Você está na página 1de 266






de la














Le Karman.
Par qui
est faite (krta) la varit

du monde des

tres vivants (sat-

tvaloka) et du monde-rceptacle (hhjanaloka) qui ont t dcrits



chapitre prcdent ?



pas Dieu (svara,



d) qui la fait intelligemment




du monde nat de

l'acte ^


varit du


nat des actes des tres vivants.

Mais, dans cette hypothse,

duisent en





les actes pro-


temps, d'une part, des choses charmantes (ramya),

safran, santal, etc., d'autre part, des corps

(raya) de qualits tout

opposes ?

[xiii, 1 b].

Les actes des tres dont la conduite est mle d'actes bons


mauvais (vymirakrin)

(iv. 60),

produisent des corps semblables


des abcs et dont l'impuret s'coule par neuf portes,

pour servir

de remde ces corps, des objets de jouissance (hJioga) charmants,

couleurs et figures, odeurs, gots et tangibles. Mais les dieux n'ont

accompli que des actes bons

sont galement charmants.
Qu'est-ce que l'acte ?

leurs corps et leurs objets de jouissance

1 b. C'est la volition et ce qui est produit par la volition ^

Le Stra

dit qu'il

y a deux actes, la volition (cetan)

et l'acte


avoir voulu l L'acte aprs avoir voulu (cetayiiv), c'est ce que la


karmajam lokavaicitryam.
cetan tatkrtam ca tat

2. 3.

cetanm aham hhiksavah karma vadmi cetayitv ca. Aiiguttara iii. 415 cetanham bhikkhave kammam vadmi, cetayitv



1-2 .

karika dsigne par ces mots

ce qui est produit par la volition.

Ces deux actes en font

trois, acte corporel, acte vocal, acte



tablissez-vous cette division ? D'aprs le point d'appui

de l'acte (raya), d'aprs sa nature (svahliva), d'aprs sa cause

motrice ou originaire (samutthna) ?

~ A quoi tend cette question ?



l'on tient

compte du point d'appui,

n'y a qu'un acte, car tous

les actes s'appuient sur le corps. Si l'on tient

compte de
de ces

la nature,

a seulement acte vocal (vkkarman),




voix et nianas, la voix seule est action de sa nature

Si l'on tient

compte de
les actes


cause originaire, on a seulement acte mental, car tous


ont leur origine dans

Les Vaibhsikas disent que

les trois

espces d'acte [2 a] sont

tablies en raison de ces trois causes, point d'appui, nature et cause






volition est acte


en naissent deux actes,


corporel et le vocal ^


volition est ce qu'on appelle acte mental

ce qui nat de la

volition ^ l'acte aprs avoir voulu (cetayitv) \ c'est les

actes, le coiporel et le vocal.

deux autres


karoti kyena vcya manas.


Comparer Atthaslinl








tatra yac cetanety

karmoktam uktam karma tan mnasam smrtam

2 et 3: cetan cetayitv ca

cetayitv ca yat tktam tat tu kyikavcikam

L'action vocale est


89, cite Bodhicaryavaiarapanjika (v. 3, ix. 73), p. 472.




vg eva karma. Au



kyena kyasya va karma.



cetan mnasam karma tajje vkkyakarman // Sur cetan, voir ii. 24. Mrs Rhys Davids (Psychology,








IG) traduit 'volition'.

'Volition' n'est

qu' peu prs satisfaisant on verra cetan subsquente j'ai tu .


(ci-dessous, p. 22)



comporte une

On sait que, pour les Jainas, l'acte mental est seulement demi-acte (addhakamma), Majjhima, 372 (Koa, iv. 105), Uvfisakadasfio, ii. App. 2, p. 18, SBE.

XLV, pp. 83, 165, 179, 192, 242, 315.






cetayitv ceti

evam cdant karisymti






ca kyavgbhytft pravarti^ya


evam cetas sam-

cintya yat kriyate tat cetayitv karmety ucyate.


xiii, fol. 1

b-2 a.



Ces deux actes sont information



non -information

L'acte coi'porl et l'acte


information (mjnapti) et

non-information (avijapti,

11, iv. 4)

on a donc


information vocale ^ non-information



information vocale.



tu vijnaptyavijnapt.


La vijnapti


ce qui fait savoir

corps, soit au

(vijnapayati), la manifestation
la voix. Elle est corporelle

d'une pense soit au

moyen du

moyen de



premier cas, vocale dans


hyavijnapti, information par

que nous appelons un geste, sarlracest, vispanda (Madhyamakavrtti, p. 307), kyavipphandana ou la bodily suffusion de Mrs Rhys Davids (Dhammasangani, 636, Atthaslin, p. 323) vgvijnapti, information par la voix,
corps, ce

parole (Kosa,



L'cole tablit (Kosa,

2 b-3 b) que la hyavijnapti n'est pas un geste, un

mouvement du

corps, mais

une disposition, une



du corps. Le Sautrntika

nie que la figure existe en soi (3

considrer la vijnapti



de sa nature, acte ? C'est

viii. 9, x.

l'opinion des VaibhSsikas et des hrtiques de Kathvatthu,

10 (Mahim-

ssaka, Sammitya, Mahsmghika) qui croient que




et la parole
1 b),

aprs avoir voulu

dont parle Bhagavat

39) et


un acte

distinct de la volition et
p. 88, 96, 323,

rpa de

sa nature. Mais pour le TheravSdin (Atthaslin,











l'acte est volition

ce qu'il

faut entendre par




volition relative

non pas l'information par le corps , mais une kyasamcetan, au corps et qui meut le corps. (La version de Aung, Points of
11, iv. 4) est

controversy, p. 225, n'est pas irrprochable).




un acte

qui ne fait rien savoir autrui

Vavijiiapti est rpa, mais ne fait pas partie du




se classe dans

Pour prendre

et n'est

connue que par


connaissance mentale.



plus ais comprendre, l'homme qui

commet un meurtre

ou qui prend


vux de Bhiksu

produit, la suite d'une volition (cetan)


corporelle ou vocale

un geste ou une parole

et fait




temps, un acte invisible, quoique matriel

de grands lments, qui continue


exister en

lui et

s'accrotre, en raison duquel


un meurtrier ou un Bhiksu.

Cet acte invisible^ cr par certains actes visibles ou audibles et qui

s'appelle avijnapti,
' ;

suivant qu'il

on le considre comme corporel ou vocal est cr par un geste ou par une parole.


homme ordonne un



n'accomplit pas
est seulement


geste par lequel


meurtre est perptr


l'ordre qu'il






n'est pas coupable de

l'information corporelle de meurtre


Qu'est-ce que Tact qui est


2 b-3


information corporelle


2 b-3


L'cole enseigne que la vijfiapti corporelle est figure


(samsthna) ;

n'est pas


(gati), parce

que tous


conditionns (saniskrta)





autrement, rien ne prirait sans cause et la cause cratrice serait en


temps destructrice

[2 b]

La vijhapti






10 a) du corps en raison d'une volition.

D'aprs une autre cole, les Vatsputrlyas ^ la vijnapti corporelle


dplacement (gati) ^ car




y a mouvement


non pas

lorsqu'il n'y

a pas mouvement

L'auteur rpond Non, parce que tous les conditionns sont

tans (ksanika).


Que faut-il entendre par ksanika ? Ksana, prissant immdiatement aprs avoir acquis son tre (tmalbhd anantaravinl) ksanika, le dharma, ce qui pos;




comme dandika,
n'existe pas

qui porte

un bton (danda).

Le conditionn
au moment o meurt

au del de l'acquisition de son tre




de meurtre nat en



de ce


coupable de meurtre.

Lorsqu'un homme entre en dhyna ce qui suppose dtachement des passions du Kfimadhfitu il ne prononce pas les vux par lesquels on renonce au meurtre, etc. Il ne produit pas l'information vocale par laquelle le Religieux produit cette non-information qui constitue son tat de Religieux et qu'on appelle discipline {samvara, iv. 13). Mais la pense, en dhyna, est assez forte pour crer, par elle-mme et sans l'intervention d'une information vocale , l'acte de


la discipline.

[samsthnam kyiksyate / vijnaptir na yatir nst samskrtam ksanikam yatah] // na kaya cid ahetoh [syd] hetur eva vinakali j

Le texte porte apare,



d'aprs d'autres


La Vyakhyfi veut que





soient les V&tsTputrTyas.


La glose de

l'diteur japonais


fixer le regard, regarder


Dhammasaigan, la vijnapti corporelle, c'est avancer, reculer, de tous cts, avancer le bras, le retirer, etc. Car lorsque le corps se meut, elle se meut en raison de Hiuan-tsang

l'acte .



ksanikah ksane bhavah ksano 'systlti va. La Vy&khy& ajoute kana est le minimum de temps (iii. 85 d). Voir ii. 46 a-b.



xiii, fol.

2 a-3


la place o




ne peut de cette place aller une

pas mouvement.


Par consquent

la vijnapti corporelle n'est


Le VatsTputrTya

Si les conditionns sont

momentans, nous


ne sont pas susceptibles de dplacement.

est tabli qu'ils sont



puisqu'ils prissent nces-


car la


des conditionns est spontane




ne procde pas de quoi que ce

(akasnidhhaquelque chose


ne dpend pas d'une cause (ahehika).



Ce qui dpend d'une cause






(krya). La destruction (nsa, vina) est un nant



comment un nant

pourrait-il tre






la destruction

ne dpend pas d'une cause (akryatvd ahh-



destruction ne dpend pas d'une cause




prit aussitt qu'il est


ne prit pas tout de


ne prira

pas plus tard, puisqu'il reste

qu'il prit,



[3 a] Puisque

vous admettez

vous devez admettre


qu'il prit tout

de suite ^

Direz-vous que

conditionn change; que, par consquent,

est plus tard sujet

destruction ? Qu'une certaine chose change,

devienne une autre chose, en restant cette


chose que vous dites

qui voit ses caractres modifis, c'est absurde




a, p.


Direz-vous qu'il n'y a pas de

moyen de connaissance (pramna)

par sa relation (samyoga)

plus dcisif (garistha) que l'exprience directe (drsta, pratyaksa),





constate que

le bois prit



que, par consquent,


faux que toutes choses

faire l-dessus.

prissent sans cause ?

H y a bien des remarques

le bois prit


fait, le

monde ne

peroit pas directement la destruction du bois

en raison du feu. Si vous pensez que


par sa relation


puisqu'il prit plus tard

Kosa ii. 46; Madhyamakavrtti pp. 29, n. 5, 173, n. 8, 222, 413. Le Saddarsanasamuccaya (d. Suali, 46) cite un Stra des Sautrntikas pancemni bhiksavah samjnmcitram pratijndmtram samvrtimtram vyavahramtram j katamni paiica j atlto 'dhv angato 'dhv sahetuko vinsah kasam pudgala iti j Vedantastra ii. 2, 23;

La destruction

n'a pas de cause, voir

Nyayavarttikatfitparyatka (Viz. S.



le feu, c'est



2 b-3


parce que, lorsque cette relation a eu



nous ne

voyons plus

le bois

votre thse repose sur un raisonnement, non

pas sur l'vidence

directe, et votre

raisonnement n'est pas concluant.



que, aprs relation avec le feu, nous ne voyons plus le bois,

est susceptible de

deux interprtations ou bien


ou bien

le boit prit

en raison

de cette relation

bois prit

incessamment de lui-mme,
normales, mais

renat de lui-mme

incessamment dans

les conditions

arrte de se renouveler en vertu de sa relation avec le feu.

Vous admettez que

la destruction

de la flamme est spontane


(kasmika). Lorsque, aprs relation avec

vent, la



plus visible, vous admettez que cette relation n'est pas la cause de la
destruction de la
cette relation,


vous admettez que


flamme, en vertu de

a arrt de se renouveler. De




son de la


la main, pose sur la cloche,


renouvellement du



ne dtruit pas


son que vous admettez qui est momentan.

cette question.


c'est le

raisonnement qui doit trancher


Le Vatslputrlya

Quelles raisons apportez-vous en faveur de la

thse de la destruction spontane ?

Nous avons
tre cause

dj dit que la destruction, tant un nant, ne peut


(kryaivd ahhvcisya). Nous dirons encore que,



destruction tait

d'une cause, rien ne prirait sans cause.




naissance, la destruction procdait d'une


n'aurait lieu sans cause.


Or on constate que



(huddhi)f la flamme,

son, qui sont

momentans, prissent sans

la destruction

que leur destruction dpende d'une cause. Donc

bois, etc., est spontane.


Le Vaiseika soutient que


la pense antrieure [3 b] prit en raison


pense postrieure, que

son antrieur prit en raison du son




deux penses en question ne sont pas simulta-

nes (asainavadhtia

= ayugapadhliva). Des

penses contradicet haine,

doute et certitude, plaisir et souffrance,



ne se

rencontrent pas



penses non contradictoires. Et

supposer rencontre, lorsque pense ou son faibles (apatu) suivent

immdiatement pense ou son

pourraient-ils dtruire des




espce ?



forts de



xiii, fol.

3 a-4




Sthavira Vasubandhu


pensent que la


prit par l'absence d'une cause de dure


hhvt). Mais une absence ne peut tre cause (krana).

D'aprs les Vaisesikas, la flamme prit en raison du





mrite et dmrite. Cette explication est inadmissible.

Le dharma


seraient, l'un et l'autre, causes de nais-

sance et de destruction



fait natre



et la fait

suivant que la flamme est avantageuse (anugrahya) ou

Vadharma, suivant qu'elle est dsavantageuse ou avantageuse. Or on ne peut admettre que le dharma
dsavantageuse (apakrya)

Vadharma entrent en activit et ^^ moment (ksana eva ksane) l


cessent d'tre actifs chaque



manire d'expliquer


destruction vaudra pour

tout conditionn, donc

est inutile de poursuivre la discussion.


n'avez pas


droit de dire



bois prit par sa relation

avec la



Si on maintient que la destruction du bois,

a pour cause la


du bois avec

le feu,

on sera forc d'avouer que

cause qui

engendre est en


temps cause de destruction.

relation avec le feu

La cuisson (pka), ou
[4 a].

(agnisamyoga), donne

des produits (pdkaja) diffrents, la couleur de plus en plus fonce

La mme cause

qui produit la premire couleur dtruit cette

premire couleur, ou, du moins

nouvelle relation avec
le feu,


vous objectez

qu'il s'agit



feu est



cause qui dtruit la premire couleur est semblable la cause qui la


D'aprs la




D'aprs la glose de l'diteur japonais

peut comprendre
: ;



D'aprs l'Ecole des Sthaviras

ksane ksana eva glos par tasminn eva ksane. Supposons la lumire avantageuse elle nat en raison du mrite, prit aussitt en raison du dmrite renat en raison du mrite Supposons la dsavantageuse elle nat en raison du dmrite, prit en raison du Ou bien ksana eva ksane nmkliye ksane 'naupacrike ksane. mrite 3. Vyakhya akyas caisa kranaparikalpa iti vistarah / dharmd adharmavinsa iti kranaparikalpa iti sarvatra satnskrte dvyanukdau anityesii rUpdisii kartnani ca sakyate kartum ato na vaktavyam etad agnisamyogt ksthdinm vina ity evamdi.


ksana eva ksane






2 b-3




est impossible

qu'une certaine cause produise un certain

cause, ou une cause pareille, dtruise

effet et qu'ensuite cette

le dit effet.


(Comparer Tarkasamgraha,

Direz-vous que, les flammes successives tant diffrentes, longues,

courtes, grandes, petites, notre conclusion ne s'impose pas ?


apporterons un autre exemple. Par l'action prolonge de la cendre,

de la neige, des caustiques, du


de l'eau, de la

terre, se produi'.

sent et disparaissent tour tour diffrents

produits de cuisson


vous n'attribuez pas ces divers facteurs de cuisson

caractre de


On demandera pourquoi

l'eau s'anantit


elle est


si la relation


le feu

(agni) n'est pas destructrice de



raison de la relation avec le feu, par la force du feu, l'lment

ign (tejodhtu)



prsent dans l'eau



22, p. 146)


que la masse de l'eau renaisse en

quantit de plus en plus rduite

(ksmaksma), jusqu'
Voil ce que

ce que,

tant tout fait rduite (ahliiksmat), l'eau arrte de se renouveler

(na punah samtnam samtanuta

relation avec le feu ^






destruction des choses est spontane. Les choses

prissent d'elles-mmes, parce qu'il est de leur nature de prir (hhan-


Comme elles prissent Comme elles prissent en


d'elles-mmes, elles prissent en

naissant, elles sont


(ksanika). Donc

n'y a pas de

mouvement, de dplacement


y a

seulement naissance une autre place d'un second moment de la



c'est le cas,

de l'avis


de notre adversaire, pour

le feu

qui dvore une jongle. [4 b] L'ide de marche est une fausse

conception (abhimna).


la vijnapti corporelle n'est

pas dplacement, mouvement

donc la vijnapti corporelle

est figure,

pas une chose distincte, une

Le Sautrantika



la figure n'est

D'aprs l'diteur japonais,

le SaqiniitTya. xviii. 82.


Comparer AsaAga, Sotr&lamkftra,


xiii, fol.

4 a-5



chose en soi (anyad dravyam). Pour les Vaibhasikas,

fia, le visible, est,


d'une part, varnarpa, couleur, bleu,

figure, long, etc.









la figure n'existe

pas rellement (dravyasat), mais seulement


dsignation (prajnapH).



dans une direction (ekadigmiikhe),

une grande

(bhyasi, bahutare) masse de couleur (varnarpe), on dsigne cette

masse comme
est petite,




Lorsque, en comparaison, la masse de couleur


la dsigne







couleur nat en

grande quantit vers


quatre directions, on la dsigne


carr \ Lorsqu'elle nat


galement en tout sens, on

la dsigne




Les autres

figures, le haut, le bas, etc., s'expli-

quent de la


manire lorsque la couleur nat en grande quantit

dirige vers le znith,


la dsigne







figure n'est

donc pas une chose en

la figure tait

un rUpa.

Premier argument. Si

une chose en

Le rpa

serait peru par

deux organes \



voyant par l'organe de la vue, on a


de longueur,
si la

touchant par


on a


de longueur.



gueur ou toute autre figure

une chose en

soi, elle

serait perue

par deux organes. Or, d'aprs la dfinition scripturaire,

le visible, est


seulement peru par


Sans doute le Yaibhque la longueur


ika rpondra que le tact ne peroit pas la longueur, mais seulement



le dur, etc.

nous avons


de longueur relativement au

mou, au

dur, disposs d'une certaine manire, sans

fasse partie

du tangible (sprastavyyatana),

C'est trs juste

en va exactement de




La longueur

n'est pas


on dsigne




visible (couleur)

ou du tangible



disposs d'une certaine manire.

Le Vaibhasika rpond.


nous avons


de longueur

aprs avoir touch, ce n'est pas que nous percevions la figure par le
tact [5 a]

nous nous souvenons de

la figure, parce


celle-ci est






associe au tangible (shacaryt).

De mme lorsque nous voyons



couleur (visible) du feu, nous nous souvenons de la chaleur (tangible)

lorsque nous sentons l'odeur d'une

nous nous souvenons de sa



deux cas que vous allguez, on conoit que

la couleur

rappelle le tangible, que l'odeur rappelle la couleur, parce que les

dharmas en

cause sont strictement eissocis (avyahliicrt)


feu est chaud, certaine odeur appartient telle fleur. Mais le tangible



associ (niyata) avec


certaine figure
ra-t-elle le

comment donc

la perception

du tangible provoquede

souvenir de

telle figure

? Si semblable souvenir se produit



ait association invariable entre tangible et figure,


on se souviendra de

la couleur aprs avoir touch.

figure restera indtermine aprs la perception tactile,

Ou bien, comme


couleur reste indtermine aprs la



on ne connatra

pas la figure aprs avoir touch. Or


le cas.

faut pas dire que la perception du tangible provoque le souvenir de

la figure.

Deuxime argument. Dans un


tapis bigarr (citrstarana),


voit de

y aurait donc, d'aprs vous, plusieurs

rpas, catgorie


dans un




ce qui est

comme pour

la couleur. [Si la figure est

une chose

ce qui, dans le tapis,

fait partie

d'une ligne longue, ne peut pas en



faire partie d'une ligne courte.]


Troisime argument. Tout rpa




susceptible de heurt
rels d'une




bleu, etc.,

comporte des atomes

(bleu, etc.) existe

certaine nature


rpa couleur


dans l'atome octuple,

22, trad. p. 144).





figure n'existe pas

dans l'atome


n'y a pas d'atome de longueur.




lorsqu'une masse longue



un moment o nous n'avons plus son gard


de long, mais bien


de court


cette ide

ne procde


na cdnau

pas d'un rpa

xiii, fol.

5 a-5





existant dans la chose.


ce que nous


long, c'est

un nombre de choses



atomes de couleur, disposes d'une certaine manire.

Si vous soutenez


les expressions, long,


portent sur des

atomes de figure (samsthnaparamnu) disposs d'une certaine

manire [5
b], et

que des atomes qui ne seraient pas




de leur

ne pourraient tre dsigns






simplement rpter votre affirmation sans


la soutenir

d'aucun argu-


effet, si

l'existence d'atomes spciaux de figure tait tablie,


vous pourriez soutenir que runis, disposs d'une certaine faon,

constituent la longueur

mais l'existence de ces atomes

n'est pas



est tablie l'existence des


atomes de couleur, comment

pourraient-ils tre runis et disposs ?


Objection du Sarvstivdin.
si la

Si la figure n'est pas distincte

de la couleur,

figure n'est autre chose qu'une certaine disposition

de couleur, la figure ne pourra diffrer quand la couleur est la

or des cruches de



couleur prsentent des figures diffrentes.

N'avons-nous pas

que Ton dsigne





un nombre

de choses relles disposes d'une certaine manire ? Des fourmis,

toutes pareilles, se disposent en

Hgne ou en

cercle, et



rentes figures.

De mme

la figure des cruches diffre sans

que leur

couleur diffre.

Objection du Sarvstivdin.

Mais, dans l'obscurit et de loin,

on voit

la figure d'un objet, colonne,



sans voir sa couleur.


la figure existe
le fait,

part de la couleur.
la couleur d'une


on voit d'abord

manire indistincte

(avyakta); on se forme ensuite




connaissance mentale

de figure, de


qu'on se forme


de fde, l'ide d'arme,

1. Hiuan-tsang, que nous traduisons ci-dessus, s'carte de l'original .... c'est simplement rpter votre affirmation, puisque l'existence de semblables atomes n'est pas tablie. Si elle tait tablie, ces atomes pourraient se runir mais la
: ;

nature propre des parties de la figure n'est pas tablie

les parties


c'est le cas


de la couleur (na ca samsthcinvayavnfft varndivat

[c'est--dire les parties



du 'long' ne sont pas 'longues',



ces parties pourront-elles, par leur runion, donner une figure dtermine ?





aprs qu'on a vu, d'une manire indistincte, des oiseaux, des fourmis,
des lphants,




est dispose en cercle ^



arrive qu'on ne distingue clairement ni la couleur, ni la figure


connaissance mentale

on connat seulement

par la

une masse (samghtamtra).

critique le Sautrantika.

Le Sarvastivadin


autres, Sautrantikas, qui niez et le dplacement (gati) et la


[6 a], quelle est donc la chose qui, d'aprs vous,


est dsigne

(prajhapyate) par


vijnapti corporelle



disons que la vijnapti corporelle est la figure

nous spa-

rant ainsi des VatsTputrTyas-Sammitlyas


que la figure n'est

pas une chose en soi (dravya)


nous sparant ainsi des Sarvas-

Le Sarvastivadin.
n'est pas

Si vous soutenez que la vijnapli corporelle

une chose


mais seulement

la figure qui existe


dsignation, quel est donc le


rel qui, pour vous, constitue

Tacte corporel ?
L'acte corporel, c'est l'acte qui a pour objet le corps (kydlaniha-

nam, kydkisthnam karma)


c'est--dire la

volition (cetan)



corps en activit (vartayati) de diverses manires

le corps,


procde en s'appuyant sur cette porte qu'est

et est



acte corporel. Les autres actes doivent tre dfinis suivant


leur nature


vocal est l'acte qui a pour objet (adhisthna) la


mental est




l'acte associ


yuMa) au mana^,
aprs avoir voulu



Le Sarvastivadin.

Le Sotra



est volition et acte

Si l'acte corporel et l'acte vocal sont volition,

quelle diffrence entre les deux espces d'acte dfinies dans le Sotra ?

y a deux sortes de




stade initial ou prpara-




Tanne sans

voir les soldats

cela ne prouve pas que l'arme existe

part des soldais.


De mme on

voit la ligure sans distinguer la couleur.


D'aprs Hiuan-tsang. Le tibluin porte

D'abord se produit




rsolution (satnkalpa).

l'acUon est

Quand on a ainsi voulu, une volition se produit dont de mettre en mouvement (vartayati), et qui est l'acte aprs avoir




xiii, fol.

5 b-6



(prayoga), on produit une volition qui est volition pure


faut que je fasse telle




c'est ce



Stra appelle

tion pure,

acte qui est volition. Ensuite, aprs ce stade de volila volition

on produit une volition d'action, que

de faire une

action en conformit avec ce qui a t voulu auparavant,

corps, mettre la voix



c'est ce


Stra appelle cetayitv kar-


acte aprs avoir voulu.

Le Sarvstivdin.


en est

ainsi, l'acte

appel vijiapti,


n'existe pas

l'acte corporel-vocal, d'aprs vous, n'est


n'y a pas de place pour la vijhapti, matire (rpa) de sa

nature. Si la


n'existe pas, Yavijnapti,

non information
\ D'o


du domaine du Kamadhatu n'existera pas davantage

un grand

nombre de

difficults qui seront


numres plus




voir ci-dessous


y a moyen de rfuter ces


Vavijfiapti s'explique fort bien dans notre systme.

Nous pouvons dire que Nous admettons


deux sortes de volitions portant sur

les gestes corporels et les

sions vocales qui sont, pour nous, ce que les vijnaptis corporelle et

vocale sont pour vous. Ces deux sortes de volitions

qui portent


[6 b]

d'acte corporel, d'acte vocal



capables de produire une volition sui generis qui est Vavijnapti.

est la difficult ?

Le Sarvstivdin.

Cette volition stii generis sera subordonne


la pense (cittniiparivar'in,


comme Vavijnapti

ne du

dhyna de notre systme (samhitvijnaptivat) du Kamadhatu se dveloppe pendant le sommeil, etc.

or Vavijnapti



pas, car cette volition sui generis est projete par

une certaine

volition (cetanviesa) de dcision

(cetan pure), cause lointaine,


par une certaine volition de geste

de voix, cause prochaine. Et

elle existait, dpendrait,

quoi que vous en ayez, la vijnapti,


corporel et vocal,

Car Vavijnapti du domaine du Kamadhatu dpend de la vijnapti, acte rpa ; elle n'accompagne pas la pense comme Vavijnapti du Rpadhatu. Voir cependant iv. 75 c-d.


anusangnm punah pratyanusangh.




3 d-4


la projection de Vavijnapti, de la force de la volition

car elle est

elle-mme inintelligente (jada).

Les Vaibhasikas disent que

corporelle est figure.

la figure existe


soi, et


la vijhapti


La vijnapti vocale (vagvijnapti),

c'est le

son vocal


Le son (dhvani) qui

est discours de sa nature


c'est--dire le

son articul (varntmaka)


c'est la

vijhapti vocale.

Vamjnapti a

t dfinie


11, ci-dessus p. 3, n. 2).

Le Sautrantika

que Vavijnapti aussi n'existe pas rellement

(dravyatas) : (1) parce qu'elle consiste seulement ne plus faire une action aprs s'tre engag ne pas la faire (ahhytipetya akaranamtratvt);

parce que l'on dsigne


avijnapti une chose

qui existerait en raison des grands lments passs (attni


bhtny updya,



or les


passs n'existent plus


(3) parce

que Vavijnapti n'a pas la nature de rpa (rpala nature



du rpa


Vavijnapti n'tant

susceptible de heurt

(apratigha) ne peut tre rpa



Le Vaibhsika

tablit l'existence de

4. a-b. Car l'Ecriture





est de trois espces et qu'il



y a un rpa pur, car il y a croissance du mrite, car pour celui qui n'agit pas lui-mme, etc.

y a chemin-





ctera, la karika vise les raisons ci-dessous 5-8.

Le Stra





est de trois espces

Le rpa


compris dans un

triple ritpa

(rpasya rpasamgrahah)


y a un


visible et susceptible de heurt (le visible)



y a un rpa invi-

sible et susceptible de lieurt (l'il, etc.)


y a un


invisible et

exempt de heurt

qui ne peut tre que Vavijnapti \ [7 a]

Le Sotra

dit qu'il

y a un rpa pur (andsrava)


Quels sont


vHgvijUaptis tu [vgdhvanih



trividhmalarpokticrddhyakurvatpath[dUah] / ROpusunigruImsatra. Comparer Dlglia, iii. 217 Vibhaga,


pp. 13, 64.


xiii, fol.

6 b-7




purs ?



pass, futur, prsent

connaissance passe, future, prsente, au sujet de laquelle ne naissent

ni affection, ni antipathie, ce sont les





2, 24).

Or, en dehors de Vavijnapti,

sible et

n'existe pas de


qui soit invi-

exempt de



n'existe pas de


qui soit pur. [Car


l'acte corporel

ou vocal ne convient pas celui qui est entr dans


du Chemin, mrgasalyasampanna],

Le Stra


y a croissance du mrite (punyavrddhi)

y a sept uvres mritoires matrielles (atipadhika punya(iv.



lorsqu'un croyant (rciddha),





famille, en est revtu

qu'il veille, le



qu'il se tienne

debout, qu'il

dorme ou

mrite crot (ahhivardhate)


avec intensit, incessamment (satatasamita)

tionnant (upajyata eva
matrielles ?


mrite va s'addi-

punyam). Quelles

sont ces sept uvres

De mme

y a sept uvres mritoires immat-



La Vykhy

cile ici

une partie du discours de Bouddha Gunda sur

p. 185-186, et



espces d'uvres mritoires (voir Minayev, Recherches,




a-b), extrait

voir E. Huber, Sources

Par upadhi,
ou au Samgha


l'iiistoire de Ghosila dans le Vinaya des SarvstivSdins, du DivyvadSna, BEFEO. 190G, p. 18. faut entendre la chose (rma, vihra, etc.) donne un moine le mrite qui procde (tadbhava) de cet upadhi s'appelle


aupadhika. Mahcundastra (Madhyama, 2, 4) saptemni Ciinda aupadliikni punyakriyvastni mahdphalni yvan mahvaistrikni yaih samanvgatasya mddhasya kulapnfrasya va kuladuhifur va carato va tisthato va svapato va jgrato va satatasaniitam abhivardhata eva punyam upajyata eva punyam j katamni sapta / iha Cunda srddhah kulaputro va kuladuhit va cturdisya bhiksusamghyrmam pratipdayati / idam Cunda



Les uvres mritoires immatrielles ne comportent pas d'oifrande

sistent essentiellement

elles con-

que le fidle prouve de la proximit, de la prsence, de l'audition du Tathgata ou d'un Srvaka. La septime comporte la prise du refuge et l'acceptation des dfenses. iha Cunda srddhah kulaputro va kuladuhit va srnoti tathgatam va
la joie

tathgatasrvakam va

amukam grmaksetram



rutv ca punar adhigacchati prltiprmodyarn

udram kusalam







dehors de Vavijnapti, en raison de quel autre

dharma le


pourrait-il s'accrotre

mme quand

la pense n'est pas bonne (anya-


lorsque l'on est sans pense ?

4. Si

Vavljnapti n'existe pas, celui qui n'agit pas par lui-mme^

qui donne des ordres autrui, ne sera pas revtu du chemin-de-l'acte


(iv. 66).


l'action vocale qui consiste


donner un

ordre (jFipanavij fiapti) ne peut constituer



cette action



n'accomplit pas actuellement l'acte

l'acte est

accomplir. Dira-t-on que, lorsque

accompli, l'action qui


consiste donner l'ordre devient chemin-de-l'acte ? Mais

est vident

que la nature de

cette action n'est

pas modifie par l'excution de

Bhagavat a




dharmas, source externe de connon comprise dans

naissance (bliyam



onze yatais).


[7 b], invisible,

exempte de heurt









Bhagavat n'avait pas en vue Vavijhapti, qui



et qui

le dharmyatana [et non pas dans le rpyatana], rwpa inclus dans le dharmyatana ? 6. Si Vavijnapti n'existe pas, le Chemin n'a plus ses huit membres, car trois membres, samyagvc, samyakkarmnta, samyagjiva

est incluse

quel serait le

(voix, activit,

manire de vivre correctes)


86)* sont incompatibles



recueillement (samdhi). Si l'ascte, dans l'tat de recueilletrois

ment, possde ces



que ces


membres sont

de leur nature avljnapti.

67, 68)


idam Cunda prathamam niraupadhikam putiyakriyp.

Voir Siksftsamuccaya,

137 (RatnarfiisQtra), Madliyamakavftti,


309 et

sources cites dans les notes.

Anguttara, ii. 50, 54 et les discussions dans Kathavatthu, 5 paribhogamayatn punnam vaddhali et x. 9 samadnahetukatn sllatn Le Kathavatthu touche d'autres points en relation avec la doctrine vaddhati. de Vavijnapti, viii. 9, x. 8, 11.12. dharnio bhikso [bhyam 1. D'aprs la Vyftkhya cette citation commence yatanam...] Je pense qu'il faut corriger dharnUi bhikso, voir i. 85 a-b, p. 65 de

Sources plies


notre traduction.

Mais, rpliqiiera-t-on,

xiii, fol.

7 a-7 b.





Lorsqu'il connat ainsi,



voit ainsi, la





ma, la samyciksmrti, le samyaksamdhi sont cultivs et achevs samyagvc, le samyakkarmnta et le samyagjlva ont t auparavant purifis. Donc les trois derniers membres sont consi'



vijnapti et


antrieurs au recueillement.


texte, dit le

Vaibhasika, ne vise pas les trois derniers

l'activit et la


du Chemin, mais bien la voix,


manire de vivre de

de dtachement (vairgya) qui ont t obtenues par


mondain (laiikikamrga). Cela n'empche pas que

fasse partie

la voix, etc.,

du Chemin sous forme d'avijnapti.

Si Vavijnapti n'existe pas, la discipline


(samvara) de



14 a)


Ce dharma

n'existe pas en vertu duquel


une personne qui a assum (samdna)


de religion est

Bhiksu ou Bhiksuni, sa pense



mauvaise ou non-dlnie.

Le Stra enseigne que


renoncement au pch (virati)


digue qui arrte l'immoralit l

Une absence


(ahJiva) ne peut tre

une digue

la virati est

donc un


rel (avijnapti), et


evant jnata

evam pasyatah samyagdrstih

hhavith paripiirnh

tasya vkJcarmntjlvh prvam parisiiddhh paryavadth j 2. Le Kathavatthu nie que le samvara soit kamma (xii. 1). Comparer Sumangalavi3. viratih setubht dauhslyam pratibadhnti. l&sin, 305, la troisime sorte de virati, propre aux ryas et non susceptible d'tre rompue, setugJitavirati Atthasalin, p. 103, samucchedavirati ; ci-dessous V. 33 a-b. La Dhammasangani, 299, dfinit la parole droite (samnivc) : catlii vacduccaritelii rati virati anatikkamo setughto. D'aprs Buddhaghosa (Atthasalin, p. 219) setum hanatti settiyhto la parole droite est la destruction (ghta) de la digue par o passent les pchs de la voix. La traductrice (Psychology, 87) adopte cette interprtation et renvoie Anguttara i. 220, 261, ii. 145. setu Mais, dans ces passages, on peut entendre setughta setuhandha digue, obstacle Bhagavat a dclar que le maithuna est setughta . Donc, moines, qu'il y ait setughta en ce qui concerne le rire . Le Nigantha enseigne


qu'on dtruit les actes anciens par la pnitence et qu'on les endigue (setughta)
par l'abstention (akarana)
d'une digue
. .

La Mahvyutpatti,

255, 9

setusamudghtya ; version


en vue d'arrter


version chinoise

en vue d'arrter

sniparyiknm passions au moyen passions comme un

du Nirvana

Voir aussi Madhyamakavrtti,




jalapravhanirodhabhtasetusthnlyah padrthah.

pas seulement

le seul fait



de ne plus accomplir l'action laquelle



a renonc, ainsi que


soutient (p. 14^ 48).

Le Sautrantika rpond.

Ces arguments sont nombreux


et divers

[8 a], mais ne sont pas concluants.

examinerons l'un aprs

Le Stra enseigne que



est de trois espces.

Les Yoga-


disent que



dhynas, par
est l'objet

la force

du recueillement

(samdhi), un rpa nat qui

du recueillement (samdhipar la


= samdher

vu par

c'est--dire qui est peru



par exemple, dans Vasuhhahhdvan,




Ce rpa

n'est pas




invisible. Il





n'occupe pas un lieu (desnvarana)





exempt de heurt

Si vous

demandez comment

cet objet



lement peut tre rpa, puisqu'il ne possde pas


les caractres habi-

du rpa, vous oubhez que votre avijhapti donne





Le Stra

dit qu'il

y a un rpa pur (ansrava).


Les Yogacaras soutiennent que



qui nat par la force du


hbyor spyod pa dag

(sin-kieu kon-hng ch)

Paramfirtha Les anciens matres de Yogacfira Hiuan-tsang y-kia-ch. Kiokuga a une note

dveloppe 7b-8a.

rsulte de la Vyfikhyfi



terme Yogcara ne dsigne pas




Le Yogficfira qui se rend prsent le Chemin (tnrgam sammukhlkurvnah) prend possession d'une disposition mentale (aya) et d'un substrat psycho-physique (raya) tels qu'il prend possession de la moralit pure (ansrava la) comme il prend possession de la vue droite cette moralit pure tant acquise, il rside dans la moralit dite naturelle (prakrtiilat). Ou hien(atha u; les Matres soutiennent que, dans le recueillement pur mme, il y a un rpa de mme nature, c'est--dire
d'une certaine cole philosophique mais simplement J'ascte

pur (ansrave


samdhau tadevamvidham rpam

: .




iksfisamuccaya, 138 yadi bhiksavo bhiksur yukto yogcro marna iksytn

pratipannah sarvasamskresv anityadari Sur yogcara dans Mahfivastu, 120, 9, voir



remarques de




Le passage

est obscur.

Suivent quelques rfrences releves dans l'Abhidharmakoa





systme (darana) des Yog&c&ras,



est distinct des six vijnnas.




7 b-8



recueillement est pur, lorsque le recueillement est pur \

D'autres docteurs, les Darstantikas ^ soutiennent que le

Arhats (organe de

la vue, etc.) et le

dire les cinq objets des sens


rpa des rpa externe (hhya), c'est-sont nomms purs (ansrava)

parce qu'ils ne sont pas support (raya) des vices (&rava).



on peut objecter que



Stra s'exprime sans faire de distinc?

Quels sont

dharmas impurs (ssrava)


Tout ce qui

organe de la vue, tout ce qui est visible


Le Drstantika rpond que tous

aux vices
seuls, en effet, les


viss dans ce Stra

sont qualifis impurs parce qu'ils ne sont pas opposs (pratipaksa)


pense-et-mentaux (cittacaitta) peuvent

s'opposer aux vices et les dtruire.


on objectera que


mmes dharmas

seraient la fois


impurs, parce qu'ils ne s'opposent pas aux vices, et

purs, parce qu'ils ne sont pas support des vices,

avec cette cons-

quence fcheuse que


les caractres

de pur


d'impur seront confon-


pas, rplique le Drstantika, car ces


dharmas ne
si le

sont pas
visible et

purs du point de vue dont


sont impurs. D'ailleurs,




Le VijMiiavdm dfend la thse vijnnam payati. La Vyakhy cite la dfinition que les yogcraciUas donnent de



154, n, 5 de notre traduction).



Doctrine des anciens matres sur les sampattis cite par les


212 de notre traduction).


Les anciens matres du Gandharva. Bhasya Vyakhya prvcry yogcr rysangaprabhrtayah.




Opinion des anciens matres d'aprs la iii. 63 a-b. Phases de la lune. Vykhya, les Yogacras. Les anciens matres *, c'est--dire, d'aprs la Vyftkhyfi Dans iv. 75. Bhasya le systme (^nayena) des Yogacras. D'aprs les Yogacras ('Hnati), il y a 128 kleas. V. 8. Vykhya V. 43 b-c. Dfinition des avarabhgyas attribue des apare. Ces autres
: :


sont les Yogacras (Vyakhy).

10 a-b. L'ascte (yogcr) qui pratique Vatibh est de trois sortes,



ansravasamdhv ansravam rpatn samdhibalajam.

D'aprs la glose de l'diteur japonais,
p. 14.


Sur ce point de doctrine voir


31 d



les autres





taient exclusivement impurs, [8 b] pourquoi le

Su ira


Les rpas impurs








dharmas impurs

provoquant upd-


sont la cause des endurcissements de la pense et de l'iiypocrisie



Le Stra




mrite s'accrot.

Les anciens matres (prvcrya) disent

choses (dharmat)
qui ont reu

Telle est la nature des



mrite s'accrot lorsque les personnes


utilisent ce


en raison des qualits de ces

personnes (giinavisest) (dliyna, recueillement de bienveillance,


en raison du bnfice qu'elles tirent du don pour elles-mmes

les tres

ou pour tous


= arravarndbalt),


sries mentales

(samtatayas) des donneurs, eussent- ils des penses

mauvaises ou non-dfmies (anyacetasm dtrnm), se trouvent parfumes (parihhvita) par

personne qui reoit

la volition de

don qui a eu pour objet


ces sries subissent


subtile transformation

arrivent ce stade

(sksmam parinmavisesam

prpnuvanti) qu'



sont capables de donner beaucoup de

le texte

C'est dans ce

sens que

Le mrite



d'une manire intense et non interrompue,

mrite s'addilionne

Mais comment expliquer l'accroissement du mrite dans

l'uvre mritoire immatrielle (niraupadhika) ? [9 a]

cas de



mentale se transforme en raison de la rptition de


tions ayant pour objet le


et les

Sravakas (tadlambana(svapnesii) ces volitions



les rves

vont s'enchanant.


(dfinition des

ssava updnya dans Samyuita updnaskandhas).







Mahfivyutpalti, 10, 24 vypdakhi2. paiica cetokhila, Dgha, iii. 237, q. v. 3. dharmnm andiklik aktih. ladvesa ; tib. tha-ba. Coiument les qualits et les services Si on dit 4. Hiuan-isang ajoute ici d'une certaine personne produisent>ils une transformation quelconque d'une autre personne qui pense autre chose ? Cette difficull se prsente aussi dans la
: : :


de Vavijnapti






services d'une certaine


qu'une certaine chose en

Vavijnapti, naisse dans une autre

personne ?


xiii, fol.

8 a-9



Par contre, nous ne voyons pas comment

Vaibhasika, partisan

de Vavijnapti, peut expliquer la croissance du mrite dans


de l'uvre mritoire immatrielle. Celle-ci ne comporte pas d'acte

corporel ou vocal, vijnapti, mais seulement la joie prouve l'endroit

du Tathgata ou d'un Sravaka


ne comporte pas davantage


le recueillement.

Or Vavijnapti ne peut natre, d'aprs

elle est


que de


vijnapti ou du recueillement. Donc


D'aprs d'autres docteurs, une varit de Sautrantikas, dans

aussi des


uvres mritoires matrielles,


mrite procde de la

rptition de la volition ayant pour objet la personne qui reoit.


cette opinion est inadmissible en prsence

du Stra qui


Lorsqu'un Bhiksu nergique, revtu de moralit, possesseur de


dharmas, mange l'aumne du donneur,

entre ensuite


rside dans les recueillements




(bienveillance, etc.),

en raison de ce


se produira

certainement (pratiknksitavi/a)



matre d'aumnes qui donne (dyaka dnapati) efflux de


mrite, efflux de bien (Jualbhisyanda) et bonheur.




d'aumnes dont


mrite va ainsi s'accroissant




spciale (cetanvisesa) ayant pour objet la personne qui a reu ?

faut donc prfrer l'opinion des premiers matres



cas de

l'uvre mritoire matrielle,


mrite procde d'une transformation

de la srie du donneur en raison des qualits de la personne qui






Vavijnapti n'existe pas, celui qui


accomplir l'action par autrui ne sera pas revtu du chemin-de-l'acte.

tion subisse

l'missaire charg du meurtre accomplit le meurtre, la

nature des choses veut que la srie mentale de l'auteur de l'instiga-

une certaine

subtile transformation [9 b] en vertu de


laquelle cette srie portera plus tard des fruits.

en va de


lorsqu'on agit par soi-mme

au moment o



Comparer Anguttara ii. 54 et le Ratnaraistra, cit Siksasamuccaya, La phrasologie de notre Stra diffre de ces deux sources Hiuan-tsang s'carte ici du tibtain il porte Un efflux de mrite mouille sa srie et un sukha sans mesure coule dans son corps ,

p. 138.





(meurtre, etc.) est achev (kriyplialaparisampimi), ce

la srie subit

une transformation. Cette transformation

moment reoit le nom


de chemin-de-l'acte, et par consquent l'homme dont la srie est

transforme est revtu du chemin-de-l'acte

(transformation de la srie)

car on donne


qui convient au propre la cause

(chemin de


et cette

transformation est dite corporelle ou

vocale suivant qu'elle rsulte d'un acte du corps ou de la voix. C'est

en vertu des

drent Vavijhapti
corporel ou vocal.

mmes principes que les partisans de Vavijnapti consicomme chemin-de-l'acte, comme chemin-de-l'acte

Le Bhadanta
de Vavijhapti

(Vibhaa, 118,


tabht diffremment l'inexistence


Un homme est touch (sprsyate) par

pch (ava-

dya) de meurtre en raison d'une

(upttesu skandhesUy
je tue, c'est tu.

volition tritemporelle (triklay

cetanay) l'gard des skandhas qui constituent un tre vivant

iv. 73), c'est--dire



je tuerai,

[Le chemin de l'acte est complet


acte principal, conscutif, et consiste seulement en cetan,



Mais, dirons-nous, cette triple volition ne ralise pas l'achvement

du chemin-de-l'acte

car, d'aprs la thorie


du Bhadanta,
qui dirait


y aurait

pch mortel (nantarya,

est tue , alors

97) pour le





celle-ci n'a

pas t tue en

par l'missaire

charg du meurtre. Cependant tout cet exercice de volition (cetan-


je tuerai, je tue, c'est


ne convient (yiiktarpa)

qu' celui qui tue lui-mme

(svayam ghnatas)


du Bha-

danta est de viser ce type d'assassin

Mais, demande


Sarvastivadin, pourquoi cette antipathie qui vous

fait nier l'existence

de Vavijnapti et admettre la transformation de


la srie mentale



c-d) ?

le Bhadanta est Dharmatr&ta. (Voir i. 20 a-b). upttesu skandhesu (= sattvasatfikhytesu vartamdnesu skandhesu) trikdlay cetanay prntiptcadyena spryate (ghutaka iti) hanisymi hannti hatam iti crSya yad bhavati.

D'aprs P'ou-kouang,



D'aprs Hiuantsang


celui qui a cette triple volition


en accom-

plissant lui-mme, sans erreur de personne, l'action de meurtre,


est touch par

pch de meurtre. Si Bhadanta vise ce cas, c'est correct


xiii, fol.

9 b-10


et la trans-


la vrit, et

Vavijnapti, doctrine des Sarvastivadins,

formation de la srie mentale, thse des Sautrantikas, sont toutes


constater (duhkhabodha)

je n^ai

donc pas d'anti-

pathie pour la premire. Mais que, au

moment de l'achvement du
celui qui

chemin-de-l'acte par une opration corporelle dpendant d'une pense

(cittnvayakifaprayogena) [10 a] naisse, chez


a ordonn

chemin-de4'acte, un certain

dharma, nomm

avijnapti, qui n'a

rien voir



avec la pense de celui qui a ordonn,

meurtre, cette hypothse



corps de celui qui a accompli

ne peut nous satisfaire (na pariioso 'smkam)

que, au

moment de

Tachvement du chemin-de-l'acte par une opration ordonne par

une certaine personne (yatkrtapt'ayogasamhhta), se produise, en
raison de cette opration (tannimitta), une transformation de la srie

mentale de cette personne, cette hypothse nous


Et ceci aussi




le fruit

naisse de la transformation de la srie et

non pas de Vavijnapti.

Tenez compte aussi des arguments numrs ci-dessus
n'existant pas,


comment y


avijnapti ?


consiste seulement ne plus faire une certaine action

ne peut dpendre des grands lments du pass


Le dharmyatana

n'est pas dfini




rponse cette objection a t donne plus haut

invisible, non tendu (apratigha), faisant partie du


y a un rpa


ce n'est pas Vavijnapti

et qui nat

c'est le


qui est l'objet du recueillement

de la force du recueillement

(dhyyinm samdhivisayo

rpam samdhiprahhvd


Le Chemin,

dit le

Yaibhasika, n'aurait pas huit membres.


quelle manire pensez-vous que le saint, lorsqu'il se trouve


Chemin (mrgasampanna),
possde parole, activit
qu'il et

lorsqu'il voit

ou mdite



manire de vivre correctes ? Entenqu'il agisse


prononce une parole correcte,

d'une manire

correcte, qu'il soit correctement

en qute du vtement religieux ?

Telle n'est pas notre pense, rpond le Sarvastivadin.

Le saint

prend possession, dans


Chemin, de certaines avijnaptis pureg,

telles que, lorsqu'il sort




de la contemplation (vipasyan), par la force


de ces pures avijnaptis

produira parole, activit et manire de

vivre correctes, et ne produira pas parole, activit et manire de vivre incorrectes.

La cause (nimiita)

reoit le




[10 b]

on dsigne donc Yavijnapti comme parole,


activit et

manire de

en est


pourquoi ne pas accepter

le saint, lorsqu'il


thoiie ?


n'y a pas

d'avijnapti ; mais
possession de

se trouve dans le Chemin, prend


intention (aija) et de telle personnalit (dsraya)

que, sortant de contemplation,


en raison de la force de ces deux

produira dsormais parole, activit et manire de vivre


On donne

la cause (aya







nous pouvons donc affirmer que

Chemin possde

les huit



D'aprs une autre opinion,


membre du Chemin

consiste seulefaut-il

ment dans


non-commission (tadakriymtra). Que


par non-commission ?
acquiert, par la force


qui se trouve dans le recueillement

du Chemin, l'abstention certaine ou absolue

(akarananiyama, vi. 33 a-b). Cette abstention, tant acquise en s'appuyant sur le Chemin pur, est pure. C'est le membre du Chemin.
1. aya craya ceti j ayahprntiptdyakaranayah raddhPar intention il faut dyayo va / raya srayaparvrttih (VyfikhyS). entendre l'intention de ne pas commettre le meurtre, ou l'intention de foi. Quand on dit que cet ascte obtient un certain sraya, on veut dire qu'il y a pour lui modification (parvrtti) du substrat psycho-physiologique. {Vraya est dfini



5, 6, 36 c-d, 44 d.) P'ou-kouang explique h'saya consiste en chanda, ou en adhimukti, ou en chanda et en adhimukti... Vsraya est la cetan qui se produit en mme temps que Vsaya elle sert de support (raya) Vaya Le sens de parvrtti est nettement marqu dans Vyftkhya iv. 14 c Lorsque
: ; :


sexe de la mre ou du pre est parvrtta, c'est--dire lorsque la qualit de mre

ou de pre est dtruite par la parvrtti du sexe. * L'cole d'Asanga a hrit de l'expression rayaparvrtti, Satralamkfira,
ix. 12.

Il s'agit,


dit S. Lvi,

d'une rvolution du fonds






l'apparition d'une nouvelle personnalit


Pfthagjana devient un rya,



devient homme, l'homme devient animal,


Sur parivftti, voir




xiii, fol.

10 a-11



Sans doute,



(parole correcte, etc.) n'est pas




(dravya), n'tant qu'abstention

mais ce ne sont pas



choses relles et distinctes qui constituent des dharnias; par exemple,


dliarmas mondains



non-possession, gloire,

non-gloire, louange, blme, plaisir, souffrance.

La non-possession du

vtement, de la nourriture,


n'est pas

une chose. (Anguttara,

157, Dlgha,



Si Vavijnapti n'existe pas, dit le Vaibhsika, la discipline de

Pratimoksa disparat.


rfute cette objection d'aprs les

tat de la force de l'intention (saya). la volition (cetan) qui, aprs qu'elle

mmes principes, en faisant La discipline (samvara) est


a t traduite dans l'affirmation

(vidhi) de l'abstention du pch, dans l'engagement de ne plus



pch, arrte les mauvaises actions et discipline (samvr:

noti) le corps et la voix

c'est ainsi qu'il

faut entendre la discipline


de Pratimoksa.


Vaibhsika objectera que,

la discipline de


est volition [11 a], le religieux qui


pense autre chose que


pense de volition cessera d'tre




ne possde

pas alors la volition qui discipline. Cette objection est sans valeur.


effet, la srie

mentale est parfume (bhvan) de

telle sorte


lorsqu'une pense de pch vient surgir, la

de l'engagement pris

mmoire aussi


la volition d'abstention se trouve


donc prsente.

Et cette volition a

caractre d'une digue. Lorsqu'on s'est

oblig ne pas



pch, on se souvient de cette obligation,



32) est prsente, on se contient de manire ne

pas violer la moralit.

Dans votre systme, au


contraire, si l'immoraht est endigue par


une avijnapti indpendante de


mmoire, l'homme


qui la

dfaut (musitasmrti) ne pourrait commettre le pch,


puisque Vavijnapti est toujours




cette discussion.

Les Vaibhasikas disent



une certaine chose en

soi (dravya),

generiSj qui


r avijhaptirpa,

De nombreuses

et divergentes dfinitions des huit

lokadharntas, Vibhfis,







a vu


11b) que Vavijnapti


nat en

dpendance (upddya)
si elle

des grands lments

la question se

pose donc de savoir


des grands lments qui sont le point d'appui de la vijnapti, c'est-dire

des grands lments du coi*ps par lequel est accompli l'acte



(iv. p. 3, 29),




drive d'autres grands l-

Vavijnapti drive de grands lments

vent d'appui la vijhapti : car

diffrents de

ceux qui ser-

est impossible qu'un

mme complexe

(smagr) des quatre grands lments produise un rpa driv

sier, la

updyarpa) subtil, Vavijnapti,


un rpa driv gros-

vijnapti l
est simultane

La vijhapti

aux grands lments dont





de Vavijhapti [11 b] ?


rgle gnrale est que tout


driv est simultan ses

et futur, drive

grands lments. Mais certain rpa driv, prsent

de grands lments passs



del du premier

moment, Vavijhapti du Kamadhatu

nat en drivant de grands lments passs \

Au moment

o nat Vavijhapti,

elle nat

en drivant de grands

lments simultans sa naissance.


del de ce premier


Vavijhapti du domaine du Kamadhatu

ne de




par opposition Vavijhapti pure 28)


nat, c'est--dire

continue de


drivant (updya) des

mmes grands

lments du premier moment, qui sont maintenant passs

ces grands

Elle dpend 1. Hiuan-lsang a ici deux pdas qui manquent dans Paramfirtha (updadti) de grands lments diffrents de ceux qui sont le point d'appui (rraya) de la vijnapti. Vibhfisa, 132, 4. 2. Certains matres disent que la vijiapti et Vavijnapti naissent des mmes quatre grands lments. Ils demandent Y a-t-il quatre grands qui produisent deux dyatanas, deux rpas ? Oui, ils produisent rpyatana et dharmyatana, ahdyatana et dharmyatana. Le Bhadanta Ghosaka dit Les matres d'Abhidharma disent que ce n'est pas correct il est impossible que les mmes (Vibhftsfi, 132, 4), quatre grands produisent un fruit subtil et un fruit grossier
: :


ksanHd rdhvam avijnaptih kmpttUabhtaj



xiii, fol.

11 a- 12



lments passs constituent, partir du deuxime moment,

d'appui (raya) de Vavijnapti, car
ils ils


sont la cause de seipravrtti,


sont sa cause projectrice (ksepakrana)


grands lments

simultans chacun des




du deuxime sont


(samnisraya) de Vavijnapti, car

vrtti, ils

anusupport (adJiisthnakrana). De mme, sont sa cause de

sont la cause de son
la roue et le sol qui supporte la roue, sont causes


main qui a lanc

de pravrtti

d'amivrtti du

mouvement de

la roue. (Voir p. 37)




terre (kutastyni),


quatre dhynas,

appartiennent les grands lments dont drivent les actes corporels

vocaux des diffrentes terres ?




l'acte corporel et vocal drive des


grands lments

de la terre laquelle


pur, des grands lments de la


laquelle appartient la personne qui



L'acte corporel ou vocal du


drive de grands lments

du Kmadhatu,

et ainsi

de suite jusqu' l'acte corporel ou vocal du




de grands lments du quatrime

dhyna. [12

Pur, l'acte corporel ou vocal drive des grands lments de la terre

ne la personne qui



car les


purs sont

transcendants (apaiita) aux sphres d'existence (Kmadhatu,


n'existe pas de grands lments purs d'o pourrait driver



acte pur

car l'acte corporel ou vocal pur nat en raison de grands

lments, et non pas par la seule pense, puisqu'il est



(updyarpa) (Vibha,
Quels sont



les caractres de ces


actes, vijnapti et

avijnapti ?

quels sont les caractres des grands lments dont


drivent ?

L'auteur examine d'abord Vavijnapti.



n^est pas intgre


elle est




appartient seulement


tres vivants.



ssravam kyavkkarma [svaklyabhtahetukam med gan du skyes pa yin,


recueillie, elle drive



5 d-6.

de grands lments qui sont d'coulement, qui

sont intgrs l'organisme, qui sont diffrencis.

Ne du



elle drive

de grands lments non diffrencis, non intgrs


l'organisme, d'accroissement



un rpa driv exempt de masse (amrta),


intendu (apratigha)

ne peut donc tre support de pense




elle est

anuptta, non intgre l'organisme senson'est



U avijhapti

jamais non dfinie



7 a)


elle n'est


ne de rtribution


elle n'est

pas d'accroisse-




reste qu'elle soit d'coulement


36), c'est--dire pro-

duite par le


52). [Le texte dit: aussi d'coulement ,


parce que Vavijhapti peut tre aussi ksanika





avijnapfi pure n'est pas d'coulement.]




(asamhita, viksipta) ou, en d'autres termes,


appartenant au Kamadhatu, [12 b]

qui sont d'coulement

drive de grands lments

et qui sont intgrs

l'organisme. Ces grands

lments sont diffrencis, parce que chacune des sept avijhapiiSy

renoncement au meurtre,


que comporte

la discipline de Prati-

moksa, drive d'un groupe


distinct des quatre

grands lments.

Ne du

recueillement (samdhija),





distinguer la discipline de dliyna et la discipline pure qui naissent

respectivement du recueillement impur (ssrava)

et pur,


ou discipline (samvara) drive de grands lments d'accroissement

(aupacayika) qui sont produits par







grands lments non intgrs l'organisme. Les sept renoncements

qui constituent la discipline sont distincts, mais tous

au meurtre au renoncement

la parole oiseuse

du renoncement drivent d'un mme

pense qui engendre

groupe des quatre lments. De





D'aprs Hiuan-tsang.

L'original est plus concis: avijnaptir amipUikd

naisyandikl ca sattvkhy nisyandopttabhfitaj / satndhijnupdUaupacayikdbhinnabhtaj // 2. La version tibtaine omet ce premier paragraphe, que j'tablis d'aprs Hiuantsang et la Vyakhya. 3. Vyakhya samutthpakacittpksatvAd asamhitacittdvijnaptyadhikrac ca na svapnasamdhydyaupacayikamahbhtaj.

ces renoncements est unique, de

xiii, fol.

12 a-13




grands lments sur

quels s'appuient les renoncements constituent une unit.



ce qui concerne la vijnaptL

est d'coulement

La vijnapti

corporelle, elle est intgre l'orga-

On demande

si la



en naissant, dtruit ou ne

dtruit pas la figure corporelle

est contraire

qui est rtribution (vipka). Les deux hypothses font difficult.

Qu'elle la dtruise,



aux principes

des Vaibhasikas qu'un rpa, rtribution de sa nature, re-continue

(punahprahandha), aprs avoir




37, trad. p. 69).

au contraire,

la vijnapti corporelle

ne dtruit pas la figure ant-


deux figures (samsthna'dvaya), la premire de rtribution,


seconde d'coulement, se trouveront coexister dans un




faut admettre que la vijnapti corporelle nat en drivant de


nouveaux grands lments, coulement de leur nature,

pas la figure antrieure.

ne dtruit

en va ainsi,


membre au moyen duquel


est produite


vijnapti corporelle sera plus grand [13 a] qu'il n'tait antrieurement,

tant pntr

(ahhivypana) par

nouveaux grands lments d'o

n'tait pas pntr

drive cette vijnapti. Si le


par ces noupar


veaux lments, on ne pourrait dire que Vavijnapti

est faite


tout entier.

Nous rpondrons que



rtribution de sa nature

prsente des vides (siisiratvt kyasya)


s'y trouve

donc place

nouveaux grands lments, coulement de leur nature, d'o

drive la vijnapti.

de cette phrase deux pdas La vijnapti est seulement Le Bhsya de Hiuan-lsang ajoute Pour le reste, elle est comme Vavijnapti de non recueillement. On objecte un passage du Sstra ynlmny upsakasya paiica sikspadni esrn katy tipttni katy anupttni / Ciha / sarvny anupttcmi. Cette dfinition n'est pas fautive parce qu'elle vise les ikspadas en tant ({u'avijnapti, ou parce qu'elle est gnrale (bdhulikatvt).







Nous avons
porel, vocal


l'acte est

de deux espces, cetand et cetand^


krta, volition et acte fait par la volition


de trois espces, mental, cor-

de cinq espces, cetan, vijnapti corporelle, avijnapti

corporelle, vijnapti vocale, avijnapti vocale.

Que sont

ces actes

au point de vue de

la qualit, bons,


quelle sphre d'existence (dhtu),

quelle terre

(bhmi) appartiennent-ils ?


U avijnapti n'est jamais



Elle est donc

bonne (kusala), mauvaise (akusala).



effet, la

volition non-dfinie est faible

elle n'est

pas capable

d'engendrer un


puissant (balavat)



va se reproduisant aprs que sa cause


a disparu.


Les autres actes sont des


trois espces l
et les vijnaptis,

Les autres

savoir la volition

peuvent tre

bons, mauvais, non-dfinis.

7 b-c. L'acte mauvais dans Non pas dans les autres

les trois



sphres, car, dans les autres sphres


8 c-d

et v. 19), la





restriction de la stance ne porte

que sur





et l'acte non-dfini


les trois sphres.











et aussi les




dhatu [13


non pas dans rrpyadhatu, car

grands lments

(mhablita) y manquent dont pourrait driver Y avijnapti (iv. 6 b). L o existent (pravartante) corps et voix, l seulement il y a cette avijnapti qu'est la discipline (samvara) du corps et de la voix.



avykrta, voir ii. 54, iv. 9 c nvykrtsty avijnaptih. [anyad eva tridh] [auhham kdme]

in fine.


[rpe 'py avijnaptih]


xiii, fol.

13 a-14



n'y a pas de grands lments purs (ansrava) et



y a une avljnapti pure. Vavijnapti pure drive des

grands lments de la sphre o est ne la personne qui produit

Yavijnapti pure.
et le

De mme, lorsqu'une personne ne dans




Riipadhatu entre dans

recueillement 'rpya, elle

produira une avijhapti d'rpyadhatu drivant des grands lments

du Kamadhatu ou du Rpadhatu.

Le cas

n'est pas le

mme, car Yavijnapti pure


est transcendante

aux sphres (adhtupatita)


n'a rien de




passions de la sphre o se trouve celui qui la produit


elle n'est



sorte, ni

d'une sorte diffrente (sabhga, visahhga) par

rapport aux grands lments de cette sphre.


contraire une

avijhapti de l'rpyadhatu ne pourrait driver des grands lments,

de sorte diffrente (visahhga), du


outre, tournant le

Kamadhatu ou du Rpadhatu. dos (vaimukhya) tout rjxv puisque

est absente

toute notion de

rpa en


recueillement d'drpya

n'est pas capable de produire Yavijnapti, qui est


Le Vaibhasika
du Kamadhatu
s'y oppose.


moralit (slla) existe en opposition avec

l'immoralit (dauhsllyapratipaksena). L'immoralit est du



la moralit, consistant

en avijhapti, du Rpadhatu


rpyas sont

loigns (dura) du


par les quatre distances, draya, prakra, lamhana, pratipaksa


67, Vibhasa, 96,




Vijhapti dans


deux terres o


y a vicra \
les terres,

n'y a de vijhapti, acte corporel


ou vocal, que dans

y a vicra


premier dhyna, o



c, viii. 7).







la vijhapti dite nivrta \

[14 a] nivrta, c'est--dire nivrta-avykrla


66), souille (klista)



vijnaptih savicrayoh



principe vitarkya vicrya





a-b, p. 174.




nivrta nsti






les terres


n'y a pas de vicra, et aussi dans


Semblable vijnapti n'existe pas dans

Kamadhatu, o toute

vijnapii souille (klista) est mauvaise (akiisala), non pas nondfinie.

C'est dire que la vijnapti de la classe anivrtvyJcrta n'existe que



monde de Brahm.


est rapport

que Mahabrahma produisit


un acte vocal de tromperie (niy)


dans son assemble,


pour viter l'enqute d'Avajit, Mahabrahma se vanta faussement

Mais, si la vijnapti vocale manque au-dessus du premier dhyna, comment le son (sahdyatana) peut-il exister dans le deuxime dhyna et au-dessus ?


mais ayant pour cause



grands lments extrieurs

le vent, etc.

D'autres matres disent


son caus par

10 b)


La vijnapti










elle y est de la classe anivr-



non pas






tres qui sont ns

dans ces dhynas ne se

rendent pas prsente (sanimukhlkar) une pense bonne ou souille

d'une terre infrieure, par laquelle pense

pourraient produire une

vijnapti bonne ou souille. Car la pense bonne d'une terre infrieure est d'ordre infrieur


et la

pense souille a t aban-

donne l




221 ci-dessus
; :


31 ci-dessous


49 c, 53c

MahavibhSsfi, 129,





Sstra dit


sabdadhtun kh samanvgatah / ha/ kniarSi les tres du Rpa ko 'samanvgatah / drpyvacarah /



ne peut tre question d'un son extrieur, n'appartenant vivant (asattvasantkhyta). Donc il faut attribuer aux tres du RQpa

du son,


cette sorte de son


l'on fait

avec les mains,



Pour viter cette critique,


d'autres matres disent


La vijnapti

Deux opinions

(1) la

vijnapti qui se produit dans

deuxime dhyna


au-dessus est du domaine du premier dhyna, tant produite par une pense du

domaine du premier dhyna, d'aprs la rgle viii. l*. Ceci est l'opinion des Vaibhfisikas (2) celte vijnapti est du domaine du deuxime dhyna et d'audessus. Une vijnapti d'une terre suprieure est donc produite par une pense

d'une terre suprieure.



les tres

de ces


parlent entre eux,


vijnapti est anivrtvykrta.


xiii, fol.


a- 14 b.




Vaibhasikas dfendent la premire opinion


Pourquoi la vijnapti, quelle qu'elle

manque-t-elle au-dessus
la classe souille-

du monde de Brahm ? Pourquoi la vijnapti de

non-dfnie (nivtia-avykrta) manque-t-elle dans le




Parce que manque la cause qui la produirait ^

C'est la pense associe




vicra qui donne origine


la vijnapti

semblable pense manque dans

7 d)

deuxime dhyna




La pense nivrtdvykrta donne naissance vijnapti de mme


caractre, lorsque cette pense appartient la classe


par la mditation


(bhvanheya). (Voir
la seule



et suiv.)




pense nivrtvykrta est la pense

associe satkyadrsti et antagrliadrsti. Cette pense appartient

la classe
elle est

abandonner par la vue des vrits




tourne vers

dedans (antarmukhapravrtta). Donc,



donne pas naissance vijnapti

67, v. 12). [14 b]

Est-ce seulement en raison de la nature de la pense qui leur donne

origine (saraiitthpaka)

nature bonae ou mauvaise



dharmas sont bons (kuala) ou mauvais (akusala) ? Les dharmas sont bons ou mauvais de quatre faons absolument

(paramrthalas), en soi

(svahhvatas = tmatas)y par association

(samprayogatas), par leur cause originaire (samiitthnatas) l




dlivrance (moksa) est absolument bonne (suhha) K


La Bhsya porte prvam eva tu varnayanti



La premire

opinion est bonne


Glose de l'diteur japonais

Tel est

de l'auteur


utthnam yatah]


Vibhsa, 144,

Le Bhadanta dit

C'est en raison de quatre causes que

origine, absolu-


mot kusala
par nature

bon par nature, par association, par




quelques-uns disent

la krl et

Vanapatrpya ;


ques-uns disent

les trois


Bon absolument


Nirvana, appel

bon parce
tion, le

qu'il est

calme (ksema).

bon par nature, c'est lejnna; bon par associajnna ; bon par origine les actes du corps et de la voix qui en procdent bon absolument le Nirvana. Les dfinitions de l'akiisala sont parallles (mauvais par nature, le mohaj. 4. [ubhah 3 moksah paramatah]
D'aprs les Vibhajyavdins,


associ au

Le Nirvana, tant



8 b-9


la cessation de toute douleur, est







absolument bon.


l'absence de maladie (rogya) (Majjhima,




Les racines,

respect et la crainte, bons en soi l



trois racines-de-bien, le respect et la crainte




de leur association et de leur cause, sont


bons en


la drogue salutaire
est associ



Ce qui


racines, etc., est

bon par association


Les dharmas,



(caittas), qui sont associs


racines de bien, au respect, la crainte, sont bons par association.

