos e presidente da CBAt, Roberto Gesta de Melo. “Há
2min06s16 de Perla dos Santos. muito tempo não víamos um Troféu Brasil tão forte.
Tivemos vários recordes na competição e vibrante
Chuva de recordes disputa entre a BM&F Bovespa e a Rede. No total,
As provas de saltos eram as mais esperadas tivemos 751 atletas, de 105 clubes de 18 estados e
depois dos ótimos resultados internacionais de do Distrito Federal. E vale citar que nada menos
Fabiana Murer, Maurren Maggi e Jadel Gregório que 52 equipes marcaram pontos no Engenhão, no
nas últimas temporadas. Fabiana não decepcionou, grande evento atlético do calendário nacional.”
superando em dois centímetros seu próprio recor- A rivalidade com a Rede, que tem dois anos, deu
de sul-americano, de 2008, ao saltar 4,82m e ainda tom especial à vitória, segundo o diretor-técnico da
registrar a melhor marca do ano, que era da norte- equipe BM&F, Sérgio Coutinho Nogueira. “No ano
americana Jennifer Stuczynski, que fez 4,81m. De passado fomos surpreendidos por uma boa atuação
quebra, a paulista foi eleita a melhor atleta feminina da Rede e pelo assédio aos nossos atletas. Vários
da competição. GHOHVUHFHEHUDPSURSRVWDV¿QDQFHLUDVLUUHFXViYHLV
Nos saltos em distância, Keila Costa superou Substituímos alguns técnicos que saíram, contra-
0DXUUHQSRUFHQWtPHWURV PDP H¿FRX tamos outros, reestrututramos o nosso trabalho e
FRP R RXUR 1R WULSOR -DGHO FRQ¿UPRX R IDYRUL- tudo deu certo”, avaliou Nogueira. Foi a vitória da
tismo e venceu com 16,96m. O resultado garantiu, competência, da ética, da união e sobre o dinhei-
além dos 21cm de vantagem para o segundo coloca- ro”, acrescentou o técnico-chefe da equipe, Ricardo
do, Jefferson Sabino, a vaga para Berlim. D’Angelo, que levou 88 atletas ao Rio e somou 61
Quem também se destacou foi Júlio César de medalhas: 27 de ouro, 19 de prata e 15 de bronze.

55
SUPERAÇÃO
10k
Fotos: Fernando Pilatos/VIPCOMM

Reebok 10KM

A corrida ajudou a
aquecer o frio da
noite de 20 de junho

A
QRLWHJHODGDTXHDQWHFHGHXRLQtFLRR¿FLDO
do Inverno no Brasil foi de bastante agitação
para 3 mil atletas da corrida Reebok 10KM,
que lotaram as ruas da Cidade Universtiária, em
São Paulo, no dia 20 de junho. A marca esportiva
promoveu um grande evento, com a participação
de professores da Reebok Sports Club realizando o A Reebok 10
alongamento antes da prova, além de muito som e KM
contou tamb
show de luzes. Um ‘corredor humano’, com gritos ém com
uma corrida
de apoio e aplausos foi um incentivo a mais aos de 5km
participantes, que não se incomodaram com a tem-
peratura na casa dos 14ºC. com 32min14.
Na disputa dos 10km, um pelotão com cin- Na disputa feminina dos 10km, vitória da atleta
co atletas tomou a dianteira da prova até o km 4, Beatriz Nascimento, que impôs um bom ritmo e
quando Adriano Bastos e Fábio Nascimento inicia- chegou tranquila à linha de chegada, com 38min16
ram um duelo particular, que durou até o km 7,5. - e mais de um minuto de vantagem para a segunda
Com um ritmo forte, Bastos assumiu a liderança colocada, Rosângela Figueiredo Silva (39min19).
e cruzou a linha de chegada com 31min36, 14 se- “Foi um resultado muito bom para mim. Meu obje-
gundos à frente de Nascimento (31min50). “Adoro tivo é melhorar cada vez mais”, disse a vencedora.
participar de provas noturnas pelo clima de festa, O pódio teve ainda a presença de Silvia Moreira
a música envolvida e as atrações que dão uma cara Lopes Ribeiro, com 40min05, na terceira posição.
diferente ao evento e conseguem interagir de uma Simultaneamente ao evento de 10km, houve a
forma motivadora com os participantes”, disse o realização da corrida de 5km, vencida por Fábio
campeão. Fábio Nascimento festejou a segunda Silva Leite (19min17), no masculino, e Vera Lú-
colocação. “Estou satisfeito com o resultado. O cia Souza (23min04), no feminino. “Foi uma prova
56
16 REMHWLYR HUD HVWDU QR SyGLR´ D¿UPRX 2 FRUUHGRU
Caio da Rocha Silva terminou em terceiro lugar,
forte e rápida. O fato de ser à noite é muito legal.
Foi muito bem organizada”, elogiou Silva.
100k
Voga Assessoria/Divulgação

Volta do Lago
M
ais de 2 mil atletas encararam, no dia A prova pôde ser disputa por equipes mistas
21 de junho, a disputa da 6ªVolta do compostas por dois, três, quatro, seis ou oito
L
ago, em Brasília, prova de 100km competidores, além de quartetos masculino e
que pode ser disputada em grupos ou indivi- feminino. Com o tempo de 5h46min31, o time
dualmente. Gran Cursos foi o primeiro a completar o desa-
Os atletas que largam do Cine Centro São ¿R3RXFRPDLVGHGRLVPLQXWRVGHSRLVDHTXL-
Francisco, no Eixão Sul, percorrem 14 trechos pe Supercei/Poupex/D
almo iRbeiro/Ida garan-
que incluem pontos turísticos famosos da ci- tiu o vice-campeonato (5h48min40), enquanto
dade, como a Ponte K ,J a Ermida oDm Bosco o outro time da Gran Cursos/Free Corner aca -
e a Concha Acústica. eD acordo com Antônio bou em terceiro lugar (6h04min53).
Bastos Júnior, organizador do evento, o trajeto
explora bem o potencial dos competidores, com
trechos de subida, estrada de terra e declives.
a turma dos ‘malucos’, que encaram os
D
100km na categoria solo, o goiano Fábio San-
tos, 43 anos, garantiu o bicampeonato. Apresen-
tando um ritmo forte, o atleta bateu seu próprio
recorde na prova em mais de 40 minutos, fe-
chando o percurso em 7h48min10 - ele venceu
no ano passado com 8h32min48.
Mas engana-se quem pensa que ele teve
moleza na reta de chegada. oLgo atrás, com
7h49min20, chegou Juvam Palmeira, enquanto
0DUFRV+R¿JJDUDQWLXRWHUFHLUROXJDUGRSyGLR
(10h10min22). Ao todo, 20 homens e cinco mu-
lheres encararam a disputa individual.

A paisagem digna de cartão-postal da


Ponte JK inspirou os atletas, que depois
fizeram a festa no pódio (acima)

58
16
Benefícios da linhaça para atletas
T
odo atleta necessita de uma alimentação
balanceada. Frequentemente, estes indivíduos
são expostos a situações que ‘estressam’ o
organismo, sendo necessário fazer uma reposição
adequada, não só das energias perdidas em forma de
macronutrientes (carboidrato, proteína e gordura), mas NUTRIÇÃO
também em vitaminas e minerais. Dra. Tânia Rodrigues
R
A semente de linhaça ganhou destaque entre
os alimentos chamados de funcionais, pois traz células do nosso organismo).
diversos benefícios à saúde, como o auxílio na Todos os benefícios da linhaça se potencializam
prevenção e redução de doenças, além de satisfazer quando a semente é moída ou triturada, pois como a casca
as recomendações nutricionais. Isso porque tem um da semente é muito dura, sua digestão é comprometida,
alto conteúdo de ácidos graxos ômega-3, lignana e podendo passar direto pelo trato gastrointestinal,
¿EUDV WRWDLV RV TXDLV VmR EHQp¿FRV QD UHGXomR GRV reduzindo a absorção de seus nutrientes. O consumo da
fatores de risco para doenças como, por exemplo, semente de linhaça pode ocorrer de diferentes formas.
cardiovasculares, ao reduzir o colesterol, e câncer. Pode ser utilizada no complemento de inúmeras
Para o atleta, este alimento pode trazer uma série de preparações: pães, bolos, biscoitos, cereais e bebidas,
EHQHItFLRVGHQWUHHOHVDDomRDQWLQÀDPDWyULDGHYLGR e até adicionadas a sucos, frutas, saladas, sobremesas,
à presença de ácidos graxos essenciais, denominados iogurtes e sopas. Existem várias formas e receitas
como ômega 3. Estes ácidos são gorduras chamadas diferentes para começar a consumir esse alimento
de poliinsaturadas, que ajudam a proteger o coração, essencial para quem busca uma vida mais saudável.
já que são antioxidantes com potente ação contra a
formação de placas de ateroma, além de reforçar o Composição nutricional da linhaça (por 100g):
VLVWHPD LPXQROyJLFR UHGX]LU LQÀDPDo}HV DWXDU QD
redução do colesterol total e triglicérides e, ainda, Nutriente Quantidade Nutriente Quantidade
retardar a coagulação sanguínea. Pelo atleta estar Calorias 333 cal Vit. B6 0,86mg
em constante desgaste, esse tipo de gordura poderia Proteínas 22g Vit. B12 1,65mg
auxiliar na diminuição dos impactos do exercício. Carboidratos 10,1g Potássio 777mg
Além disso, a linhaça possui na sua composição Gorduras 36,2g Sódio 253mg
FRPSRVWRV DVVRFLDGRV jV ¿EUDV FRQKHFLGRV FRPR Fibras 21,94g Magnésio 3270mg
lignanas, que desempenham um papel de prevenção Colesterol 0g Fósforo 6551mg
de cânceres de mama, de próstata, de cólon e de Ômega-3 16,51g Ferro 2,2mg
pulmão. Existem dois tipos de lignanas: enterodiol e Ômega-6 5,74g Cobre 14,4mg
enterolactona, ambas formadas no trato gastrointestinal Vit. A 18,47 UI Zinco 46,2mg
pela ação de bactérias. A linhaça é a maior fonte de Vit. E 28,2 UI Manganês 33,3mg
precursores de lignanas em alimentos. Vit. B1 0,6mg Selênio 0,64mg
A semente de linhaça ainda contém vitaminas B1,
B2, C, E e caroteno, e minerais como ferro, zinco, A linhaça também auxilia no aumento da vitalidade
potássio, magnésio, fósforo e cálcio. Sendo que estes ItVLFDHVWLPXODQGRRDXPHQWRGRFRH¿FLHQWHPHWDEyOLFR
micronutrientes (vitaminas e minerais) desempenham PHOKRUDQGR D H¿FiFLD QD SURGXomR GH HQHUJLD H
uma série de funções, entre elas estruturais (geram a diminuindo a fadiga dos músculos após o exercício,
estrutura da formação de ossos e dentes), funcionais além de auxiliar na diminuição do peso, pois ajuda a
(participam na manutenção do ritmo cardíaco, na controlar a obesidade e a sensação desnecessária de
contratilidade muscular, condutividade neural e no apetite.
equilíbrio ácido básico do organismo) e reguladoras
Dra. Tânia Rodrigues é nutricionista, especialista em Fisiologia do Exercício
(agem como parte importante das enzimas e dos (UNIFESP), sócia/diretora da RGNutri Consultoria em Nutrição - São Paulo e
KRUP{QLRV TXH PRGL¿FDP H UHJXODP D DWLYLGDGH GDV nutricionista do Clube BM&F.

59
SUPERAÇÃO
16k
Fotos: Divulgação

Mizuno
10 Milhas Brasil
A
primeira das quatro etapas da Mizuno 10
Milhas Brasil reuniu, dia 31 de maio, cer-
ca de 6 mil pessoas no Aterro do Flamen-
go, no Rio de Janeiro, para as disputas individual O Aterro do
(16,09km) e de duplas (8,045km cada);foi o recor - Flamengo recebeu
de do evento. Para dar ênfase à nova campanha da cerca de 6 mil
tecnologia eGnder Engineering, que leva em conta corredores
as diferenças biomecânicas entre homens e mulhe -
res na corrida, a organização dividiu a largada, com o percurso em 51min21, com Marcio Souza e Al-
homens correndo de um lado e mulheres do outro. deri Moreira (51min44) em segundo Equam pere
lugar. O tria-
Com o tempo de 51min09, o estudante minei- aperrarte
tleta Marcos aHllack e Edson do Nascimento, com
ro Lourival do Nascimento Libanio venceu a prova demnerum il
PLQ¿FDUDPHPWHUFHLUR(QWUHDVGXSODVIH-
individual masculina. A “ corrida serviu como um mininas, vitória do time formado porhinsIte istantem
abel e Paula
teste para eu correr uma meia maratona e vi que es- dem atiam
&ULVWLQDFRPKPLQGHL[DQGRSDUDWUiV3ULVFL-
tou preparado”, contou o campeão, que disputou as temussiliem hus,
OD/RXUHQoRH.iWLD3LQWRGH$OPHLGD KPLQ 
10 Milhas pela primeira vez. O pódio teve ainda os que terminaram em segundo. O pódio cessimus
teve ainda as
atletas Adair José eHnrique dos Santos (52min51) SUHVHQoDV GH 0DULD GH )iWLPD 3HVVRD H 0DULD GD
e eW
der D
ias Ferreira (54min08), na segunda e ter - Consolação (1h18min33).
ceira colocações, respectivamente. Entre as duplas mistas, vitória da experiência.
Na disputa feminina, iGsele Barros de Jesus, 26 $ PDUDWRQLVWD 0iUFLD 1DUORFK FRUUHX DR ODGR GH
DQRV ¿FRX FRP R WtWXOR ³)RL D SULPHLUD YH] TXH $PDXUL-RVpGRV6DQWRVHJDUDQWLXRWtWXORFRPR
disputei uma prova de 10 milhas e gostei muito. O tempo de 54min52. É “muito bom participar deste
SHUFXUVRIRLyWLPRPXLWREHPVLQDOL]DGRGRLQtFLR evento e senti uma diferença enorme no número de
DR ¿P DOpP GH WHU YiULRV SRQWRV GH KLGUDWDomR´ pessoas, aumentou muito em relação ao ano passa-
comentou a atleta, que cruzou a linha de chegada GR´GLVVH0iUFLDTXHQRPRPHQWRVHGHGLFDDSUR-
com 1h01min11. Minutos depois, chegaram Rai- vas mais curtas. José Luiz Lima e Fernanda Nóbre-
munda Maria Brito da Fonseca, com 1h04min27, ga (58min38), e Luis H enrique dos Santos e Neilda
em segundo lugar, e Silvia Moreira Lopes Ribeiro do Nascimento (58min59), completaram o pódio.
(1h04min42) em terceiro. Outras três cidades receberão as 10 Milhas Mi-
Na prova de duplas, o clima foi de muita anima- zuno:São Paulo (2 de agosto), Belo oHrizonte (4 de
ção. eDnivaldo Francisco e dÉer oGmes fecharam RXWXEUR H%UDVtOLD GHQRYHPEUR 

A etapa do Rio foi a


primeira das quatro que
compõem o circuito
Mizuno 10 Milhas Brasil

60
16
assinante sa

Julio Mine
Arquivo pessoal

“I
niciei neste maravilhoso mundo das corridas em
2005, na Nike 10K, a convite de minha irmã, que
também começara a correr naquele mesmo ano.
6HQGR D SURYD LQLFLDO ¿TXHL HQFDQWDGR FRP R yWLPR DV-
tral que encontrei entre todos os integrantes do evento, que
chegou a quase 10.000 pessoas, todas vestidas com a mes-
ma camiseta amarela, que foi a marca registrada daquele
evento.
D
e lá para cá, foram mais de uma centena de corridas,
de 4 a 21km, a menor delas com sete pessoas e algumas
com mais de 20.000 participantes, mas em todas elas en-
contrei aquele mesmo astral da primeira, ou seja, todos aju-
dando a todos, companheirismo, amizade e a preocupação
com a saúde e o condicionamento físico.
Atualmente treino com a equipe de Vinhedo (SP) e mui-
to tenho a agradecer ao professor Leandro, que incentiva a
união, ajuda os integrantes da equipe e os demais corredores
e nos dá o apoio técnico necessário para que continuemos a
prática desta atividade física de forma prazerosa e segura.
Agradeço também a minha esposa Magali, que me in-
centiva a continuar treinando, mesmo que algumas ativi-
GDGHVGRQRVVR¿QDOGHVHPDQD¿TXHPSUHMXGLFDGDVSHORV
longões ou provas que fazemos, pois ela também sabe que
‘correr é tudo de bom’.”

A parceria com a Nike do Brasil continua e em toda as edições uma nova pessoa será selecionada. Se

Foto ilustrativa do kit masculino


você é assinante da revista SuperAção, mande uma carta para ASSINANTE SUPERAÇÃO (Av. Nossa
Senhora de Fátima, 95 - Campinas/SP, CEP 13076-000) ou envie e-mail (superacao@interesportes.com.
br) com este título, nome completo, telefone e endereço do e-mail para contato, endereço completo e sua
história em corridas de rua. Não esqueça das fotos, de preferência em atividade. São elas que ilustrarão
as páginas e devem estar nítidas e grandes. As melhores histórias serão selecionadas pela equipe da
SuperAção e Nike do Brasil para publicação, e ganharão KIT NIKE.

www.nikecorre.com
10k

Corrida das Pontes do Recife


Emerson Silva

O
s quenianos roubaram a cena - e o primeiro na terceira e quarta colocações, respectivamente.
lugar do pódio - na 6ª Corrida das Pontes Enio Kleiton de Lima fechou o pódio na quinta co-
do Recife Bicbanco, na manhã do dia 14 de locação, com 32min09.
junho. O evento, um dos maiores do Nordeste, reu- A exemplo do que aconteceu na prova mascu-
niu mais de 4 mil corredores em um dia de bastante lina, entre as mulheres o alto do pódio também
sol na capital de Pernambuco. foi do Quênia. Anne Cheptanni Berewe teve mais
Na prova de 10km, que contou com 2,6 mil par- tranquilidade que o compatriota Kipleting e fechou
ticipantes, a largada principal ocorreu às 9h. Com os 10km em 34min29, com quase de um minuto
certa tranquilidade, o queniano Biwott Stanley Ki- de vantagem para Marily dos Santos (35min15).
pleting foi impondo seu ritmo durante o percurso e Maria Lúcia Alves Vieira (36min40), Marluce
garantiu a vitória com o tempo de 30min14. O cam- Queiroz (38min05) e Solange Cerqueira de Souza
peão deixou para trás o brasileiro Ubiratan José dos (1h06min28) completaram o pódio feminino.
Santos, que chegou a liderar a prova, mas acabou Além da prova de 10km, o evento agitou toda a
em segundo com o tempo de 30min33. Os brasilei- população com a realização da corrida de 5,6km, da
62
16 ros Josueldo Francisco do Nascimento (31min27) e
Jorgivaldo Oliveira Santos (31min44) terminaram
corrida infantil de 2,5km, para crianças de 10 a 17
anos, da rede pública de ensino, e da caminhada.
minha história

Brincadeira de mulher
Arquivo pessoal

“C
om o outono já avançado, o friozinho
do litoral para alguns até poderia ser
PRWLYRSDUD¿FDUGHEDL[RGRHGUHGRP
0DVjVKGDPDQKmGHViEDGRGHGHPDLR
Mi HVWDYD HX GH Sp FRP XPD ~QLFD G~YLGD HQWUH
EHUPXGD RX FDOoD SDUD YHVWLU H TXDVH SURQWD SDUD
RGHVD¿RGRGLDD0DUDWRQDGH5HYH]DPHQWR%HU-
WLRJD0DUHVLDVQROLWRUDOQRUWHGH6mR3DXOR5HD-
lizada duas vezes por ano, pela Cia de Eventos, a
FRPSHWLomRDWUDLDPDQWHVGDQDWXUH]DDSDL[RQDGRV
SRU FRUULGDV GH UXD H DOJXQV PDOXFRV FRQKHFLGRV
SRUXOWUDPDUDWRQLVWDVTXHSHUFRUUHPVR]LQKRVRV
TXLO{PHWURVGHSURYD
(X DSHVDU GH PH HQTXDGUDU HP WRGRV RV LWHQV
LQFOXVLYHQRµPDOXFRV¶FRQWLQXRFRPRXPDVLPSOHV
PRUWDODSWDDSHQDVSDUDXQVNP3DUDPLQKDDOH-
JULDHGDPDLRULDGRVHVSRUWLVWDVFDWHJRULDVGH
RXSDUWLFLSDQWHVIRUPDPHTXLSHVGHUHYH]DPHQWR
para atravessarem praias, trilhas, estradas de terra FRPSHWLGRUHVPDVQHQKXPDPXOKHU3DVVHLRXWURV
H DVIDOWR 1D PLQKD HTXLSH 83),7 /DGLHV 3RZHU H VHJXLPRV QXP ULWPR FRQVWDQWH DOWHUQDQGR HQWUH
QRYH PXOKHUHV TXH QR GLD D GLD GLYLGHP R WHPSR FRUULGDWURWHFDPLQKDGDUXPRDRFpX3RUpPVHP-
HQWUHWUDEDOKRHVWXGRVFDVDHHPDOJXQVFDVRV¿- SUHFRPRFRUDomRQDERFD'HSRLVGHXQVNPGH
OKRVDOLHUDPDSHQDVDWOHWDVDPDGRUDVHPEXVFDGH VXELGDLQWHQVDFRPGLUHLWRDPXLWRVLQFHQWLYRVGDV
GLYHUVmRHFODURGHXPSRXFRGHFRPSHWLomR'HV- PHQLQDVGDHTXLSHGHDPLJRVTXHSDVVDYDPGHFDU-
FREULHQTXDQWR¿FDYDQDWRUFLGDDFDGDWUDQVLomRj UR H GH PXLWRV GHVFRQKHFLGRV SHOR FDPLQKR FKH-
HVSHUDGDPLQKDYH]±HXVHULDD~OWLPD±TXHDGLV- JDPRVDRWRSR1DGDPHOKRUGRTXHOHUDSODFDGH
SXWDHUDWDQWRFRPDVFRQFRUUHQWHVIHPLQLQDVTXDQWR µ)DOWDPPHWURVSDUDDGHVFLGD¶
FRPD83),73RZHUHTXLSHPDVFXOLQDWDPEpPGH 6RTXHLQXPULWPRDOXFLQDGRVHUUDDEDL[R&RU-
DOXQRVGD83),7$VVHVVRULD(VSRUWLYD ULYRHLFRUULDWpDHQWUDGDSDUDDSUDLDGH0DUHLDV
'R ODGR GH Fi 6DQGUD $QLWD 6XVLOD 0DIH µ)DOWDPHQRVGHNP¶DYLVRXDVWDIISRXFRDQWHVGD
&OiXGLD7DLDQD*HVLDQHVHUHYH]DUDPHDEULUDP DUHLDIRIDGDSUDLDDLQGD~PLGDGDFKXYDGRGLDDQ-
PLQXWRVGRVPHQLQRVTXHHVWDYDPHPDSHQDVVHLV WHULRUFRPHoDUDOLWHUDOPHQWHPHVXJDU&DGDSDVVR
LQWHJUDQWHV (QTXDQWR DJXDUGiYDPRV D FKHJDGD GD SDUHFLDXPDHWHUQLGDGH$OX]YHUGHTXHDSRQWDYDD
SHQ~OWLPD FRUUHGRUD D 0DULDQD TXH OXWDYD FRQWUD FKHJDGD HVWDYD GLVWDQWH$ SHOR PHQRV XPD OpJXD
RUHOyJLRSDUDPDQWHUDGLIHUHQoDQRWUHFKRHPTXH HUD VHQVDomR 8P SDVVR SRU YH] XPD UHVSLUDomR
FRUULDRPDLVUiSLGRGDHTXLSHPDVFXOLQDRVRXWURV RIHJDQWH SRU YH] 5HVSLUD )DOWD SRXFR (VFDSR
VHUHYH]DYDPQXPHVIRUoRSDUDDIHWDUPHXSVLFROy- GDVRQGDVTXHLQVLVWLDPHPPHEXVFDUPDLVDOJXQV
JLFR(QWUHXPµQyVYDPRVSDVVDU¶HXPµYRFrGHYLD SDVVRVHQRYDPHQWHRFRUDomRDFHOHUD
LUFRPSUDUXPVDSDWRQDORMLQKDDOL¶VySDUDPHGLV- 1RV SDVVRV ¿QDLV DTXHOH DSHUWR QR SHLWR PDV
WUDLUGDFRUULGDHXWHQWDYDDORQJDUHDTXHFHU QmRPDLVSHORHVIRUoRHVLPSHODHPRomRGHFRP-
3DUDDPLQKDDOHJULDHWULVWH]DGHOHVHLVTXHFKH- SOHWDUDHWDSDHPKFUDYDGDHMXQWRGDVFRPSDQKHL-
JDD0DULSDUDPHSDVVDURFKLS6HPVDEHUTXDQWRV UDV GH HTXLSH TXH FUX]DUDP R SyUWLFR GH FKHJDGD
minutos ou segundos atrás estava a turma dos ra- DR PHX ODGR SDUD QXP DEUDoR FROHWLYR FRPHPR-
SD]HVHVHPQHPOHPEUDUTXHKDYLDPRXWUDVHTXL- UDUPRVDµ1266$9,7Ï5,$¶$K(PLQXWRVQD
SHVIHPLQLQDVQDSURYDSDUWLSDUDRVNPHQWUH IUHQWHGDHTXLSHPDVFXOLQD5VVV´
&DPEXUL H 0DUHVLDV$FRPSDQKDGD SDVVR D SDVVR
SHORPHXPDULGRTXHQRDQRSDVVDGRSDUWLFLSRXGD Por Lilian Araujo
VROR VXELPRV D VHUUD )XL XOWUDSDVVDGD SRU DOJXQV Equipe UpFit Ladies Power