Associs ces principes,



sont bons

non associs ces



ne sont pas bons [15 a]


une boisson o on a

ml une drogue salutaire (ausadhapnlya).


Les actions,


sont bonnes en raison de leur cause origi-



leur origine dans les

dharmas bons

en soi ou bons par

association, l'acte corporel, l'acte vocal, les laksanas, prptis, niro-

dhasampatti, asamjhisampatti
raison de leur cause originaire.


et suiv.) % sont

bons en


le lait

d'une vache

qui a bu une boisson mle d'une drogue salutaire.



demandera comment peuvent

bonnes des prptis qui

ont leur origine dans une pense qui n'est pas bonne (visabhgacitta) ^


Les aksemalenubandhbhvt. [mahrvyapatrpyam tmatah //]

les racines

autres kualas ne sont pas tels.

Divya, 255,
v. 20.


4. 5.

de bon, de mauvais, de non-dfini,

[samprayogatas tadyuktam] [utthnatah kriydayah /]

le tibtain.

Paranifirtha et Hiuan-tsang

L'acte corporel, l'acte


vocal et les cittaviprayuktasantskras

C'est aussi la lecture de la


L'acte corporel, l'acte vocal, la jti, etc. (laksanas,



et les

prptis des deux recueillements-sans-pense (nirodha et asafnjnisam'



Lorsqu'on reprend possession des racines de bien par

doute (vicikits)


xiii, fol.

14 b-15




Le mauvais (akusala)
tel qu'il

est le contraire

Le contraire du bon

vient d'tre expos

Le sarnsra

ou existence

pour nature



(pravrtli) de toute douleur



donc parfaitement malheureux

(aksma), donc absolument mauvais.


Les racines de mal, l'absence de honte






sont mauvaises en soi.




associs ces principes sont

mauvais en




leur origine dans les racines,

etc., l'acte

etc., et


associs ces racines,

corporel, l'acte vocal, les caractres


etc.) et les

prptis des

dharmas mauvais,

sont mauvais

en raison de leur cause originaire.


maladie (vydhi), drogues malsaines (apathyau-

[15 b]

Mais, dira-t-on, tout ce qui est impur (ssrava) est intgr (abhy-


parypanna) au samsara

donc rien de ce qui est impur

ne pourra tre ni bon, ni non-dfini ?

parler strictement, cela est vrai. Mais on se place au point de

la rtribution

vue de



agrable (ista), est

n'est pas

impur qui

le dharma impur qui produit une nomm bon (kuala) le dharma (vydkrta) comme devant tre rtribu

(vipkam prati)
Si on






ce qui est

absolument non-dfini


Non-dfinis, au sens absolu, deux stables



deux inconditionns (asamskrta,





80) les prptis de ces racines sont bonnes

or elles ne sont pas bonnes en

elles-mmes, ni par association, ni par origine, ni absolument.

De mme,
75 b


prptis du bien inn



71 b) sont bonnes et ne rentrent dans aucune des quatre

cette objection, xxiii. 4,


Samghabhadra rpond [tadviruddham akualam] paramvykrte dhruve II



La doctrine du Kathvatthu sur le bon, 8 le Nibbna est avykata, xi. 1, xiii.




non-dfini, est expose

9, xiv. 8.




9 d-li


Vapratisankhynirodha, sont, sans amphibologie, non^



Le Vaibhasika enseigne que

bonne ou mauvaise. La
2 3

Tacte, corporel ou
originaire, savoir

vocal, est

bon ou mauvais en raison de sa cause

volition (cetan)


rgle doit s'applil'acte

quer aux grands lments

corporel ou vocal

(mahdblmtas) qui constituent




pas, rpond le Vaibhasika, car l'intention de l'agent se rap:

porte l'action, non pas aux grands lments

action et


veut faire


non pas

faire des

grands lments


Mais, dirons-nous,

comment Vavijnapti

produite par le recueille-



6 c-d) sera-t-elle bonne ? L'agent, entr en recueillement,


n'a pas d'intention l'endroit de Vavijnapti et ne pense pas


sons une avijhapti


Nous ne pouvons pas non

le le

plus admettre que


Vavijnapti produite par

recueillement ait son origine dans

pense non recueillie qui prcde

est d'une autre classe.

recueillement, car cette pense


Donc Vavijnapti produite par

si le


n'est pas


ou bien,

Vaibhasika soutient qu'elle

l'il divin
b, trad. p.


devra considrer

comme bons



divine qu'il







y a l une



Vaibhaikas doivent rsoudre (kar-

tavyo Hra yatnah).


dit ci-dessus (iv.




pense susceptible d'tre aban-

donne par
vijnapti [16


vue des vrits (darsana) ne donne pas origine


Cependant Bhagavat a




mauvaise vue

(mithydrsti) procdent la mauvaise rsolution (samkalpa), la mauvaise parole, la mauvaise action, la mauvaise manire de vivre



mauvaise vue


abandonne par


vue des vrits


(v. 4).

Ce Sotra ne

contredit pas la thorie.




Ce qui donne



est de

deux espces

qui sont

nommes hettisamutthna

idam karma kurym

na mahabhtani

kini tarhi


samutthnaifi dvidh hetutatksanotthnasamjnitamj

Vibhafl^ 117,



xiii, fol.

15 b-16



samutthna, ce par quoi

Ce qui
est cause (hetu) et


prend origine (samiittisthate).


samutthna, hetusamutthna. Ce qui


samutthna au moment mme de




Qui sont respectivement promoteur


second moteur*.

Le hetusamutthna




donc promoteur (pravartaka). [16

contemporain l'action
p. 27).

Le tatksa-

Mais quelle




donc second

moteur (anuvartaka) (voir ci-dessus,


sur l'action (vijnapti), l'efficace (smarthya) du


moteur ?
Si le

par laquelle


en serait



tatksanasamutthna manquait,

l'action n'aurait pas lieu,


mme projete (ksipta) par le promoteur comme,


par exem-

ple, l'action

n'a pas lieu lorsque celui qui a projet une action ( J'irai
vient mourir.

au village



la vijnapti n'a

pas lieu en l'absence du second moteur,

comment y

vijnapti pour l'homme exempt de pense qui prend


la discipline ?

(Vibhasa, 113,

On aura donc

recours une autre explication.

La vijnapti

est plus

(sphuta, vyakta) chez celui qui est dou de pense, qui de la vijnapti, la pense



second moteur

Telle est


cace de cette pense.



Le vijnna abandonner par



vue des vrits


seulement promoteur ^

[pravartakam dvayoh prvam dvitlyam] anuvartakam





en est



homme exempt de pense (acittaka)


produit Vavijfapti-slla, o sera la pense

en est

atmvartaka ? Hiuan-tsang comment l'homme exempt de pense produira-t-il le sla ? Un homme, pendant qu'il reoit l'ordination (upasampdyamna) et va



l'acte corporel

nirodhasampatti en lui la discipline (samvara), la fin de la crmonie (kannavcanvasna), comment peut avoir lieu l'acte corporel (kyavijnapti) que suppose la discipline

qui y est ncessaire, entre dans la et devient donc exempt-de-pense. Au moment o se produit


pravartakam drsHheya}n vijnnain.



IV, 11.

La pense
promoteur de

qui est

abandonne par


vue des vrits



vijnapti, parce qu'elle est cause (nidna, hetu) du

processus mental (vitarka et vicra) qui donne origine (samutth-


la vijnapti. Elle n'est

pas second moteur



parce qu'elle

moment o a lieu la vijnapti celle-ci est mise en mouvement par une pense tourne vers le dehors abandonner
n'existe plus au


par mditation (bhvan),

et qui


second moteur


parce que,

supposer qu'elle soit second moteur,

(c'est--dire la vijnapti) cr

s'ensuivrait que le



elle serait lui aussi


par la vue





vijnapti cre par une pense aban-

donner par mditation


abandonner par mditation. Et cette


hypothse est en contradiction avec l'Abhidharma




effet, le

rpa (= vijnapti)
exact), ni par

n'est contredit (virudhyate) ni par (erreur)


vidy (savoir




ne peut tre

abandonn au moyen de
pt contredit

vue des vrits

Le Sautrantika rpondra que

par la vidy

cette affirmation

Le rpa


doit tre prouve.


celui qui soutient


la thse de l'abandon

du rpa par la vue n'admettra pas que


n'est pas contredit par la vidy.

Le Vaibhasika
la vue, les


Si le


{== vijnapti) qui a son origine dans

une pense abandonner par


est, lui aussi,

abandonner par

grands lments qui servent de substrat (raya) ce


cette vijnapti, seront,



abandonner par

la vue,

tirent leur origine

de la


pense. Et c'est inadmissible,

car ces grands lments appartiennent la classe des



souills-non-dfinis (aklistvykrta), et tout ce qui est


par la vue est souill (klista)




c'est--dire 1. Le rpa (l'action, vijnapti) n'est pas contredit abandonn au moyen de la vidy, c'est--dire par le chemin de vue, comme c'est le cas pour l'hrsie du personnalisme, etc. (satkyadrsti) : car les personnes mme qui ont vu les vrits sont munies (samanvgata) du rpa. Il n'est pas contredit par Vavidy, comme c'est le cas pour le chemin pur (ansrava), car Vavidy existe tandis qu'on cre des rpas (actions) souills ou non-souills, tandis que se continuent lesprptis (ii. 36 b) de ces rpas; et elle existe aussi dans le cas contraire. Donc, on ne peut pas dire que le rpa soit abandonner par la vue, ni non plus qu'il n'est pas abandonner. Reste qu'il soit abandonner par mditation.
' '


xiii, fol.

16 b-17


effet, les

Nous nions

la consquence,

reprend l'objectant.



lments en question ne sont pas bons ou mauvais en raison de la

pense qui leur donne origine, ainsi que c'est



cas pour la vijnapti








grands lments

en question sont abandonns par la vue.

Le Vaibhasika rpte que

non--abandonner. Car
dit ni

c'est impossible.

Les grands lments ne

ne sont pas non plus

peuvent tre abandonns par la vue [17 a]



dharma non

souill (aklista) n'est contre-

par la vidy, ni par Vavidy.

effet, le


dharma non

qu'il soit

de la classe anivrt-

vykrta, non-souill-non-dfni, ou de la classe ktisalasrava, bonimpur, n'est pas contredit par la vidy, c'est--dire par

chemin pur



c'est le cas




souill qui prit


que saprpti


coupe par

le dit




cit ci-dessus (p. 36,

25) n'invalide pas notre thse


La pense

susceptible d'tre

abandonne par

vue ne donne pas

origine vijnapti

car ce Stra vise la vue fausse (mithydrsti)


comme promoteur

(pravartaka). (Vibhas, 117,





susceptible d'tre

abandonn par mditation


La connaissance mentale (manovijnna) de nheya est la fois promoteur et moteur ^.


la catgorie


Les cinq sont seulement moteur l


Les cinq vijnnakyas, connaissance visuelle,

moteur, tant exempts de

sont seulement

rflexion (vikalpa)



y a donc quatre cas

/ heyam eva bhvanay] La Vykhy explique Car il est tourn vers le dedans et vers le dehors (antarbahirniukhapravrtta) . Hiuan-tsang: Car il est accompagn de vikalpa


[ubhayam manah


(savikalpakatva), car


est tourn vers le dehors





Hiuan-tsang : Car

sont exempts de vikalpa, tant tourns vers







Exclusivement promoteur,


connaissance mentale (manovijnla vue.


na) susceptible

abandonne par
les cinq

Exclusivement moteur,

connaissances sensibles,




moteur, la connaissance mentale susceptible d'tre

abandonne par mditation.


Ni promoteur,

ni moteur, la

pense pure (ansrava)







de la



mauvais, non-

promoteur ?

n'y a pas de rgle ce sujet



D'un promoteur bon,


un moteur des

trois espces


D'un promoteur bon, un moteur bon, ou mauvais, ou non-dfini.

De mme d'un promoteur mauvais ou





ce qui regarde le Muni,

moteur de


espce ou bon \ espce que le

ce qui regarde Bhagavat, le moteur est de




d'un moteur bon, un moteur bon

d'un promoteur non-

un moteur non-dfini. [17 b]



arrive que d'un promoteur non-dfini sorte


un moteur

tandis que, d'un promoteur bon,


n'y a jamais moteur non*.


l'enseignement des Bouddhas n'est pas sujet diminution


D'aprs d'autres Ecoles^



pense des Bouddhas n'est jamais

Car cette pense est recueillie et tourne vers le 1. La Vyftkhya explique dedans (samhitntarmukhapravrltci) . Hiuan-tsang place ici iv. 12 d Ni promoteur ni moteur, (1) la pense pure, parce qu'elle ne se produit que dans le recueillement, (2) la pense ne de rtribution (vipkaja) parce qu'elle se

produit spontanment, sans effort



[pravartakdc chubhder anuvartakam api tridhCt /] 3. [muneh samam ubham va tan] Hiuan-tsang Moteur gnralement de mme espce, quelquefois diffrent . ~ Enseignement , anusani. La 4. anilyamn. Hiuan-tsang pense des Bouddhas, dans l'enseignement du dharma, etc., ou bien grandit ou

bien ne diminue pas


D'aprs l'diteur japonais, les Mahasflmghikas,

savoir correct sont fermes
qu'il est libre


Vibhftsa, 79, 15


VibhajyavR'Jins louent Bhagavat, disant que sa pense est toujours recueillie,

parce que la mmoire et

n'est jamais



disent q^ue le


endormi (middha), parce

des obstacles (varanas).


xiii, fol.

17 a- 18




sont toujours en recueillement

leur srie mentale

exclusivement une srie de penses bonnes (kualaikatna).


C'est pourquoi le Stra dit

Le Naga

est recueilli



marche, quand


se tient debout,


est couch,


est assis

Les Vaibhasikas disent

Le Stra s'exprime

ainsi parce



pense de Bhagavat ne se disperse pas (avisarana) vers


les objets


(anicchay) [Bhagavat

est toujours recueilli est chez lui toujours

(nityasamhita) en ce sens que la mmoire




sait qu'il



ce n'est pas dire


que Bhagavat soit exempt de

rtribution (vipkaja),



dharnias de


aux attitudes (rypalJiaJ,

pense-de-cration (nirmnacitta)


Nous avons vu que

ceptible d'tre


connaissance mentale (manovijnna) susest

abandonne par mditation,




moteur, et peut tre bonne, mauvaise, non-dfmie.



Ce qui nat de rtribution

n'est ni l'un, ni l'autre l

La pense

qui est rtribution (vipkaja,





60, iv, 85), se


produisant sans

spontanment (nirabhisamskravhin),

promoteur, ni moteur.

La vijnapti


bonne, mauvaise, non-dfinie, (1) d'aprs



caractre de son promoteur,

d'aprs le caractre de son moteur ?


quoi tend cette question ?

Premire hypothse. Les deux drstis de personnalisme (satkya)

[18 a] et de pass-et-futur-de-la-personne (antagrJia) sont promo-

2. Anguttara, iii. 346, TheragStha, 686-697 gacchani samhito ngo tliito ngo samhito / sayam samliito ngo nisinno pi samhito / sabbattha samvuto ngo esa ngassa sampad j La rdaction sanscrite porte caran
: :


La Vyakhyfi

tablit que,



Stra, le

Tathgata Udyin sadevake manas tasmn nga ity ucyate. l. [nobhayam tu vipkajam //]


Buddha Bhagavat reoit le nom de go na karoti kijena vc



11 a-b)
elles sont


de la classe souille-non-dfnie (nivrtd-

vykrta). Si la vijnapti laquelle elles donnent origine suit leur

nature, on aura done, dans le

Kamadhatu, une action souille-non-


vous regardez cette consquence




Si vous maintenez, sur ce point, votre opinion, vous

devrez admettre, contrairement votre thse,


11 a-b, que toutes

penses susceptibles d'tre abandonnes par la vue ne sont pas

tandis que la satkyadrsti et V antgrhadrsti ne sont
les autres drstis


pas promoteur,

sont promoteur.

Seconde hypothse. La vijnapti par laquelle une personne prend

la discipHne de

Pratimoksa ne sera pas bonne,

si cette

personne, tanest de

dis qu'elle reoit l'ordination



mauvaise ou non-dfinie.

Le Vaibhasika rpond.

La vijnapti

est de la



que son promoteur lorsque

celui-ci est

une pense susceptible

abandonne par mditation. Elle

son promoteur lorsque

n'est pas de la


nature que


une pense susceptible


abandonne par

la vue, par



Le moi


dans ce


prend place entre


et l'acte (vijnapti)

un autre promoteur, une pense susceptible


abandonne par

mditation, tourne vers le dehors, accompagne de vicra et de

vitarka, par laquelle, par exemple, on prche l'existence du moi.


premier promoteur est non-dfini








Du promoteur

susceptible d'tre

abandonn par

la vue,

un promoteur susceptible


abandonn par mditation


et qui est

bon, ou mauvais, ou non-dfini

{vijnapti) de

de ce second promoteur, un acte




si l'acte

(vijnapti) n'est pas bon, mauvais ou non-dfini,


en raison du moteur, l'explication que vous avez donne

10 a-b)

du Sotra ne

tient pas.

Vous avez






Sotra considre




comme promoteur

et que,

par consquent, en

mant que

vue fausse est gnratrice de vijnapti^

Sotra ne con-

tredit ni le principe

pense susceptible d'tre abandonne


par la vue n'engendre pas vijftapti, ni

corollaire que,




xiii, fol.

18 a-xiv,

fol. 1 b.


dfinie. Il


n'y a pas de vijnapti


de la classe souille-non-

faut dire que

Sotra considre la drsti


comme un


moteur auquel succde,

promoteur qui

sparant de l'acte (vijnapti), un autre

est susceptible d'tre

abandonn par mditation.


voil assez sur ce point, [xiv]




est triple, discipline

(samvara), non-discipline


diffrente de la discipline et de la non-discipline

t dfinie ci-dessus

Uavijnapti a

Il, iv.


de trois sortes, (1) samvara, discipline, ainsi

le flux


parce qu'il contraint (samvrnoti)

de l'immoralit (dauhsllyale

prabandha), parce

qu'il dtruit

ou arrte


de l'immoralit,

asamvara, l'oppos de
ni celui de

la disciplme, la non-discipline (iv.




naivasanivaransamvara, une avijnapti

Y asamvara.

qui n'a ni le caractre

du samvara,



Discipline de Pratimoksa, discipline pure, discipline ne


du dliyna ^


y a


espces de discipline

(1) la discipline



moksa (prtimoksasamvara)

c'est la moralit (slla)


du domaine

du Kamadhatu, la moralit des tres de ce monde

produite par le dhyria, moralit du
discipline pure

(2) la discipline

domaine du Rpadhatu

(3) la

(ansrava), qui nat du Chemin, moralit pure.

est de huit espces l



Le Pratimoksa

\ du

les disciplines

du Bhiksu, de

la BhiksunT, de la Siksa-



(novice), de la

Sramanerika, de l'Upasaka

2. 3. 4.

samvarsamvaretar / [samvarah prtimokskhyo 'nsravo dhynajas tath [astadh prtimokskhyah]

avijnaptis trividheti


(I-tsing, p. .38

D'aprs une opinion dont Takakusu Siksaman est la femme qui se soumet aux rgles en vue de devenir Srmanerik elle est comprise (dans la liste plie) parmi les SrmanerikSs. Nous allons voir que la discipline de la SiksamSna est identique la discipline de la Srmanerik. Mais la Siksaman est une candidate

La Siksamna

est la




97) se lait l'interprte, la


de Bhiksuni voir iv. 26 c-d et Cullavagga, x. 1. 4. (Vinaya Texts, i, p. 296). Yogcras On demande pourquoi Bhagavat^ en ce qui concerne la discipline

(dvot laque,
iv. 28). iv.


IV, 14.

de l'Upasika, de l'Upavasastha




Ces huit disciplines sont disciplines de Pratimoksa

donc, au

point de vue des

noms qu'on


donne, la discipline de Pratimoka

est de huit espces.




fait, le

Pratimoksa est de quatre espces \


Quatre espces qui prsentent des caractres distincts


du Bhiku, du Sramanera, de l'Upasaka


de l'Upavasastha. [2 a]


effet, la discipline

de la Bhikunl ne diffre pas, n'existe pas


part de la discipline du Bhiksu

la discipline de la




Sramanerika ne


pas de la discipline du Sramanera

la disci-

pline de l'Upasika ne diffre pas de celle de l'Upasaka.



Le nom change avec




Sexe, vyanjana, c'est--dire linga, ce qui distingue l'homme

et la


C'est en raison du sexe qu'alternent les

noms, Bhiku, Bhi-

ksunl, etc.

Lorsque leur sexe

est modifi,


Bhiku devient BhikunT



de Bhiksu, tablit deux disciplines, celle de Bhiksu, celle de Sramanera

que, en ce qui concerne la discipline de BhiksunT,


tablit trois disciplines, celle

de BhiksunT, celle de Siksamana, celle de Sramanerika.

ont beaucoup de passions
pline de BhiksunT. Si la

Parce que


la disci-


donc progressivement qu'elles prennent

joie et adhsion

femme montre

dans une petite partie des

Siksamana ; si elle montre joie et adhsion dans une grande partie des rgles de la Siksamana, il ne faut pas prcipitamment lui donner la discipline complte il faut qu'elle s'exerce deux ans durant Jnanaprasthana, 13, 34. Le Sramanera, possesseur de dix rgles, est appel prendre la discipline complte. Pourquoi, dans le BhiksunTdharma, y a-t-il une Siksamana ? Du temps de Bouddha, la femme d'un marchand, enceinte sans le savoir, sortit du monde et reut la discipline complte Il fut tabli que les femmes s'exerceraient dans les rgles durant deux ans, prenant six dharmas, et
rgles de la Sramanerika,

faut lui donner les rgles de la

prendraient ensuite

la discipline

(8, 25) la




discipline de

Bhiksu comporte 250 dhar-

mas ;ce\\e

de BhiksunT, 500 dharmas. D'aprs


sun prend 500 rgles




jAanaprasthana 13, 34, la Bhik80000 rgles le Bhik?u prend 250 rgles


on dUille 80000.


[dravyatas tu caturvidhah /] [vyanjandn uAmasai^tcArt]





hpho bahi


iiian-tsang, xiv,
BhiksunT, Bhiksu

fol. 1

b-2 b.


ramanera, Sramanerika

la ramanerika,


aussi la Siksamana,

Sramanera l'Upasaka, Upsika l'Upa-

Upasaka. Or

on ne peut pas admettre qu'une personne, en

changeant de sexe (parivrttavyahjana), abandonne la discipline

antrieure et en acquire une nouvelle


changement de sexe ne

peut avoir cette influence



[2 b] les quatre disciplines fmi-

nines se confondent avec les trois disciplines masculines.


les disciplines

sont prises successivement, discipline d'Upa-

saka, avec ses cinq prceptes, discipline de

dix prceptes, discipline de

Sramanera qui comporte


Bhiksu qui comporte deux cent cinquante





seulement par

diffrent les

de prceptes


renoncement) nouveaux,



cinq, dix, vingt



un denier

deux deniers ?


bien ces disciplines, produites chacune tout d'une

pice, existent-elles

part l'une de l'autre ?



Les discipHnes existent part ^

Elles ne sont pas mles.


les parties qui leur sont


Upasaka, Sramanera


Bhiksu renoncent (virati) au meurtre, au



au mensonge, aux liqueurs enivrantes


trois disciplines

ont des caractres distincts.


Leur diffrence


la ditrence des occasions de

pch (nid-



l'homme qui


l'observation d'un plus grand

nombre de

rgles (sikspada), s'carte par le fait


d'un plus
c-d) et de

grand nombre d'occasions d'orgueil-ivresse (mada,



les trois sries








mme, d'un plus grand nombre d'occasions de pch, meurtre,

Par consquent


de renoncements ne se confondent


en tait autrement,
taient intgres








la discipline de Bhiksu,

Les causes qui dterminent

la perte

d'une discipline sont numres

religieux qui renonce au repas




prthak te. La Vykhya donne un exemple




hors du



moins expos commettre


meurtre que

le laque.




14 d-16


Bhiksu qui renonce la discipline de Bhiksu (""samvaram praty-

caksnah) abandonnerait du
thse qu'on n'admet pas.



les trois disciplines

[3 a]


les disciplines existent







ne se contredisent pas

Elles peuvent coexister

en prenant la suivante, on n'abandonne

le fait

pas la prcdente


Ainsi s'explique



Bhiku qui renonce

sa qualit de Bhiku reste en possession de la discipline d'Upasaka


de Sramanera ^


devient-on Upasaka, Upavastha, Sramanera, Bhiksu ?


15. En prenant

renoncement cinq choses





choses viter (varjya), on ohtient la qualit d'Upa*.

saka, d'Upavasastha, de Sramanera, de Bhiksu


En assumant


renoncement (viratisamdna) cinq points



meurtre (prntipta),






na virodhinah


2. Vibhasfi, 124, 4

Celui qui prend une discipline postrieure n'abandonne pas

la discipline antrieure.

L'Upsaka qui prend

de l'Upisaka

la discipline

de Sramanera n'aban;

donne pas

les cinq points



les dix points

possde donc en

mme temps

quinze disciplines

du Sramanera Le Bbiksu possdera donc

la discipline

965 disciplines. D'autres matres disent que l'Upasaka prenant


Sramanera n'abandonne pas les cinq points de l'Upasaka et prend cinq points du Sramanera il possde donc dix espces de discipline .... Si un homme possde en mme temps deux disciplines, trois disciplines (Upasaka, Sramanera, Bhiksu), pourquoi est-il nomm d'aprs la dernire, Bhiksu, et non pas Upasaka ? 3. Le Tibtain et Paramartha disent S'il en tait autrement, celui qui abandonne la discipline de Bhiksu ne serait pas Upasaka . Hiuan-tsang Upasaka, etc. L'diteur japonais dit que le Bhiksu qui renonce la discipline de Bhiku devient Sramanera pareillement, le Sramanera devient Upasaka. 4. pacstadaasarvebhyo varjyebhyo viratigraht /


Divya, 160


Rambhaka rmika RddhilamtA




Cundah ramanoddea Utpalavarn bhiksuni



bhikkhusu bhikkhunlsu upsakesu upsikesti antamaso


r& m ikasa manuddesesu.

Prfilimoka des Sarvftstivadins,



As. 1914, 515).


La Vyfikhyft reproduit ci-dessous iv. 30 d (note) ramanoddea, nom liturgique du Sramanera.

formule prononce par



xiv, fol.

2 b-4

dans la discipline



mensonge (mrsvda),


liqueurs enivrantes

(siirmaireijapramdasthnavlrati), on


En assumant


renoncement huit points,



meurtre, 2. vol,






enivrantes, 6. odeurs, guirlandes, onguents (gandhamlyavilepaiia),

ballets-chant-musique (nrtyagltavCidU)







(iiccasayana, mahsayana),


repas hors du temps (viklahliO'


jana), on s'installe dans la discipline d'Upavsastha


En assumant


renoncement ces mmes points

fait dix,


en outre,

l'or et

l'argent, ce qui



dans la discipline de




dix points, car on compte part







En assumant

renoncement tous

les actes

du corps


de la

voix qui doivent tre vits, on est Bhiksu.


discipline de




a-b. Moralit (la),

bonne conmie

(siicarita), acte


et discipline



Moralit \ parce qu'elle redresse (pratisamsthpana) ce qui est



(visama), car


pcheurs se conduisent d'une manire

injuste l'gard des tres.


Etymologiquement, parce qu'elle rafrachit

la stance



est dit



est la prise de la

moralit, parce que la moralit ne brle pas.

[4 a]


Voir Mahavyutpatti, 268, o la sixime virati est formule


vilepanavarnakadhranavirati. 2. [slam sucaritam caiva karma samvara ity api /] las dan sdom pa zhes bya ho. 3. La Vibhsa (44, 13) donne dix explications du mot la : froid ou rafrachissement sommeil calme, car celui qui observe le slla obtient un sommeil calme,

ayant toujours de bons rves; exercice rpt (abhysa), en raison de

incessante des bons









p, 55)


ou musoir, d'aprs




tang de la
souillure et


de Bouddha, la moralit est

musoir, les ryas se lavent de toute

amvent l'autre rive des qualits . la dfini [sukham lasatndnam tena kyo na tapyate]








conduite, parce qu'elle est loue par les sage^.

elle est

3. Acte, parce que, de sa nature,

action (kriy).

Objection. Le Stra ne


pas que Yavijhapti est

ne pas


elle tre

action ? Sans

(voir ci-dessus p. 14, 17, 18)?

Gomment Yavijhapti


doute, Vavijnapti fait que le disciplin,


revtu de honte, s'abstient du pch en raison de l'engagement





ne pas faire


elle est action, d'aprs




elle est faite (kriijate) soit


par un acte corporel-

vocal (vijhapti), soit par la pense (citta)

D'aprs d'autres, Vavijnapti est action parce qu'elle est cause

effet d'action ^


4. Discipline,

parce qu'elle discipline ou contraint


corps et la




discipHne de Pratimoksa


dsigne toute la discipline

de Pratimoksa depuis son origine.



Le Pratimoksa,

c'est la

premire vijhapti

et la



celles-ci sont chemin-de-l'acte


L'expression Pratimoksa dsigne la premire vijhapti et la pre-

mire avijhapti de la prise de la discipline.

Le Pratimoka molcsana \



Pratimoksa, car par


lieu le prati:

c'est--dire l'abandon (tyga),

du pch (papa)


L'avijnapti qui constitue

satttvara de Pratimoksa rsulte d'une vijnapti.

la pense en tat de recueillement, d'une pense impure du domaine des dhynas, d'une pense

L'avijnapti ne-de-dhyna et Vavijnapti pure naissent de


Cause d'action, parce que le disciplin (satnvarastha), en vue de garder la (pariraksanrtham), accomplit des actions (kriy) consistant en actes corporels et vocaux. Effet d'action, parce que dans le cas de Vavijnapti de Prfitimok^ elle est le fruit d'une vijnapti; parce que dans le cas de Vavijnapti ne de la pense recueillie elle est le fruit d'une volition (cetanCi) ne du recueillement.





prtimoksah [kriypathah


D'aprs cette tymologie on attend pratimoksa, mais

vidhna^ comme dans vaikrtam vikrtam



= viasam mranam

y a svArthe vrddhi-


le j*eus

de pratimoksa, Kern, Manual,

74 (something serving as a

est l'efficace

xiv, fol.



du premier moment (vijnapti


avijnaptt) de la prise

de la discipline.

Cette vijiapti et cette avijnapti sont aussi


discipline de Pra-


parce qu'elles disciplinent


corps et la voix.

3. Elles

sont chemin-de-l'acte, c'est--dire


chemin-de-l'acte pro-




(iv. 66).

Au moment

qui suit le premier



aux moments qui

rejet (prati-

n'y a plus Pratimoksa,


cir le

pch n'est pas

moksyate) par
parle premier;

second moment, ayant t rejet (pratimoksita)

y a pr^/wo/Vsasawyara


c'est--dire discipline

de l'espce du Pratimoksa

ou discipline


ne du Pratimoksa


n'y a plus chemin-de-l'acte proprement



mais seulement



(iv. 68).

[4 b]
trois disciplines ?

Qui possde chacune des



Huit personnes possdent



Seules huit personnes,


Bliiksun... l'Upavasastha,

possdent la discipline de Pratimoksa.

Est-ce dire que les infidles (bhya) ne puissent possder la

moralit dite d'engagement (samdnaslla) ?

ritual] cuirass)


peuvent pos-

Oldenberg, Bouddha (1914)



419, note (Entlastung,

= loslassen, Divya, 94,





x. US).


reste qxie

pratimuc pratimuc signifie



Telle est bien la notion,


obligation, (Contrainte

Mahvagga-Niddesa lesquels ajoutent


qu'exprime la dfinition de une explication tymologique slam


dicaranam santyamo samvaro mukhanipamnkham kusalnm



sampattiy. Mais Visuddhimagga, p. 16 ptimokkhatu eca samvaro ptimokkiiasamvaro. 2. so sor thar dai idan pa brgyad ~- [priiinoksnvit astan] 3. Dans l'Abhidhamma (Atthaslin, p. 103), samdnaviraU abstention la suite d'engagement (par opposition sampaitavirati) s'entend de la virati
* '

obtenue par





samdnaslla, moralit que


l'on obtient

en prenant un enga:

gement, une rsolution

moksa), et

Je ne ferai ni


ni cela


moralit de Prati-

dharmatCipriiambhikasila, moralit acquise sans engagement


ou acte vocal

c'est la discipline

acquise soit par

le fait

de la possession d'un



on ne prend possession d'un dhyna qu'en se dgageant des passions





17 a-18


sder cette moralit, mais

ne peuvent possder la discipline de




leur moralit d'engagement ( Je m'abstiens

du meurtre

, etc.),

repose sur la notion d'existence (hliavasamniils

mme quand

ont en vue, non pas une renaissance cleste,


mais ce






conoivent la


comme une

certaine sorte d'existence.



pch ne se

trouve pas absolument





par leur moralit d'engage-




Celui qui possde le


dhyna possde

la discipline qui nat

qui nat

du dhyna (dhynaja),

c'est--dire qui nat

du dhyna


ou par




Par dhyna,
ce village

faut entendre

non seulement




principaux (maula), mais encore les recueillements qui les avoisinent




un champ de


De mme que, lorsqu'on dit Il y a dans un champ de bl , on entend parler du


village et de ses environs.



L'rya possde

la discipline pure ^

saints, les oaikas et Asaikas, possdent la discipline




Nous avons


dans la dfinition du sahbhhetu



51) [5 a],

que deux disciplines sont des

sont ces deux disciplines ?

compagnons de






Les deux dernires disciplines sont concomitantes la

pense \
du Kfiinadhftiu, iv. 26), soit par l'entre dans le chemin (discipline pure qui comporte l'abstention certaine de certains actes samucchedavirati d'Attha-

ttfilinl, p.


Voir ci-dessus

p. 17,

note 3 et





bsara gtan skyes dan de Idan pa

= [tadvanto dhynajena tu]

seras can dan [anasravenaryasattv&h] samucchedavirati d'AtthasalinT, p. 103; elle comporte Vakarananiyama, l'impossibilit de commettre le pch. 3. tha ma gftis ni seras rjes hbraft [antyau cittnuvartinau //]


med hphags pahi

C'est la

discipline qui nat

xiv, fol.

4 b-5


pure sont conco-

du dhyna

et la discipline

mitantes la pense (ciUnuvartin)

non pas

la discipline de Prati-

inoksa, car celle-ci continue exister (amivrttl) chez


l'homme dont

pense est mauvaise ou non-dfinie ou qui est inconscient (anyai.





Naissant des nantaryamrgas, dans Yangamya, on


dit qu'elles





Ces deux disciplines, la discipline d'extase


et la discipline pure,

nantaryamrgas de Yangamya^ sont disciplineabandon (prahnasamvara abandon et discipline), car on abanneuf


donne par

elles l'immoralit


et les

passions qui produi-

sent l'immoralit




y a donc une discipline ne du



qui n'est pas discipline-

abandon. Quatre cas


Discipline ne du

dhyna, impure (ssrava),


l'exception de
discipline ne

celle qui nat des

nantaryamrgas de Yangamya

du dhyna qui n'est pas abandon


bar chad

med lam skyes de


mi Icogs med


spon zhes bya

= [prah-

nam ity anganiye tv nantaryamrgajau //] Vangamya (viii. 22 c) est le stade de recueillement

prliminaire au premier

du domaine du Kmadhtu il ne se dtache pas de ces passions dans le premier dhyna, car, pour entrer dans le premier dhyna, il doit tre dtach de ces
C'est dans ce stade que l'ascte obtient de se dtacher des passions



y a neuf catgories, forte-forte, forte-moyenne, forte-faible, moyenne-forte, de passions du domaine du Kmadhtu ces neufs catgories sont dtruites ou

abandonnes par neuf chemins, les nantaryamrgas. La pratique de chacun de ces nirgas comporte donc abandon et en mme temps discipline Les neu vimuktimrg as de Vangamya ne comportent pas abandon (vi. 28, 65 c) les nantaryamrgas et les vimnktimrgas des dhynas proprement dits et du dhynntara (viii) n'ont aucune relation avec les passions du domaine du Kmadhtu, puisqu'ils dtachent des passions propres aux dhynas. Dans les nantaryamrgas et vimnktimrgas, l'ascte ou bien pratique le chemin mondain, et dans ce cas la discipline est dite ne de l'extase ou bien
' ' '




chemin supra-mondain, et dans ce cas la discipline, bien du dhyna, au moyen du dhyna, est dite pure (vi. 49).

qu'elle naisse


discipline pure, obtenue





nantari/amrgas de Van-


abandon, mais non pas discipline ne du

discipline impure,



dhyna ; nantaryamrgas de Vangamya


discipline ne

du dhyna

et qui est

[5 b]


ne en dehors des nantaryamrgas de

D'aprs les
la discipline


non ne du dhyna
on tablira

et qui n'est

pas abandon.



quatre cas relatifs

pure qui n'est pas abandon, l'abandon qui n'est pas


discipline pure, etc. (Vibhasa, 44,

Bhagavat a



chose, la discipline du corps, la discipline


de la voix, la discipline de

la discipline universelle



Il vit

disciplin par la discipline de l'organe de la

la nature


On demande quelle est

l'esprit, discipline

de ces deux disciplines, discipHne

des organes.


l'une ni l'autre ne sont, de leur nature, avijhapti. Bien au





discipline de l'esprit et la discipline des organes sont,


chacune, deux choses

conscience attentive et mmoire l

1. Samyutta, i. 73; Dhammapada, 361 Udfinavarga, vii. 11. kyena samvaro sdhu sdhii vcya samvaro j manas sanivaro sdlni sdhu sabbattha sanivaro. Les traducteurs chinois traduisent sdhu comme une exclamation Bon . Le texte des stances finales du PrStimoksa (L. Finot,

Journal Asiatique, 1913,



543) porte

kyena samvarah sdhuh sdhur vc


ca samvarah ; mais Kumfirajva traduit


Quel bonheur

cakkhundriyasamvarasamvuto viharati. 3. es bzhin dan ni dran dag gnis yid dan dbai po sdom pa smrlih satftprajanyam ca] mana- indriyasamvarah //

yin =^ [dve

La Vibh&sa

(197, 6)

donne d'autres dfinitions


D'aprs les uns, Vindriya-

satftvara est mmoire et conscience attentive d'aprs d'autres, apramda ; d'aprs d'autres, les six attitudes perptuelles (satatavihra) ; d'aprs d'autres,

non-possession de



de Vaparijnna,

et la

possession du ciiemin

qui a'y oppose

d'aprs d'autres, les

dharmas non


Les Mah&sfimghikas considrent Vindriyasantvara

action (Katli&valthu,
xii. 1).


tant, de sa nature,


les divers

samvaras du Visuddhimagga (palimokkha,


nna, khanti,

viriyasatftvara), voir l'analyse de Warren, JPTS. 1891, 77 et suiv. et




xiv, fol.

5 a-6



Pour que

le lecteur n'aille

pas croire que la premire discipline est

conscience (saniprajna) et la seconde mmoire (smrti), l'auteur


que chacune

d'elles est

deux choses. [6



Examinons qui possde vijnapti

et avijfiapt,


quelle poque

appartiennent celles-ci dans chaque cas

19-22, 23-24 b) ^


a-c. Celui qui est plac



Pratimoksa possde toujours

Vavijfiapti du


prsent, aussi longtemps qu'il ne rejette pas

Vavijnapti \

Les personnes que nous avons

pline de

dites tre installes

dans la






aussi longtemps qu'elles ne rejettent


pas Vavijiiapti qui






toujours Vavijfiapti prsente.




del du premier



possde aussi Vavijnapti

passe \


del du premier

moment, qui


dsign par l'expression



c-d), ces

personnes possdent aussi Vavijnapti


Bien entendu, aussi longtemps qu'elles ne

rejettent pas la discipline l

Tel celui qui est plac dans

la discipline de


anyatar kila devat 1. Pour tablir cette thse, la VyakhyS cite l'garaa bhiksum visayesv indriyni vicrayantam avocat / hhikso bhikso vranam




itij bhiksiir ha piclhsymi clevate devatliaj kumhhamtram vranam krtv katham pidhsyasi bhiksur ha smrty pidJisymi

safftprajanyena ca.

Dans Anguttara,




l'homme qui ne

surveille pas ses organes est


vanam paticcJidet.
Possder, possder la prpti de


prsence, dans le complexe qui

constitue le moi, du


qu'est la





peut avoir

prpti d'un


pass, prsent ou futur


(v. 25).

so sor thar gnas



gtan bar rtag da

Itar gyi



4. 5.

= yvan na tyajati [prdtimoksastJio vartamdnay

prvaksand rdhvam atltayd
Hiuan-tsang ajoute
: :

avijnaptyd sad]


pas Vavijiiapti future

du contexte que ces personnes ne possdent Vavijnapti qui n'est pas de recueillement n'est pas



l'tat futur .







Tel celui qui est plac dans l'indiscipline

Celui qui est plac dans l'indiscipline (asamvarastha,




aussi longtemps qu'il ne la rejette pas, possde toujours Vavijnapti

du moment prsent


possde aussi Vavijnapti passe, partir du

deuxime moment de




Celui qui possde la discipline ne du

dhyna possde

toujours Vavijnapti passe et future ^

Celui qui possde la discipline ne du

dhyna (dhynasamvara)

aussi longtemps qu'il ne la perd pas, possde toujours Vavi-

jnapti passe, Vavijnapti future, car Vavijnapti en question

savoir la discipline ne du dhyna accompagne la pense






moment o


acquiert la discipline de


y a


lui prise

de possession de la discipline de



de cette existence, soit d'une existence antcdente, qu'il avait




Pour l'rya, au premier moment,


ne possde pas Vavi-

jnapti passe \

L'rya possde Vavijnapti pure, qui constitue sa

possde Vavijnapti ne du
et future.

discipline pure,

de la manire dont celui qui possde la discipline ne du




possde son avijhapti passe


cette diffrence que,

au premier moment du Chemin,


prenant pour la premire fois possession de Vavijnapti pure,

peut, videmment, possder une avijhapti pure passe.





qui est en tat de recueillement,

l'homme qui

est plac


Chemin, possdent Vavijnapti du moment prsent

sdom inin^nas pa han de dan hdra [taisaino *samvarastho 'pi] hsam gtan sdom dan Idan pa ni / rtag tu hdas dan ma hons dan dhydnasatftvaravdn sad atltjatay 3. ryas tu prathatne nahhyatitay // 4. samAhitaryamrgasthac [dhunikya]. Le recueilli et celui qui est plac dans le Chemin celte dernire expression fait difficult. Si on entend AryamArgastha dans le sens homme en possession du Chemin (mrgasaman2.



on arrive

la conclusion

que l'rya,


en dehors du recueillement,


xiv, fol. 6 a-7 a.



qui est recueilli (samhita),

l'homme qui


Chemin (ryamrgam sampannah), possdent,

du recueillement
(vyiitthita), ils

Yavijnapti qui leur est propre, ne du dliyna ou pure. Mais lorsqu'ils sortent

ne possdent pas cette

avijnapti actuelle, car cette avijnapti accompagne la pense.


dsignera sous




(madhyastha) l'homme

plac dans



rastlia), qui

ne possde pas la discipline



Bhiku, ni







L'intermdiaire, au premier

moment, possde, moyenne,



quand Yavijnapti se produit

Moyenne (madhya),
et la future.

c'est--dire prsente, situe entre la passe

L'acte (vijfiapti) ne produit pas ncessairement avijnapti. L'inter-









etc.), soit





(dauhsilya, meurtre,

Yavijnapti cre par un acte de mora-

(ilnga, abstention du meurtre), soit encore Yavijnapti que

crent d'autres actes bons ou mauvais, culte d'un Stpa, coups et


au moment o




possde cette avijnapti,

actuelle. [7 a]





possde Yavijnapti prsente




entendre stha dans


normal (prakrtistha), possde Vavijnapti actuelle. Il faut donc le sens tant mont sur' (abhirdha), comme on dii:naustha, plac sur un bateau donc aryamrgastha mrgam abhirdhah santl'tat


que dans

= l'rya qui, actuellement, mdite




mditation qui n'a lieu

d'aprs laquelle

de recueillement. de suivre une autre opinion


est plus simple

(anyah punar ...)



doit s'entendre

le recueilli

et celui qui, tant plac




est recueilli


= sanihitah sanihitamrgasthas

bar gnas

yod na dan po bar gyi dan



phyin chad dus ni gnis dan ho





moment o


la rejette.




peut-il possder peut-il


mauvaise avijhapti ?



possder bonne avijnapti ?


Et combien de temps dure, dans


V avijnapti ?

22. Aussi longtemps



sont revtus de

ou de passion

aussi longtemps l'indisciplin possde

bonne avijnapti,

aussi longtemps le disciplin possde mauvaise avijnapti

Aussi longtemps que continue (anuvartate), dans

l'indisciplin, la

violence de foi (prasdavega) par laquelle, accomplissant des actions



le culte

d'un StQpa,


a cr bonne avijhapti

aussi long-

temps que continue, dans

le disciplin, la

violence de passion (klesatelles

vega) par laquelle, accomplissant des actions



tuer, frapper,

a cr mauvaise avijhapti,

aussi longtemps continue

et passe. [7 b]

V avijhapti, bonne ou mauvaise.

Au moment

de l'action en question, l'agent possde Vavijhapti



possde Vavijhapti actuelle


23 a-b.

Ceux qui font une vijhapti

possdent toujours, actuelle


Tous ceux qui accomplissent une action


ou vocale





aussi longtemps qu'ils sont accomplissant cette action, la possdent





du second moment,


possdent la vijhapti

passe, jusqu'au

moment o

la quittent \



du second moment,

c'est--dire aprs le




sdom min gnas pa dge ba dan




gnas pa mi dge bahi

rnani rig min




rab dad fton nions sugs Idun no

ubhay 'ubhay satftvare sthitah / avijnaptyanvito yvai] prasadaklesavega[van] // 2. raam rig byed ni Iharas cad la / byed pa dag la da Itar Idan [vijnaptikrt kurvann eva sarvatra vartatnanaya /] 3. atllaya k^anad rdhvam atygat 4. La vijiiapti peut 6lre (1) satfivaralaksatUi, par exemple, toutes les actions


xiv, fol. 7 a-8 a.





ne possde pas la vijhapti future


Personne ne possde la vijhapti venir, parce que

la vijhapti

n'accompagne pas


pense (cittmiparivartim).



On ne

possde pas

vijhaptis passes

des classes

anivrta \

C'est--dire les
dfnies (voir



et suiv.).
fois qu'elles sont passes,


ne possde pas ces actions, une


la possession (prpti) d'un

dliarmamhle, tant

faible elle-mme,

ne se prolonge pas (amibandhinl).

non-dfinie, est-il faible ?

Pourquoi ce dharnia, l'action


qui lui

donne naissance.

cette pense, elle aussi,

En raison de la faiblesse de la pense Mais alors la possession (prpti) de cas ne se prolongera pas. Non pas

n'est pas


mme. La vijhapti, en

est stupide (jada), car


ne connat pas un objet (anlamhanatvt)

en outre

elle est

dpendante (paratantra), car

dpend de la pense. Telle n'est

pas la pense elle-mme. Donc la vijhapti produite par la pense

non-dfinie est plus faible que cette pense




(prpti) de la vijhapti ne se prolonge pas

se se prolonge.

la possession de la pen-

Nous avons parl de

pline. Qu'est-ce

l'indisciplin, celui qui est plac





(asamvara) ?

[8 a]
acte, cfiemin-


c-d. Indiscipline,

mauvaise conduite, immoralit,

de-l'acte l
d'un moine qui sont conformes sa discipline. Le moine possde tous ces actes,

moment o il perd la discipline (siksniksepandibhih, iv. 38) asamvaralksand, tous les meurtres que commet un boucher le boucher possde tous ces actes, passs, jusqu'au moment o il renonce l'indiscipline et s'engage ne plus tuer (3) naivasamvaransamvaralaksan, l'adoration
passs, jusqu'au
: ;

d'un Stpa,


on perd ces

actes, ces vijnaptis,

lorsque cesse la violence de

ma bons med

= [na tv ajtayd


/ hdas pa dag dan Idan pa ban med [nbhyatltbhyftt nivrtnivrthhym samanvitah /] 3. sdom pa min dan fies spyad dn / hcbal bahi thsul khrims las dehi lam [asatnvaro ducaritani dauhlyam karma tatpatkah //]


bsgribs pa dan ni

bsgribs pa


Indiscipline, parce




que non-contrainte du corps


de la voix.


Mauvaise conduite (duscarUa), parce que blme par les hommes

Immoralit (danhllya), parce qu'oppose (vipaksa) la mora-

sages, parce que donnant des fruits pnibles.


lit (iv. 122).


Acte, en tant que cre par


corps et par la voix.

Chemin-de-racte, en tant qu'incluse l'acte principal (maidaiv.




Celui qui possde la vijnapti peut aussi possder Vamjnapti.

Quatre cas se prsentent.


a-b. L'intermdiaire, agissant


avec une volition



la seule vijfmpti

Celui qui est plac dans

le ni-discipline-ni-indiscipline

[8 b] et qui,

avec une volition

faible, fait

un acte (vijnapti) bon ou mauvais,


possde seulement cet acte (vijnapti), ne possde pas d'avijnapti

plus forte raison n'y


pas possession d'avijfiapti pour

l'agent lorsque l'acte est non-dfini (avykrta).



accomplis avec une volition

faible, (1) les



(2) les



112) et


68) crent toujours avijhapti.


L'rya possde

la seule avijiapti lorsqu'il n'a


pas produit

ou a abandonn


Lorsque l'rya, ayant chang d'existence, ou bien n'a pas cr

vijnapti (par exemple lorsqu'il se trouve dans
Hiuan>tsang ajoute

moment o


L'indiscipline n'est



elle nat .


vijnaptyaivAnvitah kurvan madhyastho mrdticetanah / Mais il produit (samutthapayati) et possde avijnapti quand


agit avec

une volition


4. rnara rig btan dan ma skyes pahi hphags pahi gan zag rnam rig min [tyaktdnutpannavijnaptir avijnaptyaryapudgalah II] 11 peut se faire que le Prthagjana aussi possde avijiapti sans possder

vijriapH (Vyakhya).


xiv, fol.

8 a-9



lorsqu'il est ren

dans l'rpyadhatu), ou bien a perdu


la vijnapti,

vijhapti cre avec une volition non-dfinie)


possde seule-

ment avijhapti

(avijfiapti pure acquise dans l'existence antrieure),

non pas vijhapti.

Les deux autres cas, possession de vijhapti

d'avijhapti, non

possession de l'une et de l'autre, s'tablissent d'aprs les




acquiert-on les disciplines ?

discipline qui nat




du dhyna

est acquise

par une

pense du domaine du



C'est par une pense du

domaine du dhyna,

du mau-



quatre dhynas) et du


quatre recueil-

lements qui prcdent

quatre dhynas), pense impure (ssrava),

ne faisant pas partie du Chemin, que la discipline de

est acquise

dhyna (dhynasanivara)


une discipline conco-

mitante (sahahhta) cette sorte de pense.




discipline pure,

par la


pense, quand elle est

rya, c'est--dire pure (ansrava), faisant partie du Chemin




[9 a]


expliquera plus bas

22) que la pense rya existe dans

six terres de

dhyna, savoir


quatre dhynas,




premier smantaka).
Pratimoksa, par paravijhpana,


c-d. Celle qui s'appelle

1. Bhasya yenryapudgalena parivrttajanman bhavati vijnaptatn va punar vihnam ....


na tvad


2. On a trty samvarsamvaramadhyasths tvray cetanay kusalant akualam vu, kurvantah / cattirthi yena janmntaraparivrUau prthagjanena [na] tvad vijnaptam bhavati vijnaptam va vihnant. 3. bsam gtan las skyes bsam gtan gyi / sa nid kyis thob [dhynajo dhynabhmyaiva labhyate]. 4. zag med ni / hphags des = [ryay tay / nirmalah], 5. so sor thar ces pa / gzhan gyi rnam rig byed sogs kyis prtimokskhyah








paravijnpana, information
Le candidat

d'autrui et information par autrui

savoir quelque chose autrui, et autrui lui fait savoir

quelque chose


Autrui est un Samgha, pour Tacquisition des

disciplines de Bhiku, BhikunT,

Siksamana une personne (pxidgala),


pour l'acquisition des cinq autres disciplines de Pratimoka.

D'aprs les docteurs en Vinaya (vainayika) de l'Ecole Vaibhaika,

y a dix espces d'ordination (iipasarnpad). Pour les comprendre toutes dans sa dfinition, l'auteur dit ... par l'information d'autrui



Ordination par soi-mme ^ dans


cas du



du Pra-

2. le





Chemin (niymvakrnii,




cas des Cinq,



de ses com-




Viens, Bhiksu



cas d'jfiata


La discipline de Prati1. paro vijnpayatiti pratyyayati. Tibtain moksa, si autrui y informe, est aussi acquise en informant autrui . Paramfirtha, dans la kSrika par mutuelle information d'autrui bhasya Si autrui informe
: ;

celui-l, celui-l

informe autrui


Information d'autrui. Qui informe

autrui est appel autrui

(On a donc

information d'autrui =: information d'un

autrui qui lui-mme informe


svma upasampad, Mahavastu,



2; Mahavagga,



28-29; Milinda,

p. 76, 2G5.


Le texte tibtain porte simplement

etc. .


des Cinq , Paramrtha


Vyakhya explique


cas des cinq

Bbiki^us, Kaundinya, etc.,

au moment o


obtiennent la

duhkhe dharmajn-



25 d)


fragment publi par Hoernle, Manuscript Remains,

p. 13,


pancakntn jnnbhisamayena tipasatnpad.


dans le cas d'jiata dans Mabavagga, i. 6, 32 tibtain Mais Ajnatakaundinya est ordonn par la formule Viens, Bliiksu . Param&rtha et Hiuan-tsang dans le cas de Yasas, etc. . Le nom technique de cette ordination est ehibhiksukay upasampad ; l'homme interpell par Vehibhiksuk (ehibhiksukay bhsita) devient moine.



Cette parole est adresse un



eta bhiksavah carata


homme ou plusieurs brahmacaryam

ehi bhikso cara





accompagne du

miracle que la Vyakhyft dcrit (d'aprs un texte voisin de la stance, Divya, 48,

coktas tathgatena tyin I munda ca ksyadharo (Comparer Mahavastu, iii. 4^30 Dhammapada, Commentaire 21-23, Fauboll, 1855, p. 107, Burlingame, i. p. 280, etc.). On a ehibhiksuk dans




xiv, fol.

9 a-b.

cas de

En En

reconnaissant Bhagavat ponr matre, dans


Mahacas de



Bhagavat par ses rponses, dans



acceptant les obligations spciales aux religieuses, dans



cas de MahprajpatT

[9 b]

Par un messager, dans Par


cas de




en qualit de cinquime, c'est--dire ordination

de cinq Bhiksus, dans les pays de frontire \

devant un


Par dix Bhiksus, dans

Madhyadesa ^



rptant trois fois la formule du refuge, dans le cas des

soixante, les Bhadravargas, ordonns en troupe ^

i. 330, ii, 113, Divya, Kosa; ehibhikstikat dans eJnbhikkupabbajj Dhammapada, 1855, p. 119 ehibinksunlvda, Divya, 616. Voir les formules de Mahvagga, i. 6, 32, Majjhima, iii. 2. Par. i. 8, (Vinayapitaiia, iii. p. 24), On a compar Satapatha, i. 1, 4, 2.





fragment Hoernle


sttir abliytipagarnn
les idoles


que Kasyapa saluait se brisaient en morceaux il vint prs de Bhagavat et omit de le saluer, craignant que le corps de Bhagavat ne prt (msya rpavinso bhcl iti). Connaissant son intention, Bhagavat dit Salue . Ksyapa salua, et voyant que le corps de Bhagavat n'tait pas le Tathagata mis mal^ il dit ayant me sst Il est mon matre . Par l, il fut ordonn. Comparer Mahavastu, iii. 51, 446 Strlamkara, trad. Huber, p. 161.




Bhagavat fut satisfait (rdhita) par les rponses Dans le fragment Hoernle il faut lire [soda]yiiiah

pranavykaranena iipasampadi.
3. giridharmbhyupaganiena, Cullavagga, x., Angultara, iv. 76^ BhiksunTkarmavcana (Bulletin de la School of Oriental Studies, 1920). 4. Elle tait enferme dans le harem et envoya un messager au Bouddha pour obtenir la pravrajy. Sur Dhammadinn, Majjhima, i. 299 et Thergalha, 12, o rhistoire est trs diffrente. 5. L'officiant (vinayadhara) est le jnptivcaka. Pays de frontire pratyantikesu janapadesii. Mahvagga, v. 13, il, ix. 41 Divya, 21, 18 (pnityantimesii) Mahavastu pancavargena ganena upasampad. 6. Voir Minayev, Recherches, 272 Takakusu, dans Hastings, vii. 320.

aranagamanatraivcikena sasHhliadravargapgopasampdilnm. ParaVjkhy buddham saranam gacchma iti trirvacanenopasampaA. raartha En disant trois fois les trois refuges , traduction confirme par vi. 30 d. Dans Mahvagga, i. 14, les Soixante sont ordonns par la formule Venez!...

Voir l'ordination de Subhadda, Dialogues,








voit que, d*aprs ces docteurs, la discipline de

Pratimoka n*est

pas ncessairement acquise au

l'ordination du Bouddha,

moyen d'une

vijnapti, par exemple

Quand on prend (samdna)

combien de temps

la discipline

de Pratimoksa, pour

prend-on ?







la vie

ou pour un jour-et-

Les sept premires catgories de la discipline de Pratimoksa sont

prises pour la vie

la discipline de

jeneur (upavsastha) est prise

pour un jour-et-nuit. Telle

Pourquoi ?

est la rgle.

y a deux priodes de temps (klvadhi),

la priode

vie, la priode jour-et-nuit.


la quinzaine et les autres dures


temps, elles consistent en des additions de la priode jour-et-nuit.


est le

dharma que

nous appelons



(kola) ? Ce n'est

pas une substance (padrtha) ternelle,



le croient


Le mot



une expression par laquelle sont dsigns


samskras en
jour, c'est

tant que passs, futurs, actuels


7, v. 25).

[10 a]



fait clair



quatre continents

la nuit,






discipline de

Nous admettons,
si l'on

disent les Sautrntikas, que la



seulement produite pour la dure de




s'engageait observer les rgles dans une

la discipline

vie venir,

on ne produirait pas

pour cette autre vie


personne (raya) qu'on sera sera diffrente (nikdyasahhga,



2. cette

nouvelle personne ne pourra pas s'appliquer aux


rgles acceptes

3. elle

ne se souviendra pas de l'engagement ^

les devoirs

1. ji



homme assume

d'un jeneur pour plus d'un


hthso dan

zhag tu

sdoin pa yan dag blan bar bya

= [yvajjivam

2. Bliftya

ahoratratfi ca] samvrteh / Yy&khySi: samvrter



visahhayrayatvat tena ca tatrprayogd asmaranc ca. Vyakhy tena visabhgarayena tatra sanmdne 'prayogt / asmarandc cetarrayena tat samdnatft na smurati.

Hiian-tsang, xiv,


9 b-10



pour cinq jours, pour dix jours, quel obstacle ce que

se produisent en lui plusieurs disciplines du jene ?


faut qu'il y ait


un obstacle puisque Bhagavat, dans


le Stra, dit

qu'on prend

jene pour un jour-et-nuit.

se pose pourquoi

La question





la discipline

du jene ne peut

tre produite

pour une dure


plus longue ? Bien plutt

pensait que les


hommes, dont




dompter, prenant

jene pour un jour-et-nuit,

seraient capables de le bien pratiquer. Car, en vrit, rien ne s'oppose

ce qu'on produise la discipline du jene pour plus d'un jour.

Comme Bhagavat

ne parle pas de jene durant plus longtemps,

Vaibhsikas n'admettent pas cette manire de voir. [10 b]

quelle est la dure de l'indiscipline

On demande




Pas d'indiscipline pour un jour-et-nuit

L'indiscipline ne dure jamais




la discipline

du jene, car

elle est

produite par l'acceptation du pch pour la vie

(ppadharmhhyupagama). Comment cela ?



Car, dit l'Ecole, on ne la prend pas ainsi K


Personne ne prend
jene, en disant
Il s'agit,

la manire dont on prend


Je veux rester un jour-et-nuit dans l'indiscipline



d'actions honteuses.


Personne ne prend
dans pour
la vie durant.

en disant

Je veux


vie durant

l'indiscipline .

Donc on ne prendra pas





n'est pas de cette faon, en effet, qu'on

On ne prend

pas l'indiscipline au moyen d'un



acquiert l'indiscipline en agissant avec l'intention de toujours agir

zhag pa




de de Itar nod


ne la

sdom min med := [nhortriko 'satnvarah] med ces grag [sa kilaivam na labhyate 1] Hiuan-tsang prend pas comme on prend la bonne [discipline].




27 d-28.

mal on n'acquiert pas l'indiscipline par l'intention d'agir mal pour Dans le cas du jene, l'intention un temps (klntaravipanna). n'est pas pour toujours '[lia]; nanmoins on obtient la discipline par la force de l'acte qui consiste dire Je veux rester un jour-et-

nuit dans

la discipline

du jene


on accomplit

cet acte parce


qu'on dsire acqurir cette discipline. Si quelqu'un dsirait


pourrait sans doute



l'indiscipline pour une

certaine priode et

acquerrait l'indiscipline pour cette priode. Mais


cas ne se prsente pas


donc nous ne reconnaissons pas



pour un temps


D'aprs les Sautrantikas, l'indiscipline n'existe pas en soi (dra-

vyaias) part de la volition (celanvyatirikta). L'indiscipline,

l'intention de




pch (ppakriybhisamdhi),



une certaine

volition (cetanvisesa) avec les traces



vsan) que




longtemps que cette

volition avec sa trace n'a pas t dtruite par


volition contraire,

mme quand


a une pense bonne, reste muni de

pline (asatnvaravnjy indisciplin


Comment faut-il
du jene ?

prendre la discipline d'un jour-et-nuit ou discipline



faut prendre le jene


(upavsa) dans une






pour jusqu'au lendemain,


matin, d'autrui

[11 b]


Sur YupavCLsa, voir VVieger, Bouddhisme chinois, i, 149 (Vinaya eu dix Oldenberg, Bouddha, '-^ d., 372 Rhys Davids, Buddhisni, 1907,
; ;

pp. 139-141

Minayeff, Recherches,

p. 166.



205; Suitanipata, 400.

six jours



Les d'upavsa, Waiters, Yuan-Chwang, i. 305, Chavannes, Cinq cents 26, n. 2 les quatre jours et leur date, Takakusu, I-lsing, 63, 188.
rpt ou de longue dure.


Groot, Code du Mahtlyana, 62.

L'uposadha d'un demi-mois de Bhagavat, Mahvastu,



97, est

une abstinence

manire des Jainas (voir l'Introduction de


2. dmah Lar t.idug smras bzlas pa yis / mi brgyan nam ni naAs par du / bsfien gnas yan lag tlisan bar ni / n& par gzhan las gnod par bya. ParamArtha et Hiuan-tsang, dans la Kfirikfi et le Bh&sya, s'cartent de l'ordre du tibtain.

smras blas pa

yis ^=

murmurant aprs


a t parl




xiv, fol.

10 b-11



Dans une
* ;


humble, ou accroupi (utkutuka) ou age^



mains jointes en kapotaka


(en plaant les

quatre doigts d'une main entre

disposes en anjali


et l'index

de l'autre) ou

fors le cas de maladie.

Faute d'une attitude


respectueuse, la discipline n'est pas produite.


Le candidat ne parle pas avant l'ordonnant ou donneur (dlar),


la personne qui
c'est d'autrui
tion, ni






la sorte,

qu'on prend




n'y aurait ni rcep-

don l

Le candidat ne porte pas de parure

parce que, de


porte la parare habi-


on ne


pas vanit \



s'engage pour jusqu'au lendemain, au lever du




jene complet, avec ses huit membres,

I-tsing, p. 188,


non pas

avec des membres manquant (Takakusu,


Cinq cents contes,


p. 136).

Le matin, au lever du





discipline d'un

jour et d'une nuit. (Vibhasa, 124,

Celui qui, antrieurement, a form l'engagement



= anu pact



la suite du donneur [de i'upavsa], aprs




bar hdag pa [ncsana


ni tsog cig por

hdug pa ham pus mo btsugs



On a aussi cog bur hdug pa = titkuhtkastha (Mahfivyutpatti, 281,



Hiuan-tsang rendent pus



plaant genou [ terre]

par koui, flchir les genoux, tre agenouill.

2. angustharahitasyngulicatuskasya itarahastngusthapradesinyor antarle vinyasant kapotakah. Voir Dict. de S* Petersbourg. De qui faut-il prendre la discipline d'Upavasa ? On 3. Vibhasa (124, g) obtient la discipline en la prenant de sept classes de personnes (ts'i tchong les sept parisads de Takakusu, I-tsing, p. 96 moine, novice, nonne, probationnaire, novice femme, dvot et dvote). Pourquoi ? Les personnes qui n'ont


pas pris

la discipline (kiai)


la vie

durant ne sont pas dignes d'tre



de discipline




rejette les

ornements qui ne sont pas vieux.


Pourquoi ?


Les ornements qu'on use constamment ne produisent pas

la vanit


ornements neufs



Le mot que nous traduisons habituel (nar ma) doit nityaka bJwjana, Mahavastu, i. 602, iii. 253, s'entend de l'ordi.


pratiquerai le jene [11




b] le huitime jour de la quinzaine, etc.


, il



jene, eut-il

mme mang

7. D'autrui,

non de soi-mme. Rencontrt-on des causes de pch,

les obligations

par honte l'gard du donneur, on ne violera pas


Lorsque ces rgles ne sont pas observes, on


une bonne action

pour l'homme

(sucarita), mais on n'obtient pas la discipline du jeune. Lorsque ces

rgles sont observes, le jene est fort utile



commet des pchs de jour

Le jene


de nuit (chasse, meurtre


adultre). [12 a]





parce que,

comportant une

manire de vivre conforme

des Arhats (tadanusiksant),

place auprs (upa) des Arhats ^ D'aprs une autre opinion, parce
qu'il place

auprs de la



la vie durant






a pour


de procurer (dh) la croissance (posa) des racines-

de-bien (kusalamla) des



qui n'ont que de petites racinesdit




procure la croissance du bien, Bhagavat a

On V appelle posadha.



du jene nat (pour


au lever du

soleil, Tefficace



natre cette discipline appartenant la pense qu'il a forme de s'obliger prendre



La Vyakhyfi




sa bhuktvpi grhnyd iti / sryodaya eva dit samdnaniyamacittasyofthpakatvt j bhuktvgraabhivyaktyartham. Paramrtlia traduit mot pour mot sa bhuktvpi


tyaya ?), 2. Sur




si quelque obstacle se rencontre (vighnapraquand mme abstinence complte . diverses lectures et interprtations, uposatha, nposadha (Lalita,









posadha (Mahavyutpatti,




voir S.

Lvi, Observations

sur une langue prcanonique du


As. 1912,

Gso-sbyon s'explique qui nourrit (les mrites], qui lave uposadhik, telle MfiyadevT la descente de l'lphant 74 a-b. - posadhika, Mahavyutpatti, 270, 13.



= nlyamavat,


Voir l'Uposalhasutta (Visuddhimagga, 227), Anguttara,




Hiuan-tsang citent




accrot la


pure pense de soi et d'autrui, Bhagavat (Bouddha Sugata) l'appellent Posadha


xiv, fol. 11 a-12 b.


Pourquoi la discipline du jene

est-elle prise

avec huit membres ?




de moralit (slaj,

membre de

vigilance (apra-

mdda), membre des vux asctiques (vrata), respectivement quatre,

un, trois


Quatre membres,


renoncements au meurtre, au



nence, au mensonge, constituent le

[12 b] par lequel est

membre de

moralit (ilnga)

abandonn ce qui

pch de sa nature (prakr-

tisvadya) l

Un membre,
membre de


renoncement aux boissons enivrantes, constitue


vigilance par lequel est arrte la non-vigilance (prapris la moralit,


mdda). Car l'homme mme qui a


boit la liqueur

enivrante, sera non-vigilant (pramatta).





Trois membres, les renoncements aux

repas hors du iemps, constituent le favorables et


levs, musique, etc., et



d'asctisme \ car


conformes au dgot (samvega).

Quelle ncessit de prendre les

membres de

vigilance et d'asc-

tisme ?




viter la dfaillance de la


et l'arrogance ^

Lorsqu'on boit la liqueur enivrante, la mmoire manque de ce

faut faire et ne pas faire. Lorsqu'on use des








38S, l'Uposatha comporte neuf


on ajoute


mditation de bienveillance.

thsul khrims

yan lag bag yod


yan lag

brtul zhugs

yan lag


gcig de bzhin

gsum rim bzbin =: [llngam apramdngam vrafngatn ca



catvry ekam tath trni] sllam prjikbhvah samghvasesdyabhvah. Sur les expressions prjika (=^ *prcika), samghvasesa, samghdisesa (= *samghtiesa), S. Lvi, Langue prcanonique du Bouddhisme, J. As. 1912, ii. 503-506. Les samghvasesas seraient les pchs qui laissent au dlinquant un reste de communaut en contraste avec les prjikas qui impliquent l'exclusion dfinitive . Sakaki Risaburo (Vyutpatti, 255-256) cite Burnouf, Kern, Lvi. Le chinois tiaduit sng-tsan qui dtruit le Samgha. 4. vratnga niyamdnga. 5. de yis dran nams dregs par hgyur [smrtimosamadan tatah //]





lorsqu'on assiste aux ballets, chants et musique, la pense devient



l'un et l'autre


on n'est pas loin de violer la

Lorsqu'on observe la rgle de manger au temps voulu, lorsqu'on

vite de

manger hors du temps,


[13 a] la


reste prsente des

obligations du jene, et le dgot


se produit.

dfaut du

huitime membre, mmoire


dgot manqueront.

D'aprs certains matres,


jene ou upavsa consiste dans



jene proprement


renoncement au repas hors du temps


membres du jene (tipavsnga). n'est pas un membre donc, afin d'obtenir le L'abstention d'aliment nombre de huit membres, on doit distinguer deux membres dans le
autres renoncements

sont les



d'une part, renoncement aux ballets, chant, musi-


d'autre part, renoncement

aux parfums, guirlandes, onguents.

Cette interprtation n'est pas conciliable avec le Stra, [disent les


car, d'aprs le Stra,


immdiatement aprs



cement au repas hors-du-temps,

jeneur doit dire

Par ce

me membre,

j'imite la rgle, je

me conforme

la rgle des Arhats

Que sera donc le jene, distinct de ses membres, et comportant membres ? D'aprs les Sautrantikas, c'est de la collection mme des membres qu'on dit qu'elle a des membres c'est la collection

* '

qu'on attribue des membres. L'expression

doit s'entendre

jene huit





membre du

arme quatre membres



poudre cinq



(pahcngapista) ^
D'aprs les Vaibhasikas, l'abstention de nourriture en dehors
est la fois le est

du temps



un membre du jene. De





fois le


un membre du Chemin (mrest





fois la



membre de




[13 b] de




dhi) est la fois


un membre du dhyna



Comparer Anguttara iv. 248, o l'ordre des membres dififre. Sur pifta, voir Haracarita 45, 2, 123, 2, 273 (F. W. Thomas).

Hitian-tsang, xiv,


12 b-13


est impossible

Mais, dirons-nous [avec les Sautrantikas],











d'eux-mmes. Direz-vous que






des samyagdrsti^

postrieures ? Ce serait admettre

moment du Chemin n'a pas huit membres. Ce serait admettre que le dernier moment des membres de la Bodhi n'est pas un membre



La possession de
Upasakas ?

la discipline

du jene

est-elle rserve

aux seuls

Samghabhadra rpond cette objection. les Upasakas et la place qu'ils occupent ct du Samgha, Bumouf, Introduction, 279-282 Spence Hardy, Eastern Monachism Oldenberg, Buddha


1914, p. 182, 317, 429

Minaiev, Recherches, 296

Foucher, Art grco-bouddhique

du Gandhra,



Przyluski, Lgende d'Aoka, p. 207-8.

v. 20,

et des




344, importants en ce qui concerne les

du Samgha


Le texte capital est


MahanSmastra dont plusieurs passages sont discuts

Kosa. D'autres passages relevs dans les notes de Buddhaghosa, Suman'

galavilsin, p. 235.

L'Upsaka est considr comme un religieux (Anguttara, ii. 8), puisqu'il a de donner l'UpavSsa ( VibhfisS, ci-dessus p. 65, n. 3), puisqu'il est appel Mais Upsaka signifie qui se confesser (iv. 34 a-b) c'est un tertiaire vnre [les trois perles] (Sumangalavilasin, p. 234), et nous verrons que, pour les Sautrantikas, on peut tre UpRsaka sans s'engager aux rgles de moralit

le droit






(silspada) dont l'observation

Si le lac peut obtenir les

fait le parfait





2 sous



de la vie religieuse



notamment la qualit d'Arhat, Kathvatthu, iv. 1, Milinda, 242, 265, 348. D'aprs un groupe de sources, le lac, mme kmabhogin, peut entrer dans le Chemin si, quoique vivant dans le monde, il garde la chastet (brahmacarin ;

exemple Ralston, Tibetan Taies, 197), il peut obtenir le fruit d'AnfigScas, il ne devient Arhat [C'est dans ce sens qu'il faut entendre Dhammapada 142 UdSna, vii. 10 Majjhima, i. 466, 483, 490 les textes ne disent pas nettement si le lac kdmahliogin peut obtenir les fruits de SrotaSpanna et de Sakrdgmin]. Mais Anguttara, iii. 451 numre vingt lacs qui ont obtenu la qualit d'Arhat voir Samyutta, v. 410, Milinda, comme le Kosa, croit que le lac peut devenir Arhat au moment o il devient Arhat, il devient moine le jour mme, il entre dans l'Ordre si l'Ordre n'existe pas, il entre dans une confrrie asctique. [Wassilieff, p. 2i8, suivi par Minaiev, Recherches, p. 220, s'est mpris
voir par


en aucun

sur le sens de sa source tibtaine, voir Kosa,

vi. 30].


le ciel est la

rcompense de l'homme

qui, incapable


les plaisirs








a-b. Les autres peuvent possder le jene,


mais non pas sans




Lorsque l'homme qui


n'est pas

Upasaka, avant de s'engager aux

jour-et-nuit, le triple refuge,
est produite en lui.
qu'il n'y ait

du jene, prend, dans


alors la discipline du jene



pas sans la prise des refuges

la condition


erreur, etc.



Le MahanamasQtra
blancs, mle et


le lac

aux vtements

muni de l'organe mle,


qui, aprs avoir pris refuge



Bouddha, dans

Dharma, dans

Saipgha, prononce cette




comme Upasaka

[14 a] par cela seul




Est-ce dire qu'on devienne

Upasaka par


seule prise des refuges ?

l'inanit (Theragfithft, 187), recule

devant l'obligation de la chastet (Suttanipftta,

pentalogue et l'Upavasa.

3%, Divya,

303), se contente d'observer le

Sur l'enseignement donn aux lacs, sermons sur le don, la morale, le ciel, etc., Majjhima, i. 379 Culla, vi. 4, 5, Mahavagga, i. 7, 5, etc. Dgha, ii. 113, Sarpyutta, iv. 314 Divya, 300, 617 Przyluski, Lgende d'Aoka, 196, 353. Senarl, Piyadasi, ii. 208. Voir iv. 112. Le lac malade ou mourant visit par Vvsika (moine rsident), etc., Anguttara, iii. 261, Majjhima, iii. 261 dfaut de moines, par des lacs, Samyutta, v. 408. Le lac rvle des Stras aux Bhiksus, Mahfivagga, iii. 5, 9.

du lac (Kosa, iv. 86). gzhan la han bsnen gnas yod mod kyi / skyabs su ma son ba la med =: [upavso 'nyesv api na] aranagatnanair vin j 2. i. Le Mah&nSmasQlra dans la rdaction d' Anguttara, iv. 220 et Samyutta, v. 395 (Sumangalavilasin, 234) a simplement yato kho mahnma buddham
Superstition, cueil

saranam gato
hoti ettvat


kho du refuge. Le MahfinaniasQtra sanscrit (Saipyukta,

dhammam saranam gato hoti samgham saranam gato mahnma upsako hoti = On devient Up&saka par la
33, 11) conlient

en outre une courte

. (De upsiktn csmn bhngacn dhrayatu). Ce Stra est partiellement cit dans la VyRkhya kiyatd hhadanta upsako bhavati j yatah khalu mahAntnan grhi avadCitavasanah purusah purusendriyasamafivgatah upsakatft niAnt dhraya iyatopsako bhavati.

formule ajoute la prise des refuges

Divya, 47, o on a

Considre-moi connue Upfisaka


grhlty uddeapadam avadtavasana iti nirdeapadam purusa uddeapadam I puritsendriyasamanvAgata iti nirdeapadam). Hiuantsang ajoute la prire du candidat les mots kanmin updya dhraya.



Une formule

plus complte avec de menues variantes, Anguttara,



Les Aparntakas rpondent

xiv, fol.

13 b-14




(Vibhas, 124,

Les KsmTriens affirment qu'on ne peut tre UpSsaka lorsqu'on

ne possde pas la discipline d'Upasaka.
85 so ahani bhagavantam Samyutta, iv. 113, v. 12, Culla, vi. 4, 5, DTgha, saranam gacchdmi dhammam ca bhikkhusamgham ca upsakam mam bhagav dhretii ajjatagge pnupetam saranam gatam. Commentaire de la Sumangalavilsin matn bhagav tipsako ayam ti evam dhreht jntu Que Bhagavat me connais,se comme tant UpSsaka . pnupetam tipnehi upetam; c'est--dire: Aussi longtemps que ma vie dure, qu'aussi longtemps Bhagavat me considre comme upeta (venu lui), n'ayant pas un autre




Upsaka ayant

pris le triple refuge, faisant ce qui est

convenable (kapqu'il n'est


On me

couperait la tte que je ne dirais pas du







n. 2.

n. 1), et


Formule que Vasubandhu dcrit comme celle du Drstasatyastra (voir p. 74 qui est cite, dans sa premire partie, par le Vaibhsika (p. 72 1. 6) avec Xednv^ prnpeta au lieu de prnopeta (lecture interprte et discute p. 72

9 et p. 75 1. 6) Upsakam mtn dhraya adygrena yvajjlvam prnpetam [saranam gatam abiiprasannam]


Le formulaire Sarvstivdin (Nanjio, 1166, dit



traduit par Wieger,

Bouddhisme Chinois,
vie, je


Moi un


d'aujourd'hui jusqu' la fin de la

prends refuge en Bouddha,

meilleur des bipdes

Sachez que je suis

un Upsaka ayant
pris les cinq sllas

pris refuge dfinitivement

en Bouddha, Dharma, Samgha, se






Dharma du Bouddha Skyamuni, ayant

Ensuite on explique les cinq sllas et

rpter trois


candidat rpond qu'il les gardera.

(cheou o kii) remplace


ayant pris
: *

les cinq slas


prnpeta de


Nous possdons

l'original sanscrit

de l'expression

ayant pris




mita, p.

dans l'Abhisamaylanikrloka, commentant Astasahasrik prajnSpSra137. Nous apprenons que le Vinaya a deux lectures (pilia). D'aprs la
le reoit

premire, le candidat prie le matre (qui

comme UpSsaka)




comme un Upsaka comme un Upsaka

qui a pris qui a pris

le triple


d'aprs la seconde, de le considrer

le triple

refuge et les cinq rgles.

trisaranaparigraht (lire ^gamant) pancasikspadaparigrahc copsakas tathopsiketi dvidhbhedah j trisaranaparigrhtam (lire ^gatam) upsakam wm cryo dhrayatu / tath trisaranagatam pancasikspadaparigrhltain upsakam mm cryo dhrayatv iti vinayadvidhptht. (D'aprs une mauvaise copie du MS. de CalcuUa, Rjendrall, Buddhist
Literature, p. 194).

y a donc deux sortes d'Upsaka

celui qui a pris le refuge sans plus, celui

qui a pris le refuge et s'est engag observer les cinq rgles.


Formulaire npalais assez confus


la prise des cinq rgles)

dans dikarmapradpa

renoncement aux dix pchs prcde (p. 189 de mon dition dans
p. 296.



rsum par Minaiev, Recherches,




30 c-31



n'est-ce pas contredire le

Sotra ?




le fait qu'il




accepte la qualit d'Upasaka, la discipline

est produite


d'Upasaka se produit en


par la seule acceptation

Considre-moi partir

de la qualit d'Upasaka,
d'aujourd'hui, pour la vie,

comme un Upasaka i^rnpefa

Quel est


sens de cette expression prnpeta ?

faut entendre, par ellipse, prntiptpeta,

p. 75, n.

exempt de meurtre,

ayant renonc au meurtre (voir

Donc, en acceptant la qualit d'Upasaka, on prend la discipline

[puisqu'on se prsente


ayant renonc au meurtre]. Cepen-

dant, pour qu'il connaisse les points de la rgle (ikspada), [14 b]




la lui explique,


c'est aussi le cas






ecclsiastique (jnpticatiirtha

lui fait


Bhiku a

acquis la discipline de Bhiku

rgles les plus importantes

cependant on


Vous avez vous abstenir de




Vos co-religieux vous diront le Sramanera ^ De mme en


De mme en



pour l'Upasaka






pas, car

l'homme en question produit

les cinq renonce-

ments . 2. dge bsien nid du khas blans nas j sdompa, qui doit correspondre un [upagamyopsakatm damah]. On a iv. 38 dama pada plus deux syllabes hdul-ba. saffivara, mais le tibtain traduit dama



Voir ci-dessus

p. 71, n.

2 sous


uktis tu bhiksuvat

yaihaiva hi bliikstir labdhasamvaro 'pi jndpticaturthena karman ikspaddni yaihdsthlam grdhyate prajnpyate / ita cdmuta ca prdjikdibhyas tava satnvarah / anyni ca te sabrahmacdrinah


le Sramanera dit aham evatnnm tatn bhagavantam tathdarhantatn samyaksambuddham kyamunim dkydhirjatft pravrajitam anupravrajdmi grhasthaligam parityajmi pravrajydlingant samddadmi / ramanoddeatn mfft dhdraya et rpte cette formule (evam yvat trir api), il acquiert la discipline de Sramanera qu'on lui dtaille ensuite. 6.



la discipline

xiv, fol.

14 a-b.


en prenant une



fois, trois fois le triple


ensuite on lui fait prendre (grhyate) les rgles



meurtre, je renonce au meurtre

Donc on

n'est pas

Upasaka sans

possder la discipline d'Upasaka.


a-b. Si tout

Upasaka possde

la discipline
etc. ?

d'Upsaka, comment


peut-il tre


Si tous les

Upfisakas sont placs dans la discipline d'Upsaka,

peut-il dcrire quatre sortes

comment Bhagavat

d'Upasaka, l'Upa-

saka d'une rgle (ekadesakrin), de deux rgles (pradeakrin), de

ou quatre rgles (yadhliyaskrin), des cinq rgles (paripr~

nakrin) ?



Ces termes,

dit l'Ecole,

visent le fait de l'observation des

rgles \
L' Upasaka qui,



observe (raksati) une des rgles



acceptes toutes] est dit pratiquer (kar) cette rgle.

ne faut pas

comprendre que Yekadesakrin


un Upasaka qui



pratiquer une seule rgle]. Cependant tous les Upasakas sont gale-

ment placs dans

la discipline


1. gai te thams cad bsdams yin na / sna gcig spyod sogs ji Ita bu [sarve cet samvrt ekadesakrydayah katham /] 2. La Matiavyutpatti, 84, ajoute apariprnakrin avant paripfirnakrin ; les versions chinoise et tibtaine traduisent pradeakrin qui observe (spyod-



Mng) pendant


jour (ni-tshe


un jour


et Russi


La Vyfikhy

cite le

Stra (Mahanfimastra, Samyukta, 33,



danta upasaka ekadesakr bhavati pariprnakr iha Mahnmann upasakah prntiptam prahya prantiptd virato bhavati iyat Mahnmann npsakah siksym ekadesakr bhavati dvbhym

prativiratah pradesakrl bhavati / tribhyah prativiratas caturbhyo va yadbhyaskrl bhavati / pancabhyah prativiratah pariprnakr bhavati. Chavannes, Cinq cent contes, i. 244, illustre ce texte.

de bsrun ba la gsuns zhes grags =r



kila raksakkhyth] ?




qu'ils observent,






visant (yo) l'observation.


Hiuan-tsang poursuit Preneur d'une rgle




tait autrement,

l'Upasaka d'une rgle serait



La question

est de savoir

n'y a pas des

Upasakas, non munis de

la discipline

avec ses cinq membres, et qui se sont

74 Le Sautrantika objecte




votre doctrine contredit le Satra (titsiitra).


dites qu'on acquiert la discipline par le seul fait d'accepter

la (jualit

d'U^^ska prnpeta



comme Upasaka
Stra qui nous


Tel n'est pas

le texte

du Sotra [15





intresse, c'est le


qui donne la dfinition de l'Upale

saka, et

non pas un autre Stra. Et


n'a pas cette

expression prnpeta.

Vous prtendez vous

autoriser d'un





Depuis aujourd'hui, pour la


comme Upasaka]
qui ont vu les



vie (prnopeta)-, ayant pris refuge, croyant parfaite

ment (ahhiprasanna),


ce texte vise les


engags observer une, deux,


quatre rgles. Non, d'aprs les Vaibhfisikas

Ykadesakrin est rUpfisaka qui viole quatre des rgles qu'il a acceptes. Dans Anguttara iii. 215, l'Upsaka Gavesin, silesu aparipralrin, dclare
ses camarades

A partir d'aujourd'hui
prend une une



sic^u paripfira-




les obligations

du Bhiksu [qui seul est un


de moralit complte].



380, v. 131.

D'aprs la Vyfikhya,


avec raison,







de Vasubandhu,




Par Drstasatyastra, j'entends 'le Stra o le candidat la qualit d'UpRsaka un homme qui a vu les vrits . Il s'agit du texte Divya, 75, ou d'ini texte semblable Bhagavat dtruit l'hrsie de personnaHsme du brahmane Indra, qui obtient le fruit de SrotaSpanna .... sa drsfasatyah kathayati / atikrnto ham

bhadanttikrdntah (Le pli lit abhikkantam ...) / eso 'ham hliagavantam buddham saranam gacchmi dliarmam ca bhiksusamyham ca / upsakatn ca mm dhraya adydgrena yvajjvam pranopetam saranam gatam abhiprasannam (Edition gatam / abhiprasauno 'theudro brahmana .... ; mme texte, Divya, 462, avec la bonne lecture). L'diteur japonais du Kosa renseigne comme DrstasatyasQtra le Stra de Srona

le fils

de G|-hapati (Sainyukta,



Srona, ayant cart toute poussire,

la h^i,

abandonn toute



pur il de

au moment o
le roi


vit la


se leva et dit Sfripiitra


Moi, partir d'aujourd'hui, je prends refuge

la qualit d'Upfisaka,

Des possesseurs de



Sona (Samyulta, iv. 113) mais ils emploient la fonnule ordinaire iipsakani Bhdradvdjo dhretu ajjatagge pdnupetatft saranaftt gatam, omettant Vabhiprasanna du sanscrit (Sur abhiprasanna, Saipyutta, v. 225, 378). 2, Tel est bien le sens de l'expression prdnopeta srog dan bsho ba risquant la vie abandonnant la vie (Hiuan*tsang). On a vu p. 71, n. 2 sou.s iii, l'interprtation de Buddhaghosa.


xiv, fol.

14 b-15



vrits, qui ont acquis la foi d'intelligence

et qui,



par consquent, adhrent la Bonne Loi


au prix de la


Nous sommes incapables d'abandonner


Dharma, mme

pour sauver notre vie

discipline d'Upasaka.


texte ne

donne pas

la dfinition de la

le le


l'expression prnpeta, sur



vous tablissez

votre thorie, ne se

nulle part, ni dans le



DrstasatyasQtra. Qui pourrait admettre semblable expression dont


manque de

prcision ?


Qui, sur la foi de cette expression

admettrait que l'Upsaka a pris les cinq renoncements avant de les

prendre rituellement ?

Si l'expression

ekadesakrin dsigne un
pose dans


qui viole la

discipline, la question
tifie, ni


(p. 73, n. 2) n'est

pas jus-

non plus

la rponse.



quel est celui qui, connaissant

la discipline


sachant qu'elle comporte cinq membres,

sera incapable d'expliquer

Celui qui ne viole pas une rgle observe

une rgle

et le reste


contraire, quelqu'un qui ne connat pas l'tendue de la disci-

d'Upasaka [15

b], visant les

personnes capables d'observer une,


toutes les rgles (tannitraiksksami prati), pourra


poser la question



pour qu'on


un Upasaka d'une
les rgles ? .



pour qu'on


un Upasaka de toutes

Le Vaibhasika

Si on tait

Upasaka sans possder



discipline d'Upasaka,

on pourrait aussi bien

Bhiksu ou Srma-

nera avec une discipline incomplte.



connaissons-nous l'tendue,


nombre des

membres des disciplines d'Upasaka, de Sramanera, de Bhiksu ? Evidemment par l'enseignement du Matre. Or le Matre parle d'Upasakas
pas la discipline dans son entiret





peut s'expliquer

pmHe6%o 'petam, prnair

apetant, prnla

tiptdibhyo 'petam. Cette dernire version exempt du meurtre, etc. justifie doctrine Vaibhasika. Dire Sache que je suis un Upasaka exempt de meurtre c'est s'engager l'abstention du meurtre.




31 d-32.
discipline incomplte.

parle pas de Bhiksus on de

Sramaneras de

Le Vaibhasika du Kasmir n'admet pas

cette opinion.




les disciplines

sont faibles,

d'aprs la pense'.

faiblesse, la mdiocrit, la force des huit disciplines,

dpend de

la faiblesse, de la mdiocrit, de la force de la pense par laquelle


a prises (samdna) [16



en est ainsi, la discipline

d'un Prlhag-

de Pratimoka d'un Arhat pourrait tre

faible, et celle

jana pourrait tre


Si on prend seulement la discipline

refuge, devient-on

(samvara) sans prendre






cas d'ignorance de celui qui donne et de celui qui

prend (najanyatrj nndt).


quoi prend refuge l'homme qui prend refuge dans




Dharma, dans



32. Celui qui prend

d'Asaika qui font
qui font le

le triple

refuge prend refuge dans les




Bouddha, dans


de deux espces



Nirvana \
font pas partie de la discipline, Angutlara,


khuddnukhuddakas ne



chun nu la sogs yid ji bzhin =: [mrdvdayo mauo yath II] buddha[satftgha]karn dharmn asaiksn ubhayms ca sait


natn caiti saranam yo yti saranatrayam

Voir dans l'Introduction


traduction du

commentaire de Samghabhadra,



et suivants.

Vibhasft, 34,

Quelques-uns disent que, prendre refuge dans




prendre refuge dans

mre, est
c'est les

corps constitu par la tte, la nuque,

le ventre, le dos, les

mains, les pieds du Tathftgala.

On explique donc que ce corps, n du pre et de la dharmas impurs (ssrava), n'est donc pas le lieu du refuge le refuge, dharmas d'Asaiksa du Bouddha qui font la Bodhi, c'est le dharmakya.

Quelques-uns disent que prendre refuge dans

trois vrits [douleur, origine,
dfinis, etc.




prendre refuge dans


ou dans

dharmas bons,

mauvais, non-

ou dans

les rgles

imposes aux Bhiksus

ne sont donc pas


faut faire ceci, ne pas

faire cela


explique donc que tous ces


la fin

sont conditionns (saffis:

kfta), impurs (sCisrava)



le refuge, c'est



la vrit


la destruction


de lu

soif, le


Quelques-uns disent que prendre refuge dans



prendre refuge


xiv, fol.

15 b-16




Bouddha prend refuge dans dharmas d'Arhat qui font un Bouddha (huddhakraka), dharmas causes de la dsignation Bouddha , c'est--dire les
Celui qui prend refuge dans le

dharmas en
personne est

raison desquels,


cause capitale, une certaine


nomme Bouddha

ou bien


par l'acquiest

sition desquels

une certaine personne, comprenant toutes choses,


nomme Bouddha, (^es dharmas dajhna et la samyagdrsti (vi. 50,

tent (parivra) ces

ksayajnna, Vanutp-

67) avec les

les cinq

qui escor-





purs l

Quant au corps matriel (rpakya)

ne prend pas refuge dans
fait, le

du Bouddha,


n'a pas subi

de modification par l'acquisition de la qualit de Bouddha.


Donc on

corps matriel du




corps matriel du Bodhisattva.


Prend-on refuge dans tous

Bouddhas ou dans un Bouddha

Bouddhas ont tous

D'aprs la nature des choses, dfaut d'une dclaration explicite

(kanthokti), dans tous les Bouddhas. Car les



chemin, chemin naturel (lankika)

surnaturel (lokottara)


34) \ [16 b]




des Pravrajitas des quatre castes


sing tch'u ki).


explique donc que les attitudes (Irypatha), etc. (wi

hng sing) de ce Sam-

gha sont impures (ssrava) : le refuge, c'est les clharmas de Saiksa et d'Asaiksa qui font le Samgha. 1. yesm pradhnyena sa tmabhvo bttddha ity itcyate. La dsignation Bouddha vise d'autres dharmas, d'autres gunas, mais non pas principalement (apradhnyena). 2. C'est le dharmakya, vii. 34 Muson, 1913, p. 266. 3. Hiuan-tsang rpdikya. Voir vii. 31. 4. Vykhya latikikamrgasya piinyajnnasambhralaksanasya lokottarasya ca ksayajnndilaksanasyvilaksanatvt tuyatvt. Vibhas, 34, 11. Si on prend refuge dans un Bouddha, le refuge sera partiel si on prend refuge dans tous les Bouddhas, pourquoi dit-on Je prends refuge dans le Bouddha , et non pas dans tous les Bouddhas ?.. Prendre refuge dans le Bouddha, c'est prendre refuge dans tous les Bouddhas dont le nombre dpasse celui des sables du Gange .... Le mot Bouddha , comprend tous les Bouddhas, parce qu'ils sont de mme espce. Prendre refuge dans le Samgha, est-ce prendre refuge dans un disciple du Bouddha ou dans tous ?



IV, 32.

Celui qui prend refuge dans le Sarngha prend refuge dans les




aaiksa, de non-Arhat


d'Arhat, qui font


SaiTigha, c'est--dire les


par l'acquisition desquels

les huit

(ryapudgala) deviennent un samgha (samghihhavanti),


deviennent unanimes (samagrarpa) ne pouvant tre diviss (ahhe-

dyatvt) en ce qui regarde


Prend-on refuge dans tous

Samghas ou dans un Samgha ?


D'aprs la nature des choses, dans tous

les saints est toujours le

car le chemin suivi par



Sans doute,

Bouddha a



deux marchands
dans l'avenir

Prenez aussi refuge dans


qui existera

\ mais le Matre s'exprime ainsi


pour exalter

du joyau de Samgha qui sera hientt

aux marchands ^
refuge dans le

Celui qui prend refuge dans le


Dharma prend

Nirvana, c'est--dire dans







prend refuge dans tout Nirvana, car

Nirvana a pour unique

sens du mot

caractre la cessation des passions et de la souffrance de soi et d'autrui

(ntyekalaksanatvt) (Voir



c le


dans dharme avetyaprasda).



Si le


n'est pas autre chose

le fait






ou d'Arhat, comment

de blesser

Bouddha avec une mauvaise


pense peut-il constituer un pch mortel (nantarya,

96) ?

Les Vaibhasikas (Yibhaa, 34,




Lorsqu'on blesse

lments matriels (rpa) qui sont

soutien de ces


(srayavipdant)j ces dharmas eux-mmes souffrent


1. Vibhfisfi 34, 12, cite le mme texte tatra bhagavms trapusabhalikan vanijv mantrayate sma / ete ytivm huddhain aranam gacchatam / dharmam ca j yo 'sait bhavisyaty angate 'dhvani satngho nnia tam api aranam gacchatam. (Extrait de riniroductiou au SanighaLliedavastu dont un fragment, retrouv au Turkestan (Miran), a t publi JRAS. 1913, p. 850). Comparer Mahfivagga, i. 4 Mahavaslu, iii, 304 Lalita, p. 386 Dulva, iv. 54 b. Variantes nombreuses.
: ;


tatpratyaksabhvinah satfigharatnasyodbhvanrtham



gharatnafft tayos trapusabhallikayor dharmacakrapravartannantarum

pratyaksibhavi^yati tasya gutmtah prakaurtham.


xiv, fol.

16 b-17


est seule-

Sastra (Yibhasa, 34,




pas que


ment dharmas dits asaiksa \ Il dit que le Bouddha est qui font un Bouddha ^ c'est--dire que les dharmas soit


naturels, soit

surnaturels (aukika, lokottara), qui sont l'objet de la dsignation




Bouddha. Donc Vraya

l'organisme, le

support constitu par les cinq




Sastra ne

nie pas qu'il fasse partie de la qualit de



l'objection tire de la blessure du

Bouddha (huddhatvpraBouddha est sans


valeur. [17 a]

en tait autrement,
si le




que dharmas




Samgha (c'est--dire les saints, Saiksas et dharmas dits saiksa et asaiksa, une personne

dont la

pense est actuellement

tre ni



(laukikaclttastha) ne pourrait




en vertu des




faudrait dire que le



la moralit, la discipline

du Bhiksu.
dit le




corps (sraya)

est, lui aussi,




qui font le Bouddha, pourquoi le Sastra


qui prend refuge en Bouddha,

prend refuge dans




asaiksa qui font

le Bouddha Nous rpondrons de mme,


celui qui



Bhiksus, ce qu'il

honore, c'est la moralit qui

fait le


D'aprs une autre opinion, celui qui prend refuge dans


prend refuge dans

les dix-huit



28) du


sont, de leur nature, les prises de refuge ?


Elles sont vijnapti vocale



Quel est


sens de




(sarana) ?



refuges sont ainsi


parce que, en s'y rfugiant,

on obtient

la dlivrance dfinitive de toute souffrance.

2. 3.

aaiks dharm eva buddhah. hxiddhakrakh. yo buddham saranam gacchaty asaiksn asau buddhakrakn dharyacchati.

mn saranam

Plusieurs opinions, Vibhs, 34,

le plus



la crainte, les




Tourments par


souvent', prennent refuge dans les montagnes, les forts, les


bosquets, les arbres sacrs


n'est pas l le


refuge, le refuge


ce n'est pas en s'y rfugiant qu'on est dlivr de toute

souffrance. Mais xelui qui prend refuge dans le



b], le




lorsqu'il voit

par la prajyi les quatre vrits,

douleur, origine de la douleur, passage au-del de la douleur, saint

chemin huit membres qui mne au calme Nirvana,

bon refuge,
c'est l le refuge


c'est l le

suprme en

s'y rfugiant,

est dlivr

de toute souffrance

C'est pourquoi les prises de refuge sont la porte de la prise de

toutes les disciplines.

Les autres disciplines comportent



renoncement l'incontinence

la discipline

d'Upasaka comporte seulement

iv. 74).

renoncement l'amour



quoi ?

nir ^




parce qu'il est trs blm, parce qu'on

s'en abstient aisment, parce que les

ryas ont obtenu de s'en abste-


iUicite est trs

blm dans


monde parce

qu'il est la

corruption de la


d'autrui, parce qu'il est rtribu

dans une

mauvaise destine (apCiyikatvl).

2. Il est facile


matres de maison


de s'en abstenir [18 a]


leur est difficile de s'abstenir de l'incontinence



matres de

maison ne quittent pas

des choses

monde parce


ne sont pas capables


(duhkara). (Divya, 303)










Vibhfistt, 34,


a bahufft ve

saranam yanti



bahavah aranani

ynti, que

Paramnrtlia traduit.

L'Udanavarga tibtain porte phal cher.



= caiiyakalpitavrksa.

Ud&navarga et les versions chinoises principal da / sla phyir mi byed thob phyir ro [mithyOcaro 'tisvadyasukhakaranalabhatah /J

khema, Divya


\n tu sniad phyir


xiv, fol. 17




l'endroit de l'amour
c'est--dire, ils ont

illicite, les

ryas possdent Vakarana;


obtenu de s'en abstenir dfinitivement


dans l'existence venir,

seront incapables de violer


prcepte. Tel n'est pas le cas en ce qui concerne l'incontinence.


consquent, la discipline d'Upsaka comporte seulement



ment l'amour



est inadmissible



que des ryas,

dans une existence ultrieure, soient susceptibles de violer la discipline


ce qui

pourrait arriver








Par akaranasamvara,

faut comprendre




certaine d'une action]


qui se marie aprs avoir pris la discipline d'Upsaka

avait-il pris le

renoncement l'gard de




pouse ?

Oui, rpond le Vaibhsika


dans l'hypothse contraire, cet


aurait pris une discipline restreinte (prdeika,

alors cet





viole la discipline lorsqu'il se







ont accept la discipline, ainsi





pas accepte l'gard des personnes ^

dkriyniyamo hy akaranasamvarah. Vyakhyfi akriyym 1. Bhasya akarane niyama ekntat akriyniyamah / so 'karanasamvarah akaranalaksanah samvarah / na samclnikah samvara ity artJiah j sa ca SautrntikanayenvastJivisesa eva Vaibhsikanayena tu llngam avijnaptir



ci-dessLis p. 17, note^

des rfrences aux sources plies, setughtavirati


= samucchedavirati,

sampattavirati, samdnavirati

p. 48,

la distinction

du samdnaslla et du dharmatprtilambhikasla. L'Abhidhamma a beaucoup de points de contact avec l'Abliidlianna, mais la concordance n'est pas
Le Vaibhsika attribue l'rya






qui n'est pas simplep.

ment akarana, mais



certain rpa,

avijnapti, setu (voir

lui la srie



Sautrntika n'admet pas ['avijnapti

incapable de certains actes (voir


de l'rya est devenue



n. 2), les

semences de ces actes ayant t


Vakaranasamvara, Vavijnapti inbranlable que postule le Vain'est pas une chose en soi, est akriyym ekntat, l'abstention

certaine rsultant d'une transformation de la personne.


sdom pa


khas blans bzhin

thob kyi rgyud las

ma yin no. [samvaro


yathopagato labhyate na tu tnatah]




33 c-34.



ont accept la discipline, ainsi l'ont-ils acquise.



sont engags en disant

Je renonce tout

Je renonce l'amour

illicite ,


commerce avec

femme dendiie(agamya)


ne se sont pas engags en disant



personne \



commettrai pas l'incontinence. l'amour


[18 b] Par consquent, ayant renonc



non pas l'incontinence,

ne violent pas la

discipline en se mariant.

Parmi les pchs de parole, pourquoi le renoncement (tyga) au mensonge constitue-t-il un des points de la rgle (iksnga) de
rUpasaka, tandis que sont omis
de parole ?

renoncements aux autres pchs





parce que



est trs


monde, parce que


matres de maison s'en abstiennent


aisment, parce que les ryas ne sont pas capables de mentir

aussi pour une quatrime raison


34 a-b.
[Si le

Parce que, ayant viol n'importe quelle rgle,



mentirait K




ayant viol n'importe quelle

fait .

rgle, interrog,


Je ne


Par consquent



renoncer au mensonge, pensant



transgress, ainsi je confesserai.


atra samtne.



n'ont pas, l'gard de la srie de tous

les tres, dit

Je renonce l'incontinence



n'ont pas, l'gard

de cette srie (asntt samtnt), dit Je renonce .... 2. bslab pa thams cad hdas gyur na / brdzun du tha bar bgyur bahi phyir [sarvaiks atikrnto mrsvdl prasajyate sarvasikstikramane mrs-

les rgles.

Hiuan-tsang traduit

Le mensonge tant autoris, il transgresserait toutes Ayant transgress les rgles, au temps o il est interrog, si le

mensonge tait autoris, il dirait Je ne l'ai pas fait , et cause de cela beaucoup de transgressions des rgles. Aussi Bhagavat, dsirant qu'on garde les rgles, place le renoncement au mensonge dans toutes les disciplines, se demandant Comment l'aire que l'Up&saka^ s'il viole la rgle, le dclare lui-mme et

empche de nouvelles transgressions ? Comparer le Sotra Rahula sur le mensonge, Majjhima,





de Bha-


xxiii. 9,

6 b



xiv, fol.

18 a-19




renoncements aux pchs de dsobissance

ne sont-

pas compris dans la discipline d'Upasaka? [19 a]






la liqueur forte, qui est

un pch de ds-

obissance ^

Pourquoi l'Upasaka


renoncer ce seul pch de dsobis-

non pas aux autres ?

Pour que
les autres rgles soient



gardes l
les autres

Celui qui boit la liqueur forte

(madya) ne gardera pas

Les bhidharmikas soutiennent que la liqueur forte n'a pas


caractre d'un pch de nature.

Le pch de nature


commis que
arrive que,

par l'homme dont la pense est souille (klista)




de remde, on boive la liqueur forte dans la quantit o

n'est pas enivrante.


La pense

est souille si

on boit en sachant que

quantit est enivrante

la pense n'est pas souille lorsqu'on

boit en sachant



quantit n'est pas enivrante (aniadanlya-


l'avis des

Tel n'est pas

Vinayadharas. D'aprs eux, la Hqueur

forte est

pch de nature.


Upali qui lui demandait



soigner les mala-

des ?

de nature

Bhagavat a rpondu [19 b] Except, Upali, par le pch *. Et, d'autre part, Bhagavat n'a pas permis la liqueur

(madyapna) aux Sakyas malades

Ceux qui me reconnais-

sent pour leur matre ne doivent pas boire de liqueur forte,



pratiksepanasvadya, pratisedlia^, prajnapti'^, par opposition au pch Pch de celui qui fait un acte dfendu, parce qu'il ne respecte pas la loi (ssHna) de Bhagavat (iv. 122 c). 2. bcad pahi kha na ma tho ba / myos hgyur las praUJcsepanasvady[n
de nature, prakrtisvadya.


gzhan bsrun phyir ro

katham bhadanta



prakrtisvadyam Uple sthpayitv.


Sur jalogi, Conciles bouddhiques, Muson, 1905,

p. 508.


Lvi, JAs. 1912,







avec la pointe d'un brin de pturin

Puisque Bhagavat n'interdit




pch de nature en cas de maladie (UpalisQtra)



ne permet pas la liqueur




la liqueur forte est

pch de nature.

Les ryas,


dans l'existence suivante, ne boivent pas la

liqueur forte, pas plus qu'ils ne commettent les autres pchs de

nature, meurtre, etc.
3. L'Ecriture,




et ailleurs,

range la liqueur



les mfaits

du corps (kyadiiscarita)

Les bhidharmikas rpondent



gnral, le pch de dsobissance est permis


aux malades,





rponse Upali. Toutefois la liqueur forte


quoique seulement pch de dsobissance,

et cela

elle est inter-

aux malades,

en vue d'empcher


consquences fcheu'%

ses de la liqueur forte


parce que la







Le texte est cit dans

stram uddiadbhih kiigrenpi madyant na ptavyam. Dans Divya, 191, on a mfn bho bhiksavah stram uddisyadbhir madyam apeyam adeyam antatah kugrenpi, que Speyer corrige uddiya
la V^ykhyfi


[bhava]dbhr ... Huber, Sources du Divya, BEFEO. 1906, 31, approuve cette coiTection, et montre la relation du Divya avec le 79' pryaciUika. Bhagavat n'interdit pas seulement la liqueur forte en quantit enivrante (madanya). L'Upfisaka malade qui consent manger de la viande de chien mais non pas boire du vin, et qui cite le Sotra de la maison , Stralamkfira, Huber, 434. Chavannes, Cinq cents contes, iii. 14. Quatre upakkilesas : surmerayapna, methuna, j&tarpa, micchjlva

53, AtthasSlin, 380)

p. 81.

Voir ci-dessus,

Si on leur met dans la bouche






le lait entre,
3. 4.

non pas

l'alcool, Sumaiigalavilasin, p. 305.


(Csoma), xxvi, 425.

Quatre kyaducaritas, meurtre,



surmaireyapramddes kyadticaritas,



manque dans



Mahfivyutpatti, 91, etc.

Hiuan*tsang traduit

parce que, en raison de la transgression de celte



on commettrait


pch de nature


Vyftkhyfi dit

Bue une


la liqueur forte est mortelle

{vyasanlbhavet), car Bhagavat a

sthndni pratisevamdnasya ndsti U'ptir va aatftt va paryptir v> / madyam abrahmacaryam stynamiddhatn ceti. Mme enseignement dans Anguttara, 261 (soppassa bhikkhave patisevanya nutthi titti, surd,merayapdnassa methunadhammasampattiy ...).


xiv, fol.

19 b-20



quantit enivrante n'est pas dtermine

2. Si les

ryas s'abstiennent certainement (anadhycarana) de

pas qu'elle soit pch de nature, mais parce

la liqueur forte, ce n'est

qu'ils sont

munis de

la force-de-pudeur


n'en boivent pas en




parce que la liqueur forte


fait dfaillir la



n'en boivent


pas une goutte, c'est parce

la quantit enivrante n'est

pas dtermine,

L'Ecriture considre la liqueur forte

comme pour le poison. comme un mfait corporel


(diicarita), parce que la liqueur forte est

cause de non-vigilance


(pranidasthna). En



rgle (ikspada) relative



liqueur forte comporte cette expression

les autres




qu'est la liqueur forte,




renonce au



n'est pas le cas



Je renonce au


qu'est le meurtre

et cela,

parce que les autres pchs sont pchs de nature. [20 a]


Le Stra

qu'on renat en enfer par la pratique de la Hqueur

de la liqueur

En consquence (prasangena)


continuelle d'une srie de mauvaises penses

(abhksnam aktialaactivit (vrtti-


ou bien projection (ksepa, vedha) d'un


nouveau rtribuable en

ou bien entre en

lbha), au


de la mort, d'un acte ancien. de







La sur

est la boisson

fermente (sava) de




La mme quantit de




ou non-madaniya suivant


Les cinq balas des Saiksas

sraddh, vrya,

apatrpya, prajfi.

L'ordre diffre





yadi hrmattvt tadaiiadhycaranam ajntam udakdivat


kasmn na pihanti.
Nandikastra dit 4. Le surniaireyamadyapramdasthdnensevitena Comparer bhdvitena bahulkrteua kyasya hhedn narakespapadyate.




surmerayapramdatthnnuyogo apyaniko







195, 235, Anguttara,

212, Samyutta,



est la boisson





fermente d'ingrdients (dravya

jus de la canne


un certain moment,

la liqueur n'est

pas encore enivrante








pourquoi est ajout




La noix

d'arec, le paspale




enivrent, sont

nomms sur




liqueur forte n'est que pch de dsobissance.

La formule



mots pramcidasthna pour

faire entendre qu'on doit

renoncer la liqueur forte parce qu'elle est cause de toutes les dfaillances de la

mmoire (sarvapramdnm spadatvt). [xv]


trois disciplines ont-elles


objet ?


Notes de Palmyr Cordier.



= annsava (zas las sbyar bai btiin ba).


Vyakhya annsava


tandulakrtah. Bire ou alcool de

C'est ce que dit

slipislakrtant madyani. C'est aussi ce que confirme

autocommentaire de Vagbhata, o surd crales, bire de froment, alcool de grains, en conformit avec la Mahavyutpalti, chan). 230, 36 o sur == hhrui chan (Amarakosa, 2, 10, 39, sur

Hemadri ad Astangahrdaya 1, 5, 67 le Vaidryakabhasya ou hbru chat gro chat, bire de


sur arack ou rack (eau de vie de riz, mot persan sanscritis sous la forme arka qui manque, dans ce sens, aux dictionnaires non mdicaux). b) maireya dravysava (rdzas las sbyar bai btun bo) tafia. Vyakhya dravysava itiksurasdikrtah. D'aprs Arunadatta, comm. de rAstangahfdaya, 1, 7, 40, maireya kharjalcool de dattes. Le Vaidryakabhasya explique bu ram chan rsava rhum ou tafia tandis que Candranandana (Padarthacandrika) et Ilemadri disent alcool de grains. Mahavyutpatti, 230, 38, sbyar bai chan ; dhanysava Amarakosa, 2, 10, 42, fait de maireya le synonyme de sava (me tog chan), liqueur de fleurs (de Lythrum fruticosum, etc.) et de idhu (bur chan) rhum, tafia. c) pgaphalakodravdayo 'pi Vyakhya diabdena nispvdayo 'pi grhyante [MS. nesyava^] POgaphala, noix d'arec (areca calhecu, palmiers). Synonymes sanscrits, pgiphala kramuka pohala guvka. Mahavyutpatti, 231, 34, pgaphala kramuka, Astangahrdaya, 4, 12, 25 et "nighanlu, 121. gla gor zho a Ama-

rakosa, 3, Vs, 21 go yu.


tsi isi,

Astanganighan^u, 198; Sarat Candra,

tsi tse tsi tsi


vyutpatti, 228, 14 ci thse,

Nipava, Lablab



une sorte de


Manque dans




du moins dans

sens botanique^ l'Amarakosa.


xiv, fol.

20 a-xv,

fol. 1 b.





acquiert la discipline de

Kamadhtu relativement

tous les actes, relativement deux sortes d'tres et deux sortes

d'actes, relativement

des choses du prsent \

est la discipline



du Kamadhtu

du Prtimoksa.

Cette discipline est relative tous les actes, acte prparatoire, acte



acte conscutif

(iv. 68).

Cette discipline est relative

vivants, par exemple

aux tres-vivants


aux non-tres-


et l'arbre.

Cette discipline est relative

aux pchs de nature


aux pchs de

dsobissance, les uns et les autres pouvant se rapporter aux tres-

vivants (meurtre

toucher la main d'une


lorsqu'on est moine)


ou aux non-tres-vivants (couper


les feuilles

d'un arbre

accepter de

lorsqu'on est moine). [1 b]

Cette discipline est relative aux choses


du prsent, car

skandhas, yatanas



choses du pass

du futur ne sont


des tres-vivants, ni des non-tres-vivants .



acquiert la discipline de


et la discipline


relativement aux actes proprement dits et aux choses des trois po-


acquiert ces deux disciplines relativement aux actes proprement

et conscutifs,

non pas relativement aux actes prparatoires


pas relativement aux pchs de dsobissance

relativement aux

skandhas, yatanas


dhtus du pass, du prsent



y a donc des skandhas, yatanas et dhtus relativement auxhdod glogs thams cad gnis ka dan





las Ihob

par hgyur =: de

\kamaptaJi] sarvobhayebhyo [vartantnebhya pyate]



le prparatif, l'acte


dit et le conscutif

la prise

de discipline de Prtimoksa


c-d) ont

respectivement pour but de



le prparatif, l'acte


dit et le conscutif

du meurtre,



prparatif du Prtimoksa considre le prparatif du meurtre, dont

niste, et lui dit

est l'antago!

en quelque sorte

Je te



ne nais pas

Point important de la thorie de l'existence du pass et du futur,



25 (voir



d, trad. p. 62).

niatilebhyah sarvaklebhyo






35 c-36


quels on acquiert la discipline de Pratimoksa et non pas les deux


Quatre cas


Actes prparatoires


conscutifs, pchs

de dsobissance, prsents

viss par le Pratimoka. 2.



du pass

du futur

viss par les deux

dernires disciplines. 3. Chemins-de-l'acte proprement dits du prsent

viss par les trois disciplines. 4. Actes prparatoires et conscutifs


du pass



l'gard desquels on ne peut prendre aucune

des trois disciplines.



n'est pas correct de dire qu'on prend la discipline


relativement au chemin-de-l'acte prsent


car, lorsqu'on

prend la

aucun mauvais chemin-de-l'acte


n'est prsent relativement

auquel on puisse prendre la discipline.

discipline relativement

faut dire


prend la

aux chemins-de-l'acte dont




est prsent

Je peux m'abstenir d'un acte futur relatif une


personne ou une chose existant actuellement je ne peux m'abstenir

d'un acte pass ou prsent. [2 a]

Acquiert-on discipline

et indiscipline

l'gard de tous

les tres,

relativement tous les membres, en raison de toutes les causes ?




acquiert la discipline l'gard de tous les tres

en ce

qui regarde les



et les causes,


faut distinguer



acquiert la discipline l'gard de tous les tres, non pas

l'gard de quelques-uns.


discipline de


est acquise relativement




abstention des dix chemins-de-l'acte. Les autres disciplines

sont acquises relativement quatre

membres abstention du meurtre,




de l'amour dfendu, du mensonge, car, par membres de la



faut entendre l'abstention des chemins-de-l'acte.

les trois

par cause de l'acquisition de la discipline, on entend

racines-de-bien (non-dsir, non-haine, non-aveuglement), la discipline

est acquise en raison de toutes les causes. Si

on entend par cause

ha yod

1. sdoin pa sems cnn thams cad las / yan lag rgyii sarvasattvebhyo bhedas tv asty angakdrane /]

la Ihye

= [samvarah

Hiuan-tsang, xv,
cause d'origine, samutthpaka

fol. 1






pense par laquelle on

acquiert la discipline, cette cause est considre





pense moyenne, pense


discipline est acquise en

raison d'une de ces trois penses.


se plaant ce dernier point de vue, quatre alternatives peuvent


tre distingues (Vibhasa, 117,

1. Il

y a un


rsidant dans la disciiiline (samvarasthyin)

les tres,

[2 b], disciplin

l'gard de tous

mais non pas disciplin

ou moyenne, ou

relativement tous les membres, non pas disciplin en raison de

toutes les causes

celui qui, par

une pense


a acquis la discipline d'Upsaka, d'Upavsastha ou de SramaIl

nera. 2.

y a un


rsidant dans la discipline, disciplin

l'gard de tous les tres et relativement tous les

membres, mais
a acquis

non pas

disciplin en raison de toutes les causes

celui qui

la discipline de
3. Il

Bhiksu par une pense


ou moyenne, ou

y a un


rsidant dans la discipline, disciplin l'gard

de tous les tres, relativement tous les membres, en raison de toutes



celui qui a acquis


chacune des

trois disciplines


saka, de


de Bhiksu par une pense respectivement


forte. 4. Il


y a un l'gard de tous


rsidant dans la disci-

les tres, disciplin

en raison de

toutes les causes, mais

non pas


relativement tous les


celui qui
et de

a acquis chacune des

trois disciplines



Srmanera par une pense respectivement


Personne ne rside dans la discipline qui ne

de tous les tres
les tres

soit disciplin



par une bonne pense ayant pour objet tous

la discipline.

que l'on acquiert


qui fait restriction

n'est pas

compltement dbarrass de


du pch.
la quintuple


discipline de

Prtimoksa comporte l'absence de

[3 a]




quant aux tres


Je renonce au pch
la discipline

l'gard de certains tres

quant aux membres de

Je renonce certains actes



quant au


Je renonce


pch dans certain lieu


quant au temps






renonce au pch pour un mois


quant aux circonstances (sa.


Je renonce au pch sauf en cas de querelle


qui prend semblable engagement n'acquiert pas la discipline



une bonne action (sucarlta) analogue l'acquisition de la discipline



Comment peut-on acqurir la discipline l'gard de tous les ? Comment peut-on acqurir la discipline l'gard des tres qui
la discipline

sont hors de porte (aakya), l'gard des tres qu'on ne peut tuer ?

Parce que, croyons-nous, on acquiert

de ne tuer aucun

par l'intention


Le Vaibhasika (Yibhsa, 120, deuximes matres) donne une

cation diffrente. Si la discipline tait acquise l'gard seulement

des tres qui sont porte, la discipline serait susceptible d'augmentation et de diminution (caya, ax)acaya, vrdhi,


car des

hommes, qui sont

hors de porte

porte, renaissent


dieux, lesquels sont


La discipline des dieux devenus hommes, perdue



donc acquise

l'gard des


devenus dieux, sans



aucune cause


de l'acquisition, soit

de la perte de la discipline.
Cet argument ne nous touche pas

la transmigration


des tres porte et hors de porte n'entrane pas l'augmentation ou

la diminution de la discipline.


la discipline qu'on

prend l'gard

des herbes ni ne s'accrot ni ne diminue lorsque naissent les herbes

nouvelles, lorsque schent les herbes anciennes. [3 b]

Le Vaibhasika

nie la valeur de cette comparaison. Les herbes exis-

tent aprs avoir t inexistantes, n'existent plus aprs avoir exist.

Les tres vivants au contraire continuent

tantt dieux. Les

d'exister, tantt


hommes, devenant

dieux, passent hors de porte

les herbes sont ananties.

Mais, lorsque les tres vivants entrent dans

tent plus





(yad parinirvrtd na santy

eva), tout


les herbes.

1. Comparer YogasQtra, ii. 31. On voit, Divya, p. 10, que le lueur de moutons, prenant rengagement de moralit (lasamdna) pour la nuit, obtient de grands avantages enfer diurne, paradis nocturne.

la discipline acquise



3 a-4



l'gard des tres vivants est sujette




du Yaibhasika

est caduque.

Si on


cas o la discipline de Prtimoksa serait acquise

l'gard de tous les tres, la discipline des


postrieurs, leur

moralit (la), serait, par comparaison avec celle

antrieurs, rduite



car elle n'est pas relative aux tres entrs dans

et leurs disciples

Nirvana, Bouddhas antrieurs


nous rpliqueles tres


si les

tous les

Bouddhas ont


l'gard de tous

Bouddhas antrieurs

existaient encore, les

Bouddhas postrieurs

auraient discipline leur gard.


c-d. L'indiscipline,

l'gard de tous, relativement tous



membres, non pas en raison de toutes

causes ^

acquiert l'indiscipline l'gard de tous les tres et relativement

les chemins-de-l'acte.


Personne n'est indisciplin avec une


indisciphne incomplte (vikala) [4


n'est pas

indisciplin en

raison de toutes les causes, l'indiscipline tant prise par une pense

ou moyenne, ou


Supposons qu'un

indisciplin ait pris


par une pense faible


commette un meurtre par une


pense forte

son indiscipline reste

d'un meurtre



est revtu d'une



Le terme


(samvarika) s'explique tymologiquel'in-


qui rside dans l'indiscipline (asamvara), qui possde



Sont indisciplins
les tueurs

les tueurs

de moutons (aurabhrika), les oiseleurs,


de porcs, les pcheurs, les chasseurs, les bandits,


reaux, les geliers, les cornacs, les gorgeurs de volaille, les vgurikas.


va de


(arthatah) que


rois, les

gens en place


juges (dandanetrka),

sont indisciplins.
la profession

Le tueur de moutons (aiirdblirika)


l'homme dont

sont entrs dans

Le tibtain porte relative aux tres anciens qui, tant devenus Bouddhas, le Nirvana . L'original prvabucldhaparinirvrtebhyah. 2. sdom pa min pa thams cad dan / y an lag kun las rgyus min no =t [asamvaras tu sarvebhyah sarvngai ca na kranaih]

est de tuer les





moutons (urahhra).


tymologie pour



des autres professionnels


On comprend que

la discipline,

prise dans

une intention de

bienveillance universelle, soit acquise l'gard de tous les tres. Mais

les tueurs

de moutons n'ont pas l'intention de maltraiter leurs parents,

leurs serviteurs [4 b]




ne voudraient pas les tuer,



au prix de leur propre

on dire

Comment, [demande

Sautrantika], peutles tres ? (Yibha-

qu'ils sont indisciplins

l'gard de tous

a, 117,5)

Le Vaibhaika.


qu'ils ont intention

de meurtre l'gard

de leurs parents devenus moutons par la transmigration ^


ne tuent pas leurs parents devenus moutons en sachant

D'ailleurs, si leurs parents obtiennent la

que ce sont leurs parents

qualit d'rya, ces parents ne renatront pas en qualit de


ou de btes



boucher n'est pas indisciplin leur gard.


Enfin, l'argument se retourne contre vous

si le

boucher est indisci-

plin l'gard de la personne actuelle de ses parents parce qu'il tuera

ses parents devenus

moutons, on dira aussi bien

qu'il n'est


indiscipHn l'gard des moutons puisqu'il n'est pas dispos tuer


moutons qui renatront comme hommes, comme ses propres


Le Vaibhaika.

Celui qui a

l'intention de tuer ses parents deve-

nus moutons est certainement indisciplin leur gard.


Tueur de moutons

tueur est traduit par gsod.



ngabandhak hastipakh

glan po che hchor ba


ou hthser ba,

qui chasse avec un lphant, qui tourmente un lphant


gaddhabdkin de CuUa 32). gorgeur de volaille , kukkufn ghnantiti kaukkuHkh




parer Mahavyutpatti, 186,

khyi hchor ba ou hthser ba

qui chasse avec


des chiens, qui tourmente les chiens

par confusion de




qui chasse au (rgyas hchor ba moyen d'un filet) et Amarakosa, 2, 10, 27 (vgur ri dvags hdzin mrgabandhinl ; vgurika bya rgya pa), signifie brajlika bya brfki ba connier, trappeur . Mais la Vyakhya fait de la vgur un animal pamp (?) nma prnijtir vgurkhy ttfi ghnantiti vgurikh) et notre version tibtaine transcrit (ba gu ri hchor ba). Comparer les listes d'Anguttara i. 251, ii. 207, iii. 303, 383.

vgurika, d'aprs Mahavyutpatti,

186, 92


Chavannes, Cinq cents contes

et apologues,


p. 117,

n 415 (Nanjio, 1329).

Hiuan-tsang, xv,


4 a-5



Mais, dirons-nous, celui qui n'a pas l'intention de tuer des moutons

devenus des fds n'est certainement pas indisciplin leur gard.

Autre point


boucher qui ne vole pas, qui n'est pas adultre, qui





peut-il tre indisciplin relativement


pchs ?

Le Yaibhsika.
Mais que


que son intention



corrompue (vipan-

na). Le muet peut s'exprimer par

dire de

l'homme qui a accept deux ou


membres de
ni par-

la moralit ?



Vaibhsikas, l'indiscipline n'est jamais


(vikala), c'est--dire relative seulement certains



(prdeika), c'est--dire comportant des restrictions (temps,

lieu, etc.)

dans la pratique d'un certain pch.


les Sautrantikas,

l'exception de la discipline du Prtimoksa,

la discipline et l'indiscipline

peuvent tre incompltes

et partielles.

Gela dpend de la manire dont on prend la discipline ou







telle partie

de l'immoralit,

telle partie

de la moralit.



l'indiscipline ?


[5 b]


avijnaptis qui ne sont ni discipHne, ni indiscipline ?




acquiert l'indiscipline par l'action ou par l'acceptation K

du meurtre


dans une famille



acquirent l'indiscipline lorsqu'ils accomplissent les actes prparatoires






ns dans d'autres familles,


lorsqu'ils adoptent tel

genre de vie


nous vivrons de

ce mtier




acquiert les autres avijnaptis en raison du champ, de

l'engagement, d'une action srieusement entreprise l

1. sdom pa min pa bya ba ham / khas len pa las thob par hgyur Paramartha On obtient l'indiscipline par deux action personnelle, accep: :


Ihag mahi rnam rig min




dan gus par byed pas thob


[esvijnaptilbhas tu] ksetrdndarehant








37 c-39.

Certaines personnes sont des


champs (ksetra) de



qu'en leur offrant un jardin,

on produit avijnapti. Voir



112) la doctrine des bonnes uvres matrielles (aupadhi-



produit avijnapti en s'obligeant par des


par exemple

Je ne mangerai pas que je n'aie rendu

vux (pratijn), hommage au

, etc.


Le jour du jene, pendant une quinzaine, pendant un

mois, pendant une anne, je ferai des

aumnes de nourriture

L'action entreprise avec srieux (dara), avec foi violente, avec


passion violente



produit avijnapti.

38. La

se perd la discipHne ? [6 a]

discipline de

Pratimoksa se perd par l'abjuration, par


mort, par hermaphroditisme, par la rupture des racines, par l'arrive

son terme de la nuit




nomme dama

la discipline de

Pratimoksa parce qu'elle


les six organes.

En mettant
discipline de

part la discipline du jeneur (upavsastha), la


Pratimoksa se perd


par abjuration, renoncement



la rgle (ikspratykliyna)

en prsence d'une

personne capable de comprendre


par la mort ou abandon du

fminin suivant




par l'apparition de l'organe masculin ou

(iv. 79).




par la rupture des racines de bien




du jeneur se perd par ces quatre causes


en outre,

lorsque la nuit prend

L'abjuration constitue une vijnapti en contradiction avec l'enga-

gement (samdnaviruddhaj




l'hermaphroditisme com-

portent l'abandon (tyga) et le bouleversement (vikopana) de la


D'aprs les versions chinoises. L'original porte, semble-t-il

les aliments d'un jour, d'un mois, d'une

Je donnerai


ijuinzaine (tithbhakta,

XyhkUyi.diabdeua mandalakarandi grhyate (voir ci-dessous p. 102, n. 2). pratinwksadamatygah siksniksepanc cynteh / ubhayavyanjanotpatter mlacchedn niatyayat jj 3. Comparer MaliRvagga ii. 36. 1, etc. ParSjika, i. 8,


Hhian-fsang, xv,
personnalit (raya) par laquelle


5 b-6


t pris (voir


Pratimoksa a

27 a) [6 b]

la rupture des racines est la rupture du fondement

mme (nidna)
cre, projete,
la nuit

de la discipline. Enfin la discipline du jeneur a t

et nuit

pour un jour

elle arrive

son terme lorsque




Par un patanya, disent quelques-uns


D'aprs une autre cole, les Sautrantikas, la discipline de Bhiksu


de Religieux


se perd en outre par n'importe lequel des

quatre patanyas ou pchs entranant chute l




la disparition de la


Loi, disent d'autres matres \

D'aprs les Dharmaguptas, la disciphne de Pratimoksa se perd

quand disparat


Bonne Loi


n'y a plus de rgles (siks), de


d'actes ecclsiastiques




Le Ksmlrien



pcheur possde moralit



comme un homme

peut avoir des richesses


des dettes ^

Les Vaibhsikas du KasmTr disent Le moine coupable (panna)

d'un pch grave (mauli patti), c'est--dire d'un patanlya, ne perd

pas la discipline de Bhiksu. Que, en dtruisant une partie de la discipline (ekadeaksohha), on perde la discipline toute entire, cela n'est

pas admissible l



commet un

autre pch que le pata-


cig Ituii bar l.igyur bas


Mahvyutpatti, 266,

smra = patanyena cety [eke] patanty aneneti patanlyam.

Ce sont


quatre prjikas

incontinence, vol d'une certaine importance (yathoktapra-

mnam adattdnam), meurtre d'un bomme (mamisyavadha), mensonge relatit

aux pouvoirs surnaturels (uttarimanusyadharmamrsvda) (Finot, JAs. 1913, ii. 476). Voir dans Wieger, Bouddbisme chinois, i. p. 215 (1910), des gloses instructives. Sur le mot prjika, S. Lvi, JAs. 1912^ ii. 505, VVogibara,


p. 36.

gzhan dag dam chos nub pa las [saddharmahnito 'pare /] 4. dhanrnavat tu ksmrair pannasyesyate [dvayam] // 5. La Vykby signale un argument tir de l'Ecriture. Il est dit dans le Vinaya Le moine immoral (duhla) qui donne des avis (anussti) une nonne commet (padyate) un pcb samghvaesa . Or par immoral nous devons entendre coupable d'un prjika car le texte oppose au moine immoral le moine









nya, n'est pas immoral (duhila). Celui qui














qui a des richesses


et des dettes

mais lorsque ce pcheur a confess son pch,



plus immoral,


seulement moral

l'homme qui a pay ses

n'est pas Religieux

Mais Bhagavat a


Il n'est

pas Bhiku,


qualit de


n'appartient plus aux





choit de la


sa qualit de religieux est tue, tomhe, crase,

chue, anantie

Le Vaibhasika.


ce texte,



par Bhiku, comprendre

pcheur, tant incapable


Bhiksu (paramrthahhiksu)

[7 a]


de voir les Vrits, n'est pas un vrai Bhiksu.

Exgse inadmissible


sollicitez la dclaration

que Bhagavat

en sens clair



en outre, vous induisez


mes passionns Le Vaibhasika.

la pratique de l'immoralit.


tablissez-vous que cette dclaration

est de sens clair et doit tre prise



lettre ?

Bhagavat explique lui-mme Il y a quatre Bhiksus. Le samjnhhiksu, Bhiksu de nom, l'homme qu'on appelle Bhiksu sans qu'il



pratijnbhiksu, soi-disant Bhiku, immoral, inconqu'il

tinent, etc.

l'homme nomm Bhiksu parce


mendie (hhiksafa


un mendiant sans plus l'homme


nomm Bhiksu

prakrtisthah sllavn. Donc

peut se rendre coupable de samghvasesa.

moine coupable deprjika reste moine, puisqu'il Vinaya uktatn / duhila ceil

bhiksur bhiksunm annclsti samghvaesam padyata iti / pannaprdjiko hi bhiksur dulilo 'bhipreto nnpannaprjikah prakrtisthah llavn iti

viparyayena vacant j ato 'vagamyate / asty asya diiltlasypi sato bhiksubhvo yasmt safnghvasesam padyata ity uktam iti f 1. Ce texte (Vinaya de dix rcitations, Nanjio, 1115, fasc. 21, 23) a pass dans Mahfivyutpatti 278 abhiksuh, aramanah, akyaputryah, dhvasyate bhiksubhvt, hatam asya bhavati srmanyam dhvastam mathitatn patitatn parjitam, apratyuddhryam asya bhavati rmanyam^ tadyath tlo mastakacchinno 'bhavyo haritatvdya / dithllah ppadharmo 'ntahptir avasrutah kaambakajtah. Comparer Kitigarbhasatra dans Sikflsamuccaya, p. 67. Sur kaambaka,

ci-dessous p. 98.


les ditions







Hiuan-tsang, xv,


6 b-7



a rompu


passions (bhinnaklesatvt), c'est--dire l'Arhat \


texte qui

nous occupe


( Il n'est

pas Bhiksu,


n'est pas




s'agit d'un

cinquime Bhiksu, savoir de l'homme

qui a t ecclsiastiquement ordonn et qui, par le patanlya, perd

sa qualit et sa discipline


n'y est certainement pas question


vrai Bhiksu, de TArhat, car,


avant son pch,


coupable de

la qualit


pas un vrai Bhiksu, un Arhat, susceptible de perdre

de vrai Bhiksu.
la discipline toute entire

Qu'on ne perde pas

par la perte d'une

partie, cet


est rfut



Matre lui-mme qui compare

la tte est coupe, dsor^


effet le

moine criminel au palmier dont


mais incapable de verdir, de

c'est dire que,

de se dvelopper, de s'largir

lorsqu'une partie de la discipline, la partie qui est la

racine de la discipline, est coupe, [7 b] le reste de la discipline est

incapable de crotre. Le

patanlya ou maull patti



en contradic;

avec ce que requiert

de Bhiksu (hhiksuhhvocita)



porte une extrme absence-de-crainte dans le pch (anapatrpya,






la racine de la discipline

toute la discipline est


Le Matre exclut l'homme coupable de patanlya de tout commerce

(samhhoga) avec les Bhiksus,




dfend de participer une bouche

Il dit

de nourriture,


lui interdit

un seul pied du couvent ^


qui n'est pas Bhiksu et qui a l'aspect de Bhiksu, dtruisez



Vinaya, fasc.

1, 5.


270, 3740.

Le Bhiksu rgu-

lirement ordonn (jnpticaturthopasanipanna), 270,

sans pudeur,

(xxiii. 4,

85 b) rappelle

y a cinq






des moutons muets,

samgha de

partisans (p'ng-tng),


au sens vulgaire (lokasamvrtisamgha


gha au sens


= sammutisamgha), = dakkhineyyasamgha).



Comparer Prjika, i. 8. .... ayam (natticatutthena iipasampanno) Vasubandhu asmims tv arthe atthe adhippeto bhikkh H.





Vibhs, 69,

cette comparaison,

dans Majjhima,



331, 464,


256, vise les passions.


Comparer CuUavagga,



Vinaya Texts,


p. 120.

ekagrsaparibhoga hrasya ekaprsxiiparibhogo vihrasya.




39 c-40


arrachez ce bois pourri, chassez cette plante sans grain !

Quelle peut bien tre la qualit de Bhiksu de ce criminel ?


Le Ka.smTrien rpond.


quoi que consiste sa qualit de



possde la qualit de Bhiksu. Car Bhagavat a



y a quatre religieux (sramana)


non pas un cinquime



gajinay qui triomphe par



mrgadaisika, qui enseigne




mrgajivin, qui





qui souille



moine immoral

Nous croyons que Bhagavat donne






mana) au moine immoral parce que la forme extrieure de religieux lui reste. Ne parle-t-on pas de bois brid, d'tang dessch, de nezde-perroquet (motif de dcoration architecturale), de semence pourrie,

du cercle du

tison, d'tre-vivant (sattva)

mort ?

[8 a]

Rphque du KsmTrien.

On ne perd pas

la qualit de



patanlya, puisque Bhagavat admet

moine coupable d'incon-

tinence en qualit de pnitent, iksdattaka l

1. [abhiks^itn bhiksvkrtim] nayata krandavakam, kamhakam apakarsata, athofplvinam (?) vhayata. kraiidava, Mahvyutpatti, 228, 2:, une herbe qui ressemble au yava.

p. 67,

Mahfivyutpalti, 278, 16; aussi




kaambaknjta (Sikssamuccaya, kasambka, kasambuka (Wogihara) pti-


L'original portait

vrlhimadhye 'bhyantaratandtilavihlnah (Vyfikhyfi). atho palvinam, comme le montre le pSli Aiiguttara, iv. 169 Suttanipata, 281, cit Milinda, 414 krandavam niddhamatha kasambum




palpe vJietha assamane samanamnine.


Cundasutta dans Uragavagga






VyakhyS, l'Asaiksa et le Saiksa d'aprs l'diteur japonais, le Bouddha et le Pratyeka mrgadaiika, le Bouddha ou Sfiriputra, etc.; inrgajlvin, Nanda, etc., d'aprs l'diteur japonais (mfirge jivati ilavCm bhiksur mrganimittam jivant). Vibhasa, 66, G. Anguttara, iv. 169, satnanads samanapalpo samanakrandava. le moine qui, par 2. Mahvyutpatti, 270, 10, SQtralanik&ra, xi. 4. Vyakhya passion charnelle excessive, s'est rendu coupable d'incontinence (striy abrahmacaryum krtv) ; aussitt, effray (jtasatnvega) : J'ai commis un acte
187), d'aprs la

affreux (kasta)

sans qu'une seule pense de cacher son crime naisse en



(upagamya) au Samgha et confesse l'instruction du Samgha (ryasamgliopadet), il dakarma kurvnah) qui consiste s'abstenir du
se rend



ce pch


accomplit sa pnitence (dancontact des Bhiksus (sarva-

Hiuan-tsang, xv,


7 b-8 b.