63
SUPERAÇÃO
10k

Circuito Volkswagen Run


Fotos: Divulgação

U
ma corrida diferente. Ao
invés de pneus, tênis. Ao
invés do ronco dos moto-
res, o som ritmado das passadas.
Ao invés de trabalho, diversão.
Deixando as máquinas de lado, a
fábrica da Volksw agen do Brasil
em Taubaté, São Paulo, foi palco
de uma corrida de 10km, no dia
14 de junho. A prova, que faz par-
te do Circuito Volksw agen Run,
reuniu mil corredores, incluindo
DWOHWDV SUR¿VVLRQDLV FRODERUDGR-
res da empresa e demais partici-
pantes.
O trajeto levou os competido-
res para dentro da empresa. Na
briga pelo pódio ou simplesmente
SRU GLYHUVmR QR ¿QDO GH VHPDQD Correr em meio à linha de produção de
os atletas conheceram, mesmo que rapidamente, a automóveis é uma das atrações da prova
linha de produção do Novo Gol e do Voyage, que
fabrica 250 mil carros por ano.
1DFDWHJRULDPDVFXOLQDDYLWyULD¿FRXFRP'D-
mião Ancelmo de Souza, que completou o percurso
em 28min48, 10 segundos àfrente de Paulo Alves
dos Santos (28min58), segundo colocado. O pódio
ainda contou com as presenças do queniano Em-
manuel Kipkemei Belt (29min03), Daniel Lopes
Ferreira (29min24) e David Benedito de Macedo
(29min28).
Na disputa feminina, Fabiana Cristine da Sil-
va triunfou ao registrar a marca de 34min36, com
Sueli Pereira Silva (34min42) em segundo e Ro-
sangela Raimunda Faria (34min54) em terceiro. A primeira etapa do Circuito reuniu mil
Conceição Maria Carvalho Oliveira, com 35min03, atletas e foi vencida por Damião Ancelmo de
foi a quarta colocada, enquanto a queniana Ednah Souza e Fabiana Cristine da Silva (abaixo)
Mukhw ana fechou o pódio em quinto com o tempo
de 35min36.
Depois de Taubaté, o Circuito Volksw agen Run
terá provas nas fábricas de São José dos Pinhais
(PR), em 19 de julho, e São Bernardo do Campo
(SP), em 22 de novembro. Os cinco primeiros colo-
cados em cada categoria levam prêmios em dinheiro
- o vencedor ganha R$5 mil;o 2ºcolocado, R$3,5
mil;o 3º, R$2,5 mil;o 4º, R$1 mil;e o 5º, R$500.
Para os concluintes da prova em menos de 1h45, há
o sorteio de um Novo Gol por etapa. Em Taubaté,
64
16 João Carlos da Silva, que trabalha na Ferramentaria
da Volksw agen, levou o carrão para casa.
As fases da corrida
avaliação dinâmica dos membros in-

A feriores durante a marcha e a corrida


tem sido foco de diversas publicações
FLHQWt¿FDV 2V SDUkPHWURV ELRPHFkQLFRV GD MEDICINA
corrida são fundamentais na determinação da
H¿FLrQFLD GR PRYLPHQWR H VXDV LPSOLFDo}HV ESPORTIVA
QRDSDUHFLPHQWRGHOHV}HV Dr. Cristiano Frota de Souza Laurino
Podemos dividir o ciclo da corrida em
duas fases:
1. FASE DE APOIO: representa 45%da corrida e se SpjSDUWHDQWHULRUGDSHUQD
FDUDFWHUL]DSHODSUHVHQoDGRSpQRVROR6XEGLYLGHVH ‡(9(56­2'25(7523e movimento da borda la-
em contato inicial (choque do calcâneo), médio apoio WHUDOGRSpHPGLUHomRjSDUWHODWHUDOGDSHUQD$VRODGR
(apoio do pé total) e propulsão (desprendimento do FDOFDQKDU¿FDDSRQWDGDSDUDIRUDGDOLQKDGHSURJUHVVmR
KiOX[RXSULPHLURGHGR  GDFRUULGD
2. FASE DE BALANÇO: representa 55% da corrida e 2VPRYLPHQWRVTXHFRPS}HPD683,1$d­2VmR
VHFDUDFWHUL]DSHODDXVrQFLDGHFRQWDWRGRVSpVQRFKmR ‡$'8d­2'2$17(3e caracterizado pelos dedos
2 WLSR GH FRUULGD SRGH VHU FDUDFWHUL]DGR SRU GLIH- do pé apontando para dentro da linha de progressão da
UHQoDV QDV GXUDo}HV GDV IDVHV GH DSRLR H GH EDODQoR FRUULGD
Durante um trote, por exemplo, a duração da fase de ‡)/(;­23/$17$5'272512=(/2 a região
apoio é maior do que a fase de balanço, enquanto que anterior do pé angulada para baixo em relação ao cal-
na corrida de longa distância, a duração da fase de FDQKDU 2 Sp VH DEDL[D SURFXUDQGR DOLQKDUVH FRP R
DSRLRpLJXDOjIDVHGHEDODQoR$FRUULGDGHYHORFLGDGH maior eixo da perna, elevando o calcanhar do chão, o
se caracteriza por uma fase de apoio de duração menor que leva ao afastamento do dorso do pé àparte anterior
do que a de balanço, além de diferenças importantes na GDSHUQD
IRUPDGHDSRLRGRSpQDVXSHUItFLH ‡,19(56­2'25(7523e caracterizado pela bor-
$IDVHGHDSRLRSRGHVHUVXEGLYLGLGDHPWUrVVXE da medial do pé, que se dirige para a parte medial da
IDVHVFRQWDWRLQLFLDOPpGLRDSRLRHFRQWDWR¿QDORX SHUQDHDVRODGRFDOFDQKDU¿FDDSRQWDGDSDUDGHQWURGD
SURSXOVmR OLQKDGHSURJUHVVmRGDFRUULGD
‡ &217$72 ,1,&,$/ ocorre na borda externa do Durante a fase de apoio do pé no solo, o tempo pro-
FDOFDQKDUFRPRSpHPVXSLQDomR ORQJDGRGHSHUPDQrQFLDGDSURQDomRRXGDVXSLQDomR
‡ 0e',2$32,2 aplanamento do pé no solo com pode gerar áreas de sobrecarga nos membros inferiores,
OHYHSURQDomR desencadeando o aparecimento de lesões musculares,
‡35238/6­2o pé volta a supinar, transformando- WHQGLQRVDVFDUWLODJLQRVDVRXyVVHDV
VHQXPDDODYDQFDUtJLGDSDUDRLPSXOVRGRFRUSR $FRQVHTXrQFLDGDSURQDomRH[FHVVLYD UiSLGDSUR-
Alguns movimentos estão presentes em cada passa- gressão para a pronação ou tempo de pronação prolon-
da e constituem elementos fundamentais da biomecâni- JDGR  VLJQL¿FD D SHUGD GRV PHFDQLVPRV GH DGDSWDomR
FDQRUPDOGDFRUULGDFRPRDSURQDomRHDVXSLQDomR GRSpQRVRORHDLQH¿FLHQWHWUDQVIHUrQFLDGHIRUoDVjV
$3521$d­2SHUPLWHTXHRSpVHDGDSWHjVVX- FRQGLo}HVGHVXSHUItFLH
perfícies do terreno e ocorre durante a fase de médio A recomendação de calçados para a corrida constitui-
DSRLR2VPRYLPHQWRVTXHDFRPS}HPVmR VHXPGHVD¿RSDUDHVSHFLDOLVWDVQRVGLDVGHKRMHHGHYH
‡$%'8d­2'2$17(3ecaracterizado pelos de- basear-se em múltiplos aspectos, incluindo a mecânica
dos do pé apontando para fora da linha de progressão LQGLYLGXDOGDFRUULGDHVHXVSDUkPHWURV¿VLROyJLFRV
GDFRUULGD Boa corrida!
‡'256,)/(;­2'272512=(/2 caracteriza- Dr. Cristiano Laurino é Mestre em Ortopedia e Traumatologia pela UNIFESP. Dire-
do pela região anterior do pé angulada para cima em WRU&LHQWtÀFRGR&RPLWrGH7UDXPDWRORJLD'HVSRUWLYDGD6RFLHGDGH%UDVLOHLUDGH
2UWRSHGLDH7UDXPDWRORJLD 6%27 0HPEURGD$PHULFDQ$FDGHP\RI2UWKRSDHGLF
relação ao calcanhar, gerando aproximação do dorso do 6XUJHRQV $$26 0pGLFRGR&OXEHGH$WOHWLVPR%0 )%29(63$$VVHVVRU0pGL-
FRGD&RQIHGHUDomR%UDVLOHLUDGH$WOHWLVPR &%$W 

65
SUPERAÇÃO
42k
Fotos: Tião Moreira/ZDL

Maratona de
São Paulo

U
ma prova para todos os gostos - e fôlegos.
A XV Maratona Internacional de São Paulo, Briga acirrada
disputada na manhã do dia 31 de maio, não no pelotão
reuniu apenas os amantes dos 42km, mas também de elite
abriu espaço para competidores de 10km e 25km. Ta-
manha variedade de percursos transformou o evento
num sucesso de público, com mais de 15 mil corre-
dores pelas ruas da capital paulista. Na prova prin-
cipal - e que dá nome ao evento - vitória da baiana
Marizete Moreira dos Santos no feminino, enquanto
o queniano Elias Chelimo estragou a festa brasileira
no masculino.
Mais do que adversárias, Marizete Moreira dos
Santos precisou superar as cãibras para triunfar. De-
pois de impor um ritmo forte em boa parte do percur-
so, por volta do km 36 as dores começaram a inco-
modar a brasileira nas duas pernas. “No último túnel
(Tribunal de Justiça) não conseguia respirar direito.
Não sei de onde tirei força. Corri na raça”, expli-
FRXDDWOHWDTXHPDQWHYHVH¿UPHSDUDYHQFHUFRP
2h42min24. A corredora comentou que os números Caldeira, segundo colocado com 2h17min23. “A cor-
indicavam que ela venceria a prova. “Meu número ULGDIRLERD0DVDSURYD¿FRXPDLVGLItFLODSDUWLUGR
de peito é 201, o quarto do hotel 401 e hoje é dia quilômetro 26, quando o vento forte atrapalhou um
31. Com tanto número 1 eu tinha de ser a número 1 pouco. Mas gostei da minha performance”, disse o
também”, disse a campeã. campeão. O pódio foi completado pelos atletas José
Marizete de Paula Rezende, com 2h45min37, do Nascimento Souza (2h19min17), Giomar Pereira
terminou em segundo lugar, com Marily dos Santos da Silva (2h21min36) e o etíope Tola Ketema Nigus-
em terceiro (2h46min27). Completaram o pódio a se (2h22min38).
brasileira Edielza Alves dos Santos (2h52min32) e a Na disputa dos 25km, Marildo José Barduco
etíope Tolla Aberash Tesfaye (2h54min09). (1h25min45) e Edinalva da Silva Nunes (1h54min33)
Entre os homens, o queniano Elias Chelimo ven- foram os campeões, enquanto Renilson Vitorino da
66
16 ceu com certa tranquilidade. Ele completou o percur-
so em 2h13min59, com larga vantagem para Franck
Silva (32min56) e Andreia Keilla Galvão Lemes
(47min06) acabaram vitoriosos na prova de 10km.
pergunte ao treinador

SuperAção tira suas dúvidas


“Corro há muitos anos, especial- meçar a correr. Gostaria de saber para ‘segurar’ um pouco e poder
mente provas de 10km. Há algu- se somente o treino na esteira é curtir a competição? Abraço.”
mas semanas, senti a panturrilha suficiente. Tem algum problema Felipe Melo
direita durante o treino na estei- em fazer corrida apenas na acade- Campinas (SP)
ra e ainda está me incomodando. mia neste início? Um beijo.”
Gostaria de saber se tem algum Tatiana Carvalho R: Olá, Felipe! Essas alterações
tratamento que posso fazer em Rio de Janeiro (RJ) pontuais nunca são uma boa
casa para voltar a correr. Obri- estratégia nutricional. Assim
gado.” R: Olá, Tatiana. Tudo bem? como não há alimentos má-
Paulo Tarso Moraes Muitas pessoas que fazem gicos para antes ou durante
Porto Alegre (RS) academia estão descobrindo as provas, não podemos dizer
o grande prazer que é correr! que exista alimentos específi-
R: Paulo, você provavelmente Não há problema em iniciar na cos que alterarem todo o seu
sofreu uma lesão muscular e corrida treinando em esteira. relógio biológico assim, tão fa-
o correto é procurar o mais É até recomendável, pois nela cilmente ou rapidamente. O
rapidamente possível um mé- é bem mais fácil controlar a nosso relógio biológico (e as
dico ortopedista. Em geral, os velocidade e com isso conse- nossas idas ao banheiro fazem
especialistas recomendam o guir correr por mais tempo. parte dele) é regulado muito
uso de bolsa de gelo no local, De qualquer forma, é sempre mais lentamente. Você vai ter
entre 5 e 10min, diversas vezes bom você fazer um ou outro que reacostumar aos poucos
ao dia, até que tenha o diag- treino de final de semana em o seu corpo, seja por meio do
nóstico e o tratamento mais parques ou ruas não muito tipo de alimento que come (e
adequado para a lesão. Talvez movimentados, para se acos- aqui as fibras têm grande par-
seja necessário fazer algumas tumar com outro tipo de piso ticipação no processo), assim
sessões de fisioterapia duran- e ir aprendendo a controlar como com o horário em que
te a fase aguda para ajudar na seu ritmo sozinha. Ótimas vai ao banheiro. E isso serve
cicatrização e, na reabilitação, corridas! para qualquer horário, pois se
seja recomendado o fortaleci- Abraços, a pessoa já sabe que a hora de
mento e alongamento da área Nelson Evêncio uma competição pode não ser
afetada. das mais favoráveis, ela deve
Espero que retorne logo às “A maioria das corridas acontece pensar nisso antes do grande
corridas! no período da manhã e meu in- dia.
Renato Dutra testino funciona como um reló- Bons treinos!
gio, justamente nessa hora. Tem Danilo Balu
“Faço academia, mas quero co- algum alimento que posso comer

CONHEÇA O NOSSO TIME


Prof. Danilo Balu Prof. Renato Dutra Prof. Cláudio Roberto de Castilho
Bacharel em Esporte e graduado em Nutrição pela USP CREF 991-G/SP CREF nº 008333-G/SP - CBAt 489
Bacharel em Esporte pela USP Graduado em Educação Física pela UMC
Prof. Nelson Evêncio Pós-graduado em Treinamento Desportivo pela Pós-Graduado em Treinamento Desportivo pela FMU
CREF nº 016048-G/SP Escola Paulista de Medicina Equipe Saúde & Performance Atividade Física
Graduado em Educação Física pela Faculdade Osec Sócio-Treinador da Ação Total Consultoria em
Pós-Graduado em Treinamento Desportivo FMU Qualidade de Vida
Equipe Nelson Evêncio Assessoria Esportiva

SuperAção tira dúvidas sobre treinamento, nutrição e tudo relacionado ao esporte. Para isso, firmou parceria com um time de profissionais com competência comprovada e respeito
no meio. Para participar, escreva para nós: Av. Nossa Sra. de Fátima, 95, Taquaral - Campinas-SP, Cep 13076-000 ou envie e-mail para superacao@interesportes.com.br.