Nous ne

disons pas que tout Bhiksu coupable d'incontinence est


un prjika, un Bhiksu tomb,

n'est plus Bhiksu. C'est la

Mais quiconque



pense de cacher

crime (praticchda-

nacitta) qui est




grce l'excellence de ses disposi-

tions normales, grce l'excellence


de sa

srie (samtativisesa),

coupable n'a pas un instant la pense de dissimuler sa faute,

Roi de la Loi l'admet en qualit de pnitent.

Le KasmTrien.

Si le


n'est plus

un Bhiksu, pourquoi

pas admis nouveau l'ordination ?

qu'il n'est


pas susceptible de la discipline


ses dispositions

mentales (samtati) sont ruines

cs de l'impudence

bouleverses (vipdita) par





Aussi, et-il


renonc aux rgles (niksiptasiksa,



38) [postrieurement son

ne peut tre ordonn nouveau.

quoi bon poursuivre

cette discussion ? Si pareil



un Bhiksu, nous rendons homtout acte ecclsiastique devient

mage sa quaht de Bhiksu l vi. Quand la Bonne Loi disparat,

[8 b]
celui qui possde la discipline

impossible, et par consquent aussi toute acquisition de la discipline.

ne la perd pas (Yibhasa, 117,


pure ?

perd-on la discipline de




b) et la discipline






du domaine du dhyna se perd par




ment d'tage



pas un pnitent.
les moines,


l'appelle siksdattcika.

Si l'immoralit

dtruisait la qualit de Bhiksu, cet


ne serait plus un Bhiksu, ne serait

noter qu'il n'a pas recevoir une nouvelle ordination.


D'aprs les gloses de Yuan-hien (cites par Wieger),

pnitent a place aprs


avant les novices



ne prend pas part aux actes ecclsiastiques

sera rhabilit

devient Arhat.
a de curieuses thories sur les privilges que conserve le

nn punah



p. 257,

Bhiksu immoral.

bhmisamcrahnbhym dhynptam



Le bon du domaine du dhyna appartient et aux dieux des sphres suprieures et aux asctes qui, ici-bas, pratiquent les dhynas.




entier, c'est--dire matriel et

Le bon du domaine du dhyna, tout


immatriel (rpay arpasvahhva), se perd par deux causes



naissance (upapatfi) dans un tage suprieur ou infrieur






qui appartient des personnes nes dans les cieux

du Ropadhatu


par la chute (parihni)

lorsque Tascte tombe du

faut ajouter

une troisime cause, d'aprs





perd certains bons

dharma^ par


mort (nikyasahhgaiyga)


lorsqu'il renat


tage cleste o

est mort.


De mme


bon d'rpyadhatu

se perd par le

changement d'tage


par la chute.

A noter


la discipline n'existe

pas dans cette sphre.

l'obtention d'un fruit, par le perfectionne-


Le bon pur par


ment des

par la chute ^


obtenant un

l'rya abandonne les bons

dharmas du

chemin de candidat (prafipannakamrga, lequel

nantarya, vimukti,

est triple,




2. lorsqu'il

perfectionne ses facults



29) [9 a],

le fruit

chemin de


3. lorsqu'il




chemin du




a-b. L'indiscipline se perd par l'acquisition de la discipline, par

la mort, par l'hermaphroditisme ^


Acquisition de la discipline


qu'on prenne rituellement la



du Prfltimoksa (samvarasamdna)

soit que,



cace de la cause intrieure (hefu

= sahhdgahetn,

52) ou de la

cause extrieure (pratyaya == enseignement d'autrui, j)ara/o ghosa),

on obtienne

le recueillement,

qui comporte la discipline de



ryatft tu phalptyuttaptihnibhih

2. 3.

sdom min sdom pa thob pa dan / i dan nilhsan gAis byun ba varah aatftvarpiicyutidvivyanjanodayt !]


= [asatnd'aban*


ne mentionne pas l'acquisition de

la discipline


comme cause

Hiuan-tscmg, xv,


8 b-9




discipline de

dhyna rompt

l'indiscipline, tant

charge de forces

hostiles l'indiscipline.

La mort


l'hermaphroditisme sont, respectivement, l'abandon et


bouleversement de

personne (tmahhva, raya) par laquelle


a t prise.

L'indisciplin qui rejette les instruments de son mtier, couteau

et filet,


avec l'intention de ne plus commettre



meurtre, ne

rompt pas pour cela

maladie [9

ne prend pas la discipline. Le


malade ne gurit pas sans remdes,



vite les causes de la

L'indisciplin qui prend la discipline du jene

lorsqu'il sort




un indisciphn

du jene, ou bien se trouve-t-il dans

l'tat intermdiaire, ni-discipline-ni-indiscipline ?

Les avis







se retrouve en indisciphn, car

l'homme qui prend


jene n'a pas l'intention de renoncer dfinitivefer porte

ment au pch

une masse de

au rouge revient son tat

fois sorti


les autres



du jene,


plus indisciplin, car l'acquisition de l'indiscipline suppose un acte

corporel ou vocal (vijhapli).


perd-on Vavijfiapti qui n'est

ni discipline, ni indiscipline

13 a-b) ?


\Javijnapti intermdiaire est perdue par la rupture de la


force, de

l'engagement, de l'action, de

de la


des racines l

Nous avons vu

37 c-d^ comment s'acquiert Vavijwpti qui

diffre de la disciphne et de l'indiscipline.

Cette avijnapti est perdue en raison de six causes






force (vega) intense de foi

(prasda) ou de passion

(klea) qui ont projet Vavijnapti.



mouvement de


don de


car la discipline de

prcde toujours

la discipline

Les docteurs du Gandhra

Samghabhadra approuve

cette opinion.

2. 3.

Les Kasmriens.

Vibhs, 117,

vegddnakriyarthdyurmlacchedais tu

madhyam //

flche et de la roue



41 c-43.

du potier [10


quand on renonce
je ne
fais plus ce


gement (samdna)

Depuis ce




m'tais engag faire


quand on rompt

l'action, c'est--dire

q land on ne fait pas ce qu'on s'tait engag faire, [par exemple vnrer le Bouddha, faire un mandalaka avant de manger (voir
p. 94, n. 1)




(artha) est rompu



caitya, le

jardin (rdma), le couvent (vihra), le



sige, qu'on s'tait

le filet (jla),

engag vnrer ou donner l'instrument (yantra),




la vie est

les racines de bien

rompue (6) quand on commence rompre (sarmicchedaprrambhvadhdym)




a-b. L'acte

non matriel, bon, du domaine du Kamadhatu,



perd par la rupture des racines


par la naissance dans une sphre

Nous avons




rompu, perdu,

l'acte qui est

matriel, savoir l'acte corporel, l'acte vocal, Vavijnapti.


non matriel, bon, du Kamadhatu,


perdu par la rupture des


Quand on



samdnena ;

en d'autres termes pratykliynava-



est perdue pour celui qui n'agit pas

conformment son engage-


yathsamttam akurvatah.

tadyath btiddham avanditv mandalakam akrtv va na tadakrtv hhunjnasya .... Dans Bliiksiinkarmavficana, (Shool of Orientai Studies, Bulletin, 1920, p. 128), il est question du trimandala qu'on construit avant la prise du refuge. J'ai pens que ce trimandala est le triratnamandala dont il est question dans le rituel des Bodhisattvas (dikarVyftkhyft



mapradTpa, dans Bouddhisme, Etudes et Matriaux, 1898,


p. 206). etc.






entendre astra,

visa, etc.
4. Il faudrait dire que la vijnapti, qui a donn naissance cette avijnapti, est abandonne en mme temps qu'elle, car sa prjtti est coupe j)ar ces six causes. Mais il peut y avoir avijnapti sans vijnapti, comme il rsulte de iv. 67 et


en parlant de Vavijnapti,




on parlait de

la vijnapti.

D'aprs d'autres, \& prpti d'une vijnapti incluse au ni-discipline-ni-indiscipline ne se continue pas (anubandhini) ; donc l'auteur n'a pas ici s'occuper de l'abandon de la vijnapti. (Vyftkhyfi).


kualrpam mlacchedordhvajanmatah

Hiuan-tsang, xv,


9 b- 10



racines de bien et par la naissance dans les sphres du

Ropa ou






Ce qui

est souill et

non matriel


perdu par la nais-

sance du contrecarrant



Tout ce qui

est souill, de quelque sphre

que ce

soit, est


par la naissance du chemin qui s'oppose cette souillure.

d'un chemin d'abandon (praJidnamclrga, distinct du vimuktimrgaj




qui peut tre de vue (darana), de mditation (hhvan),

qui peut tre



supra-mondain (lokottara). Ce



abandonner une certaine catgorie d'upaklea



tout son cortge de prptis, etc.

et d'indiscipline ?

Quels tres sont susceptibles de discipline






des deux catgories d'eunu-

ques, des hermaphrodites et des

sont susceptibles d'indisci-



la discipline, qui appartient aussi

aux dieux.


existe seulement chez les

et les

hommes. Encore

et les

excepter les






discipline chez les


hommes, avec

les exceptions susdites, et



donc, dans deux destines.





dans certains cas, par le dtachement du kma (vairgya) bonne dissatisfaction (kusala daurmanasyendriya, ii. 1,



p. 106, n. 4).

non nions pa can gzugs min

gilen po skyes nas


rnam iams hgyur =r




praUpaksotpdd vihlyate


Les kleas sont des upaklesas

V. 46.

tous les tipaklesas ne sont pas des klesas.


4. za ma ma nih sgra mi snan / mthsan gnis ma gtogs mi rnams sdom pa han de bzhin du / Iha la han nrntn asamvaro hitv sandhapandadvidhdkrtln /


sdom min

[kurti ca]



evam [devnm


Mahvyutpatti, 271,


Le Theravdin (Kathvatthu,


10) soutient qu'il n'y a

pas discipline chez



dieux parce qu'il n'y a pas indiscipline.

Voir ci-dessous






43 "45


Les eunuques ne sont pas susceptibles de discipline


ceci rsulte

du Stra [11


le lac

aux vtements blancs, mle

du Vinaya

muni de l'organe mle



a-b), et





faut l'expulser

Pourquoi ? Parce

qu'ils poss-


un degr extrme,


passions des deux sexes

parce qu'ils

sont incapables (aksama) de la rflexion (pratisamkhyna) ncessaire pour combattre les passions
et de la crainte (Itr,

parce que la vigueur du respect



32 a-b) leur

fait dfaut.

Pourquoi ne


pas susceptibles d'indiscipline ?

Parce que

rintention de commettre le pch (ppaya) n'est pas ferme chez

eux parce que


l'indiscipline s'oppose


la discipline

qui est susceptible de discipline est seul susceptible d'indiscipline.


Aux Uttarakurus manquent l'engagement (samdmi),

et le recueillement


absence de la discipline de Pratimoksa,



d'o absence des deux autres disciplines. D'autre part, l'inten-

tion de



pch leur

fait dfaut.


mauvaises destines (pylka) manque



vigueur de

respect et de crainte



ait discipline,


faut respect et

crainte vigoureux [11 b]



ait indiscipline,

faut qu'on


(vipdana) respect

et crainte (iv.




la discipline, ni l'indiscipline ne
la personne, des

peuvent natre dans


le corps,

eunuques, des hermaphrodites


des tres des

mauvaises destines, car ce corps


semblable un sol satur de

o ne peuvent

crotre ni le bl, ni la

mauvaise herbe.


Le Stra


y a un Naga n de Toeuf
sortant de sa

a) qui,

chaque huitime jour de

la quinzaine,

demeure, vient prendre

jene huit membres



Vibhasa, 24, h; comp. Visuddhimagga, 300).





Nagas, non pas de


mais de bonne action (sucarita),


discipline existe

donc seulement chez



chez les




trois disciplines,

chez les




raison de leur


mi rnanis

mndya. gsum pa [nruAm trayah



Hiiian-tsang xv,


10 b-12



Discipline de Pratinioka, discipline ne du




a-b. Discipline
et le

du dhydna, chez


dieux ns dans





pas dans la sphre suprieure.




discipline pure,

en exceptant


dieux du


intermdiaire et les Asanijnisattvas, et aussi dans l'rQpya

Elle existe dans le


en exceptant



kas ou

tres ns



intermdiaire, et les Asanijnisat-

et dans rArpyadhatu. Les


dieux de l'ArQpya ne sont jamais

cette discipline, puisque la

munis en

(sammiikhhJulvatah) de

discipline est matire,





peuvent la



82) \

Poursuivant son examen de

l'acte [12 a], l'auteur


dfinir les

diverses catgories qui sont enseignes dans le Stra.


y a trois actes,
a-b. L'acte






non-dfmi (Vibbsa, 51,




salutaire, l'acte


est pernicieux,

1. hdod dan gzugs skyes Iha jadevcinm cUiynaja h]

rnaiiis la


g tan skyes yod := [kntarpa-

Non pas

la discipline

de PiTitinioksa, parce (jue les dieux sont trangers au

sarniefja, terreur-dgot.

zag nied ni

bsani gtan khyad par hdu ses nied


sems can ma gtogs gzugs

nied na


= [ausravah punah

dhyanntarsamjnisaUvn hitvrpye


La version


la pratique

du Bhsya saute cette krik. du dhynntara (viii. 22-23) on renat dans



surleve du ciel des Brahniapurohitas, qu'on appelle dhi/ntitarik, o sont

Mahbrahnis (ii. 41 d iii. 2 d). La naissance parmi les inaltbrahninas un obstacle (varana) (iv. 96), car l'entre dans le Chemin et la discipline pure que comporte le Chemin sont impossibles Brahm, lequel croit qu'il est




etc. (vi.




exceptant les

La discipline pure chez les dieux du Kma dhynntarikas et les asamjiiisattvas, et chez
non pas actuellement.


du Rpa, en
dieux d'r-


Les dieux ns dans l'rpya possdent virtuellement

la discipline d'extase

et la discipline pure,

l'acte diffrent





du bon


du mauvais

est diffrent

du salutaire





Telle est la dfinition de l'acte bon, etc.

L'acte bon (kitsnla, uhha) est salutaire (ksema), parce qu'il est

de rtribution agrable (istavipka)

souffrance pour un temps


par consquent protge de la

c'est l'acte

bon impur, kusalassrava)


ou bien parce

qu'il fait atteindre le


par consquent, pro-

tge dfinitivement de la souffrance

c'est l'acte


c'est l'acte

L'acte mauvais (akusala, auhha) est pernicieux

rtribution dsagrable.


L'acte dont

Bhagavat ne



qu'il est

bon ou mauvais,


non-dfini (avykrta), n'est ni salutaire, ni pernicieux.



Acte mritoire, dmritoire, non-agit


les trois actes


-sentir-agrablement est
trois actes, mritoire




y a

(punya), dmritoire (apunya), non-

agit (nihjya).

y a trois actes, -sentir-agrablement (stikhave-

daniya), -sentir-dsagrablement (diihkhavedamya), -sentir-nidsagrablement-ni-agrablement (aduhkhsiikhavedaniya),


a-b. L'acte mritoire est l'acte

bon de Kamadhtu



agit est l'acte

bon d'au-dessus


[12 b]
est ce qu'on appelle l'acte

L'acte bon du

domaine du Kamadhtu
qu'il purifie,



pmiya, parce

parce qu'il produit une

bution agrable \


bde mi bde dan gzhan



dge dan mi dge dan gzhan yin


= \kstmam




bsod nams bsod nanis min mi ^yo

bde ba myoh hgyur




[punyam apunyam

nifijyatn stikhavedyAdikam trayant


bsod nams hdod kliains dge babi las

mi ^yo gon



skyes bahi

[kmadhtuubham karma 2iunyani ninjyam rdhvajam]

L'AbliisamayalanikaiTiloka, ad Astasabasrika, p. 62, cite rAbliidiiarmasamuc-


kniapratisantyuktam knsalam
la version



nmjyam. Commentaire de
Manque dans



mais donn par Paramflrlba.



L'acte bon

du Kamadbalu

nomm punya

parce qu'il


du bien

Hhian-tsang, xv,


12 a-b.


bon d'au-dessus,


du domaine des deux sphres


suprieures, est



les trois

Mais Bhagavat







agiles (sehjlta) ? N'a-t-il pas



vitarkita et le vicarita du

premier dhyna, les ryas disent qu'ils en sont l'agitation

autrui et produit une rtribution agrable




nomm apunya

parce qu'il


autrui et produit une rtribution dsagrable

admet deux lectures, nejya de ejr (kanqjane) i. La Vykhya (iii. 101 d) Variantes releves par Wogihara dans son ninjya de igi (gatyarthe). dition de la MahSvyutpatti, 21, 49, 244, 124 aninga, aningya, aninja, anijya, nijya. Opinions des modernes. Lotus, p. 300 Cliilders (inj) Senart, Mahavastu, i. 399 (MSS. nimja) Leurnann, Album Kern, 393 Kern, note dans BodbicarySvatrapanjik, p. 80 (vdique anedya --= anindya) E. Muller, Simplified grammar, p. 8. (V^oir ma note Madhyamakavrtti, p. 335). ii. Action anenja. Les trois abhisamkkhras (punna, apuntia, anenja),



217, Saniyutta,




xvi. 1

(dneHjya). C'est


leading lo immovabilily

de Warren

180, d'aprs




of imperturbable character





de Mrs Rhys Davids

(trad. du Kathvatthu, p. 358, ad xxii. 2). [C'est sans doute l'acte que dcrit ici Vasubandhu, l'acte du domaine des sphres suprieures.] iii. Pense anenja, cittassa nenjat non agitation de la pense '; pense, recueillement, dhyna, saint, qualifis dnenjappatta, ninjyaprpta : Udna, iii. 3, Nettippakarana,87, Puggalapafmatti, 60, Angultara, ii. 184, Visuddhimagga, 377, Wogihara, Bodhisattvablmmi, 19. C'est la pense dans le 4"ie dliydna o, d'aprs hrtiques Kathvatthu xxii. 3, a lieu la mort de l'Arhat (comp. Kosa, iii. 43, Dgha, ii. 156, Avadnasataka, ii. 199) pense acala, nirinjana. La pense netija, fondement du pouvoir magique (iddhi) est, dans Visuddhimagga, p. 386, une pense qui ne s'incline pas (na injati) vers le rdga, etc. Ce n'est pas la pense du quatrime dhyna, mais une pense bonne et recueillie (samhita). (Sur la rddhi, voir Kosa, vii. 48). Dans Samyutta iv. 202, la pense aninjamna, aphandamdna, etc., est celle dbarrasse des mannitas, injitas, phanditas, papancitas, mdnagatas qui consistent dire Je suis , etc. De mme faut-il comprendre le injUa d'Anguttara, ii. 45. iv. Dans Majjliima, ii. 254, 262, le vintidna devient 1. nanjtipaga, 2. kincannyatanupaga, 3. nevasannnsanndyatantipaga. On obtient Vtianja en abandonnant la notion de kma et de rpa ; Vdkincanna en abandonnant en outre la notion d'dnanja ; le nevasatlndndsannyatana en abandonnant en outre la notion d'dkincanna. Il semble que Vuanja corresponde aux deux
' ;

premiers tages de l'rpyadhtu (voir Kosa,



yad atra vitarkitam vicaritam idant atrryd injitam ity hiih j yad atra prltir avigat idam atrary injitam ityaliuh yad atra sukhatn stikham iti cetasa blioga idam atrryd injitam ity huh. Madhyama,













sont agits,

en se plaant au point de vue du caractre vicieux (spaksalatd) de

dhynas dhynas





24 a

et l'expos





vices sont ce qui les agite.

Mais dans


Bhagavat dclare


non-agits parce qu'il les considre


comme un chemin

favorable la non-agitation

Mais pourquoi appeler non-agit ce qui

est agit ?



Parce que, en ce qui concerne sa rtribution,




domaine des tages suprieurs ne varie pas

L'acte du

domaine du Kmadhtu

est agit (ihjaii)

en ce qui

concerne la rtribution. La place de sa rtribution n'est pas fixe


acte qui produit, naturellement, telle destine, peut tre rtribu dans


un acte qui produit


destine divine peut tre rtribu



autre destine divine.


les actes

produisant force,


beaut, objets de jouissance,

arrive que, au lieu d'tre rtri-

bus dans une destine divine,

soient, par l'efficace de certaines

causes, rtribus dans une destine humaine, animale, de prta.



aucune cause ne peut

faire (jue l'acte

du domaine du Rpa

de Trpya [13 a] ne soit pas rmunr dans la terre (hhmi) qui

lui est propre.




Comparer Majjhiiiia, i. 454 .... idam kho aham Udyi injUasmim kini ca tattha ijitasmimj yad cva tattha vitakkavicr aniruddh


tattha iHJitasmim.

gyo bahi mdo.


et Hiuaii-lsang

Dans rAiiinjyasQtra


2. ini yyo ba dan nilhun par bgro bahi lani las brtsams te =: ninjya-sampresa-gminlm rabhya nmjynujcalahhfjinam kampyniiklabhgiuam mrgam rabhya (Vykhya).

D'apn'-s Hiuaii-tsang


les dclare non-agits, les considrant (litt.




prenant en main



produisant une rtribution (cipka)


d'aprs Paramrlha

visant (yo) le chemin capable de produire

agit peut-il produire une rtribution

un pratyaya de bon non-agit



non agite ? nanmoins on


Comment le dhyna (Juoique ce dhyna comporte


Tagilation dfte ses vices (apaksla)^



agit, parce (pie,

en ce qui concerne sa rtribution



tadbhmisu yatah karma vipkam prati nenjati



avabhfiniisu, iliuan-tsang





12 b-13




est dmritoire. Ceci est bien

connu dans


n'y a pas lieu d'insister sur ce qui est connu dans le monde.

Quant aux actes -sentir-agrablement,


a-b. L'acte bon,


jusqu'au troisime dliyna, est -sentir-agra-


La sensation agrable (siikh vedan) n'existe pas au-dessus du troisime dhyna elle a donc pour domaine le Kamadbatu et les


premiers dhynas. Donc la rtribution de l'acte bon est -sentir-

agrablement jusqu'au troisime dlnjna. L'acte qui a semblable

rtribution est dit



(voir iv. 49).




est -senlir-ni*agrablement-ni-dsagrable-

ment l
Les sensations agrable
n'existent pas au-dessus

dsagrable (siikli, dnlikh vedan)

la sensation

du troisime dhyna. Reste

bon qui

d'indiffrence, unique rtribution de l'acte

est rtribu au-

dessus du troisime dhyna.


c-d. L'acte


d'ici-bas, est -senti r-dsagrablement


L'acte mauvais est -sentir-dsagrablement.

La Karik



bas ,pour indiquer que cet acte existe seulement dans




de tous ces actes



la sensation ?



Sikhavedyam suhham dlujnd trtlyt

dirions plus clairement

D'aprs Vibhs, 115,


la rtribution




est sensation agrable



le Kmadbtu et les deux dhynas la sensation de plaisir (kyika sukha) et la sensation de satisfaction (saumanasya) (2) dans le troisime dhyna, la sensation de satis:

a lieu dans le Kfimadhfitu et dans Par snkh vedan, il faut entendre

les trois

premiers dhynas.




7, viii.




param aduhkhsukhavedyam.




sdug bsnal myon ligyur

(Une syllabe

et \\\\ pda). un quivalent de hdipahi


mi dge := [duhkhavedyani aihiknhham //] lidilii ne peut tre un gnitif; reste en faire un

= aihika, qu'on a


13 c-d


moralit des

tres de ce

monde aihikasllani. ParamSrtba Dans le Kmadbtu,





sentir dsagra-



La krik





pour indiquer que cet acte

n'existe pas ailleurs






ont encore


fruit [de rtribution] ce qui constitue l'appareil


(samhlira) de

la sensation

[13 b]



D'aprs quelques-uns, l'acte intermdiaire existe aussi en

dessous ^
D'aprs d'autres, l'acte intermdiaire

c'est--dire l'acte qui a

pour rtribution ime sensation ni-agrable-ni-dsagrable

aussi en dessous du quatrime dhyna, contrairement


la doctrine

47 a-c (Vibhas,



Deux arguments, 48 b




tara \


Puisqu'il y a rtribution en ce qui concerne le

Si l'acle intermdiaire faisait dfaut en dessous

du quatrime



n'y aurait pas de rtribution (vipka) de l'acte de



ou bien



n'y aurait pas rtribution d'un acte quelconque


Objets, complexe psycho-somatique (sraya),


adho 'pi madhyam ity ke. Cit VyfikhyS, iii. 43. dhynCintaravipkcith j 3. bsam gtan khyad par rnam smin las i/Le dhynntara est le dhyna intercalaire entre le premier et le deuxime dhyna, ou, comme traduit le tibtain, un dhyna suprieur (khyad par) au

premier par l'absence de vitarka (voir viii. 22 d) premier dhyna. (Voir ci-dessus p. 105).



une sorte d'annex du


distingue le




consistant en recueillement,

l'extase, et

l'upapattidhyna, l'existence dans un certain


chaque extase. L'acte de dhynntara (dhynntarakarman) est l'acte par lequel on obtient le dhynntara-e\[ase et le dhynntara-exislence. dhynnii. La karika comporte deux interprtations qu'indique le Bhfisya puisqu'il y a rtribution de l'acte de dhynntara ; tarakarmano vipkatas puisqu'il y a rtribution dans le dhynntara. dhynntare vipkatas Paramartha traduit littralement l'original Hiuan-l sang Parce que l'jacte]

= =

intermdiaire produit rtribution



dhynntarakarmano vipko na bhavet (med pa). Vyftkbyfi 4. Bbasya dhynntarakarmano dhynntaropapattau vipkena veditena hhavitavyam tatra s^ikh duhkh va vedan nsti tasmd asydiihkhsukh = L'acte de dhynntara doit, dans l'existence de vedan vipka iti


dhynntara. avoir une


rtribution qui soit sensation. Or, dans le



sensation dsagrable donc la sensation ni-dsagrable-ni-agrable [qui s'y trouve] est la rtribution du dit acte. Donc en dessous du quatrime dhyna existe un acte qui est sentir ni-dsagrablen'y a ni sensation

agrable, ni

5. <

ou bien si nous considrons (Note du traducteur).


deuxime interprtation de

la kfirikfi.

Hiuan-tsang, xv,


13 a-b.



\ car les sensations agrable et dsagrable

y manquent. [Rpondant

cette argumentation,] les

uns disent que la rtribu-

tion de l'acte de


est la sensation de plaisir (siikhen-



7, viii.

9 b) du dliyna



d'autres disent que la rtrietc.].


bution de cet acte n'est pas sensation, [mais rpa,

Ces deux opinions sont en contradiction avec

(Jnanaprasthana, 11,

le h'sivdi (iicclistra)



la rtribution d'un acte soit

sensation mentale seulement?

Oui, la rtribution de l'acte


exempt de vitarka


dhynntare va kasya cii karmano vipko na syt (rnam par Vykhya dhynntare va kasya cit karmano *nyasya vipko vedan na syt na sambhavati Ou bien, dans le dhynntara,


smin par mi hgyur).


n'y aurait pas de rtribution, sous forme de sensation, de n'importe quel acte

diffrent de l'acte

du dhynntara, car on ne peut pas




la rtribution

exprimente dans


est le fruit d'un acte sentir

le fruit


du domaine du premier dhyna, ni qu'il est blement du domaine du Kmadbtu, ni qu'il


d'un acte sentir dsagra-

est le fruit d'un acte

du domaine du



Hiuan-tsang traduit




n'y aura pas d'acte [qui soit rtribu dans


(houo ng o



n'en est pas ainsi


si l'acte



dfaut en

dessous du quatrime dhyna], l'acte de dhynnta^'a n'aura pas de rtribution

y aura un acte de diffrente nature [rtribu] , [Or on ne peut pas dire que la sensation du dhynntara soit la rtribution de

ou bien, dans




quelque autre


dhynntarakarmano dhyna eva sukhendriyam vipka ity eke brnvate. Hiuan-tsang Cet acte produit comme rlril>ution la sensation de du premier plaisir (sukhendriya) du dhyna principal . [Glose de l'diteur dhyna], Ce qui peut s'entendre l'acte qui produit le dhynntara est rtribu en sensation, mais dans le dhyna principal. 3. Bhfisya naiva tasya vedan vipka ity apare. Ces matres soutiennentils qu'il n'y a pas de sensation dans l'existence de dhynntara (dhynntaro: :

papattau) ? Non. Mais



disent que celte sensation n'est pas fruit de rtribution,





kusalasykarmanas caitasiky eva vedan vipko vipacyate vitarkasya karmanah. Cet acte bon exempt de vitarka est l'acte qui produit le dhynntara ; sa
rtribution est sensation mentale seulement.



est faux


la rtribution

de l'acte qui produit



soit la sensation



du dhyna










admis que

la rtribution des trois sortes

d'acte a lieu eu



Deuxime raison d'admettre que

dessous du quatrime dliyna.





Le Sstra










temps rtribution des

trois sortes d'acte ?

Oui. Peuvent avoir lieu




la rtribution d'un acte -sentir-agrablement,

savoir des


matriels, [l'organe de la vue, etc.]

(2) la rtri-

bution d'un acte -senlir-dsagrablement, savoir la pense et les

mentaux [en excluant

la dissatisfaction,


10 b-c]


la rtribution

d'un acte -sentir-ni-agrablement-ni-dsagrablement, savoir les


dissocis de la pense, [organe vital,

les trois sortes d'acte





en debors du Kamadbatu,

ne peuvent tre

bues simultanment, car la rtribution de

l'acte -sentir-dsagrable-

ment a


seulement dans




1 18, lo).


-sentir-ni-agrablement-ni-dsagrablement, [lorsqu'il ap-

partient un tage infrieur au quatrime



bon ou

mauvais ?


est bon,

mais de

faible force.

Mais n'avez-vous pas

[14 a] que

bon, jusqu'au troisime


est -senlir-agrablement (iv.



Cette dfinition

vise la gnralit des cas (hhulika nirdesa).

Mais comment peut-on

sensation, n'est pas senti



l'acte est -sentir-agrablement

(siikhavedanya, sukhavedya) ? L'acte, de sa nature,



(avedansvabhva) ?


s'exprime ainsi parce que l'acte est favorable la sensation


agrable (sukhavedaiihita, amikla) bution est sentie agrablement.

ou bien parce que sa



De mme qu'on



(du premier





Tannexe suprieure)


aussi que cette rtribution ne soit pas sensation. Car l'acte exempt de viiarka
n'existe qu' partir du




sna phyi med gsuui suiiu hdod



= [fiYii/as/Jpiirrdcarcwnam [vip6>ka
le plaisir,

inyate yatah

Ce que

l'un sent


c'est le


non pas


Hiiian-tsang, xv,


13 b-14



sya, vtement baigner,


vtement avec lequel on se baigne, de



on appelle




par lequel on sent une





y a cinq manires d'tre vedamya,





' :


par association, en tant qu'objet, en tant que rtribu, par



de prsence


sensation, de sa nature




La sensation
c, ii.

agrable est exprience (aniibhava) agrable,





Le contact (spara)


sentir parce

qu'il est associ

la sen-


contact -sentir-agrablement,

(Saniyukta, 13, Saniyutta,




trad. p.


et 154)

Les six objets (visaya) des six organes sont sentir en tant




la couleur






sent la couleur, mais

ne sent pas la couleur avec affection

^ [14 b]

La couleur

est l'objet de la sensation.

4. L'acte est

sentir en tant que rtribu

un acte



l'existence prsente





sensation est sentir par

le fait

de prsence







prouve (annbliavati) la sensation

agrable, deux sensations, la dsagrable et la neutre, se trouvent


empches pour


donc lorsque

la sensation agrable est

dmigs pa dan ni rnam smin dan / mnon 1. no bo iiid dan mthsuns Idan dan sum du ni gyur pa las / myon gyur rnam pa Ina yin no. La Vykhya fournit les termes svabhvavedanyat, lambanavedanyat,

sammtikhtbhvaveclanyat. {svabhvatah samprayogd lambanavipkatah / samnitkhbJivatas cpi pancadli vedanyat //]

D'aprs Vibhs, 115,

o l'ordre

diffre (5 devient 2).

[rpam caksus drstv] rpapratisamved no ca rpargapratisamvedl


Mme texte Samyulta,


rpam pratyamibliavati no ca rpargani pratyamibliavatty arthah atha va no ca rpam rgena pratyamibhavaty lambata iti. 3. yasmin samaye snkhm vedanm vedayate dve asya vedane tasmin
samaye niruddhe bhavatah (MahanidanadharmaparySya)

comparer Digha,


en exercice (pravartate),




n'y a pas d'autre sensation par laquelle



la sentirait. Si

donc on



sensation est




parce qu'elle






Cet acte est dtei-min ou indtermin


[15 a]

1. de yaii ns dan Le problme de la


ns pa


ca niyatniyatani].


de la rtribulion de l'acte n'est pas sans prsenter

compte de multiples doimes. V^oir notamment accumul (upacita) : accumul *, s'il est suivi de repentir, confession, etc. compt l'acte ne sera pas En eftet, l'acte n'est complet que par le prstha ou conscutif (iv. 68) la gravit de l'acte dpend de la gravit du prparatif, de l'acte principal, du conscutif Tout acte accumul n'est pas ncessairement rtribu. Le caractre (iv. 119). de la rtribution d'un acte ncessairement rtribu peut changer tel acte sentir en enfer dans la vie prochaine sera rtribu ici bas (Angulimfila est un bon exemple) (iv. 55). En effet, si on excepte les pchs mortels (iv, 97), les crimes n'empchent pas fors le cas de vue fausse coupant les racines de bien (iv. 79) et encore celles-ci peuvent-elles renatre ds cette vie (iv. 80 c-d) de se dtacher du Kamadhtu , et, par consquent, de renatre la prochaine naissance dans


doit tenir

1:^) la distinction de l'acte fait (krta) et de l'acte







les cieux

de Rpa



auquel cas


pchs qui ne sont pas de rtribution

ncessaire sont


n'avaient pas t


les autres sont rtribus

Les crimes, l'exception de ceux qui doivent ncessairement mrir en


mauvaise destine, n'empchent pas d'entrer dans le Chemin ds lors l'me, parfume par de puissantes racines de bien (puret de la conduite, respect des joyaux) devient rfractaire la maturation des anciennes actions non dtermines qui pouvaient produire une mauvaise destine L'ignorant, n'eut-il commis qu'un petit pch, va en bas; le sage, et-il commis un grand pch, vite le mal. Une petite masse de fer, compacte, coule le mme fer, en grande masse mais faonn en vaisseau, flotte (vi. 84 a-b, Anguttara, i. 249). En plantant une petite racine de bien dans le champ de mrite que sont les Bouddhas, on supprime la rtribution des actes de rtribution non ncessaire (vii. 34 al finem). -- Le


iv. 60, traite





(ansrava) qui

dtruit les autres actes.


autre problme est celui de l'ordre dans lequel les divers actes sont rtribus


sont lourds, nombreux, proches (voir Kou,

p. 601).

du Pudgala,

la fin



Le Bouddha a dclar que la rtribution de l'acte dfend de chercher la comprendre (Anguttara, ii.

est 80,

Madhyamakfivat&ra, vi. 42, Miliuda, 189, Jatakamla, xxxiii. 1-3). trs clair pour les Bouddhistes, et pour nous obscur, est qu'il y a acte



et rtribu-


qu'il n'y

a pas d'agent.


a discut
b, d, 85)

si la

toute souffrance tait

rtribution comportait
vii. 10,

rtribution ou provenait de rtribution


elle-mme une rtribution (Visuddhimagga, 002, Kathfivatthu,





14 b-15


etc.) est

L'acte que nous venons de dcrire (-sentir-agrablement,

ou bien dtermin (niyata), c'est--dire

tre senti

qui doit ncessairement


ou bien indtermin (aniyata),


qui ne sera pas nces-

sairement senti


b-c. L'acte

dtermin est de

trois espces,

sentir dans la vie

actuelle, etc.

L'acte dtermin est


sentir dans la vie actuelle (drstadhar-

la vie


sentir aprs tre ren, en d'autres termes dans


immdiatement wQmv (upapadijavedanlya),

sentir plus


ajoutant l'acte indtermin, cela


au point de vue de


modalit de la rtribution, quatre espces.



D'aprs une opinion, l'acte est de cinq espces ^


divisant l'acte indtermin en deux catgories

celui qui est

indtermin quant l'poque de la rtribution, mais dont la rtribution est d'ailleurs certaine


celui qui est indtermin

quant la rtribution (aniyatavipka), qui peut ne pas tre rtribu.

L'acte sentir dans la vie actuelle est l'acte qui mrit ou est
rtribu dans l'existence



a t accompli. L'acte sentir

Deiissen, Vedanta (1883), un chapitre de son trait sur le





la fin.


Vasubandhu consacre

ce problme

Intressent la


et le



questions suivantes


prouve-t-il la rtribution de ses anciens pchs ?


102, la fin)


expliquer les naissances animales du Bodhisattva ?



mthon bahi chos


sogs pa la

myon gyur

phyir ua ns

rnam gsum

[(Irstaclharmdivedyatah j tridh niyatani] Voir Childers, 178 b Warren, 245 Visuddhimagga, 601, Compendium, 144.

Les anciennes sources opposent

enfer (Anguttara,



ditthadhamme vedanya Pacte qui mne l'acte sentir plus tard, samparyavedanya

(ibid., iv. 882).



cig las



zhes zer

= [eke tu bruvanti karmapaiicakam




bien on dit qu'il y a cinq actes




y a cinq actes




50 c-51


aprs tre ren (tipapadya) est l'acte qui est rtribu dans Texistence
qui suit celle o

a t accompli. L'acte sentir plus tard est


qui est rtribu dans une existence ultrieure, partir de la troisime.

Mais, disent d'autres matres, [les Saulrantikas], on ne peut admettre

qu'un acte trs fort soit de faible rtribution. Par consquent, la

rtribution d'un acte sentir dans la vie actuelle peut se continuer

dans d'autres existences



cette rtribution


mence (mpkramhha) dans


la vie actuelle, cet acte reoit le


sentir dans la vie actuelle


Les Vaibhasikas n'acceptent pas cette manire de

disent-ils, des actes




le fruit est

proche (samnikrstaphala), des

actes dont le fruit est loign (viprakrsta).

De mme

le lin (siivar-

cala) porte son fruit aprs deux mois et demi,

le bl


et le


aprs six mois.


[15 b]

D'autres distinguent quatre alternatives ^


Les Darslantikas

distinguent quatre cas


Acte dtermin quant

l'poque de

la rtribution,

indtermin quant la rtribution.



cet acte est rtribu,


sera certainement rtribu


moment, mais
la rtri-

n'est pas ncessairement rtribu

c'est l'acte

niyata ou niyatave-

daniya, mais aniyatavipka.


Acte dtermin quant

bution, indtermin quant l'poque de la rtribution.


Cet acte

Les traducteurs chinois s'cartent du tibtain Il y a des actes dont le fruit il y a des actes dont le fruit est lointain et grand ... . C'est bien ce qu'enseigne la Vibh5s5, 114, 16 L'acte sentir dans la vie actuelle produit un fruit proche on peut donc dire qu'il est fort comment peut-on dire

est proche et petit


les autres actes,


fruit loign,

sont trs forts ?


vie actuelle produit


proche, mais faible

sentir dans la on ne peut pas dire que cet acte


soit trs fort .... Le yava a son fruit aprs six mois, fruit plus loign mais plus grand que celui du lin le khadira (k'ia-l-chu) a son fruit aprs cinq, six, douze ans, mais ce fruit est plus grand le tla a son fruit aprs cent ans, mais ce fruit est le plus grand .
; ;

Edition des kfirikas





ni bzhi zhes zer.


gzhan dag


Paramfirtha et Hiuan-tsang

D'autres matres disent

quatre alter-

natives (kia

= mot)

[ctuskotikam ity anye] 3. drstntikh sautrantikh





15 a- 16



sera rtribu, mais l'poque de la rtribution


niyaiavipka, mais aniyata, aniyatavedanya.


Acte dtermin

aux deux points de vue

D'aprs ce systme




4. Acte

indtermin aux deux points de vue




y a huit sortes d'actes

de rtribution certaine,
de rtribution


acte sentir dans

la prsente existence et
la prsente existence et

2. acte

sentir dans
peut tre

possible.... 7. acte qui


dans n'importe quelle existence (aniyata ou aniyatavedanya)


mais de rtribution certaine

8. acte qui

peut tre senti dans n'im-

porte quelle existence et de rtribution possible (aniyatavipka).


les actes dfinis

dans l'Ecriture


sentir dans cette

l'acte dfini



sont toujours de rtribution certaine




(aniyata) peut ne pas tre rtribu





produise ou projette (ksipati) en


temps des actes des quatre espces ?

vol et

A supposer qu'un homme fasse commettre


par autrui meurtre,


commette lui-mme adultre


que ces quatre

appartenant respectivement aux quatre espces, soient perp-








Trois espces d'acte projettent l'existence ^

L'acte sentir dans l'existence actuelle ne projette pas l'existence







a t projete par un acte


1. Hiuan-tsang ajoute deux mots La doctrine des quatre actes (50 a-c)



Quatre, bon





Les actes


dans l'existence actuelle




sont les trois actes dtermins

l'acte ind-

bon [16 a], car, en indiquant seulement ici l'acte dtermin ou indtermin quant l'poque de la rtribution, on explique les quatre catgories d'acte enseignes dans le Stra . Glose de l'diteur japonais En disant que c'est bon, le Sstra ne condamne pas la thorie
termin est

Nous disons que

des cinq actes, des huit actes




ris ni

hphen par byed

= [nikyah ksipyate tribhih





51 c-53


Combien d'espces

d'acte peuvent tre produites dans les diverses

sphres d'existence (dhtu) et dans les diverses destines (gati) ?



Quadruple production partout

les trois



sphres d'existence et dans toutes les destines peu-

vent tre produites les quatre espces d'acte bon ou d'acte mauvais.

(51 d-53)

cette rgle gnrale souffre des restrictions.




n'y a pas d'acte mauvais au dessus du



d'autre part



L'acte bon, dans les enfers, est seulement de trois espces ^

les enfers,


on peut produire



sentir dans l'exis-

tence prochaine, l'acte bon sentir dans une existence ultrieure,

bon indtermin

mais non pas





tence actuelle, car


n'y a pas, dans les enfers, de rtribution agra-

(manojha, manpa).




est ferme, le sot

ne produit pas d'acte


l'tage dont

est dtach,

dans l'existence prochaine l


la chute

Quand il est ferme (sthira), (aparihnadharman,



n'est pas sujet

56, Puggalapafinatti, p. 12).

Le sot (bdla),

c'est--dire le Prthagjana.

Lorsqu'il est dtach d'un certain tage, lorsqu'il est dlivr d'atta-

chement (virakta) l'gard d'un certain plan de

dhatu, premier d/ii/wa....),
cet tage,



ne produit jamais un acte


sa prochaine renaissance.



L'rya ne produit pas non plus d'acte sentir dans une


existence ultrieure



est ferme, le saint ne produit pas d'acte



Ihams cad na

ni hplieii

pa bzhi

= [sarvatra caturdhksepah]


ubhasya narake tridh

3. gan las lulod chags hral brtaii pahi / byis pa der skyes niyo mi byed yadviraktah sthiro halo [ntropapadyavedyakrt H] 4i. hphags pa gzliaii du han niyon mi byed nnyavedyakrd apy [dryah]

Hinan-tsang, xv,


16 a-b.

dans nne

est dtach, soit



prochaine existence,

existence ultrieure.


effet, le

Prthagjana incapable de chute (aparihnadharman)

ne renat pas, dans la prochaine existence, l'tage relativement auquel


est dtach

et le saint

incapable de chute ne renat jamais

cet tage.
et l'autre produisent, la

l'tage o


sont ns, l'acte

sentir dans

prsente existence et l'acte indtermin.



L'Arya, non ferme, lorsqu'il est dtach du Kamadhatu ou

du hhavgra, de mme. [16 b]'

L'rya dtach du Kamadhatu



(vi. 36).

L'rya dtach du hhavgra ou naivasamjnnsamjnyatana,

dernier tage de l'Arripyadhatu, est l'Arhat
(vi. 45).

Mme quand
le fruit


sont sujets la chute, c'est--dire susceptibles de

obtenu, ces saints ne produisent pas d'acte sentir,


dans l'existence prochaine,


dans une existence ultrieure,







Nous expliquerons
reconquiert toujours



saint, sujet

la chute,

le fruit

avant de mourir.

L'tre intermdiaire




produit-il des actes ?


a-b. L'tre intermdiaire,


Kamadhatu, produit vingt-

espces d'acte


L'embryon passe par cinq

tats, kalala,

arhuda, pesin, ghana,

praskh. L'homme passe par cinq


tats, enfant, adolescent,



mr, vieillard


L'tre intermdiaire produit des actes dtermins (niyata) sentir

hdod rtsehi mi brtan pa yan min [npi kmgrato 'sthirah] srid pa bar ma hdod khams su / hphen pa rnam pa ni su gnis atidhksipaU kmadhtvantarbhavah /] Vibhasa, 114, 22.


= [dvvitn;

3. Voir ii. 52 a, iii. 19. - Samyutta, i. 206 Buddha's Geburt, 87 et sources cites. Sur

Mahftvyutpatti, 190



vie embryonnaire, notre note


prna, Kosa,


73 a-b.


tre intermdiaire,


53 c-55






Soit onze sortes d'acte

arbuda .... comme dtermin. De mme il



onze actes indtermins.



Ces actes portent leur


dans l'existence actuelle \ [17a

Les onze actes dtermins de

la catgorie


intermdiaire appartiennent

sentir dans l'existence actuelle





Car tous ces

forment avec l'existence intermdiaire

une seule existence ^

L'existence intermdiaire et les dix tats (avasth) qui la suivent

sont projets par un seul acte



Aussi ne distingue-t-on pas

' :

un acte



l'existence intermdiaire

celle-ci est projete,






qui est sentir dans la vie qui suit l'exis-

tence intermdiaire \


vertu de quels caractres un acte


dtermin, c'est--dire

ncessairement rtribu ?

54. L'acte accompli par passion

l'gard d'un

violente ou par foi violente,

champ de

qualits, continuellement, et le

meurtre du

pre et de la mre, sont dtermins

de ni mthon chos hbras bu yin de ni



gcig kho na yin

= [etad drstadharmaphalam] = [ekanikya eva sah]. L'tre intermdiaire

l'tre intermdiaire,

appartient (avec la vie subsquente) un seul nikya.

L'existence intermdiaire et l'existence qui suit ne forment qu'une existence

(nikyasabhga). Donc
l'existence prsente

les actes

mrissant tous dans


son existence intermdiaire ou dans l'existence qui


sont tous

sentir dans



de rtribution (vipka)








est projete par l'acte



dans l'existence suivante, aprs tre ren [une foisj . Hiuan-tsang ... par l'acte upapadyavedaniya, etc. (Ce qui vaut mieux car une existence intermdiaire peut tre projete par un acte sentir dans une existence ultrieure). 4. non mohs rab dad drag po dan / yon tiin zhin dan i*gyun cliags su / byas pa



yin pa dan / pba ma gsod dan de ns so [Hvrakleapras&dena yunaksetre nirantaram j yat kriam nitpitro ca vadho niyatam eva tat


Hiuan-tsang, xv,


16 b-17



L'acte accompli par passion violente, l'acte accompli par foi violente, l'acte

accompli l'gard d'un champ de qualits,



continuellement, cet acte est dtermin.

Par champ de



faut entendre ou bien les trois joyaux,


ou bien certaines personnes, savoir

saints (Srotapanna,
etc.) et les

possesseurs des fruits ou

possesseurs de certains recueilled,

ments {nirodhasampattif







viii. 29).

L'acte accompli l'gard de ces champs,


en l'absence d'une
est dtermin,

pense intense de passion ou de

qu'il soit d'ailleurs


ou de continuit,

bon ou mauvais.
pre ou de la mre, dans (juelque intention

qu'il soit

De mme le meurtre du commis [17 b]


Tout autre acte

klea), etc.

celui qui est fait

avec passion faible (manda-

est indtermin.


vertu de quels caractres un acte est-il senti dans l'existence

actuelle ?


a-b. L'acte porte fruit

dans l'existence actuelle en raison de

de l'intention

certain caractre

du champ


raison de l'excellence du champ, bien que l'intention puisse


tre faible

par exemple


Bhiksu qui devint femme pour avoir

que des femmes

insult le




(striyo yiiyam).


raison de l'excellence de l'intention

par exemple cet eunuque

qui dlivra les taureaux du danger d'tre chtrs, et reprit son sexe \


bien encore

Que ce soit par la pense 1. Le texte porte yath tath ceti. Vyakhy que le meurtre est mritoire (punyabucldhy) ou par haine, etc. Le Perse (prasika) qui tue son pre ou sa mre en croyant faire uvre pie ... (voiriv. 68 d). Hiuan-tsang Meurtre ... avec une pense lgre ou lourde . Paramrtha choai eil sin. 2. mthon chos hbras bu can gyi las / zhin dan bsam pahi khyad par las

[drstadharmaphalam karma] ksetrsayavisesa[tah

D'aprs Vinaya des dix rcitations, 51,


Vibhs, 114,


Ceux qui offensent



mre sont punis dans

cette vie, Divya, 586.

Hiuan-tsang ajoute

De semblables

rcits sont








Et aussi, lorsqu'on est dfinitivement dtach l'gard de


Ttage auquel l'acte appartient,



est dfinitivement dtach

l'gard d'un certain


(iv. 52),

ne peut plus renatre cet tage

par consquent,

l'acte rtribuable

cet tage,

mais dans une autre existence, change

la prsente existence, qu'il soit

de nature

et devient rtribuable

bon ou mauvais.



dtermin quant la rtribution




d'un acte de rtribution ncessaire, mais



quant l'poque de la rtribution


cet acte sera rtribu

dans la vie



dtermin quant l'poque de la rtribution,




rtribu l'poque pour laquelle





actions doivent tre rtribues, sa premire renaissance, dans un

certain tage, ne peut pas se dtacher d'une manire dfinitive de cet
tage. [18 a]



non dtermin quant


la rtribution elle-mme,


ne sera pas rtribu

on se dtache de l'tage o

aurait pu tre

Quel champ confre

l'acte qui


rapporte la qualit d'tre

ncessairement rtribu dans l'existence actuelle ?



tadbhmyatyantavairgyt. rnam smin ns par gan yin paho


= [vipke niyatam ca yat




220, Anguttara.




sentir dans cette vie


tre transform

en acte


sentir dans l'avenir

Le mme problme
huit sortes d'actes


(safnparyavedaniya) examin dans Karmaprajnapti, Mdo, 62, 240 b



y a

sentir agrablement, dsagrablement, dans ce monde, plus

sentir petitement, sentir grandement, mr, non mr. L'acte sentir


chang en acte sentir dsagrachang en acte nu'ir ? Oui et non. Quelques-uns, pour oprer cette transtormation, se coupent les cheveux, la barbe, les cheveux et la barbe, se tourmentent par divers chemins et mauvaises
par nergie et
effort, tre

blement ? Impossible


non mr

peut-il tre



chouent. D'autres, par nergie et







autres ? Oui.
actes arrive


y a

trois actes

existence, plus tard. Arrive-t-il

sentir dans cette vie, la prochaine qu'prouvant le premier on prouve aussi les deux

Quand on

obtient la qualit d'Arhat, la rtribution des deux autres

Hiuan-tsang, xv,


17 b-18







des Bhiksus ayant sa tte




personnes, cinq sortes de personnes


56. Les hommes qui sortent


du nirodha,

soit de la maitr,

de Varan, soit de la vue des vrits, soit du fruit d'Arhat



bien et tout mal leur gard est aussitt rtribu.


qui sort du recueillement d'arrt (nirodhasampatti,



c, viii.


ce recueillement


a obtenu une tranquilest


extrme (nti) de la pense, car ce recueillement


tait all

au Nirvana. Lorsqu'il en sort (vyutthita),

au Nirvana




en revenait.


qui sort du recueillement qui arrte la passion d'autrui


mentale (samtati)




ce recueillement, sa srie

s'est revtue

de l'intention d'installer


dans l'absence de passion (arana)




sa srie

pntre d'un mrite intense (atyudagra

tksna) et sans

mesure. [18 b]


qui sort du recueillement de bienveillance





recueillement, sa srie s'est revtue de



du bonheur de

des tres



srie est pntre d'un mrite intense et sans mesure.


qui sort du chemin de la vue des vrits




a abandonn toutes les passions qui sont abandonnes par

vrits. Lorsqu'il

vue des



sa srie est donc pure, puisque sa

d'tre renouvele (parivrtti).

personnalit (raya

= sarra) vient

le fruit

qui sort du fruit d'Arhat, c'est--dire qui vient d'acqurir



vient d'achever d'abandonner toutes les passions

qui sont abandonnes par la mditation

(hhvan) des



srie est pure, puisque sa personnalit vient d'tre renouvele.


ye nirodhamaitryarandarsancirhatpkaloUhith

krpakdrndm sahasd vedyate phalant



Hiuan-tsang traduit


qui sort du chemin de la mditation

car ce fruit


qui sort du fruit d'Arhat



terme du chemin de


mditation des vrits.


C'est--dire qui sort

du recueillement dans lequel












C'est pourquoi les actions

et mfaits

bonnes ou mauvaises, bienfaits (kra)

(apakra), l'gard de ces cinq personnes, portent un


dans l'existence actuelle (Vibbasa, 154,

Quant aux chemins de mditation par lesquels on obtient

de Sakrdagamin et d'Anagamin,

les fruits

sont incomplets en


dans leur


(apariprnasvahhvaphala). Les hommes qui

sortent de la conqute de ces deux fruits ne sont pas des

champs de

mrite comparables l'Arhat. Leur srie n'est pas pure

nalit n'a pas t

leur person-

rcemment renouvele.
c'est la sensation.

L'lment essentiel de la rtribution {vipka),

La La

rtribution d'un certain acte peut-elle tre exclusivement sensa-

tion mentale (caitasikl),

non pas sensation corporelle (kdyikl)



rtribution d'un certain acte peut-elle tre sensation corporelle,


non pas sensation mentale ? [19




sensation, fruit de l'acte bon


exempt de vitarka,


exclusivement mentale

Les actes du domaine du dliynntara, entre-deux du premier

du deuxime dhyna




et les actes des tages suprieurs


sont exempts de vitarka







la sensation

associe aux cinq connaissances sensibles,


comporte toujours vitarka



32), elle

ne peut tre

le fruit

de rtribution d'un acte exempt de vitarka ^




sensation, fruit d'un acte mauvais, est exclusivement

corporelle \

sensation, fruit de rtribution d'un acte mauvais, est pnible

la sensation pnible mentale est ce qu'on


sensation de dissaseuis kyi thsor


rnatn par rtog pa

med pa


dge bahi

las ni

rnam smin


ha kho nar hdod.

[kualasyvitarkasya vipkah karmano mata / vedana caitasiky eva] 2. En effet, l'acte exempt de vitarka ne peut avoir une rtribution appartenant un tage infrieur et comportant vitarka et vicra (VyakhyR). [aktialasya tu kyiki //] 3. mi dge ba ni lus kyi yin

Hinan-tsang, xv,


18 b-l9



(daiirmanasifendriya). Nous avons tabli que la dissatis(ii.

faction n'est jamais fruit de rtribution

10 b-c)



si la


ou sensation mentale pnible, n'est pas


dans quelle connaissance

connaissance visuelle,


connaissance mentale

se produit le trouble mental ou Irouble-de-

la-pense (cittaksepa) qui est sensation pnible ? Et en vertu de

quelle cause

(krana) se

produit-il ?



est la rtribu-

tion d'un acte mauvais].



Le trouble-mental se produit dans


connaissance mentale


L'expression qu'emploie la karika, manascitta

pense mentale


quivaut l'expression

consacre manovijnna,


mentale, connaissance du nianas \

Les cinq connaissances sensibles ne peuvent tre troubles (ksipta)

[19 b] parce


exemptes d'imagination (avikalpaka),


enqute et mmoire (abhinirpana, anusmarana),


mental est imagination de ce qui n'existe pas {asadvikalpa)



b. Il nat

de la rtribution de l'acte \
nat de la rtribution de l'acte.

Le trouble mental
et des

Celui qui trouble et drange la pense d'autrui par des malfices


qui fait boire du poison ou de l'alcool ceux qui ne


dsirent pas en boire

qui effraye le gibier, soit la chasse, soit en

incendiant la jongle



en creusant des trappes


par un pro-

cd quelconque, trouble la mmoire et la prsence d'esprit d'autrui,

sa pense sera trouble, prive de l'aide de la mmoire (hhrastasmr-

tikam cittam vartate) par



de la rtribution de ces actes ^

l'acte d'attention

Vibhasa, 115,

Le daiirmanasya nat de


comporte forte imagination (vikalpa), est abandonn par

va pas de




de rtribution. (/yens pahi sems ni yid sems la i= cittaksepo [manascitte].



de ce qui est




de ni las kyi rnam smin skyes =: sa ca karmavipkajah

4. 5.

dvas trndigahancito deavisesah.

Paramfirtha ajoute



y a d'autres causes



trouble de la pense nat de cinq causes


rtribution, 2. frayeur, 3. attaque des










la frayeur, l'attaque des




des l-



dmoniaques (amanusya)


d'aspect horrible, s'appro2.


les voir, l'homme s'effraye

sa pense se trouble.


de la mauvaise conduite des hommes, les tres dmoniaques les

frappent aux parties vitales
corps sortent d'quilibre

la pense,


Les grands lments du

et le

le vent, la bile

flegme sont


Le chagrin trouble aussi

Mais, dira-t-on,
si le

par exemple

VasistliT, etc.

trouble mental, ou trouble de la connaissance


mentale, nat de la rtribution de

[20 a]

comment peut-on



la sensation

mentale n'est pas rtribution ?


Nous ne

disons pas que

trouble de la pense



skrag gnod


= attaque des dmons


ma mnam mya

iian gyis




mal qui en

comp. JatakamSl,
99 c-d



D'aprs Vibhfis, 126,


Sur les amannsyas, Kosa, 344 de Cosmologie bouddhique.







203, Milinda, p. 207, Sukbavatvyha, 39, SiksSsamuccaya, p. 351.


Abhisamayalamkrloka (ad Astashasrik,



pretdir amamisyah.

4, 23.

Bliagavn Mitlii3. gnas byed kyi bu la sogs. La Vyakhya cite le Stra Ukyin(?) viharati sma Mithilmravane I tena khalu punah samayena Vasisthasayotry brhmanynh sat putrh kagath / sa tesm klakriyay naynonmatt ksiptacitt tena tevmihindati .... Et le reste jusque, aprs la mort du septime enfant, l'entretien de Vasislli avec son mari Jadis

tu t'affligeais de la

mort de tes


maintenant tu n'es pas


afflige. C'est


doute que tu as mang tes



putrs tvay bhaksith)

rpond (comp. Thergatba, 314)

putrapautrasahasrnijntisantghaatni ca / dlrghe 'dhvani maya brahman khditni tath tvayd


putrapautrasahasrnm parimnatn

lui vidyate

tsu tspapattisu // paritapyeta parideveta va punah j jdtvA nihsaranafft lokejte ca maranasya ca // sham nilisaranatft jntvA jte ca maranasya ca j na ocmi ia tapymi krte buddhasya sane II Lire V&sitbl (et non Vasistlia) dans le joli morceau o Bhagavat exalte

anyonyam khdyamndnm




de sa prdication, Sl^filamkara, trad. Huber, p. 205.




19 b-20



nat de



de rtribution, mais qu'il nat de la

rtribution de l'acte. Les grands lments l'tat de dsquilibre sont


pense trouble en procde

elle nat

donc de la





que la pense est trouble lorsque, en raison du ds-

quilibre ou de l'irritation des


humeurs, qui rsulte de

l'acte, la


drange (prcikopa), anarchique (dba-med


soustraite la direction de la

mmoire (blirastasmrtika).

Quatre alternatives


Pense trouble (ksipta) sans tre dsor;

donne (viksipia)


pense non souille (aklista) mais trouble


pense dsordonne sans tre trouble


pense souille, mais





du hdug pa

= svastha ?)


pense trou-

ble et dsordonne


pense ni trouble ni dsordonne].

trouble de la pense ?

Chez qui se produit





les tres

du Kmadhtu, l'exception des Kurus



dieux du Kmadhtu,

y a des dieux fous (unmattaka)


plus forte raison, des fous parmi



Prtas, les

Les damns (nraka) ont toujours la pense trouble
vitales sont

leurs parties

incessamment heurtes par des

sont crass

milliers de tourments




= paripldita)

par la souf-



ne se connaissent pas eux-mmes, plus forte raison ne


pas ce


faut faire et viter.

Donnons comme




qui se lamente en disant



l'exception du

Bouddha [20

b], les

ryas ne sont pas exempts

dsquilibre des

du trouble de


leur pense peut tre trouble la suite du


(vaisamya) des lments. Mais

lments n'est jamais, dans leur cas, rtribution

car les actes




dont la rtribution pouvait produire


trouble de la pense

sont rtribus avant qu'on obtienne le chemin, et les actes


mins 'ne porteront pas de




le fait




est obtenu.

sgra mi san min hdod Idan rnams

= [akururgisii









la frayeur, ni l'attaque des tres


ni le chagrin


peuvent troubler la pense des ryas, car


sont au dessus des cinq


n'accomplissent aucun acte dsobligeant (aprasdika)


qui excite la fureur des tres dmoniaques,

connaissent fond la

nature des choses ^

Le SQtra enseigne
du corps, de


y a

trois tortuosits (kaniilya), tortuosits


la voix, de la


et aussi

trois corruptions


et trois teintures (kcisya).



Ce qu'on


tortuosit, corruption, teinture ^ c'est

n de l'hypocrisie, de

la haine, de l'attachement.

L'acte du corps, de la voix ou de la pense qui nat de l'hypocrisie

(sthya), procdant du tortueux (kiitilnvaya), est






l'acte qui nat

de la haine (dvesa), procdant de


la haine, est


corruption (dosa)

l'acte qui nat

de l'attacheteinture

ment (rga), procdant du colorant (rahjana),

\ [xvij




c-d. L'acte est

de quatre espces, blanc, noir,

l'acte est


Le Stra * enseigne que


de quatre espces

noir, de rtri-

1. Les cinq craintes sont jvikbhaya, aslokabhaya (= akrti), parisacchradyabhaya (= sabhym samkucitya), maranabhaya, dttryatibhaya (VibhasS, 75, 2). Voir MadhyamakavrUi, p. 46. Les lectures de Dharmasam-

graha, 71, sont fantaisistes.



tout ce qui est impur (ssrava) est douloureux,

les dJiarmas sont insubstautiels . yon skyon snigs mar gsuns pa ni / [/yo dan zhe sdaii hdod ehags skyes [kautilyadosakasyoktam thyadvesargajam /J Dans Vildiaiiga, 368, rga, D'aprs Janaprasthana, 11, 6; Vibhasa, 117, 9. dvesa et moha sont kasva. Mais Aguttara, i. 112, distingue le vanka, le dosa et le kasva. 4. La couleur (kasya) est ranjanahetu, cause de teinture, comme l'attache' ment (rga) qui, en eiet, attache et teint (ranjayati). [krsnaukl^ 5. dkar nag la sogs bye brag gis / las ni rnam pa bzhi yin no dibhedena karma bhavec caturvidham] 6. Madbyama, 27, 12; Vibhasa, 114, 1; Agultara, ii. 230; Digha, iii. 230; AtthasaUnT, p. 89 Netippakaruna, 158, 184. AAguttara, iii. 385 akanham

les conditionns sont






asukkam nibbnam


Hiuan-tsang, xv,
billion noire



b-xvi, fol. 1 b.


blanc, de rtribution blanche


noir-blanc, de rtribution


ni noir ni blanc,

sans rtribution noire ou blanche, et

qui dtruit les autres actes.

60. Les actes mauvais,

les actes

bons du Rpa,

les actes

bons du

Kama, sont respectivement


blancs, noirs-blancs


dtruit les autres actes est l'acte pur. [1 b]


L'acte mauvais, tant souill (klista), est absolument noir; sa

rtribution, tant pnible


(aiuanojna), est noire.

L'acte bon du domaine du Rpadhtu, ne se mlant pas avec le


mauvais, est absolument blanc

blanche (Voir ci-dessus

sa rtribution, tant agrable, est




Objection. Pourquoi

ne pas en dire autant de

bon du

domaine de l'rQpyadhtu ?

Parce que, dit-on


la qualification



s'applique seulement l'acte qui comporte une double rtri-

bution (dans l'existence intermdiaire et dans une existence propre-



ntarbhavika, aupapaUibhavlkavipka



qui est

corporel, vocal et mental.



du domaine de l'rpyale

dhtu ne prsente pas ces caractres.

elle est

Stra dcrit


du domaine d'rQpyadhtu



de rtribution blanche \
se mlant au mauvais,

3. L'acte bon du domaine du


est noir-blanc

sa rtribution est mle,

donc noire-blanche.

Cette dfinition s'entend en se plaant, non pas au point de vue de

la nature de l'acte

lui-mme, mais au point de vue de la





1. mi fige gziigs dai hdod gtogs pahi / dge ba iiid ni rim bzhin du dkar dan gnis kahi las / de zad byed pa zag med yin [aiibham rpa]kmptam [siibhani eva yathkramam /

gnag dan

krsnastiklohhayam karma tatksayakrcl ansravam Comparer Yogastra, iv. 7.



C'est la rponse des troisimes matres, Vibhs, 114,









une existence

et l'existence intermdiaire

qui y


13 a-b).


n'y a pas d'existence intermdiaire prcdant la renaissance

dans l'rpya.
asti karma nhlam uklavipkam tadyath 4. La Vyakhy cite le Stra prathame dhyne evatn yvad bhavgre.

de la personne




dans une


srie mentale, l'acte





n'y a pas d'acte qui soit noir-blanc, ni de rtribution


qui soit noire-blanche, ce qui impliquerait contradiction






mle aussi avec







doit tre dfini





mauvais ne se mle pas ncessairement

tandis que, dans le


bon se mle ncessairement

au mauvais, parce que, dans


cette sphre, le


est plus fort



4. L'acte

pur dtruit


trois autres



N'tant pas

souill [2 a] (aklista),


pas noir

n'ayant pas de rtribution

n'est pas blanc,







du Stra, asukla,




gavat veut opposer




mais, parlant dans

s'exprime ainsi

dharmas propres l'Arhat (asaiksa), il Les dharmas d'Arhat, nanda, sont absolument


blancs, absolument bons, absolument irrprochables

le Trait

Et on



Quels sont les


blancs ? Les bons



et les



L'acte pur n'a pas de rtribution, car

n'est pas

du domaine des

sphres d'existence




arrte le processus de l'existence ^

1. Voir iv. 1. samtnata etad vyavasthnam iti ekasmin samtne kMalam ckualarn ca sanmdcaratiti krtv kualam aknalena vyavaj

kryate. (Vyfikhya)




consquences de cette thorie du mlange, Aiigulp. 218).

249 (traduit par Warren,



recueillement (samdhi), qui est l'adversaire du




dfaut dans






seul Kamadhfitu, que



les racines

de bien par

vue fausse (tnithydrsti)

mais jamais on

ne peut y arracher la vue fausse par la vue droite (samyagdrsti), 3. Le Theravadin, Kathavatthu, vii. 10, soutient que les actes supramondains

comportent rtribution.

tra (Vyakhyfi).

Le texte porte tnahatym nyatym, c'est--dire mahnyatrthiis Madhyama, 49 ekntaukl Ananda aaiksadharm, ekn:



G, 9;



ne correspond pas).


Vibhasa, 114,



kual dhar-


avykrt ca dharmah.

avipakam dhatvaputitatvt pravrttivirodhatah.




Faut-il penser

xvi, fol. 1 b-2 b.


que tous

les actes purs, quels qu'ils soienl, dtrui-

sent tous les actes des trois premires catgories, noirs, blancs, noirsblancs, quels qu'ils soient ?

61. Une
volition (cetan) de

douze espces


la volition


des huit premiers chemins d'abandon dans le

dtachement du Kmadhtu

tel est l'acte

qui dtruit l'acte noir ^

Quatre volitions correspondant aux quatre dharmaksntis du

chemin de


vue des vrits


volitions correspondant

aux huit

premiers chemins d'abandon (nantaryamrga) dans


(vairgya) du Kmadhtu

en tout douze volitions, autant d'actes

purs qui dtruisent l'acte mauvais.





du neuvime,



qui dtruit l'acte

noir-blanc ^
volition qui correspond

au neuvime chemin d'abandon dans

b], c'est l'acte

dtachement du Kmadhtu [2

pur qui



ner l'acte noir-blanc et l'acte noir, car ce

moment on abandonne,
(lequel est noir-blanc)

dans son ensemble,

et la


bon du Kmadhtu


et dernire catgorie

de l'acte mauvais.



volition qui nat

aux derniers chemins d'abandon du


dtachement des dliynas, dtruit

bon \

ne sont ni clhUi, ni intgrs aux dhtus (na dhtur



Sur ce qui engendre (janayati)


et arrte


processus (pravrtti),

chos bzod hdod chags hbral ba yi


pa rnam pa bcu gnis

/ bar cbad med lam brgyad kyi gan nag po zad par byed pabi las //


[dharmaksntikmavairgynantaryapathstasu / krsnasya ksayakrt karma dvdaavidhacetati //] Cbaque moment du cbemin est un complexe psychologique qui comporte, parmi
d'autres mentaux, la cetan ou volition D'aprs la dfinition, iv. 1 b, cette cetan est l'acte. Les quatre dharmaksntis, vi. 25 c le dtachement du Kmadhtu, vi. 49. [krsnau2. dgu pahi sems pa gan yin pa / de ni dkar nag zag byed yin klasya ksayakrd y navamasya cetan /]. 3. dkar po bsam gtan chags hbral la / bar chad med lam tha mas skyes


uklasya dhynavairgyesv [nantaryapathntyaj





62 c-64



du neuvime

et dernier

chemin d'abandon qui produit


dtachement l'endroit de chaque dhyna

quadruple volition

qui dtruit l'acte blanc.