67
SUPERAÇÃO
Foi assim...
N
R ¿QDO GH PDLR H LQtFLR GH MXQKR
WLYHPRVR7URIpX%UDVLOGH$WOHWLV-
PRTXHpRFDPSHRQDWRQDFLRQDO
GHFOXEHV1HVWHDQRIRLUHDOL]DGRHPGXDV
HWDSDVVHQGRXPDHP%UDJDQoD3DXOLVWD RECORDAR
,QWHULRU GH 6mR 3DXOR QD VHGH GR &OXEH
5HGHHRXWUDQR5LRGH-DQHLURQR(QJH-
É CORRER
Sergio Coutinho Nogueira
QKmR
'HVGHDVHTXLSHVTXHGLULMRWrP
VH VDJUDGR FDPSHmV QDFLRQDLV VHP LQWHU- HPVXDVHGH1RPDUWHORIHPLQLQR.DWLXVFLDGH
UXSomR'HDSHOD)XQLOHQVHHGH -HVXV 7ULVWDQ TXH HVWDYD GHVDFUHGLWDGD VH VX-
HPGLDQWHSHOD%0 )DJRUD%0 )%RYHVSD SHURXHYHQFHXGHIRUPDFRQYLQFHQWHHHPRFLR-
eXPDSURH]D$SHQDVTXDWURSHVVRDVPHDFRP- QDQWH1RGHFDWOR$QGHUVRQ(VWHYmR9HQkQFLR
SDQKDUDP QHVWD WUDMHWyULD GHVGH R LQtFLR HP TXH YHLR SDUD R FOXEH QHVWH DQR H WUHLQD FRP
WRGRVRVWtWXORVRVWpFQLFRV5LFDUGR'¶$QJHOR RQRVVRH[GHFDWOHWD(GHPDU$OYHVGRV6DQWRV
H$ULVWLGHV-XQTXHLUDRDGPLQLVWUDWLYR$JQDOGR WDPEpPVXUSUHHQGHXFRPVXDFRQTXLVWD
9HURQH]LHRDWOHWD9DQGHUOHL&RUGHLURGH/LPD $R¿QDOGHHWDSDOLGHUiYDPRVFRPSRQ-
KRMHSDWURQRGDHTXLSHHIXWXUDPHQWHJHUHQWHGR WRVFRQWUDGRDGYHUViULRTXHDLQGDDFUHGLWD-
&OXEH %0 ) %RYHVSD $ JUDQGH PDLRULD GDV YDHPXPDUHDomRSDUDSRGHUHP³GDURFRXURQD
FRQTXLVWDVIRLQR5LRGH-DQHLURHDQWHVGHFR- %0 )´FRPRKDYLDPSURPHWLGRHPHQWUHYLVWD
PHoDUR7URIpX%UDVLOGHVWHDQRHUDPWtWXORV FROHWLYD
FRQVHFXWLYRV 9HLRDVHJXQGDHWDSDQR5LRGH-DQHLURQD
6LQFHUDPHQWH HX QR ¿QDO GR DQR SDVVDGR EHOD SLVWD GR (QJHQKmR 1D SULPHLUD SURYD D
HVWDYDGHVPRWLYDGRHSHQVDQGRHPGHL[DUDGL- QRVVD &UX] 1RQDWD GD 6LOYD YHQFHX RV 
UHomRWpFQLFDGRFOXEH0DVFRPRWRGRVVDEHP PHWURV FRP PDUFD GH PLQV VXUSUH-
QR¿QDOGRDQRYiULRVWpFQLFRVHDWOHWDVGHQRVVR HQGHQGR D IDYRULWD /X]LD GH 6RX]D 3LQWR TXH
FOXEHIRUDPDVVHGLDGRVSHORFRQFRUUHQWHHPXL- KDYLD VLGR FRQWUDWDGD SHOR FRQFRUUHQWH DSHQDV
WRVIRUDPVHGX]LGRVDRVHQFDQWRVHVHWUDQVIHUL- SDUDFRPSHWLUR7URIpX%UDVLOHTXHIH]WDPEpP
UDP ,QFOXVLYH DOJXQV GRV SULQFLSDLV QRPHV GR XPDEHODSURYDFRPPLQV1DRXWUD¿-
DWOHWLVPRQDFLRQDO(QHVWHFDVRHXQmRSRGHULD QDO GR GLD GHX D OyJLFD 0DUtOVRQ *RPHV GRV
GHL[DURFOXEHHPXPGLItFLOPRPHQWR$VVLP 6DQWRVWDPEpPGD%0 )%RYHVSDHWUHLQDGR
GHFLGL¿FDUPDLVXPDQRUHHVWUXWXUDUDHTXLSH SHOR $GDXWR 'RPLQJXHV PDQWHYH R IDYRULWLV-
UHRUJDQL]DU SUHVWLJLDU H GDU IRUoD DRV WpFQLFRV PR2ELFDPSHmRGD0DUDWRQDGH1RYD,RUTXH
HDWOHWDVTXHSHUPDQHFHUDPPXLWRVGHOHVUHFX- IH] R UHFRUGH GR 7URIpX FRP PLQV VH-
VDQGR LQFOXVLYH SURSRVWDV ¿QDQFHLUDV YDQWDMR- JXLGRSRU'DPLmR6RX]DTXHIH]PLQV
VDV2SWDUDPSHODVHJXUDQoDHVWDELOLGDGHHYD- &RPHVWHVUHVXOWDGRVDXPHQWDYDDYDQWDJHPGR
ORUHVTXHRQRVVRFOXEHWHPRIHUHFLGRDRORQJR &OXEH %0 ) %RYHVSD PDV DLQGD WHUtDPRV DV
GRWHPSR SURYDV GH YHORFLGDGH TXH HUDP R SRQWR IRUWH
)LTXHLHMXQWRFRPRVWpFQLFRVPRQWDPRVD GD5HGH
PHOKRUHTXLSHTXHSXGHPRVHDFRORFDPRVSDUD 1R VHJXQGR GLD GD VHJXQGD HWDSD D 5HGH
FRPSHWLUQDPHOKRUIRUPD9DORUL]DPRVDRPi- FRQ¿UPRX R IDYRULWLVPR QRV P PDVFXOLQR
[LPRDXQLmRDFRODERUDomRRUHVSHLWRHDLQ- FRP -RVp &DUORV 0RUHLUD PDV D %0 ) UHV-
GLYLGXDOLGDGH GH FDGD XP SDUD TXH VRPDGRV SRQGHX FRP YLWyULD QRV P IHPLQLQR FRP
IRUPiVVHPRVXPJUXSRFRHVRHIRUWH /XFLPDU0RXUDID]HQGRDERDPDUFDGHV
1D SULPHLUD HWDSD HP %UDJDQoD IRUDP UH- 1HVWHGLDD5HGHYHQFHXRLWRSURYDVHD%0 )
DOL]DGDVTXDWURSURYDV9HQFHPRVWUrVGHODVMi %RYHVSD TXDWUR PDV QRV SRQWRV D YDQWDJHP
VDLQGR j IUHQWH H VXUSUHHQGHQGR R DGYHUViULR VHJXLD¿UPHSDUDD%0 )%RYHVSD
68
16
3RUpP R FOLPD HQWUH RV DGYHUViULRV HUD GH FRPHoRX EHP YHQFHQGR RV  PHWURV VREUH
TXH QR ViEDGR FRP RV UHYH]DPHQWRV SDVVD- EDUUHLUDVQRPDVFXOLQRHQRIHPLQLQR$FRQWHFH
ULDPjIUHQWHSDUD³GDURFRXUR´3RURXWURODGR TXHD%0 )UHVSRQGHXjDOWXUDQRGDUGRIHPL-
QD%0 )%RYHVSDSHUPDQHFLDDWUDQTXLOLGDGH QLQRFRPD$OHVVDQGUD5HVHQGHODQoDQGR
H PXLWD XQLmR GH WRGRV QD OXWD SRU XP PHVPR PHWURV H (OLVDQJHOD $GULDQR YHQFHQGR R SHVR
LGHDORWtWXOR QXPJUDQGHHVIRUoRPHVPRFRQWXQGLGD
1RVPFRPREVWiFXORVIHPLQLQRYLWyULD 1R VDOWR WULSOR YLWyULD GH -DGHO *UHJyULR
GD6DELQH+HLWOLQJGD8QLVFFRPPLQV GR3LQKHLURV$VLFV3RUpPSRUXPUHFXUVRIHL-
1RVPHWURVJDQKRX)DELDQR3HoDQKDGD WR SHOD 5HGH QmR VRPRX SRQWRV SDUD VHX FOX-
3LQKHLURV$VLFV FRP PLQV TXHEUDQGR D EH $VVLP HVVD SRQWXDomR IRL SDUD XP DWOHWD
KHJHPRQLD%0 )%RYHVSD5HGHDWpHQWmR GD 5HGH -HIIHUVRQ 6DELQR 0DV D %0 ) GHX
(UDViEDGRSHQ~OWLPRGLDGHGLVSXWDVHWLYH- R WURFR FRP D YLWyULD GH 0DUtOVRQ *RPHV QRV
PRVDVSURYDVGHPDUFKDDWOpWLFD1RIHPLQLQR  PHWURV H FRP QRYR UHFRUGH GR 7URIpX
YHQFHX 7kQLD 6SLQGOHU TXH KDYLD VLGR GLVSHQ- %UDVLO PLQV  (VVH UHVXOWDGR GHX XPD
VDGDSHOD5HGHQR¿QDOGRDQRHIRLFRQWUDWDGD FHUWDIROJDj%0 )%RYHVSDQDOXWDSHORWtWXOR
SHOD %0 ) %RYHVSD 1R PDVFXOLQR JDQKRX QDFLRQDO1RVPHWURVIHPLQLQRYROWDUDPDV
-RVp$OHVVDQGUR%DJLR HVSHUDQoDVGD5HGHFRPGREUDGLQKDORJRIUXV-
1RV  PHWURV FRP REVWiFXORV YLWyULD WDGDFRPDYLWyULDGH+XJR%DOGXLQRGH6RX]D
GH )HUQDQGR $OH[ )HUQDQGHV TXH KDYLD VLGR QRVPPDVFXOLQRSHOD%0 )%RYHVSD
FRQWUDWDGRSHOD5HGHSDUDR7URIpX%UDVLOFRP 2GLDHVWDYDSRUWHUPLQDUHDLQGDWLYHPRVXP
PLQV HQTXDQWR TXH QRV  PHWURV UHFRUGH VXODPHULFDQR FRP )DELDQD 0XUHU GD
QRYDYLWyULDGH&UX]1RQDWDGD%0 )%RYHV- %0 )%RYHVSDQRVDOWRFRPYDUDFRPP
SDFRPPLQVFRPVXDFRPSDQKHLUDGH 2EHOtVVLPRVDOWRIRLFRPHPRUDGRFRPJUDQGH
FOXEH)DELDQD&ULVWLQHGD6LOYDTXHUHWRUQDYDGH DOHJULD SHOD DWOHWD FDUUHJDQGR D EDQGHLUD GR
OHVmRHFRPSRXFRVGLDVGHWUHLQRVXUSUHHQGHQ- FOXEHMXQWRDVXDWRUFLGD
GRFRPXPyWLPRVHJXQGROXJDUHQXPH[HP- 1R VDOWR HP GLVWkQFLD .HLOD &RVWD FRP
SORGHVXSHUDomRIH]DPDUFDGHPLQV PVXSHUDYDDFRPSDQKHLUDGHFOXEH0DXU-
$ 5HGH TXH HVSHUDYD YLUDU QHVWH GLD QmR UHQ 0DJJL TXH FRQVHJXLX P QXPD EHOD
FRQVHJXLXGHSRLVGHYHUVXDHTXLSHGHUHYH]D- GLVSXWD1RVPHWURVHQRVPVREUHEDU-
PHQWR[PIHPLQLQRIUDQFDIDYRULWDSHU- UHLUDVYLWyULDVGHDWOHWDVGD5HGH
GHUSDUDDVULYDLVGD%0 )%RYHVSDFRPXPD 1DVGXDV~OWLPDVSURYDVWRUFLGDDWOHWDVWpF-
GHPRQVWUDomR GH VLQFURQLVPR QDV SDVVDJHQV QLFRVHPHPEURVGR&OXEH%0 )MiFRPHPRUD-
GHEDVWmRHPXLWDJDUUDQDSURYD1R[P YDPPDLVXPWtWXORFRQTXLVWDGR(SDUDFRURDU
PDVFXOLQRD5HGHWDPEpPIDYRULWDQmRWHUPL- DHTXLSHDLQGDVXUSUHHQGHXFRPXPDEULOKDQWH
QRXDSURYDHYLXD%0 )%RYHVSDFKHJDUQD YLWyULD QR  [ P PDVFXOLQR SURYD HP TXH
IUHQWH3RUpPSDUDDOHJULDGRULYDODHTXLSHIRL HUD FRQVLGHUDGD ]HEUD 0RVWUDQGR XQLmR RUJD-
GHVFODVVL¿FDGD SRU LQYDVmR GD UDLD H D YLWyULD QL]DomRHVXSHUDomRGHWRGRVGXUDQWHDFRPSH-
DFDERXVHQGRGD2UFDPSLHTXLSHGH&DPSLQDV WLomRRVJXHUUHLURVGD%0 )%RYHVSDDUUDQFD-
$R¿QDOGHVWHGLDDYDQWDJHPFRQWLQXDYDFRP UDP QRV PHWURV ¿QDLV FRP 5DSKDHO )HUQDQGHV
D%0 )%RYHVSD0DVQR~OWLPRGLDWHUtDPRV SDUDIHFKDUR7URIpX%UDVLOFRPFKDYHGHRXUR
YiULDV¿QDLVHRWtWXORQmRSRGHULDHQHPGHYH- (D%0 )%RYHVSDVHVDJURXFDPSHmFRP
ULDVHUFRPHPRUDGRGHYpVSHUD SRQWRVHQTXDQWRD5HGHVRPRXSRQWRV
2GRPLQJRSURPHWLDVHUHPRFLRQDQWHFRPR )RL OLQGR (PRFLRQDQWH $ FRPSHWLomR IRL
WURIpXGHFDPSHmRVHQGRGLVSXWDGRSRQWRDSRQ- GLVSXWDGDSRQWRDSRQWRHQR¿QDODXQLmRIH]
WRSRLVD5HGHDLQGDWLQKDHVSHUDQoDVGHWLUDUD DIRUoDHGHXXPDQRYDYLWyULDDR&OXEH%0 )
GLIHUHQoDTXHDVHSDUDYDGD%0 )%RYHVSD( %RYHVSD

69
17
SUPERAÇÃO
calendário

CORRIDAS DE RUA
JULHO
Dia Prova Local Data de inscrição Valor Informações
03 1ª Corrida da Telemática de Área – 8km Brasília/DF Até 01/07 Donativos www.7cta.eb.mil.br
 ž'HVD¿RGD0DWD$WOkQWLFD$7ULEXQD &XEDWmR63 $Wp   (QFHUUDGDV  ZZZWULHVSRUWHVFRPEU
 &RUULGD+RUWR)ORUHVWDO&DPSRVGR-RUGmR±NP &DPSRVGR-RUGmR63 $WpDWOHWDV 'H5D5 ZZZFRUSRUHRUJEU
 &LUFXLWR6(0(GH&RUULGDGH5XD±NP 6mR3DXOR63 $Wp   *UDWXLWR  ZZZDWLYRFRP
 )DVKLRQ5XQ±NP 6mR3DXOR63 $Wp   5  ZZZIDVKLRQUXQFRPEU
 (WDSD&LUFXLWR&RUSD3RUWR$OHJUH±NP 3RUWR$OHJUH56 $Wp   'H5D5  
 &RUULGDGR)RJR±NP %UDVtOLD') $Wp   5  ZZZFRUUHGRUGHUXDFRPEU
 &RUULGD&RUSRUH%RPEHLURV.P 6mR3DXOR63 $Wp   'H5D5 ZZZFRUSRUHRUJEU
 &LUFXLWR6(6&GH0LQLPDUDWRQD±NP 6mR/HRSROGR56 $FRQ¿UPDU  'H5D5 ZZZVHVFUVFRPEU
 ,&RUULGDH&DPLQKDGD6'55LRGR6XO±NP 5LRGR6XO56 $Wp   *UDWXLWR  ZZZUVOVGUVFJRYEU
 ž'HVD¿RGH&RUULGD$UUDLDOGR&DER±NP $UUDLDOGR&DER5- $Wp   5  ZZZDWLYRFRP
 &LUFXLWR%UDVLOHLURGH&RUULGDVGH0RQWDQKD 6%HQWR6DSXFDt63 $Wp   5  ZZZFRUULGDVGHPRQWDQKDFRPEU
 &RUULGD6SRUWV 7UDFNV *RLkQLD*2 $Wp   5NJDOLPHQWR ZZZVWUDFNVFRPEU
 683(5.0 6mR3DXOR63 $Wp   'H5D5 ZZZ\HVFRPFRPEU
 3URYD3HGHVWUHGH-XOKR±NP *XDUDWLQJXHWi63 $Wp   'H5D5 ZZZUXQQHUEUDVLOFRPEU
 &RUULGDGD)RJXHLUD±HNP -XL]GH)RUD0* $Wp   5  ZZZFRUULGDGDIRJXHLUDFRPEU
 &LUFXLWR0RQJDJXiGH&RUULGDV(WDSD±NP 0RQJDJXi63 $Wp   'H5D5 ZZZUXQQHUEUDVLOFRPEU
 &LUFXLWR6(0(GH&RUULGDGH5XD±NP 6mR3DXOR63 $Wp   *UDWXLWR  ZZZDWLYRFRP
 &RUULGD3LQGD±NP 3LQGDPRQKDQJDED63 $Wp   5   
 &URVV&RXQWU\GR&253$±HNP 3RUWR$OHJUH56 $Wp   $FRQ¿UPDU  ZZZFRUSDHVSEU
 &DPLQKDGDH&RUULGDSHOD,QFOXVmR6RFLDO±HNP 6mR3DXOR63 $Wp   5 ZZZFDPLQKDGDSHODLQFOXVDRFRPEU
 &LUFXLWRGDV(VWDo}HV,19(512 6mR3DXOR63 $Wp   'H5D5 ZZZFLUFXLWRGDVHVWDFRHVFRPEU
 7UDFN )LHOG5XQ6HULHV'LDPRQG5XQ±NP %HOR+RUL]RQWH0* $Wp   5  ZZZWUDFNDQG¿HOGFRPEU
 .1LJKW %UDVtOLD') $FRQ¿UPDU  $FRQ¿UPDU  ZZZEVE¿WQHVVFRPEU
 &LUFXLWR,OKDEHODGH&RUULGDGH5XDHWDSD ,OKDEHOD63 $Wp   *UDWXLWR  ZZZDWLYRFRP
 5-&ODVVLF±&RUULGDGRV)X]LOHLURV1DYDLV±HNP 5LRGH-DQHLUR5- $Wp   'H5D5 ZZZFRUSRUHRUJEU
 &LUFXLWRGDV(VWDo}HV,19(512 %HOR+RUL]RQWH0* $Wp   'H5D5 ZZZFLUFXLWRGDVHVWDFRHVFRPEU
 5~VWLFD,QWHUSUDLDV±HNP %DO&DPERUL~6& $Wp   'H5D5 ZZZDWLYRFRP
 &LUFXLWR6(0(GH&RUULGDGH5XD±NP 6mR3DXOR63 $Wp   *UDWXLWR  ZZZDWLYRFRP
 92/.6:$*(1581±NP &XULWLED35 $Wp   5  ZZZYZEUFRPEU
 %HDFK&URVV.03HUXtEH,WDQKDpP 3HUXtEH63 $Wp   'H5D5 ZZZWKHYHQWRVFRPEU
 )DVW5XQ)OH[3p)LOD±HNP 0RJLGDV&UX]HV63 $Wp   5  ZZZÀH[SHVSRUWFRPEU
 0HLD0DUDWRQDGDVÈJXDV±NP 3RoRVGH&DOGDV63 $Wp   5   
 &LUFXLWR6(0(GH&RUULGDGH5XD±NP 6mR3DXOR63 $Wp   *UDWXLWR  ZZZDWLYRFRP
 &LUFXLWRGDV(VWDo}HV,19(512 5LRGH-DQHLUR5- $Wp   'H5D5 ZZZFLUFXLWRGDVHVWDFRHVFRPEU
 &LUFXLWR%DUGR0DQpGH&RUULGDVGH5XD *XDUDWLQJXHWi63 'LD   'H5D5  
 &RUULGDGR3DUTXH0DULD$SDUHFLGD±NP &DMDPDU63 $Wp   'H5D5  
 (FR5XQ%UDVtOLD±HNP %UDVtOLD') $Wp   'H5D5 ZZZHFRUXQFRPEU
 &RUULGDGD6ROLGDULHGDGH±NP 5LEHLUmR3UHWR63 $Wp   5NJDOLPHQWR  
 &LUFXLWR6HVFGH&RUULGD±NP 6mR3DXOR63 $Wp   (VJRWDGD  ZZZDWLYRFRP
 &LUFXLWRGD/RQJHYLGDGH%UDGHVFR±NP &DPSLQDV63 $Wp   'H5D5 ZZZFRUULGDGDORQJHYLGDGHFRPEU
 (WDSD&LUFXLWR&RUSD±32$±HNP 3RUWR$OHJUH56 $Wp   'H5D5  
 &RUULGDGH$QLYHUViULRGD6RJLSD±HNP 3RUWR$OHJUH56 $Wp   'H5D5 ZZZFRUSDHVSEU
 5XQQLQJIRU1DWXUH(WDSD7HUUD±HNP 2VDVFR63 $Wp   'H5D5 ZZZUXQQLQJIRUQDWXUHFRP
 &RUULGD&LGDGHGH3LUDFLFDED±NP 3LUDFLFDED63 $Wp   5OOHLWH  
 (VWDomR0DUDWRQD±HNP 5LEHLUmR3LUHV63 $Wp   'H5D5 ZZZDWLYRFRP

AGOSTO
Dia Prova Local Data de inscrição Valor Informações
 &RUULGD3HGHVWUH&LGDGHGH*DUoD±NP *DUoD63 $Wp   5   
 &LUFXLWRGH&RUULGDVGD&$,;$±HNP %HOR+RUL]RQWH0* $Wp   'H5D5 ZZZFLUFXLWRFDL[DFRPEU
 &LUFXLWR6(0(GH&RUULGDGH5XD±NP 6mR3DXOR63 $Wp   *UDWXLWR  ZZZDWLYRFRP
 &LUFXLWR0L]XQR0LOKDV%UDVLO 6mR3DXOR63 $WpDWOHWDV 'H5D5 ZZZPLOKDVFRPEU
 7UDFN )LHOG5XQ6HULHV5LEHLUmR6KRSSLQJ±NP 5LEHLUmR3UHWR63 $Wp   5  ZZZWUDFNDQG¿HOGFRPEU
 9,,&,&255( 5HFLIH3( $Wp   5  ZZZDWLYRFRP
 ,&RUULGDH&DPLQKDGD9LYDD/DUDQMD±NP 1LWHUyL5- $Wp   'H5D5  
 ;;,,,&RUULGDGR3RUWR)HUUHLUD)XWHERO&OXEH 3RUWR)HUUHLUD63 $Wp   'H5D5 ZZZFRUSXVHYHQWRVFRPEU
 &RUULGD,QIDQWLOGD)DPLOLD&RUGI %UDVtOLD') $FRQ¿UPDU  $FRQ¿UPDU  ZZZFRUGIFRPEU
 &RUULGDH&DPLQKDGD&RQWUDR&kQFHUGH0DPD±NP 6mR3DXOR63 $Wp   5  ZZZ\HVFRPFRPEU
 ;,9&RUULGD&RUSRUH&HQWUR+LVWyULFR±NP 6mR3DXOR63 $Wp   'H5D5 ZZZFRUSRUHRUJEU
 &LUFXLWR6(0(GH&RUULGDGH5XD±NP 6mR3DXOR63 $Wp   *UDWXLWR  ZZZDWLYRFRP
 &LUFXLWRGD/RQJHYLGDGH%UDGHVFR %DXUX63 $FRQ¿UPDU  $FRQ¿UPDUZZZFRUULGDGDORQJHYLGDGHFRPEU
 &RUULGD0~OWLSOD(00RYLPHQWR±HNP *RLkQLD*2 $Wp   'H5D5 ZZZZHEUXQFRPEU
 .P&LGDGHGH-D~ -D~63 $Wp   5  ZZZUXQQHUEUDVLOFRPEU
 'H]0LOKDV*DURWR±NP 9LWyULD(6 $Wp   5  ZZZJDURWRFRPEU
 $OSKDYLOOH5XQQLQJ HWDSD  %DUXHUL63 $Wp   5  ZZZ]DUUREUDVLOFRPEU
 &LUFXLWR6(0(GH&RUULGDGH5XD±NP 6mR3DXOR63 $Wp   *UDWXLWR  ZZZDWLYRFRP

70
 &LUFXLWRGDV3UDLDV(WDSD±NP %HUWLRJD63 $Wp   'H5D5  
 &RUULGD7URIpX'XTXHGH&D[LDV±HNP 6mR3DXOR63 $Wp   'H5D5 ZZZFRUSRUHRUJEU
 6WUHHW5XQ$%&&KDOOHQJHHWDSD±HNP 6WR$QGUp63 $Wp   5  ZZZDWLYRFRP
 &RUULGD,QWHUQDFLRQDO0DWLODW1DUGLQL±NP &DWDQGXYD63 $FRQ¿UPDU  $FRQ¿UPDU  ZZZPDWLODWFRPEU
 &LUFXLWR%DUGR0DQpGH&RUULGDVGH5XD *XDUDWLQJXHWi63 'LD   5   
 &LUFXLWR6(0(GH&RUULGDGH5XD±NP 6mR3DXOR63 $Wp   *UDWXLWR  ZZZDWLYRFRP
 &LUFXLWRGDV(VWDo}HV3ULPDYHUD 3RUWR$OHJUH56 $Wp   'H5D5 ZZZFLUFXLWRGDVHVWDFRHVFRPEU
 &RUULGD79%&DPSLQDV±NP &DPSLQDV63 $FRQ¿UPDU  $FRQ¿UPDUZZZWYEFRPEU
 &RUULGDGR/DJR6XO %UDVtOLD') $FRQ¿UPDU  'H5D5 ZZZIUHHFRUQHUFRPEU
 &RUULGD5~VWLFDH&DPLQKDGDGH6DSXFDt0LULP±HNP 6DSXFDt0LULP0* $WpDWOHWDV 'H5D5 ZZZDFRVPFRPEU
 1LVVDQ;7(55$1LJKW7UDLO5XQ $QJUD5- $Wp   'H5D5 ZZZ[WHUUDEUD]LOFRP
 1LVVDQ;7(55$.LGV5XQQLQJ $QJUD5- $Wp   5  ZZZ[WHUUDEUD]LOFRP
 &LUFXLWRGH&RUULGDVGD&$,;$±HNP 3RUWR$OHJUH56 $Wp   'H5D5 ZZZFLUFXLWRFDL[DFRPEU
 &RUULGD$QRV81,)$/±NP $OIHQDV0* $Wp   'H5D5 ZZZUXQQHUEUDVLOFRPEU
 &LUFXLWRGD/RQJHYLGDGH%UDGHVFR 6-RVp5LR3UHWR63 $FRQ¿UPDU  $FRQ¿UPDU ZZZFRUULGDGDORQJHYLGDGHFRPEU
 &LUFXLWR6(0(GH&RUULGDGH5XD±NP 6mR3DXOR63 $Wp   *UDWXLWR  ZZZDWLYRFRP