Les huit

premiers chemins d'abandon dans


le dta-

chement du Kamadhatu dtruisent

concerne les actes noir-blanc






blanc (actes bons et impurs


ssrava), c'est seulement au neuvime chemin d'abandon que vous

attribuez le pouvoir de les dtruire. Pourquoi ?

n'y a pas, proprement parler,

abandon des dharmas bons,



mme abandonn


dharma bon


lorsque la passion (klesa) qui a pour objet ce


est dtruite,


que ce



abandonn. Donc aussi longtemps que



pas dtruite la dernire catgorie de passion qui peut

prendre pour objet, ce

dharma bon


pas considr


abandonn. [Or

c'est le

neuvime chemin d'abandon qui rompt


prpti de


neuvime catgorie de passion




(Kamadhatu, dhynas)

par consquent,

qu'on obtient la



d'avec cette passion]


a-b. D'aprs d'autres, les

deux premiers actes sont


cehii qui

est rtribu en enfer et celui qui est rtribu ailleurs


dhatu. [3 a]


D'aprs d'autres matres (Vibhasa, 114,2) l'acte 'qui doit tre

senti en enfer


est l'acte noir

l'acte qui doit tre





ailleurs qu'en enfer, est l'acte noir-blanc.

lii tasya (kualasya) svabhAvaprahnam iti prpficcheilah prahprahnasypi kualasya sammukhlhhvt / tadlambanakJeasya prahnt tasya kualasya prahnam bhavati / tadlambanakleaprahnam ca navamasya tadlambanakleaprakrasya prahne sati bhavatUi navamnantaryamrgacetanaica krsnauklasya karmanah ksayya bhavati I tad hi navamasya Jileaprakrasya prpticchede visamyoyaprptir ntpadyate / tasya ca krsnasnklasya karmano 'uyasypi cCinicrtvy&krtasya ssravasya dharmasya visamyo(juprptir ulpadyate. (Vyakhya) 'i. gzhuii ni dmyul ba iiiyon hgyur du // hdud g/han myoi hgyur gilis su rig =i [nraktyafft (narake vedyam) anye kme 'nyatra vedyam dvayani viduh\





xvi, fol.

2 b-3



rtribution infernale est produite exclusivement par l'acte



vais (akiiala)
est l'acte noir.
l'enfer, est

par consquent,

l'acte qui doit tre senti

en enfer


rtribution dans le


l'exclusion de

produite exclusivement par l'acte bon-mauvais (c'est--dire


par l'acte bon ml l'acte mauvais)

l'acte noir-blanc.

par consquent cet acte est



D'aprs d'autres, ns du Kania, les actes sont noirs lors;

peuvent tre abandonns par la vue des vrits



sont noirs-

blancs dans

cas contraire


D'aprs d'autres matres (Vibhasa, 114,


l'acte qui est



par la vue des vrits, n'tant pas ml avec

autre acte du



est noir.


domaine du Kamadhatu, savoir

l'acte qui est

donn par


mditation, est noir-blanc, c'est--dire bon ml de

Le Stra



y a

trois silences (matinet/a), silence


du corps,

silence de la voix, silence de l'esprit



Asaiksas, c'est--dire propres l'Arhat,

l'esprit, sont,


du corps,

de la voix et


l'ordre, les trois silences

[3 b]

1. drgheyam krsnam [anye] 'nyat krsnasiiklam tu kmajam jj Littralement L'acte abandonn par la vue est noir tout autre est noir-blanc lorsqu'il nat du Kuia . Objection il faudrait dire kmiacaram drgheyam krsnam : L'acte du domaine du Kamadhatu qui est abandonn par la vue, est noir en effet, il y a des actes abandonner par la vue et qui n'ont pas une rtribution Rponse noire, savoir certains actes du domaine du Rpa et de l'rpya. le qualificatif kmaja, n du Kma (c'est--dire du domaine du Kamadhatu), porte



premier pada.



na drstiheyam akUstam,






4; Anguttara,

273; Dgha,
la qualit




Suttanipla, 700,

nit va


moneya, c'est

de Muni ou l'acte d'un Muni [mup.


Childers (Supplment,


conduct worthy of a



x. 136. 3

Col. Jacob, Concordance,

idam maunam.

p. 748,


la valeur


muni dans


et la Gta.

aaiksam kya[vk]karma

eva [yathkramam]

p. 346,








la voix, c'est l'acte

Ce qu'on
du corps,



du corps, silence de

l'acte de la voix

propres l'Arhat

Ce qu'on




est le vrai

c'est l'esprit, la

pense propre l'Arhat

ce n'est pas l'acte de l'esprit

que la pense

(mandhkarman). Pourquoi ? Parce Silencieux, le vrai Muni \ Les Vaibhai-

kas disent qu'on


par induction

en raison des actes du corps


de la voix



pense est


pense est aaiksa


Mais, dirons-nous, l'acte du corps, l'acte de la voix propres l'Ar-

hat (aaiksa) sont




(virati) de leur nature, tandis que



l'esprit n'est




de sa nature, parce

qu'il n'y

a pas d'avijnapti de la pense


ce qu'on entend par




c'est l'abstention




donc l'esprit


qui s'abstient

(viraia) qui reoit le


de silence.

Et pourquoi


propre l'Arhat

reoit-il seul ce


? Parce

que l'Arhat
tion de tout

est le vrai silencieux

(paramrthamtmi) par

la cessa-

murmure de passion (sarvaklesajalpoparateh).


Le Stra


y a

trois purifications

(auceya), purification

du corps, purification de

la voix, purification de l'esprit .




reoit le


de tnuni

triple silence, dfini



ou silence





mais des actes qui

ne s'agit pas de tous les actes corporels et vocaux qu'un Arliat peut accomle caractrisent comme Arhat ou Asaiksa (vi. 45). Les

actes en question sont de leur nature avijnapti, non-information

le silence


corps est donc Vavijnaptl-du-corps caractristique de l'Arhat. Les actes qui sont

vijnapti (kyavijnapti, vgvijnapti) sont ncessairement impurs (ssrava) et on ne peut leur attribuer la qualit asaksatva. (Voir ci-dessus p. 23 au bas) 2. mana eva manomaunam. Ici matina muni, d'aprs la rgle svrthe



M paramrthamunih.


kathain tathyaio "ntimdtavyah

prantena kya-

karman prantena vkkarman.





L'acte du corps et de la

voix sont abstention de leur nature. L'acte de l'esprit est exclusivement cetan



ne comporte pas de vijnapti, on ne peut pas, en connaissant

qu'il est silence .

par induction qu'il est abstention, dire



5. H







Uni soceyyni kaya-

soceyyatfi vacisoceyyam



xvi, fol.








bonne pratique toute

entire est la triple purifi-

Les bonnes pratiques du corps, toutes

corps, impures (ssrava)


bonnes pratiques du

ou pures, sont purification du corps, parce

d'une manire dfinitive, elles effacent

que, soit pour

un temps,


la souillure des passions et des

mauvaises pratiques (duscaritama-


De mme pour

la voix et



Cet enseignement a pour but l'instruction des

nent un faux silence pour


qui pren-

le silence,

une fausse purification pour la

Le Stra "

dit qu'il

y a


mauvaises pratiques (duscarita).




Les actes mauvais du corps, de la voix






tant les trois mauvaises pratiques. [4 a]

Les actes mauvais du corps sont la mauvaise pratique du corps,

et ainsi

de suite










vue fausse, bien que

yin no =t

legs spyod gsuni po

thams cad

gtsan byed rnam pa


saucam] sarvasiicarita[trayam
arrter, faire cesser.

// ]

mithydmaunasaucdhimuktnm vivecanrtham




Arrter les gens qui croient qu'on obtient

puret (suddhidarsin) par

les ablutions

seul fait de ne pas parler


ou par



faux silence

et le

silence des


Theragth, 650, Sultani-

pta, 388, Samyutta,

273, Anguttara,

153, 359, v. 266,


iv. 1.



42, 60

rnaunn na


munir bhavati.


les ablutions,

Thergath, 236, Udfina

9 (Udanavarga,




ryadeva, Ciltavisuddhiprakarana.
a-c (superstitiofis
14, 4





v. 7,

8 (silavrata).




214, Anguttara,

49, 52, etc.


v. 75.

4. lus kyi la sogs mi dge ba /lies par spyod pa gsum astibham duscaritatrayam matant /] 5. La volition mauvaise, ou acte mauvais de l'esprit,

du hdod =r [kyikddikam

mauvaise pratique de







n'tant pas des actes, constituent une triple mauvaise pratique de





y a


mauvaises pratiques de

l'esprit qui,

de leur

nature, ne sont pas des actes


la convoitise (abhidhfj),

mchancet ou nuisance (vypda)

et la

vue fausse (mUliydrsti)

et la

Le Darstantika
fausse sont, en


que la convoitise, la mchancet



des actes mentaux, car elles sont considres



des actes dans



Le Vaibhasika.
seraient la


cette hypothse, la passion (klea) et l'acte


Le Darstantika. Le

Quel mal y voyez-vous ? Admettre que la passion Vaibhasika.

donne de

est acte, c'est contre-

dire le Stra et la dfinition qu'il

l'acte (iv. 1 b).

Quant au

SamcetanTyasQtra que vous allguez,

entend dsigner lorsqu'il

la volition



parce que la volition entre

en exercice (pravrtti) sous l'influence (mukliena) de la convoitise.

Parce qu'elles produisent une rtribution pnible, parce qu'elles

sont blmes par les gens de bien, ces pratiques du corps, de la voix
et de l'esprit sont





donc mauvaises



1. brnab sems la sogs las iiiiii yaii / yid kyi fies spyol yani apy abhidhycU nianoduscaritain tridh II ]



mo =



L'acte mental,


est exclusivement volition, cetan, iv. i b.


drstntikli saiitrCintikavies ity arthah (Vyakhya).



78 c-d

o celte doctrine est attribue aux Sautrntikas.

Cette discussion est tire de Vibbasfi,

11.3, 14.

Madhyama, 18, 14 comparer Angutlara, v. 21^2, Majjbima, iii. 207. Notre Stra porte isamcetaulyam karma krtvopacitya narakesilpapadyate katham ca bhiksavah sntftcetanlyam karma krtam bltavaty upacitam / iha bhiksava ekatyah samcinfya trividham kyena karma karoty upacinoti caturvidhafn vc trividhatfi manas .... f katham bhiksavas trividham manas satftcetanlyam karma krtatn bhavaty upacitam ihaikatyo 'bhidhylur bhavati vydpanna^citto yvan mithydrsti\ka]h khalu bhiksava ihaikatyo bhavati
I /



Ce SQlra ne signale pas c'est Vabhidhy, etc. qui est

d'acte mental en debors de

l'acte mental.




Hitian-tsang, xvi,






La bonne pratique

est l'oppos


Le contraire de

mauvaise pratique

est la

bonne pratique


bons du corps, de la voix, de

et la

en outre, la non-convoitise, la

vue droite (samyagdrsti). [4 b]

Comment la vue fausse et la vue droite peuvent-elles tre regardes comme mauvaise, comme bonne (akuala, hiiala) ? En effet, la

premire ne comporte pas l'intention de faire du mal, la seconde ne

comporte pas l'intention de


du bien autrui (parmigraliopa-


Sans doute, mais

elles sont la racine

de cette double intention.




prenant, parmi ces pratiques, les plus videntes, on

dfinit les dix cliemins-de-l'acte,

respectivement bons et mauvais \

Le Stra

dfinit dix chemins-de-l'acte


bons che-

mins, en prenant les plus graves, les plus faciles voir, parmi les

bonnes pratiques

mauvais chemins, en prenant

plus graves



mauvaises pratiques.

Quelles pratiques, mauvaises et bonnes, ne sont pas comprises



chemins de

l'acte ?

N'est pas comprise



chemins de


une partie des

prparatif et

mauvaises pratiques du corps, savoir


conscutif des chemins-de-l'acte du corps (prayoga, prsthahhta,



c), (2)

certains actes souills (klista) du corps, par exemple

lier, etc.

boire de l'alcool, frapper,




parce que ces



ne sont pas extrmement graves. Parmi


pratiques du corps sont chemins-de-l'acte celles qui privent autrui


bzlog pa legs par spyod pa yin


[viparltam sucaritam].








La mithydrsfi

est dfinie iv. 78 b-c.

Elle est



vajja, Visuddhi-

rnagga, 469


produit tout mauvais


3. [tad]audrikasamgraht bhuhhh // ] Madhyama, 3, 16, Samyukta, 37,

dharma, Majjhima, iii. 52. [dasa karmapatha ukt] yathayogam







xii. 2-7.

de la



66 b-67.

de ses biens, de son pouse, [5 a] car

faut absolument

s'en abstenir.

Ce qui
pour la

est trs

grave dans la mauvaise pratique de la voix,



raison, dclar

chemin de


non pas

le prparatif,

conscutif et les actes lgers.


partie de la

mauvaise pratique de


savoir la volition

(cetan) est aussi exclue des mauvais chemins-de-l'acte

Quant aux bons chemins-de-l'acte,

partie de la


ne comprennent



3. ni

bonne pratique du corps


prparatif, conscutif; abstenculte,


tion de la boisson enivrante, etc.


2. ni

partie de la

bonne pratique de

la voix, parole affectueuse, etc.

l'esprit, la

une partie de

bonne pratique de




les chemins-de-l'acte,



Six mauvais peuvent tre exclusivement


amjnapH \


excuter par autrui




meurtre, vol, mensonge [5

parole inconsidre

parole maligne, parole injurieuse,

ces six chemins de l'acte

sont seulement
la vijiapii


celui qui fait excuter ces actions


principale, c'est--dire l'acte


de tuer,



Hiuan-tsang ajoute

la convoitise lgre, etc.

madyddivirati, c'est--dire madyatdanabandhandivirati ; comparer Digha iii. 176. dnejydi (sbyin, iiichod sbyin) par di, entendre snapanodvartanavisanta(?)hastapradnddi. ijy est presque synonyme de dna ; offrir-nourrir Hiuan-tsang traduit kong-yng pilj snapana et udvartana peuvent tre des actes de pj. Mahavyutpatti, 245, 378-379 (snpana, utsa* dana), dition de VVogihara.


priyavacanadi ; par di, entendre dharmadeanmrgakathandi. Toute la discussion qui suit d'aprs Vibhftsft, asubhh sad avijnaptih.


La vijnapti (dans

resjSce, acte vocal) par laquelle j'ordonne

un meurtre,
et n'est


fait partie

du prparatif ('prat/o^aj de ce meurtre



chemin-de-l'acle. Elle n'est pas


vijnapti, vijnapti prin-

L'action de meurtre dont je suis coupable et revtu est

donc seulement


xvi, fol.

4 b-5





Un mauvais

est toujours des

deux sortes

L'adultre est toujours vijhapti et avijnapti, car

ptr en personne.


doit tre perautrui,


Quand on



commettre par


procure pas



67 b. Des mme \

deux sortes aussi

les six, lorsqu'on


excute soi-


excute soi-mme,



si la

spcifis ci-

dessus (67 a) sont la fois vijnaptl et avijnapti

mort a



au moment


de la vijhapti (c'est--dire au

moment du coup

par lequel on veut tuer)




mort a

lieu plus tard,



bons chemins de




Sept bons sont des deux sortes \

l'acte matriels (rpin), c'est--dire

Sept chemins de

du corps


de la voix, sont des deux sortes, vijhapti



effet la

moralit d'engagement (samddnalla) dpend d'une vijhapti.



Ns du



sont seulement avijnapti ^


Sont qualifis

ns du recueillement


chemins de






dans la discipline de


dans la discipline pure. Ces deux disciplines dpendent de la seule




chemins ne sont donc pas vijhapti \


de gslian byed du bcug de dag kyat byed



ni de

dan hdra bar dgah ba ma yin

j ].




vol, etc.




Six mauvais sont certainement avijnapti

accomplis en personne, et l'adultre sont des deux sortes.


y a mort,

etc. .


en va du

comme du



dvividhh sapta kualh



L'abstention du meurtre est un chemin de l'acte matriel.

Lorsqu'on acquiert

la moralit

d'engagement (samdnaslla),

c'est--dire la discipline

de PrSti-







du prparatif (prayoga)

du conscutif (prstha)


de l'acte principal ou chemin-de-racle proprement

(maula kar-




Les smantakas sont vijhapti


Les smantakas ou prliminaires sont

les actes qui




chemin-de-l'acte du domaine du Kainadhatu.



toujours vijhapti




b. Ils

peuvent tre ou ne pas tre avijhapti ^

Lorsqu'ils sont accomplis avec une grande violence de passion



47, hrikya,


82, etc.) [6 a], ou avec une


extrme puissance de
avijnapti. Sinon, non.


22), ils sont



Le contraire en ce qui concerne

les conscutifs \

Les conscutifs au contraire sont ncessairement avijnapti.

sont vijnapti lorsque,


cbemin-de-l'acte tant achev, on continue

commettre des actes analogues au chemin-de-l'acte.

moksa, il y a ncessairement vijnapti (dans l'espce, la dclaration Je renonce prise d'autrui au meurtre ), car cette discipline est toujours (parasmd diyate) (iv. 28). Lorsqu'on obtient le dhyna, ce qui suppose l'abandon, au moins provisoire, des passions du Kauia et des actes mauvais on acquiert
: '


mme, sans qu'aucune vijnapti soit ncessaire membres du Noble Cbemin). Celle moralit ne dpend pas d'un engagement (samdna) ; elle rsulte de la nature mme des choses (dharmatd) : le possesseur du dhyna possde celle avijnapti qui est l'abstention du meurtre. [Note du traducteur.)

du meurtre par

le fait



lorsqu'on obtient la discipline pure (trois


sitiantaks tu vijnaptih
avijnaptir bhavet de


na vd


bzlog pa mjug yin no =prsthatti

viparitam= [tadviparyayatah prstham]

proprement dit est cre une avijnapti qui va .se contiaprs nuant et qui est conscutif en outre on peut, aprs avoir commis l'acte frapper la bte avoir tu la bte commettre des actes analogues l'acte morte, couper sa chair, etc. (tasya karmapathasya anudharmam anusadratn

Au moment


cliacun de ces actes est conscutif.


xvi, fol.

5 b-6



Qu'est-ce qui constitue le prparatif, le chemin de l'acte proprement

dit, le

conscutif ?


Un homme,

dsirant tuer une bte (pasu), se lve de son



de l'argent, se rend au march, palpe la bte, achte la bte, l'emla tire, la fait entrer, la maltraite,



couteau, frappe la

bte une fois, deux fois

aussi longtemps qu'il ne la tue pas, aussi

longtemps dure


prparatif du meurtre.


coup par lequel

prive la bte de la vie



moment o la bte meurt la vijnapti de ce moment et Vavijnapti

qui est simultane cette vijnapti, c'est le chemin de l'acte propre-





en raison de deux causes que l'on est touch par


pch de meurtre

en raison

du prparatif





l'achvement du

[du prparatif]

Les moments qui suivent, moments de Vavijnapti cre par

meurtre, sont



[6 b] sont aussi le conscutif la srie des

le cuir

moments de vijnapti
dre, cuire,


de la bte, laver, peser, ven-

manger, se



De mme

faut-il expliquer,



changements ncessaires,
vue fausse,


six autres chemins-de-l'acte

du corps

et de la voix \
et la

la convoitise, la



n'y a pas lieu

elles se

de distinguer prparatif et conscutif

La description qui

au moment o


... si, avec une pense de 1 mauvais acte du corps ffe/avijnapti) et Vavijnapti de ce moment, c'est le meurtre proprement dit ... Le chemin-de-l'acte proprement dit (ou meurtre) 2. phalaparipritas ca. est l'achvement du fruit du prparatif; qui prpare le meurtre (yo lii prayujyate), mais ne produit pas le meurtre (ntaulantkarmapatham na janayati), fruit du prparatif mais non pas achvement, complet ion, de ce il y a pour lui fruit (tasya prayogaphalam astina tu phalapariptirih) 3. iha kascit parasvam hartukmo maicd uttisthati astram grhnti paragrham rjaccliati supto na vety karnayati parasvam sprsati yvan na sthdnt pracyvayati tvat prayogah / yasmin tu ksane sthnt pracyvayati tatra y vijnaptis tatksanik cvijnaptir ayant maulali karmapa1.

suit d'aprs VibhSs, 113,


dtruit la vie d'autrui (prnfipta), le



dvbliytn hi

kdranbhym adattdnvadyena

tah phalapariprita ca

yvat tat parasvam asya vijnaptiksan api prstham bhavanti (Vyakhy).

sprsyate prayogatatah parant avijnaptiksanh prstham bhavanti / vibhajate vikrnte gopayaty annkrtayati va tvad


le seul fait




de leur prsence (samniukhlbhvamtrena),

elles sont cheniin-de-l'acte






question se pose. Le chemin-de-l'acte


constitu par la vijhapti et Vavijnapti du



moment o l'animal maranbliava\ c'est--dire du moment o l'anifaut-il

mal meurt ? ou bien


la vijnapti et


du moment o l'animal est dans




moment o



mort ?

Si vous acceptez la premire bypotlise,

bomme sera coupable du moment mme o meurt la


pch de meurtre quand

bte tue


meurt au

ce que votre systme (sid-

72 a-b) n'admet pas. Et dans la seconde hypothse, vous


tort que

au coup par lequel



prive la bte de la vie, la

vijnapti de ce


Vavijnapti simultane cette vijnapti,


c'est le chemin-de-l'acte


[Vous auriez d


mrte prnini y vijhapth mal est mort .... ] [7 a].

La vijnapti

qui a lieu lorsque l'ani-


outre, si vous acceptez la seconde hypothse, vous contredisez




Vaibhasikas donnent de la phrase


lorsque le


n'a pas disparu





MlasOstra (.Tnana-

prasthana, 11, n). Ce Sastra dit




vivant soit

dj tu et que le meurtre ne soit pas pass ?

Oui, lorsque, l'tre

n'a pas

vivant tant dj priv de la vie, le

prayoga [du meurtre]



Les Vaibhasikas (Vibhasa,

expHquent ce texte en

disant que le

mot prayoga



normalement prparatif



sens de conscutif (prstha).

Or vous contredisez


explication puisque, plaant le chemin-de-l'acte principal au


o l'animal


mort (mrte prnini),

c'est bien le chemin-de-l'acte

principal qui, d'aprs vous, n'a pas disparu au

moment o

Le tnaranabhava est dfini iii. 13 c-d. et que le meuiire ne soit pas dtruit hatah prntipta ctumddhah (ma hgag pa yod dam)



syt prani

3. (Iper


sroy chngs kyi srog bcad la sbyor ba

med par ma gyur pa







= n'a pas disparu = aviyata




uparata, nivrita


wi ch wi

est mort.

xvi, fol.

6 b-7




interprtez le

mot prayoga du Sastra dans


d'acte principal.

Le Vaibhasika.


faut expliquer le Sastra de telle manire qu'il

ne prte pas la critique.

Et comment cela ? Dans


le texte






lorsqu'on envisage le


qui suit immdiatement la mort de

lorsqu'on envisage les

dit la


qui suivent ce
le conscutif.]


prayoga signifie, Mais comment

Le Vaibhasika.

la vijnapti

du moment o l'animal

est dj

pourrait-elle tre le chemin-de-l'acte principal ?

Pourquoi ne

le serait-elle

pas ?

Parce qu'elle est inefficace. [L'animal est mort

on ne

le fait


mourir nouveau.]

Le Vaibhasika.


comment Vavijnaptiy
Ce qui

qui est toujours


inefficace, est-elle chemin-de-l'acte ?

qu'une vijnapti

une avijnapti sont chemin-de-l'acte, ce

le fait qu'elles

n'est pas leur efficacit


se produisent

au moment de l'achvement du



Arrive-t-il qu'un

chemin de

l'acte soit le prparatif




d'un autre chemin de l'acte ?

Oui. Par exemple les dix chemins de l'acte peuvent tre le prparatif

du meurtre. L'homme qui dsire tuer son ennemi, [7 b] pour



succs de cette entreprise, prend



bien d'autrui et offre

une bte en

l'adultre avec la

au moyen du mme bien vol, il commet femme de son ennemi pour faire d'elle une comil

par des paroles menteuses, malignes, injurieuses, frivoles,


1. Bhsya Vaibhsikair asya stravkyasyaivam artho vykhytah / atra sstre prayogaabdena prstham uMam iti j asyrthasya virodhah / maulasyaiva tadnlni aniruddhatvt j Vaibhasika ha / yath na dosas tathstu I kathant ca na dosah / mania evtra prayogasabdenoktah j 2. Bhfisya vijnaptis tarhi tad katham maulah karmapatho bhavati f

kaiham ca na bhavitavyam

asmarthyt / avijnaptir idnm katham / bhavati tasnit prayogaphalapariprikle tad iibhayam karmapathah syt /. maiilakarman. Le chemin de l'acte principal prayogaphala a donc lieu prnino mrtvasthym.

brouille son





ennemi avec


amis qui


pouvaient dfendre




bien de son ennemi


veut du mal son ennemi


en vue

du meurtre

veut commettre,

nourrit la vue fausse.


mme les dix chemins de l'acte peuvent tre le conscutif De mme pour les autres chemins de l'acte, vol, etc.

du meurtre.

Mais, dirons-nous, la convoitise, la malignit et la vue fausse ne

sont jamais prparatif, car elles ne sont pas



(kriyrcnnhha) ;

elles n'ont

pas de prparatif, car


sont seulement

production de pense (cittotpda)

Le Stra




Bhiksus, trois espces de meurtre, meurtre

la haine,

n de la concupiscence, meurtre n de
ration (lohha, dvesa, molia)

meurtre n de l'aber:

et ainsi

de suite jusque
[8 a]


Bhiksus, trois espces de vue fausse

quels sont ces diffrents meurtres,



faut expliquer

Tous les chemins-de-l'acte ne sont pas achevs (nisth) remment par concupiscence, haine ou aberration mais




Le prparatif

nat des trois racines \

les chemins-de-l'acte

Le prparatif de tous

peut natre indiffrem-

ment des



Bhagavat, en s'exprimant

comme nous

avons vu, vise


cause premire, la cause qui donne origine (samnt-

10 a-b) au chemin-de-l'acte.


73) n de la concupiscence


Meurtre pour prendre




telle partie

de la bte

meurtre pour s'emparer d'un bien


meurtre pour



meurtre pour se dfendre, pour

dfendre ses amis (imasuhrtpariirnrtliam).

Meurtre n de

la hane,

pour assouvir





yatha parasvatn hartukamah kryasiddhaye parakiyam

hrtv tena paunfi balitn knryt 2. Saraghabhadru rfute ces objections. 3. sbyor ba rtsa ba gsum las skyes
ttliasfilinT, p.

[prayogas tu IriinQlajah



dtinitions qui suivent est la KarmaprajAapti

Une des sources des





aussi Vibhfisft, 116,

Meurtre n de l'aberration.
action pie et tuer
' ;

xvi, fol. 7 b-8 b.



le sacrifice

comme une
des actions


le roi,

d'aprs l'autorit des lgistes (dhar:


tue par pense de devoir

La premire

mritoires du roi est de punir les malfaiteurs

(Praska) disent
[8 b]


faut tuer pre et

quand les Perses mre gs et malades ^


quand on



faut tuer les serpents, les scorpions, les


mouches tryamhiika (Mahavyutpatti, 213,

btes sont nuisibles

parce que ces


faut tuer le gibier, le btail, les oiseaux, les


pour s'en nourrir


meurtre enfin qui est provoqu


C'est l'exemple classique. Voir l'intressante histoire, Chavannes, Cinq cent



287, et les rfrences.


Voir ci-dessus,

121, n.


La KarmaprajMpti

attribue le meurtre des

parents aux brahmanes d'Occident


tiinda ou ntagh qui est un Naksatra

nichu donne ostha, peut tre Maghaja ou Maghabhava.

nomms Mou-kia

Vibhasa, 116,

14. Il


l'Ouest, des Mlecchas


qui ont cette

opinion, qui tablissent ce systme

Ceux qui tuent pre

malades obtiennent mrite



non pas pch.

Pourquoi ?

mre dcrpits et Le pre dcrpit a


manger s'il meurt, il obtiendra des organes nouveaux et forts, il boira de nouveau lait tide le malade a beaucoup de sensations douloureuses mort, il sera dlivr. Donc celui qui le tue ne commet pas de pch . Semblable meurtre nat de l'aberration. Maga, proprement Magu et Muga sous l'influence de la labiale Mou-kya
organes ruins

n'est plus capable de boire et de

initiale [S. Lvi]

Sur les mmes Mages, ci-dessous p. 148, n. 1. Le Grand Vhicule admet qu'on peut tuer l'homme qui va commettre un pch mortel (nantarya), Sikssamuccaya, p. 168. Nariman dans Revue Histoire des 3. Comparer Jtaka, Fausboll, vi. 208, 210 Religions, 1912, i. 89 et JRAS. 1912, 255 J. Charpentier, dans le Zeitschrift pour l'Indologie et l'Iranistique, ii, p. 145 (Leipsick, 1923), qui compare les Kambojas, pieux tueurs de kltas, pataugas, uragas, bhekas, kimis et makkhiks, aux Zoroastriens du Vendidad 14, 5-6 et d'Hrodote i. 140. 4. D'aprs Hiuan-tsang, c'est l'opinion de certains TTrthikas d'aprs ParamrHiuan-tsang tha, l'opinion du Trthika P'in (Julien 1431)-na-ko (Vinnaka ?). Les serpents ... nuisent l'homme celui qui les tue produit grand mrite les moutons ... sont essentiellement de la nourriture les tuer n'est pas un pch . Sur le meurtre des animaux et l'usage de la viande et du poisson, 1. les cinquime et sixime dits sur piliers 2. les trois purs , aclittha asuta apari;
; ;

sankita, Majjhima,
Life, p.


368 Anguttara,


187, Dulva,



28 (apud Rockhill,
31, 14 et

38 note)


poisson seulement, Mahvagga,




15 (schisme de Devadatta)

dans Dulva, IV,


d'autoriser la viande


Devadatta reproche Religieux minents, p. 48, Takakusu,









(pravartita) par la vue fausse


meurtre commis par un


qui nie la vie future et que rien n'arrte (nirmanjda).






n de la concupiscence.

Soit qu'on vole



qu'on vole pour s'emparer ensuite d'un autre objet,


acqurir honneurs et respects

se dfendre et dfendre ses amis.


Vol n de

la haine,

ou pour assouvir

Vol n de l'aberration.



d'aprs l'autorit des lgistes,

s'empare des biens des malfaiteurs.

Les Brahmanes disent


Toutes choses ont t donnes aux Brahmanes par Brahma

par la faiblesse des Brahmanes que




Vrsalas jouissent. Par

consquent, quand

(d) ce qui



donne du sien

Brahmane drobe (apahar), le Brahmane prend il mange du sien il se vt du sien, il a] et cependant, quand les Brahmanes prennent,

ont bien la notion du bien d'autrui.

Le vol provoqu par




fausse est aussi un vol n de l'aberration.



illicite (iv.



n de la concupiscence.


avec la


d'autrui, soit par


pour obtenir honneui*s

et respects^ soit

pour se dfendre

dfendre ses amis.



n de la haine, ou pour assouvir l'hostilit.

I-tsing, p. 46, 58, etc.

La viande d'homme, d'lphant,

etc. est interdite


E. VV.

Hopkins, The buddhistic rule against eating mat, J. Am. Or. Soc. 1906, 455-464. Il est interdit de couper les feuilles d'un arbre (ci-dessus iv. 35 a-b), de fouler les herbes (tinni) vertes, de dtruire les tres vivants un organe (ekindriya

Mahavagga, iii. 1. anyalbhasatkrayaortham. svam haranti yathsvahrikdh



anyalbhasyrthe para-

L'original nous est fourni par la Syfidvfidamanjar


S. S. 1900,

Ces textes disent na hirnsyt sarvablmtni, et ordonnent le memtre de 597 btes dans l'Asvamedha ils disent nnrtum hryt, et expliquent les cinq mensonges
: ; :

32) qui dmontre le


d'autorit des textes brahmaniques.

mme adattdnam anekadh nirasya pacd uktam yady api brhmano hathena parakyam datte balena va tathpi tasya ndattdnam yatah sarvam idam briimanebhyo dattam brhmanntft tu daurbalyd vrsalh paribliunjate tasmd apaharan brhmanah svam datte svam eva brhmano bhunkte svam vaste svam dadtti. Compapermis





101 (Bhagavatapurfina,

4. 22. 46).



daurbalyt (Manu

nrafftsyi) est certaine

dmas pa.


xvi, fol.

8 b-9





n de l'abeiTalion.

avec leur mre


autres fennnes interdites

Les Perses, ont commerce Dans


le sacrifice

boit de l'eau [ la

manire d'une

bte], broute de l'herbe,


a commerce avec sa mre, sa sur, une


femme de son gotra ; o

: :

trouve (labli, vindj, l


doit mettre

de la sorte ce taureau

triomphera du monde.

Ceux qui disent


Les femmes sont




ga pa


sogs pa.

Les Perses louent l'abrahmacarya



gosava, transcrit par ParamSrtha, traduit par ba lan hbran,



du taureau

La Vyakhy porte


tatra moliaprdJinyd tipaiti mtaram abrahmacanpasvasram upaitti vartate / upasvasram npaiti bliaginm ity upasagotrm upaiti satnnagotrm ity arthah upah (?) yajaj


est visible

que Yasomitra dbrouille mal ce texte vdique.

le Gosava dans Jaiminya tasya vratam upa mtaram iyd tipa svasram upa sagotrm upvahyodakam cnied upvahCiya trnny chindyd yatra yatrainam visth vindet tat tad vitisthetnudtiho ha lokam jayati. Nous avons ici la source de Vasnbandhu. M. W. Caland veut bien m'expliquer et complter la traduction qu'il a donne de ce passage (Jaiminya in Auswahl, p. 157).

L'obligeance de M. Keith m'a permis de dcouvrir




pastamba Srauta xxii. 13 tenestv samvatsaram pasiivrato bliavet / iipvahCiyodakam un autre Stra porte upanighya pibet M. Caland corrige upanighya, et traduit upvahya, upanighya, par se baisser visth





besoin naturel


vitistheta signifierait


carter les







quelqu'endroit qu'un besoin


le satisfait

La finale



s'empare du monde du taureau

gi nichod sbyin la cho

ba lan hbran ga can gyi chu btun no j j rtsva bcad do j j mahi gan du nal po la hgroho / srin mohi gan du hgroho / rtis gcig pahi gan du hgroho shes bya ba dan j gan dan gan na hdi dag rned pa de dan der hphro bar bya ste j de Ita na ba lan hdi hjig rten las rgyal bar hgyur ro / Seule fait difficult l'expression cho ga can gyi vidhi-mat qui, grammaticalement,
texte est faite sur la version tibtaine

La traduction porte au

qualifie l'eau

on ne peut traduire


l'eau rituelle


Mieux vaut entendre



qui a pris

le rite boit l'eau



Les femmes et


hommes prennent
les dents

vu du taureau {govraou bien restent en place,

la rencontre, ils





coupent l'herbe avec

ou bien vont

sans distinguer qui est parent ou loign, suivant




comme dans

le sacrifice


les autres




broutent l'herbe



prend sa parente, ou prend

tante, ane, cadette,

femme de mme





68 d-69.
la bouillie


la fleur,



la route




c-d) et autres

pchs vocaux ns de la con-

cupiscence et de la haine,


ci-dessus. [9 b]

roi, le mensonge joyeux, le Mensonge n de l'aberration. mensonge avec les femmes, au mariage, en danger de mort, ne

nuit pas



que ces cinq mensonges ne sont pas des pchs


Le mensonge provoqu par

Parole maligne
et autres

vue fausse.

pchs vocaux ns de l'aberration.


Ceux provoqus par

pralpa) du Veda,


vue fausse. En outre,

faux discours (asat-


sont des paroles frivoles (sambliinnapra-

lapa) nes de l'aberration.


la convoitise, la


et la

vue fausse


II-IS) naissent-elles de la concupiscence, etc. ?

Puisqu'elles n'ont

pas de prparatif, cela

fait difficult

69 a-b. La convoitise et les

deux autres chemins mentaux naissent

des trois racines parce qu'elles apparaissent la suite de ces racines ^

Lorsqu'elles apparaissent immdiatement la suite de la concupiscence, elles naissent de la concupiscence






autres racines.

Nous avons

expliqu les mauvais chemins de l'acte dans leurs


rapports avec les racines. Quant aux bons chemins de l'acte


ye chur tidkhalditulyo mtrjanah


ropinion du TTrlhaka P'in-

na-ko (Paramartha).

Hiuan-tsang ajoute

escalier, pont, navire.


D'aprs Vibhfisa, 116,



y a des Mlecchas nomms Mou-kya

qui ont celte opinion, qui tablissent ce systme qu'il n'y a pas de pch avoir


Conqjarer Divylvadana,

Pourquoi ? Parce que les fennnes sont comme la bouillie cuite.... panthsnmo p. 257 (xviii. histoire de Dharmaruci)

ca mtryrdmah / yatraiva hi tirthe pit snti putro 'pi tasmin sn&ti api ca pratyantesu janapaclesu dharmataivais ym eva pitdhiyacchati tm eva putro 'py adhigacchati ... 2. C'est la stance ttt narmayuktam vacanatn /i/asf/... SySdvadamaftjarT, comparer Gautama, v. 24 Vasisthasmvti, xvi. 30. p. 32; Mbli. i. 82, 16, etc. Max MUer, India, What can it .... p. 272 venial untruths. 3. de yi mjug thogs las byun phyir / brnab sems sogs rtsa gsum las skyes




[tadanvayata utpadad


abhidhydi trimlajam



xvi, fol.

9 a- 10


de non-



Les bons, avec prparatif

et conscutif, naissent

concupiscence, non-haine, non-aberration. [10 a]

Les bons chemins de




prparatif et


conscutif, ont

pour cause originaire (pravartaka,


une bonne pense. La

bonne pense, tant ncessairement associe (samprayiikta) aux

trois racines, nat des trois racines.

Le renoncement au prparatif du mauvais chemin de l'acte, c'est prparatif du bon chemin de l'acte le renoncement l'acte proprement dit qui constitue le mauvais chemin de l'acte, c'est le bon

chemin de





renoncement au conscutif du

mauvais chemin de

l'acte, c'est le

conscutif du bon chemin de l'acte.

Donnons un exemple


du novice. Depuis
^ salue le


moment o

novice entre dans



Samgha, adresse sa

requte l'Upadhyya, jusqu'au premier, jusqu'au second


c'est le prparatif \

karmav' l'achvement (parisampti, avasna)

ont lieu une vijnapti et une avijnapti

du troisime


simultane cette vijnapti qui constituent

chemin de

l'acte propreles



Aprs ce moment, lorsqu'on intime au nouveau moine


nirayas, lorsqu'il

connatre qu'il les accepte


et aussi


1. dge La sbyor dan nijug bcas rnanis / chags sdaii [uhhh saprayogaprstha alobhaclvesanohajdh //]


mug med






nnvsa (^traduit littralement par le lotsava, gnas sua tshogs et par pou ping tchu, traduit par lliiian-tsang Mai Vn, autel des dfenqu'on trouve ailleurs comme quivalent de sm, voir iv. 39 b) est expliqu




nnvsatn pravisatti mandalam pravisatty artJiah


M tasmin mahsmmandale bhavanti.

3. Pour les sources sanscrites, A Fragment of the Sanskrit Vinaya; Bhiksunkarmavcana, Bulletin of Ihe School of Oriental Studies, I, iii. (1920). Pour les sources plies, voir par exemple K. Seidenstiicker, Pli Buddhismus (Socit plie allemande) Kern, Manual, p. 78. Il faut entendre que le prparatif dure jusqu'au dernier moment, exclusivement, du troisime karmavcana. 4. Le texte porte tata rdkvam yvan nisray {= gnas) rocyante {= bsgo) tadadhisfhnatn (= dehi brten) ca vijnapayati, c'est--dire nisraydhisthnm ca vijnaptim karoti. Paramrtha traduit Jusqu'au moment o l'on dit les quatre nirayas (l), en dpendance () de cet acte principal tout ce qu'il y a
; : : :

de vijnapti et

' avijnapti,

aussi longtemps que la srie n'est pas coupe, c'est le






que se continue la srie d'avijnaptis cre par

c'est--dire aussi

l'acte principal


longtemps que


moine ne perd pas

la discipline




c'est le conscutif.

Nous avons vu que



mauvais chemins de

l'acte n'taient



(nlsth) par les trois racines. [10 b]


a-b. Meurtre,

mchancet, parole injurieuse sont achevs par

Par haine seulement.


sont achevs lorsque se manifeste (sam'

mukhbhvt) une pense de parityga


(en ce qui concerne le

meurtre), une pense de violence (pariisacitia) (en ce qui concerne


et la parole injurieuse).


b-d. Adultre, convoitise, vol sont


achevs par concupiscence ^












La vue

fausse, par aberration \

Par une extrme aberration.

conscutif. >

Hiuan-tsang, lui aussi, est obscur

(catvro nirayh) kf (ca) y (sesa, anya) vanti ?).

tch (yvat) choo (roc) se T (nisraya) ts'in (prdurbha-

catvro nisrays ctvarapindaptasayysanaglanapratyayabhaisajyalaksanh (VySkhya). 1. vadhavypdaprusyanisthd dvesena 2. La pense de parityga est la cause tatksanasamutthna (iv. 10) qui est
simultane au chemin de l'acte [Note de l'diteur japonais].
regarder, ngliger

Parityga, yons-su hdor ha, traduit par Hiuan-lsang o soUo ku, ne pas Voir ci-dessous, est un euphmisme pour dtruire, tuer 153, n. 3. Comparer AtthasalinT, p. 91 gabbham ... ppakena manasnu*






n'est pas indiffrent l'gard de l'embryon





haite sa destruction

pense de violence


parusa^^itta, Paramftrtlui






(audrika) connne dans prusya.






= nisth, achvement.

mithydrstes tu mohena.

Hiiian-tsangy xvi,


10 a-Il





Les autres, par

les trois.


Les autres chemins de

mensonge, parole maligne, parole

inconsidre, sont achevs soit par concupiscence, soit par haine, soit

par aberration.
Les chemins de
tions, trois

qui viennent d'tre diviss en quatre sec-

(70 a-b),



et trois, ont

respectivement pour




les tres vivants, les objets


de jouissance,




[11 a]

Les tres vivants sont


la matire
les objets

du meurtre, de



de la parole injurieuse

de jouissance (bhoga)

sont l'objet de l'adultre, de la convoitise et du vol

c'est--dire les cinq
c'est--dire le



est l'objet de la

vue fausse

nmarpa, le nman^


47), est l'objet

du mensonge


de deux

autres pchs de la voix \

Lorsqu^on a dcid la mort de quelqu'un

avant, soit aprs



qu'on meurt soit


oui ou non, pour l'auteur du meurtre,

chemin-de-l'acte principal

(maula karmapatha)



a-b. Si

on meurt avant ou en



n'y a pas chemin-

de-l'acte principal.

C'est pourquoi la



du meurtre,

peut-il arriver

Quand un homme a que, au moment o

fait le


le fruit le

de ce

prparatif est achev, cet


ne soit pas touch par

pch de

meurtre ^ ?

Oui, lorsque cet

homme meurt

avant ou en



tribhir isyate



gzhi ni sems can

spyod dan

min dan gzugs dan min yin no



adhisthnam nmarilpam ca nma ca


= [sattv = adhikaiti

rana, visaya.
Atthasalin, p. 101.

nmakydhisthn mrsvdddayo vg ndmni pravartata



Voir Vyfikhya ad
le texte




Je crois que


paramarane krtaniscayah

(pha roi po hchi bar

ns par byas nas).


saniam prg va mrtasysti na maulah.



p. 142.


du chemin de

l'acte principal.






temps [que



raison est claire

aussi longtemps que

celui qui doit tre tu



est vivant [11 b], aussi



meurtrier n'est pas touch par


pch de meurtre

lorsque meurt

celui qui doit tre tu,


pas davantage

meurt en


temps ou auparavant



Parce qu'un nouveau corps a pris naissance.

Le corps

la personnalit


par qui


prparatif a t

corps du meurtrier, est dtruit


meurtrier prend un

nouveau corps qui appartient un autre nikyasahhga

ce corps n'a pas fait le prparatif,



n'est pas



consquent, ne peut tre touch par


pch de meurtre.
tuer, soit

Lorsque beaucoup d'hommes sont runis en vue de

la guerre, soit



la chasse





l'un d'eux tue, qui

coupable du meurtre ?

72 c-d. Comme les soldats, etc., concourent mme effet, tous sont coupables comme celui qui
Le but tant commun, tous sont coupables
eux qui
tue, car tous s'incitent
le fait

la ralisation du



celui d'entre

mutuellement, non par la voix, mais


qu'ils se sont runis

pour tuer ^


Mais l'homme qui a

est-il, lui

t contraint par la force se joindre

aussi, coupable ?

pour sauver


qu'il n'ait

form un

cette rsolution



vie, je

ne tuerai pas

tre vivant. [12 a]



pour que celui qui tue commette


chemin de

l'acte ?


question pour les autres pchs juscpie et y compris la vue

la sogs

% dmag

pa don

gcig phyir

thams cad byed pa po hghin Idan

reffet, tous,

Les soldats,


munis [du meurtre]


= [sainikdyekakryatvt sarvesm asti kartrvat


en raison de l'unit de


l'agent, sont

Suppler asti karmapathah,

comme 72


arthato ht


te 'nyonyatn prayoktra iti na vc te 'nyonyatn prayokttarhiprAntiptakaranbhyupagamd arthataiti darayati.




11 a-12 a.




Le meurtre,

c'est tuer autrui,

consciemmeut, sans

Quand uu homme

tue en pensant

Je tue un

tel , et qu'il




non pas une autre par

tue en doutant


y a meurtre.

Et quand un

frappe un

frappe un tre vivant ou


une chose,


ou un autre, y

meurtre ?



possde la certitude
par consquent,

C'est certainement ce que c'est



a pense de parityga.


y avoir meurtre, destruction du




pta), puisque les

skandhas sont momentans

1. srog gcod pa ni bsams bzhin du / ma nor bar ni gzhan bsad paho / [prntiptah sammntyhhrntyaiva paramranam /] 2. ParamSilha Si un homme a l'intention Je veux tuer un tel si, l'gard d'un tel, il a la notion de un tel s'il tue un tel et non un autre par erreur, en raison de ces trois points le meurtre est chemin de l'acte. samcintya samcicca, Mahvyutpatti, 245, 68 Par. iii. Karmaprajnpti, Mdo 62, chap. xi. Buddhaghosa, Atthasalin, p. 97 (= Su:




p. 69)

Sp. Hardy, Manual,









meurtre cinq choses sont ncessaires

peina, pnasannit, vadhakatre sdliatthika,

upakkama, marana.

Le meurtre peut


nissaggika, thvara, vijjmaya, idclhimaya. (Voir la traduction de Maung Tin et Mrs Rhys Davids, Expositor, 129 vijj potency) art, iddhi Aussi quand il y a doute, il y a meurtre 3. Hiuan-tsang un homme, l'en:



droit de l'objet qu'il dsire tuer, est en doute

Et, si c'est vivant, est-ce



tre vivant

ou non ?



ou un autre ?



la dcision


ce soit l'un ou l'autre, je tuerai tue

en raison de cette pense de parityga,


un tre vivant, ParamSrtha





chemin -de-l'acte

sus, n. 2). S'il

en est

pch de meurtre)

trois points, il y a chemin-de-l'acte (ci-desun homme peut tre en doute et tuer (= commettre le Cela est-il un tre vivant ou non ? Cela est-il un tel ou non ?

en raison de ces

Cet homme, l'endroit de l'objet tuer, est dtermin tuer


ce soit l'un


l'autre, je tuerai,


a donc produit la pense de parityga.

S'il tue,


pch de meurtre.

Le tibtain donne
yin no.

de yan gdon mi za bar gan yin pa yin zhes bya bahi

a seulement pense de parityga


pa a

hdi brned nas de la snun par byed pas des na hdor bahi sems su byas pa kho na



ou plutt


bien pense de parityqa.

On ne

voit pas

que parityga


de fttrana.

Les skandhas sont momentans,

c'est--dire prissent

d'eux-mmes (svara-


entend par prna,

IV, 73.


souffle vital


un vent (vyu) dont


tence dpend du corps et de la pense'. Ce


celui qui


meurtre l'anantit [12 b] (atiptaijaii


= vinaijali) de


manire dont on anantit

flamme ou

son de la cloche,


dire en l'empchant de continuer se reproduire.


bien ^ ^tm'



faut entendre l'organe vital (jivitendriya,





obstacle la naissance d'un nouveau



de l'organe



touch par


pch de

Mais qui attribuez-vous l'organe


vital ?


qui dites-vous qu'il

mort lorsque

la vie


valeur vraie de ce
le trait

manque ? pronom
vie, la

qui ? de qui ?

sera examine

de la rfutation du Pudgalavada \ Observons que Bha-

gavat a


Lorsque la

chaleur et la connaissance quittent





comme un morceau
et c'est

de bois, priv de




du corps qu'on

dit qu'il vit, lorsqu'il est

dit qu'il est

muni d'organes (sendriya)


du corps qu'on


en est dmuni (anindriya).

leur destruction serait-elle cause par une cause

sena vinasvara). Comment

trangre ? (Voir

trad. p. 232, et iv.


entr dans les deux recueillements d'inconscience (ii. 42). La Vyftkhya cite le Ssstra ya ime svsaprasvdsh kim te kyasamnisritd vartanta iti vaktavyam j cittasamnisrit varfanta iti vaktavyam / naivakydcittasamnisrit vartanta iti vaktavyam j kyacittasamnirit vartanta iti vaktavyam / aha I kyacittasamnirit vartanta iti vaktavyam. Atthasftlin, p. 97 pana satta, jivitendriya. 2. Contre la premire dfinition on formule cette objection que Vsvasapravasa manque pendant les quatre premires priodes de la vie embryonnaire. Tuer un embryon ne serait donc pas chemin-de-l'acte. Houi-houi cite le Nanjio 1157 (cole MahTsasaka) qui fait du man%isyavigraha de Pfirajika iii. l'embryon jusqu'au 49"* jour (Voir Prfitimoksa des Sarvflstivfidins par Finot-Huber, J. As. 1913, ii. 477, et BhiksunTkarmavacana, p. 138). 3. kasya tujivitani yas tadabhvn mrtah. En effet, il n'y a pas d'tre vivant, prnin, dont on puisse dire qu'il est mort.

prno nma vyuh kyacittasamnirito vartate. Le prna dpend de la pense puisqu'il manque chez l'homme


pudgalapratisedhaprakarane (Vyakhya).




la dernire partie

du Ko.4a (Le passage vis par Vasubandhu est traduit par Stcherbatski, The seul Iheory of the Buddhists, p. 853 trad. de Hiuan-tsang, xxx. 8 a). 5. Cit ad IL 45 a (trad. p. 215) et viii. 3 c.

D'aprs les Nirgranthas

xvi, fol.

12 a-13


le savoir,

du meurtre,

mme commis



vouloir (ahuddhiprvt), rsulte,




(adharma), comme, du contact avec

le feu, la brlure.






coupable (ppaprasanga) quand on

vouloir la


quand on touche sans



[13 a] celui qui

tond les Nirgranthas est coupable


matre des Nirgranthas est


coupable puisqu'il prche des austrits terribles

celui-l aussi est


coupable qui donne au Nirgrantha une nourriture qui provoque

cholra et la mort.

La mre


l'embryon qui sont, l'un pour


Tautre, cause de souffrance, sont coupables

coupable aussi l'homme


qu'on tue, car



est li

l'action de meurtre

de matire ou
part, celui qui

et le feu

brle son point d'appui.



meurtre par autrui n'est pas coupable, car on ne se


brle pas

quand on



feu par autrui.

Puisque vous ne
bois et les autres

tenez pas compte de l'intention (hiiddhiviesa),

matriaux, quoique privs de conscience, sont coupables de meurtre

lorsqu'une maison s'croule et que des tres vivants prissent \ Si

vous voulez viter ces consquences, reconnaissez qu'un exemple

l'exemple du feu

lui seul,

non accompagn d'argument, ne peut

prouver votre thse.



Le vol

prendre ce qui

n'est pas

donn (adattddna)

c'est s'approprier le bien d'autrui


par force ou en secret.


Milinda, pp. 84, 158

p. 414,),

Kalhavatthu, xx.




26 (Sacred
p. 2.

Books, 45,
n. 3.



2 (cinq espces de meurtre).

Voir ci-dessus


= nagntaka.

adharmah / yathgnisamtesm parastrldarsanasamsparsana esa prasangah / nirgranthasiroliincane va j kastatapodesane va nirgranthasstiih I tadviscikinarane ca dtur esa prasangah / mtrgarbhasthayos cnyonyaduhkhanimittatvt / vadhyasypi ca tatkriysamhandht / agnisvsrayadhavat /
abtiddhiprvcl api prntiptt kartur

sparsd dha


Le tibtain ajoute

De mme

sont coupables les souffrances de la maladie

et les

herbes qui font mourir



Lecture douteuse).

Manque dans les versions chinoises.




gnod pa dan


ha na sman pa

4. ma byin len pa gzhan gyi nor mthu dan hjab bus bdag tddnam parasvasvikaranam balacchalt //]


= [adat-

Atthaslin, p. 97-98.

Mahvyutpatti, 281


adattasya pancamsak-




73 c-74



ci -dessus

vaut toujours


qu'il n'y ait



S'approprier, par force ou en secret, ce qui est possd (svkrla)

par autrui, lorsqu'on ne confond pas avec une autre la personne

qu'on veut voler, qui on veut drober, voil ce qui constitue
[13 b]
Dpouiller un Stilpa, c'est prendre une chose qui n'a pas t donne
le vol.





au moment du Nirvana, Bha gavt a accept,



appropri (parlgrlilta) tous les dons faits aux Stnpas

D'aprs d'autres, c'est prendre une chose qui n'est pas donne par les
gardiens du Stupa.

Prendre un bien sans matre,



prendre ce qui n'est pas donn

matre du pays.
le bien, le


vtement religieux,


d'un religieux dfunt ^

prendre ce qui n'est pas donn par

l'acte ecclsiastique



de la paroisse \

au cas o

a t accompli (krte karmani)


cas contraire, c'est prendre ce qui n'est pas donn par tous les


du Bouddha.

manusyagatiparigrhitasya Hatsamjnay haranahraBhiksunkarinav&cana, p. 137-8 .... antatah phalatusam api parakyam ndCLtavyam kahpunar vdah pancamsikam uttarapandeh steyacittena
iiayor dtenpi.

camsikam va


Vyakhya nnyatra satnjnvihhramt j yadi devadattadravyam haramlti yajnadattadravyam harati ndattdnamify abhipryah. Corriger: Comparer p. 76, 12, anyatrjnnt ; p. 65, anyatra satnjnvibhramdt. 4, anyatra glnyt ; Pfir. 4, anyatrbhimnt, etc. 2. parinirvnakle parigrliltam iti dtrjanapiinynugrahrtham / ananugrahe hi stpe dnam aphalam syt parigrkakbhdvt.






une doctrine


Opinion des deuximes matres de

l'admettre, les gardiens

la VibhSsa 113, 7 opinion errone, car, du StQpa ne voleraient pas en prenant ce qui appartient

au SlQpa.

Vyakhya parivartakam mrtasya bhikso ctvardidravyam (parivat:








le tibtain,



bien d'un mort



bahi nor phrogs na)


d'aprs Paraniartha et Hiuan-tsang, prendre



d'un hoi-tchon, c'est--dire d'un pratikr an ta (Muhflvyutpatti, 130,


Le Samgha de la paroisse ', Hiuan-tsang kii nei sng (limite-intrieurnnavasagatah ; Tibtain Paramartha tch pou kng tchu jen antahslniparypannCih. htshams kyi nan du gtogs i)a rnams


xvi, fol.










quadruple, c'est le commerce avec une


femme avec

on ne peut avoir commerce.

interdite, la

Commerce avec une femme



d'autrui (para;

parigrlilta), mre,

parente paternelle ou maternelle

' ;



merce avec sa propre femme par un chemin



dans un

non convenable





[14 aj

un moment non convenable (akla)

lorsque la


enceinte, lorsqu'elle nourrit \ lorsqu'elle a pris

un vu (myamaun vu du consen-

vati) \

Quelques-uns disent
la rserve relative

lorsqu'elle a pris

tement de son mari.


au meurtre

la condition de

ne pas

faire erreur

s'tend l'amour

illicite, il

n'y a pas chemin de l'acte


bgrod min hgro ba hdod pa yis

gamanam kmamithycras
AtthaslinT, p. 98.



y a six

[agamy/ log par gyem pa rnam pa bzhi caturvidhah /] D'aprs la source de Grand Vhicule (YogacSra) cite par prohibitions 1. avisaya, agamya, mles, femme telle que

seul le yonUnrga ; 3. asamaya \ovs>(\\\e la femme a ses rgles (hoi-liia), est enceinte, nourrit, a pris l'Upavasa, est malade pas 4. asfhna ; 5. sans mesure , mnam atikramya gaccJiati ; 6. ayoga conformment aux rgles du monde .

mre, etc.;

amrga, ananga :


Hiuan-tsang ajoute


et le reste

jusque protge par


le roi




classique Mahvyutpatti, 281,



3. Mahvyutpatti, 281, 2G-27 pravistah sparasvkrtaii j prasrvakarane prasrvakaranasya imikhe varcomrge va. Comparer SiksSsamuccaya, 9. 3 p. 7G evam svastrsv apy ayonmrgena gacchatah Suttavibbanga,


angajtena vaccamaggam .... passvamaggam .... 7nukham.... L'diteur japonais 4. snai ba ham mchod rten nam gtsug lag khan nam. glose par a-lin-jo (aranya) le k'iwig (loign, etc.) de Hiuan-tsang Paramr-



l'on pratique le


Lieu dcouvert


sans doute

abhyavaksa. 5. garbhinlgamane garbhoparodhaJi / pyayantl (? voir iv. 103) stanyopabhogvasthaputrik strl j abrahmacarye hi tasyli stanyatn ksyate / blakasya va pustaye tatstanyam na bhavati (Vyakhya). 6. posadhika, iv. 23 srakkh d'Atthaslin, p. 98. Hiuan-tsang Lorsque la femme a pris Viipavsa . Sikssamuccaya, p. 76 evam iipav-

p. 11,




commentaire sanscrit de l'Uvasagadasao,



sur les lois du mariage chez les Jainas.





quand on a commerce avec



d'autrui en la prenant pour sa

Les avis divergent sur un autre point,


y a chemin de


quand on prend





pour la femme de


uns, oui, car c'est la


prparatif de l'acte

c'est aussi

femme d'autrui qui a t l'objet du de la femme d'autrui que l'on jouit.



les autres,


comme dans

cas du meurtre avec erreur de

l'objet de la jouissance.



du prparatif n'est pas


regard de qui

commerce avec





l'gard du matre

du pays, qui n'est pas dispos


tolrer \

Quant au matre du pays lui-mme,

lui est interdite,

son pouse, lorsqu'elle

les religieuses.

a pris un vu,

plus forte raison


Le commerce avec une jeune

est illicite [14 b]

l'gard de

l'homme qui

elle est fiance, et, si elle n'est


pas fiance, l'gard

de son gardien (raksitar)

si elle

n'a pas d'auti'e gardien, l'gard


(antato rjnah). (Vibhsa, 113,



Le mensonge,

c'est le discours tenu,

avec une pense




une personne qui en comprend


le sens.

Le mensonge

un discours tenu, avec une pense diffrente

le sens.

du sens exprim (arthavda), une personne qui comprend



ne comprend pas, semblable discours


parole fiivole (samhliinnapralpa).

Le discours


47 a-b)

est parfois constitu par de

l'acte ?


syllabes. Laquelle sera

chemin de

Laquelle sera mensonge ?


dernire, qui est



et qui est

accompagne d'avijfiapti

Hiuan*tsang ajoute

Et inversement. De

on se trompe sur





anyusmin vashini prayogo

tasya hi tan

'bhipreto 'nyac ca vastti




na marsanlyam.

es gzhan bsgyur bal.ii // Ihsig don miion par go baho. La version de Paramfirllm aulre-pense-dit ce discom-s -comprenant-le-sens vol bien d'autrui.... ) (est) mensonge (alors que dans la kfirika sur le vol on a montre que l'original termine notre krik par le mol mensonge . Hestillisig lidu


anyasamjoditam vakyam




Hiiian-tsang, xvi,


14 a-15


le sens.

ou bien

la syllabe

dont l'audition





bes qui prcdent sont


prparatif du mensonge.


faut-il interprter l'expression




personne qui comprend

cuteur comprend


? S'agit-il du

moment o


sens ? S'agit-il d'un interlocuteur capable de



sens (abhijntum samartha} ?




premire a lieu

bypotbse [15

vous admettez que


chemin de


lorsque Tinterlocuteur a compris le sens

l'acte est


s'ensuit que le

chemin de

seulement avijhapti

car l'interlocuteur comprend le sens

par la connaissance mentale (manovljnna), laquelle est conscutive

la connaissance auditive (rotravijnna)

vocal, prit en

et la

vijnapti, ou acte


temps que


connaissance auditive ^

n'y a

donc plus vijnapti

au moment o


comprend. Dans

seconde hypothse, cette


ne se prsente pas. Mais que fautle

pour que l'interlocuteur



capable de comprendre



capable de comprendre


l'homme qui connat



en qui est ne la connaissance auditive.

faut interprter le texte de manire ce qu'il ne prte pas la


Le Stra ^ enseigne


y a seize

conduites vocales



quelle poque se rapporte l'expression

: '

qui comprend


(artlihhijna) ? Faut-il entendre


qui comprend actuellement [par

: '


novijiina] ce

a entendu


? Faut-il entendre

qui est capable de compren'

dre actuellement ce qu'il entend actuellement [par


rotravijnna] ?


consquences dcoulent des deux solutions ?

sens du discours tant l'objet de


premire hypothse,

connaissance mentale et la vijnapti vocale

[qui trompe l'auditeur] disparaissant en

mme temps que


connaissance auditive

[qui est trompe], l'acte sera seulement avijapti [puisque la connaissance

tale n'est

mendeuxime hypothse, cette objection ne porte pas, mais comment celui qui ne saisit pas le sens, comment, au moment o il entend, peut-il tre dit capable de comprendre ? La bonne explication est que l'on appelle capable de comprendre celui en qui, les causes de confusion manquant, la connaissance auditive est dj ne. Il faut expliquer le texte de manire
pas encore ne]. Dans





ne prte pas l'objection.


Vibhs, 171, 7 Anguttara, ii. 246, iv. 307 Majjhima, iii. 29 cattro anarlyavolir: aditthe ditthavdit, assiite stUavdit, amute mntavdit, avinte vinitacdit. Apure pi cattro anariyaDrgha,

8, 13






hra), huit mauvaises (anrya)

n'ayant pas vu, dire qu'on a vu


n'ayant pas ou, connu, senti, dire qu'on a ou, connu, senti
vu, dire qu'on n'a pas vu




connu, senti, dire qu'on n'a pas


connu, senti

huit bonnes (rya)

n'ayant pas vu, dire qu'on

n'a pas vu

On demande quel

est le sens de ces termes

vu (drsta), ou (sruta),

(vijfita), senti

par la connaissance visuelle, par la connaistrois connaissances,

75. Ce qui

est peru

sance auditive, par la connaissance mentale, par



l'ordre, vu, ou,

connu, senti


[15 b]

Ce qui

peru par la connaissance visuelle reoit



ce qui est peru par les connaissances de l'odorat, du got

tact, reoit le



de senti (mata).


justifier cette dernire interprtation ? les odeurs, les

Les Vaibhasikas disent que


et les tangibles,

tant non-dfinis (avydkrla)^ sont


morts (mrtakalpa)




sont mata.

Le Sautrantika.


quelle autorit soutenez-vous que, par


faut entendre ce qui est flair, got, touch ?

Le Vaibhasika. Le Sotra


le Stra,

en vertu du raisonnement.
les visibles


Qu'en penses-tu, MalakTmatar ^


que tu

ditthe aditlhavdU.... (Comparer Majjhima,

135, cit Verbatim

Vijfifinakfiya, fol. 12 b, qui,



sources plies, place vijnta aprs mata.

Le Boutldhisme emploie
peine l'interprter.

phrasologie traditionnelle (Upanishads) et a grand

raig ma yid kyi rnam ses daii / gsum gyis nams su myoi gan de / mthon rnam par ses pa daii / rtogs pa yin te rim bzliin bsad / [caksuhsrotramanovijnnnubhtam trihhi ca yat tad drstarutavijntamatam uktam



La Vyftkhyfi




donne Mlliakmatar.



72, l'auditeur

de ce discours est Malukyaputta (Malunky).




byed kyi ma can Paranifirtha m-l-ki-mdn, ce qui suppose une lecture MalakTmatar P'ou-kouang mn-mu (mn : cheveux longs, etc.) qui donne tnZ-mre, ou alakl-iure, ou encore Mallikamalar (Mahavyutpatti 240, 14: mU' hoa mallik) ; les diverses Mallika^, Kern, Mauial, p. 40. IIiuan-U:iang qui a pour mre la Grande (mahallakimtar ?) . ta-mu Pour mchod;


xvi, fol.

15 a-16



n'a pas vus, que tu n'a pas vus auparavant, que tu ne vois pas, dont

ne penses pas

Puiss-je les voir


en raison d'eux,

souhait (clianda), concupiscence (rga), dsir (kma),

(preman), attachement (laya), w^^iii (niknti), recherche (adhye-

san) ?




Les sons que tu n'as pas ous


que tu n'as pas connus par Tesprit, as-tu, en raison

d'eux, souhait, recherche ?


Non, Seigneur.




sujet de ce qui est vu, tu penseras seulement





au sujet de ce qui

est ou, connu, senti (mate), tu penseras


c'est ou,

connu, senti



Les termes vu,


connu, se rapportent certainement aux visihles,


aux sons


aux dharmas




se rapporte


odeurs, aux saveurs et aux tangibles (Opinion de Buddhaghosa,

Visuddhimagga, 451).




autrement, l'exprience (vyava-

lira) relative aux odeurs, aux saveurs et aux tangibles ne serait

pas vise dans cet enseignement de Bhagavat.

Le Sautrntika.
pas dfinir

Ce Stra n'a pas


sens que vous croyez



confirme pas votre interprtation du terme mata. Bhagavat ne vise


caractres des quatre expriences (vyavahra),

avoir vu, avoir ou, avoir connu, avoir mata.

Sa pense




Dans la quadruple exprience, voir,


dont chaque espce

porte sur un sextuple objet, visibles, sons, odeurs, saveurs, tangibles


mahil hyed-kyi-ma-can, comparer Sarad Chaiidra Das nichod Idan ma maha, fte religieuse := mchod) [J'utilise pour cette note des remarques de

S. Lvi et J. Przyluski].






dittham siitam mutant vinntam ajoute pattam

pariyesitam anuvicaritam

manas (na updiyissmi na ca me tannissitam






donne seulement

synonymes aWii


tattha chando

va rgo va peman

no lietam bhante.

Les stances qui suivent

; :


qui sont Theragth, 794, sont cites par Samghabhadra.

comparer Hiuan-tsang donne en transcription laya et niknti (ni-yen-ti) Dhammapada, 411 et Comm. de 348 (Fausboll, p. 413) layam nikantim ajjhesanam parivuithnam gliam parmsam tanham. Tibtain hdiin pa, hdod-chags, hdod pa, dgali ha, cliags pa, hchnms pa, Ihag par cJiags pa. Hiuan-tsang a trsn au lieu de rga (hdod cJiags) et place trsn aprs preman.




IV, 75.

dliarmas, tu constateras seulement que cette exprience a

vois, etc.,


que tu

sans attribuer (adhyropa)

l'objet les caractris-

tiques (nimitta) de dsagrable ou d'agrable



donc entendre par vu,


mata, connu ?

D'aprs les Sautrantikas, ce qui est peru immdiatement par les

cinq organes matriels, est vu, drsta
est transmise

ce dont la connaissance nous


(gamita) par

autrui, est ou, ruta

ce qui est admis

en raison d'un raisonnement correct (ynktyanumna), est mata,

admis ce qui

est peru par l'organe

mental est connu, vijnta [16




Donc cinq

catgories d'objets




sont vues, dharmas pas


oues, admises,


la sixime catgorie



quadruple exprience


le Sotra.


donc faux que, dans l'hypotbse o

mata ne

dsignerait pas les odeurs, saveurs et tangibles, l'exprience


ces objets serait omise dans


l'argument du Vai-

bhasika ne porte pas.

D'aprs les anciens matres (prvcrya)
^, il

faut entendre par vu


(drsta) ce qui est peru par l'organe de la vue

par ou

(srtita), ce

qui est peru par l'organe de l'oue et ce qu'on apprend d'autrui

(parata cgamitam) ; par admis (mata), ce qui est personnellement

accept, approuv

par connu (vijnta), ce que l'on sent en


mme (pratytmam

pratisamvedita, sensation agrable,




dont on a l'intuition dans

Celui qui

recueillement (adhigata).

au moyen du corps,

non par

la parole, fait


gamitatft tac chrutam


yat paicabhir indriyaih pratyaksl[krtam] tad drstam [ yat parafa yuktyamimCmato rucitam ( abhipretam) / yad

tan matant [yan manahpratyakslbhtam (?) hhvandhUjatam pratytmavedyatft tad vijntam] (yid kyi miion siim du gyur La bsgoms nas riogs pa so so ran gis rigs par bya La gaii y in pa de ni inaui par es so), Paramfiiiha et Hiuan-tsang ont seulement yan manahpratyakslbhtam tad vijntam. 2. Les Yogaefiras (Vyfikhytt) yat pratyakslkrtant caksusa .... 3. bdag nid kyis bsam pa gart yin pa. Vyfikhya pratytmam pratisani:


sukhdy asamhitena cittena


adhigatam samahitena


kenaiva na lokottarena

laukikavyavahradhikrt. - Ce qui est connu dans le recueillement pur ou supramondain nVsl pus vijnta, mais jnta. 4. Le problme discut dans ce paragraphe est trait par Buddhaghosa


xvi, fol.

16 a- 17



prendre ce qui n'est pas dans sa pense \ commet-il

Oui. Le Sstra dit en effet

mensonge ?

Peut-on tre touch par

pch de

meurtre, sans agir, sans attaquer


(parkram) corporellement ?
Peut-on tre touch par

quand on


vocalement ^


de mensonge sans agir vocalement?

Oui, quand on

agit corporellele



tre touch par le

pch de meurtre, par

pch de

mensonge, sans agir


ni corporellement ni

vocalement ?



les Rsis, coupables de meurtre par la colre ^ le Bhiksu,

le silence

coupable de mensonge par



dans la crmonie de

la confes-

(Vibhasa, 118,


Mais, dirons-nous,

comment admettre que



Rsis ou



avljnapti ? Ni


chemin de
Rsis ni

qui doit tre la fois vijnapti et


Bhiksu n'agissent corporellement ou




n'y a pas vijnapti


Vavijnapti du domaine



ne peut exister l o


la vijnapti [17 a] (iv.

C'est une


Plusieurs points de contact entre les deux exposs moine ment par le silence, le possesseur du pouvoir magique tue un embryon donc on peut commettre par l'esprit les pchs de la voix et du corps. 1. yak kyencinyathrthafft gamayati. 2. vc pardkratneta vc param mrayet : quand on tue par la parole. 3. C'est l'histoire des forets Dandaka, etc. vides d'tres vivants par la colre des Rsis (Majjhima, i. 378 Uplistra, cit dans Yasubhandhu, Vimsaka, 20, Muson, 1912, i.), qui tablit la gravit de l'acte mental (voir ci-dessous iv. 105 a-b), Pour la mention de cet pisode dans le SaddharmasmytyupaMilinda, p. 130. sthna et les rfrences au Rmayana, voir S. Lvi, Pour l'histoire du Ramyana,
(Atthasalin, pp. 90-95).


As. 1918,








est dpeupl par la maldiction

du Rsi Usanas. Vasubandhu, Virasaka, 20

pas (voir ci-dessous
4. n. 5).

c-d, tablit

les tres

dmoniaques n'intervinrent

Le Bhasya porte posadhanidaranam ctra. En effet, dans le Bhiksu Etes-vous purs ? (kaccit [s]tha le Vinayadhara demande (anusrv) parisiiddliah). Si un Bhiksu ne dclare pas le pch qui existe (satm pattim) et, par le silence mme, acquiesce (adhivsayati), il ment (mrsvdd bhavet). Comparer le Pratimoksa dit par L. Finot, J. As. 1913, p. 476, 488 (avec la lecture tatryitsmatah prcchmi kaccit sthtra parisuddhh). Mahavagga,
: :





Le Bhasya porte kartavyo 'ira yatnali rsoudre par les Vaibhasikas .


= kartavyah samdhih. C'est

Samghabhadra explique



(arthatas), les Rsis commandent (jnpi-








parole maligne ou mdisance, c'est



discours d'une

personne de pense souille en vue de diviser.

Le discours qu'on
les autres,


avec une pense souille, en vue de diviser

l'inimiti, c'est parole

en vue de crer


Les restrictions formules ci-dessus

prend, quand



n'y a pas confusion de personnes





parole injurieuse, c'est le discours outrageant.

Le discours prononc avec une pense

par celui qui
ort l'adresse,

souille, outrageant,


adress celui qui on veut l'adresser,

c'est la parole injurieuse.

dmoniaques (amanusya), connaissant (avetya) (sattvaparltygapravrtta ppsaya), dvous comme ils sont aux Rsis, agissent corporellement contre les tres en raison de cette action corporelle, il y a chemin de l'acte en ce qui concerne les Rsis. Comment les Rsis manifestent-ils (vijnapU) leur En raison de la colre, il y a certainement chez eux modification du intention ? corps et de la voix s'ils maudissent, il y a certainement mouvement (cest) du corps et de la voix. D'autres matres disent que toute avijnapti de la sphre du Kfima ne dpend pas d'une vijnapti. Par exemple, les Cinq (paiicaka) en obtenant un fruit obtiennent du mme coup la discipline de Prfitimoksa (ci-dessus de mme une mauvaise avijnapti peut natre sans qu'il y ait vijnapti. p. 60) Dira-t-on que les Cinq avaient fait vijnapti auparavant ? Il en sera de mme dans d'autres cas. Voil pour le cas des Rsis. Quant au mensonge la crmonie de la confession (posadhamrsvda), le fait que le moine coupable (apariuddha) entre dans le Samgha, s'assied, s'y tient (svam rypatham kalpayati) et tout ce qu'il peut dire, voil pour lui une vijiajiti antrieure [au moment o Samghabhadra, xxiii, 5, 7 a). il acquiesce par le silence]. (Vyakhyfi 1. phra ma plia roi dbye bahi phyir / non mous can kyi sems kyi thsig




leur intention pcheresse de destruction des tres vivants

paiunyam [parabhedya
2. 3.

thsig rtsub po ni

bhsanam] AtthaslinT, mi snan pa = prusyam [apriyam]


p. 99.

Dans AtthaslinT

p. 100, la

tion, la parole

par laquelle on


phariis vc est rinq>rcation ou la maldicviolence soi ou autrui (yya attnam

pi param pi pharusam karoti).

dictions contraires la pense

Buddhaghosa donne des exemples de malmre souhaite qu'un buffle furieux crase l'enfant qui va dans le bois malgr sa dfense, ou que la maison s'croule sur ses enfants le matre d'cole souhaite la mort de ses coHers paresseux. Dans ces cas, il n'y a pas pharus vc. Au contraire, il y a phattis vc quand on dit Dormezbien , la personne qu'on veut assassiner.
; :


xvi, fol.

17 a-b.




Tout discours

souill est parole inconsidre.

La stance

tout ce qui est souill



s'agit ici


Tout discours

souill est parole inconsidre


celui qui le profre est




discoureur inconsidr

(samhhinnalieu de

la stance porte

donc hhinnapralpit au


hhinnapra lapa.



D'aprs d'autres docteurs, la parole inconsidre est


le dis-

cours souill qui diffre des autres.

Le mensonge,
on rserve
n'est ni



et l'injure

sont des discours souills



parole inconsidre

au discours

souill qui


mdisance, ni injure. [17 b]

la vantardise, le chant, la



Par exemple,







Par exemple un moine se vante pour obtenir des aumnes,

par frivolit



d'aucuns chantent

au cours des reprsentations ou

le public,

danses, les danseurs, pour rjouir


tiennent des discours



les doctrines des

mauvaises philosophies,

hrtiques lisent les mauvais traits. Ajoutez les lamentations (pari-

anibaddhapralpa. // Manu, xii. 7 gzhan ni de las gzhan non mons [tato 'nyat klistam anye tu] 3. lapangtantyavat / ktisstravat 4. Ce moine est mithycvjlvin (iv. 86 b). Le mithyjva est dfini par la Vykhya kuhan lapan naimittikat naispesikat. VVogihara (Bodhisaitvabhmi, Leipsick, 1908) a une note tendue sur ces quatre termes et cite la dfinition que la VySkhya donne ici du terme apan : lapanftt karotti lbhayasaskmatay sevhhidyotikcim vcam niscdrayatUy arthah il conviendrait donc de traduire lapan par flatterie comme Paramfirtha et Hiuantsang (gning). Mais les sources cites par Wogihara (Nanjio 1296, etc.) montrent qu'il s'agit du moine qui vante son propre mrite. Voir Majjliima, iii. 75 Vibhanga, 352, comment dans Visuddhimagga, p. 22 et suiv., JPTS. 1891, 79. 5. chags-pa laiilya (Siksasamuccaya, p. 69). 6. zlos gar mkhan rnams zlos gar gyi tshe gzhan dag mgu bar bya bahi phyir hkbyal ba.

sarvam klistam bhinnapralpitci







77 b-78


deva), les bavardages


\ tout propos tenu avec


pense souille

et qui diffre

du mensonge, de la mdisance




pas vrai que, Tpoque d'un




des chants sans qu'il y ait parole inconsidre ?


y a

cette poque,

chants sont inspirs par

la sensualit ^


de dtachement (naiskramya),

non par




une autre opinion,



poque, parole inconsidre, puisqu'on parle d'vha, de




cette parole inconsidre

ne constitue pas


chemin de


de ce nom.




convoitise est le dsir de s'approprier, par des voies

illgitimes, le

bien d'autrui \

Dsirer s'approprier

bien d'autrui d'une manire illgitime (visa-

mena), d'une manire



de l'acte

% par force

ou clandestinec'est le



bien d'autrui tre moi





D'aprs une autre opinion, par abhidhy


faut entendre toute

(Irm) du domaine du Kamadhatu, car


Stra des cinq niva-





ye samganikrnth
p. 100,


Divya, 464,



donne comme exemple de samphappalpa la rcitation du combat des BhSratas et de l'enlvement de Sltfi. 2. Tibtain ... sont munis de naiskramya, ne sont pas munis de stegs snags Hiuan-tsang ... viennent de naiskramya, sont capables de produire naiskramya, ne prparent pas pense souille . Param&rtha traduit l'original de stegs snags par mithy-rasa. nekkhamma s'oppose samganik,
110; Childers,
p. 447.
: ; :







p. 106.

vhavivhdyabhildpasadbhvt Vykhya vha driky ddraka^ya drikgrhgamanam ; on bien, ; viv>}ia --= praveanaka (union libre ?), vivha parinayana. Comparer Childers, vahana, vivhana, Senart, Piyadasi, i. 203 (mariage d'un fils ou d'une fille) Mahftvyutpatti, 223, 246-7 (vha = bag ma gton ba donner une fille en mariage vivha bag ma len pa prendre femme)

drakagrhgamanam d'aprs d'autres, vha

281, 261-262 (o les sens sont intervertis).



abhidhy y parasve visam sprh // visamennyyenety uddeanirdearpau paryyau. Attliasalini, p. 101. aho vata idam mam 'ass H.


xvi, fol. 17





an sujet du kmacchanda, s'exprime ainsi


Ayant abanUttarakurus

donn abhidhy

Mais, disent d'autres matres, les Cakravartins

et les

ne sont pas coupables du chemin de





ne sont pas dlivrs de la soif du domaine du Kamadhatu. Admet-

tons que toute soif du domaine du







n'est pas

chemin de


sont comprises parmi

chemins de


plus notables parmi les mauvaises




La mchancet

est la

haine des tres vivants ^

C'est la haine des tres vivants, par laquelle on souhaite nuire


personne d'autrui.



La vue

fausse est l'opinion qu'il n'y a ni bien ni mal. [18 b]

C'est la traduction de Parainfirtha et Hiuan-tsang.

Le texte porte


rannm adhikrena katnacchandam


so 'bhidhyfft loke prahya vigatbhidhyena cetas bahulam viharati vypddam stynamiddham auddhatyakaiikrtyam vicikitsm loke prahya

paca nlvaraxini prahya...

tirnaknkso bhavati tirnavicikitso 'kathamkathl kiisalesu dharmesu j sa Samyukta, 29, 3, Dgha, iii. 49, Majjhima, iii. 3, Angutiara, ii. 210, cit et comment Viblianga, p. 252, o abhidhy est expliqu Il rsulte de ce texte que le terme abhidhy est synonyme rga srga, etc. de kmacchanda, le premier nlvarana. Sur les nlvaranas, Kosa, v. 59. 2. gnod sems sems can la sdan pa [vypdah saftvesu dvesah] Manu, xii. 5 manasnistacintanam. 3. Atthasalini, p. 101. paravinsya manopadosalakkhano.... aho vatyam ticchijjeyya vinasseyy ti. 4. nstidrsUh subhsiibhe / mithydrstih A la nstidrsti s'oppose Vatthikavda (Majjhima, i. 515). Comme le montre le Bhfisya, il faut entendre par mithydrsti la diffhivipatti de Puggalapaiiiiatti, la doctrine condamne dans le Stra comme tant celle d'Ajita Kesakambali (Dlgha, i. 55, Majjhima, i. 515, Samyukta, 16, 1, Jnnaprasthfina, 20, 5, Vibhasa, 98, l, trait du Pudgala, trad. Hiuan-tsang, xxx.)


a vu,




pourquoi cette erreur est akiisala.

la mithydr.sfi, la

micchditthi niyat et

les drstis

en gnral,



(ci-dessus p. 36), 79 c,


d, v. 7.

Sources plies, KathSvatthu,







388, Samyutta,



par micchditthi est dsign




IV, 78.


est dit





n'y a pas de don, de sacrifice,


de bonne action, de mauvaise action


n'y a pas

d'Arhat dans



La vue




montre ce

Stra, consiste dans la ngation de l'acte, du fruit, des ryas.


karika indique seulement


Telle est la dfinition des dix mauvais chemins de l'acte [xvii].


est le sens de cette expression chemin-de-l'acte


1 b).


Trois sont chemin

sept sont, en outre, acte

convoitise, la mchancet, la

vue fausse sont des chemins de


chemins de cet acte qu'on


volition (cetany iv.


la volition qui se les associe

(tatsamprayogim) se

meut par



\ en ceci que, par leur force, elle veut



v. 7)

puni par l'enfer ou une naissance animale. (De



Theragatha, 1091, Commentaire, sur

acteurs renaissent au

destin de l'homme qui croit que

p. 358,

Mais AtthasSlinT,

distingue la micchdifthi



nstidrsih uhhsubhe de l'Abhidharma) des autres micclidifthis

(voir ci-dessous note


iv. 96),


101, enseigne



seulement par la

ngation de



qu'est ralis le


de micchditfhi, non

pas par les autres vues inexactes. (L'Expositor traduit


na annaditthlhi

the distinctive stage of the course of action


by the views



no resuit


doit s'entendre

and not by other views kammapatharalisation du chemin-de-l'acte , comme vacibheda


(? kramena) karmaphalrypavdik. gsum lam bdun ni las kyan yin / On peut tatra pathah karmpi saptakam

sa kalpena
hdi la




Vibhasa, 113,


Pourquoi ne pas considrer

la volition,


chemin-de-racte ?

La cetan est acte. Ce qu'on

De mme on

comme un

appelle chemin-de-l'acte, c'est

ce par o va la cetan

appelle chemin-du-roi ce par o va le


le roi n'est

pas chemin-du-roi

peut servir de chemin la cetan et chemin-de-racte. Mais au cas o on fait commettre le meurtre par autrui, beaucoup de temps peut se passer entre l'ordre du meurtre et le meurtre la cetan du meurtre a disparu, comment peut-on dire que le dharma (l'acte de meurtre) est le chemin de la cetan ? Disons donc que le dharma qui peut coexister avec la cetan est chemin-de-l'acte. Or deux cetans ne coexistent pas. 3. testft vhena vahati tesm gaty gacchati.

dharma qui sera donc nomm

coexiste avec la cetan

leur alle.

xvi, fol.

18 b-xvii,

fol. 1 b.


= cetayafe)

en conformit avec



va par

Le meurtre

et les six autres

pchs sont acte, car



sont, de leur

nature, actes du corps et de la voix

cet acte qu'on

et ils sont aussi des

chemins de


volition, car la volition qui leur



naisfin et

sance (tatsamiitihcmacetanyh,

10) a dans ces pchs sa

sa raison d'tre (tn adhisthya pravrtteli).

L'expression chemin-de-l'acte signifie donc simplement chemin de
l'acte lorsqu'on l'applique

la convoitise,


elle signifie acte et

chemin de


(karma karmapatha

ca) quand on l'applique au



est justifi par la rgle



apy ekasesah.
seul est

Mme quand

termes du compos sont diffrents,

2. 64). [1 b]



faut entendre de


bons chemins-de-l'acte, renoncement


au meurtre,

non-convoitise (anahhidhy),

le YirpsLY?iii


et le conscutif (pr^f/to^

ne sont-

pas considrs




b-d) ?

Parce que

le prparatif est

accompli en vue de



parce que

conscutif a pour racine l'acte



outre, sont seules chemins-de-l'acte les plus

notables parmi les bonnes et mauvaises pratiques.

Enfin, sont

chemins-de-l'acte les actions dont l'augmentation et la diminution

ont pour rsultat l'augmentation ou la diminution des choses et des

tres vivants



99) ^

Les Sautrntikas ne reconnaissent pas la volition (ceian)

acte mental


(manaskarman) pour



n'y a pas d'acte mental

en dehors de la convoitise,

etc. (iv.




Stra donne la convoitise,

Comment donc etc., le nom de



l'acte ? C'est

une question laquelle


doivent rpondre.



Lorsque prparatif ou conscutif sont chemin-de-l'acte (ci-dessus p. 143), en vertu de leur caractre propre et non par leur connexion avec un autre

2. yesni utkarspakarsenadhytmikabhynm utkarspakarsau loke bhavatah.




78 c-79


La rponse

n'est pas difficile.


convoitise, la
et elles


et la

vue fausse sont acte mental (karman)

de mauvaise destine

sont chemin (paiha)

ou bien





unes des

autres, car la convoitise

et la

met en mouvement (vhayati)



vue fausse,

et rciproquement.
l'acte sont tous

Les dix mauvais chemins de


en contradiction avec


dharmas ; mais

[2 a]
les racines


La vue de ngation rompt

de bien.


rupture des racines de bien (kualamlasamuccheda) a lieu


par la vue fausse du neuvime degr, forte-forte






affirmez que seule la vue fausse rompt les


racines de bien, mais le Trait


Quelles sont les racines de

les racines


fortes ?

Les racines de

mal qui rompent


de bien,

les racines

de mal qui sont abandonnes

premires lorsqu'on

acquiert le dtachement du

Kamadhtu (kmavairgya)
du mal rompent



prouve que
de bien.


et les autres racines

les racines




vue fausse rompt

les racines

de bien

mais Ja

vue fausse

amene (adhylirta -= upanta) par

les racines de



Trait attribue donc ces dernires l'opration qui appartient

en propre la vue fausse.

De mme on



les bandits brident le

village parce qu'ils allument le feu qui brle le village.

Quelles racines de bien sont rompues ?



Les racines innes du domaine du Kamadhtu.


79 a-b

med par


On peut restituer
trad. p. 184).

bas rtsa ba gcod // bdod glogs skyes nas thob pa rnanis / mlacchedo nastidr. Le second pda dpend gramma*

ticalement 4e chiiiatfi de 80

Les racines de bien ne peuvent tre coupes d'une manire dfinitive




= adhinitrdhimtrA.


Vibh&sa, 35,

c'est--dire kamAptaupapattikni hdod gtogs skyes nas thob pa rnauis (mlni). Paramfirthu le bon (iibha) du K&niadhatu obtenu la naissance kdntaupapaftikatn ubham (??)


xvii, fol. 1




Ce sont
les racines

les racines

de bien du domaine du

Kamadhalu (kmpta)

qui sont rompues lorsque l'on rompt les racines

n'est pas

car celui qui rompt

muni des

racines de bien du Rcipadhatu ou de


en est ainsi, comment

l sont


entendre ce texte de la Prajfiapti




racines de bien des trois sphres de cette


personne (pudgala)

? (Vibhs, 35,


texte veut dire que,

ce moment, les acquisitions des racines de bien des sphres suprieures deviennent lointaines [2 b], et cela parce que cette personne,

qui auparavant tait idoine


(bhjana) ces

acquisitions, cesse de

par la rupture des racines du Kmadhtu.


des racines de bien innes (upapatiilbhika)


car la

personne qui rompt

racines de bien est dj dchue des racines


de bien acquises (pryoglka,


b, trad. p.

320, Vibhas, 35,

les racines



est l'objet de la

vue fausse qui rompt



La vue

fausse qui nie la cause,


le fruit.

Ngation de Ngation du



n'y a ni bonne, ni mauvaise action


n'y a pas de rtribution, fruit de la

. (iv.

bonne ou

de la mauvaise action


b-c, v. 7)

D'aprs une autre opinion, ces deux vues fausses, celle qui nie la
cause, celle qui nie le fruit, concourent la rupture des racines de la

manire dont Vnantaryamrga

la rupture des passions (vi. 28,

et le

vlnmktimrga concourent
qui rompt les racines a pour


Quelques-uns disent

La ngation

objet (c'est--dire nie) le ssrava, l'impur, c'est--dire les deux pre-

mires vrits,


non pas Vansrava,


le pur, c'est--dire les


dernires vrits

a pour objet la sphre o Ton se trouve (sahhle

gadhcitu), et non pas





effet, la

ngation qui porte sur






sphres suprieures est faible,

parce qu'elle n'est en relation avec ces objets que par association,





% samprayogamtrnmyitvena









Vaibhasikas disent





Les racines de bien sont rompues par la vue fausse toute entire,
qu'elle porte sur la cause

ou qu'elle porte sur

le fruit, le pur, l'impur,



sphres suprieures.

Quelques-uns disent que

neuf catgories de racines de bien,

racines de bien faibles -faibles, faibles-moyennes, faibles-fortes,

nes-faibles, etc., sont



la fois

par un


de vue fausse,





passions abandonner par la vue d'une vrit sont,

dans toutes leurs catgories, abandonnes par

(vi. 1 c-d).

vue de cette vrit



Vaibhasikas disent




Les racines de bien sont rompues de



manire dont sont aban-

passions abandonner par la mditation des vrits






la racine de bien forte-forte




rompue par
vue fausse

vue fausse


faible qui est

[3 a] et ainsi de suite jusqu' la racine de bien faible-

rompue par



Cette thorie

est d'accord



Quelles sont les racines de bien





? Celles qui sont abandonnes

lamban visahhyadhtvlamhan ca y mithyddrstih sa samprayogatasmd asau nttrena samprayuktesu dharmesv anu^etc nambanatah

durbal. 1. Le Bhfisya porte evam tu varnayanti et rpte ci-dessous la mme formule. En employant l'expression Vyflkhya evatn tu varnayanti Vaibhsikh. eiam, l'auteur marque qu'il approuve celle opinion.





evam ayam granthah

pariplito bhavati.




Jnttnaprastlina, 2, 8




Les MSS, de





phra mo dan Ihan

cig tu

anusahagata que traduisent litlralement gyur ba, Hiuan-tsang wi-ki-hing, et



xvii, fol.

2 b-3


par l'absence

en dernier lieu la rupture des racines de bien

desquelles un
le texte



est dit qui-a-les-racines-de-bien-rompues

est graduelle,

Si la rupture




Quelles sont les racines de mal fortes-fortes ?



racines de

mal par


les racines

de bien


texte vise l'achvement

(sampti) de

la rupture des racines de

bien, car c'est par les racines de




les racines


bien disparaissent totalement (niravasesaccheda). Aussi longtemps


la dernire catgorie des racines


de bien, la faible-faible, n'est


pas rompue,

peut dterminer la rapparition des autres

D'aprs certains matres, la rupture des neuf catgories a lieu en



sans interruption (avi/titthnena



l'instar de l'abandon

des passions par

chemin de


vue des


Mais les Vaibha-

sikas disent qu'elle a lieu soit sans

reprises (Vibhasa, 5,

interruption, soit plusieurs

D'aprs certains matres, l'abandon de la discipline (samvarapra-



38) prcde la rupture des racines.

Mais les Yaibhasikes


disent que la discipline est perdue (tyga)

quand on perd


dont cette discipline est

le fruit [3 b]

(Vibhasa, 35,
les racines

Quels tres sont capables de rompre

de bien ?



La rupture a

lieu chez les



seuls rompent

non pas

les tres des

mauvaises des-


car leur discernement (prajh), qu'il soit souill


irs-subtil-toujours- la suite


mais atiu-


discussion des

Dans la pratyayas (ii. 61 e), Samghabliadra critique la doctrine des antisahagatakusalamla (soi-ki-Mng) dea Stba viras c'est le terme pli,
est expliqu par la

Vykhy nirdu-mrdu




130, Kathvatthu, p. 215.



trad. p. 245-246.

j^ St^ff'^^^

piinar utpattau hetuh syt. Voir d'ailleurs ii. 36 c-d, p. 184. 2. Sur l'expression vyutthna, ii. 44 a-b, p. 206. 3. L'homme qui a pris la discipline avec une pense faible-faible perd la discipline lorsqu'il perd (tyga), lorsqu'il rompt (satnuccJieda) cette pense faible-faible qui est associe (samprayukta) une racine de bien faible-faible
(Vyfikhya et Hiuan-tsang).



ou non



79 d-80


souill (klista, dklista), n'est pas

ferme (drdha)

non pas


dieux, car le fruit de l'acte leur est manifeste



de trois

fait dfaut.

non pas ceux de l'Uttarakuru, car


mauvais saya


D'aprs une autre opinion \ seuls les

hommes du JamhudvTpa


les racines

de hien. Mais cette manire de voir est en contra:

diction avec le texte

Les habitants du JamhudvTpa possdent au



huit organes


les habitants

du Prvavideha


de l'AvaragodanTya.




et la

femme rompent

les racines.

D'aprs une autre opinion, la

femme ne rompt pas




parce que sa volont (clianda) et son application sont molles (manda).



manire de voir

en contradiction avec

le texte

Qui possde l'organe fminin possde ncessairement huit organes



Le sensuel (trmcarita) ne rompt pas

les racines

parce que son



mobile (cala)





Le rationaliste

1. aciropapannasya devaputrasya trlni cittni samudcaranti kuto 'hafn cyutah kutropapanuali kena karman (Vyakhya).

80 d. D'aprs Vibhaiiga, 340, il faut entendre par en gnral, mais l'allitude l'endroit des problmes philosophiques: croire que le monde est ternel croire la survivance du Tathfigata, .... prendre la voie du milieu entre la bhavaditthi et la vibhavaditthi.

ppsaya ;



aya, non pas



Le Bhadanta Ghosaka (glose de


l'diteur japonais).

iatra viesena

iarkikatvat (Vyfikhya).
15, 11, Vibhfisfi, 130, 12.

Le texte porte
les facults

evam Paurvafoi, etc.

videhiko Gaudtilyakah.

Le chiffre de huit organes au mininuim (cinq organes


de sensation, kya, jvita et manas) montre que exister dans le PQrvavideha.



chinatti trl


Le terme est expliqu dans la Vyakhy ad iv. 100 satkyadrstyddisu paiicasu caritah pravrtto drsticaritah j drstir va caritam asyeti drsticaritah / sa hy hpohasmarthyd anyani strani mryntaratfi ca yrahayitum samartho na tfsncaritah. - Nettippakarana, pp. 7, 109.


xvii, fol.

3 b-4



Parce que son saya est mauvais (papa), ferme (drdha)y cach

[4 a].


vertu des


principes, les eunuques, etc. ^ ne

rompent pas

racines de bien, parce qu'ils sont ranger avec les sensuels

(trmcaritapaksatvtj, parce





celui des tres des

mauvaises destines,

n'est pas ferme.

Quelle est la nature de la rupture des racines ?




rupture est non-possession.


la possession des racines de bien arrte de renatre, de se

continuer, alors nat la non-possession (aprptl), le ne-pas-tre-muni




Lorsque Vaprpti

est ne,

y a rupture des racines de bien.


les racines

de bien ont t rompues,

comment reprennent-

naissance ?


Renaissance par


doute, par la vue de l'existence de la

cause, etc.

arrive que

l'homme dont

les racines

de bien sont rompues pro-

duise, relativement la cause et



ou doute, ou vue de leur

existence (astidrsti), c'est--dire vue droite (samyagrsti). Lorsque


vue droite

est ne, alors




les racines

de bien ont repris


parce que la possession de ces racines est dsormais

prsente (tatprptisamudcrf). Les racines reprennent naissance

dans leurs neuf catgories




graduellement qu'elles se
la sant

De mme qu'on reprend d'abord



ensuite, graduellement, des forces.

1. 2.

gdha = pracchanna (Vyakhya). Hiuan-tsang traduit pandaka, sandha, ubhayavyanjanaka, avyanjanaka.

de ni mi Idan paho



Vibhfis, 35,


= [so




mthsams ni the thsom yod Ita bas =: [vimatystidrs samdhili] pratisamdhitni pratisamdhikrtni pratisamdhitni / prtipdika' dhtuli j pratisamhitnty apare pathanti (Vykhya).




arrive que, relativement la cause et



et fruit existent peut-tre ,

au fruit, ou bien naisse ou bien naisse vue droite Cause et





80 d-81








coupable d'nantarya.
les racines

Les autres personnes qui ont rompu


de bien peuvent

reprendre ds cette vie

97) qui a

mais non pas

coupable iXnantarya


les racines de bien. C'est

au sujet de ce pcheur

qu'il est dit

Cette personne (piidgala) est impropre (bliavya)


reprendre les racines de bien dans cette vie (drstadharma)

elle les


reprendra certainement soit en mourant

l'enfer [4 b], soit

en naissant (iipapadyamna)

(cyavamdna) de % En nais-



se trouvant dans l'tat intermdiaire [qui prcde

l'existence infernale].

En mourant


dispos mourir

[de l'enfer] (narakacyutyahhimikha).

Les racines de bien sont

la force de la

reprises en naissant lorsqu'elles ont t

rompues par

cause (hettibalena)

en mourant, lorsqu'elles ont t rompues par la

force de l'occasion (pratyaya).


diffrence lorsqu'elles ont t


rompues par

la force personnelle,

par la force d'autrui.


qui est
le fait

vinasta) par

c'est--dire perdu (vipanna, sayavipanna de vue fausse (mithydrstisammnkhbhva)

reprend les racines dans la prsente existence.


qui est

fruit existent





perdu en outre


est faux qu'ils n'existent pas




racines de bien reprennent naissance.



possession (prpti) du bien se



que cet


a repris

les racines

de bien.

Certains matres

disent que les neuf catgories reprennent naissance successivement. Mais


[Vaibhsikas] disent qu'on reprend en une fois les racines de bien c'est cependant
plus lard et peu peu qu'elles se manifestent, de


qu'on expulse



d'un coup et qu'on reprend des forces graduellement,






explique pourquoi

nantaryakr nantaryatac cittam aknoti

cittenvirahito bhavati

yvan maranvasthym na
xiii. 3.

prativinodayitum ... 2. Madhyama, 37.





vue fausse.




C'est le cas o


adhre spontanment (svayam)

pratyayahnena. c'est--dire

par la force de la parole d'autrui (parato gliosa).

balena, par la force du raisonnement personnel.

svabalena = scatarkaparabalena

= paratah

rutabalena. 4. Voir ci-dessus

p. 174, n. 2.

le fait

xvii, fol.

4 a-5



du pch nantarya

ne reprend

les racines qu'aprs la

destruction du corps.
ce qui vient d'tre dit

[Ceci est une variante


(ayam paryyah)


Celui qui a

les racines

par sa propre
celui qui

par la force d'autrui

Mme diffrence pour

et celui qui est


drstivipanna (perdu par



vue fausse)

la fois


lavipanna (perdu en outre par

pch ^nan-

[Ceci est une variante de ce qui prcde immdiatement].


peut avoir



racines de bien (samiicchinnakusalaiii.

ne pas tre vou la perdition (mithytvaniyata,



Quatre cas


et les cinq autres

docteurs ^ 2. Ajta-

satru, 3. Devadatta, 4. les

et qui n'ont


qui n'ont pas


les racines

pas commis


pch nantarya.


de vue fausse, qui rompt les racines de bien, est puni


l'hoinme coupable



est puni

dans l'Avci

ou ailleurs



volition (cetan) est le principe de l'acte.

Nous expliquerons

avec combien de chemins-de-l'acte la volition peut coexister. [5 a]




ce qui regarde les

mauvais chemins,

la volition peut

coexister avec huit chemins au



volition avec

un chemin.

Lorsque se manifeste convoitise,


ou mchancet, ou vue fausse, sans qu'aucun chemin

Le Samyutta,
266, distingue le






et le




p. 21, la dfinition

Voir Puggalapanlatti,

du sllavipanna (sabbam dus106,

sllyam^^sllavpatti) et du ditthivipanna (sabb micchditthi=:rditthivipaUi).

Dans Samadhirja prapanna.





= kumrga-

Les six matres (sstar), types du mauvais matre (ayathrtha) (Vyakhy,


p. 8,

sont Prana Ksyapa, Maskarin Goslputra, Samjayin Vairatputra,

Ajita Kesakambalaka,

Mahfivyutpatti, 179 (voir les


Kakuda Ktyyana et Nirgrantlia Jntiputra. nombreux quivalents tibtains et chinois dans les de Wogihara et Sasaki) Divyavadna, p. 143 (VairattTputra, Kesakam;

bala), Burnouf, Introduction, 162, Lotus, 450.

4. 5.

Manque dans les deux versions chinoises. Voir iv. 99 c. astabhir yvad aubhais cetan saha vartate j yugapat.





ou bien lorsque l'homme qui a prpar un des


chemins matriels se trouve avoir une pense non-souille,


bonne ou non-dfinie, au moment o, sur son

est perptr.

instigation, ce



volition avec

deux chemins.



de pense

mchante (vypannacitta) tue (prnivadha)

proie la convoitise (ahhidhyvistaj vole, ou
parle d'une manire inconsidre.








volition avec trois chemins.

et vole



de pense

mchante tue





dira-t-on, n'avons-

nous pas vu que


vol n'est achev (nisth) que par le seul dsir

70) ?

Cette restriction vise l'achvement (parisa-

mptaii) du vol (adattdna) commis par un

seulement voler (apaharana)


qui pense


volition encore avec trois chemins.

Lorsque la convoitise est



(sammukhhhva) au moment o

consomms deux

chemins matriels qu'on

commettre par

autrui. [5 b]


volition avec quatre chemins.


Lorsqu'on menl (anrtavacana)

Sivec l'intention

ou lorsqu'on


de diviser


aklistacetaso vpi tasya prayogena

rpinm anyatamasya nisthpane.

une pense


faut exclure l'amour illicite toujours accompli en personne et avec



peut critiquer cette rdaction. S'agit-il d'actes commis en personne ?

est inutile de spcifier




meurtrier est de pense mchante, que



voleur est en proie au dsir, d'aprs


principe vyabhicre



d'actes qu'on fait


commettre par autrui ? Alors



convoitise, ou la
le vol, etc.

mchancet, ou

vue fausse peut coexister avec

meurtre, avec

nous spcifions, ce n'est pas vrai dire spcifier, mais seulement expliquer quels sont les deux chemins. Soit, mais il y a aussi deux chemins dans l'hypothse de l'homme qui fait com:



s'agit d'actes

commis en personne,

et si



meurtre avec pense de convoitise.




ce cas devrait

tre signal

mais l'auteur veut seulement donner un exemple.


3. vypannacittasya prdniniranpaharane yugapat. Vyttkhy yutra m&ranenaivpaharanatn sidhyati / tatra hi vypdaprntvadhdattdnakarmapath yuyapad bhavanti. 4. ananyacittasya tatparisapiptau sa niyamah. \ y Hkhy a uinyacittasya tu mranaciltasya nyam niyamah la restriction n'est pas justifie quand


s'agit d'un


qui vole en vue de tuer.

a un chemin mental

xvii, fol.




chemins vocaux






pense est en proie la convoitise,

(ahhidhydigata), au moment

o sont consomms


chemins matriels.


volition avec cinq, six, sept chemins.




pense est

en proie la convoitise,
cinq, six

au moment o sont consomms quatre,

chemins matriels.


volition avec huit chemins.


Un homme

fait le


de six chemins, meurtre,

au moment o ces six chemins sont




en proie la convoitise et commet l'adultre.


volition ne peut coexister avec neuf chemins, avec dix chemins,

parce que la convoitise, la mchancet, la vue fausse ne sont pas





ce qui concerne les bons chemins, la volition coexiste


Les dix bons chemins peuvent tre simultans la




Elle ne coexiste pas avec un, huit, cinq chemins.


mensonge, qui est paisunya (parole maligne) puisque



a l'intention de diviser, qui est parole inconsidre puisque toute parole souille
est parole inconsidre (iv. 76 c-d).

De mme pour l'injure.

ou mchancet




chemin mental peut mental est mchancet.


tre convoitise


l'injure, le


C'est la


parole qui est mensonge, parole maligne, parole inconsidre

la distinction

des trois chemins vocaux est donc purement verbale, non relle.
la distinction est relle, car

D'aprs une autre opinion,

y a lieu de distinguer

trois vijnaptis. [Les interlocuteurs sont tromps, diviss, etc.]


dge ba bcu


bar dag da

= [dasabhir yvac chubhair]





volition ne peut se trouver avec



chemin unique ne peut

pense bonne est toujours accompagne de non-abliidhy et de non-vydipcida ; il ne peut tre un chemin matriel compris dans la discipline, car les disciplines comportant au moins le renoncement au

un chemin mental, puisque


meurtre, au vol, l'amour



volition ne peut se trouver avec cinq

au mensonge. chemins

ce qui supposerait les quatre

chemins des disciplines les plus troites (Upsaka, etc.), plus un bon chemin mental or la nou-abhidhy et le non-vypda sont insparables. La volition ne peut se trouver avec huit chemins. En effet, le-Bhiksu de pense mauvaise ou non-dfinie ne possde que sept bons chemins, et, lorsque la pense

est bonne,


en possde au moins neuf.


volition avec


81 d-82



deux chemins.

Un homme

dans un recueille-

ment d'rQpya, en possession du ksayajnna ou de Vamitpda-



45, 50)

les cinq

connaissances sont bonnes.



y a donc

deux chemins

non-abhidhy, non-vypda.

La volition avec trois chemins. tale (manovijnna) est associe

les sept


la connaissance




bons chemins matriels manquent.

avec quatre chemins.




avec une pense

mauvaise ou non-dfinie, on prend


la discipline

d'Upasaka ou


de Sramanera qui comportent quatre bons chemins matriels, nonetc.


volition avec six chemins.


les cinq


tant bonnes, on prend les


quatre bons chemins

matriels, non-convoitise, non-mchancet.


volition avec sept chemins.


Lorsque, avec une connaissance


mentale bonne, on prend


ajouter la vue droite.


bien quand, avec une pense mauvaise ou non-dfinie, on

la discipline

de Bhiksu

sept chemins matriels sans plus.


volition avec neuf chemins.





prend la


pline de Bhiksu, les cinq connaissances (connaissance visuelle, etc.)

tant bonnes


vue droite manque

on prend






o, dans

un recueillement d'rpya, on possde ksaya


ou anutpdajnna [C'est



ci-dessus, des

deux cheici



faut ajouter les sept chemins de la discipline, qui


ne sont

pas avijhapti]

au cours d'un recueillement de dhyna, on possde


ksaya ou anutpdajnna [La vue



les sept


matriels existent en tant que partie de

la discipline de


ne sont pas drsti (vii. 1) donc la accompagne de samyagdrsH. Dans les recueillements d'rpyadhalu manquent le rpa, et, par cons(juent, la discipline avec les sept bons chemins corporels et vocaux. 2. Le texte porte kualesu paicasu vijnesii tatsamCidne ksaynntpdajnnasatnprayukte ca manovijfine tasminn eva ca dhynasafngrhite.

Le ksayajiina

et V anutpdajnna

volition de cet


n'est pas

Hiuan-tsang distingue nettement

les trois cas

Lorsqu'on prend

la discipline


xvii, fol.

5 b-6





avec dix bons chemins.


les cas diffrents

lorsqu'on prend la discipline de Bhiksu avec une connaissance

tale bonne,




cas de Usayaj flna et


toute volition concomitante (sahavartin) la discipline de



la discipline

pure lorsque cette volition n'est pas associe au

ksaijajhna ou Vamdpdajnna.

Nous avons montr dans



conditions la volition coexiste

bons chemins-de-l'acte inclus aux disciplines (sanivara-

sanigrhlta). Si on envisage les bons chemins de l'acte indpendants

des disciplines, la volition peut aussi se trouver avec un chemin, avec

cinq chemins, avec huit chemins


Lorsqu'on renonce un pch (ekngaviratisamdna) et qu'on

celle qui

a une pense diffrente de


provoque ce renoncement,


une pense souille ou non dfinie



lorsqu'on renonce

deux pchs

qu'on a une connaissance mentale bonne




connaissance mentale comporte




mentaux auxquels

deux renoncements, deux actes matriels

8. lorsque,


conditions, on renonce cinq pchs. '[6 b]


Quels sont

chemins de

l'acte qui existent, soit


fait, soit


possession ^ dans les diverses destines ?





parole inconsidre, parole injurieuse, mchan^

cet, des

deux manires.
les cinq

de Bhiksu

connaissances tant bonnes

les cinq



vue droite

manque parce qu'on admet







ou non-dfinie

on renonce cinq pchs.

y a aussi cinq chemins lorsque


pense tant


par possession

sammukibhvatas (mnon sum du hgyur ba), svayatn (dhos su) , sanianvganmt, sainanvayt, prptitah, Idbhatas (Idan

pahi sgo nas, Idan pas, brned pas, tcheng-tsieou).

Les tres de l'enfer n'ont pas convoitise

la convoitise n'existe la convoitise


pas en enfer



n'ont pas coup la prpti


36 b) de


possdent, passe,

la convoitise qu'ils ont

eue dans une existence antrieure.

dmyal ba na ni bkyal ba dan / thsig rtsub gnod sems rnam gnis so Vibhsa^ 113, 5. [bhinnapralpaprusyavypd narake dvidhd /]. lieu o naissent mauvais, naraka naraka : nara homme, ka agrable (comp. DhtupStha, 10, 197), naraka mchants; ou bien raka



o rien n'est agrable (VibhsS, 112,







Parole inconsidre, car les damns se lamentent (parideva)

parole injurieuse, car les
injurieux (nigrha)


se font mutuellement des reproches

qu'ils se hassent mutuelle?)

mchancet, parce

ment dans

la duret de leurs

mes, (cittasamtnaprusyt



Convoitise et vue fausse, par possession.


Les damns possdent convoitise

n'existent pas actuellement en enfer

vue fausse, mais


par suite de l'absence de tout

objet auquel on puisse s'attacher (ranjanlyavcisiu) [7 a] ^ parce que

le fruit

de l'acte est manifeste.

manque le meurtre, car les damns meurent par puisement de l'acte (karmaksaya, ii. trad. p. 217-9) manquent le vol et l'adultre, car les damns n'ont en propre ni objet de proprit, ni femme (dravyastrlparigrahbhvt) ; manque le mensonge, qui serait sans utilit manque la parole maligne, qui serait sans utilit, car les damns sont d'avance et toujours diviss.




Trois dans l'Uttarakuru.

Convoitise, mchancet et vue fausse existent dans


Kuru en


sens que les habitants du Kuru sont en possession de la convoitise,

de la mchancet


de la vue fausse. Mais, en

rien en propre


la convoitise

manque, car on n'y possde



y mchancet,

parce que les mes sont douces (snigdhasamtdnatvt), parce que


dfaut toute cause de dplaisir (ghtavastu)





fausse, parce que fait dfaut le


mauvais aya (appsayatvt)




nigraha; Hiuan-isang, ma, maudire,


injurier; Vyutpatti, 255,


brgyad gag

Udftnavarga, xx.


brnab sems log Ita Idan pas so [samanvgamato 'bhidhyniithyddrsH] Vibhasa (172, 5) Dans l'enfer Samjlva (iii. 59, Lokaprajnfipli, dans Cosmo:

logie bouddhique, p. 324, Mahftvastu,


10) le vent

froid pii ressuscite les


excite la convoitise




n'y a pas, pour cela, le chemin-



[kurau trayant


xvii, fol.

6 b-7





Le septime chemin y

existe en fait aussi.

parole inconsidre y existe en fait

car, quelquefois, les habi-

tants du

Kuru chantent avec une pense



Parce qu'y

dfaut le mauvais aya, parce que la dure de la


y est dtermine



trad. p. 219), parce qu'on n'y pos-

sde en propre ni objet de proprit, ni femme, et encore par

d'utilit, le


et les autres chemins-de-l'acte

manquant dans

Si les

hommes du Kuru
soit la

n'ont pas une


comment donc


femme en propre (parigra(katham esm ahrahmacaryam) ?


Quelle que
sir, ils la

femme avec

dsirent goter le plai-

prennent par la main

vont vers un arbre. Si cette




permise (anaganiya), l'arbre recouvre


couple de ses branches



cas contraire, l'arbre ne recouvre pas le couple.

Ailleurs dans le




les dix

mauvais chemins.


Les dix mauvais chemins existent en

exceptant l'enfer et l'Uttarakuru [7


Kamadhatu en


ce qui concerne les animaux, les Prtas et les dieux, les

vais chemins ne sont pas intgrs l'indiscipline (asanivaranir-

miikta, voir




en ce qui concerne





chemins sont ou intgrs, ou non intgrs


Le meurtre
Prtas, etc.


chez les dieux ? Les dieux ne se tuent pas

entre eux, mais

tuent des tres appartenant d'autres destines,

D'aprs une autre opinion, les dieux aussi meurent


par la rupture de la tte ou de la


de na bduii pa dnos su yan [saptamo 'tra] svayam api. Pas de mariage dans l'Uttarakuru, Mahabhrata, i. 122, 7. 3. hdod pa gzhan na mi dge bcu [knie 'nyatra dasubhh /] devo 4. dev api iromadhyacchedn mriyanta iti. On vient de dire devant na mdrayati, un dieu ne tue pas un dieu *, ce qui implique la conclusion les dieux ne peuvent tre tus (avadhya). En effet leurs membres et sousmembres, coups, renaissent. Cependant leur tte, leur taille ne repoussent pas quand elles sont coupes donc les dieux peuvent tre tus.





83 c-85



Trois bons chemins existent partout, et par possession



Partout, dans les trois sphres d'existence et dans les cinq destines, la non-convoitise, la non-mchancet et la vue droite existent

par possession








rQpyas, chez

les Inconscients, sept,

par posses-

les sept

les tres de



chez les Asanijfiisattvas (ii.41



bons chemins matriels, corporels

qu'ils sont possds.

vocaux, existent seule-

ment en tant




ryas qui renaissent dans rArpyadhatu possdent

la discipline

les Inconscients

ou moralit pure, passe

et future, et

possdent la discipline de








discipline pure, passe,

que possde l'rya ren dans l'rQles tages (quatre


pyadhatu, a pour point d'appui (sraya) l'tage ou

dhynas) auquel ou auxquels


Ta produite

et dtruite

la discipline

pure, future, qu'il possde, a au contraire pour point d'appui les cinq

tages (Kamadhatu et quatre dhynas).


et les


le reste,


fait aussi,

en exceptant

les tres infer-


1. dge ba gsum ni thams cad na / rned dan mnon du gyur sgo nas [stibhatrayam tu sarvatra sammiikhtbhvalbhatah //J [rpysatnjni2. gzugs med hdii ses med sems can / rned pas bdun yod sattvesu lbhatah sapta] 3. yadbhmysrayam ansravatn silam ryenotpditatn nirodhitam pancabhilmysrayena tv tenrpyesv atitena samanvgato bhavati andyatena. Par xUpdita, il faut entendre vartamnant adhvnam gamifam; par nirodhita, atiiam adhvnatft gamitam. Problme discut dans

Vibhasa, 132,


Ibag byas na (=: Ihag mar byas pas na)

ninon du gyur bahi sgo nas kyaA


dmyal bcas sgra mi sfian ma gtogs n>rakakuruvarjUe //]


satfttntikhlbhCtvata cdpi


xvii, fol. 7





reste, c'est--dire


les autres

sphres d'existence, dans les

autres destines.




infernaux et chez les Kurus

les sept


la moralit

d'engagement (samdnalla). Ailleurs

riels existent

bons chemins mat-



[8 a]

faut tablir une distinction.





chez les Prtas,



bons chemins ne sont jamais intgrs


la discipline




sont toujours intgrs la discipline

ailleurs ils

peuvent tre de l'une ou de l'autre catgorie.





chemins ont


de rtribution, fruit d'coule-

de souverain.



les dix

chemins de

l'acte portent


triple fruit.

Par chaque mauvais chemin pratiqu (sevita),

sarve 'clhipaUnisyandavipkaphalad ntath



Les explications de Vasubandhu reproduisent, avec de menues variantes, celles

de Vibhs, 113,


trois fruits ont t dfinis


5(5 et




tant pass,

peut porter un
et suivantes.

voir le trait sur le

Hiuan-tsang, xxx, 13 b) et

Pudgala qui termine le Kosa (trad. de l'importante discussion dans Madhyamakavrtti, p. 316

Tout ce que l'homme sent n'a pas pour cause les actes anciens (Majjhima, ii. de Ksyapa-le-Nu (mme dbut que Samyutta, ii. 18) qui constitue un chapitre de la KarmaprajnSpti (Mdo, 62, 241 a), la souffrance est produite par soi (lorsqu'on se coupe les cheveux, la main, etc.), par autrui (lorsqu'un autre coupe la main), par soi et par autrui (lorsque, avec autrui, on se coupe la main), ni par soi ni par autrui, mais par des causes et conditions comme, par exemple, le vent se levant, la pluie tombant^ la foudre frappant, ou les maisons
214). D'aprs le Stra



les arbres

sont briss, ou les sommets de rocher sont prcipits


quelques-uns ont

pied coup

la souffrance

dans ce cas est produite par des

toute souffrance sont produits

causes et conditions.

Ksyapa, tout
et autrui,

plaisir et

(rtti) .... en hiver par le grand grande chaleur, en t par le froid et le chaud, se produisent plaisir et souffrance . Mais le problme n'est pas rsolu par ces dfinitions nous savons en effet que le trouble mental (qui est sensation pnible) nat du trouble des lments et n'est pas de rtribution, mais que le trouble des lments est rtribution (iv. 58). De mme en va-t-il de la maladie, etc. Sur le

par autrui, par soi


par la saison


en saison des



utuja, comparer Milinda, p.271, Visuddhimagga, 451, Compendium,


161 (l'origine



douleur n'est pas envisage)




les huit sortes

souffrances, Milinda, 134-135.







dvelopp (hahulkria) \
de rtribution.
2. Si le

coupable renat en enfer


Tel est

le fruit

coupable renat dans une existence humaine, par



est de vie brve


(alpyur hhavati)
il il


le vol,

pauvre (hlioga-

dra); par

par l'amour

a une pouse






calonmi (ahhykhynahahiiln) [8

par la parole maligne, ses amis deviennent ennemis (hhinnapari-


par la parole injurieuse,


n'entend que des discours odieux

parole n'obtient

(amandparavana) ; par la parole inconsidre, sa pas crance (andeyavacana) ; par la convoitise,


est de





par la mchancet,


est de

grande haine

par la vue fausse,

de grande aberration, car l'aberration est

est le fruit d'coulement.

grande dans


vue fausse. Tel

Mais, dira-t-on, une existence humaine, fut-elle brve, est la

bution d'un acte bon.


peut-on la regarder


le fruit

d'coulement du meurtre ?





Stra indique, par ces

trois termes, le prparatif

proprement dit (mailla), le conscutif (prsUia). Cette interprtation n'est pas admise par toutes les coles comme on verra ci-dessous, p. 187-S. la 2. La renaissance infernale est donne comme exemple de rtribution

renaissance animale, la renaissance


de prta


sont aussi rtribution.

3. [prnUptensevitena bhvitena bahulikrtena narakespapadyate] saced itthamtvam gacchati manusynm sablmgatm prntipaten- Karmaprajiiftpti Ipyur bhvati j adattdnena bhogavyasani bhavati (Mdo. 72, fol. 206 a) ... par le meurtre fort, on renat cliez les tres infernaux par le meurtre moyen, parmi les animaux; par le meurtre faible, parmi les Prtas. Mme doctrine dans Dasabhmaka, ii (cit Madhyamakavatfira, ii. 7, traduit Muson, 1907, p. 290). Comparer Anguttara, iv. 247 pntipdto bhikkhave sevito bhvito bahulikato nirayasantvattaniko tiracchnayoni^atftvattaniko pittivisayasaiftvattaniko j yo sabbalahuso pntijyta^sa vipko manussabhtassa appyukasamvattaniko koti ; Jfttaka, i. p. ^Ih: pndtiptakammam nma niraye tiracchdnayoniyam pettivinaye asurakye ca

manussesu nibbattatihne appyukasamvattanikatn hoti. Fragments du Kandjour (Karmavibhanga) Saddliarmasmj-tyupasthana (Lvi, Pour l'histoire du Itamayana, J. As., 1918, i. 9) cit Siksasamuccaya, 69 et suiv. Chavannes, Cinq cents contes, i. 198 etc. La quasi-impossibilit d'une naissance humaine pour le bla une fois qu'il

est n en enfer



nouveaux pchs que l'ancien damn commet, Majjhhna, voir J. Przyluski, Lgende d'Aoka, p. 120).

fcheux caractres de cette naissance (caste, etc.) et les i. 169 (Balapanditasutta;


xvii, fol.

8 a-9



Nous ne
du meurtre

disons pas que celte existence soit


le fruit

du meurtre

nous disons que


coupable de meurtre sera de vie brve en raison


meurtre est la cause qui rend brve une existence

humaine qui

d'ailleurs est cause par

un acte bon.


raison de la pratique intense du meurtre, les choses extles plantes,




= alpavlrya)


sol, etc.

sont de

petite vitalit

en raison du vol,

sont accables par des




ou d'acide (asanirajohahida)

en raison de l'amour


sont couvertes de poussire ou

d'acide (rajovaklrna) ; en raison du mensonge, elles sont de


odeur (durgandha)

en raison de la parole maligne,

elles sont

fosse et en bosse (utkidanikida

= unnatanimna)

en raison de la

parole injurieuse, elles sont imprgnes de sel et striles (sarajan-



s'agit des terres,



sont dtestables (vipra-


= vigarhita)
sont petits

et pernicieuses



s'agit des plantes

en raison de la parole inconsidre, les saisons sont bouleverses

(visamartuparinmd hhy hhvh)

; ;

en raison de la convoitise,
les fruits

en raison de la mchancet,
les fruits



en raison de la vue fausse,

sont peu

nombreux ou

manquent. Tel

est le fruit de souverain. [9 a]

Est-ce en raison du meurtre





coupable renat en enfer

ensuite, ne jouit

que d'une courte vie humaine ?

D'aprs les uns, c'est en raison du meurtre



infernale est le fruit de rtribution, la brivet de la vie est le fruit

d'coulement du meurtre. [En


effet, la

rtribution est toujours sensa-

d'avoir une vie brve vient de l'acte proprement

D'aprs les autres, l'existence infernale vient du prparatif du


le fait


est vrai



Stra parle du meurtre


cause d'existence




pchs rduisent

dtrioration des

la dure de la vie humaine CakkavattisThanadasutta (Dgha,



prajnSpti, xi (traduit

aanih silvrstih
Le texte porte


dans Cosmologie bouddhique, p. 309 et suiv.). / rajo dklivrsHh ksravrstir va (Vykhy). tatra prayogeneha maulenety apare.








entend par meurtre, non pas





meurtre avec


cortge des actions qui l'accompagnent (sapariici


vra). Ce qu'on appelle fruit d'coulement n'existe pas


(ntivartafe) du


de rtribution et du


de souverain.


d'coulement en raison de la ressemblance entre la cause

et l'effet (tuer, avoir


vie brve

voler, tre pauvre, etc.).

Celui qui

le fruit

des chemins de l'acte


est-il triple


meurtre (prncitipta)

fait souffrir celui qu'il

va tuer (vadhya)^
vigueur (ojas)




krtamj, dtruit sa




fruit est triple,

parce qu'on

fait souffrir,

parce qu'on


mourir, parce qu'on dtruit la vigueur.

Parce qu'on

fait souffrir, fait

fruit de


souffrances infer:

parce qu'on

mourir, fruit d'coulement

la vie est brve


parce qu'on dtruit la vigueur ^ fruit de souverain

rieures sont de petite vigueur.


choses ext-

De mme pour

les autres

chemins de



De mme
dieux [9 b]
vie longue.

trois fruits des

bons chemins de





ment au meurtre

pratiqu, cultiv, dvelopp, on renat parmi les



on revient


la condition

humaine, on a une
oppos celui des

Pour tous

les actes bons, le fruit


actes mauvais. (Vibhasa, 113,

Bhagavat distingue

mauvaise parole (mithyvc),





mauvaise manire de vivre (mithy-


duhkhann [inrand] ojonsant trividham phdlam





La vigueur rside dans le cur ojo hrdayapradee bhavati. adattdnafn ht kurvat dravyasvdmino duhkham utpditatn bhognvyasanam krtam ojo nitam / ato 'sya duhkhand bJiogatyajanad ojonsant ca trividhatn phalam // evam paradram abhigacchat parasya duhkham lUpditam sasapatnadrat krt ojo nitam yenaujas tejasvti

loke nirucyate.

Hinan-tsang, xvu,


a- 10 a.

de la mithyvc

Est-ce dire que



soit distinct

du mithi/karmnta ?

n'existe pas part



Les actes corporels



vocaux qui naissent de


ment sont

mauvaise manire de vivre


elle constitue



gorie part, parce que


L'acte corporel et l'acte vocal ns de la haine et de l'aberration

sont respectivement ce qu'on appelle


mauvais acte (mithykarl'un



mauvaise parole (mithyvc). Ns de l'attachement,


et l'autre constituent la

mauvaise manire de vivre (mithyjva),


ainsi distingue parce

manire de vivre

est difficile


L'attachement (rga), de sa nature, est un bandit (apahar)


garde difficilement la pense des actes que provoque l'attachement.

Par consquent,
vit, est difficile



manire de

vivre, aussi

longtemps qu'on

purifier, afin

qu'on s'applique la purifier, Bhaga-

vat fait de la mauvaise manire de vivre une catgorie part. [10 a]


y a une stance




difficilement l'opinion,


Saipyukta, 28,


VlbhasS, 116,


Ce sont


des mithyngas, Dlgha,



h'jlva, d'aprs l'opinion rfute



c-d, est





manire de se procurer

vivre, vtement, etc.



dan nag


chags las skyes

log hthso sbyan dkalii phyir logs sig


bstan te

= [rgajam kyavkkaruta mithyjlvah prthakkrtah



Voir Vjvaprisuddhi, Visuddhimagga,

siijlvam ahirkena



Le mithyjva est dcrit Astasahasrika, p. 334. atrha. Vibhasa, 116, 13. [duhsodh drstir grhina nityam] vividhadrstin / [bhiksun tv jva eva] paresv yattavrttin // Les superstitions du lac sont numres dans la Vyakhy kautukamangala3.


Dict. de S* Petersbourg,





voir Childers


dit sur roc (Senart,


Suttanipata, 258; Jataka, 87; Huber, Sotralainkara, 302.

- Mahavyutpatti, 266,


Waddell, Lamaism, 392 mangalaposadha. Lalita, 378, 9, mangalaptirna kumbha.

Grnwedel, Mythologie, 47

Le moine, qui dpend d'autrui pour la nourriture, etc., est port pratiquer kiihan lapan naimittikat naispesi[ka]t et lbhena lhhaniciklrs qui
sont autant de mithyjvas.








86 C.87


toujours la proie de multiples opinions




purifie difficilement

manire de vivre, car sa subsistance dpend d'autrui


c-d. Si


dit qu'elle est

la vie,

l'acte issu

de l'attacbement

aux ressources ncessaires

contradiction avec


car cette opinion est en



Si quelqu'un pense que danser, chanter,

plaisir n'est


pour son propre

pas mauvaise manire de vivre, parce que la mauvaise

les actes corporels et

manire de vivre comprend seulement

inspirs par l'attachement


aux moyens de subsistance ^ nous rpon'\


Non. En


Bhagavat, dans la Slaskandhika

dai hgal phyir

a enseign


gai te yo byad la

ehags slan imlo



= [vasltirgottha

cen cen
2. 3.

na stravirodhatah

littralement pariskra,


jiviiopakarana, Mahvyutpatti, 289,


llaskandhikym iti llaskandhiknm samnipte (Vykhyfi) il faut sllaskandhnfn .... La SlaskanJhika est la collection des sldcorriger
: :

skandhas. D'aprs le tibtain et Iliuan-tsang SlaskandhasQtra; Paramfrtha kidi tsi king : Slasamnipfitastra.

L'diteur japonais renvoie Sarnyukta 18,


qui correspond Samyulla,

le texte vis


228 (l'homme qui mange



bouche en bas,



par Vasubandhu


une rdaction sanscrite des slas de Brahmajla et Samannaphala (Dgha, i. Lotus de la Bonne Loi, 465 Rhys Davids, Dialogues, i. 17 0. Franke,
; ;




p. 5).

Le texte fourni par



Vykhyfi s'carte du



des versions chinoises du Dlrgha. Nous

copions tout au long

yathd Tridandinn



sratnanabmhmanh sraddhdeyam paribhujya

amiyukt viharanti j tadyath hastiyuddhe 'svayuddhe ratliayuddhe pattiyxiddhe yas iyuddhe mustiyuddhe srasayuddhe vrsabhayuddhe mahisayuddlie ajaytiddhe mesayuddhe kukktitayuddhe vartakayuddhe lbakayuddhe stryuddhe purusayuddhe kumraynddhe ktimrikytiddhe ndgrane ttdytkikdym b dhvajgre bagre senvyhe anikasamdarsane mahsamjam va pralyannbhuvuniy


evamrpc chramano vividhadaranasamrambhmiyogt pratiyath Tridandinn eke sruntanabrhmanh sraddh// deyam paribhujya vicidhasabdasravanasamrambhnuynkt viharanti / tadyath rathasabde pattisabde unkhsabde bhersabde dambaraabde


virato bhavati

nrttaabde gltabde geyuabde ^ ucchatsabde pnisvare kimbhatnre citrksare c citrapadavyanjane Jokyatapraiisamyukte d khyyik va rotum icchanty eke ity evamrpc chramano vividhasabdaravanasamrambhmtyoyt prativirato bhavati jj


xvii, fol.

10 a-b.




vue des combats d'lphants,

pourquoi ? Parce que


mauvaise manire de

vivre. Et

c'est jouir

de mauvais objets (mithyci'

visayaparibh oga).

Nous avons vu


56) qu'il y a cinq fruits, fruits de souverain

(adhipati), d'activit virile (purusakra), d'coulement (nisyanda),

de rtribution (vipaka), de disconnexion ou de libration (visamyo-


On demande combien

de fruits comportent les


rentes espces d'acte.



Impur, dans


chemin d'abandon,



les cinq

[10 b]

Le chemin d'abandon (prahnamrga)


est ainsi



a pour but l'abandon (pralinrtham) ou parce que les passions

sont abandonnes grce lui (prahyante 'nena). C'est le chemin

nomm nantarya

qui sera dfini plus loin



28, 49) et qui est de

pur (ansrava)

impur (ssrava).
une rtribution agrable qui

L'acte qui fait partie du chemin d'abandon impur, comporte les

cinq fruits



de rtribution

appartient au


tage que l'acte






ns du recueillement, pareils


dhij dtare sadrs dharmh)


3. fruit

de disconnexion
la liste

la discon-

les Tridandiiis

(tedandika, traidandika) voir


des confrries et

asctes htrodoxes dans Angiittara, niddesa, 89, 310, 416


276, Majjhima, 57, Milinda, 191,




notes de Rliys Davids, Dialogues,


220, Bendall,

Siksasamuccaya, 331

Foucher, Gandhra,


MS. ndylavase utsatikym



de Cambridge communique par

51 et 53.

E. J.

Correction d'aprs Mahvyutpatti, 261,


Pratimoksa, Pc. 48-50


= Ptayantik 47, Finot,

kacite cUrksare.


As. 1913,


MS. ayysabde


v. p.


nacca glta vdita

akkhna pnissara kumbhathna



vi. p.

276: ktimbhathna,

thnika ; Mahavastu, ii. 150, iii. 113: kumbhatni, tuna, tnika, thnika ; cakrikavaitlikanatanartakarlamallapnisimrik obhik langhakktimbhatiinik

Lire praiisamyiikt


bcas spon bahi lam dag gi

l'acte^ c'est--dire

las ni liia yis hbras


bur bcas

= [prahna

mrge samaam] saphalam [karma pancabhih

2. Pareils

qui ne sont ni purs, ni non-dfinis.


tha et Hiuan-tsang, d'aprs les dfinitions de

postrieurs, pareils,

52, traduisent


gaux ou suprieurs

nexion d'avec
(a) le

les passions,




l'abandon des passions

4. fruit d'activit


dharmas que

cet acte fait natre (taddkrsta), savoir

vi. 28), (b) les

dharmas dharmas futurs dont cet acte fait obtenir la possession (yac cngatam hhvyate), (d) l'abandon luimme ' 5. fruit de souverain tous les dharmas conditionns en exceptant l'acte en question, en exceptant les dharmas dj ns
chemin de dlivrance (vimuktimrga,

qui coexistent (sahahhj

(c) les






comporte quatre


Les prcdents, en exceptant

le fruit

de rtribution.



De mme

aussi tout acte diffrent, impur, bon ou mauvais

L'acte qui ne fait pas partie du

chemin d'abandon, qui



qui est bon ou mauvais, comporte aussi quatre fruits, en exceptant

le fruit

de disconnexion.




reste de l'acte


et l'acte non-dfini, trois fruits.

reste de l'acte




pur non inclus dans


chemin d'abandon, mais faisant partie des prayoga-vimuMi-visesa-





ne comporte

ni fruit

de disconnexion, puisqu'il

n'est pas cause d'abandon, ni fruit de rtribution, puisqu'il est pur.

Les deux


manquent aussi

l'acte non-dfini, qu'il

ou non

souill (nivrta,

Quelle peut tre la nature, bonne, mauvaise ou non dfinie des

fruits des diffrents actes ?


C'est--dire les

dharmas associs



et les

soci de la pense (jii, etc.)




D'aprs VihhfisS

(9, 11) les

dharmas dissaha-

bhs sont


et les

viprayuktas concomitants (annvartin).

purusakraphalam tadkrst dharmas tadyafh vimiktimrgah sahabhuvo yac cngatam bhvyate tac ca prahnam. Le prahna est donc
la fois fruit
3. dri

de disconnexion

et fruit d'activit virile.


bzhi yis =r [catiirbhir



zag bcas gzhan


dge da


dge ga yin pa ha

= [anyat ssravafit] yac



ansruvatn punah esam avykrtam ca yat tribhih


xvii, fol.

10 b-11





Des dharmas bons, mauvais, non-dfinis, constituent


quatre, deux, trois fruits de l'acte bon.


d'coulement, de disconnexion, d'activit virile et de

souverain de l'acte bon sont de bons dharmas. Le fruit de rtribubution, de sa nature, est non-dfini





virile et

de souverain de l'acte bon sont de

mauvais dharmas.



d'coulement d'un acte bon est ncessairement bon


de disconnexion est bon de sa nature.



de rtribution, d'activit



de souverain de l'acte

bon sont des dharmas non-dfinis.



Des dharmas bons, mauvais, non-dfinis, constituent,


dans Tordre, deux,


quatre fruits de l'acte mauvais.



de matrise, de l'acte mauvais


fruits, fruits d'activit virile et

sont de bons


Trois fruits

en cartant

les fruits

de rtribution et de discon-


sont de mauvais




cartant le fruit de disconnexion

sont des

dharmas non-dfinis. On admet donc que le fruit d'coulement (nisyandaphala) de dharmas mauvais peut tre constitu par des dharmas non-dfinis. Deux non-dfinis, la croyance la personnalit Comment cela ?


et la

croyance au pass


au futur d'un moi (anta-




sont fruit d'coulement de


catvri dve tath trni kualasya [ubhdayah]




clans l'ordre



quatrime pda, 89 b

trlni catvry amikramam j y avoir ressemblance entre le sahiigahetu et son fruit, qui est le nisyandaphala. Or le dharma mauvais diffre du diiarma non-dfini (dans l'espce du dharma souill-non-dfini, nivrtvylcrta), puisqu'il comporte rtribution. Mais l'un et l'autre sont souills (klista), ce qui constitue ressem2.

asubhasya uhhdy dve









89 c-91


mauvais savoir des passions universelles (sarvatraga,

passions de la classe rga,


54, v. 12)
et des

qu'on abandonne par la vue de la douleur et de l'origine,


qu'on abandonne par la vue de la




mmes dharmas,



bons, mauvais,


constituent deux,

trois, trois fruits

de l'acte non-dfini.



fruit d'activit virile et

de souverain, sont de bons

Trois fruits


cartant les fruits de rtribution et de discon-


sont de mauvais dharmas. En effet des dharmas mauvais


des cinq catgories



abandonner par


vue de la vrit

de la douleur,


le fruit

d'coulement de deux non-dfinis,

savoir de la saikyadrsti et de Vantagrhadrsti.

Trois fruits


mmes que


sont non-dfinis.


ce qui concerne l'poque, l'tage, etc.



Des dharmas de toute


sorte constituent quatre fruits de

l'acte pass.



dharmas ou



de toute sorte, c'est--dire

passs, prsents et futurs> peuvent constituer quatre des fruits de

pass \

faut excepter le fruit de disconnexion qui est hors du




Des dharmas futurs constituent quatre


de l'acte


avykrtasya dve trlni trlni caite uhhadayah II hdas pahi tliams oad bzhi yin no [catvry atitasya sarv] 3. Soit un acte pass. Le tlharma pass, n aprs cet acte, et qui en est la rtribution, est son fruit de rtribution les dharmas qu'il a attirs (krsta),

que ces dharmas soient ns en mme temps que lui ou immdiatement aprs lui, sont son fruit d'activit virile tous les dharmas qui sont ns avec lui ou qui, ns depuis, sont maintenant passs, sont son fruit de souverain; tous les dharmas pareils, ns aprs lui et maintenant passs, sont son fruit d'coulement. De

mme des dharmas prsents et futurs 4. madhyamasypy angath /

constituent quatre fruits de l'acte pass.


xvii, fol.

11 b-12



L'acte mdian, c'est--dire prsent, a quatre fruits

le fruit

de disconnexion

qui sont des dharmas


en cartant

futurs. [12 aj


c. Il

en a deux qui sont des


Des dharmas prsents sont


de souverain et fruit d'activit

de l'acte mdian.



l'acte qui n'est

pas encore n,


trois fruits consti-

tus par des





de rtribution, de souverain, d'activit




futur n'a pas de fruit d'coulement



91 a-b. Des dharmas du mme tage des dharmas d'nn autre tage constituent

constituent quatre fruits


ou deux


en cartant qui sont des dharmas de son tage (svahhfruit de disconnexion

acte d'un certain tage produit quatre fruits



Des dharmas purs appartenant un tage

l'acte constituent trois fruits

diffrent de celui de

de cet acte

fruits d'activit virile,




et aussi

d'coulement, d'aprs la rgle


Des dharmas impurs appartenant un tage

l'acte constituent les fruits d'activit virile et

diffrent de celui de

de souverain de cet acte.



Des dharmas aiksa,

[12 b]


constituent trois fruits de l'acte


Des dharmas

caractristiques du saint qui n'est pas



(saiksa) constituent les fruits d'coulement, d'activit



souverain de l'acte saiksa.



gnis so =^ [dve



skyes pahi

hbras bu

madhyam] ma bons gsiim

yin no

= [ajtasya phalatrayam =


ran gi sa pa bzbi yin no

slob pahi slob

tu catvri trlni dve


[svabhmiks gzban gyi sa pa gsum dan giis / cnyabJmmikh] la sogs pa gsum =: [saiksasya trlni saiksdyh]. La

disconnexion n'est ni saiksa ni asaiksa.










91 c-94


De mme des dharmas caractristiques de l'Arhat (aaiksa). Des dharmas ni'Saiksa'm-asaiksa constituent les fruits d'activit


de souverain


de disconnexion de l'acte saiksa.


91 d-92

Des dharmas aiksa,

de l'acte aaiksa,

constituent un

fruit, trois




Des dharmas saiksa sont

de souverain de cet acte. de souverain, fruit d'coulement,

Des dharmas asaiksa sont

fruit d'activit virile


de cet acte.

Des dharmas m-saiksa'm-asaiksa sont

d'activit virile de cet acte.

de souverain

et fruit



Des dharmas saiksa,


constituent deux fruits, deux


cinq fruits de l'acte diffrent des deux prcdents.


s'agit de l'acte ni'Saiksa-ni'asaiksa

et des

sont fruit d'activit

Des dharmas saiksa

virile et

dharmas asaiksa

de matrise de cet acte.

les cinq fruits

Des dharmas ni-saiksa-n-asaiksa sont

de cet acte.



Des dharmas susceptibles


abandonns par


des vrits (darsanaheya), susceptibles d'tre abandonns par la

mditation (hhvanheya), non susceptibles d'tre abandonns (%)r-

heya), constituent trois

tible d'tre






de l'acte suscep-

abandonn par


vue des


[13 a]

Des dharmas darsanaheya sont

virile et

de souverain, d'activit

d'coulement de l'acte darsanaheya.


Des dharmas hhvanheya sont quatre

le fruit

de cet acte


de disconnexion.
slob las kyi hbras bu ni
slob pa yi ni cbos la sogs




yin no

= [aaiksasya tu karmanah

de las gzhan pahi bbias bu ni


dan / gcig dan gsum aiksadJiarmddayas sogs gfiis dan gilis dan Ina [aiks'

dayas tadanyasya dve dve phalni panca ca //J 3. nitlion bas span byabi de la sogs / gsum daii bzhi da daranaheyasya catvry ekam] tadfidayah / tadadayah daranaheydayah

gcig yin no

= [trlni


xvii, fol.

12 b-13



Des dharmas aprheya sont


de souverain de cet acte.

trois fruits



Les mmes dharmas constituent deux, quatre,

de l'acte susceptible d'tre abandonn par la mditation (hliva-


Des dharmas darsanaheya sont

souverain de l'acte hhvanheya.

fruit d'activit virile et fruit


Des dharmas hhvanheya sont quatre

le fruit


de cet acte


de disconnexion.
fruit d'activit virile,

Des dharmas aprheya sont


de souverain

de disconnexion de cet acte.


a-b. Les

mmes dharmas

constituent, dans l'ordre,




quatre fruits de l'acte non susceptible d'tre abandonn



Des dharmas darsanaheya sont aprheya.


de souverain de l'acte

Des dharmas hhvanheya sont



de souverain

et d'activit

de cet acte.

Des dharmas aprheya sont quatre



de cet acte

carter le

de rtribution.

Le texte porte yathkramam,






89 b)



aniikramam dans

sens de yathkra-





on en conclura que ce mot


doit tre suppl

dans chaque



effet, le


des rsums (ahhisamksepanyyah)

Dans l'expos de

la doctrine

de l'acte se pose encore la question

1. bsgom pas span bar bya las kyi / de dag gnis dan bzhi dan gsum dve catvri trni bhdvanheyakarmanah II]




= darsanaketfdayah
span bya min pahi de dag gcig
te tv

gnis dan bzbi ste go rim bzhin


= aprahequi


ekam dve




fruit d'activit virile

abandonner par


de bons


se produisent la sortie (vyutthne)

du chemin




94 c-95


Trait (Jnanaprasthna)




(tjogavihita), l'acte non-convenable (ayogavihita), l'acte ni-conve-

nable-ni-non-convenable. Quelle est la dfinition de ces trois actes ?

[13 b]


c-d. L'acte

non-convenable est

l'acte souill

d'aprs quelques-

uns, aussi l'acte irrgulier.

Quelques-uns disent que


non-convenable est



(klista) parce que celui-ci procde d'un

d'autres, l'acte irrgulier

jugement vicieux ^ D'aprs

(vidhiprabhrasta) est aussi acte non-contient,


lorsqu'une personne marche, se

mange, se vt autre-




doit, ces actes

qui sont non-souills-non-dfinis



ou bien

non -convenables (ayogaviMia), car

personne agit contrairement l'usage reu (ayoga).

ou bien

divergence de vue en ce qui regarde l'acte convenable



l'acte bon,


et l'acte rgulier


hhrasta). L'acte qui diffre du convenable et du non-convenable est



acte projette-t-il (ksipati) une naissance ou plusieurs nais-

sances ? Plusieurs actes projettent-ils une naissance ou plusieurs

naissances ?



systme de l'Ecole (siddhnta)

acte projette une naissance.




Par naissance, jamnan,

dite (jti),

faut entendre, non pas la naissance


mais une existence (nikyasbliga,



Celui qui arrive une existence, on dit qu'il est n.




min bakyed pa non mous eau kha ciy cho ya narns pa han sites cho ga nams pa ehe ho. [ayogacihitam klislam vidhipra'
j j




api H] ayogavihita





ayonya anyyena klesayogena yah pravrtto

3. ekafft


janmksipaty ekam.

D'aprs Vibha:^,

19, 16-20,



doctrine dans YogasQtra,


xvii, fol.







acte projette une naissance et

non pas


Le Sautrantika.

Cette thse est en contradiction avec ce que dit


Sthavira Aniruddlia



rtribution de cette seule



(pindapta), aprs tre n jusqu' sept


chez les dieux Trente-

finalement (yvat) je suis


n dans la famille des




par cette aumne, a obtenu une grande



a obtenu


souvenir des anciennes nais:



a accompli beaucoup de nouvelles uvres mritoires






prtend indiquer ce qui a t


point de

C'est ainsi qu'un


acqurant une


de mille au

moyen d'un

seul denier, peut dire


C'est par un denier que j'ai

acquis cette fortune

On rpond

[14 b] encore

Aniruddha, en raison de son aumne,


sujet de son

aumne, a produit de nombreux courants de


chaque volition appartient un


Plusieurs actes ne projettent pas ensemble une naissance

tait ainsi, la projection



des existences aurait lieu par fractions

(hhgasah). Mais on admet que, une existence tant projete par un

seul acte,



Plusieurs actes compltent, remplissent une existence.

Par la rtribution d'une seule aumne de nourriture dans le 1. Paramartha temps pass, je suis sept fois revenu natre chez les Trente-trois-dieux sept fois, j'ai t roi Cakravartin et maintenant je suis n dans la riche famille des Sfikyas .

Hiuan-tsang^ dont
et sept


texte est plus dvelopp, a aussi sept naissances divines

naissances humaines en qualit de Cakravartin.


au Pratyekabuddha TagaraDhp. 355) d'aprs Theragath, 910 (voir trad. p. 329), Uparittha qui reoit l'pithte de Yasassin Uparittha et Yasassin figurent d'ailleurs comme des Pratyekas distincts dans la
D'aprs la VySkhya,

don d'Aniruddha

fut fait

sikhin (un des Pratyekas de Majjhima,

69, Jtaka, 390,

du Majjhima. hdi des hbyor pa rned nas tshe rabs dran pa dan yan bsod nams gzhan byas pas ... sa tena sanircldhim labdhv jtismrtim anyni ca punyni krtv tadutthnam darsayati .... 3. yan smras pa. Hiuan-tsang En outre, certains disent ... .


anekam pariprakam




95 b-96.

De mme qu'un

peintre dlimite d'un seul trait le


champ de


et remplit ensuite cette image

de mme, bien que leur qualit

d'homme membres

soit la et





hommes ont, au complet, organes, hommes sont beaux par l'excelcela.


lence du teint, de la figure, de la taille et de la force, tandis que,

hommes, manque




n'est pas

l'acte qui projette

une existence projettent


aussi tous les dharnias qui comportent rtribution (savipka),

savoir la sensation,


Cependant [15 a]




projettent ni les deux recueillements d'inconscience ni

les prptis.



comportent rtribution,


deux recueillements



42) ne projettent pas, parce qu'ils ne coexistent pas


(saha na bhavatah) avec

elles coexistent.

Les prplis


36) ne projettent

pas, parce qu'elles n'ont pas le



avec lequel


dper na


mo mkhan



lu (?) gcig gis gziigs kyi sa

bcad nas yons su

rdzogs par byed pa dan hdra




Comme un


dessine l'image d'un


et la remplit

peintre au moyen au moyen de nombreux



un homme possde au complet les organes (sakalendriya), si un autre ne les possde pas au complet (vikalendriya), cela ne tient pas la diversit de l'acte de remplissage (pariprka karman), car l'il et les autres organes sont fruit de l'acte qui projette l'existence (ksepakakarmaphala) Les six organes (sadyatana) sont projets (ksipyate) . Mais le teint




(varna), la

figure, etc.,


le fruit



de remplissage (Vyakhya).

Hiuan-tsang Ce n'est pas seulement l'acte qui projette et remplit une existence, mais encore tous les dharmas comportant rtribution. Mais, en raison de l'importance capitale de l'acte, on ne parle que de l'acte. Cependant ces dharmas, lorsqu'ils ne coexistent pas avec l'acte (saha), sont capables de remplir
ni les

non de projeter, parce que leur force est petite. Deux catgories Ne projettent La sensation et les autres mentaux associs deux recueillements ....


cetan, volition, qui est acte, projettent avec


sems med sfloms par hjug pa dag / hphen byed ma yin thob pa han min [acUtakasampaUl nksipato na cptayah /J tadaksepakena karmana saha5. karmananekaphalatvat - Vyakhya


xvii, fol.

14 b-15






y a


varanas ou



constitu par l'acte, ou obstacle d'acte



constitu par la passion (klesdvarana), l'obstacle constitu par la



Quels sont

les trois obstacles ?

96. Les actes iVnantarya

la passion chronique



destines, les Asarnjnisattvas et les Kurus, tel est le triple obstacle.

L'obstacle qui consiste en acte, c'est les cinq pchs mortels (nantarifa)


matricide, le parricide, le meurtre d'un Arhat, le schisme,


blesser le Tathgata avec une pense de haine.

bhavantyo 'pi prptayo na tenaica saphalh. Voir Vibhsa, 19, 13, l'opinion de Ghosaka les prptis ne sont pas capables d'attirer la sabhgat, etc.

Hiuan-tsang ajoute
et remplissent

Les autres [dharmas comportant rtribution] projettent

4, 6, etc.


doctrine Bodhisattvabhrai,



les sources plies,

comme ici, Vvarana est ce qui empche l'entre dans le Chemin, ce qui fait qu'un homme est ahhavya. Les trois varanas sont nomms Anguttara, iii. 436, Vibhanga, 341, mais associs trois autres dharmas (asaddho ca hoti acchandiko ca duppaniio ca). [Les varanas de Samyutta, v. 77, Dgha, 246,

sont des obstacles au Vinaya, des


(voir Kosa, v. 59)].


Le Grand Vhicule, par klesa ei jileyvarana, dsigne non pas les obstacles bkavyat, la qualit de pouvoir entrer dans le chemin, mais les obstacles
de la pense.

la dlivrance

De mme, Kosa,


77, la

pense est
iv. 30.


par une vrti, except la pense de



Le karmvarana de Sikssamuccaya, 280, etc. est le karmvarana de les aksanas, auxquels s'opposent les quatre roues, correspondent partiellement au vipkvarana. (Mahvyutpatti, 120, 83 Nanjio 728 et autres sources, Religieux Eminents, 70, Cinq cents contes, i. 32, 231, etc.). 2. mthsams med pa yi las rnams dan / non mons sas chen nan hgro dan / hdu ses med pahi sems can daii / sgra mi siian sgrib gsum du hdod / [nantaryxii karmny abhksnakleso ditrgatayah / asamjnisattvh ktirava varanatrayam matam //] Comparer les dfinitions de Visuddhimagga, 177. 3. C'est l'ordre de Vibhanga, p. 378 dans Mahvyutpatti, 122, le meurtre de l'Arhat prcde le parricide; dans Dharmasamgraha, 60, la blessure du Tathfigata
; ; ;




Suttanipta, 231 (Khuddakapatha,


choses impossibles un rya, savoir





abhithnas Anguttara, i. 27 1. mtughta, 2. pitughta, samghabheda, 6. anfiasatthu-uddesa





IV, 96.

L'obstacle qui consiste en passion, c'est la passion chronique.


passion est de deux sortes, chronique [15 b] et violente (livra)


passion chronique est la passion continuelle, la passion violente est

la passion

c'est le cas,

La passion

chronicpie constitue



par exemple, chez les eunuques. La

ft-il terrible,

passion qui surgit de temps en temps, son lan

tre vaincue,


mais non pas

la passion continuelle,



L'homme en
devient forte

qui elle se continue ne trouve pas le temps de faire effort


pour la vaincre. De

devient mdiocre

de mdiocre,



elle fait obstacle.

[6. signifie

sans doute

reconnatre un autre matre que




numre six choses qui rendent un homme abhavya, incapable d'entrer dans le Chemin .... A savoir 1-5 de la liste prcdente, plus duppanno hotijalo elamgo. iii. Cullavagga, vii. 3,9: idam devadattena pathainam nantarikakammam upacitam yam dutthacittena vadhakacittena tathdgatassa rtidhiram uppditam ; vi. 17, 3, les cinq nantaryas de la liste classique numrs ple mle


le viol

d'une Bhiksun, la qualit d'animal,


Dhammasangani, 1028

(AtthasSlin, p. 358) dfinit les six



causent ncessairement une mauvaise destine (micchaUaniyata, voir Kosa,

paiica kamntni anantarakni yd ca micchdiithi niyat les cinq actes nantarya et la vue fausse niyata . Puggalapannatti dfinit comme vous la perdition (niyata) : paiica puggal nantarik yeca micchdiiihikd


cinq coupables


et les

hommes de vue




entendre par

vue fausse niyata


natthikavdesu annatar

micchdiithi niyat ti ahettivda-akiriyavda one or other of the assuredly vvrong views of


who do

not believe in cause, deny the eflicacy of action, are nihilists

(Maung Tin


Davids). Traduisons plutt

La vue fausse niyata


des vues de ngation de la cause, ngation de



une (Voir Majjhima,




vue fausse (ci-dessus

p. 167) qui,

l'exclusion des autres


vues fausses, constitue le chemin-de-l'acte nomm vue fausse, AtthasalinT, p. 101 natthikhetuakiriyadiithlhi eva kammapathabhedo hoti na annaditthhi. [Parmi les autres vues fausses, par exemplela satkyadrsti]. Est donc niyata

vue fausse proprement


dite, laquelle,



Koa, rompt les racines de bien





fausse niyata

vue fausse comportant

avons vu

certitude, c'est--dire

celui qui l'adopte


micchattaniyama, certitude de perdition , pour d'aprs l'Abhidhamma ce mcrant est vou la perle nous

80 d) que la doctrine de l'Abhidharma diffre. Vibhanga, p. 378, numre les cinq kammni nantarikni.

L'obstacle qui consiste en

xvii, fol.

15 a-i6




les trois


existence infernale, existence animale, existence de prta une partie des bonnes destines existence bumaine dans

rUttarakuru, existence divine chez les dieux inconscients.


entendre par obstacle ?

obstacle au

Ce qui



aux racines-de-bien prparatoires

etc. (vi. 17).

(pryogika) au Chemin, usmagatas,


On devrait mentionner comme obstacle d'acte, comme

la naissance de l'uf,

actes faisant obstacle, d'autres catgories d'actes ct des pchs

mortels. Les actes qui produisent ncessairement les mauvaises destines, etc.

(apmjdiniyata) \ qui produisent

la naissance de la sueur, la naissance

en qualit de femme, huit nais-

sances, font obstacle.



sont mentionns



les actes

aisment discer-

nables par les autres (sudaraka) et par l'agent lui-mme (supra-


et cela

cinq points de vue. L'acte en quoi consistent



pchs mortels,
fruit est pnible

meurtre, mensonge, prparatif de meurtre



la destine qu'il produit, est Tenfer


l'poque de sa

rtribution est l'existence prochaine


coupable lui-mme reoit

l'acte qui est


de parricide


cinq points de vue,


pch mortel

est ais



les obstacles, le plus

grave (sarvappidha) est l'obstacle de

passion, ensuite l'obstacle d'acte. Car ces deux obstacles rendent

incapable de salut (ahhavya), non seulement dans la prsente existence,

mais encore dans l'existence prochaine.





Les mauvaises destines,

etc. >

Par et ctera
b-c), la

faut entendre les actes

qui produisent l'tat d'inconscience


naissance en qualit de


ou androgyne. Toute personne qui entre dans le chemin obtient la dlivrance aprs sept naissances au maximum (vi. 34 a-b) donc la personne qui a fait un acte produisant une huitime
44 b-d,


a-b), la


comme eunuque

(astama bhava) ne peut entrer dans le Chemin (Voir SuttanipRta, 230). 2. Le texte porte [2)ancaclh] sudarsakni suprajnakni j adhisthnatah phalato gatita upapatUtah pudgalafa ca. On peut entendre .... la le coupable est homme destine o ils se produisent est la destine humaine


ou femme, ni eunuque, ni androgyne





sikas (Vibhasa, 115, n), robstacle de passion est le plus grave parce,

produit l'obstacle d'acte

l'obstacle d'acte est plus lourd que

l'obstacle de rtribution parce qu'il produit cet obstacle.

Quel est


sens du terme



Les cinq pchs mortels sont

peuvent tre

nomms nantarya

parce qu'ils ne



(antarita), c'est--dire

empchs (ahM-

hhta), dans leur rtribution par des actes qui devraient tre rtribus

dans la prochaine existence

renat, aprs cette vie,



bien le coupable du pch mortel


immdiatement (anantaram) en enfer



coupable est donc un anantara, un


' ;



donc nantarya

dharma par la possession duquel le coupable anantara, comme on nonmie rmanya le dharma qui fait quelqu'un un ramana (vi. 51)



quelles sphres d'existence se trouvent les obstacles ?



Pch mortel dans

trois continents

[16 b]

Les habitants de l'Uttarakuru

et les tres vivants qui

ne sont pas
forte raison


ne sont pas capables du pch mortel.


A plus

pch mortel manque-t-il dans

les hommes, femme

sphres suprieures.


et la

seuls peuvent commettre le pch mortel



Vibhasa, 119,


Pourquoi ce

(pratyaya) ni dans cette



ces cinq pchs sont ainsi

nom iVnantarya? Pour deux raisons nomms parce cju'ils ne sont rtribus

vie, ni

dans une existence

mais seulement dans l'existence


parce qu'ils sont rtribus seulement en enfer et non pas dans une

autre destine. C'est pour deux motifs qu'un acte est





nuit des bienfaiteurs, (2) parce qu'il nuit un champ de qualits. Deux conditions sont requises pour qu'il y ait pch mortel (1) prparatif et (2) consommation du


et-on fait

le prparatif, si le fruit n'est

pas consomm,


n'y a pas pch


le fruit ft-il



on n'a pas

fait le prparatif,


n'y a pas pch

.... (Comparer Kathavatthu, xiii. 3). Comparer AtthasalinT, p. 358. Certain coupable ^'nantarya










et quatre autres, Milinda, p. 101,

Kern, Manual,

p. 36.

trisu dvlpesv Cinantaryant


Pas dans l'Uttarakuru

bhvCic ca.

7iiyatyuskaivt prakrtiilatv&t tatra C^and'


xvii, fol.

6 a-xviii, foL

1 a.




On n'admet

pas que



soient capables de ce

pch, cause de la mdiocrit du bienfait et du respect.




raisons qui rendent les eunuques,



de l'indiscipline



c), et,

en outre, parce que les parents, n'ayant

donn l'eunuque qu'un corps (tmahhva) incomplet (vikala) et n'ayant pour leur fils qu'une mdiocre affection (sneha), sont de
mdiocres bienfaiteurs
pas pour ses parents

parce que, d'autre part, l'eunuque n'prouve

le violent respect (lajjitva

= hrlvyapatrpyay
le rendrait

32) dont la destruction (vipdana, vikopana)


du pch mortel.




raisons, les Prtas et les

animaux, tuassent-ils

leurs parents, ne sont pas capables de pch mortel. Toutefois, le




animaux dont

l'intelligence est vive (patu-

huddhi), par exemple

cheval jneya, sont capables de pch

mortel (Viblisa, 119,6).='

Pour les mmes raisons, l'homme issu de parents dmoniaques (amanusya) ne commet pas de pch mortel en les tuant.



Les deux autres obstacles dans

les cinq destines.

[17 a]

La naissance dans l'Uttarakuru

qui concerne les

est l'obstacle de rtribution en ce


la naissance



Asamjnisattvas en

ce qui concerne les dieux, [xviii]

Que sont de

leur nature les divers actes de pch mortel ?

tu nesyate

Voir ci-dessus



incomplet {vikala)

Le corps (tmahhva) de l'aveugle-n est mais on envisage ici le vaikalya qui rend l'homme incapable
n. 1.

En outre l'aveugle-n est aim de ses parents. Vykhy ryate yath kacid eva visistsi^a jneyo mtaram na gacchatti vsas mukham pracchdya mtaram gamitah j iena pascj jnatv svam angajtam utptitam ity evam jneyo 'svah patnbuddhih I asynantaryam syd ity abhipryah j La Vibhsa raconte cette histoire hei long en d'autres termes. Elle traduit jneya par ts'ng (oue fine)


Paramfirtha et Hiuan-tsang ont seulement ts'ng hoi. Voir Mahfi-

vyutpatti, 213 (ling

= bon).



hgro ba Ina dag na

= [esau gatim pancasxi





trois sont

Quatre sont acte corporel


est acte vocal






est prparatif de

meurtre (prntipta-


car les Tathagatas ne peuvent mourrir par l'attaque

[1 b]


disons que

schisme (satnghahheda) est mensonge,




est le

quatrime pch mortel.


cela ?


nous faisons du schisme un pch mortel,

nons, par hypallage, le


parce que nous don-


de schisme au mensonge qui est la cause


du schisme (hetuphalopacra)
hJieda, doit s'expliquer

ou bien


mot schisme



ce par quoi le


est divis





98 a-c. Le schisme est, de sa nature, non-concorde dharma dissoci de la pense, non -souill-non-dfini.



Le schisme,

c'est--dire la non-concorde, est


un samskra non-

associ la pense

35, trad. p. 178, n. 2, et 304), non-souill-non:

(univrivy krt a) comment donc pourrait-il tre pch mortel ?


D'autant que l'homme qui divise

n'est pas




en possession du schisme.
C'est le





Sarngha qui possde


C'est ce qui est divis, et


non pas

schismatique, qui


samskra nomm
Mais que possde


du Sanigha


schismatique ? [2 a]



Le pch de schisme



appartient au schis-



Hiuan-tsang met en kfirikS ces dAnitions.



hi tathgath



phrasologie de






aklistvykrto 3. samghabhedas tv asmayrsvubhvo viprayuktakah dharmah. D'aprs Vibhsa, 0(), IG. 4. de dan dge hdun yaii dag Idan = [tena satnghah samanviiah //] de dun hbyed po yan dag Idan ^= [tadavadyam 5. de yi kha na ma llio brdzuii mrsvdas tena bhett samanvitah /] ou tatkilbisatft
; :



xviii, fol. 1




Le schismatique possde ghahhedasahaja)


pch (avadya) de schisme, lequel est

mensonge. Ce mensonge nat en

; il


temps que


schisme (sam-

consiste en


avijnapti vocales.

Revtu de ce mensonge



Le schismatique


dans l'AvTci durant un kalpa.


grand enfer AvTci pendant une priode intermdiaire




Les coupahles

des autres pchs mortels

ne sont pas ncessairement punis dans TAvTci.

Cependant tout pch mortel


est rtribu

dans l'existence pro-




se rend coupable de plusieurs

pchs mortels ?



La souffrance


en raison du pch supplmentaire.

ligyur :^ [avTcau

bskal par mnar


med par smin

pacyate kalpam]

% Itivultaka, 18 pfiko nerayiko Jcappattho samghahhedako samgham samaggam bhitvna kappam nirayamhi paccati. Aiiguttara, 402....

pyiko Devadatto nerayiko kappattho atekiccho et v. 75 (= Cullavagga, vii. 5, 4) .... samgham bhetv .... kappatthiyam kibbisam pasavati / kimpana kappattliiyam kibbisan ti / kappam Ananda nirayamhi paccatti payiko nerayiko .... samgham samaggam bhetvna kappam nirayamhi paccatti. La stance de l'Itivuttaka est discute Kathavatthu, xiii. 1. Les Rjagirikas croient qu'il s'agit d'un [grand] kalpa entier (sakalam kappam) ; pour Buddhaghosa, il faut entendre la quatre-vingtime partie du [grandj kalpa [c'est--dire un antarakalpa, ce qui est la dure normale de la vie, yukappa, dans l'AvIci, voir Kosa iii. 83 b]. La Vibhsfi (85, 15, 116) signale de nombreuses opinions. Les uns croient que, par kalpa, Bhagavat entend parler de quarante petits kalpas (antarakalpa), ce qui fait un kalpa de disparition (vivarta) plus un kalpa vide, ou un kalpa de cration (samvarta) plus un kalpa de dure (Kosa, iii. 90 b) d'autres comd'autres comprennent prennent grand kalpa (quatre-vingt petits kalpas) En outre, il y a un texte du Vinaya annonant que Devadatta ])etit kalpa renatra parmi les hommes un moment o la vie humaine sera de 40000 ans. On peut donc entendre par kalpa la priode d'accroissement ou de diminution de la vie c'est--dire la moiti d'un petit kalpa (voir iii. 92 a-b). D'aprs Milinda, 111, Devadatla a commis le crime de schisme la fin de la premire des
; '




six parties

du prsent fcapa ;


passera les cinq autres en enfer,


dlivr de

deviendra un Pratyeka.

Les sources du Grand Vhicule, cites par l'diteur japonais, mritent aussi
d'tre tudies.

Ihag pas gnod pa Ihag par hgyur

= [adhikd adhik vyath






Le coupable de plusieurs pchs mortels revt dans

corps grand et de chair trs tendre par lequel



sent double, triple,

quadruple, quintuple, et les tourments sont extrmement nombreux

et insupportables.

Qui est capable de diviser


Samgha ?


a-b. Divise le

Bhiksu qui


intellectuel, qui est vertueux.



un Bhiksu qui

non pas un

non pas une


[2 b]

Ce Bhiksu

doit tre


non pas un sensuel


doit tre vertueux (lavn),

non pas immoral (slavipanna)


les paroles

du Bhiksu immoral manquent d'autorit.

schisme ?

a lieu


b. Ailleurs.

pas dans l'endroit o se trouve



Tathagata. Le schisme est

impossible l o se trouve

Matre, car le Tathagata ne peut tre

vaincu (duhprasaha) et sa parole est pleine d'autorit.

Quels sont ceux que divise


schismatique ?





Les sots (bla) seulement

d'une vue directe

non pas


ryas, car ceux-ci voient



D'aprs une opinion,



ne peut pas non plus diviser

les possesseurs de la ksnti,

La premire ligne de la kSrik 100 est traduite dge slon Ha spyod thsul bhiksur drsticaritah ilavn / hbyed do gzhan dulio byis pa rnams bhinatty anyatra bln. La Vyakhya commentant le BliSsya donne les mots bhiksur bhinatti drsticaritah ... Paramartha lit bhiksur drsti-su-caritah (kin-hO'hng) bhinatty anyasmin dee bln, et sa version du Bliftsya oppose le moine de mauvaise pratique (mithycarita) au moine de conduite droite (samyak). On peut donc restituer bhiksur drstisucarito bhinatty anyatra blakn j S. Le Bhiksu seul, car le Bouddha est un Bhiksu et le schismatique se pose

Idan pas


comme son

p. 174.

trsncarita, voir ci-dessus




divise seulement les Pfthagjanas,

non pas


ryas parce


xviii, fol.

2 a-2





pour que



soit divis ?


c-d. Lorsqu'il

admet un autre Matre, un autre chemin,







sots admettent

un autre

Matre que



un autre Chemin que

est divis.

Chemin enseign



Tathagata, alors
fois divis
d. Il



combien de temps

reste-t-il divis ?


ne dpasse pas

nuit du






est divis, infailli-

que ceux-ci voient directement le Dharma. D'aprs certains matres, les possesseurs de la ksnti ne peuvent pas non plus tre diviss. Pour runir les deux opinions,
l'auteur dit

les sots

Par Dharma,

faut entendre





d'une part l'Ecriture, d'autre part les bodhipksikadharmas.

est le

La ksnti

vue des

vrits, vi.

(prtliagjanaj, est

deuxime des nirvedhabhglyas, ou prparatifs de l'entre 18 b. Le possesseur de la ksnti, quoique sot rput semblable celui qui a vu les vrits (drstasatya'


ston dan lam gzhan la bzod pa

forme plus ou moins correcte de hhyed,

byed paho de ni mi gnas ouvrir, rompre '.]



[byed est une

C'est un Bouddha,

Le sujet de
des sots


phrase prcdente (100 a-b) est



Bhiksu, hrtisant, moral, qui divise, dans un lieu o ne se trouve pas


hhiksur drstisucarito hhinatty anyatra blakn. L'auteur pouril est divis il ne passe pas la nuit [dans cet tat de division] . Par il , nous devons entendre le Sarngha, un Sarngha compos de sots. On peut restituer

Acceptant un autre matre, un autre chemin,

[anyasstrmrgaksanio bhinno] na vivasaty asau



Paramrtha Par quoi (kiyat) le Sarngha obtient-il division ? Au temps o il admet autre matre-chemin, il est dj divis (\ p'oo) ... Sur le schisme, voir les rfrences dans l'article Councils de l'Encyclopdie de Hastings, iv. p. 180 b. La dfinition plie du schisme, des diverses sortes de PrStischismes, Cullavagga, vii. 5, Mahvagga, x. 1, 6 5, 4, Anguttara, i. 19. moksa, Finot, J. As. 1913, p. 22. Traditions relatives au concile de Vaisal (vsakappa), Muson, 1905, p. 277, 318. L'pisode de Devadatta, Rockhill,


dit de Srnth, d. Oertel, Ep. Indica,


viii. p.


Vykhy na vivasaty asau na tm rtrim parivasatlty arthah. Bhasya da nid kyi nub gcig tu / de ni mi gnas so.






blement, au lever du jour (pratyse),


Sarngha sera de nouveau en

Le schisme que nous venons de

dcrire, et qui est

pch mortel



a. C'est

ce qu'on entend par rupture de la roue.

La roue de la loi de Bhagavat est alors rompue, parce que la marche du Chemin est empche (mrgapravrttlvisthdpant) K Par consquent il y a, la fois, et rupture de la Roue (cakrahheda) et

du Sarngha (samghabheda).

se produit la rupture de la


? [3 a]






pas dans les autres continents o


Bouddhas n'apparais-

sent pas.

Par combien de Bhiksus ?



Par neuf

et plus.




n'est pas fix.

Le Sarngha susceptible


compte au minimum huit Bhiksus


neuvime moine ncesil

saire est le schismatique.





faut qu'un Sarnle

gha se

divise en

deux partis


premier tenant pour


second pour



formant ainsi deux Saniglias de

quatre Bhikus chacun, ce qui est


requis pour constituer

un Sarngha (Vibhasa, 116,



autre sorte de schisme, diffrent de la rupture de la



qui ne comporte pas pch mortel, rsulte de la division relative aux

[ayant] cakrabhedo [matait] yvat santgho na pratisamdhlyate tvan wrgapravrttir visthit bhavati j na kasya cit samtne mrgali santmukhbhavatty arthah. rupture de la roue parce qu'il est la cause de 3. Ce schisme reoit le nom de

de ni hkhor lohi db(y)en du hdod





rupture de la roue.
4. 5.

hdzam Luhi glin naho [jambudvpe] navdibhih / Vibhttsa, 116, 5. 6. Le texte porte [astau bhiksavah satnghah / navamo bhett] hi aantghena dvayoh paksayoh sthtavyam samghadvayena ca /


actes ecclsiastiques

xviii, fol.

2 b-3



(karmabhedd hhavati)

lorsque, daus une

paroisse (shn), les moines se divisent (vyagra

faire les actes ecclsiastiques,

= nnmati) pour






trois continents.

L seulement o

existe la religion.



Ce schisme suppose huit Bhiksus ou

faut que se forment

deux groupes de quatre Bhiksus



n'y a pas de schismatique qui se dclare Matre.


six poques, le

schisme de la rupture de la Roue ne peut avoir

102. Au commencement, la fin, avant l'abcs, avant une paire, quand le Muni est teint, quand la paroisse n*est pas dlimite, la rupture de la Roue est impossible. ^

Au commencement,
mise en mouvement de

lorsque peu de temps s'est coul depuis la





Tpoque du Nirvana de


[3 b]

ces deux poques



est pntr d'un




Dans l'intervalle, la rupture est impossible avant


las kyi

de l'abcs (arbuda)
ni glin gsiim

aussi longtemps que n'ont pas

Mahvyutpatti, 276,

Voir [karmabhedas trisu dvpesu] na (karmabhedavastu). 2. astbhir adhikais ca sah // 3. da po mtha skyon zun gcig gi / sna roi thub pa nous pa dan / mthsams ma bcad pa dag tu yan / hkhor lohi dbyen ni mi hbyun no / [dv ante] 'rbudd [ekayugt prr nirvrte munau /] abaddhfm [ca] slmym [na cakrabhedasambliavah H] Voir Divya, 150, parmi les uvres que doit accomplir le Bouddha ... tribhga yusa utsrsto bhavati j slmbandhah krto bhavati j rvakayiigant agratym nirdistam bhavati. 4. ekarasa =^ avyagra ekamati. Joie au dbut, terreur et angoisse la


Hiuan-tsang traduit p'a, pustule, ampoule. Le tibtain traduit dosa, skyon. i. 43, les brigands sont Varbuda du monde. Samantapasadika, ... ssanassa abbudam ca nialam ca .... (Rfrences de pp. 294, 295, 307

Dans Samyutta,








apparu dans l'Eglise (ssana) l'abcs de la moralit (lrhuda),

l'abcs de la doctrine (drstyarbuda). Elle est aussi impossible avant

l'apparition d'une paire


aussi longtemps que n'a pas

apparu la paire d'excellents

disciples, parce



Samgba ne


pas passer la nuit (parivasali) dans

cette paire de disciples a

de division

parce que

pour tcbe de rtablir la concorde. La rup-

ture est impossible lorsque le


est teint, car, le Matre



entr dans le Nirvana, le schismatique n'aurait pas d'antagoniste

(prafidvandvabhvt). Enfin, lorsque

la paroisse n'est pas dlimite


(slmym abaddhym)


car on dit que


est divis

y a deux partis dans une paroisse.



Bouddhas n'ont


comme Sakyamuni,

leur roue rom-

cela dpend de leurs actes anciens.



pchs numrs ci-dessus, matricide,

etc. sont-ils


pchs mortels Texclusion des autres pchs ?

slmym abaddhym iti mandalasmym ekasym hi 1. Vyakhya slmym prthakkarmakarant sarnghadvaidham hhavati nanu ca pra:

krtislmsti grmanagcjrdi satyam asti / jnaptislmym tu satym sa prakrtislm vyavasthpyata iti / tasy api bandho vyavasthpyata eveti veditavyam. 2. Sakyamuni, lorsqu'il tait Bodliisattva, divisa la compagnie (parsadbheda) Ceci est d'un Rishi possesseur des cinq abhijns (Vyakliy Vibhasa, 116, 17). en contradiction formelle avec Milinda, 161, d'aprs lequel ce n'est pas un acte ancien du Bodliisattva qui provoqua le schisme de Devadatta. Il existait une vieille formule tathgato abhejjapariso. Le Bouddha n'a pas franchi la rtribution de ses anciens pchs, Divya, 416 < N'as tu pas appris cette parole du Muni que les Jinas eux-mmes ne sont pas dlivrs de leurs actes ? Bhagavat, dans sa tourne d'aumnes, fut bless au pied par une pine, et dclara ita ekanavate kalpe akty me puruso hatah / tatkarmano vipkena pde viddho 'smi bJiiksavah (Saddaranasaingraha, d. Suali, p. 26). Sur le morceau de rocher qui blessa Bhagavat au pied, Chavannes, Religieux minents, 155 Fa-hien, Legge, 83. Bhagavat souffre du dos parce qu'il a jadis rompu l'pine dorsale d'un lutteur dloyal, Vinaya des Sarvastivfidins, Comparer Milinda, 134, 179. dans Chavannes, Cinq cents contes, ii. 424. D'aprs Majjhima, ii. 227, le Tathagata n'a que des sensations agrables et pures (ansav sukh vedan) : Si les tres prouvent plaisir et peine en raison de leurs actes anciens, le Tathagata a accompli jadis de bons actes puisqu'il

sent maintenant de telles pures agrables sensations. Si les tres prouvent plaisir
et peine en raison de l'acte crateur de Dieu (issaranimmnahetn), a t cr par un Dieu bienveillant ....



xviii, fol.

3 b-4






qu'ils dtruisent

ou blessent un champ de bienfai-

un champ de


Le matricide
ont donn la

et le parricide

sont pchs mortels parce qu'ils dtrui-

sent un bienfaiteur.

La mre et le pre sont bienfaiteurs parce qu'ils naissance. Comment le meurtre les dtruit-il ? En les
et les

Le meurtre de l'Arhat

deux derniers pchs mortels sont


pchs mortels parce que l'Arhat,

Sariigha et le

Bouddha sont des


champs de


[4 a].


ne dtruit pas


et le


mais on

les blesse


= vikopa).
si la


sexe de la mre

du pre a chang,

qualit de



de pre n'existe plus chez la mre




pre ?



si le

sexe change,


y a pch mortel

celui qui tait la mre, celle qui tait le pre.

est dit en effet

(Vibhsa 119.






coupable de pch mortel en tuant un

qui n'est pas Arhat ?


qui n'est pas son pre,




tue sa

mre dont

sexe a t


Arrive-t-il qu'un


coupable de pch mortel en

tuant une


qui n'est pas sa mre, qui n'est pas ArhatT ?

tue son pre dont le sexe a t chang.

Lorsque l'embryon (kalala) d'une femme tombe (cyu


?) et




verse (hlugs,



dans sa matrice


laquelle de ces



D'aprs la Vyakhya,


entendre upakdriksetrasya nirkrteh.



(voir ci-dessus p. 153).

Comment les pre et

194, 204


sont des bienfaiteurs, Divya, 51, Avadnasataka,

(pyyikau posakau
qu'ils sont

samvardhakau stanyasya ddtrau



Itivuttaka, p. 110.




champ de


ou bien parce


point d'appui de qualits


de leurs qualits (gunaih),


srayatvt), ou bien parce que, en raison sont un champ toute semence de mrite (punya:

seme dans ce champ porte un grand fruit. [vyajannyathbhve 'pi] 4. mthsan ni gzhan du gyur kyan hgyur Si l'embryon est vivant^ il ne tombe pas 5. Le Sthavira n'admet pas ce cas s'il tombe, c'est qu'il est mort car un tre vivant ne peut pas aller travers

deux femmes

est rpute tre la




mre dont


meurtre constitue un

pch mortel ?



La mre

est la

femme du sang
les offices

de laquelle on est n.

La seconde femme remplit kj posikj samvardhik.


d'une mre

elle est


Point de pch mortel

autre personne


voulant tuer sa mre, un



tue une

point de pch mortel

tue sa

voulant tuer une autre

personne, un


mre \ Par exemple, l'homme qui tua sa


mre tendue sur un

et le fils

(mahcatalvalna) o




du blanchisseur qui tua son pre en voulant tuer


un moustique, ne furent pas coupables de pch mortel.




coup, un


tue sa



une autre personne,

toutes les ordures


est rapport


Stra que KumSrakasyapa

la matrice,
le boit

(t'ng-ts-kia-y) naquit ainsi.



seconde femme place l'embryon dans

la porte-de-la-naissance et l'aspire (In)


jusque dans que l'embryon traverse des ordures. Ou bien elle

on ne peut pas


[mt] yacchonitodbhavah // [dvitypi] sarvakrtyesv avaloky. Vyakhy sarvamtryogyesu kryesu drastavyety abhipryo tnCUrkalpatvt Hiuan-tsang: Tous les offices [propres la mre], on les constatera dans la seconde mre . Vpyyik est la kadvhik, qui conduit terme la grossesse \a posik (gso bar byed pa) est la stanyadyik, qui donne son lait; \r sarnvardhik (skyed par byed pa) est Vaudrikhrakalpik, qui rgle l'alimentation assimilable (traductions de P. Cordier). Ou bien, d'aprs une autre interprtation, pyyik stanyadhtrik, noun-ice posik, parce qu'elle donne l'aliment


samvardhik, parce


baigne et carte les aliments nuisibles


(visamaparihra). (Vyakhyfi

ci-dessus p. 213, n.


a Divya, 303, pyyitah positah samvardhitah.


= nu zlio Idud


nu zho


blud (Mlanges Asiatiques,





=^ yots su rgyas bya, MahSvyutpatti, 197,

est discut Kathvatthu, xx,

Ce problme

dans Karmaj)rajnapti.


Uttarfipathakas croient qu'un





anantarika) par

meurtre inintentionnel (asatncicca) de sa mre,

tant donne la gravit

1, 2,

des anantariyavaithus.


Comparer SQtrak|-tanga,

6, 2G


242, 414)

Voir Cliavannes, Cinq cents contes, n" 339

du Che sony




Nous traduisons




:' teinturier


texte porte

dhvdka que



explique rajaka.


xviii, fol.



il y a deux avijhaptis, avijtiapH de meurtre simple, avijnapti de pch mortel mais la vijnapti est seulement de pch mortel, en raison de la force du pch mortel [4 b]. Toutefois, d'aprs Ghoaka

(Vibhsa, 18,



y a deux mjnaptis, car la vijfiapti est




qui tue

un Arhat sans connatre sa quaht

est coupable

de pch mortel, car l'objet du meurtre est dtermin

tel , pense-t-il.

Je tue un


qui tue son pre, quand ce pre est

un Arhat,

n'est cou:

pable que d'un pch mortel, savoir du meurtre d'un Arhat

pre et l'Arhat ne font qu'une seule personne.

car le



[L'Arhat Rudryana, assassin sur l'ordre de son






Dis Sikhandin qu'il a comet le

mis deux pchs mortels,

le parricide

meurtre d'un Arhat


expliquer cette parole ?


veut dire que son

a commis pch mortel par deux causes de pch mortel (dv;

bhydm kranbliym) ou

bien Rudryana dit

deux pchs morfils.

pour rprouver doublement la conduite de son




en est


comment l'Avadna




Hiuan-tsang {= pH-y-king = avacliia) dit


deux pchs mortels

peut-il obtenir



comment le y Le Bouddha dit Sikhandin Tu as commis La Vibhs (119, 7) attribue aussi au Bouddha cette
en est
faut expliquer

Comment Sikhandin, en dtruisant une seule vie^ deux pchs mortels ? Il n'obtient qu'un pch mortel, parce que le bienfaiteur ou pre et le champ de qualits ou Arhat sont ensemble dans une personne. Le texte devrait dire Tu as obtenu pch mortel par deux causes, deux pchs pour blmer Sikhandin parricide, meurtre de l' Arhat , et il dit

dclaration et poursuit



en raison de deux pchs. D'aprs d'autres matres, bien

mortel, la rtribution de douleur est accrue

qu'il n'y ait

qu'un pch

Vykh) Eaiiruke nagare Mudryano nma rj Sikhandinam ndma putram abhisicya pravrajitah pravrajyrhattvatn adhigatavn / sa Kaurukbhysam gatavn / pun rjyam knksatity matyaprakrmitena tena Sikhandin rjn svapit mritah tena tu mryamnvasthdym sa mrako manusya ukto gaccha Sikhandinam hrhi.
j /

Vinaya des Mlasarvstivdin, Tokio, xvi. 9, viii. 109, Huber, BEFEO., 1906, p. 14), il y a plusieurs assassins. Dans Nanjio 1329, le roi Udasena (?), Arhat, est tu par un candala sur l'ordre de son fils Rajasena (Chavannes, Cinq cents contes, iii. 131).

Dans Divya, 567 (comparer

92-99, cit Lvi,



T'oung Pao,

Les Janas ont des histoires analogues (Maharastr Erzahlungen,

p. 33).







dans une pense mauvaise,


couler le sang du

Tathagata, commet-il ncessairement pch mortel ?

commet pch mortel



a l'intention de tuer



pas, avec l'intention de frapper le




qui blesse mort un



qui devient Arhat aprs

avoir t bless,

coupable de pch mortel ?




pas, en ce qui concerne

l'homme qui devient Arhat


Suppler, d'aprs ce qui prcde, pas de pch mortel

effet, le


prparatif du meurtre a eu pour objet un


qui n'tait

pas Arhat.


qui a fait


prparatif d'un pch mortel, peut-il, l'arret le fruit ?


tant, obtenir le

celui qui

[5 a]






prparatif de pch mortel,


Pourquoi ?

et le fruit

sont impossibles.

Parce qu'il y a contradiction absolue entre l'intention


de pch mortel et l'acquisition du dtachement ou d'un

Para1. sans rgyas brdeg par sems la min =: [na bucldhatddacittasya]. martha et Hiuan-tsang ont ta, frapper. 2. bsnun hog dgra bcom pa la min [na vedhd rdhvam arhati /] 3. ci mtshams med pahi sbyor ba byas te / de yan bzlog par hdod chags dan bral bali hbras bu lithob par hgyur ba kitn krtnantaryaprayogas tatn

nivartayan vairgyaphalam prpsyati.


Celui qui fait le prparatif de pch mortel,

arrt (tchoan, nivart), peut-il devenir


un prparatif non susceptible et obtenir un fruit ?



104 c-d. Celui qui fait un prparatif dterminant (tiny) de pch mortel, pas de dtachement, pas obtention du fruit. Au cours du prparatif de pch mortel, si celui-ci doit ncessairement s'accomplir, il n'y a certainement pas dtachement. Au cours du prparatif des autres

mauvais chemins-de-l'acte


mthsams med sbyor ba byas pa la / hdod chags bral hbras mi srid do [nnantaryaprayuktasya vairgyaphalaaatnbhavah II] Ce point de doctrine est discut Kathttvatlhu, xiii. 3. Les Uttarfipathakas
nient que l'instigateur du parricide puisse entrer dans



xviii, fol.

4 b-5


fait le


qui entre dans le

Chemin aprs avoir



d'un chemin-de-l'acte diffrent du pch mortel,


ne se produit pas pour


en raison de l'absolue contradiction entre


sa nouvelle personnaht

et le chemin-de-l'acte.


est le plus

grave parmi


pchs mortels ?
est considr


Le mensonge en vue du schisme




plus grave pch.



sachant ce qui est



et le


ment en vue de

diviser le



enseigne faussement, par l

se rend coupable du plus

grave pch (svadya) parmi tous

blesse le corps de


mfaits (diicarita).




des Tatha-

fait obstacle

au bonheur temporel

la dlivrance des

cratures. Aussi longtemps que la concorde ne sera pas rtabhe dans




y a empchement l'entre dans


Chemin (niym




a) [5 b],

l'acquisition des



dtd.chemeni(vairgya),L la destruction des ipassions (sravaksaya):

tous les actes relatifs au

dhyna, Ttude,
dieux, des

la rflexion (cint)
et des

sont aussi arrts




mondes des



rayasytyantam tadviruddhatvt.





au cours du prparatif (prayogdQuelques-uns disent dans le meurtre vasthym), d'entrer dans le Chemin ? des animaux, non pas dans le meurtre des hommes. Quelques-uns disent aussi dans le meurtre des hommes, en excluant seulement celui qui a fait le prparatif de pch mortel. Par consquent ils disent on peut faire prparatif de meurtre
meurtre de quels tres vivants


dans l'entretemps obtenir


La Vykhy



vue du Dharma * exemple le ChekvadSna. Par crainte de Virdhaka

Vidadabha, Kern, Manual, 40) un certain Skya nomm Cheka se rfugie dans la fort et vit de chasse avec ses enfants. Bhagavat, qui passait alors trois mois chez les Trente-trois, descend pour le convertir et lui fait obtenir le fruit de Srotapanna. Ds lors Cheka n'est plus touch par le meurtre des animaux qui



continuent prir dans les trappes ou



/ kha na ma tho rab chen hdod [santghabhedamrsvdah svadyam sumahan matant /] 3. bsam gtan dan / klog pa dan kha ton dan sems pahi las rnams kyan mi mjug cin. Hiuan-tsang wnn (tide, repasser dans sa mmoire ce qu'on a appris) sng (rcitation) ParamSrtha tou-song (tudier et rciter, ou svdhyya, ou ptimokkhuddesa).

dge hdun dbye phyir brdzun smra ba








sont troubls, attrists (durmanas), non matres d'eux-mmes (asvatantra), gars (musitasnirti).

C'est pourquoi la rtribution de ce

crime dure un ge cosmique et a lieu dans l'Avci.


les autres

pchs mortels,




troisime et le

premier sont, en ordre dcroissant,


les plus lourds.

Le parricide

plus lger.







(mahsvadyatara) des

danda mental est le plus coupadandds il dit que la vue fausse


(mithydrsti) est

plus grave parmi tous les pchs.

faut entendre que, parmi les pchs mortels, le schisme est le


plus grand pch

trois actes



danda mental

est le plus

grave parmi


que la vue fausse est la plus grave parmi





bien le schisme est le plus grave pch


on considre
si si

l'tendue de la rtribution (vipkavlstara)



considre le

nombre des personnes


vue fausse,


considre les racines-de-bien que seule rompt la vue fausse.

fruit ?


bonnes actions (sacarita), laquelle porte


plus grand






dharmas mondains,

la volition

du hha-

porte le plus grand fruit.


Par volition du hhavgra,

faut entendre l'acte mental par lequel


on renat dans

l'tage le

plus lev de l'rQpyadhtu. Cet acte est

plus fructueux des bons actes mondains, car sa rtribution est une
parfaite tranquillit de quatre-vingt mille priodes cosmiques


Ceci s'entend au point de vue du fruit de rtribution.

le fruit


de disconnexion


57 d)

l'acte le plus

fructueux est la voli-

1. La mre est cent fob plus vnrable que le pre (Roth et Bhtlinck, s. voc. satayuna). 2. Vihhfisa, 115, 17. Majjhima, i. 372 (danda, dans la langue des Nirgranlhas,

est l'quivalent de

Comment lu


karman). Dandaka

fut vide par la colre des Rishis, ci-dessus, p. 163.

4. hjig

rien pa yi dge ba la

srid rtselii


librus rab lu che

bhavdgracetana phalavattatna


Comparer Majjhima,

= [laukika^ubhe


tion associe
cette volition

xviii, fol.

5 b-6



au Vajropamasamdhi
a pour


44 d

voir iv. 112 b), car

fruit la

rupture de tous les liens. C'est pourquoi






bons dharmas mondains

[6 a]

Est-ce seulement par les pchs mortels que l'homme renat nces-

sairement en enfer?


renat aussi ncessairement en enfer par les pchs sem-

blables aux pchs mortels (nantari/asahhga).


D'autres ajou'

mais non pas immdiatement (anantaram).



Souiller sa mre, souiller une Arhant



un Bodhice

sattva prdestin


un Saiksa

voler les biens du



sont les pchs semblables aux pchs mortels

destruction d'un Stupa.


cinquime est la

narake 'vasyam utpattyd tant tatsdryt tatsabhgny j anyath hy nantaryny eva syur ity aparesm abhipryah / anantarabhvitve 'pi na tny nantaryny eva sambhavanty atulyaklavipkatvd ifi prathamapksiknm pari:




tu tatrnantarotpatty

2. ma dgra bcom ma sun byas dan / byan chub sems dpa ns gnas dan / slob pa gsod dan dge hdun gyi / hdu bahi sgo ni hphrog pa dag / mthsams med pa dan cba hdra ste / Ina pa mchod rten hjig pa yin.

dsanam nmtur arhanty



[niyatisthasya] saiksasya sanighyadvraharik

cLuantaryasabhgni pancamain stpabhedanam j Comparer Mahvyutpatti, 123. Conjecture de Wogihara upnantarya presque pch mortel pch mortel mineur (mthsams med pa dan ne ba sio o kin tsoi). Les MSS. de la Vykhya ont arhanty ; Minaev-Mironov, arJiaty Wogihara,
: *




bhikkhundsaka. Mahvyutpatti niyatabhmisthitasya bodhisattvasya mranam (ns pahi sa la gnas pa); V}khy: niyatipatitabodhisattvamrana. Le ns gnas
vi. 17,

Dans Culla,

de notre Krik est glos ns


voler la porte

par rtogs pa. samghyadvraharana. Bhasya samghyadvrahrik expliqu dans Vyakhya aksayanides revenus du Samgha



voler les biens de main-morte




connu par


une des versions chinoises de la Vyutpatti [proprit] perptuelle. - Takakusu, I-tsing, p. 193.

voler le tch'ng-tchou,

Vasumitra explique

mukhyadvrahriketi yan mukhopabhogikam yena samgho jvikm payati tasypahra iti (Vyakhya).


stpabhedaka, Mahvastu,


101, Nettippakarana, p.


et les


de Hardy,


Ces cinq pchs, dans
souiller sa mre, souiller




l'ordre, sont

semblables aux pchs mortels

une Arhantl



tuer un Bodhi-

sattva prdestin




un saint qui

n'est pas



meurtre d'un Arhat)

voler au Sanigha ses

moyens de





un Stupa


blesser le Tathagata).

Les autres actes comportant rtribution sont entravs en




l'acquisition de la ksnti, de la qualit



de la qualit

d' Arhat,

entrave absolument les actes.


Ds que, sortant du stade

nomm mrdhmias,


obtient le stade


patience (ksnti)

(vi. 23), les

actes qui doivent tre rtribus

mauvaises destines, tant entravs, restent en dessous



bar gnas

upatidhanti) [6


parce qu'il dpasse l'tage de rtribu-

tion de ces

De mme

se lvent (tittisthante) les cranciers de

l'homme qui migr de son pays (desatygam kurvatah).

qu'il obtient la qualit




d), les

actes qui

doivent tre rtribus dans le Kmadhatu, tant entravs, restent en



de ceux qui doivent tre rtribus dans la

prsente existence.

De mme, ds
tre rtribus

qu'il obtient la qualit d'Arhat, les actes qui





Nous avons vu que


meurtre d'un Bodhisattva

un pch



Depuis quand



partir de quel


reoit-il le


de Bodhisattva ?




qu'il fait les actes

producteurs des marques.

1. ksntyangamitrhattvaprdptau karmCitwighnakrt // Cit dans Vyakhya vi. 36 a-c. Voir ci-dessus p. 1 14. 2. bodhisattvah kuto yvat laksanakarmakrd yatah Cette ligne est cite dans la Vyakhya ad iii. 41 a-d (p. 11)7 de Cosmologie

bouddhique), pour expliquer l'expression samnikfstabodhisattva,




xviii, fol.

6 a-6




du moment o



faire les actes qui ont


rtribution les trente-deux marques,

est prdestin


cela ?

partir de ce
c-d. Il

moment, toujours


a de bonnes destines,


dans des familles nobles


possde tous




un mle


se souvient de ses

naissances anciennes
proche, c'est--dire


ne se dsiste pas.

proche de




= ns par rtogs pa (niyatipatita ?)




Bodhisattva et sa carrire, Kosa,


44 a-h


14, 21, 28, 41,


c-d, 85,


d, vi.


a-b, vii. 34.

Kranaprajnpti^ dans Cosmologie boudle

dhique, p. 327, 332, 336.

Vibhfis, 176,


longtemps que

premier asanikhyeya n'est pas

difficiles et



Bodhisattva, bien qu'il accomplisse diverses tches


reuses, cependant n'est pas capable de savoir en lui-mme avec certitude qu'il

sera Bouddha.


en lui-mme avec certitude


deuxime asamkhyeya est achev, le Bodhisattva sait qu'il sera Bouddha, mais cependant il n'ose pas
la parole

proclamer sans crainte (vaisraclya)

Je serai Bouddha




est achev, lorsque le Bodhisattva pratique les actes qui


qu'il sera Bouddha, du Matre Au temps o il pratique les actes qui produisent les marques, il abandonne cinq mauvaises choses et obtient cinq bonnes choses 1. il abandonne les mauvaises destines et nat toujours dans de bonnes destines 2. il abandonne les familles humbles et nat toujours dans des familles opulentes 3. il abandonne le corps non-masculin et

produisent les marques,



en lui-mme avec certitude


proclame sans crainte

rugissement du

obtient toujours

un corps masculin


Les marques sont expliques dans TAbbisamayalainkra,



vabhQmi, Camb. Add. 1702, 138 b-141 b (laksannuvyanjanapatala).

dans BodhisattDepuis


(voir Hastings, Encyclopdie,


Bodhisattva, et

S. Lvi^

Strlamkara, Introduction), toute la prparation de

produit (nrvartaka) les marques


Bodhi (bodhisous-marques

est de


sous-marques. Cette prparation


deux natures

lointaine, aussi

longtemps que' les marques

ne sont pas obtenues (yo 'pratilabdhesti vipkato laksannuvyanjanesu) ; proche, depuis l'instant o, pour la premire fois, les marques sont obtenues et Les aussi longtemps qu'elles se purifient et se perfectionnent de plus en plus

marques sont

le fruit


est expliqu

de diverses bonnes actions (vicitrakarmbhisamskradans le Laksanastra parce qu'il est solidement


install (pratisthita)


la moralit, la patience et la gnrosit, le


(D'aprs Lakkhanasuttanta, Dgha, marque supratisthitapdatva iii. 146, la marque n'apparat que dans la dernire existence du Bodhisattva) 1. bde hgro(r) rigs mthor skye dban tshan / pho(r) hgyur tshe rabs dran mi
obtient la


dit qu'il est


108 c-109.




parce que ses destines sont excellentes


(prasasta), car







[7 a]

nat dans des familles opulentes

de Ksatriyas, de Brahmanes,

de Grhapatis, non pas dans des familles humbles.

L'homme dont


organes ne sont pas au complet est vikalenil

ses organes tant au complet,






de aviklendriya.

est toujours mle,

jamais de sexe fminin,


plus forte raison,

jamais insexu (sandha,


toutes ses existences,

se souvient de ses anciennes nais-


cdant, on se dsiste



ne cde pas,


est avivrt


synonyme de avaivartika, ne
d'tre utile

se dsistant pas





but de

aux cratures,


n'est pas abattu

par toutes

les sortes

souffrance, par tous les outrages \ Celui qu'on


l'esclave non-






bien le Bodhisattva


magnanime, qui


L'dition des Krikas


lit bde hgro et pho hgyur. [sugoccakrilaimrnksah pumn jdtismaro 'vivrt





sugati) koi-kia (uccaktila) ki (sa-

kala) nn (pum) -siu (jtismara) pou-t'oi (avinivartanya, Mahavyutpatti, 24. 4, avivartana, 133. 20). Hiuan-tsang a le mme terme ki pour sakalendriya ; il traduit les deux derniers mots, mi-ldog, par kin-ku, ferme,

drdha, dhlra.

L'expression avaivartika est consacre.






triyamahslakulajo yvad grhapatimahslakulaja

kiilaja ity arthah.

Mahavyutpatti, 187.

arthah / ksamahgrhapatiksatriyamahlakulam 9.
' ;

tcaktilam .... 11. nlcakulam. Voir Childers et le Dict. de S* Petersbourg. Paramrtha traduit simplement grande famille Hiuan-tsang transcrit le mot 8la ; les versions chinoise et tibtaine de la Mahavyutpatti et la traduction tibtaine du Koa ont famille semblable au grand arbre sala . 2. Mahavyutpatti, 245. 957-960 7ia kundo bhavati ... na vikalendriyo bhavati.
' : :

kadarlhanA. Vyakhya kadarthan mahparihhavaprvik vihethan j yayoh kyavcoh pravrtty parasya duhkhadaurntanasye bhavatah / tadapeksay tannigraho yantrunety ucyate (?) 4. Le Bodhisattva est le sattvadsa de cinq manires, Satralainkara, xix. 19 ... ksamo bhavati paribhsanatdanadlnm / nipuno bhavati sarvakryakarant. Comparer Sikfisamuccaya, pp. 35, 143.

log par sgrub

cependant possde
les plus

xviii, fol.

6 b-7


vii. 34),

sublimes perfections (sampad,

agissant par pure compassion, se tient sans gosme,

comme un

chien \ en prsence de toutes les cratures


supporte, de la part

de toutes les cratures, outrages

toute tche fatigante et pnible.


mauvais traitements


Les actes qui ont pour rtribution





les projette



Jambudvpa, tant un mle; en prsence

des Bouddhas, pensant aux


provenant de rflexion


cours des cent ges cosmiques supplmentaires.

Le Bodlisattva
le seul

projette les actes qui mrissent en

marques dans
du Jambu-

Jambudvpa, non pas


ailleurs, car les habitants


dvpa sont d'esprit



un mle


non pas une

p. 35.



Comparaison du Bodhisattva et du chien, Sikssammuccaya, [jamhudvl^e punin eva sammnkhabucldhacetanah / cintmayam kalpaate ese (tad) ksipaty asau //]

de ni hdzam

phor hgyur nid


mnon sum sans



sems pa

bsam pa

byun bskal pa brgya


pa dag tu hphen par byed


Paramrtha, dans le deuxime pda, rpte le mot Bouddha toi-fo f-kou-i := hiiddhapratyalcsam buddhacetanah ; et traduit le Bhasya A quelle poque eultive-t-il ces actes ? A l'poque o les grands Matres sont prsents (malistrsammukhlbhvakle), parce que la volition [dans ces actes] a pour objet les Bouddhas , Vibhsa 177. 1. Les actes mrissant en marques sont-ils sriitamaya, cintmaya, bhvanmaya, issus de l'enseignement, de la rflexion, du recueillement ? Ils sont seulement cintmaya. Pourquoi ? En raison de l'importance


(prdhnya) de

cette sorte d'acte (de l'acte n de rflexion)


l'acte issu

de l'enseignement existe seulement dans


Quelques-uns disent

que l'acte qui mrit en marques est issu et de l'enseignement et de la rflexion, non pas du recueillement. Dans quel lieu est produit l'acte mrissant en marques ? Dans le seul Kmadhtu, dans la seule destine d'homme, dans le seul Jambudvpa, seulement avec un corps d'homme et non pas de femme, etc. A quelle poque ? A l'poque o apparaissent (utpda) des Bouddhas non pas une poque vide de Bouddhas. Avec quoi pour objet ? Portant directement sur le Bouddha, car la volition (cetan) et la rsolution-vu (pranidlina) spciales [qui crent cet acte] ne portent pas sur un autre objet. 3. Astashasrika, p. 336 le Bodhisattva renat dans le Jambudvpa et gn-

ralement dans



femme, car

a dj dpass





en prsence des Matres

seulement, car sa volition a pour objet les Bouddhas. Ces actes pro-

viennent de rflexion (cint), non pas d'audition ou de recueillement


hhvanmaya). Le Bodhisattva


accomplit au cours des

cent ges cosmiques supplmentaires


non pas pendant un temps

plus long.


ese, lecture

confirme par VyfikhyS,


13 a


147 de Cosmolo-

gie bouddhique).

s'agit des cent

kalpas (grands kalpas, mahkalpas, Kosa,



94 a) qu'un

kalpsamkhyeyas qui font le gros de sa carrire au cours de ces cent kalpas, il mrite vraiment le nom de Bodhisattva et ralise la Bodhi (Mahavastu, iii. 249 te bodhim kapasatena samudnenti narottam). Souvent on nglige ces cent kalpas et on dit que la qualit de Bouddha est obtenue par trois kalpsamkliyeyas (iii. 94 b-c), c'est-dire par trois asamkliyeyas fou asamkhyas) de mahkalpas. h'asamkhyeya
Bodhisattva doit normalement durer au del des



varie d'aprs les

un chiffre dtermin, calculable, mais norme, dont la valeur modes de comput (cinquante-neuvime terme d'une srie 1, 10,



ou d'une


1, 10,

100, 10.000, 10.000



voir Kosa,




peut croire que cette thorie a remplac celle des Asamkhyeyakalpas, kal-

incalculables, expression qui demeure ct du nouveau comput kalpsamkhyeya, Religieux Eminents, p. 150, etc. Tout kalpa est sans mesure aparimita) et cependant les kalpas sont nombreux (Mahavastu, i. 78, comparer Samyutta, ii, 181 et suiv.). Dans l'Abhidharma, on entend par Asanikhyeyakalpa le quart du grand kalpa , la priode de cration, de dure, de destruction

de chaos.

du Bodhisattva est de quatre asamkliyeyas kalpas fChilders, sub voc. asamkhyeya ; Cariyapitaka, i. 1 Jataka, Anguttara, commentaire dans PTS. 1883, p. 98; Nettippakarana, p. ICI i. p. 2 Visuddhimagga, .302). Le Sarasamgaha (premier chapitre, d. Neumann, 1891, p. 12) distingue les Bodhisattvas en qui domine la sapience, la foi, l'nergie leur carrire est de 4, de 8 et de 16 asamkliyeyas (plus 100.000 kalpas). Aux rfrences classes dans Cosmologie bouddhique p. 264, il convient d'ajoula seconde, ter l'Abhisamayalamkaraloka, viii, o sont exposes deux thories d'aprs cet ouvrage, est la thorie de Vasubandhu 1. La carrire du Bodiiisattva est de trois asamkliyeyas de kalpas (kalpsamkhyeya, non pas asamkhyeyakalpa). Le premier comprend la carrire du Bodhisattva depuis la terre


les sources plies, la carrire

et cent mille


(samskrabhmi) jusqu'


premire terre proprement dite



second, dep\iis la deuxime terre jusqu' la septime


troisime, depuis la

huitime terre jusqu' l'entre dans

terre des

Bouddhas (buddhabhmi


on a un kalpsamkhyeya pour la saniskdrafew ; deux pour Vadhimuklicaryfibhmi, trois pour la premire terre proprement dite (pramudit) et trois pour chacune des dix terres. Ayant parcouru

Mais, en



xviii, fol.

7 b-8



Cependant Bhagavat Sakyamimi, par

franchit neuf de ces cent ges cosmiques

la purification de l'nergie,

et projeta les actes mrissant en marques au cours des quatre-vingt-onze ges cosmiques

(ekanavatym kalpesu)

qui, de la sorte, restrent des cent. C'est


pourquoi, parlant Asibandhaka,


Chef de




morant quatre-vingt-onze ges cosmiques

bde ha) ou mise mal (upahata) par

partir de maintenant, je
ait t

ne vois pas (nbhijnmi) qu'aucune famille


appauvrie (mi
cuits .

don d'aliments

Bhagavat s'exprime

ainsi parce



sur ce nombre de priodes


cosmiques que porte sa mmoire naturelle. (Voir

Les anciens Matres

30, 37, 42) [8 a]






a achev


sa carrire en trente-trois kapsamkJiyeyas,

Bodhisattva arrive la terre des


samantaprabhm huddliahlimim sdayatlty evam trayaskalpsamJcliyeyair buddhatvam prpyata ity ryavasubandhii....

pdh. 1. [Bhagavat] nava ca kalph pratyiidvartith

Le futur Skyamuni, en purifiant son nergie comme il est expliqu iv. 112 a, effort d'nergie (vryarmbha), obtint de complter sa perfection (pramit) d'nergie et ses autres perfections en quatreen d'autres termes, par un grand
vingt-onze kalpas.

Le Mahavastu


249) est d'accord

vlryakyena sampanno




pani sthyesi vryena puriisottamah

As. 1914,



Nanjio 430 traduit par



(trs intressant).

par Kiokuga et qu'il faudrait kalpas onze en nourrissant la tigresse, huit en tendant ses cheveux dans la boue (Divya, p. 252), neuf en louant Pusya, douze en cherchant au pril de sa vie une demi-stance. 2. Comparer Samyutta iv. 354. La Vykhy rsume le Stra Asibandhakena grmany nirgranthasrvakena bhagavn uktah / kim anarthysi bho Gautama kulnm pratipanno yas tvam drse durbhiksa iyat bhiksusamghena srdliam asanivad utsdayan bhiksm atasi j sa bhagavatbhiD'aprs certaines autorits du


tudier), le futur

Skyamuni a

franchi quarante



'ham grmani ekanavatam kalpam updya samanusmar;


faut expliquer

ekanavateh pranam kalpa ekanavatah.


Les passages sont nombreux o Bhagavat semble limiter 91 kalpas son exprience du monde, par exemple Majjhima i. 483 cette poque rgnait Vipasyin, Dgha, ii. 2, Divya, 282, dont l'avnement marque la fin du troisime asamkhyeya
de la carrire de Skyamuni (ci-dessous

110 b-c)

Les anciens matres, prvcryas.


D'aprs la glose de l'diteur japonais,






Les quatre dfauts (dosa) sont

mauvaise destine (durgatidosa), mdiocrit

ge cosmique que





Bodhisattva abandonne quatre dfauts

et obtient



Des marques




nat de cent mrites.

la famille

(aknlnatdosa), organes incomplets (vikalendriyatdosa), sexe


fminin (strlhhvadosa). Les deux qualits (guna) sont

souvenir des existences

passes (jtismaratguna), qualit de ne pas reculer ou se dsister (anivarta-

katguna). Paramartha


Hiuan-tsang spcifient que, par premier ge cosmique (kalpa),

faut entendre le premier




naissances animales du Bodhisattva et ses pchs, voir

cent mrites ? La


ekaikam punyaafajam. Comment faut-il entendre ces



fournit trois expli-

Cinquante volitions (cetan) se produisent lorsqu'

ayant pour ohjet




l'acte d'attention


Bouddha (bnddhlambana)


autres volitions quand le Bodhisattva pense



aussi, tre

un Boud-


{aham apJttliam sym)

Le Bodhisattva a des penses de piti (kamn^itta) l'endroit des quarantemonde (20 places dans le Kmadhatu, 16 dans le Kpa, 4 dans l'rpya, plus 8 enfers froids) ces penses sont associes autant de volitions plus une quarante-neuvime volition ayant pour objet le Bouddha De la manire dont il dlivre les tres ; plus une cinquantime volition Puiss-je de la mme En rptant ces cinquante volitions, le Bodhisattva a manire les dlivrer !
huit parties du

cent mrites.

Le renoncement au meurtre est pris sous un quintuple mode (voir ci-dessous, purification du chemin de l'acte proprement dit (maulakarmapatharenoncement l'acte proprement dit) purification du prparatit pariuddhi et du conscutif ('swan^afca, iv. 68 a); vitarknupaghta, le renoncement n'est pas troubl par les [trois] vitarkas [mauvais] smrtyamiparigrhtatva, le renoncement est gard par le souvenir du Bouddha, du Dharma et du Sanigha nirvnaparinmitatra, le mrite du renoncement est appliqu la conqute du Nirviina. Cela fait cinq volitions quand le Bodhisattva renonce au meurtre, cinquante volitions pour les dix renoncements, cent volitions en rptant les cinquante premires volitions (VySkhya) Samghabhadra Cent mrites, c'est--dire cent volitions (cetan). Au moment o il va produire l'acte produisant une marque, le Bodhisattva produit d'abord cinquante volitions qui purifient le rceptacle du corps ensuite il produit l'acte qui attire une marque plus tard, il produit cinquante bonnes vf!iti(uis qui affermissent et perfectionnent l'acte de manire ce qu'il obtienne plnitude (paripri). Les cinquante volitions ont pour objet les dix chemins-de-l'acte il y a


123 a-b)


xviii, fol.

8 a-8



Quelle est la mesure de chacun de ces cent mrites ?

D'aprs les uns,


est gal

au mrite qui a pour

fruit les jouissan-

ces de tous les tres, en exceptant le Bodhisattva proche de la Bodhi

c'est--dire accomplissant les actes qui

mrissent en marques.

D'aprs d'autres,



gal l'acte collectif de tous les tres,


par sa souverainet



produit la cration du monde.

D'aprs d'autres, les Bouddhas seuls connaissent la mesure de ce


Combien de Bouddhas a vnrs (pari/upsaymsa) Bhagavat quand il tait Bodhisattva ?


cours du premier



a vnr soixante-quinze


[8 b]

soixante-seize mille au cours du second


soixante-dix-sept mille au cours du troisime.

Quels furent



la fin de

chaque asamkhyeya ?


l'ordre inverse de l'numration,



la fin des trois

asamhhyeyas, Pasyin, Dpa, Ratnasi-

cinq volitions pour chacun

(Mahvyutpatti, 245, 428)




prntiptaviraticetan ; 2. samdpanacetan samuttejanacetan (tsn-mi, comparer 245, 429) ;' parindmancetan : volition de renoncer au meurtre,



prendre aux autres ce renoncement, de



louer et prcher, de se rjouir


soit accept,


mrite acquis l'acquisition du NirvSna.


D'aprs d'autres matres,

tions, faible, etc.,

y correspondant aux cinq dliynas


pour chaque chemin de


cinq honnes



D'aprs d'autres matres,

pour chaque chemin de





maulakarmapathaparivitarknupaglita, 5. smrtyannparigrMle

D'aprs d'autres matres, tous les actes qui mrissent en marques sont

des volitions nouvelles, extraordinaires (n'i-ts'ng-s), ayant pour objet

dha lorsque cent sont ensemble (npasohhita ?)


ralises, le

Bodhisattva est orn [de




yena sarvasattvakarmdhipatyena trishasrko nirvartate





Saipghabhadeuxime opinion aux Yaibhasikas. dra expose cinq opinions la Vibhs (177, 9) en signale onze. 2. Ce sont les chiffres de la Vibhs, 178, 2. - Dans le MahSvastu, Ckyamuni se souvient d'avoir honor et servi huit mille Buddhas du nom de Dparakara ... trois cent millions de kyamunis, et ainsi de suite travers des pages

Paramrtha attribue



et suiv.)



des Savants, aot 1899.

rnam gzigs mar me rin ehen gtsug / grans med gsum gyi tha mar byu [asamkhyeyatrayntajah / Payl Dlpo Batnaikhl]




110 b-112



l'poque du parfait et complet

Bouddha Ratnasikhin



plt le premier


l'poque de Bhagavat DTparnkara



l'poque du Talhagata Vipasyin fut com-

plt le troisime.


tous les





Le premier



ancien Sakyamuni (Vibhasa, 177,



Bouddha, sous

lequel Bhagavat, alors Bodhisattva, formula pour la premire fois le

de Bodhi en disant



aussi, devenir

un Bouddha

tout semblable lui

Ce Sakyamuni, comme

ntre, apparut

pendant un mauvais ge du monde

ans. [9 a]

aussi sa loi ne dura que mille







chaque Paramita

(p. 231, 1.3)?


a-b. Il remplit le

don en donnant tout tous, par

tous, jusqu' ses




donne tout



la moelle de

ses os, par piti, sans souhaiter quelque flicit,

remplit la vertu

de don.




moralit et la patience en ne s'irritant pas, brist-on


ses membres, bien qu'il soit engag dans le dsir.


dan po sa kyar thub pa yin. kalaliaynga, kaliyuga. poque de dispute rtsodpahi dus kho na la okntakle ; Hiuan-isang (Sarad Chandra Das). Paramartha mo-che-ch mo-ki kalpnte, c'est--dire apakarsakalpe : dans un temps o la vie diminue de dure (iii. 92). A cette poque, le futur Sakyamuni tait un kumbhakrakaknmra du nom

de Prabhasa (Vyakhyfl).


Le Mahavastu connait un Sakyamuni qui vcut il y a un nombre infini de kalincalculables (asatnkhyeya) (i. 47), lui aussi de Kapilavastu, et qui reut l'aumne de notre Sakyamuni, alors un marcband (pratham pranidhi tad
3. kun la thams cad sflin rje yis / sbyin par byed pas sbyin pa rdzogs == [dnasya prih krpay sarvebhyo sarvadnatah /| Exemple Sibi. 4. chags bcas yan lag bcad kyan ni / mi kbrug bzod dan tbsul khrims kyi


xviii, fol.

8 b-9



Lorsque, bien qu'il ne soit pas dtach (vltarga),




mme quand

on brise ses membres, alors


remplit les

Vertus de moralit

de patience.



L'nergie, en louant Pusya.


lorsqu'il tait Bodhisattva, vit le

Tathagata Puya


l'intrieur d'une grotte de



se rendait incandescent l

[ksdntislasyngacchede sargasypy] akopatah // Exemple le bhiksu Ksnti tortur par le roi Kali [= Kalbu] (Jnanaprasthana) c'est le Rishi Ksnti [Ksntivdin] du Stralamkra (Huber, p. 325, 383), le hros de Jtaka, 313 (Visuddhimagga, 302), Jtakaml, 2-8, Avadnakalpalata 38, Chavannes, Cinq cents contes, i. 161, Przyluski, A(^'oka, 358, Watters, i. 227. D'aprs Mahvastu, i. 170, le futur Skyamuni est dgag du dsir (vUarga)
: ;

depuis Dpamkara.

skar rgyal bstod pas brtson hgrus kyi

14 (quelques variantes), o le

= [vryasya ptisyastavanat]

Cette histoire est raconte dans Avadnasataka, 97

176) et dans









martha et Hiuan-tsang ont, en transcription, Tisya notre version tibtaine a skar rgyal que le Dr. P. Cordier, (d'aprs Astiigahrdaya 2. 1. 38) traduit Pusya. Dans Mahvyutpatti on a rgyal Pusya (le Naksatra) (165. 6) Tisya (le

Cakravartin), (180.







= hod

Iclan avec la glose


sa (sus) clan (ma) hclom na skar rgyal du gdags : tant exhort par Pusya (?), Dans Mahvastu, iii. 240. 6, Pusya reoit la il est appel skar-rgyal (?). prophtie de Tisya. D'aprs Romantic Legend, Tisya vint 4 kalpas avant Pusya, 95 kalpas avant kyamuni. dans la grotte du Ratnagiri 2. Paramrtha Avadnasataka: himavantam parvatam abhiruhya ratnaguhm pravisya 3. tejodhhim sampadyamnam. Paramrtha et Hiuan-tsang traduisent
: ; :

entr dans le recueillement de tejodhtu


(hoo kidi ting

c'est l'expression

dont Eitel


Les interprtes chinois emploient



souvent la formule hoo kong ting,

samdhi de


de feu



iii. 155, 264), qui corrrespondrait k jyotisprahhasamdhi. de cette manifestation de rddhi par laquelle un saint rend son corps incandescent, met flammes et fume, Mahvyutpatti, 15. 14 dhmayati prajva-

Cinq cents contes,



layaty api tadyathpi nma ntahn agniskandJiah (Voir Dgha, iii. 27 Kosa vii. 48 et suiv. sur la rddhi). Le pouvoir de Tascte sur les lments, lment aqueux, lment ign, est acquis par une mditation dans laquelle il considre cet lment. Ainsi s'explique l'explication de Childers (s. voc. tejo) tejodhatum sam having entered upon jhna by tejokasina (sur les krtsnyatapajjitvci nas, Kosa, viii. 36) que Senart (Mahvastu, i. 556) compare celle de Beal

causing their bodies to ascend into space and mit

ail sorts

of brilliant appearan-




b], se

loua pendant sept jours et sept nuits [9


tenant sur un pied,

rptant la stance

Ni au


ou sur la

terre, ni

dans ce monde,



le sjour

de Vaisravana, ni dans

le palais

des Marus, ni dans

autres lieux clestes, ni dans les directions et sous-directions



o trouver, chef des hommes, un ascte qui


soit ton

gal ? Qu'on parcoure,

Toi; veut, la terre entire, si peuple, avec


ses montagnes et ses forts.

Alors, d'aprs l'Ecole, se trouva

remplie la vertu d'nergie et neuf ges cosmiques furent franchis




Le recueillement

et l'intelligence,

immdiatement avant.

L'homme, entrant en dhyna par la contemplation du feu (tejokasina), On verra Divya, mme, au cours du dhyna, de crer des flammes, etc. proclam par Bouddha le meilleur pratiquer le p. l&S, la lutte de Svgata recueillement ign, tejodhtum sampadyamnnm agrah (Anguttara, i. 25) avec le Nfiga enflamm par la colre. Dans un grand nombre de sources le satndhi de feu ou tejojjhna accompagne le Nirvana (Udna, viii. 9 Przyluski, Lgende d'Aoka, p. 26, Mahvamsa, v. 220, Mahvastu, i. 550, etc.). 1. fia divi bhuvi va nsmiml loke na vaisravanlaye na marubhavane divye sthne na diksu vidiksu ca / caratu va^udham sphltm krtsnm saparvataknanm purusavrsabha tvattulyo 'nyo mahramanah kutah If Le MS. de l'Avadanasataka donne purusavrsabha stutulo nyo fnahsramanah kutuvh //



que Speyer corrige

purusavrsabhsty anyas tulyo inahsramanas tava. h jeu tng tsun yeu san (eul) te. La version tibtaine finit par ga la yod, qui donne kutah. Vyfikhyfi na divi bhuvi ceti vistarah j divi bhuvi cety uddesapadanyayefioktam II ndsmin loke na vaisravanlaye na marubhavane divye sthna iadvyaktyartham nirdesapadni / asmin loka iti manusyaloke / vaisravatilaya ili cttirmahrjikasthne / marubhavana iti marudbhavane tryastrimabhavana ity arthah / divye sthne ymdisthne II lokadhtvantaresv api tatsudfsasybhvajnpanrtham ha na diksu vidiksu ceti // aiha na sraddhiyate j caratu kacid vasudhm imm krtsnm sphilffi bahusattvdhyasitm svayam pratyaveksatm ity abhipryah / 2. satndhidhyor anantaram jl Cest par le samdhi et la prajn (= dhi) que sont acquis les fruits. Pour


sous l'arbre


Bodhisattva reste Pfthagjana jusqu'au



Les coles ne sont pas d'accord l-dessus

moment o il s'installe comme on peut


voir daiui les traits de


et de

Bhavya. D'aprs Madhyamakfivatara,


xviii, fol.

9 a-b.

la Bodhi,

Au moment

du vajrasamdhi


immdiatement avant

remplit les vertus de

dhyna et Les Pramits reoivent le nom


de praji. de


parce qu'elles sont

parvenues l'autre bord de l'ensemble des perfections (sampad)

propres chacune

Le Stra enseigne


y a


punyakriyvasttis, celui qui

consiste en don, celui qui consiste en moralit, celui qui consiste en



don, la moralit, la mditation sont-ils

punyakriyvastu ?



Trois sont mrite, action, lieu d'exercice de l'action


comme dans

cas des chemins-de-l'acte \ [iO a]

Bodhisattva, ds la premire




vues errones (satkyadrsti,


sllavrata, vicikits).

Le vajropamasamdhi


44 d) est

recueillement par lequel


la qualit d'Arhat rompt

les derniers liens et obtient la

Bodhi, laquelle consiste

passions sont dtruites,








savoir qu'elles ne renatront plus).

la qualit



la qualit

de Bouddha


un Bodhisattva n'acquiert

d'Arhat qu'aprs

avoir rempli les Pramits (voir

24 et



a-b, trad. p. 206).

Hiuan-tsang ajoute

prenant place sur




ou bodhimanda

(Minaiev, Recherches, 177), qui est dcrit dans Vibhs, 13,


Le Kosa en parle



les traductions
p. 2.

chinoises du

mot pramitd, Chavannes, Cinq cents



Etymologie, Candrakirti dans Madhyamakvatra,

16 a-b

Muson, 1907, p. 29), F. W. Thomas, JRAS. 1904, 547. 3. gsum po bsod nams bya ba dan / dehi gzhi dper na las lam bzhin nyam kriy ca tadvastu trayam karmapatho yath //]

= [puiii.


11, 14

Vibhs, 126,


112, 11

Mahvyutpatti, 93.





punnakiriyavatthu, slamayam, bh-

347-348, examine la place du dna dans ii, which conlains a good deal more of the milk for babes than the other three of the great Nikyas , consacre un vagga la charit, laquelle ne figure pas parmi les ailes de la Bodhi , laquelle est ignore dans le Dhammapada. Mais l'enseignement du dna, par dfinition, s'adresse aux Upsakas voir ci-dessus p. 70 et ci-dessous p. 235 cependant le dna est utile

Rhys Davids, dans Dialogues,




au Nirvana,




Louange du don de


vi, 24. 5,

du don d'un vihra, Culla,

vi. 1. 5.




112 c-113.

don, moralit, mditation, chacun suivant sa nature,

sont mrite (punya), action (kriy), lieu d'exercice (vastu), soit

combins, soit isols


mme que les chemins-de-l'acte sont


ou bien

la fois acte et

chemin de

ou bien seulement chemin de


considrer d'abord le punydkriyvastu


qui consiste en don,

faut distinguer

1. l'acte

corporel et vocal qui est


triple titre

mrite, parce que sa rtribution est agrable

qu'il est acte


(punyakriyjy parce

de sa nature

lieu d'exercice


objet (vastUj adhisthna) de la volition de donner qui le provoque

2. la volition

(cetan) de donner, qui est mrite (punya)


et action


3. les


(sensations, etc.) qui


l'acte corporel et vocal, et qui

sont seulement mrite.

est exclusivement
et lieu

Le punyakriyvastu qui consiste en moralit

acte corporel et vocal



ncessairement mrite, action

lieu d'exercice de l'action.



punyakriyvastu qui

consiste en mditation, considrons


la mditation de bienveillance (maitrl, viii. 30)


cette mditation

est mrite


aussi lieu d'exercice




(punyakriyys ca vastu), savoir de

veillance, car cette volition

la volition associe

la bien-

prend forme dans

moule de

la bienveil-



2. la volition

en question est mrite

et action




la moralit qui constitue le


discipline de


que possde l'homme qui pratique la mditation de bienveillance


les autres




concomitants la mditation sont

seulement mrite.


bien l'expression



punyakrana, punyaon entreprend


prayoga. Le don,

la moralit et la mditation sont le vastu de la


punyakriy, parce que, en vue de

prparatif du mrite.






maitrlmukhena abhisafftskarant Ou bien punyakriy


= maitrlvaena abhisatficetant
signifie faire



prparatif de


(punyaprayoga). Le mot vastu


signifie point d'appui

(Araya, adhisthna)



moralit et la mditation sont





d'appui du prparatif du

punya, parce qu'on produit


prpoxatif du



vue de ralier don, moralit et mditation


xviii, fol.

10 b-11



D'aprs une autre opinion, lapimyakriy


parler exactement,




don, la moralit et la mditation sont


le lieu d'exercice

de cette volition.

Qu'est-ce que le don, clna ?

Sans doute, par dna on entend en gnral ce qui

(deya), mais





Le don,

c'est ce qui



Mais on donne par

crainte, par espoir de rciprocit, par attacheil

ment (rga),



ne s'agit pas


de ce genre de don. Par

c'est ce qui

consquent, pour prciser, l'auteur

Le don,




Par dsir de rendre hommage ou


Qu'est-ce qui donne ?




un acte corporel


vocal et ce qui produit cet acte.


(kalpa) de pense-et-mentaux (cittacaitta) donne



un acte corporel ou vocal


cette collection et cet acte





Lorsqu'un homme, avec une bonne


pense (manas), donne ce qui

appartient, alors





bons skandhas donnent.

[11 a]


d. Il

a pour


de grandes jouissances.


Le punyakryvastu qui consiste en don (dnamaya) porte pour


de grandes jouissances.
dlyate yena




tacl dnam. Dans Kathvatthu, vii. 4, le Theravdin soutient dna est seulement ce qui est donn. Par le don on rend hommage aux Caityas, aux pjnugrahakmay

tres nirvns (parinirvrta).

dan iiag las slon dan bcas [kyavkkarma sotthnafn] Les traducteurs chinois comprennent les bons skandhas de ce moment donnent ... . L'acte corporel et vocal de don est rpa ; les pense-et-mentaux
3. lus 4.

sont les quatre


et ailleurs


de hbras Ions spyod chen po can


[tan mahbhogavatphalam //] udrabhoga on peut entendre grande jouissance


d'aliments, de vtements, etc.


jouissance de grands objets de jouissance


Voir Anguttara,







maya, que nous

ayant pour nature


qui consiste en






l'on dit




(trnamaya grha),


de feuilles


Le don



aux deux, aucun

des deux.

Le don
celui qui


un Caitya n'est pas





est utile

donne lorsque

celui-ci est

un rya non dtach du


(amtarga, avirakta, sarga) ou un Prthagjana dtach ou nondtach. (Voir



Le don que


autrui un rya dtach


l'exception du cas

o ce don mrirait dans

prsente existence n'est pas


rya, car l'rya dtach a dpass dfinitivement la sphre (Kmadhatu) o pourrait avoir

dans une existence postrieure,



du don. Ce don




Le don que
Le don que

autrui un rya non-dtach, un Prthagjana

b], est utile

dtach ou non-dtach [11


soi et


un Caitya un rya dtach

cas o ce don mrirait dans la prsente

soi, ni

l'exception du existence
n'est utile ni

autrui. Ce don a seulement pour





Nous avons


d'une manire gnrale, que


don produit de

grandes jouissances



Le don

est excellent par l'excellence


du donneur, de

donn, du champ.

1. svabhve caisa mayad iti na vikrdisu. La maison n'est qu'herbes non modifies (nirvikdra) ; elle n'est pas une transfoiiuation des herbes. maya a une valeur diffrente dans rutamayl prajn (vi. 5 c). 2. bdag gzlian don phyir gnis don pliyir / gnis kahi don du min phyir sbyin

svaparrthobhayarthya [nobhayrthaya diyate /J 3. de yi kliyad par sbyin bdag dan / dnos dan zhin
vieso dfiapativastuksetraviesatah
// ]


khyad par


= [tad'


xvii. 1 1, les

Uttarfipathakas soutiennent que

donneur (ddyaka),
celui qui est

non pas



purifie le don.

Karmaprajiiapti (Mdo 02,

246 b)


y a quatre dons

pur du


xviii, fol.

11 a-12





Le donneur

est excellent par la foi, etc.


Le donneur (ddnapati)

est excellent lorsqu'il est revtu




de science (sruta), de

gnrosit (tyga),
etc. le

de sapience

(prajn), de sobrit (alpecchatd),

excellent, le






est excellent



est excellent,


est excellent.


b. Il

donne avec

respect, etc.

Semblable donneur donne avec respect (satkrtya), de sa main

(svahastena), au

moment voulu

(kle), sans faire de

mal personne

(parn aniipahatya

comparer Milinda,






obtient des honneurs, des jouissances suprieures,


au moment convenable,

de tout


Le donneur qui donne avec respect obtient des honneurs

de sa main,


trouvera satisfaction dans des jouissances suprieures


(udrebhyo hhogehhyo rticim lahhate)


donnant au moment voulu,

obtiendra ces jouissances en temps convenable et non pas lorsqu'il


ne peut en jouir

donnant sans

faire de mal, ses jouissances seront

le feu, etc.


ne seront pas drobes, annihiles par

Nous avons expliqu en quoi consiste l'excellence du donneur et comment le don est excellent par l'excellence du donneur. Com-





excellent ?

du donneur, impur du



rcipient, et le reste

comme dans




C'est le texte cit par l'auteur de Kathvatthu (Dgha,








256 (dakkhinvibhangasutta)


121 c-d.

sbyin bdag khyad hphags dad sogs kyis




sogs par sbyin par byed

= [sraddhdimsisto data] = aatkrtydi dadti [M]




sakkaccam dnam, sahatth, cittikatam, anapaiiddham

Sur ls traits du don, de la moralit et du ciel , voir ci-dessus p. 70. Un spcimen de dnakath, Anguttara, iv. 393 le Vimnavatthu appartient celte

cule (trente-sept qualits

Divyvadna xxxiv est de Grand Vhidu don kle ... satkrtya ....) 3. de phyir bkur sti rgya chen dan / dus dan bar chad med par rned [satkran udrn kle] 'nacchedyn lahhate tatah //
littrature (MinayefF, Recherches, 165)







L'objet parfait de couleur, etc.





L'objet est excellent lorsque ce qu'on


est parfait de couleur,

d'odeur, de saveur, de contact.

Qu'oblient-on par


don de semblable objet ?

gloire, joie,



D'o beaut,

grande dlicatesse du corps


contacts correspondant la saison.

Celui qui donne un objet parfait de couleur sera beau.

Celui qui donne un objet parfait d'odeur [12 b] s'tendra de toute
part par sa rputation, de


que se rpand une odeur.

Celui qui donne un objet parfait de saveur sera joyeux,


une saveur douce.

Celui qui donne

un objet


au toucber, son corps sera

et ses



joyau de femme d'un Cakravartin,


n'auront que des contacts agrables, chauds ou froids suivant la

saison (rtusukhasparsni csyngclni).





excellent ?



Le champ

est excellent

par la destine, la souffrance,


bienfait, les qualits.


excellent par la destine.

Bhagavat a



faut atten;

dre une rtribution cent fois plus grande du don fait un animal
faut attendre une rtribution mille fois plus grande du don fait





varndisafftpannam vastu.
la foi


l'intention importe,

donn, voir par exemple Huber, Slrfilamkfira,


122, Minayeff, p. 167

non pas l'objet au bas


Les pauvres, qui ont


de las gzugs bzan grags Idan dan


bgyur arayas tatah jj


na bde

= [surpah

/ dga dan sin tu gzhon sa dan / dus su reg klrtimn ratah / atisukumra rtusukhaspar-


manpadyi labhate manpam.


gatiduhkhopdkaraxiayunaih ksetram visisyate / C'est le Sotra cit Kosa iii. 41 la fin. Comparer Mujjhima,




xviii, fol.

12 a-13




excellent par la souffrance.





atipadhika pnnyakrii/vastus, numre

l'infirmier, le

don au malade,


don pendant



froids, etc.

poursuit [13 a]





de famille qui est revtu de ces sept uvres mri-

toires matrielles,

on ne peut dire


mesure de son mrite.


excellent par les bienfaits.

Don au

pre, la


p. 52),

au matre, aux autres bienfaiteurs. Exemple




de l'ours, de l'antilope,


excellent par les qualits l






clattv satacjini dakJchinrx pCttikankifabb, puthtijjana-

ici la

Yasiibandhu mentionne

sixime et la septime

uvre mritoire mat-

rielle (voir ci-dessus p. 15).





gamikya va dnam da-

6. .... glnya glnopasthpakya va dnam ys ta bhavanti sltalik va vtalik va varsalik va tadriipsi ltaliksii yvad varsaliksu bhaktni va tarpyni (tarpanni) va yavgpnni va tni samgliybhinirhrtya atmprayacchaU j idam ry asmkam anrdragtr anabhivrstacvarli paribJmjya sukham sparsam viharantu / idam Cunda saptamam atipadhikam pimyakriyvastu. D'aprs l'diteur japonais du Kosa, Madhyama, 2, 4 diffre un peu. La version de Hiuan-tsang porte Dans les sept aiipadhikapunyakriyvastus, il dit qu'on doit donner Vgantuka, au gamika, au glana, au glnopasthyaka, Vupadliivrika (yun-ln-tch'ng) qu'il faut rchauffer celui qui a froid. Hiuan-tsang numre donc les cinq bnficiaires des tyayikapindaptas (Divya, 50, Burnouf, 2G9 Sixime dit, Bhler, Beitrage 2G9) le moine qui arrive, qui part, qui est malade et l'infirmier (liste de Mahvagga, viii. 15. 7,


idam paricamam




comp. Angutlara,
lequel nous
t'ng che)


41) et Viipadhivrika, le

bedeau, gardien du Vihra


sommes insuffisamment
Divya, 54, 542

renseigns. (Malivyutpatti, 274, 12 (tch'ng


Sarad Chandra Das, dge skyos


S. Lvi,


titres nigmatiques...

JAs. 1915,


Nos textes se proccupent peu des pauvres . On peut signaler l'Avadna du Nirvana de Mahksyapa .... Dans les rues du village, les malheureux sont affligs et affaiblis. Les pauvres, il a toujours eu piti d'eux et les a secourus. Maintenant cette multitude de misrables a perdu son protecteur.... (Przyluski, Lgende d'Aoka, p. 232).


C'est l'ours auquel


est fait allusion,

Huber, Strlamkra,

p. 383.


VykhyS explique que l'ours a sauv un homme gtthm pravisya gtrosmastpanayena d'aprs Vibhs (114, 9) On raconte qu'un homme cherchant du bois s'gare dans la neige . Pour le mrga, c'est l'animal qui fait traverser
; :


la rivire



qui se noie,





253, ou

Gautamstra (Samghabhadra,

xxiii. 4,







bution cent mille fois plus grande du don

et le reste.





Parmi tous

les dons,



Le meilleur,


don du dlivr au


Le don donn par l'homme dtach (vltarga, vlrakta) un homdtach,

Bhagavat a



c'est le meilleur des

dons matriels




Le don du Bodhisattva.
don que donne

bien, le


Bodhisattva pour


bien de tous les


Mah5praj5palT offre une paire de vtements au Gautam, donne au Samgha en donnant au Sauiglia, tu m'Iionoreras et tu honoreras le Samgha . De ce texte et des passages o le Samgha (les quatre paires ou huit personnes , Arhat .... Srotafipannaphalapratipannaka) est dfini comme le champ de mrite par excellence (Dgha, iii. 255, Silltaniplita, 569, etc.), certains docteurs concluent que le don au Samgha est

Bouddha qui


don au Bouddha. Samghabhadra rfute cette thorie. [Le champ, Majjhima, iii. 254 Kosa, vii. 34 Divya, 71, Chavannes, Cinq cents contes, i. 394. Mais voir dans Vasumitra-Bhavya-VinTtadeva (Wassilieff, 251, 283) l'opinion des MahsSsakas (don au Samgha trs fructueux, non pas le don au Bouddha culte des Stupas peu fructueux), l'opinion des Dharmaguptas (don au Bouddha trs fructueux, non pas le don au Samgha). Un problme connexe si le Bouddha fait partie du Samgha.] Lorsqu'on prend refuge dans le Bouddha et dans le Samgha on prend refuge dans les dharmas de Saiksa et d'Asaiksa qui font le Bouddha, qui font le Samgha (voir Kosa, iv. .32). Or on ne peut pas donner des dharmas de Saiksa et d'Asaiksa, mais seulement des personnes (pudgala) ; donc le don au Bouddha et au Samgha ne porte pas de fruits. Thse discule Kathavatthu, xvii. G-10, et Samghabhadra loc. cit. [Le Samgha au sens propre, paramrthasamgha, c'est les dharmas des Saints et les huit personnes qui leur servent de rceptacle on prend refuge dans les dharmas, mais on donne aux personnes ]. 1. mchog ni grol bas grol ba la han [sresthatn muktasya mitktya]. D'aprs Madhyama, 47, 14. Voir les menus cadeaux que se font les novices arhats dans Divya. Majjhima, iii. 257 yo vltargo vitaryesu dadati ... tam ve dnafft Amisamritoire,

non pas



est le meilleur

dnaffi vipulatft

brmi. [bodhisattvasya ca]. Le don du Bodhisattva a pour but


la parfaite


et le bien

de tous les tres.


xviii, fol.

13 a-b.


ce don, bien

que donn par un


non-dtach des non-

dtachs, est le meilleur don.




don du Bodhisattva,


Le huitime

Le huitime parmi
Quels sont

les huit

dons qu'enseigne Bhagavat.


les huit



Le don sadya ;
m'a donn

2. le

don par

crainte [13 b]; 3. le don parce qu'il



me dnam


4. le



me donne


5. le


parce que mes pres


mes grands

pres donnaient

Jtaka, 444.

me pitrhhis
vol. iv,

ca pitmahais
6. le

dnam) (Comparer
le ciel



don pour obtenir


7. le

don en

vue de

la rputation


8. le

don pour orner




pour obtenir



pour munir la pense (cittapariskrrtham) [des memln-es du che-



67 b]

pour l'quiper en vue du yoga (yoga;

hat ou

= ^nidnrtham)

pour acqurir
pour obtenir


but suprme

(dtamrthasya prpfaye)


la qualit d'Ar-

entendre par



don sadya ?

Les anciens matres



instantan ceux qui sont proches, s'approchant









1-4 sont formuls


comme dans


dnam ti dnam deti aham pacmi ime na pacanti 7. idam me dnam dadato kalyno kittisaddo abbhuggacchati 8. ciUlamkracittaparikkhrattham dnam deti.


6 diffrent (slin

... )



des dnavattlms d'Anguttara,


236, fournit les n^^ 5 et 6 de notre

dinnapubbam katapubbam pitupitmahebi na arahmi pornam kulavamsam Jipetnm ti dnam deti saggalokam upapajjisdatv smi 3. sna ma dag na re nam fie bar gyur ciii ne bar Ihags pa dag la sbyin paho. Pammrtha y tch ki ts'Tn kin j'en = Don aux sanna et aux proches.





soi kin

tch fng nng ch y


suivant qu'on s'approche, don-

tara, iv.

Commentaire de l'Angutpatv dnam deti gatam disvva tam muhuttam yeva nisldpetv sakkram katv dnam deti.



p. 342).







crainte, c'est le



Le don par

don que donner


un homme qui



va prir

Mieux vaut


, pense-t-il.

Le Sntra




Du don


un srotapanna;

phcUapratipannaka procde une


rtribution incalculable

du don

un sroiapanna procde une rtribution encore plus incalculable


y a aussi cinq personnes qui, bien que Prthagjanas, confrent


l'offrande qu'on leur

une rtribution incalculable

118. Bien


ne soient pas des ryas,

les offrandes faites

pre et mre, au malade, au prcheur, au Bodhisattva sa dernire

naissance, sont sans mesure.

Ces offrandes sont sans mesure au point de vue de

la rtribution.


Bodhisattva sa dernire



Fauteur veut dire

hhavika). [14 a]

Bodhisattva sa dernire existence


quelle catgorie appartient le prcheur

faut-il le


Parmi quels champs

des bienfaiteurs

ranger ?


11 fait

partie de la catgorie




de la sapience (prajhcaksus) aux


multitudes aveugles par l'ignorance

qui est bien

proclame (praksayitar) ce


= dharmaj
la loi


mal (visama
en un mot,

= adharma)



difie le corps

immacul de

accomplit toute

l'uvre d'un Bouddha



un grand




1. Comm. de l'Anguttara bhay ti ayam adyako akrako ti garahabhay apdyabhay va 2. hphags pa min yan pha ma dan / nad pa dan ni clios smra ba dan / [mtpitrbhym glnya bhnakyntyajanmane] j bodhisattvya cmey anryebhyo 'pi daksinh //


Cette seconde ligne est cite Vyakhya, ad






D'aprs l'ditenr japonais


ce qui produit

une naissance divine

viaama, ce qui produit une mauvaise destine. 4. La version tibtaine porte chos smra ba
palti, 138. 5.

t il


= mnon par sgrub. Hiuan-tsang traduit


= dharmabhnaka, Mabfivyut^




les tres






corps de la


Voir ci*dessus p. 77.

Pour apprcier
stance, tenir

xviii, fol.

13 b-l4



la lgret et la gravit des actes,

en sub-

compte de

six causes


Conscutif, champ, adhisthna, prparatif, volition, inten-

suivant que ces causes sont petites ou grandes, l'acte aussi est

ou grand.



aprs avoir

fait l'acte,

agir en consquence.


ce quoi on fait du bien ou du mal.




chemin-de-l'acte proprement


action corporelle ou vocale en vue du prcdent.


Volition Y^etan)
(nisthd). [14 b]

ce par



chemin-de-l'acte est achev

Intention (aya)
ensuite ceci ou cela.


Je leur ferai ceci ou cela

je ferai

arrive que l'acte soit grave en raison du seul conscutif (prsthaeva), lorsque celui-ci confre la rtribution le carac-


tre de ncessit



arrive que l'acte

grave en raison du champ



parricide est plus grave que le


arrive que, le


tant le

rende l'acte grave tandis qu'un autre

exemple, tuer pre
leur mentir,

mme, certain adhisthna adhisthna le fait lger par




un acte grave

voler pre et mre,

n'est pas grave en comparaison.


expliquera de


la gravit rsultant

du prparatif,



toutes ces causes sont grandes, l'acte est trs grave


sont petites, l'acte est trs lger.


mjug dan zhin dan gzhi daii ni / sbyor dan sems pa bsam pa ste / de dag daii che ba las / las kyan chun dan che ba nid [prstham ksetram adhisthnam prayogas cetanSayah / tadalpanahattvd alpamahattvam api karmanah // ] 2. byas palii rjes la byed pa krtmikarana. Tous les projets Je dois faire ainsi, ainsi je ferai ainsi, 3. Hiuan-tsang ainsi . Note de l'diteur C'est le prparatif loign. 4. Comparer Milinda, 193, sur le mensonge grave ou lger en raison de l'objet (catthuvasena) ; de mme le meurtre est sans importance quand l'animal est

petit, Atthasalin, p. 97.



distingue Tacte






(krta) et l'acte





Quelles sont les caractristiques et les conditions de l'acte accumul ?


L*acte est dit



en raison de son caractre inten-

tionnel, de la compltion, de l'absence de regret et de contrecarrant,

de l'escorte, de la rtribution.

[15 a]


raison de son caractre intentionnel (samcetantas).



volontairement ou intentionnellement (samcintya)


est accu-


non pas

l'acte fait

involontairement ou inconsciemment (ahudl'acte



non pas

en hte (salias krtani),



D'aprs Paramfirtha et Hiuan-tsang

d'actes, l'acte kria, l'acte



Le Stra dit qu'il y a deux sortes D'aprs l'diteur japonais, ce Stra est le


kim so vediyati. Anguttara, v. 292 nham samcetaniknm kammnam katnam upacitanam appatisantiiditv vyantibhvam vadmi. Divya, passini na karMajjhima,


Voir Koa,

v. 1



katnmam katv

mni krtny upacitni prthivdhtau vipacyante

p. 303.





la thorie vdantique, voir les

sources indiques par G. A. Jacob, Vedfin-

Bombay, 1911, p. 160 (samcitakarmatt upacita'^, kriyamnni karnmni, rabdhaphalni karmni). 2. bsam bzhin pa dan rdzogs pa dan / mi hgyod giien po med pa dan / hkhor dan rnam par srain pa las / bsags palii las ses bya ba yin (oh bzhin) / [samcetansamptatvkankrtypratipaksatah j parivravipkc ca karmopacitam ucyate jj ]
Voir ci-dessus,
3. p. 114.


= samcicca, Mahavyutpalti, 245.




xi. 90,

prescrit des

pnitences pour

meurtre involontaire, akntatas, (ce qui ressemble beaucoup

asamcintya) d'un brahmane. Pour le meurtre volontaire, il est inexpiable. 4. Vyakhya nbuddhiprvam na sahasakrtam iti / atha va nbuddhiprvam krtam idam kurym ity asanicintya krtam / tan nopacitam / avykrtam hi tat karma / na sahas krtam iti buddhiprvam api na salias krtam j yad abhysena bhsydksepn mrsvddyanusthnam krtam tad akualam na punar upacitam : Ou bien il faut entendre L'acte abuddhic'est--dire l'acte qu'on lait sans dcider Je ferai cela , n'est pas prva,

accumul, car cet acte est non-dfini. L'acte

sion, n'est


en hte,


prcd d'une dci-

pas accumul, par exemple


mensonge profr par habitude verbale

dans l'entrainement du discours. Cet acte, mauvais, est fait, mais n'est pas accumul . C'est par bhsyksepa que l'auteur d'un trait rpte, dans une num-


xviii, fol.

14 b-15




raison de la





Quelques-uns vont

dans une mauvaise destine par un mfait (duscarita)

par deux


quelques-uns par trois (mfait corporel, vocal, mental)


quelques-uns par un chemin-de-l'acte, par deux, par trois

par dix.

Etant donn qu'un


doit aller

dans une mauvaise destine par

une certaine quotit

est fait,

d'actions, si cette


n'est pas remplie, l'acte


non pas accumul


elle est remplie,




raison de l'absence de regret (kaukrtya) et de contrecarrant



28j, lorsque

manque le remords (vipratisra, anutmanque le contrecarrant, confession, etc. ^

mots qui ne sont pas
justifis telle place. (Voir

ration strotype, des




La Vykhy, exposant les caractres de l'acte bon qui est accumul, dit evam kusalam api yojyam iti kathatn samcetancitah / samcintya krtam biiavati j nhuddhiprcakrtam bhavati tadyath vyakrtacitteiia psnam dadmlti suvarnapindam dadyt krtam tan na punar upacitam / avykrtam yath hhsyksept satyavacanam / hi tat karma / na sahas krtam krtam tat kusalam na punar iipacttam. 1. kas cid ekena duscaritena durgatim yti kacid yvat tribhih / kacid ekena karmapatliena kas cid yvad dasabltih tatra yo yvat gacchati tasminn asampte krtam karma nopacitam j sampte tpacitam. Comj / j /

parer Anguttara,

i. 249 ci-dessus note ad iv. pratidesandipratipaksbJmvataJi.



y a

ppassa kammassa samatikkamo,


passage au del du pch




l'abstention (virati

= prise de

la discipline),


mditation de bienveillance

(maitrl), Samyutta,


Prtimoksa (Finot,


As. 1913,



s'tant dcouvert,

sera tranquille
n. 2, et


Qui se rappelle une faute doit se dcou viskrtvsya phsam bhavati

(voir ci-dessus iv. 39, p. 98,





iv. p.

163, n. 4).

Ptimokkha, dans Vinaya Texts, i. 2 et Culla, ix. 1. 4 (Vinaya Texts, iii. 305, note 1) Confession dans le Grand Vhicule, Bodhisattvabhmi, I, x. Divya, passim Reconnais ton pch (atyayam atyayato deaya) ; cette

(apy evaitat karma taniitvam pariksayani parydnam gaccheta) [Majjhima, iii. 247 yato ... accayam accayato disv yathdhammam putikarosi tan te rnayam patiganhma ; Dgha,
action sera rduite, dtruite, anantie





238, Burnouf, Introduction, p. 299






reconnaissant son pch (avoir insult un Arhat dont

ignorait la qua-


vaiyvrtyakra de Divya,

54-55, vite l'enfer,

mais cependant renat






Sikssamuccaya, 160




98 citent



raison de l'escorte.









a une

mauvaise escorte (akualam akusalaparivram ca)

rjouit de Tavoir

lorsqu'on se



raison de la rtribution.

Est accumul l'acte qui donne

(iv. 50).

ncessairement rtribution (vipkadne nlyatam)

De mme pour

l'acte bon.

L'acte qui ne prsente pas ces caractres est




Nous avons vu








un Caitya par un

homme non

dtach du dsir est un don avantageux pour celui qui

la chose

Mais personne ne jouit de





peut-il tre mritoire

Le mrite du don
don (tygnvaya),

est de

(punya) ? [15 b] deux sortes


mrite produit par l'abanfait

mrite qui rsulte du seul


mrite produit par la jouissance (parihliognvaya)


mrite qui

rsulte de la jouissance, par la personne qui reoit, de l'objet donn.



Le mrite du don au Caitya

est mrite produit

par l'aban-

les quatre


par lesquels


Bodhisattva triomphe du pch

fait et





pratypattibala (prise de la Bouddha, etc.) Doctrines analogues, Subhasitasamgraha, 1900) ad fineni. Theragatha 872 Dhammapada 173: ppam katam

pratipaksasamiidcra (pratique du discipline ou virati), ruyahala (refuge en


Bendall (Muson,






plants dans

tathgataprasda peut le Bouddha (lire avec





la foi

les mauvais dharmas que Mara a MS. buddhvaropitnm akualntn (raddh), la dvotion (bhakti) de Mara

l'gard du Bouddha lave toutes ses perfidies (vrjina), Divya, 359, Przyluski,

Lgende d'Aoka,


Voir ci-dessus


15 et 20.

mchod punyam.]

rten la btan rgyus byuii bahi

bsod nams

= [caitye



a vu





Le mrite des dons


Bouddha a accept d'avance les dons laits aux au Bouddha et au Samgha est contest par

sectes, voir ci>dessus p. 237, n. 3.


le culte

du Bouddha dfunt, Milinda,

p. 100-101, Bodhicar>'fivatara, ix. 36.


xviii, fol.

15 a-16


reoit ?




peut-il produire mrite

quand personne ne

cette objection,

nous rpondrons en demandant pourquoi



produirait mrite

quand quelqu'un

ne produirait

pas mrite quand personne ne

satisfait, favoris

Parce que, dans ce second cas, personne n'est


don (kasya cid anugrahdbhvt).

la satisfaction



de la personne qui reoit est la condition du

mrite, niez donc que les mditations incommensurables (mditation

de bienveillance,



29) et la mditation de la vue droite


(samyagdrstibhvan) soient mritoires

donc mrite,

Le don au Caitya produit



Bien que personne ne reoive,



c'est le cas



bienveillance, etc.

la force

la mditation de bienveillance,

personne ne



n'est satisfait, et

cependant un mrite


le bienveillant,


de sa pense de bienveillance.

De mme, bien que


l'Etre excellent ait pass



don au Caitya

par dvo-

tion son gard (tadbhaktikrta)


en raison de la





(svacittd eva

la dvotion qui produit

Faut-il en conclure que les actes matriels d'offrande et de culte

(dnamcmakriy) sont
ces actes l'emporte

superflus ?

Non, car

beaucoup sur

la dvotion de

l'homme qui adore

qui a l'intention

donne en

esprit seulement.



de tuer son ennemi continue sur son ennemi mort [16 a] les actes
corporels et vocaux que provoque cette intention, pensant


mon ennemi



Cet ennemi n'est pas encore




un dmrite bien plus grand

est enseigne devient
le culte




Le lieu o la Prajnpramit (caityabmtah krtah), parce que

tion de mrite

semblable un Caitya



rend est cause de l'accumula-

(vandandinCt ptmyopacayaheUitvat) (Abhisamayalamkrloka

p. 57).

ad Astashasrik,


M pratigrahitari yuktam tygnvayam punyam


tatra hiprtya-

nugrahena grahtd yujyata iti % maitrydivad agrhnati

rinlention seule



121 c-123



bien que le Matre ait pass, l'homme

qui fait les actes de don et de culte inspirs par la dvotion, obtient

un mrite bien plus grand

Si la


ne ferait par la dvotion seule.

fruit agrable,

semence donne un bon champ porte un


penser que, donne un mauvais champ,

donne un


pnible ?



Mme sem

dans un mauvais champ,


don porte des

fruits agrables, car

n'y a jamais opposition entre le fruit et la


la graine

de la vigne (mrdvik)


nat seulement le

doux (ma-


de la vigne

de la graine du


(Azadirachta Indica)

nat seulement le fruit

mauvais champ,


amer (tikta) du nimba mme seme dans un graine porte le fruit qui lui convient. De mme,

semence qu'est

don d'une personne qui a

l'intention d'tre

autrui, ft-elle place

dans un mauvais champ, ne peut pro-

duire qu'un fruit agrable. Mais, par le vice du champ, le fruit sera



Nous avons

expliqu, avec les questions connexes, l'uvre mri-

toire qui consiste


en don

(dnamaya punyakriyvastu).

[16 b]

faut expliquer maintenant le

qui consiste en


yath hi atrum hanmti krtbhipryasya tatsamutthitam kyavk'pi kurvato baliutaram apunyam atrusamjnay doit s'entendre atrur ayant na tvan mriyata ity anay

karma atrusatnjnay tasmin mrte



samjnay (Vyakhya).

kuksetre 'pstaphalatphalahljviparyayt


don fait des voleurs, etc., porte de mauvais fruits. Mais nous n'admettons pas que la qualit du champ rende le fruit agrable (ista) : elle fait que le fruit est important, minent dans son genre (visistaj
Les Nirgranthas pensent que







conseille Upali de continuer

ses gnrosits aux Nirgranthas


celui-ci se

garde de planter ses dons dans


un mauvais champ.

D'aprs Milinda, 258 (qui cite Majjhima,


257), le reli-

(suvipanna) et de mauvaises murs (dusslla) purifie le don car on peut se laver dans de l'eau sale. 3. mrdvlk, attest par la Vyakhya Hiuan-tsang m-tu-kia ; rgun. Paramarlhu p'oj* (jonc)-rAo (pche) raisin.
parfaitement tomb

(samana) mme



xviii, fol.

16 a-b.



a-b. L'immoralit, c'est le


mauvais rpa. La moralit,

renoncement l'immoralit.

On donne



d'immoralit (daiihslya) an mauvais rttpa. Le

est la moralit, est

renoncement l'immoralit, qui



De deux


Le renoncement (virati)

est vijnapti, l'acte

par lequel on renonce,


le fait

de s'abstenir. (Ci-dessus pp. 14, 18, 48).

La moralit

n'est pas



renoncement l'immoralit.



C'est en outre le

renoncement ce qui

dfendu par



Renoncer ce


sans tre en soi immoralit, est dfendu par

Bouddha Bhagavat, par exemple renoncer au repas hors du temps,

c'est aussi moralit.

Ce renoncement

est aussi vijnapti et avijnapti.

Celui qui s'est engag observer les rgles (siks) et qui les viole,

commet immoralit. La moralit que nous venons de

dcrire en





Pure, quand elle est munie de quatre qualits.

qualits est pure

La moralit munie de quatre


elle est


cas contraire.



trouble par l'immoraht, parles causes de l'immoles adversaires

s'appuyant sur

de l'immoralit et sur la





trouble par l'immoralit telle que nous l'avons dcrite


trouble par les causes de l'inmioralit, c'est--dire par les klesas

hchal bahi thsul khrims mi dgehi gzugs


de spon thsul khrims


lyam asiibham rpam sllam



Le mauvais rpa

= [dauhs-

actes du corps

de la voix.

rnam gnis


= [dvidhd

j ]


sans rgyas kyis ni bcad pa yan

rnam dag yon tan bzhi Idan no [parisiiddham caturgunam // 5. hchal khrims dehi rgyus hphan ma byun / dehi gnen po dan zhi [dauhslyataddhetvaksiptam tadvipaksasamr ayant j ]

= [buddJiena pratisiddhc ca] =








[17 a] et upaklesas (v. 41)


s'appuyant sur les adversaires de l'immo(vi.

parce qu'elle s'appuie sur les quatre smrtyupasthnas



s'appuyant sur la



non pas sur des naissances

clestes, parce

qu'elle est applique

au Nirvana.

D'aprs une autre opinion, cinq causes font que la moralit est



puret des chemins-de-l'acte proprement dits (maulakar-

mapatha) [renoncement aux mauvais chemins], 2. puret de leurs annexes (smantaka) [renoncement au prparatif ou moyens du
etc.], 3.

absence de trouble par



vitarkas (vitarknupa4. surveillance

ghta) [kma^ vypda


par la

mmoire (smrtyanuparigrhltatva) [buddha, dharma, ^amghnusinrti


qui comporte le renoncement aux actes non-dfinis],

5. application

au Nirvana (nirvnaparinmitatva)


D'aprs une autre opinion, la moralit est de quatre espces


moralit de crainte, celle qu'on observe par crainte du

manque des

ressources ncessaires la vie, par crainte de la mauvaise rputation,

par crainte du chtiment, par crainte des mauvaises destines


moralit mercantile (amssila), celle qu'on observe par attache;

ment des existences agrables, aux jouissances, aux honneurs


moralit propice (amikla)

aux membres de




qu'observent, en vue de la dlivrance, les


qui possdent la

vue droite (samyagdrsti)


moralit pure (pariuddha), celle qui,

tant exempte de taches (nirmala), est libre des vices (ansrava).

Nous avons

expliqu la moralit.

c'est la






ou bon de Tordre du recueillement,


hhvan, mditation, imbibition, imprgnation [17


Les quivalents sanscrits sont fournis par


Vykhyri dcrivant

les cent

mrites qui produisent les marques (ci-dessus

cite par Tditeur japonais.


l'inierprtation (que


placions entre parenthses) d'aprs Nanjio 1287, le trait de Dharniairaia, 8,

prayofjapariuddhi, maulapariuddhi, prsthaparisuddhi, vitarknupaghata, smrtyanuparigrhitatva. 2. ajivikabhaya, aslokabhaya, dandabhaya, durgatibhaya. Les numrations de bhayas sont nombreuses en combinant Angultara, ii. 121 et iv. 364 (Dharmasangraha, 71), on peut reconstituer notre texte. 3. satnhitafn tu kiialatft [bhvand]
177, 9







samdhisvabhavaaahabhu yat



xviii, fol.

17 a-b.




entendre par smnhita, recueilli ?


Ce qui est recueille


lement (samddhi,




de sa nature, ce qui coexiste avec ce

qui est recueillement de sa nature.

reoit-il le







hhvan ?
parfume, imprgne la pense.





Le bon de
se, parce


du recueillement imprgne extrmement la penprend




qualits de ce





des grains de ssame sont imprgns par des fleurs en prenant l'odeur
des fleurs

dit (iv.

Nous avons




le fruit

du don consiste en jouissanpar la moralit et par la

(mahbhoga). Quel

fruit obtient-on

mditation ?


a-b. Essentiellement, la moralit

a pour rsultat

le ciel


mditation a pour rsultat la disconnexion.

Le don aussi a pour

rsultat le ciel,


la moralit

en est la

cause normale, principale. La disconnexion ou Nirvana



278) a pour cause la mditation, laquelle, dans



chemin d'aban-

don (prahnamrga,
nexion d'avec



produit immdiatement la disconla moralit



y contribue, puisque
la moralit.


calme (amatha)

et la vision

(vipasyan) supposent

mcl idam bhvanety ucyate cittavsant I ] tad ht samhitam kusalam atyartham cittam vsayati gunais tanmaykarant samtateh puspais
/ j

tilavsanvat Par bon recueilli

* *



faut entendre le


mental (caitta)



lement et les cinq skandhas qui coexistent avec ce caitta.


Nous disons

parce que la pense bonne, mais non associe au caitta



recueillement, n'est pas

pense imprgne

la srie

hhvan, imprgnation, mditation sans doute cette mentale, mais non pas au mme degr que le recueille',

Nous disons


parce que


recueillement des

associ dlectation


(svdan) (viii. 6) ne constitue pas BJivan quivaut vsan.

dhynas souills, punyakriyvastu



bsgos phyir ro

= [cittavsant]




prdhnyd visamyogya hhvan

rites funraires

Suppler samvartate, samhhavati. Voir Samyutta, iv. 312, l'inefficacit des



271, la

destine de l'assassin qui donne des aumnes.






Le Sntra
que \

que quatre personnes produisent





brhma punya

Quel est ce mrite ?


D'aprs les Vaibhasikas (Vibliasa, 82,


mrite qui a t dfini

ci-dessus pour faire connatre la

mesure de

l'acte qui

a pour

fruit les

marques du Bodhisattva
Les anciens matres






Quatre possdent
les cieux


mrite brahmique, parce qu'ils sont


heureux dans

pendant un kalpa.

Ekottara, 21, 5; Vibhfisa, 82,


- catvrah pudgal brhmam punyatn


tathagatasya sarrani stvpam ayant prathamah piidgalo hrhmam punyam prasavati / cturdise bhiksusamghe rmatn nirytayati / ayam dvitiyah .... j hhinnam fathagata[sya] rvaJcasamgham pratisamdadhti I ayant trllyah .... maitrlsahagatena cittenvairena asapatnena (MS. sanipannena) avybddhena vipulena ntaliadgatenprantnena subhvitenaikfn disant adhimucya spharitvopasampadya viharati .... ayam caturthah. [Voir Mabvyiitpatti, 69, ditions de Wogihara et de Sasaki, et Dasabhmaka cit dans Madhyamakfivaapratisthite prthivipradese



55, 391, trad. Miison, 1907, p.



quelques variantes.]

samgliam santaggam katv kim brahntam nanda puniiam pasavatlti kim pana bhante brahmam punnan ti / kappam nanda saggamhi modatiti. Suivent les six padas d'Itivuttaka, 19 sukh sangliassa smagg sangham samaggam katvna kappam saggamhi modati.


bhinnam pana


so pasavatiti


2. 3.

Saipghabhadra attribue cette opinion d'autres matres.

D'aprs une glose de l'diteur japonais, les Sautrntikas ou les





y a d'autres matres qui disent

bzbi yi tbsaiis pabi bsod


[brhmam punyatn catuskasya] kalpam svargesu [modant

dgab bahi pbyir

par nitho



Le Bbasya

// ]


dgah gnas



svargesu, est attest parla Vjkhy.

502, le don l'Arhat produit la naissance chez Brabma. Paramartha correspond, dans l'ensemble, au tibtain. Il traduit 124 c-d Quatre actions sont nommes mrite brahmique, parce que, pour un kalpa, elles produisent le bonheur du ciel . Il numre les quatre actions. Iliuan-tsang bouleverse le texte de Vasubandhu. Aprs avoir numr les quatre actions dont parle le Sotra, il poursuit Quelle est la mesure de ce mrite ? La karika (124 c-d) dit Produire pour un kalpa naissance dans le ciel, etc., c'est la mesure d'un mrite brahmique . Le Bbasya dit Les anciens matres disent Le mrite qui fait qu'on demeure au ciel un kalpa Dans une autre cole, il y a cette gtha L'homme de foi, de vue droite, qui cultive les dix excellentes pratiques (caritaj, qui engendre le mrite brahmi: :

Dans Suttanipata,


xviii, fol.

17 b-18


le ciel

Le mrite de
un kalpa,
est d'un


mesure qu'on


heureux dans


c'est le

mrite brahmique, car la vie des Brahmapurohitas




Et dans un autre Canon, on







mrite brahmique,


heureux dans

les cieux


un kalpa.

Nous avons

tudi le don matriel

les cieux


[18 b]
Les Vaibhsikas


demeure heureux dans


pendant un kalpa

disent que la mesure de ce mrite est celle indique pour l'acte qui mrit en marques.

La krik porte





pour indiquer

la varit des opinions.

L Vykhy Ce mrite est nomm hrhma, brahmique, mrite des Brahms (braJimanm) par le mot Brahm, il

parce que c'est


faut entendre, dans

Brahmapurohita, puisque les Brahmapurohitas vivent un kalpa ; un autre Canon, on lit ces deux pdas brhmam ptmyant prasavati kalpam svargesi moclate. Ce mrite est donc appel brahmique parce que, [pour la dure], il est semblable (sadharnia) celui des Purohitas. Dans Majjhima, ii. 207, la nielt est le brahmnam sahavyatya maggo. Comment faut-il entendre la rtribution, d'une dure d'un kalpa, du mrite brahmique ? C'est ce qu'explique Samghabhadra (xxiii. 5, 20 a). L'homme dtach du Kma (vtarga, virakta) qui pratique les quatre Incommensurables renat parmi les dieux de la sphre suprieure et prend un bonheur qui dure une vie d'un kalpa. L'homme non dtach du Kma qui tablit un Stiipa qui construit un rma ; qui rtablit la concorde dans le Sarngha qui, plusieurs
cette expression,

puisque, dans

reprises, cultive le prparatif de la bienveillance et des autres



nous disons

le prparatif,

car pour pratiquer les Incommensurables eux-mmes,

faut entrer dans le clhydna, ce qui suppose dtachement







du Kma , proprement


(ntaula), produit un bonheur cleste (svrgika) d'un kalpa

(kalpapramna j.

Mais n'a-t-on pas dit ci-dessus qiie, dans le Kamadhtu, il n'y a pas de rtribution d'un acte bon qui dure un kalpa ? Il n'y a pas un acte bon, ne durant

qu'un instant, qui puisse,


c'est le cas

pour certain acte mauvais, produire

ainsi. Mais quand beaucoup de volitions portant sur un mme objet (construction d'un Stpa, etc.), elles donnent en succession un fruit cleste qui dure un kalpa : on meurt dans le ciel pour y reprendre aussitt naissance. Il n'y a donc pas contradiction parler d'un bonheur durant un kalpa. La Vykhy rsume cette doctrine sans nommer Samghabhadra et termine brhat piinyani brhmam ity apare.


vie d'un



pourquoi nous nous sommes exprims

se produisent




i. 91 Itivuttaka, 98 et 100 dvemni bhikkhave dnni mica dhammadnam ca. Dharmasamgraha, 105, ajoute le ntaitrlSpence Hardy, Eastern Monachism, 196. Diglia, iii. 191, misnup; :







Le don de Dharma,





du Sotra,

Le don de Dharma,
souille, le



tels qu'ils sont,

avec une pense


et les autres

quent, ceux qui exposent le

membres de l'Ecriture. Par consDharma soit faussement, soit avec une

pense souille, par dsir de gain (Idhha), de respects (satkra), de

rputation (klrti) ^

dtruisent le grand mrite qui leur chait.

Nous avons

expliqu les trois espces de bon d'aprs la distinction

des trois punyakriyvastus.





Le bon

est triple, de mrite, de



de pntra-

Le bon de mrite ou

favorable au mrite



est le

bon qui comporte une rtribution agrable.

Le bon de dlivrance (moksabhglya)



est le

qui, ds qu'il

chos sbyin non nions can min pas


sogs yan dag ji bzhin ston


madnam] strdiu^n [samyag]aklistadesan

aklistacittasamutthpitd desana. (Vykhy)


= [dhar=

Comparer nirmisadharmadesaka,
bsod nanis mya nan hdas pa dan

Malifivyuipatti, 30,


ns hbyed cha mthun dge rnam gsum =:

puHya[nirvna]nirvcdhabhyyam [kusalam tridh] Il 4. Dans Mabvastu, i. 34, punyabhgya sattva un tre susceptible d'acqurir du mrite de mme phalabhgiya un tre susceptible d'acqurir les


(Comparer Nettippakarana, 48)

punyahhgiya kuala punyabhgya hitam. Ou bien punyam bhajata iti punyabhk punyahhg cva punyabhglyam / svrthe kapra/



On peut entendre moksabhga comme s'opposant samsrabhga ou moksabhga = fnoksaprpti ; donc ntoksabhgya moksaprptyanu;




ntoksabhgya, Kosa,



c-d, vi. 24, vii.


Divya, 50,







a pour


Nirvana), 303, 28

moksabija, Karunpun-

darlka, 78,




quelle poque sont plantes les racines

rpo<{ue o apparaissent des






ntoksabhgya ? que le Dharma du

Rouddha existe pour qu'on puisse planter ces racines. D'aprs d'autres matres, mme quand le Dharma du Bouddha manque, si on rencontre un Pratyeka, on
peut les planter.

Quel corps


avoir pour planter ces racines ?



nat, devient

xviii, fol.

18 b-19



un dharma de Parinirvna \ Quiconque, entendant

les dfauts

sermons sur

du Sanisra, sur


non-moi, sur

les qualits

du Nirvana, [19

a] hrisse ses poils et verse des



on reconnat

possde la racine de bien moksabhglya



la pluie, on voit pousser une plante, on sait qu'il y a une graine




Le bon de




est quadruple,



sera expliqu plus loin


Quelle est la nature de ce qu'on appelle dans




d'homme ou de femme.
racines ?

En quelle

occasion ou par quelle cause plante-t-on ces



raison du don, en raison de la moralit, en raison de l'audition



cause n'est pas ncessitante.

Pourquoi ?


raison de la varit des



y a des


en donnant une bouche ou un

cure-dents, plantent ces racines, par exemple Candra, etc. Ces

hommes, aprs

avoir donn, disent

Je souhaite (pranidhi) qu'en raison de cela j'obtienne la

dlivrance . Il y a des hommes qui, quoique donnant sans rserve (o tchj un grand Samgha (comparer Takakusu, I-tsing, p. 40), ne plantent pas ces raciceux-ci, aprs avoir donn, nes, comme O-pao-ng (Acanda, Araudra ?), etc. souhaitent richesse^ etc., dans une vie venir, non pas la dlivrance. De mme certains hommes aprs avoir pris l'Upavsa pour un jour et nuit, aprs avoir d'autres qui prennent le rcit une stance de quatre vers, plantent ces racines Prtimoksa pour toute la vie, qui rcitent le Tripitaka, ne les plantent pas. Tout dpend de la vivacit de l'inclination pour le Nirvana et du dgot l'endroit de
; ;


gan skyes na yons su mya nan hda bahi chos su hgyur ba ste / gan la la fies .... thos nas spu zin zhes byed pa dan / mchi hkhrug ces byed pa Hiuan-tsang Le bon moksabhdgya est le bon qui certainement de la ni produit comme fruit le Nirvana. La personne en qui il est n est dite avoir en soi un dharma de Nirvana. 2. La mme ide dans le Grand Vhicule, par exemple Madhyamakvatra, vi. 4-5: prtliagjanatve 'pi nisamya nyatm .... tanfiruhotphullatann ca jyate / yat tasya sambuddhadhiyo 'sti bljam. 3. Le khalahila {gyn\ gyi gseb) est le trou creus pour y dposer la graine. Le Jchala est l'aire battre le grain Anarakosa, 3. 3. 42. Paramrtha ti k'n

khor bahi


= terre-trou-fissure.

251 (cha iiihhedhahhgiyasann), 277 (nibbedhabhgiyo sa-

viii. 17). Dans le mme sens nibbedhika frquent dans Visuddhimagga, 88 nibbedhabhgini panfi, 15 nibbedhabhdNettippakarana, passim. Dans le Divya sont distingus les giyam sllam. quatre nirvedhabhgyas (Comparer 50. 8 et 166. 15)

mdhi, comp. Kosa,






gravure (mudr), calcul oral (gananj, posie (kvya), calcul

acte industrieux, du corps, de la voix ou de la pense,


126. Un
avec ce qui


origine, tels sont l'criture, la gravure, le calcul


oral, la posie, le calcul




(yogapravartita), c'est--dire du une certaine

technique (upyavisesapi'a vartitaj


acte triple


c'est--dire acte corporel, acte vocal, acte mental.

L'criture et la gravure sont

un acte corporel, industrieux, avec ce

qui donne origine cet acte, savoir le faisceau de la pense et des



calcul oral et la posie sont

un acte vocal.

Par consquent,

criture, gravure, calcul oral, posie, sont de leur

nature cinq skandhas.

Le calcul

est acte

mental [19 b]


s'agit de la

numration (sam-

kalana) mentale (manas) des dharmas.

Maintenant nous expliquerons quelques synonymes




bcug pahi

souills sont

svadya, nivrta, hna.



rigs pas rab tu

brgya dai bgran bcas pahi


/ rnam gsiim kun sloii bcas pa nag grans te go rims bzhin. \trividham] sasnmitUhnatn [karma] ijogapravartitam j


yig hbru


mudr [sajgananam kvyam samkhy [yathkramam]



Dans le Sstra on entend par criture non pas l'criture au sens mondain ( aksaracihnam pustakdau), mais l'acte par lequel l'criture est crite. De mme, par ntudr, on n'entend pas un sceau portant un signe, lettre ou autre signe (aksarnaksaracihnaj, mais l'acte par lequel le sceau est creus (khanyate). (V^yakhyfl). La Vibhasa (126. 16) donne un exemple de calcul.


Mahavyutpatti, 217





de Schiefner)
(3, 18,





mudr (= lag-rtsis, chebii-soan = hastagasamkhy (chou-mou) ganan (chou2G, 12, etc.) lipi samkhy ganan mudr ud:

dhra nysa niksepa,


puis les huil parlkss.




lekh lipi



ganan mudr dhran du Brahmajla mudd ganan samkhna kveyya



est explique

par Buddhagliosa, Rhys Davids (Dialogues



22), 0.

Franke (Dgha


Sur kveyya, voir aussi Mrs Rhys Davids, Theragfitha,

klist [dhartnh]


svady nicft hinh


xviii, fol.

19 a-b.

est associ

Synonymes de

souill (klista)

svadya, ce qui

Vavadya, au mauvais

nivrtay ce qui est couvert par les passions


passions elles-mmes sont couvertes par d'autres pasignoble^ parce que bas (nihkrstaj ou abandonn par






dharmas bons


immaculs sont pranta.

iibJia, c'est--dire

pranlta, excellent, est

synonyme de


bon, et d'amala, immacul, c'est--dire ansrava.



qui ne sont ni ignobles, ni excellents, sont donc


mdians (madhya).




dharmas bons


conditionns sont sevya.


sevya, cultiver (sevitavya, paryupsitavya, introduire dans

la srie mentale,



synonyme de bon


tionn (kiisala samskrta).


s'en suit


les autres

dharmas, d'une

part les inconditionns,

d'autre part les conditionns qui sont souills ou non-souills-non-

dfmis (anivrtvykrta), ne sont pas cultiver.


effet, l'incondi-

tionn n'est pas susceptible d'tre produit, cultiv


= paunahpimyena kartum aakya ou anntpddya)

n'a pas de fruit

or, c'est

en vue du


qu'on cultive.


les autres


sont infrieurs



dlivrance est sans suprieur.

n'y a rien qui l'emporte sur le Nirvana.

Le Nirvana, tant


nel, tant bon, l'emporte sur tout.

tibkmalh j pranlth Comparer Vibhafiga, hlna majjhima panlta, p. 17 et passiin. 3. samskrtasibhh sevyh 4. Un autre quivalent est bhvayitavya kusalasamskrtadharm hhvayitavy iti nyyaJi.



Prakarana, 33 b 4

Quels sont


dharmas sa-uttara

? Les


conditionns, l'espace,



terminologie dans

l'Abliidlianima, Vibhaiiga, p. 19 et passim.










y.^ic3 DI7T. FEB 1


BL 1^16 V374

Vasubandhu L' abhidharmakosa

1923 V.3