SETEMBRO
Dia Prova Local Data de inscrição Valor Informações
 &RUULGD&RUSRUH:7&±HNP 6mR3DXOR63 $FRQ¿UPDU  $FRQ¿UPDU  ZZZFRUSRUHRUJEU
 5~VWLFD3DQRUkPLFD'HFNGD%DUUDGR1RUWH±HNP %DO&DPERUL~6& $Wp   'H5D5 ZZZOXL]IHOLFLRFRP
 7URIpX,QGHSHQGrQFLDGR%UDVLO±NP 6mR3DXOR63 $Wp   'H5D5ZZZMMVHYHQWRVFRPEU
 &RUULGD3HOD3D]&DL[D±HNP 6mR3DXOR63 $Wp   'H5D5 ZZZ\HVFRPFRPEU
 9,,,&,&255( 5HFLIH3( $Wp   5  ZZZDWLYRFRP
 7UDFN )LHOG5XQ6HULHV6KRSSLQJ,JXDWHPL±NP 3RUWR$OHJUH56 $FRQ¿UPDU  $FRQ¿UPDU  ZZZWUDFNDQG¿HOGFRPEU
 &LUFXLWR6(0(GH&RUULGDGH5XD±NP 6mR3DXOR63 $Wp   *UDWXLWR  ZZZDWLYRFRP
 &RUULGDGRV)X]LOHLURV1DYDLV %UDVtOLD') $FRQ¿UPDU  $FRQ¿UPDU  ZZZFRUUHGRUGHUXDFRPEU
 &RUULGDGH$QLYHUViULRGD6RJLSD±HNP 3RUWR$OHJUH56 $Wp   'H5D5 ZZZFRUSDHVSEU
 &RUULGD,QIDQWLO 6mR3DXOR63 $FRQ¿UPDU  $FRQ¿UPDU  ZZZFRUSRUHRUJEU
 &URVV&RXQWU\GH1RYD)ULEXUJR$GYHQWXUH5- 1RYD)ULEXUJR5- $Wp   'H5D5 ZZZSURGHVSRUWHFRPEU
 &LUFXLWRGD/RQJHYLGDGH%UDGHVFR 5LEHLUmR3UHWR63 $FRQ¿UPDU  $FRQ¿UPDUZZZFRUULGDGDORQJHYLGDGHFRPEU
 &LUFXLWR0RQJDJXiGH&RUULGDV(WDSD±NP 0RQJDJXi63 $Wp   'H5D5 ZZZUXQQHUEUDVLOFRPEU
 &LUFXLWR6(0(GH&RUULGDGH5XD±NP 6mR3DXOR63 $Wp   *UDWXLWR  ZZZDWLYRFRP
 &LUFXLWRGH&RUULGDVGD&$,;$±HNP )RUWDOH]D&( $Wp   'H5D5 ZZZFLUFXLWRFDL[DFRPEU
 &RUULGDH&DPLQKDGD³4XLO{PHWURVGH6ROLGDULHGDGH´ 6mR3DXOR63 $FRQ¿UPDU  $FRQ¿UPDU  ZZZFDLUEDUVFKXWHORUJ
 3URYD(FROyJLFD,OKD3RUFKDW±NP 6mR9LFHQWH63 $Wp   5   
 7UDFN )LHOG5XQ6HULHV%+6KRSSLQJ±NP %HOR+RUL]RQWH0* $FRQ¿UPDU  $FRQ¿UPDU  ZZZWUDFNDQG¿HOGFRPEU

MEIA MARATONA
JULHO
Dia Prova Local Data de inscrição Valor Informações
 0HLD0DUDWRQD&DWDUDWDVGR,JXDoX )R]GR,JXDoX35 $Wp   'H5D5 ZZZSURFRUUHURUJEU
 ,90HLD0DUDWRQD&RUUH5HFLIH 5HFLIH3( $Wp   5  ZZZFRUUHGRUHVGRUHFLIHFRPEU
 0HLD0DUDWRQDGDVÈJXDV±NP 3RoRVGH&DOGDV0* $Wp   5   
 0HLD0DUDWRQDGH&DPSLQDV &DPSLQDV63 $Wp   'H5D5 ZZZWYEFRPEU

AGOSTO
Dia Prova Local Data de inscrição Valor Informações
 0HLD0DUDWRQD&LGDGHGH6mR%HUQDUGRGR&DPSR 6%HUQDUGR&DPSR63 $Wp   'H5D5 ZZZFRUSRUHRUJEU
 0HLD0DUDWRQD$7ULEXQD 3UDLD*UDQGH63 $FRQ¿UPDU  $FRQ¿UPDU  ZZZWULHVSRUWHVFRPEU
 0HLD0DUDWRQDGH%OXPHQDX %OXPHQDX6& $Wp   'H5D5ZZZPHLDPDUDWRQDEOXPHQDXFRPEU

SETEMBRO
Dia Prova Local Data de inscrição Valor Informações
 0HLD0DUDWRQD5~VWLFDGH*XDULED *XDULED63 $Wp   *UDWXLWD  ZZZUXQQHUEUDVLOFRPEU
 ;,,,0HLD0DUDWRQD,QWHUQDFLRQDOGR5LRGH-DQHLUR 5LRGH-DQHLUR5- $Wp   'H5D5 ZZZ\HVFRPFRPEU
 0HLD0DUDWRQDGDV3RQWHV±HNP 6mR3DXOR63 $Wp   5   

MARATONA
JULHO
Dia Prova Local Data de inscrição Valor Informações
 5XQ'D\0DUDWRQD%UDVtOLD±HNP %UDVtOLD') $Wp   5  ZZZPNVHVSRUWHVFRPEU

AGOSTO
Dia Prova Local Data de inscrição Valor Informações
 .%RPELQKDV$GYHQWXUH0DUDWKRQ %RPELQKDV6& $Wp   'H5D5 ZZZERPELQKDVUXQQHUVFRPEU

SETEMBRO
Dia Prova Local Data de inscrição Valor Informações
 0DUDWRQDGDV3UDLDV%HUWLRJD %HUWLRJD63 $Wp   'H5D5 ZZZWKHYHQWRVFRPEU

71
SUPERAÇÃO
calendário

REVEZAMENTO
JULHO
Dia Prova Local Data de inscrição Valor Informações
 0DUDWRQD%HWR&DUUHUR±NP 3HQKD6& $Wp   'H5D5 ZZZPDUDWRQDEHWRFDUUHURFRPEU
 0DUDWRQD3mRGH$o~FDUGH5HYH]GH)RUWDOH]D )RUWDOH]D&( $Wp   'H5D5 ZZZPDUDWRQDGHUHYH]DPHQWRFRPEU
 %UDVtOLD0XOWLVSRUW'HVD¿RQR&HUUDGR±HNP %UDVtOLD') $Wp   'H5D5 ZZZYLYDEUDVLOLDFRP 

AGOSTO
Dia Prova Local Data de inscrição Valor Informações
 0DUDWRQD3mRGH$o~FDUGH5HYH]GH%UDVtOLD %UDVtOLD') $Wp   'H5D5 ZZZPDUDWRQDGHUHYH]DPHQWRFRPEU
 ž5HYH]DPHQWR9ROWDGH6mR)UDQFLVFR±NP 6)UDQFLVFR6XO6& $Wp   'H5D5 ZZZHFRÀRULSDFRP
 &RUSRUDWH5XQ 6mR3DXOR63 $Wp   5  ZZZFRUSRUDWHUXQFRPEU
 0HLD0DUDWRQDGH5HYH](FR5XQ 6DOYDGRU63 $WpDWOHWDV 'H5D5 ZZZHFRUXQFRPEU

SETEMBRO
Dia Prova Local Data de inscrição Valor Informações
 0HLD0DUDWRQDGH6DOYDGRUGH5HYH]DPHQWR 6DOYDGRU0* $Wp   'H5D5 ZZZ\HVFRPFRPEU
 0DUDWRQD3mRGH$o~FDUGH5HYH]GH6mR3DXOR 6mR3DXOR63 $Wp   'H5D5 ZZZPDUDWRQDGHUHYH]DPHQWRFRPEU
 $YHQWXUD&DPSRVGR-RUGmR±NP &DPSRVGR-RUGmR63 $FRQ¿UPDU  $FRQ¿UPDU  ZZZFRUSRUHRUJEU
 6XSHUNPGH5HYH]DPHQWR±(WDSD%UDVtOLD %UDVtOLD') $Wp   'H5D5 ZZZ\HVFRPFRPEU

PROVAS DE PISTA
JULHO
Dia Prova Local Informações
 &DPS%UDVLOHLURV&DL[DGH$WOHWLVPRGH-XYHQLV 8EHUOkQGLD0*    ZZZFEDWRUJEU
PROVAS INTERNACIONAIS
 5XVND0DUDWRQ )LQOkQGLD ZZZUXVNDPDUDWRQFRP
MEIA MARATONA  7RUVKDYQ0DUDWKRQ ,OKDV)DURH KWWSWRUVKDYQPDUDWKRQFRP
AGOSTO  .DXD¶L0DUDWKRQDQG+DOI (8$ ZZZWKHNDXDLPDUDWKRQFRP
Dia Prova Local Informações  0DUDWRQ:URFODZ 3RO{QLD ZZZZURFODZPDUDWRQSO
 0HGLD0DUDWyQGH%RJRWi &RO{PELD ZZZPHGLDPDUDWRQERJRWDFRP  0RVFRZ,QW¶O3HDFH0DUDWKRQ 5~VVLD ZZZPDUDIRQPVNUX
 9LOQLXV0DUDWKRQ +DOI /LWXkQLD ZZZPDUDWRQDVOW
SETEMBRO  7DOOLQQ0DUDWKRQ (VW{QLD ZZZMRRNVHH
Dia Prova Local Informações  +DQV&KULVWLDQ$QGHUVHQ0DUDWKRQ 'LQDPDUFD ZZZKFDPDUDWKRQGN
 )MRUG1RUZD\+DOI0DUDWKRQ 1RUXHJD ZZZNQDUYLNPLODQR  6\GQH\0DUDWKRQ $XVWUiOLD ZZZUXQWKHEULGJHFRPDX
 WK1LNH%XGDSHVW,QW¶O+DOI0DUDWKRQ +XQJULD ZZZEXGDSHVWPDUDWKRQFRP  UHDO%HUOLQ0DUDWKRQ $OHPDQKD ZZZUHDOEHUOLQPDUDWKRQFRP
 0HGLR0DUDWyQ$WODVGH*XDGDODMDUD 0p[LFR ZZZPHGLRPDUDWRQDWODVFRP  'DPWRW'DPORRS +RODQGD ZZZGDPORRSQO
 3LOD,QW¶O+DOI0DUDWKRQ 3RO{QLD ZZZSLODKDOIPDUDWKRQSO  0DXL0DUDWKRQ +DOI0DUDWKRQ (8$ ZZZPDXLPDUDWKRQFRP
 *UHDW6FRWWLVK5XQ+DOI0DUDWKRQ *Um%UHWDQKD ZZZUXQJODVJRZRUJ
 9DUD]GLQVNL3ROXPDUDWKRQ &URiFLD ZZZPDUDWKRQKU
 5HHERN%ULVWRO+DOI0DUDWKRQ *Um%UHWDQKD ZZZEULVWROKDOIPDUDWKRQFRP
 0DUDWRQ/HRQ,QGHSHQGHQFLD 0p[LFR ZZZPDUDWRQLQGHSHQGHQFLDFRPP[
 6WRFNKROP+DOI0DUDWKRQ 6XpFLD ZZZVWRFNKROPKDOIPDUDWKRQVH
 1RYRVLELUVN+DOI0DUDWKRQ 5~VVLD ZZZPDUDIRQQVNUX  0DUDWRQGHOD&LXGDGGH0p[LFR 0p[LFR ZZZPDUDWRQGIJREP[
 0HGLD0DUDWRQ,QW¶O&LXGDGGH0HGHOOLQ &RO{PELD KWWSPDUDWRQPHGHOOLQFRP  1HGEDQN&DSH7RZQ0DUDWKRQ ÈIULFDGR6XO ZZZZSDRUJ]D
 7XULQ+DOI0DUDWKRQ ,WiOLD ZZZWXULQPDUDWKRQLW  /DNH7DKRH0DUDWKRQ (8$ ZZZODNHWDKRHPDUDWKRQFRP
 ;;,0HGLD0DUDWyQGH%XHQRV$LUHV $UJHQWLQD ZZZFKDPSLRQFKLSFRPDU  6FRWLDEDQN7RURQWR0DUDWKRQ +DOI &DQDGi ZZZWRURQWRZDWHUIURQWPDUDWKRQFRP
 573+DOI0DUDWKRQRI3RUWXJDO 3RUWXJDO ZZZPDUDWRQDFOXEHGHSRUWXJDOFRP  ,QWHUQDWLRQDO/DNH*DUGD0DUDWKRQ ,WiOLD ZZZODNHJDUGDPDUDWKRQFRP
 'H[LD%LO5RXWHGX9LQ+DOI0DUDWKRQ /X[HPEXUJR KWWSURXWHGXYLQUWOOX  )RUWLV6LQJHOORRS8WUHFKW +RODQGD KWWSDWKOHWLFQOVLQJHOORRSQO
 0DUDWRQLQD³&LWWD'L8GLQH´ ,WiOLD ZZZPDUDWRQLQDGLXGLQHLW

MARATONA
PROVAS DE PISTA
JULHO
Dia Prova Local Informações
JULHO
 =HUPDWW0DUDWKRQ 6XtoD ZZZ]HUPDWWPDUDWKRQFK
 *ROG&RDVW$LUSRUW0DUDWKRQ $XVWUiOLD ZZZJROGFRDVWPDUDWKRQFRPDX Dia Prova Local Informações
 7KH*UHDW7LEHWDQ0DUDWKRQ &KLQD ZZZJUHDWWLEHWDQPDUDWKRQFRP  &DPSHRQDWRV0XQGLDLVGH0HQRUHV ,WiOLD ZZZFEDWRUJEU
 6ZLVV$OSLQH0DUDWKRQ'DYRV 6XtoD ZZZVZLVVDOSLQHFK  &DPS6XO$PHULFDQRVGH-XYHQLV 9HQH]XHOD ZZZFEDWRUJEU
 6DQ)UDQFLVFR0DUDWKRQ (8$ ZZZUXQVIPFRP
AGOSTO
AGOSTO Dia Prova Local Informações
Dia Prova Local Informações  &DPSHRQDWR0XQGLDOGH$WOHWLVPR $OHPDQKD ZZZFEDWRUJEU
 6LEHULDQ,QWHUQDWLRQDO0DUDWKRQ 5~VVLD KWWSUXQVLPUX
 0DUDWyQ,QWHUQDFLRQDO&LXGDGGH3DQDPi 3DQDPi ZZZPDUDWKRQSDQDPDFRP SETEMBRO
 +HOVLQNL&LW\0DUDWKRQ )LQOkQGLD ZZZKHOVLQNLFLW\PDUDWKRQ¿ Dia Prova Local Informações
 ,1*(GPRQWRQ0DUDWKRQ &DQDGi ZZZHYHQWVUXQQLQJURRPFRP  )LQDO0XQGLDOGR$WOHWLVPR *UpFLD ZZZFEDWRUJEU
 5H\NMDYLN0DUDWKRQ ,VOkQGLD ZZZPDUDWKRQLV
 0DUDWRQDH0HLD0DUDWRQDGH3DUN&LW\ (8$ ZZZSFPDUDWKRQFRP
 6644XHEHF&LW\0DUDWKRQ &DQDGi ZZZTXHEHFPDUDWKRQFRP
 +RNNDLGR0DUDWKRQ -DSmR ZZZDLPVDVVRFLDWLRQRUJ ULTRAMARATONA
SETEMBRO JULHO
Dia Prova Local Informações Dia Prova Local Informações
 -XQJIUDX0DUDWKRQ 6XtoD ZZZMXQJIUDXPDUDWKRQFKZV  8OWUD0DUDWRQD$WOkQWLFD0HOLGHV7UyLD 3RUWXJDO XOWUDPDUDWRQDDWODQWLFDEORJVSRWFRP
Consumo máximo de oxigênio
S
empre vale recordar os principais
conceitos relacionados ao desempe-
nho aeróbio. Por meio desses conhe-
cimentos cresce a possibilidade do desen-
volvimento de potencialidades físicas, com
ALTO
EDVH HP DVSHFWRV FLHQWt¿FRV SRU PHLR GH
atividades de treino. O consumo máximo de
RENDIMENTO
Prof. Ms. Ricardo Antonio D’Angelo
R[LJrQLR 92PD[ pXPSDUkPHWUR¿VLROy-
gico de carga muito utilizado no esporte em
geral, sobretudo para esportes aeróbios. Austrália, descobriram que é possível melhorar o
O que é VO2max? VO2max ou capacidade aeró- VO2max correndo a uma velocidade de consumo
bia é o limite máximo da habilidade de uma pessoa de 60% do Tmax (tempo durante o qual mantém-
gerar energia por meio das vias oxidativas. O VO2- se a velocidade de VO2max). A recuperação deverá
max é uma medida de nossa capacidade para obter compreender a mesma duração que a velocidade do
oxigênio do ar para ser utilizado no músculo, produ- esforço de VO2max. Por exemplo: se o tempo gasto
zindo, assim, energia aeróbia. Em simples palavras, correndo é de 2min45, a recuperação (um trote lento)
o VO2max mede o quão apto está o sistema cardio- deve ser de 2min45 (Anderson, 2002). Durante uma
vascular. importante parte do tempo de recuperação, o ritmo
É possível calcular o VO2max com base em resul- FDUGtDFRSHUPDQHFHUiPXLWRDOWR8PDYH]¿QDOL]DGR
tados de corridas, segundo Costill (2002). Por exem- o tempo de recuperação, deverá ser possível repetir o
plo, se o tempo atual de uma milha (1.609m) para um esforço várias vezes. Com a frequência e regularidade
determinado indivíduo é 5min45, calcula-se utilizando do exercício, a tendência será o aumento contínuo do
a seguinte fórmula: 133,61 – (13,89 x tempo em minu- número de repetições.
tos). Assim, o cálculo estimado do VO2max de acordo O volume de corrida percorrido durante o treina-
com a fórmula projeta um valor relativo de 53,74ml/ mento é um fator determinante para o desenvolvimen-
kg/min. Existem fórmulas para marcas em duas mi- to da resistência aeróbia, entretanto, o êxito da corrida
lhas, seis milhas e 10km, respectivamente 128,81 – depende, em grande parte, da qualidade e da velocida-
(5,95 x tempo em minutos), 120,62 – (1,59 x tempo de do treinamento. A corrida lenta de longa distância
em minutos) e 120,9 – (1,54 x tempo em minutos). se realiza a um ritmo consideravelmente mais lento
Em recente estudo de Swain & Franklin (2002), que o ritmo de competição. Tal treinamento não al-
as pessoas com valores de VO2max inicial abaixo de cança o desenvolvimento de padrões neurológicos de
40ml/kg/min, após treinamento em intensidades entre UHFUXWDPHQWRGH¿EUDVPXVFXODUHVVROLFLWDGRVGXUDQ-
28 a 32% da frequência cardíaca de reserva, mostra- te as competições. O treinamento para as competições
UDPVLJQL¿FDQWHVPHOKRUDVQRVYDORUHVGRSDUkPHWUR UHTXHUXPULWPRPDLVUiSLGRXPDYH]TXHDV¿EUDV
Entretanto, para aqueles com valores de VO2max musculares exigidas serão diferentes de acordo com
aproximado de 40ml/kg/min e intervenção de treino a velocidade da corrida. Os atletas que só treinam a
em intensidades abaixo de 46% da frequência cardíaca uma velocidade menor que o ritmo de competição,
GHUHVHUYDQmRIRLLGHQWL¿FDGDPHOKRUDQDFDSDFLGD- SRUVXDYH]QmRUHFUXWDPWRGDVDV¿EUDVPXVFXODUHV
de máxima aeróbia. A frequência cardíaca de reserva SDUDDOFDQoDUDH¿FiFLDQHFHVViULDSDUDDFRPSHWLomR
é a frequência cardíaca máxima menos a frequência (Costill & Trappe, 2002).
de repouso. Por exemplo: uma frequência cardíaca
máxima de 160bpm menos uma frequência cardíaca 5HIHUrQFLD %LEOLRJUi¿FD Jones E. Warren. VO2 Max:
de repouso de 60bpm equivale a 100bpm. Realizar What Is It? How Do You Develop It?. NSCA’s Performance
o exercício a 28% da frequência cardíaca de reserva Training Journal, 2003.
colocaria o ritmo cardíaco a 88bpm (28% de 100bpm,
Prof. Ms. Ricardo Antonio D’Angelo é Doutorando em Biodinâmica do Movimen-
somado o ritmo cardíaco de descanso de 60bpm). to e Esporte, UNICAMP-2008 e Treinador Coordenador do Clube de Atletismo
Investigadores da Universidade de Queensland, BM&FBOVESPA.
74
16
Aninha já sabe Mas a Rita ainda
escrever o próprio nome. não teve essa sorte.

11 reais
16 reais

0300 789 3801 0300 789 3802

Doe Agora!
Rita

Aninha

Aninha
& Rita
RJ Classic
a
22 Corrida dos
Fuzileiros Navais
5 KM, 10 KM E 20 KM
Data:
19 de julho de 2009

Local:
Aterro do flamengo
Arena montada em frente ao monumento aos
expedicionários da 2ª guerra mundial

Programação:
6h00 - início do evento - abertura do guarda-volumes
8h00 - largada geral todas as distâncias
10h00 - cerimônia de premiação

Valor da Inscrição:
R$ 40,00 - associado corpore
R$ 50,00 - não associado

Informações e inscrições: www.corpore.org.br

PATROCÍNIO: REALIZAÇÃO: