Você está na página 1de 200

Universidade Federal de Viosa

Campus de Rio Paranaba


CBI 250- Bioqumica Fundamental
Segundo perodo 2011













CBI 250- Bioqumica Fundamental

Primeira Prova



Professora Fabrcia Queiroz Mendes


CARBOIDRATOS
Estrutura, funo e propriedades
- Molculas biolgicas mais abundantes;
- Contm carbono, hidrognio e oxignio combinados de acordo com a frmula (CH
2
O)
n
, em
que n 3;
- So compostos aldedos ou cetnicos com mltiplas hidroxilas.


Funes:
Principal fonte de energia;
Reservas energticas: amido e glicognio;
Constituinte dos cidos nuclicos: ribose e desoxirribose;
Constituinte do ATP (moeda energtica);
Constituinte de coenzimas;
Elementos estruturais nas paredes celulares de bactrias e plantas e no exoesqueleto
de insetos;
Reconhecimento (celular, organelas).

Classificao quanto ao tamanho da cadeia:
Monossacardeos
Dissacardeos
Oligossacardeos
Polissacardeos

Monossacardeos
- Acares simples: so sintetizados de precursores menores, originalmente derivados de CO
2

e H
2
O pela fotossntese.
- Aldedos ou cetonas derivados de poliidroxilcoois de cadeia linear contendo pelo menos trs
tomos de carbono.

Classificao:
Pela natureza qumica: aldose ou cetose;
Pelo nmero de carbonos: trioses, tetroses, pentoses, hexoses, heptoses, etc.
Isomeria
Gliceraldedo: um carbono assimtrico, portanto dois estereoismeros:




- Para monossacardeos com mais de um tomo de carbono assimtrico, os smbolos D e L
referem-se composio absoluta do carbono assimtrico mais
aldedo ou cetona:








Epmeros
- Os acares que se diferem apenas pela configurao de um carbono so denominados
epmeros: D-glicose e D-manose so epmeros no carbono 2, D
epmeros no carbono 4





























Para monossacardeos com mais de um tomo de carbono assimtrico, os smbolos D e L
se composio absoluta do carbono assimtrico mais distante do grupamento
Os acares que se diferem apenas pela configurao de um carbono so denominados
manose so epmeros no carbono 2, D-glicose e D
Para monossacardeos com mais de um tomo de carbono assimtrico, os smbolos D e L
distante do grupamento
Os acares que se diferem apenas pela configurao de um carbono so denominados
glicose e D-galactose so
Aldedo lcool
Cetona lcool

Ciclizao

- lcoois reagem com grupos carbonila para formar hemiacetais ou hemicetais:












- Da mesma forma, a hidroxila e aldedo ou cetona dos monossacardeos podem reagir
intramolecularmente






Hemiacet
al
Acetal
Hemiceta
l
Cetal
lcoois reagem com grupos carbonila para formar hemiacetais ou hemicetais:
a hidroxila e aldedo ou cetona dos monossacardeos podem reagir
CICLIZAO

lcoois reagem com grupos carbonila para formar hemiacetais ou hemicetais:
a hidroxila e aldedo ou cetona dos monossacardeos podem reagir


























- Anmeros: quando um monossacardeo se cicliza, o carbono da carbonila, denominado
anomrico, se torna um centro quiral com duas configuraes possveis: anmero
anmero .









Ciclizar os monossacardeos: D

- Mutarrotao: converso dos anmeros
solues aquosas.
- Em equilbrio, a D-glicose uma mistura do anmero
geral, a forma linear est presente em quantidades mnimas.

quando um monossacardeo se cicliza, o carbono da carbonila, denominado
, se torna um centro quiral com duas configuraes possveis: anmero
Ciclizar os monossacardeos: D-Manose e D-Galactose
Mutarrotao: converso dos anmeros e . Os anmeros se convertem livremente em
glicose uma mistura do anmero (36,4%) e do anmero
geral, a forma linear est presente em quantidades mnimas.
quando um monossacardeo se cicliza, o carbono da carbonila, denominado
, se torna um centro quiral com duas configuraes possveis: anmero e
meros se convertem livremente em
mero (63,6%). Em
- O anel da piranose tende a assumir uma conformao de cadeira, na qual os constituintes de
cada tomo esto organizados tetraedricamente.


Pentoses de importncia fisiolgica
Hexoses de importncia fisiolgica



Acares redutores

Monossacardeos podem ser oxidados por agentes oxidantes suaves (Fe
ons ferrco ou cprico


Acares redutores


O anel da piranose tende a assumir uma conformao de cadeira, na qual os constituintes de
esto organizados tetraedricamente.
Pentoses de importncia fisiolgica
Hexoses de importncia fisiolgica
Monossacardeos podem ser oxidados por agentes oxidantes suaves (Fe
3+
,Cu
Acares redutores
O anel da piranose tende a assumir uma conformao de cadeira, na qual os constituintes de


,Cu
2+
), reduzindo os

















Derivados das hexoses
- Glicosamina, galactosamina e manosamina: a hidroxila do carbono 2 substituda por um
grupo amino. O grupo amino quase sempre est condensado com o grupo acetil
acetilglicosamina. Este monossacardio parte de muitos polmeros estruturais, como a
quitina, presente nos exoesqueletos de insetos








- Desoxiaccares: substituio do grupo hidroxila por um hidrognio.
grupo hidroxila por um hidrognio em C
L-ramnose, respectivamente; estes desoxiacares so encontrados em polissacardios de
plantas e oligossacardios complexos componentes de glicoprotenas e glicolipdios.








- cidos cidos aldnicos e urnicos: oxidao at cido
carboxlico do aldedo (cido aldnico) ou da outra extremidade
Glicosamina, galactosamina e manosamina: a hidroxila do carbono 2 substituda por um
O grupo amino quase sempre est condensado com o grupo acetil
acetilglicosamina. Este monossacardio parte de muitos polmeros estruturais, como a
quitina, presente nos exoesqueletos de insetos
Desoxiaccares: substituio do grupo hidroxila por um hidrognio. A substituio de um
xila por um hidrognio em C-6 da L-galactose ou da L-manose produz L
ramnose, respectivamente; estes desoxiacares so encontrados em polissacardios de
plantas e oligossacardios complexos componentes de glicoprotenas e glicolipdios.
cidos aldnicos e urnicos: oxidao at cido
carboxlico do aldedo (cido aldnico) ou da outra extremidade
Glicosamina, galactosamina e manosamina: a hidroxila do carbono 2 substituda por um
O grupo amino quase sempre est condensado com o grupo acetil, formando N-
acetilglicosamina. Este monossacardio parte de muitos polmeros estruturais, como a
A substituio de um
manose produz L-fucose ou
ramnose, respectivamente; estes desoxiacares so encontrados em polissacardios de
plantas e oligossacardios complexos componentes de glicoprotenas e glicolipdios.
de cadeia carbnica carbono 6 no caso da glicose (cido
urnico)


- cido silico (N-acetilneuramnico):
derivado da N-acetilglicosamina,
componente de glicoprotenas e
glicolipdeos.




- Derivados fosforilados: intermedirios
metablicos






- Poliidroxilcoois acclicos: ribitol, xilitol






DISSACARDEOS
- Dois monossacardeos unidos por uma ligao
- Ligao glicosdica: associao de duas hidroxilas com liberao de uma molcula de gua.
















-D-Glicose
hidrlise
carbono 6 no caso da glicose (cido
acetilneuramnico):
acetilglicosamina,
componente de glicoprotenas e
Derivados fosforilados: intermedirios
Poliidroxilcoois acclicos: ribitol, xilitol
Dois monossacardeos unidos por uma ligao O-glicosdica.
Ligao glicosdica: associao de duas hidroxilas com liberao de uma molcula de gua.












-D-Glicose
hidrlise condensao
Ligao glicosdica: associao de duas hidroxilas com liberao de uma molcula de gua.
Carbono anomrico: carbono que na estrutura linear aberta do monossacardeo possui o
grupo carbonila (aldedo ou cetona)

- A oxidao do carbono anomrico de um acar por um on ferro ou cprico (acar redutor)
ocorre apenas com a forma linear que existe na soluo em equilbrio com as formas cclicas.
Quando o carbono anomrico est envolvido em uma ligao glicosdica, ele no pode assumir
a forma linear e, portanto, torna-se um acar no-redutor.

Maltose: duas unidades de D-Glicose

-D-glicopiranosil (1 4) -D-glicopiranose
Glc ( 1 4) Glc



Lactose: D-galactose e D-glicose

-D-galactopiranosil (1 4) -D-glicopiranose
Gal ( 1 4) Glc




Sacarose: D-glicose e D-frutose

-D-glicopiranosil (1 2) -D-frutofuranosdio
Glc ( 1 2 ) Fru




Trealose: duas unidades de D-Glicose

-D-glicopiranosil (1 1) -D-glicopiranose
Glc ( 1 1 ) Glc





Polissacardeos
A maioria dos carboidratos na natureza ocorre como polissacardios
Homopolissacardios: nica unidade monomrica
Heteropolissacardios: dois ou mais tipos diferentes de unidades monomricas



Amido
- Polissacardeo de reserva vegetal;







- Dois polmeros: amilose e amilopectina.
- Amilose (20 a 30 % do amido):
Cadeias longas, no ramificadas;
Unidas por ligaes (


- Amilopectina:
Ramificada: uma ramificao a
Ligaes ( 1

Glicognio
- Polissacardeo de armazenamento em clulas animais;
- Retculo endoplasmtico liso de clulas hepticas e musculares;
- Polmero ramificado: uma ramificao a cada 8 a 12 unidades
- Ligaes ( 1 4) e ( 1


Polissacardeo de reserva vegetal;
Dois polmeros: amilose e amilopectina.
(20 a 30 % do amido):
Cadeias longas, no ramificadas;
Unidas por ligaes ( 1 4)
: uma ramificao a cada 24 a 30 unidades;
1 4) e ( 1 6) nos pontos de ramificao

Polissacardeo de armazenamento em clulas animais;
Retculo endoplasmtico liso de clulas hepticas e musculares;
: uma ramificao a cada 8 a 12 unidades;
4) e ( 1 6) nos pontos de ramificao


Por que no estocar glicose na forma monomrica?
Osmolaridade;
Captao da glicose.

Dextranas
- Bactrias e fungos;
- poli D-glicose;
- Ligaes ( 1 6) e nos pontos de ramificao (
ramificaes ( 1 2)e ( 1
- Dextranas sintticas: cromatografia de excluso molecular.

Agarose (Agar)
- Algas marinhas;
- poli D-galactose;
- Ligaes ( 1 4) ou ( 1 6).
- Formam gel: uso em microbiologia, biologia molecular, entre outros

Celulose
- Fibrosa, resistente e insolvel.
- Parede celular dos vegetais.
- Homopolissacardeo de D-glicose;
- Ligaes ( 1 4), linear.














Por que no estocar glicose na forma monomrica?
Osmolaridade;
Captao da glicose.
6) e nos pontos de ramificao ( 1 3) e alguns tambm possuem
2)e ( 1 4).
cromatografia de excluso molecular.
1 6).
Formam gel: uso em microbiologia, biologia molecular, entre outros
Fibrosa, resistente e insolvel.
arede celular dos vegetais.
glicose;

e alguns tambm possuem
- A maior parte dos animais no possui -amilases: no apresentam a capacidade de hidrolisar
a celulose.
- Ruminantes utilizam celulose como alimento: bactrias no rmem que produzem -amilases.

Quitina
- Componente do exoesqueleto de artrpodes.
- Homopolissacardeo de N-acetilglicosamina;
- Ligaes ( 1 4), linear.










Heteropolissacardeos:

Peptdeo-glicano
- Paredes celulares bacterianas
- Heteropolmero de N-acetilglicosamina e cido N-acetilmurmico, unidos por ligaes
( 1 4). So intercalados por peptdeos.
Glicosaminoglicanos
- Espao extracelular nos tecidos animais
- Heteropolmero composto por unidades dissacardias: uma hexoamina (glicosamina ou
galactosamina) o outro na maioria das vezes cido hexurnico. Esto sulfatados.
- Carregado negativamente.

Principais Glicosaminoglicanos







Galactosaminoglicanos

cido hialurnico: componente do lquido sinovial das juntas, atuando como lubrificante.
Tambm o componente central da matriz extracelular da cartilagem e dos tendes,
contribuindo para a sua fora e elasticidade.


Condroitim sulfato : se localizam em stios de calcificao do osso, sendo tambm encontrados
nas cartilagens. Esto presentes no interior de determinados neurnios, podendo
proporcionar uma estrutura endoesqueltica, o que auxilia na manuteno de suas formas.


Dermatam sulfato: manuteno estrutural da matriz extracelular. Presente na crnea




Queratam sulfato: presente na crnea


Heparinides
- cido glicurnico ou idurnico + Glicosamina, que pode estar N acetilada ou N
sulfatada
- Heparam sulfato e heparina
- Heparam sulfato: lmina basal e membranas do endotlio vascular
- Heparina: interior das clulas de defesa



Proteinoglicanos
- Protena que contm uma ou mais
cadeias de glicosaminoglicanos
- Matriz extracelular
- Podem atuar como malhas,
restringindo a passagem de
macromolculas para a matriz
extracelular, mas possibilitando
difuso relativamente livre de
molculas pequenas



Alm de reserva de combustvel e materiais estruturais, poli e oligossacardeos tambm agem
como portadores de informaes:
endereamento de algumas protenas;
mediadores de interaes entre a clula e matriz extracelular

Exerccios Carboidratos
1- Conceituar carboidratos e descrever as suas funes.
2- Qual a diferena entre cetose e aldose?
3- O que um carbono assimtrico?
4- O que um carbono assimtrico?
5- Quais as duas formas cclicas que so encontradas nos monossacardeos comuns?
6- O que um cabono anomrico? Quais os ismeros formadas a partir da ciclizao dos
monossacardeos?
7- Como chamado o fenmeno de interconverso entre as formas e ?
8- Que tipo de ligao formada entre dois monossacardeos?
9- O que so acares redutores?
10- Tanto a sacarose como a lactose so dissacardeos, porm uma existe em duas formas
anomricas, enquanto outra ainda no teve sua forma anomrica descrita. Diferencia-las e
justificar a afirmativa.
11- A reao de Fheling propicia a oxidao de acares redutores por agentes oxidantes
relativamente fracos como os ons frrico (Fe
3+
) e cprico (Cu
2+
). Uma amostra de lactose e
outra de sacarose foram confundidas e deseja-se identific-las. A reao destes dissacardeos
com o reagente de Fheling, sob aquecimento em cido diludo, deu origem a um precipitado
vermelho para um dos dissacardeos. Para qual deles? Explicar com base nos princpios do
mtodo.
12- PPD a estrutura dos seguintes trissacardeos:
a) O--D-glicopiranosil (1-4) -D-galactopiranosil (1-6) -D-frutofuranose;
b) O--D-galactopiranosil (1-6) -D-manopiranosil (1-1) -D-galactopiranosdio.
Ambos so redutores? Explicar.
13- Faa a estrutura e d o nome de um trissacardeo qualquer, redutor, que contm os
seguintes monossacardeos: -D-glicopiranose, -D-frutofuranose, -D-galactopiranose,
respectivamente.
14- Nos bulbos de orqudeas e pinheiros encontrado um polissacardeo formado por
resduos de -D-manopiranose. A cadeia principal deste polmero apresenta ligaes (1-4) e
ramificaes aleatrias do tipo (1-3) e (1-6). Fazer uma possvel estrutura deste
polissacardeo.
15- Sobre os polissacardeos glicognio, amido (amilose e amilopectina), quitina e celulose,
discutir:
a) monossacardeos constituintes;
b) tipos de ligaes glicosdicas presentes;
c) funes biolgicas.
16- Sabemos que a amilose e a celulose so polissacardeos formados por unidades de D-
glicose unidas por ligaes (1-4) e podem ser intensamente hidratadas. Apesar destas
similaridades, uma pessoa em dieta consistindo predominantemente de amilose (amido)
ganhar peso, enquanto que outra, em dieta predominantemente de celulose (madeira)
passar fome. Por que?




Um grupo de compostos que, apesar de serem quimicamente diferentes entre si, exibem sua
insolubilidade em gua como caracterstica definidora e comum a todos.
No so polmeros. So molculas relativamente pequenas que tendem a se associar por
ligaes no covalentes.

Funes
Membranas celulares (fosfolipdios e
glicolipdios)
Reserva energtica (triacilgliceris)
Hormonal (esterides)
Impermebilizante (ceras)

Lipdios de armazenamento
leos e gorduras so compostos altamente reduzidos e derivados dos cidos graxos
cidos graxos so derivados dos hidrocarbonetos e seu estado d
So cidos carboxlicos de 4 a36 tomos de carbono


Classificao


Numerao dos carbonos a partir de C1 Numerao dos carbonos a partir do ltimo














Lipdios
Um grupo de compostos que, apesar de serem quimicamente diferentes entre si, exibem sua
insolubilidade em gua como caracterstica definidora e comum a todos.
No so polmeros. So molculas relativamente pequenas que tendem a se associar por
Membranas celulares (fosfolipdios e
Reserva energtica (triacilgliceris)
Anti-oxidante (Vitaminas A e E)
Isolante trmico (triacilgliceris)
Digestiva (sais biliares)
Pigmentos (Bixina)
Cofatores enzimticos, etc

leos e gorduras so compostos altamente reduzidos e derivados dos cidos graxos
cidos graxos so derivados dos hidrocarbonetos e seu estado de oxidao mnimo.
So cidos carboxlicos de 4 a36 tomos de carbono
Numerao dos carbonos a partir de C1 Numerao dos carbonos a partir do ltimo
carbono
Um grupo de compostos que, apesar de serem quimicamente diferentes entre si, exibem sua
No so polmeros. So molculas relativamente pequenas que tendem a se associar por
oxidante (Vitaminas A e E)
Isolante trmico (triacilgliceris)
Cofatores enzimticos, etc
leos e gorduras so compostos altamente reduzidos e derivados dos cidos graxos
e oxidao mnimo.

Numerao dos carbonos a partir de C1 Numerao dos carbonos a partir do ltimo
Notao Simplificada
cido palmtico: 16 carbonos, saturado

cido esterico: 18 carbonos, saturado
cido oleico: 18 carbonos, insaturao no C 9
cido oleico: 18 carbonos, insaturaes no C 9 e C 12










Nome sistemtico

















cidos graxos de ocorrncia mais frequente:
nmero par de tomos de carbono
cadeias no ramificadas
12 a 24 carbonos
Polinsaturados: duplas separadas por grupos metila
Duplas ligaes na configurao cis
cido N de Carbonos
Lurico 12
Mirstico 14
Palmtico 16
Esterico 18
Araqudico 20


Nome Comum Abreviatura
Palmtico 16:0
Esterico 18:0
Araqudico 20:0
Palmitolico 16:1(9)
Olico 18:1(9)
Linolico 18:2(9,12)
Linolnico 18:3(9,12,
Araquidnico 20:4(5,811,14)


cido palmtico: 16 carbonos, saturado
cido esterico: 18 carbonos, saturado
cido oleico: 18 carbonos, insaturao no C 9

cido oleico: 18 carbonos, insaturaes no C 9 e C 12
cidos graxos de ocorrncia mais frequente:
nmero par de tomos de carbono
cadeias no ramificadas
Polinsaturados: duplas separadas por grupos metila
Duplas ligaes na configurao cis
Frmula
CH
3
(CH
2
)
10
CO
2
H
CH
3
(CH
2
)
12
CO
2
H
CH
3
(CH
2
)
14
CO
2
H
CH
3
(CH
2
)
16
CO
2
H
CH
3
(CH
2
)
18
CO
2
H
cido N de
Carbonos
Grau de
Insaturao
Palmitolico 16 16:1(
9
)
Olico 18 18:1(
9
)
Linolico 18 18:2(
9,12
)
Linolnico 18 18:3(
9,12,15
Araquidnico 20 20:4(
5,8,11,14


Abreviatura Nome Sistemtico
Hexadecanico
Octadecanico
Eicosanico
Hexadecenico
Octadecenico
18:2(9,12) Octadecadienico
18:3(9,12,15) Octadecatrienico
20:4(5,811,14) Eicosatetraenico

Insaturao
Frmula
CH3(CH2) 5CH=CH(CH2) 7CO2H
CH3(CH2) 7CH=CH(CH2) 7CO2H

CH3(CH2) 4CH=CH(CH2)CH=CH(CH2) 7CO2H
9,12,15
)
CH3(CH2CH=CH) 3(CH2) 7CO2H
5,8,11,14
)
CH3(CH2) 4(CH=CHCH2) 4(CH) 2 CO2H

cidos graxos trans:
produzido por fermentao no rmem de animais produtores de leite e obtidos
atravs de derivados de leite e carne
produzidos durante a hidrogenao de leos vegetais
relacionados a nveis aumentados de LDL e reduzidos de HDL

Solubilidade em gua

Ponto de fuso e ebulio

Nos compostos totalmente saturados, a livre rotao ao redor de cada ligao C
grande flexibilidade cadeia hidrocarbonada. A conformao mai
estendida e, nela, a interferncia estrica entre os tomos vizinhos minimizada. Estas
molculas podem justapor-se de forma apertada em arranjos quase cristalinos, com interaes
de van der Waals ao longo de toda a cadeia. N
no forma cis provoca uma dobradura na cadeia. cidos graxos com uma ou vrias dessas
dobraduras no podem justapor

produzido por fermentao no rmem de animais produtores de leite e obtidos
atravs de derivados de leite e carne
produzidos durante a hidrogenao de leos vegetais
a nveis aumentados de LDL e reduzidos de HDL


Nos compostos totalmente saturados, a livre rotao ao redor de cada ligao C
grande flexibilidade cadeia hidrocarbonada. A conformao mais estvel aquela totalmente
estendida e, nela, a interferncia estrica entre os tomos vizinhos minimizada. Estas
se de forma apertada em arranjos quase cristalinos, com interaes
de van der Waals ao longo de toda a cadeia. Nos cidos graxos insaturados, uma ligao dupla
no forma cis provoca uma dobradura na cadeia. cidos graxos com uma ou vrias dessas
dobraduras no podem justapor-se to estreitamente quanto aqueles saturados e as
produzido por fermentao no rmem de animais produtores de leite e obtidos
Nos compostos totalmente saturados, a livre rotao ao redor de cada ligao C-C confere
s estvel aquela totalmente
estendida e, nela, a interferncia estrica entre os tomos vizinhos minimizada. Estas
se de forma apertada em arranjos quase cristalinos, com interaes
os cidos graxos insaturados, uma ligao dupla
no forma cis provoca uma dobradura na cadeia. cidos graxos com uma ou vrias dessas
se to estreitamente quanto aqueles saturados e as
interaes entre cadeias so mais fracas.
energia trmica para desorganizar estes arranjos, eles exibem temperaturas de fuso menores.

Triacilglicerois
3 molculas de cidos graxos unidas por ligao ster a uma nica molcula de glicerol
Estrutura do glicerol


Classificao dos Triacilgliceris
Triacilglicerois simples:
Formado por 3 cidos graxos iguais.
Ex: tripalmitina (3 cidos palmticos)
Triacilglicerois mistos:
Formado por 2 ou 3 cidos graxos diferentes.
Ex: 1,3-palmitoil, 2-oleil glicerol
(2 palmitato + 1 oleato)

Triacilglicerois so molculas no polares, hidrofbicas e essencialmente insolveis em gua.
Grupos polares dos cidos graxos esto envolvidos em ligaes

Armazenamento:

Na maioria das clulas
gotculas de leo depsito de combustvel
metablico
interaes entre cadeias so mais fracas. Devido a ser necessrio menor quantidade de
energia trmica para desorganizar estes arranjos, eles exibem temperaturas de fuso menores.
3 molculas de cidos graxos unidas por ligao ster a uma nica molcula de glicerol

Classificao dos Triacilgliceris
Triacilglicerois simples:
Formado por 3 cidos graxos iguais.
Ex: tripalmitina (3 cidos palmticos)
Triacilglicerois mistos:
Formado por 2 ou 3 cidos graxos diferentes.
glicerol
Triacilglicerois so molculas no polares, hidrofbicas e essencialmente insolveis em gua.
Grupos polares dos cidos graxos esto envolvidos em ligaes
Na maioria das clulas eucariticas:
gotculas de leo depsito de combustvel
Nos vertebrados: clulas especializadas
chamadas adipcitos
Devido a ser necessrio menor quantidade de
energia trmica para desorganizar estes arranjos, eles exibem temperaturas de fuso menores.
3 molculas de cidos graxos unidas por ligao ster a uma nica molcula de glicerol
Triacilglicerois so molculas no polares, hidrofbicas e essencialmente insolveis em gua.
Nos vertebrados: clulas especializadas
Armazenamento de lipdios:
Vantagens:
tomos de carbonos mais reduzidos oxidao libera mais en
so hidrofbicos no necessita de peso extra de hidratao
Alm de reserva energtica, em alguns animais os triacilglicerois servem tambm como
isolantes trmicos.
Reaes dos triacilglicerois
Rancificao
Saponificao
Hidrogenao

Ceras
So steres de cidos graxos de cadeia longa com alcois de cadeia longa.
Funes:
Reserva metablica do plancton
Repelente a gua (pssaros marinhos)
Proteo de plantas evitando perda de gua
Vrias aplicaes na indstria farmacutica

Lipdios estruturais de membrana
So anfipticos: Uma das extremidades hidrofbica e a outra hidroflica
Interaes com a gua: Organizao em bicamadas

Glicerofosfolipdios ou fosfoglicerdeos
Derivados do cido fosfatdico



2 cidos graxos esto ligados por meio por meio de uma ligao ster ao primeiro e segundo
tomos de carbono do glicerol e um grupo fortemente polar ou eletricamente carregado est
ligado ao terceiro por uma ligao fosfodister
Estrutura geral glicerofosfolipdio


tomos de carbonos mais reduzidos oxidao libera mais energia
so hidrofbicos no necessita de peso extra de hidratao
Alm de reserva energtica, em alguns animais os triacilglicerois servem tambm como
So steres de cidos graxos de cadeia longa com alcois de cadeia longa.

Reserva metablica do plancton
Repelente a gua (pssaros marinhos)
Proteo de plantas evitando perda de gua
Vrias aplicaes na indstria farmacutica
Lipdios estruturais de membrana
So anfipticos: Uma das extremidades hidrofbica e a outra hidroflica
Interaes com a gua: Organizao em bicamadas

ou fosfoglicerdeos
Derivados do cido fosfatdico
cidos graxos esto ligados por meio por meio de uma ligao ster ao primeiro e segundo
tomos de carbono do glicerol e um grupo fortemente polar ou eletricamente carregado est
ligado ao terceiro por uma ligao fosfodister
folipdio
ergia
Alm de reserva energtica, em alguns animais os triacilglicerois servem tambm como

cidos graxos esto ligados por meio por meio de uma ligao ster ao primeiro e segundo
tomos de carbono do glicerol e um grupo fortemente polar ou eletricamente carregado est












Lipdios tipo ter:

Galactolipdios:
Um ou mais resduos de galactose esto conectados por uma ligao glicosdica ao C 3 de uma
molcula de 1,2 diacilglicerol

Lipdio de membrana de arqueobactria:
Ligaes mais resistentes







Um ou mais resduos de galactose esto conectados por uma ligao glicosdica ao C 3 de uma
molcula de 1,2 diacilglicerol
Lipdio de membrana de arqueobactria:

Um ou mais resduos de galactose esto conectados por uma ligao glicosdica ao C 3 de uma

Esfingolipdios
Uma esfingosina unida a um cido graxo de cadeia longa e a um grupo cabea polar que ,em
alguns casos, unido por uma ligao glicosdica e , em outros, por uma ligao fosfodister

Fosfomielinas: contm fosfocolina e fosfomielina como cabea polar. So essencialmente
importantes na mielina

As pores carboidratos de certos esfingolipdios definem os grupos saguneos humanos


Esteris
Lipdios estruturais formado por um ncleo esteride constitudo por 4 anis fundidos entre si,
3 deles com 6 tomos de carbono e um com cinco.
O ncleo esteride quase plano e relativamente rgido

Colesterol

Alm de serem constituintes de membrana, os esteris so precursores de uma variedade de
produtos com funes biolgicas especficas, como os hormnios esterides, que atuam na
regulao da expresso gnica e sais biliares, que auxiliam na digesto de lipdios.







Os Eicosanides
Derivados do araquidonato
Compreendem as prostaglandinas, as tromboxanas e os leucotrienos.
Hormnios parcrinos: agem apenas sobre as clulas prximas

Prostaglandinas:
Regulam a sntese de cAMP
Estimulam a contrao do msculo liso do tero na menstruao e no parto
Afetam o fluxo sanguneo a tecidos especficos
Afetam o ciclo sono-viglia
Elevam a temperatura do corpo, causam inflamao e dor
Tromboxanos:
Formao de cogulos sanguneos
Reduo do fluxo de sangue ao stio do cogulo
Leucotrienos:
Induz a contrao do msculo que reveste as vias areas que levam ao pulmo
A superproduo causa ataques de asma


Isoprenides:
caroteno, vitaminas lipossolveis, ubiquinonas e plastoquinonas (transporte de eltrons),
etc.
Exerccios Lipdios
1) Conceitue lipdeos e d suas principais funes.

2) Explique resumidamente:
A. As vantagens dos triacilgliceris sobre o glicognio como reserva de energia em longo
prazo.
B. O fato de que os leos vegetais so geralmente lquidos a temperatura ambiente e as
gorduras animais tendem a ser slidas apesar de ambos serem formados essencialmente por
triacilgliceris.
C. Como a margarina, slida, produzida a partir de leo vegetal, lquido.

3) Por que os triacilgliceris no podem ser componentes significativos das bicamadas
lipdicas?



4) Classifique os lipdeos abaixo, faa o esquema geral de sua classe e d a principal
funo de cada um.
A.






B.
O
CH
2
O C CH
2
CH CH CH
2
CH
3

O
CH O C (CH
2
)
22
CH
3

O
CH
2
O C (CH
2
)
10
CH
3


C.
HO CH CH CH (CH
2
)
12
CH
3

H O
CH N C (CH
2
)
18
CH
3

O
CH
3
O P OCH
2
CH
2
N(CH
3
)
2

O
-


D
O
CH
2
O C (CH
2
)
14
CH
3

O
CH O C CH
2
CH CHCH
2
CH
3

O
CH
2
O P OCH
2
CH
2
N
+
H
3

O
-

5) Escreva as frmulas dos cidos graxos abaixo e os organize em ordem crescente de
ponto de fuso. Quais os aspectos estruturais desses cidos graxos podem ser correlacionados
com o ponto de fuso?
A) 18:3 (
9
,
12
,
15
)
B) 18:0
C) 12:0
D) 18:2(
9
,
12
)
E) 18:1(
9
)
6) Montar um triacilglicerol contendo os cidos graxos palmtico (C16:0), linolico
(C18:2
9 ,12
) e esterico (C18:0) nos carbonos 1, 2 e 3, respectivamente. Espera-se que este
triacilglicerol contribua para o estado fsico lquido ou slido de uma reserva lipdica? Justificar.

7) Alguns alimentos lipdios, como o azeite, se estragam rapidamente aps exposio
ao ar temperatura ambiente, enquanto outros, como a manteiga slida, demoram um tempo
maior para se apresentarem estragadas. Explicar a afirmativa, descrevendo
bioquimicamente o que ocorre com estes alimentos.

8) Qual a funo biolgica principal dos glicerofosfolipdios e esfingolipdios? So
anfipticos? Justificar.

9) Durante o preparo do molho barnaise, gemas de ovos so incorporadas na
manteiga fundida para estabilizar o molho e evitar a separao. O agente estabilizador
existente na gema do ovo a lecitina (fosfatidilcolina). Sugerir porque isto funciona
(LEHNINGER et al,1995).

10) Quando bactrias crescendo a 20C forem aquecidas a 30C, elas sintetizaro lipdeos
de membrana mais provavelmente com:
A. cidos graxos saturados ou insaturados? Explique.
B. cidos graxos de cadeia longa ou curta? Explique.
AMINOCIDOS E PROTENAS
Protenas
So as macromolculas mais abundantes nas clulas vivas.
Grande diversidade de funes biolgicas.
20 aminocidos ligados covalentemente em sequncias lineares caractersticas.
Tem tamanhos e formas variados.
Aminocidos
Um grupo carbonila e um grupo amino

Os aminocidos nas molculas proticas so sempre ismeros L
Classificao dos aminocidos:
Polaridade dos grupos R
Cadeias laterais apolares e alifticas
So as macromolculas mais abundantes nas clulas vivas.
Grande diversidade de funes biolgicas.
20 aminocidos ligados covalentemente em sequncias lineares caractersticas.
Tem tamanhos e formas variados.
Um grupo carbonila e um grupo amino
Os aminocidos nas molculas proticas so sempre ismeros L



Cadeias laterais apolares e alifticas

20 aminocidos ligados covalentemente em sequncias lineares caractersticas.

Cadeias laterais aromticas

Cadeias laterais polares no carregadas

Cadeias laterais carregadas negativamente

Cadeias laterais carregadas positivamente

Aminocidos no padro
Aminocidos derivados nas protenas: hidroxilisina e hidroxiprolina (colgeno), N-metillisina
(miosina), -carboxiglutamato (protrombina)

Aminocidos biologicamente ativos:
Mensageiros qumicos: glicina, GABA (c. Glutmico descarboxilado), dopamina.





Hormnios: Tiroxina

- Intermedirios em processos metablicos: ornitina, citrulina (ciclo da uria).
Aminocidos no essensiais ou dispens
glicina, prolina, serina, tirosina e cistena
Aminocidos essenciais ou indispensveis:
metionina, valina e fenilalanina e, condicion
Aminocidos podem atuar como cidos ou bases
Em gua: on dipolar ou zwitterion
Podem atuar como cido (doador de prtons)

biologicamente ativos:
Mensageiros qumicos: glicina, GABA (c. Glutmico descarboxilado), dopamina.

Intermedirios em processos metablicos: ornitina, citrulina (ciclo da uria).
Aminocidos no essensiais ou dispensveis: alanina, aspartato, glutamato, asparagina, glutamina,
glicina, prolina, serina, tirosina e cistena
Aminocidos essenciais ou indispensveis: treonina, triptofano, histidina, lisina, leucina, isoleucina,
metionina, valina e fenilalanina e, condicionalmente, arginina.
Aminocidos podem atuar como cidos ou bases
Em gua: on dipolar ou zwitterion

Podem atuar como cido (doador de prtons)
Mensageiros qumicos: glicina, GABA (c. Glutmico descarboxilado), dopamina.
alanina, aspartato, glutamato, asparagina, glutamina,
treonina, triptofano, histidina, lisina, leucina, isoleucina,
Podem atuar como base (receptor de prtons)

Titulao dos aminocidos
Titulao: adio ou remoo gradual de prtons.
pK
a
: tendncia a ceder prtons
Equao de Handelson-Hasselback: calcular a proporo entre as espcies doadoras e receptoras de
prtons
Equao de Henderson-Hasselbach

+ =

=
=
+

+
+
+
] HA [
] A [
log pK pH
A [
HA [
log K log ] H log[
] A [
] HA [
K ] H [
] HA [
] A ][ H [
K
A H HA
a
a
a
Titulao da alanina

Ponto Isoeltrico (pI): pH no qual a molcula no
apresenta carga lquida.
) pK pK (
2
1
pI
j i
+ =
Alanina
Podem atuar como base (receptor de prtons)
gradual de prtons.

Hasselback: calcular a proporo entre as espcies doadoras e receptoras de
Hasselbach

] A
] HA


(pI): pH no qual a molcula no

Hasselback: calcular a proporo entre as espcies doadoras e receptoras de
Titulao Aspartato


Titulao Lisina


PEPTDIOS
Dipeptdio: dois aminocidos unidos por uma
ligao amida substituda LIGAOPEPTDICA


Tripeptdios
Tetrapeptdios
Oligopeptdios
Polipeptdios: peso molecular menor que 10.000
Protena: pesos moleculares maiores
Curva de titulao de peptdios
Peptdios biologicamente ativos
Hormnios:
Ocitocina, fator de liberao da tirotropina, tirotropina
Insulina e glucagon
Venenos de cogumelos, como amanitina
Analisador de aminocidos
Troca ctions (carregada negativamente)
Polipeptdios: peso molecular menor que 10.000
Protena: pesos moleculares maiores
Curva de titulao de peptdios

Peptdios biologicamente ativos
Ocitocina, fator de liberao da tirotropina, tirotropina
Venenos de cogumelos, como amanitina
Troca ctions (carregada negativamente)

Aspartato, treonina, serina, glutamato, prolina, glicina, alanina, cistina, valina, metionina, isoleucina,
fenilalanina, tirosina, lisina, histidina, NH
Identificao: reao com ninidrina cololmetro
Determinao da estrutura primria de uma protena
I- Quais aminocidos?
Protena n aminocidos livres

Problemas:
Triptofano destrudo
Gln e Asn Glu e Asp

Hidrlise bsica
II- Qual o aminocido do terminal amino?
Reaes com dinitrofluorbenzeno ou cloreto de dansila ou
Fenilisotiocianato Sequenciador de

Consegue sequenciar at 20 aminocidos
III- Qual o aminocido do terminal carboxlico?
Reaes com LiBH
4
ou com carboxipeptidase (parar a hidrlise num tempo muito rpido)
IV- Quais so os aminocidos intermedirios
Fragmentao enzimtica: endopepeptidases
tripsina: aps Arg e Lys
quimiotripsina: aps Phe, Tyr e Trp
termolisina: antes Leu, Ile, Val
Fragmentao qumica:
brometo de cianognio:aps Met
Sequenciamento de uma protena:
A
Aspartato, treonina, serina, glutamato, prolina, glicina, alanina, cistina, valina, metionina, isoleucina,
tirosina, lisina, histidina, NH
4
+
, arginina
Identificao: reao com ninidrina cololmetro
Determinao da estrutura primria de uma protena
Protena n aminocidos livres
Gln e Asn Glu e Asp
Qual o aminocido do terminal amino?
Reaes com dinitrofluorbenzeno ou cloreto de dansila ou
Fenilisotiocianato Sequenciador de Edman
Consegue sequenciar at 20 aminocidos
Qual o aminocido do terminal carboxlico?
ou com carboxipeptidase (parar a hidrlise num tempo muito rpido)
Quais so os aminocidos intermedirios
opepeptidases
tripsina: aps Arg e Lys
quimiotripsina: aps Phe, Tyr e Trp
termolisina: antes Leu, Ile, Val
brometo de cianognio:aps Met
Sequenciamento de uma protena:
A U
Aspartato, treonina, serina, glutamato, prolina, glicina, alanina, cistina, valina, metionina, isoleucina,
ou com carboxipeptidase (parar a hidrlise num tempo muito rpido)


Tripsina: A-B-C-D-E-F
G-H-I-J-K-L
M-N-O-P-Q-R
S-T-U
Quimiotripsina: R-S-T-U
A-B-C-D
E-F-G
H-I-J-K-L-M-N-O-P-Q

PROTENAS
Macromolculas compostas de uma ou mais cadeias polipeptdicas, em que cada cadeia possui uma
sequncia caracterstica de aminocidos unidos por ligaes peptdicas
As protenas possuem tamanhos variados:
Inibidor de proteinase III do melo possui 30
O citocromo c humano possui 104 aminocidos; RNA polimerase do bacterifago T7 (vrus de
bactria) possui 883 aminocidos
Titina humana, uma protena que ajuda a arranjar as fibras musculares, contm 26.926
resduos de aminocidos.
Funes biolgicas:
Catlise(enzimas): tripsina, hexoquinase, ribonuclease; catalase, isocitrato liase
Transporte: hemoglobina, albumina srica;
Proteo: Imunoglobulinas, trombina, venenos de cobra e insetos;
Armazenamento: Zena, glicinina (soja), ovoalbumina;
Regulatrias: Insulina, glucagon;
Contrteis: Miosina, actina;

Estruturais: Colgeno, elastina, queratina;
Exticas: adesivas (adeso celular), anticongelantes (peixes e alguns insetos)
As protenas podem ser:
Monomricas: uma cadeia polipeptdica
Oligomricas: mais de uma cadeia polipeptdica
Simples: somente aminocidos
Conjugadas: presena de grupos prostticos
Grupo prosttico
on metlico (Cofator) ou componente orgnico que no aminocido (Coenzima), que se liga
covalentemente protena e essencial para a sua atividade.
Estrutura tridimensional das protenas
a conformao assumida pela molcula proteica
- Conformao nativa
Conformao: o arranjo espacial dos tomos (alteraes no envolvem quebras de ligaes)
A estrutura tridimensional:
1. determinada pela sequncia de aminocidos;
2. determinante da funo da protena;
3. nica (ou quase) para cada protena;
4. As foras estabilizantes so interaes no covalentes
5. Vrias estruturas definidas podem ser identificadas em seu interior.
Quatro nveis estruturais
Estrutura primria: ligaes covalentes unindo resduos de aminocidos em uma cadeia
polipeptdica.
Estrutura secundria: arranjos particularmente estveis de resduos de aminocidos dando origem a
padres estruturais.
Estrutura terciria: descreve todos os aspectos de enovelamento tridimensional de um polipeptdio.
Estrutura quaternria: arranjo espacial de duas ou mais cadeias polipeptdicas.
Estrutura primria
Esqueleto covalente da molcula (ligaes peptdicas e pontes dissulfeto).
A sequncia de aminocidos de uma protena est fortemente lig
Protenas Polimrficas: a sequncia de aminocidos pode variar de 20 a 30%, mantendo
Ligao peptdica
Os C

dos resduos de aminocidos adjacentes so separados por trs ligaes covalentes:
C C N C.
Diagrama de Ramachandran
Representa os valores permitidos para os ngulos
- ligao N-C
- ligao C -C
Por conveno so definidos como
180
o
quando o polipeptdio estiver na
sua conformao totalmente estendida
e todos os grupos polipeptdios
estejam no mesmo plano


Esqueleto covalente da molcula (ligaes peptdicas e pontes dissulfeto).
A sequncia de aminocidos de uma protena est fortemente ligada sua funo.
Protenas Polimrficas: a sequncia de aminocidos pode variar de 20 a 30%, mantendo
dos resduos de aminocidos adjacentes so separados por trs ligaes covalentes:
Representa os valores permitidos para os ngulos (phi) e (psi)
Por conveno so definidos como
quando o polipeptdio estiver na
sua conformao totalmente estendida
e todos os grupos polipeptdios
Alanina

ada sua funo.
Protenas Polimrficas: a sequncia de aminocidos pode variar de 20 a 30%, mantendo-se a funo.
dos resduos de aminocidos adjacentes so separados por trs ligaes covalentes:

Ponte dissulfeto
A cistena possui um tomo de enxofre na extremidade de seu grupamento R. Dois enxofres, quando
se aproximam, podem formar uma ponte de enxofre ou ponte dissulfeto.

Exemplo da importncia da estrutura primria:
Anemia falciforme: hemoglobina contm 287 aminocidos. A nica diferena entre hemoglobina de
um indivduo normal e de um anemia falciforme a substituio de uma valina por um cido
glutmico.
Determinao da seqncia de aminocidos:
hidrlise em peptdeos menores;
degradao de Edmam;
ordenar os fragmentos.
Uma sequncia proteica pode ser deduzida a partir da sequncia de nucleotdeo de seu gene no DNA
Estrutura secundria:
Arranjos regulares da sequncia de aminocidos da cadeia polipeptdica.
Dois tipos comuns
1. -hlice
2. Conformao
-hlice
Esqueleto peptdico enovelado ao redor de um eixo imaginrio e os grupos R dos resduos de
aminocidos projetando-se para fora.
Cada passo da hlice: 3,6 resduos de aminocidos

Toro da mo direita

Estrutura predominante nas -queratinas
Estrutura estabilizada por ligaes de hidrognio: H ligado ao N de uma ligao peptdica e o O do
quarto aminocido do terminal amino daquela ligao peptdica
Interaes entre cadeias laterais de aminocidos podem estabilizar ou desestabilizar as -hlices.
O volume e a forma de alguns aminocidos tambm podem desestabilizar as -hlices.
Resduo de prolina introduz toro nas -hlices. Resduos de glicina tambm so infrequentes em -
hlice por possuir maior flexibilidade
Aminocidos carregados negativamente so freqentemente
encontrados no terminal amino do segmento helicoidal.


Folha
O esqueleto da cadeia polipeptdica estendido em ziguezague.
As cadeias podem ser arranjadas lado a lado (Folhas ).
Ligaes de hidrognio entre segmentos adjacentes.
Os grupos R de aminocidos adjacentes projetam-se em direes opostas
Podem ser paralelas ou antiparalelas.
Duas ou mais folhas assentadas juntas grupos R dos resduos de aminocidos nas superfcies que se
tocam devem ser pequenos.

Dobra
Elementos de conexo de dois segmentos
adjacentes de uma folha antiparalela.
Dobra de 180 envolvendo quatro resduos de
aminocidos.
Glicina e Prolina freqentemente ocorrem

Estrutura terciria
Arranjo tridimensional geral de todos os tomos em uma protena.
Interao de aminocidos situados a longas distncias na cadeia polipeptdica.
Estruturas enoveladas e muito compactas, estabilizada por interaes entre os grupos R:
Interaes fracas:
-Interaes hidrofbicas
-Ligaes de hidrognio
-Interaes inicas
-Interaes de van der Waals
Pontes dissulfeto
As curvaturas na cadeia enovelada so definidas pelo nmero e localizao de Pro, Thr, Ser e Gly.
Cada protena apresenta uma estrutura terciria que lhe caracterstica, ou seja, todas as
mioglobinas da espcie humana, por exemplo, apresentam a mesma estrutura terciria.
A estrutura terciria de uma protena pode ser obtida pela utilizao de dois mtodos: difrao de
raio X e ressonncia magntica nuclear.
Cristalografia de Raio X
Primeiramente necessrio obter o cristal desta protena. Obtido o cristal, incide-se sobre ele
radiao raio X. Os tomos da protena recebem esta radiao, que se espalha produzindo o que se
chama de padro de difrao de raio X. Com a ajuda de computadores e programas especficos estas
impresses digitais so analisadas, chegando-se estrutura final da protena.







Ressonncia Magntica Nuclear
Protena em soluo e no na forma
cristalizada. A molcula colocada sob um
campo magntico muito forte, fazendo com
que os ncleos dos tomos de H, C e N
fiquem alinhados. Em seguida, so aplicados
pulsos de radiofreqncia que so absorvidos
pelos ncleos dos tomos presentes na
molcula. Quando esses ncleos retornam ao
seu estado basal, eles emitem
radiofreqncias especficas que podem ser
medidas.
Estruturas supersecundrias ou motivos estruturais
Associaes de estruturas secundrias que se repetem no enovelamento das cadeias proticas
Mais comum o motivo : Uma -hlice entre duas folhas paralelas.


Motivo grampo : Uma folha antiparalela
conectada por voltas relativamente firmes
Motivo : duas -hlices antipararelas e sucessivas acondicionando-se uma contra a outra
Motivo chave-grega: um grampo dobrado
sobre si para formar uma folha antiparalela de
quatro fitas

Domnios estruturais
Unidade estrutural distinta no interior de uma
cadeia polipeptdica
Unidades globulares estveis em uma mesma
cadeia polipeptdica
Formados por associaes de motivos e de estruturas secundrias adicionais.
Grupos de motivos podem ser combinar para formar a estrutura terciria de um domnio, que
chamado de padro de dobramento.
O nmero de padres de dobramento possveis poderia parecer ilimitado, mas, ao se comparar as
estruturas proticas, a maioria possui padres de dobramento que tambm ocorrem em protenas
no relacionadas.
Domnios : contm somente -hlices. o padro de drobamento da globina
Domnios : Ex: barril




Domnios /: uma folha central ladeada por -hlices. 10 % das estruturas de enzimas
conhecidas contm um barril /.
Estrutura quaternria
Arranjo espacial das subunidades polipeptdicas em uma protena constituda por mais de
cadeia polipeptdica.
Uma protena com multissubunidades pode ser constituda por cadeias polipeptdicas idnticas ou
diferentes.
estabilizada pelas mesmas interaes que aparecem na estrutura terciria, exceto pontes
dissulfeto.
Ex: Hemoglobina (quatro cadeias: duas cadeias e
duas cadeias )


Protenas Fibrosas e Protenas Globulares
Protenas fibrosas: so insolveis e possuem cadeias polipeptdicas arranjadas em longas fitas ou
folhas. Adaptadas para funo estrutural: suporte,
Protenas globulares: solveis e possuem cadeias polipeptdicas enoveladas em forma esfrica ou
globular. Frequentemente contm vrios tipos de estrutura secundria.
Protenas fibrosas
-Funo estrutural: suporte, forma e
-Insolveis em gua;
-Formam complexos supramoleculares, com cadeias arranjadas em filamentos ou folhas.
-queratina
- Encontradas em mamferos: cabelo, l, unhas,
penas, espinhos, chifres, casco e a maior
parte da camada externa da pelo
- -hlice (sentido da mo direita);
- duas hlices formam uma espiral supertorcida
(sentido da mo esquerda);
- Funo de resistncia e proteo;
- Rica em aminocidos hidrofbicos: Ala, Val,
Leu, Ile, Met, Phe;
- Muitas espirais: filamento do cabelo;
Arranjo espacial das subunidades polipeptdicas em uma protena constituda por mais de
Uma protena com multissubunidades pode ser constituda por cadeias polipeptdicas idnticas ou
estabilizada pelas mesmas interaes que aparecem na estrutura terciria, exceto pontes
Hemoglobina (quatro cadeias: duas cadeias e
Protenas Fibrosas e Protenas Globulares
Protenas fibrosas: so insolveis e possuem cadeias polipeptdicas arranjadas em longas fitas ou
folhas. Adaptadas para funo estrutural: suporte, forma e proteo externa.
Protenas globulares: solveis e possuem cadeias polipeptdicas enoveladas em forma esfrica ou
globular. Frequentemente contm vrios tipos de estrutura secundria.
Funo estrutural: suporte, forma e proteo externa;
Formam complexos supramoleculares, com cadeias arranjadas em filamentos ou folhas.
Encontradas em mamferos: cabelo, l, unhas,
penas, espinhos, chifres, casco e a maior
parte da camada externa da pelo;
hlice (sentido da mo direita);
duas hlices formam uma espiral supertorcida
Funo de resistncia e proteo;
Rica em aminocidos hidrofbicos: Ala, Val,
Muitas espirais: filamento do cabelo;
Arranjo espacial das subunidades polipeptdicas em uma protena constituda por mais de uma
Uma protena com multissubunidades pode ser constituda por cadeias polipeptdicas idnticas ou
estabilizada pelas mesmas interaes que aparecem na estrutura terciria, exceto pontes
Protenas fibrosas: so insolveis e possuem cadeias polipeptdicas arranjadas em longas fitas ou
Protenas globulares: solveis e possuem cadeias polipeptdicas enoveladas em forma esfrica ou
Formam complexos supramoleculares, com cadeias arranjadas em filamentos ou folhas.
- Pontes dissulfeto entre as cadeias: aumentam a resistncia
Colgeno:
- Funo de resistncia tenso
- Tecido conjuntivo: tendes, cartilagens, matriz orgnica dos ossos, crnea do olho
- Estrutura secundria: hlice de sentido da mo esquerda;
- Trs cadeias polipeptdicas formam uma espiral (sentido da mo direita);






- Tipicamente contm: 35 % de Gly, 11 % de Ala e 21 % de Pro ou 4-hidroxiprolina;
- Unidade tripeptdica repetida Gly- X- Y, na qual X freqentemente prolina e Y 4-hidroxiprolina;
- Ligaes cruzadas no usuais envolvendo lisina, 5-hidroxilisina ou histidina;
- Acmulo de ligaes cruzadas envelhecimento do tecido conjuntivo;
- Gelatina: derivada do colgeno, baixo valor nutricional.


Fibrona da seda
- insetos e aranhas;
- conformao ;
- rica em resduos de Ala e Gly;
- no se estica, mas flexvel.
Protenas globulares
- Solveis e com cadeias peptdicas, no geral, com
vrios segmentos de estrutura secundria (
hlices, folhas );
- densidade de empacotamento semelhante a cristais
moleculares;
- Cadeias laterais dos aminocidos distribudos
de acordo com a polaridade:
resduos apolares: interior das protenas;
resduos polares carregados: na superfcie da protena, em sua maior parte. Quando no interior,
geralmente esto associados a uma funo especial, como ligao de ons metlicos;
resduos polares no carregados: superfcie e interior (ligaes de hidrog
Solubilidade das protenas
Concentrao de sal



- pH: altera as cargas das protenas
- Ponto isoeltrico de uma protena: carga
lquida igual a zero. Interaes com meio
aquoso so minimizadas. Diminui a
solubilidade.




rica em resduos de Ala e Gly;
Solveis e com cadeias peptdicas, no geral, com
vrios segmentos de estrutura secundria (-
densidade de empacotamento semelhante a cristais
Cadeias laterais dos aminocidos distribudos
de acordo com a polaridade:
resduos apolares: interior das protenas;
resduos polares carregados: na superfcie da protena, em sua maior parte. Quando no interior,
geralmente esto associados a uma funo especial, como ligao de ons metlicos;
resduos polares no carregados: superfcie e interior (ligaes de hidrognio entre eles)
pH: altera as cargas das protenas
Ponto isoeltrico de uma protena: carga
lquida igual a zero. Interaes com meio
aquoso so minimizadas. Diminui a
resduos polares carregados: na superfcie da protena, em sua maior parte. Quando no interior,
geralmente esto associados a uma funo especial, como ligao de ons metlicos;
nio entre eles).
Desnaturao e enovelamento
- Funo em ambientes celulares particulares.
- Condies diferentes resultam em alteraes estruturais da protena.
- Desnaturao: perda da estrutura tridimensional, suficiente para causar a perda de sua funo.
Exemplos de agentes desnaturantes:
calor: afeta as interaes fracas;
alterao do pH: alteram carga lquida da protena;
solventes orgnicos;
uria; rompem interaes hidrofbicas
detergentes.
Renaturao
A estrutura terciria determinada pela sequncia de aminocidos. Certas protenas desnaturadas
recuperam sua estrutura nativa se retornadas s condies na qual a conformao nativa estvel
(retirada das condies desnaturantes).



Enovelamento de protenas
- Vrios modelos possveis:
Processo hierrquico: estrutura secundria, estruturas supersecundrias, domnios e peptdeo
inteiro enovelado.
Colapso espontneo, mediado por interaes hidrofbicas.
Protenas envolvidas no enovelamento de protenas:
- Chaperonas moleculares:
Hsp 70: clulas estressadas por temperaturas elevadas;
Chaperoninas: protenas celulares que no se enovelam espontneamente.
- Protena dissulfeto isomerase: troca interna das pontes dissulfeto.
- Peptdeo prolil cis-trans isomerase: Interconverso dos ismeros cis e trans dos peptdeo com
ligaes prolina.
Trabalhando com as protenas
As protenas so separadas e purificadas beneficiando-se das diferenas nas suas propriedades. As
protenas podem ser eletivamente precipitadas pela adio de certos sais. Uma grande variedade de
procedimentos cromatogrficos faz uso das diferenas em tamanho, afinidade de ligao, cargas e
outras propriedades. Essas incluem troca inica, excluso pelo tamanho, afinidade e cromatografia
lquida de alto desempenho.
Cromatografia Cromatografia de troca inica





Cromatografia de excluso molecular Cromatografia de afinidade


A eletroforese separa as protenas na base da massa ou da carga. A eletroforese em gel de SDS e a
focalizao isoeltrica podem ser usadas separadamente Ou em combinao para maior resoluo.
Eletroforese

Focalizao isoeltrica

Eletroforese bidimensional







Todos os procedimentos de purificao requerem um mtodo para quantificar ou ensaiar a protena
de interesse na presena de outras protenas. A purificao pode ser monitorada ensaiando a
atividade especfica
1) Consultando a tabela de valores de pK
a
, responda:
a) Qual a estrutura predominante do pentapeptdeo Trp-Val-Glu-Gln em pH 7,00 ?
b) Qual o nome do peptdeo ?
c) Qual o nome do resduo Carboxi Terminal (CT) e do Amino Terminal (NT) ?
d) Classifique os grupos R quanto a polaridade em pH 7,00.
e) Circule os grupos do peptdeo que podem ser protonados ou desprotonados e escreva os valores
doa seus respectivos pKs.
f) Esboce o grfico da titulao (pH x n de H+ liberados) do peptdeo, a partir do pH 1,00.
g) Em que pH o grupo alfa-amino da metade das molculas do peptdeo est ionizado?
h) Em que pH o grupo alfa-carboxlico da metade das molculas do peptdeo est ionizado?
i) Em que pH o grupo R da metade das molculas do peptdeo est ionizado?
j) Em que pH o grupo alfa-carboxlico do peptdeo est completamente titulado ( primeiro ponto de
equivalncia)?
k) Em que pH o grupo R do peptdeo est completamente titulado ( segundo ponto de
equivalncia)?
l) D a carga lquida do peptdeo em pH : 1,00; 2,17; 4,25; 9,39.
m) Qual o valor do ponto Isoeltrico ( pI) do peptdeo ? O que esse valor significa?
n) Quais so os valores de pHs que o peptdeo apresenta maior capacidade tamponante?

2 ) A protena insulina consiste de dois polipeptdeos chamados de cadeia A e B. As insulinas de
diferentes organismos j foram isoladas e sequenciadas. As insulinas dos seres humanos e dos patos
tm a mesma seqncia de aminocidos, com exceo de seis resduos de aminocidos, como
mostrado a seguir. O pI da insulina humana maior ou menor que o pI da insulina do pato?
Resduo de Aminocidos
A8 A9 A10 B1 B2 B27
Humano Tyr Ser Ile Phe Val Thr
Pato Glu Asn Pro Ala Ala Ser


3) Quanto estrutura tridimensional de protenas:
a) Diferenciar estruturas primria, secundria, terciria e quaternria;
b) Quais as ligaes e interaes que as mantm ?
c) Quais os principais tipos de estruturas secundrias ? Diferenci-las.
d) Por que nem todos segmento peptdico pode se dobrar na forma de uma -hlice estvel ?
e) Como so as estruturas do colgeno e da elastina ?
f) Que diferenas existem entre protenas fibrosas e globulares ? Exemplificar.

4) Voc concorda com as seguintes afirmativas? Caso discorde, reescrev-las justificando as
mudanas:
a) Nas protenas, encontramos somente os elementos C, H, N e O.
b) As protenas so formadas por seqncias de aminocidos ligados por ligaes glicosdicas, que
podem ser (14) e (16).
c) Protenas so macromolculas formadas exclusivamente por aminocidos.
d) Cada protena tem sua massa molecular definida, no geral superior a 10.000 Da.
e) A estrutura terciria de uma mesma protena pode apresentar vrios segmentos em -hlice,
folhas -pregueada e aleatrios, dependendo da estrutura primria.
f) A curva-beta um tipo de estrutura secundria de protenas, que geralmente ocorre no interior
da estrutura tridimensional das molculas.
g) Em cada tipo de protena, a cadeia polipeptdica enrolada em uma conformao tridimensional
especfica, o que indispensvel para sua funo biolgica especfica ou atividade.
h) As protenas, apesar das inmeras funes, no podem ser usadas para produo de energia.
i) A desnaturao no afeta a atividade biolgica das protenas.

Enzimas

Asenzimassocatalisadoresdasreaesdossistemasbiolgicos:
Altopodercataltico(frequentementemaiorquecatalisadoresinorgnicos)
Altograudeespecificidade
FuncionamemsoluesaquosassobcondiesmoderadasdetemperaturaepH.
Centraisatodosprocessosbioqumicos
Atuamemsequnciasorganizadas
Coordenamasviasmetablicas(enzimasreguladoras)
ComexceodeumpequenogrupodemolculasdeRNAcataltico,todasasenzimas
soprotenas.
Atividadecatalticadependedaintegridadedasuaconformaonativa.
Enzima desnaturada ou dissociada em suas subunidades: atividade cataltica
usualmenteperdida
Se degradada a aminocido: atividade sempre destruda Dessa forma, estruturas
primrias,secundrias,terciriasequaternriassoessenciaisparasuaatividadecataltica.
Algumas enzimas no requerem outros grupos qumicos alm de seus resduos de
aminocidos
Outrasrequeremumcomponentequmicoadicional:
Cofator:onsinorgnicos(Fe
2+
,Mg
2+
,Mn
2+
,Zn
2+
)
Coenzima:complexoorgnicooumolculametalorgnica
Enzima+grupoprosttico:Holoenzima
Parteproteicadetalenzima:Apoenzima
Algumas enzimas so modificadas covalentemente por fosforilao, glicosilao ou
outrosprocessos:Alteraesenvolvidasnaregulaodaatividadeenzimtica

Nomeclatura
SculoXIXpoucasenzimasidentificadas
Adio do sufixo ASE ao nome do substrato ou a uma palavra ou frase que
descreviasuaatividade:
*gorduras(lipogrego)LIPASE
*amido(amylongrego)AMILASE
*polimerizaodoDNADNAPOLIMERASE
Outrasparaumafunomaisampla,antesqueareaoespecficafosseconhecida:
*Pepsina(protease)dogrego:pepis=digesto
Asvezesamesmaenzimatinhaomesmonomeouduasenzimasdiferentestinhamo
mesmonome
1955ComissodeEnzimas(EC)daUnioInternacionaldeBioqumica
(IUB)nomeareclassificar.
Cadaenzima cdigo com4 dgitosquecaracterizaotipo dereao
catalisada:
1dgitoclasse
2dgitosubclasse
3dgitosubsubclasse
4dgitoindicaosubstrato
Grupoprosttico
Classe

Catliseenzimtica
Essencialaossistemasvivos.
Sobcondiesfisiolgicas,reaesnocatalisadastendemaserlentas.
Catlise enzimtica se realiza dentro de um bolsoconfinado da enzima, chamado de
stioativo.
Molculaqueligadaaostioativo:substrato
Resduos de aminocidos do stio ativo ligam o substrato e catalisam sua
transformao

Afunodeumcatalisadoraumentaravelocidadedareao,catalisadornoafetao
equilbrioqumicodareao.
Condiespadro:T=298K,P=1atm,[]soluto=1M
Emsistemasbioqumicos:[H
+
]1M
G
o
=energialivrebioqumicapadroempH=7
OequilbrioentreSePrefleteadiferena
entreasenergiaslivresdeseusestadosbasais.No
exemplo,G
o
negativoeoequilbriofavoreceP.
UmequilbriofavorvelnosignificaumaconversorpidadeSemP
N
0
Classe Tipo de reao catalisada
1 Oxirredutases Transferncia de eltrons
(ons hidreto ou tomos H)
2 Transferases Reaes de transferncia de grupos
3 Hidrolases Reaes de hidrlise
4 Liases Adio de grupos em ligas duplas ou
remoo de grupos com a formao de
ligas duplas
5 Isomerases Transferncia de grupos dentro da mesma
molcula para formar ismeros
6 Ligases Formao de ligaes C-C, C-S, C-O, C-N
pelo acoplamento da clivagem do ATP

H uma barreira energtica entre S e P: energia requerida para o alinhamento dos
grupos,formaodecargastransitriasinstveis,osarranjosdeligao
NotopodaenergiadamontanhaestumpontoondeodecaimentoparaoestadoSe
Pigualmenteprovvel:Estadodetransio
A diferena entre os nveis de energia basal e o estado de transio a energia de
ativao=G

Umaaltaenergiadeativaocorrespondeaumareaomaislenta.
As velocidades de reao podem ser aumentadas pela elevao da temperatura,
aumentando o nmero de molculas com energia suficiente para ultrapassar a barreira de
energia.
Alternativamente, a energia de ativao pode ser diminuda pela adio de um
catalisador

Osequilbriosdareaosoligadosvariaodaenergialivrepadrodareao,G
o
,
easvelocidadesdereaosoligadasenergiadeativao,G

R=ctedosgases=8,315J/molK
T=TemK

A velocidade de qualquer reao determinada pela concentrao do reagente (ou


reagentes)eporumaconstantedevelocidade(k).

Paraumareao
V (quantidade de S que reage por unidade de tempo) expressa pela equao da
velocidade

A partir da teoria do estado de transio, podemos derivar uma expresso que


relacionaumaconstantedevelocidadeenergiadeativao.
naqual:kaconstantedeBoltzmann
haconstantedePlanck.

A relao entre a constante da velocidade k e a energia de ativao G

inversa e
exponencial:Umamenorenergiadeativaosignificavelocidadedereaomaisrpida

Podercatalticoeespecificidadedasenzimas
Enzimassoexcelentescatalisadoresetambmmuitoespecficas.
Interaescovalentesentreenzimasesubstratosdiminuemaenergiadeativao.
'
eq
o '
'
eq
K ln RT G
] S [
] P [
K
= A
=
] S [ k V =
RT
G

e
h
kT
k
A
=
Grandepartedaenergiarequeridaparadiminuirasenergiasdeativaoderivadade
interaesfracas,nocovalentesentreosubstratoeaenzima.
AformaodecadainteraofracanocomplexoESacompanhadapelaliberaode
uma pequena quantidade de energia livre que fornece um grau de estabilidade para a
interao.Aenergiaderivadadainteraoenzimasubstratochamadadeenergiadeligao,
G
B

A energia de ligao a principal fonte de energia livre usada pelas enzimas para
diminuirasenergiasdeativaodasreaes.
Essaenergiadeligaocontribuiparaaespecificidade,bemcomoparaacatlise.
Asinteraesfracassootimizadasnoestadodetransiodareao

Interaesfracasentreaenzimaeosubstratosootimizadasnoestadodetransio

Em1894,EmilFischerpropsqueenzimaseramestruturalmentecomplementaresao
seussubstratos:Chaveefechadura
A moderna noo de catlise enzimtica, primeiro proposto por Michael Polanyi (
1921) e Haldane (1930),foi elaborada por Linus Pauling em 1946: para catalisar as reaes,
umaenzimadevesercomplementaraoestadodetransiodareao

A mesma energia de ativao que fornece a energia para a catlise tambm d


enzima sua especificidade, a habilidade de discriminar entre um substrato e uma molcula
competidora.
Cinticaenzimtica
Avelocidadedeumareaocatalisadaporenzimainfluenciadapela[S].

Entretanto, [S] se altera durante o curso de uma reao in vitro, medida que o S
convertido em P. Em experimentos de cintica medese a velocidade inicial, V
o
([S] >> [E]).
Monitorando apenas o incio da reao, alteraes na [S] so minimizadas e [S] pode ser
consideradacomoconstante.V
o
podeentoserexploradacomoumafunoda[S].

Embaixas[S],V
o
aumentaquaselinearmentecomoaumentona[S].Em[S]maisaltas,
V
o
aumentadequantidadescadavezmenoresemrespostaaoaumentona[S].Finalmente,um
pontoalcanado,almdoqualaumentosemV
o
tendemaserpequenosmedidaquea[S]
aumenta.EssaregiodeV
o
parecidacomumplatestprximadavelocidademxima,V
mx
.
OcomplexoESachaveparaentenderocomportamentocintico
VictorHenri(1903)ESumaetapanecessrianacatliseenzimtica
Michaelis e Menten (1913) postularam que a enzima primeiro combina
reversivelmente com seu substrato para formar um complexo ES em uma etapa reversvel
relativamenterpida:

O complexo ES depois se quebra em uma segunda etapa mais lenta para produzir a
enzimalivreeoprodutodareaoP:
Pelo fato de a segunda reao mais lenta Iimitar a velocidade da reao global, a
velocidade globaldeveserproporcionalconcentraodasespciesquereagemnasegunda
etapa,ouseja,ES.

Cinticadoestadoestacionrio
Acurvaexpressandoarelaoentre[S]eV
o
temamesmaformageralparaamaioria
das enzimas (ela se aproxima de uma hiprbole retangular), que pode ser expressa
algebricamentepelaequaodeMichaelisMenten.

EquaodeLineweaverBurk

A equao de MichaelisMenten no depende de um mecanismo de reao em duas


etapasrelativamentesimplespropostoporMichaeliseMenten.Muitasenzimasqueseguem
acinticadeMichaelisMentenapresentammecanismosdereaobemdiferentes,eenzimas
quecatalisamreaescomseisouoitoetapasidentificveisfreqentementeexibemomesmo
comportamentocinticodoestadoestacionrio.
O significado atual de Km depende de aspectos especficos do mecanismo de reao
como o nmero e as velocidades relativas das etapas individuais. Para reaes com duas
etapas:

Quando k
2
limitante da velocidade, k
2
<< k
1
, e K
m
reduzse a k
1
/k
1
que definida
comoaconstantededissociao,K
d
,docomplexoES.Quandoessascondiessemantm,K
m

representaumamedidadaafinidadedaenzimaparaseusubstratonocomplexoES.
Entretanto,essecenrionoseaplicaparaamaioriadasenzimas.
Algumasvezesk
2
>>k
1
eentoK
m
=k
2
/k
1
.Emoutroscasos,k
2
eK
1
socomparveise
K
m
permanece uma funo mais complexa de todas as trs constantes das velocidade. A
equao de MichaelisMenten e o comportamento caracterstico de saturao da enzima
ainda se aplicam, mas K
m
no pode ser considerada uma simples medida da afinidade do
substrato.
Se uma enzima reage por um mecanismo de duas etapas, V
max
=k
2
[E
t
], na qual k
2

limitante de velocidade. Entrelanto, o nmero das etapas da reao e a identidade da etapa
limitante da velocidade podem variar. Por exemplo, considere a situao muito comum na
qualoprodutoliberado,EPE+P,limitantedavelocidade.

tildefinirumaconstantedavelocidademaisgeral,k
cat
,paradescreveravelocidade
limitante de qualquer reao catalisada por enzima na saturao. Se a reao possui vrias
] S [ K
] S [ V
V
m
max
o
+
=
mx mx
m
o
V
1
] S [
1
V
K
V
1
+ =
1 k
k k
K
2 1
m
+
=

] E [ k V
t 3 max
=
etapaseumaclaramenteavelocidadelimitante,k
cat
equivalenteconstantedevelocidade
paraaquelavelocidadelimitante.
Aconstantek
cat
umaconstantedevelocidadedeprimeiraordeme,portanto,possui
unidades da recproca do tempo. Ela tambm chamada de nmero de renovao.
equivalente ao nmero de molculas de substrato que se convertem em produto em certa
unidade de tempo em uma nica molcula de enzima quando ela for saturada com o
substrato.
Amelhormaneiradesecompararaseficinciascatalticasdeenzimasdiferentesouos
nmeros de renovao de substratos diferentes pela mesma enzima comparar a razo
k
cat
/K
m
para duas reaes. Esse parmetro, algumas vezes chamado de constante de
especificidade,aconstantedavelocidadeparaaconversoE+SatE+P.

Inibioenzimtica
Inibidores enzimticos: agentes moleculares que interferem com a catlise,
diminuindoouparandoasreaesenzimticas

Inibioirreversvel
Ligamse de forma covalente ou destroem o grupo funcional de uma enzima ou
formamassociaesnocovalentesestveis.
Estudosdemecanismodereao
Inativadoressuicidas
Ex:Inibiodaenzimaciclooxigenasepeloacetilsalicilato

Inibioreversvel

Inibiocompetitiva:competecomosubstratopelostioativodaenzima.Enquantoo
inibidorocupaostioativo,eleimpedealigaodosubstratoenzima

Inibidortemsemelhanaestruturalcomosubstrato
Oinibidorseliganostioativodaenzima
Aumentoda[substrato]diminuiainibio
K
m
aparentedaenzimaAUMENTAemumfator
Em uma concentrao suficientemente alta de substrato a VELOCIDADE da reao
atingeaV
mx
observadanaausnciadoinibidor

Inibio incompetitiva: inibidor incompetitivo ligase a um stio distinto do stio ativo


dosubstratoapenasnocomplexoES

Oinibidorseliganumstiodiferentedostioativodaenzima
Em uma concentrao suficientemente alta de substrato a VELOCIDADE da reao
aproximasedeV
mx
/
K
m
aparentedaenzimadiminui
] EI [
] I ][ E [
K
K
] I [
1
] S [ K
] S [ V
V
I
I
m
mx
o
=
+ =
+
=
o
o
] ESI [
] I ][ ES [
K
K
] I [
1
] S [ K
] S [ V
V
'
I
'
I
'
'
m
mx
o
=
+ =
+
=
o
o

Inibiomista:inibidorligaseaumstiodistintodostioativodosubstratotantoemE
quantonocomplexoES

Oinibidorseliganumstiodiferentedostioativodaenzima
Em uma concentrao suficientemente alta de substrato a VELOCIDADE da reao
aproximasedeV
mx
/
K
m
aparentedaenzimanapresenadoinibidorserK
m
/

Casoespecial:=Inibionocompetitiva

Inibionocompetitiva
KmaparentedaenzimaNOsealtera
AVELOCIDADEmximaDIMINUInapresenadoinibidor
] S [ K
] S [ V
V
'
m
mx
o
o o +
=
] S [ K
] S [ V
V
] S [ K
] S [ V
V
m
mx
o
'
m
mx
o
o o
o o
+
=
+
=
( )
] S [ K
] S [
V
V
] S [ K
] S [ V
V
m
mx
o
m
mx
o
+
=
+
=
o
o

Fatoresdecorrentesdanaturezaproticadasenzimasafetamaatividade
Concentraodaenzimaedosubstrato;
pH;
Temperatura.

pHTemperatura

ENZIMASREGULATRIAS
NoobedecemacinticadeMichaelisMenten.
Controlamaetapalimitanteemumacadeiadereaesenzimticas.
Tem sua atividade cataltica aumentada ou diminuda em resposta a
determinadossinais,molculassinalizadoras(pequenosmetablicosoucofatores).
Classesdeenzimasreguladoras:
- Enzimasalostricas;
- Enzimasreguladaspelamodificaocovalentereversvel.

Enzimasalostricas
Funcionam atravs da ligao nocovalente e reversvel de um
metablitoreguladorchamadomodulador;
Moduladorespodemserinibidoresouativadores;
So maiores e mais complexas, possuem duas ou mais cadeias
polipeptdicas.
Enzimasreguladaspelamodificaocovalentereversvel
Grupos qumicos so ligados covalentemente e removidos da enzima
reguladora por enzimas diferentes. Podem ser: fosfato, adenosina monofosfato,
gruposmetil,etc.

ExercciosEnzimas
1) Expliqueoquesoenzimaseporquesomaisefetivasquecatalisadoresnobiolgicos.
2) Por que as estruturas primria, secundria, terciria e quaternria das enzimas so
essenciaisparaoexercciodasatividadescatalticas?
3) Relacione os termos dando exemplos: cofatores enzimticos; coenzimas e vitaminas
hirossolveis.Dumexemplo.
4) Conceitue os termos: centro ativo de uma enzima e substrato. Faa um desenho
esquemticodeumaenzimaatuandoemseusubstrato.
5) Oqueenergiadeativaodeumareao?Comoasenzimasaumentamavelocidade
dareao?
6) A)Expliqueaatividadeenzimticaobservandoafigura
B)Correlacione com esse grfico a
reao entre a glicose e o oxignio
para formar CO
2
e H
2
O no ambiente e
quandoocorrenaclula.
C) Por que importante, como no
exemplo acima, que as reaes na
ausncia da enzima tenha energia de
ativaoalta?
7) Um aluno de BQI 100 afirmou em uma prova que a presena de enzimas alterava o
equilbriodereaes.Vocconcordaoudiscordadoaluno.Justifiquesuaresposta.
8) Expliquecomoaconcentraodesubstratoafetaavelocidadedereaesenzimticas.
9) Expliqueinibiocompetitivadenocompetitiva,eexplique,inclusivegraficamente,o
comportamento de Vmx e Km para cada caso (montar apenas o grfico de Michaelis
Menten).
10) ComoatemperaturaeopHafetamaatividadeenzimtica.
11) Expliqueefunodasenzimasreguladoras,ediferencieenzimasalostricasdeenzimas
reguladaspormodificaocovalente.Conceituezimogneo.Dexemplos.
12) Osaboradocicadodomilhorecmcolhidodevidoaoaltonveldeacarnosgros.O
milho comprado no mercado (vrios dias aps a colheita) no mais to doce, porque
cerca de 50% do acar livre convertido em amido um dia aps a colheita. Para
preservar o sabor doce do milho fresco as espigas descascadas so mergulhadas em
gua fervente por alguns minutos (branqueamento) e ento resfriadas em gua fria. O
milho tratado desta maneira e depois guardado em congelador mantm seu sabor
adocicado.Qualabasebioqumicadesteprocedimento(LEHNINGER,1995)?

13)Analisandoosresultadosdosensaiosenzimticosaseguir,respondaaoquesesegue:
[S]mM V
o
M/min(Reao1) V
o
M/min(Reao2)
0,0025

28,0 15,5
0,004 40,0 23,3
0,01 70,0 46,7
0,02 93,3 70,0
0,04 112,0 93,3
1,00 138,6 137,25
2,00 139,3 138,6
10,00 139,8 139,7

Regresso Y=7,143x10
5
X+7,142x10
3
Y=1,429x10
4
X+7,142x10
3

a) Determineotipodeinibiodareaoenzimticaapartirdosvaloresestimadosde
VmaxeK
M
napresenaeausnciadoinibidor.Justifique.
b) Esquematizeogrficodev
0
x[S]paraestetipodeinibio.

14)Duasisozimas,asquaisseguemacinticadeMichaelisMenten,apresentamosseguintes
valoresdeK
M
eV
Max
:
Enzima1K
M
=1,0mM;V
Max
=1,0mM/min;
Enzima2K
M
=2,0mM;V
Max
=1,5mM/min;
Emqualconcentraodesubstratoasreaescatalisadasporestasisozimasteroamesma
velocidadeinicial(V0)?

15) Vocconcordacomasseguintesafirmativas?Casodiscorde,reescrevlas,justificando
asmudanas:
VMaxavelocidademximaobservadanumareaoenzimtica;
Asenzimassoconsumidasduranteareaoquecatalisam;
As enzimas so protenas que atuam como catalisadores nas reaes nas reaes do
metabolismoeapresentambaixaespecificidadepeloproduto;
Muitas vezes uma enzima exige um componente adicional para que possa continuar
exercendo sua funo. Estes componentes so cofatores que podem ser coenzimas e ons
metlicos;
Oefeitocatalticodeumaenzimasefazpronunciadonareduodaconstantedeequilbrio
deumareao.

VITAMINAS

OnomevitaminafoicriadopelobioqumicopolonsCASIMIRFUNKem1912.
Baseadonapalavralatinavita(vida)enosufixoamina(aminasvitaisouaminasda
vida).
Foiusadoinicialmenteparadescreverestassubstnciasdogrupofuncionalamina,
poispensavasequetodasasvitaminaseramaminas.
Compostosnaturaisdosalimentos,presentesemquantidadespequenas.
Necessidadestambmsopequenas.
Nososintetizadasemanimaisparasuprirasnecessidadesfisiolgicasnormais.
Adeficincialevadoenascarenciaiseoexcessopodeproduzirefeitostxicos.
Asvitaminassoindispensveisparasuportarouestimularreaesqumicasdo
metabolismoanimal.Quasetodososcarreadoresativadosqueatuamcomocoenzimas
derivamdevitaminas.
Elasexecutamosmesmospapisemquasetodasasformasdevida,masosanimais
superioresperderamacapacidadedesintetizlanocursodaevoluo.
Osrequerimentosdevitaminasvariamdeespcieparaespcie,dependendodaidade
edafasedeproduo,garantindoasnecessidadesdirias.

CLASSIFICAO
Hidrossolveis: vit C, tiamina, riboflavina, niacina, piridoxina, cobalanmina, c.
Pantotnico,biotina,c.Flico
Lipossolveis:vitA,VitD,VitE,VitK

VitaminasLipossolveis
VitaminaA,D,E,Ksocompostosisoprenidessintetizados
pelacondensaodemltiplasunidadesdeisopreno.
Nopossuemvalorenergtico.
Oorganismonoassintetizaequandoofazdemaneirainsuficiente.
O armazenamento se d de forma diferente a A armazenada no fgado, a D e E, no
tecido adiposo e muscular, enquanto a K no armazenada por no ter essa
capacidade.
Megadosesdevitaminaslipossolveissotxicasaoorganismoesoeliminadaspelas
fezeseurina,maispelasfezes

VITAMINAA
Principais compostos: retinol, retinal,
palmitato de retinil, acetato de retinil,
provitaminas.
Provitaminas:carotenides
- o,|,carotenos
- ocriptoxantina
- Lutena

PrincipaisfunesBioqumicasefisiolgicas
Retinol:oprecursordoretinalecidoretinico
Retinal:ocomponentesensvelluznarodopsinaeemoutrospigmentosvisuais.o
pigmentodosconesebastonetespresentesnasclulasdaretinaqueiniciamoprocessovisual
derespostaluzpelaproduodeumsinalneuronalenviadoaocrebro.

cidoretinico:umhormnioqueatuapormeiodeprotenasreceptoraspresentes
noncleocelular,regulaaexpressognicaparaodesenvolvimentodetecidosepiteliais,
incluindoapele.
Todosostecidossoalvoparaoshormniosretinidesetodosostiposcelularestm
pelomenosumaformadereceptornuclearparaeles.
OutrasfunesassociadasaVitaminaA
Crescimento
Diferenciaodetecidos
DesenvolvimentodoEmbrio
Reproduo
Metabolismosseo
Imunidade
Atividadesantioxidantes
Reduodedoenascardacas
Papelnacarcinognese

Deficincia:Fatores
- Ingestoinsuficientedasquantidadesdiriasrecomendadas(~1mg/dia)
- Ingestocrnicaeemexcessodelcool
- Deficincianaabsorodegordurasdointestino

Deficincia
- Problemadesadepblica
- Xeroftalmia
- Anorexia, retardo no crescimento, ressecamento e queratinizao de membranas,
infeces

Biodisponibilidade
- Humanosabsorvembemoscarotenides.
- Formaodevitaminaapartirdecarotenidesregulada.
- Absorofacilitadapelapresenadegorduraeagentesemulsificantes.

Principaisfontes
- Retinol:fgado,leiteintegraleenriquecido,ovos.
- Carotenides:vegetaisefrutasamarelolaranja,vegetaisfolhososverdeescuros.

VITAMINAD
Principaiscompostos
VitaminaD
2
(ergocalciferol):origemvegetal
VitaminaD
3
(colecalciferol):origemanimal

ProduodevitaminaD
3

Principaisfunesbioqumicasefisiolgicas
ManutenodahomeostasedoCaeP:essencialnaabsorodeCaePnointestino
delgadoeemsuamobilizaoparaosossos
Contribuiparaamineralizaossea
Sustentaodasfunesneuromuscularesedosprocessoscelularesdependentes
dessesminerais.
Previneodesenvolvimentodedoenasautoimunes,comoodiabetesmellitustipo1.

Deficincia
NveisreduzidosdeCaePnoplasma,fraquezamusculareaumentoderiscoa
infeces
Raquitismoeosteomalcia
Inapetnciaeretardonocrescimento

Principaisfontes
Leite,peixesgordurosos,cereaisenriquecidos

VITAMINAE
Principaiscompostos
o,|,,otocoferol

o,|,,otocotrienol

Funes
Antioxidante:doenasepreservaodealimentos
Protegerostecidoscorporaiscontrareaesdanosas
Proteodelipoprotenas
AuxiliaautilizaodevitaminaAenoprolongamentodavidadoseritrcitos

Deficincia
CarnciadevitaminaEemhumanos(rara):fragilidadedoseritrcitos
Esterelidade,peleescamosa,atrofiamuscular(emanimais)

Fontes
leosvegetais
Grmendetrigo
Arrozintegral
Nozes

VITAMINAK
Principaiscompostos
VitaminaK
1
:filoquinona,fitonadiona(encontradanaturalmentenasplantas)

VitaminaK
2
:menaquinona(75%dapotnciadaK
1
sintetizadaporbactriasnotrato
intestinal)
Vitamina K
3
: menadiona (composto sinttico que pode ser convertido a vitamina K
2

notratointestinal)

Funes
Essencialnasntesedeprotrombina(processodecoagulao)
Cofatordereaesdecarboxilao

Deficincia:Doenahemorrgica

Fontes
Vegetaisdefolhasverdes
Feijesverdes
Pra
Abacate
VitaminasHidrossolveis

VITAMINAC
CIDOASCRBICO
Principaiscompostos
cidoascrbico(100%debiopotncia)
cidodehidroascrbico(80%debiopotncia)

Funes
Antioxidante
Produodecolgeno(hidroxilaodaprolina)
Formaodevasossanguneos,ossosecartilagens
Ajudanaabsorodeferro
Inativaodalipasedotecidoadiposo
Conversodecolesterolemcidosbiliares
Substratoparaenzimaascorbatoperoxidasenasplantas
Precursordooxalatoetartarato
Hidroxilaodeprolinanasprotenasdeparedecelular

Deficincia
Escorbuto
Doenascardiovasculares
Atrofiamusculareesqueltica
Falta de apetite

Escorbuto
Aumentodasarticulaes
Diminuiodaexcreourinria
Anemia
Reduodoapetiteecrescimento
Frouxidodosdentes
Inflamaodagengivaearticulaes
Dificuldadenarespirao
Hemorragias
Doresnarealizaodosmovimentoscorporais.

Excesso:Formaodeclculosdeoxalatonosrins

Fontes
Frutasctricas
Brcoli,couveflor
Cenoura
Repolho

VITAMINAB
1
TIAMINA
Funes
NaformadeTPP:participadometabolismodecarboidratos,funcionandocomo
cofatordevriasreaes(reaesdedescarboxilao)
Papelvitalnatransmissonervosa

Deficincia
Beriberi(alteraesnosistemanervosoemuscular)

Fontes
Gros
Carnes,especialmentesuna
Nozes

VITAMINAB
2

RIBOFLAVINA

Funes
Flavinas:metabolismode
carboidratoselipdeos
(transportadorde
eltrons)

Produodeenergiacadeiatransportadoradeeltrons
Biossntesedec.Graxos
catabolismodeaminas
Conversodepiridoxina,c,flicoetriptofano

Fontes
Leiteseprodutoslcteos
Carnes,ovos
Brcolis,espinafre
Cereais

Deficincia
Queiloseouestomatiteangularouboqueira

Glossite

Inibiodecrescimentoemcrianas

VITAMINAB
3
ouPP
NIACINA
Funes
ComponenteessencialdeNAD
+
eNADP
+
(metabolismodecarboidratos,cidosgraxos
eaminocidos)

Deficincia
Pelagra(dermatite,diarriaedemncia)

Fraqueza,anorexiaeindigesto
Tremores,irritabilidade,ansiedadeedepresso

Excesso
Coceira
Ondasdecalor
Distrbiosdigestivos
lceras
VITAMINAB
6

PIRIDOXINA
Funes
Piridoxalfosfato:coenzimaemreaesdo
metabolismodeaa(reaesdetransaminao)
Produodeneurotransmissores
Metabolismodeeritrcitos
Metabolismodecobalaminaec.Flico
Auxiliaaformaodeniacina

Deficincia
Fraqueza, insnia, desordens neurolgicas, glossite, estomatite, prejuzos no
crescimento,lesesnapele
Deficinciaemconvertertriptofanoemniacina
Convulsescerebrais

Excesso
Formigamentodasmos
Diminuiodaaudio
Foramrelatadoscasosdedependncia

VITAMINAB
12

COBALAMINA
Formas
Cobalamina
Hidroxicobalamina
Adenosilcobalamina
Metilcobalamina
Cianocobalamina: produto sinttico usado em formulaes farmacuticas.
Transformaseemcompostoativoapsingesto

Funes
Essencialnometabolismodelipdeosecarboidratos
Essencialparaocrescimento
Essencialparametabolismodefolato

Deficincia
Alteraeshematolgicaseneurolgicas
Anemiamegaloblstica
Fraqueza,cansao,perdadepesoeapetite

Fontes
Carnes,aves,peixes Leite
CIDOFLICO

Funes
Metabolismodeaminocidosesntesedepurinas
Sntesedecidosnucleicos
Formaodeclulassanguneas
Essencialparacrescimentoefuncionamentonormal
Formaodotuboneural

Deficincia
Perdadeapetite,doresabdominais,diarria,cansao
Anemiamegaloblstica

CIDOPANTOTNICO
Funes
ConstituintedaCoenzimaA:metabolismodecarboidratos,lipdeoseprotenas

Sntesedecolesterol,hormnios,neurotransmissores,fosfolipdeos,anticorpos
ComponentecoenzimaACP:sntesedecidosgraxos

Deficincia
Vmitos
Depresso
Fadiga
Insnia
Fraquezamuscular

Excesso:Diarria

Fontes
Carnes,aves,peixes
Leite,iogurte
Legumes
Cereais

BIOTINA

Funes
Metabolismodecarboidratos,lipdeoseprotenas(reaesdecarboxilao)
Sntesedeaminocidoseglicose

Deficincia
Anorexia
Nuseas,vmitos
Glossite
Depresso
Dermatite
Perdadecabelo

Excesso:Diarria

Fontes
Fgado
Nozes
Manteigadeamendoim
Cereais

ClassificaodasCoenzimas


NUCLEOTDIOSECIDOSNUCLEICOS

Os nucleotdios so os constituintes dos cidos


nuclicos: cido desoxirribonuclico (DNA) e cido
ribonuclico (RNA), os repositrios moleculares da
informaogentica
Os nucleotdios possuem trs componentes
caractersticos: uma base nitrogenada, uma pentose, e um
fosfato
Amolculasemogrupofosfatochamadadenucleosdio.
As bases nitrogenadas so derivadas de dois compostos parentais, a pirimidina e a
purina

Propriedadesdaspurinasepirimidinas
Ressonncia dos tomos do anel d a maioria das ligaes um carter parcial de
duplaligao.
Somolculasplanares(pirimidinas)ouquase(purinas).
AbsorvemluzUV,seumximodeabsoronoCde260nm.
Existemem2ou+formasdependendodopH(tautomerismo).Ex:uracila

A base de um nucleotdio est ligada de maneira covalente (no N1 das pirimidinas e


noN9daspurinas)aocarbono1'dapentoseemumaligaoNglicosdica,eofosfatoest
esterificadoaocarbono5'
Oscidosnuclicospossuemduasespciesdepentoses.

TantooDNAcomooRNAcontemalgumasbasessecundrias.
NoDNAamaiscomumdessassoformasmetiladasdasbasesprincipais.
Bases no usuais ou alteradas possuem funes na regulao ou proteo da
informaogentica.
Bases secundrias de muitos tipos soencontradas tambm em RNAs, especialmente
nostRNAs
BasessecundriasdoDNABasessecundriasdoRNA

Alm de seus papis de subunidade dos cidos nuclicos, os nucleotdios possuem


umavariedadedeoutrasfunesemtodasasclulas:
- Transportadoresdeenergiaqumica

- Componentesdecofatoresenzimticos:

Mensageirosqumicos:

cidosnucleicos:
Os nucleotdios sucessivos tanto do DNA quanto do RNA so unidos covalentemente
pormeiode"pontes"degruposfosfatos,ondeogrupo5fosfatodeumaunidadenucleotdica
estunidoaogrupo3hidroxiladonucleotdioseguinte,criandoumaligaofosfodister

OsesqueletostantodoDNAquantodoRNAsohidroflicos.Osgruposhidroxilasdos
resduos de acar formam pontes de hidrognio com a gua. Os grupos fosfato esto
completamente ionizados e carregados negativamente em pH 7 e as cargas negativas esto
geralmente neutralizadas por interaes inicas com as cargas positivas de protenas, ons
metlicosepoliaminas.
Todas as ligaes fosfodisteres possuem a mesma orientao ao longo da cadeia,
dandoacadacadeialineardecidonuclicoumapolaridadeespecificaeextremidades5e3
distintas. Por definio, a extremidade 5 no possui um nucleotdio na posio 5 e a
extremidade3'nopossuiumnaposio3.
Assequnciasnucleotdicaspodemserrepresentadasesquematicamente:

Por conveno, a estrutura de uma fita nica de cido nuclico est sempre escrita
com a extremidade 5 esquerda e a extremidade 3 direita, ou seja, na direo 5 3.
Algumasrepresentaesmaissimplesso:
pACGTA
OH
,pApCpGpTpAepACGTA
EstruturadoDNA
Como no caso da estrutura protica, algumas vezes til descrever a estrutura dos
cidos nuclicos em termos dos nveis hierrquicos de complexidade (primrio, secundrio e
tercirio)
A estrutura primria de um cido nuclico sua seqncia de nucleotdios e sua
estruturacovalente.
Qualquer estrutura estvel regular, assumida por alguns ou todos os nucleotdios em
umcidonuclico,podeserconsideradasuaestruturasecundria.
Ocomplexoenovelamentodeumlongocromossomodentrodacromatinaeucaritica
enonucleidebacterianogeralmenteconsideradosuaestruturaterciria

ODNAarmazenaainformaogentica
1865GregorMendel,publicaseutrabalhocomcruzamentoentrediferentestiposde
ervilhas, em que prope que certos tipos de caractersticas fsicas dessas plantas eram
transmitidasdegeraoemgeraoatravsdefatores.
1868 Miescher Isolou uma substncia contendo fsforo, que ele chamou de
nuclena
1889 Richard Altmann obteve preparaes altamente purificadas de nuclena, sem
nenhumacontaminaoporprotenas.Pelofatodeasubstnciatercartercido,sugeriuque
elafossechamadadecidonuclicoemvezdenuclena.
1944OswaJdT.Avery,ColinMacLeodeMaclynMcCarty

1952 Alfred Hershey e Martha


Chase confirmaram que o DNA o
componente cromossmico exclusivo que
contm a informao gentica das clulas
vivas.

Fim da dcada de 1940 Envin Chargaff e seus colegas descobriram que as quatro
bases nucleotdicas do DNA ocorrem em propores variadas nos DNAs de organismos
diferentesequeaquantidadedecertasbasesestointimamenterelacionadas
I. AcomposioembasesdoDNAgeralmentevariadeumaespcieparaoutra.
II. AmostrasdeDNAisoladasapartirdediferentestecidosdamesmaespciepossuama
mesmacomposioembases.
III. AcomposioembasesdoDNAemumamesmaespcienosealteracomaidadedo
indivduo,estadonutricionaloualteraoambiental.
IV. Em todos os DNAs celulares, independentes das espcies, o nmero de resduos da
adenosina igual ao nmero de resduos da timina (ou seja, A = T) e o nmero de
resduos d e guanosina igual ao nmero de resduos da citidina (G = C). A partir
dessas relaes, seguese que a soma dos resduos das purinas se iguala soma dos
resduosdepirimidina,ouseja,A+G=T+C.

1950 Rosalind Franklin e Maurice Wilkins DNA produzia um padro de difrao de


raiosXcaracterstico
DNA hlices com duas periodicidades ao longo do seu
eixo,umaprimeiracom3,4eumasegundade34

Modelo de DNA que explicasse os dados de difrao de raio X e tambm as


equivalnciasespecficasA=TeG=C
Em 1953, Watson e Crick postularam um modelo tridimensional da estrutura do DNA
quelevavaemconsideraotodososdadosdisponveis.
25 de abril de 1953 Watson e Crick publicaram a descoberta e em1962 ganharam o
PrmioNobeldeMedicina.
Duas cadeias helicoidais de DNA em volta do mesmo eixo para
formarumaduplahlicecomosentidodamodireita.
O esqueleto hidroflico dos grupos fosfatos e desoxirriboses
alternantes esto do lado de fora da dupla hlice, olhando para a gua
circundante.
As bases pricas e pirimdicas de ambas as fitas esto
empilhadasdentrodaduplahlice,comsuasestruturashidrofbicasde
anisquaseplanaresmuitoprximaseperpendicularesaolongodoeixo
O pareamento espacial das duas fitas cria um sulco principal e um
sulcosecundrionasuperfciedodplex.
Cada base nucleotdica de uma fita est pareada no mesmo plano
comumabasedaoutrafita.

As bases de ambas as cadeias so estruturas planas


(perpendiculares ao eixo imaginrio, separadas por uma
distnciase3,4)
10 pares de bases com 34 de comprimento /cada
volta completa da hlice (em solues aquosas possui 10,5
paresdebasescom36porvolta)

Watson e Crick encontraram que os


pareamentos de bases por pontes de hidrognio G
com C e A com T eram aqueles que melhor se
encaixavam dentro da estrutura, fornecendo um
racional para a regra de Chargaff que, em qualquer
DNA,G=CeA=T

Trs pontes de hidrognio podem ser formadas entre G e C e


duaspodemserformadasentreAeT
Fitaspossuemorientaoantiparalela
Asbasesadjacentesestoseparadaspor3,4
Asfitassocomplementares(AT,CG)
A dupla hlice de DNA mantida junta por duas foras: as
pontesdehidrognioentreosparesdebasescomplementareseas
interaesdeempilhamento.

ODNApodeocorreremoutrasformas
Muitos desvios significantes da estrutura do DNA de Watson e Crick so encontrados
noDNAcelularepodem desempenharfunes nometabolismodoDNA. Essasvariaesno
afetam as propriedadeschave do DNA definidas por Watson e Crick: complementaridade de
fitas,fitasantiparalelas,eorequerimentoparaospareamentosdebasesA=TeGC.
A variao estrutural no DNA reflete trs aspectos: as
diferentes conformaes possveis da desoxirribose, a rotao
sobre as ligaes contnuas que fazem o esqueleto
fosfodesoxirribose

earotaolivresobrealigaoC1Nglicosidica

A estrutura de Watson e Crick tambm


referidacomoaformaBdoDNA,ouDNAB.
Duas variantes estruturais que foram bem
caracterizadas em estruturas cristalinas so as formas A
eZ
FormaA:
Soluesrelativamentedesprovidasdegua;
Duplahlicedemodireita
Hlicemaislarga
FormaZ:
Duplahlicemoesquerda.
Estruturamaisdelgadaeelongada.

FunodoDNA
Armazenamentoetransmissodainformaobiolgica
DesnaturaoerenaturaodoDNA
SoluesdeDNAnativo,cuidadosamenteisolados,soaltamenteviscosasempH7,0e
atemperaturaambiente(25
o
C).
QuandotalsoluoforsubmetidaaextremosdepHouatemperaturasacimade8OC,
suaviscosidadediminuirapidamente,indicandoqueoDNAsofreuumaalteraofsica.
Calor e os extremos de pH produzem a
desnaturao, ou fuso, da dupla hlice do DNA. O
rompimento das ligaes de hidrognio entre as
bases pareadas e o empilhamento de bases produz
um desenovelamento da dupla hlice formando
duas fitas nicas. Nenhuma das ligaes covalentes
noDNAforamquebradas
A renaturao de uma molcula de DNA
um processo rpido, de uma etapa, desde que um
segmentodeduplahlicededozeoumaisresduos
ainda una as duas fitas. Quando o pH ou a
temperatura retornarem aos valores onde vivem a
maioria dos organismos, os segmentos
desenovelados das duas fitas espontaneamente se
reenovelam ou anelam, produzindo o dplex
intacto
Se as duas fitas esto completamente separadas, a renaturao ocorre em duas
etapas.Naprimeira,maislenta,asduasfitas"seencontram"porcolisesaleatriaseformam
um segmento curto de hlice dupla complementar. A segunda muito rpida: as bases
desempareadas restantes ficam sucessivamente em registro como pares de bases e as duas
fitas"fechamozper",formandoaduplahlice.
A ntima interao entre as bases empilhadas em um cido nuclico tem o efeito de
diminuir a sua absoro da luz UV em relao a uma soluo com a mesma concentrao de
nucleotdioslivres,eaabsorodiminudamaisaindaquandoduasfitascomplementaresde
cidonuclicosopareadas.Istochamadodeefeitohipocrmico.
A desnaturao de um cido nuclico de fita dupla produz o resultado oposto: um
aumentonaabsoro,chamadodeefeitohipercrmico.
AtransiodeumDNAdefitaduplaaumaforma
desnaturada de fita nica pode, dessa forma, ser
detectadapelomonitoramentodaabsorodaluzUV.

Molculas de DNA viral ou bacteriano em soluo desnaturamse quando elas so


aquecidas lentamente. Cada espcie de DNA possui uma temperatura de desnaturao
caracterstica, ou ponto de fuso (t
m
): quanto maior seu contedo em pares de bases G C,
maioropontodefusodoDNA.Istoporqueosparesdebases
G C, com suas trs pontes de hidrognio, requerem maior energia trmica para se
dissociarqueparesdebaseA=T

RNA
OprodutodetranscriodoDNAsempreumRNAdefitanica.Afita
nica tende a assumir uma conformao helicoidal de mo direita, dominada
por interaes de empilhamento de bases que so mais fortes entre as purinas
queentreumapurinaeoutrapirimidinaouentreduaspirimidinas.
O cido Ribonuclico um polinucleotdeo que difere do DNA em trs
aspectosbsicos:
OacarumaRibose;
formado,geralmente,porumafitasimplesquepodeenrolarse;
NoexisteabasepirimdicaTiminaenoseu
lugarseencontraabaseUracila.
Quaisquer seqncias autocomplementares na molcula produzem estruturas mais
complexas.
O RNA pode parear com regies complementares, quer de
RNAquerdeDNA.OpareamentodebasessegueospadresdoDNA:
GpareiacomCeApareiacomU.Umadiferenaqueopareamento
de bases entre resduos de G e U pouco usuais no DNA muito
comumnoRNA.AsfitaspareadasnoRNAounodplexRNADNAso
antiparalelas,comonoDNA.
ORNAnopossuinenhumaestruturasecundriasimples,regular,quefuncionecomo
um ponto de referncia, como a dupla hlice para o DNA. As estruturas tridimensionais de
muitos RNAs so complexas e nicas. Interaes fracas, especialmente interaes de
empilhamento de bases, desempenham um papel principal na estabilizao das estruturas
tantodeRNAcomodeDNA.
Ondeestiverempresentesseqnciascomplementares,aestruturapredominantede
fitaduplaaduplahlicedemodireitanaformaA.HlicesdeformaZtmsidoobtidasno
laboratrio (sob condies de alta concentrao de sais ou alta temperatura). A forma B do
RNAnotemsidoobservada.
Quebras na hlice da forma A regular, causadaspor bases mal ou no pareadas em
uma ou ambas as fitas, so comuns e resultam em salincias ou alas internas. Alas em
grampoformamseemseqnciasquaseautocomplementares.

TiposdeRNA
Os RNAs possuem um espectro mais amplo de funes que o DNA e vrias dessas
classessoencontradasnasclulas.
RNAsmensageiros(mRNA)
So intermedirios na expresso gnica, transportando a informao gentica de um
oualgunspoucosgenesdoDNAatosribossomos.
Nos procariotos, uma nica molcula de mRNA pode codificar para uma ou v rias
cadeias polipeptdicas. Se ela transporta o cdigo para apenas um polipeptdio, o mRNA
monocistrnico; se ela codifica para dois ou mais polipeptdios diferentes, o mRNA
policistrnico.Noseucariotos,amaioriadosmRNAsmonocistrnica.
RNAsribossmicos(rRNA)
o principal componente dos ribossomos, sendo o catalisador da sntese das
protenas.
RNAs de transferncia (tRNA): funcionam como molculas adaptadoras na sntese
proteica. Ligados de maneira covalente a um aminocido em uma extremidade, eles pareiam
commRNAdetalformaqueosaminocidossoligadosaumpolipeptdioemcrescimentona
sequnciacorreta.
Hpelomenos1tipodetRNAparacadaumdos20aminocidos.

Existem, ainda, uma ampla variedade de RNAs com funes especiais, incluindo alguns
(chamadosderibozimas)quepossuematividadeenzimtica

Nucleotdiosecidosnuclicospodemsofrertransformaesnoenzimticas
As purinas e as pirimidinas sofrem vrias alteraes espontneas na sua estrutura
covalente. A velocidade dessas reaes geralmente muito lenta, mas elas so
fisiologicamente significantes por causa da tolerncia muito baixa das clulas para alteraes
nasuainformaogentica
AlteraesnaestruturadoDNAqueproduzemmudanaspermanentesnainformao
genticacodificadasnesselugarsochamadasdemutaes
Vrias bases nucleotdicas sofrem a perda espontnea do seus grupos amino
exocclicos(desaminao)

Outra reao importante nos desoxirribonucleotdios a hidrlise da ligao N


glicosdicaentreabaseeapentose

Outras reaes so promovidas pela radiao. A luz UV induz a condensao de dois


grupos etileno para formar um anel ciclobutano. Na clula, a mesma reao entre bases
pirimidnicas adjacentes nos cidos nuclicos forma dmeros ciclobutano. Isso acontece mais
freqentementeentreresduosdetimidinaadjacentesnamesmafitadeDNA

A radiao ionizante (raios X e raios gama) pode causar a abertura do anel e a


fragmentaodasbases,bemcomoquebrasnoesqueletocovalentedoscidosnuclicos.
ODNApodetambmserlesadoporqumicosreativosintroduzidosnoambientecomo
produtosdaatividadeindustrial.
Duas classes proeminentes de tais agentes so: agentes desaminantes,
particularmenteocidonitroso(HN0
2
)oucompostosquepodemsermetabolizadosemcidos
nitrosoounitritos,eagentesalquilantes.
O cido nitroso (formado a partir de nitrosaminas e sais de nitrato e nitrito), e o
bissulfitosoumpotenteaceleradordadesaminaodasbases.Ambossousadosnos
alimentos para prevenir o crescimento de bactrias. No parece que eles
aumentem o risco do cncer significativamente quando usados em
pequenas quantidade, pois a contribuio para os nveis globais da leso
do DNA pequena (o risco a sade a partir do estrago de alimentos se
elesnoforemusadosmuitomaior).

OsagentesalquilantespodemalterarcertasbasesdoDNA.
Por exemplo, o qumico altamente reativo dimetilsulfato pode
metilar uma guanina para produzir O
6
metilguanina, que no
podeparearcomacitosina.

PossivelmenteamaisimportantefontedealteraesmutagnicasnoDNAsejaaleso
oxidativa. Espcies de oxignio excitadas como o perxido de hidrognio, radicais hidroxila e
radicais superxidos originamse durante a irradiao ou como subproduto do metabolismo
aerbio. Dessas espcies, os radicais hidroxila so responsveis pela maioria das leses
oxidativasdoDNA.
As clulas possuem um sistema elaborado de defesa para destruir as espcies de
oxignioreativas,incluindoenzimascomoacatalaseeasuperxidodismutasequeconvertem
as espcies reativas do oxignio para produtos sem perigo. Entretanto, uma frao desses
oxidantes inevitavelmente escapa dasdefesas celulares e ocorre a leso do DNA por meiode
umgrandegrupodereaescomplexas,variandodaoxidaodadesoxirriboseedasbasesat
quebrasdafita.
Muitos compostos carcinognicos nos alimentos, gua ou ar exercem seus efeitos
causadoresdecncermodificandoasbasesnoDNA.Noobstante,aintegridadedoDNAcomo
um polmero mais bem mantida que a do RNA ou da protena, porque o DNA a nica
macromolculaquepossuiobenefciodossistemasdereparobioqumico.Estesprocessosde
reparodiminuemgrandementeoimpactodalesodoDNA.

Exerccios
1) Oquesonucleotdeos?
2) Oquesoc.Nuclicos?
3) Quaisasfunesprincipaisdosnucleotdeos?
4) Quaissoosc.Nuclicosesuasfunes?
5) QuaisasprincipaisclassesdeRNAsencontradasnasclulas?Conceituecadaumdeles.
6) Qualadiferenaentrenucleotdeoenuclesdeo?
7) Danomenclaturaparaosnucleosdeosmonofosfatos.
8) CitetrsdiferenasentreDNAeRNA.
9) QuaisascaractersticasdafitadupladoDNA?(ObservaromodeloWatsonCrick).
10) Quaisosfatoresquepromovemadesnaturaodosc.Nuclicos?
11) Considerandodoisc.Nuclicos
a) Ricoembaseguanina
b) Ricoembasetimina
Qualtemmaiorpontodefuso?Explique.
12) Daraestruturadotrinucletdeo:5
,
CTA3
,
everificardequalc.Nuclicoelederivado.
13)
EscreveraseqnciadebasesdafitacomplementardaduplahlicedeDNAondeumadas
fitaspossuiaseqncia:5ATGCCCGTATGCATTC3.

14)
QuetiposdeinteraesmantmaestruturadaduplafitadeDNA?

15)
ExplicarporqueocorreoaumentonaabsorodaluzUV(efeitohipercrmico)quandoo
DNAduplafitadesnaturado.

16)
Emumaespciedebactriadesconhecidaaquantidadedetimina30%.Calcularas
percentagensdeadenina,citosinaeguanina.


METABOLISMODECIDOSNUCLEICOSESNTESEPROTEICA

ReplicaodoDNA:
Areplicaodosemiconservativa:

Areplicaocomeanaorigemeprocessabidirecionalmente:

AsntesedoDNAprossegueemumadireo53:
UmanovafitadeDNAsempresintetizadaemumadireo53,comaOH3livre
comopontodealongamentodoDNA.PelofatodeasduasfitasdeDNAseremantiparalelas,a
fita que funciona como molde lida a partir da sua extremidade 3 em direo sua
extremidade5.
OkazakiobservouqueumadasnovasfitasdeDNAerasintetizadaempedaoscurtos,
agora chamados de fragmentos de Okazaki. Dessa forma, uma fita sintetizada
continuamente e a outra descontinuamente. A fita contnua, ou fita lder, aquela onde a
sntese prossegue na mesma direo da movimentao da forquilha de replicao. A fita
descontnua, ou fita atrasada, aquela onde a sntese prossegue na direo oposta direo
damovimentaodaforquilha.

AsntesedoDNAfeitapelasDNApolimerases:
Primeiramente foi purificada e caracterizada uma DNA polimerase de E. coli, uma
enzima de um nico polipeptdio, agora chamada de DNA polimerase I. Mais tarde, os
investigadoresdescobriramqueaE.colicontinhapelomenosoutrasquatroDNApolimerases
distintas.
Estudos detalhados da DNA polimerase I revelaram caractersticas do processo de
sntesedoDNAqueagorasesabemsercomunsatodasasDNApolimerases.Onuclefiloo
grupo 3OH do nucleotdio na extremidade 3 da fita em crescimento. O ataque nucleoflico
ocorre no fsforo do desoxinucleosdio 5 trifosfato que chega. O pirofosfato inorgnico
liberadonareao.

Todas as DNA polimerases requerem um molde. A reao de polimerizao guiada


por uma fita de DNA molde de acordo com as regras de pareamento de bases preditas por
Watson e Crick: onde uma guanina estiver presente no molde, um desoxinucleotdio de
citosinaseradicionadonovafita,eassimpordiante.
A polimerase requer um iniciador. Um iniciador o segmento de uma fita
(complementar ao molde) com um grupo 3OH livre ao qual o nucleotdio pode ser
adicionado: a extremidade 3 livre do iniciador chamada de terminal do iniciador. Todas as
DNA polimerases podem adicionar nucleotdios apenas em uma fita preexistente. A maioria
dos iniciadores so oligonucleotdios de RNA em vez de DNA, e enzimas especializadas
sintetizaminiciadoresquandoeondeelessejamrequeridos.
Depois de adicionar um nucleotdio a uma fita de DNA em crescimento, uma DNA
polimerasedissociaseoumovimentaseaolongodomoldeeadicionaumoutronucleotdio.A
dissociaoeareassociaodapolimerasepodemlimitaravelocidadeglobaldapolimerizao
(maisrpidoseaadicionamaisnucleotdiosemsedissociar).Onumeromdiodenucleotdios
adicionadosantesqueapolimerasesedissociedefinesuaprocessividade.
AE.colipossuipelomenos5DNApolimerases.LogoapsoisolamentodaDNApolI,
evidnciassugeriramqueelanoeraapropriadaparaareplicaodeumcromossomogrande.
AprocuraporoutrasDNApolslevoudescobertadasDNApolIIedaDNApolIIInoinciodos
anos 70. A DNA pol II uma enzima envolvida em processos de reparo. A DNA pol III a
principal enzima de replicao da E. coli. As DNA pol IV e V, identificadas em 1999, esto
envolvidascomreparodoDNA.
ADNApolIIIpossui10tiposdesubunidades.A
atividade de polimerizao reside na subunidade e
derevisonasubunidade.

Etapasdareplicao:

Iniciao:
DnaA
ProtenaHU
DnaC
DnaB(helicases)
Topoisomerase(DNAgirase)
SSB(protenasdeligaofitasimples)

Alongamento:
Helicases
Topoisomerase
SSB
Iniciaseouprimase(DnaG)
DNApolimerase
DNAligase

Terminao:
SequnciasTer
ProtenaTus
TopoisomeraseIV

A replicao semelhante nas clulas eucariticas, mas os cromossomos eucariticos


possuemvriasorigensdereplicao.
AreplicaoprosseguecomumextraordinriograudefidelidadeemE.coli,umerro
feitoapenasumavezparacada10
9
a10
10
nucleotdiosadicionados.ParaocromossomodaE.
colideaproximadamente4,6x10
6
pb,istosignificaqueocorreumerroapenasumavezacada
1.000ou10.000replicaes.
A acurcia da reao de polimerizao se deve s ligaes de H que especificam o
pareamentocorretoentreasbasescomplementareseageometriacomumdosparesdebase
ATeGC.Entretanto,istoinsuficienteparaexplicaroaltograudefidelidadenareplicao.
Medidas in vitro mostram que a DNA pol insere um nucleotdio incorreto para cada 10
4
a10
5
corretos.Invivo,ataxadeerroreduzidapormecanismosenzimticosadicionais.

Atividadeexonuclease3 5:
TodasasDNApolimerases;
Revisacadanucleotdioapssuaadio;
Removeonucleotdiorecmsintetizado;
Apolimerasecomeanovamente;
Especficaparaparesdebasesdesempareados;
Melhoraaacurciade10
2
a10
3
vezes.

Atividadeexonuclease5 3:
DNApolI;
Substitui segmentos de DNA ou RNA pareado a uma fita molde (deslocamento ou
corte);

TranscrioeprocessamentodoRNA
TodasasmolculasdeRNA,excetoosgenomasdeRNAdecertosvrus,soderivadas
da informao permanentemente armazenada no DNA. Durante a transcrio, um sistema
enzimticoconverteainformaogenticadeumsegmentodeDNAdefitaduplaemumafita
deRNAcomumasequnciadebasescomplementaraumadasfitasdoDNA.
Apenas genes particulares ou grupos de genes so transcritos em um certo tempo e
algumas pores do genoma de DNA nunca so transcritas. A clula restringe a expresso da
informao gentica formao dos produtos gnicos necessrios em um momento
particular.SequnciasreguladorasespecficasmarcamoincioeofimdossegmentosdeDNA
aseremtranscritosedesignamquefitanoDNAdplexparaserusadacomomolde.
AsntesedeRNAdependedeDNA(molde);
Adireodasntese5 3;
ApenassegmentoslimitadosdeDNA;
feitapelasRNApolimerases;
Norequeruminiciador;
A iniciao ocorre quando a RNA pol se liga a sequncias especficas chamadas
promotores;
Topoisomerasesaliviamassuperespirasformadas;
RNApolnoapresentastioexonuclease3 5;
Umerroacada10
4
a10
5
ribonucleotdiosincorporados;
MuitasRNApolremovemumnucleotdiodespareadoapartirdaextremidade3pela
reversodaatividadepolimerase.

AlgunspromotoresemE.coli:

Regulaodatranscrio:
Podeocorreremqualqueretapadatranscrio;
Grandepartedaregulaosonasetapasdeligaodapolimeraseeiniciao;
Ligaodeprotenasprximasoudistantedospromotores

Terminaodatranscrio:
EncontrocomcertassequnciasdeDNAresultamempausadasntesedeRNA

ProcessamentodeRNAemeucariotos:
Capacete na extremidade 5 de mRNAs eucariticos: resduo de metiguanosina ligado
aoresduoterminal5domRNAporumaligao5trifosfato.

Processamentodentrons:sequnciasnocodificadoras(ntrons)sotranscritoscom
o resto do gene. Os ntrons so processados e os xons unidos para formar um RNA
funcionalmaduro.

Caudapoli(A):naextremidade3,80a250nucleotdiosdeA

Transcriptasereversa
RNA fita simples do genoma viral (~ 10.000
nucleotdios) e a enzima entram na clula
hospedeira. A transcritase reversa catalisa primeiro
asntesedeumafitadeDNAcomplementaraoRNA
viral,depoisdegradaafitadeRNAdo hbridoRNA
DNA viral e o substitui com DNA. O dplex de DNA
resultantefrequentementesetornaincorporadono
genomadaclulahospedeiraeucaritica.

Sntesedeprotenas
3resduosdenucleotdiosdoDNAsonecessriosparacodificarumaminocido.
Umcdonumatrincadenucleotdioquecodificaparaumaminocido.

Pautasdeleitura:

Cdonsdefunesespeciais
AUG:cdondeiniciao.
UAA,UGGeUGA:cdonsdeterminao

Cdigogenticodegenerado:umaminocidopodeserespecificadopormaisdeum
cdon,masumcdonespecificaapenasumaminocido.
Cdigogenticoquaseuniversal:pequenasvariaesencontradasemmitocndrias,
algumasbactriaseeucariotosunicelulares.

Asnteseproteicaocorreemcincoetapas:

Etapa1:Ativaodosaminocidos:
tRNAssoesterificadosaseusaminocidoscorrespondentes,comhidrlisedoATP.

Etapa2:Iniciao:
Ligao das subunidades ribossmicas ao mRNA com hidrlise de um GTP. Requer
fatoresdeiniciaoIF1,IF2,IF3.

Etapa3:Alongamento:
Requer o complexo de iniciao os aminoacil tRNA, fatores de alongamento (EFTu, EFTS,
EFG)eGTP.

Etapa4:Terminao:
Presenadeumdostrscdonsdeterminaoefatoresdeliberao.

Custoenergtico:
FormaodecadaaminoaciltRNAusadoisgruposfosfatosdealtaenergia.
GTPclivadoduranteaprimeiraetapadealongamentoeduranteatranslocao.
Umaligaopeptdicaformadagastaenergiade4ligaesdefodfato=4x30,5=122
KJ/mol
Hidrlisedaligaopeptdicalibera21kJ/mol
Energiapermitealtafidelidade.

Etapa5:Enovelamentoeprocessamento:
Acadeiapolipeptdicaenoveladaeprocessadaatsuaformabiologicamenteativa.
Modificaesnoterminalamino;
Perdadesequnciadesinalizao;
Modificaodeaminocidos;
FixaodeCHOemglicoprotenas;
Adiodegruposprostticos;
Processamentoproteoltico.

ExercciosMetabolismodecidosnuclicos
1) OprocessodereplicaodeDNAenvolveaparticipaode6protenas/enzimasprincipais.
Descreverbrevementeoprocessoenfatizandoafunodecadaprotena.

2) Esquematizar uma forquilha de replicao, localizando as seis protenas ou enzimas


envolvidas no processo, assim como a presena de primers na fita descontnua. A seguir,
representar a outra forquilha (continuao do DNA), observando como ocorrem a
replicaocontnuaeadescontnuanasmesmasfitasfrentedaorigemdereplicao.

3) ADNApolimeraseumaenzimaextremamenteimportantenoprocessodereplicao,j
quepossui3atividades.Descreverestasatividades.
4) AfunorevisoranareplicaodoDNAdeextremaimportnciaparaamanutenoda
espcie. A transcrio e a traduo no apresentam esta atividade durante a ocorrncia
dosprocessos.Explicar.

5) Diferenciarostermos:
a) Primerouiniciador.
b) FragmentosdeOkazaki.
6) Atranscrioeatraduosoprocessosintensosouocorremapenasocasionalmentenas
clulas?Discutir.

7) Enumerarsemelhanasediferenasqueentreatranscrioeareplicao.

8) Descreveroprocessodesnteseprotica,salientandoogastoenergtico

9) Predizerasseqnciasdosresduosdeaminocidosdospeptdeosformadosnatraduoa
partirdosseguintesmRNAs,assumindoqueocdoninicialaprimeiratrincadebasesem
cadaseqncia.
a)5GGUCAGUCGCUCCUGAUU3
b)5CAUGAUGCCUGUUGCUAC3
c)5UUGGAUGCGCCAUAAUUUGCU3
d)5AUGGACGAA3

10) UmadasfitasmoldedeumDNAduplahlicecontmaseqncia:
5CTTAACACCCCTGACTTCGCGCCGTCG3
a)QualaseqnciadebasesdomRNAtranscritaapartirdestafita?(53)
b)QualaseqnciadeaminocidoscodificadaporestemRNA?(NTCt)
c)Seafita complementaraestafitamoldedeDNA fortranscritaetraduzida, aseqncia de
resduosdeaminocidosresultanteseramesma?Explicarecitaraseqnciaderesduosde
aminocidos

INTRODUO AO METABOLISMO
Metabolismo:
Atividade celular altamente coordenada;
Sistemas multienzimticos atuam para:
obter energia qumica
converter os nutrientes em molculas com caractersticas prprias de
cada clula
polimerizar precursores monomricos em macromolculas
sintetizar e degradar biomolculas necessrias a funes celulares
especializadas
Os organismos vivos se dividem em dois grandes grupos, de acordo com a forma
qumica pela qual eles obtm carbono do meio:
auttrofos (bactrias fotossintticas e plantas vasculares)
hetertrofos (animais multicelulares e maior parte dos
microrganismos).



Ciclos de matria so impulsionados por um enorme fluxo de energia que comeam
com a captao da energia solar pelos organismos fotossintticos e sua utilizao para gerar
carboidratos ricos em energia e outros nutrientes orgnicos; esses nutrientes so ento
utilizados como fontes de energia pelos organismos heterotrficos.
O metabolismo, o somatrio de todas as transformaes qumicas que ocorrem em
determinada clula ou organismo, ocorre por meio de uma srie de reaes catalisadas
enzimaticamente, as quais constituem as vias metablicas.
O catabolismo a fase do metabolismo na qual molculas nutrientes orgnicas
(carboidratos, gorduras, protenas) sofrem degradao, sendo convertidas em produtos finais
menores e mais simples. As vias catablicas liberam energia , uma parte da qual conservada
na forma de ATP e de transportadores de eltrons reduzidos (NADH, NADPH e FADH
2
); a
energia restante liberada na forma de calor.
No anabolismo (biossntese) molculas precursoras pequenas e simples so ligadas
entre si formando molculas maiores e mais complexas, incluindo-se lipdios, polissacardios,
protenas e cidos nuclicos. As reaes anablicas requerem um fornecimento de energia
(ATP, NADH, NADPH ou FADH
2
)


Clulas possuem enzimas para degradar e sintetizar biomolculas regulao
recproca
As vias catablicas e anablicas que conectam os mesmos produtos finais podem
compartilhar muitas enzimas, mas, invariavelmente, ao menos um dos passos deve ser
catalisado por enzimas diferentes nas direes catablica e anablica, e essas enzimas
constituem pontos de regulao independentes.
Como contribuio adicional regulao independente das sequncias de reaes
catablicas e anablicas, elas geralmente ocorrem em diferentes compartimentos celulares,
como, por exemplo, catabolismo de cidos graxos nas mitocndrias e sntese de cidos graxos
no citosol.
As vias metablicas so reguladas em vrios nveis, intra e extracelulares:
Concentrao do substrato;
Regulao alostrica;
Hormnios.

Principais reaes na vias metablicas:
oxidao-reduo;
reaes que rompem ou criam ligaes carbono-carbono;
rearranjos internos, isomerizaes e eliminaes;
transferncia de grupos;
reaes com radicais livres.

PRINCPIOS DE BIOENERGTICA
As clulas e os organismos precisam realizar trabalho para manter a prpria vida, para
crescerem e para se reproduzirem. A capacidade de controlar a energia e dirigi-Ia para a
realizao de trabalho biolgico uma propriedade fundamental de todas as clulas e
organismos vivos e que deve ter sido adquirida muito cedo no curso da evoluo celular.
Os organismos atuais convertem uma forma de energia em outra. Eles utilizam a
energia qumica contida nos combustveis biolgicos para sintetizar, a partir de precursores
simples, molculas complexas e altamente organizadas. Eles tambm convertem essa energia
qumica em gradientes de concentrao e eltricos, em movimento e calor, e, em alguns
organismos em luz. Os organismos fotossintticos transformam a energia luminosa em todas
essas outras formas de energia.

Bioenergtica
o estudo quantitativo das transdues da energia que ocorrem nas clulas vivas, bem
como da natureza e funo dos processos qumicos envolvidos
As transformaes biolgicas de energia seguem as leis da termodinmica
A primeira lei o princpio da conservao de energia: para qualquer transformao
fsica ou qumica, a quantidade total de energia no universo permanece constante; a energia
pode mudar de forma ou ser transportada de uma regio para outra; entretanto, ela no
pode ser criada ou destruda.
A segunda lei da termodinmica refere-se tendncia que o universo apresenta para
uma desordem crescente: em todos os processos naturais, a entropia do universo aumenta.

Algumas definies:
Sistema reagente a coleo de matria que est sofrendo um determinado processo
fsico ou qumico; ele pode ser um organismo, uma clula ou dois compostos reagem.
O sistema reagente e seu meio ambiente constituem o universo.
Energia livre de Gibbs, G, expressa a quantidade de energia capaz de realizar trabalho
durante uma reao a temperatura e presso constantes. Quando uma reao ocorre com
liberao de energia livre, ou seja, quando o sistema se transforma de maneira a possuir
menos energia livre, a variao de energia livre, G, apresenta valor negativo, sendo a reao
denominada exergnica. Nas reaes endergnicas o sistema ganha energia livre, sendo o
valor de G positivo.
Entalpia, H, o contedo de calor do sistema reagente. Ela reflete o nmero e os tipos
de ligaes qumicas nos reagentes e produtos. Quando uma reao qumica libera calor, ela
denominada exotrmica; o contedo de calor dos produtos menor que o dos reagentes e H
possui, por conveno, um valor negativo. Sistemas reagentes que captam calor dos seus
ambientes possuem valores de H positivos, sendo denominados endotrmicos.
Entropia, S, uma expresso quantitativa da casualidade, ou aleatoriedade, ou, ainda,
desordem de um sistema. Quando os produtos de uma reao so menos complexos e mais
desordenados que os reagentes, a reao ocorre com um ganho em entropia. Por conveno,
S possui sinal positivo quando a entropia aumenta
Sob as condies existentes nos sistemas biolgicos, incluindo-se temperatura e
presso constantes, as variaes na energia livre, entalpia e entropia esto quantitativamente
relacionadas entre si pela equao:


A segunda lei da termodinmica refere-se a um aumento na entropia do universo
durante todos os processos fsicos e qumicos. A ordem produzida dentro das clulas medida
que elas crescem e se dividem mais que compensada pela desordem que elas criam nos seus
ambientes. Em resumo, os organismos vivos preservam a ordem interna pela captao de
energia livre do ambiente (nutrientes ou luz solar) devolvendo para ele uma quantidade igual
de energia nas formas de calor e entropia.

As clulas necessitam de fontes de energia livre
As clulas so sistemas isotrmicos elas funcionam essencialmente em temperatura
constante (e tambm em presso constante). O fluxo de calor no uma fonte de energia para
as clulas porque o calor capaz de realizar trabalho somente quando ele passa para uma
regio ou objeto com menos temperatura.
A energia que as clulas utilizam a energia livre, que permite predizer o sentido das
reaes qumicas, sua exata posio de equilbrio e a quantidade de trabalho que elas podem
teoricamente realizar em temperatura e presso constantes.
As clulas heterotrficas obtm energia livre das molculas nutrientes, e as clulas
fotossintticas a obtm da radiao solar absorvida. Ambos os tipos de clulas transformam
essa energia livre em ATP e outros compostos ricos em energia, todos eles capazes de fornecer
energia para a realizao de trabalho biolgico temperatura constante.
A variao de energia livre-padro est diretamente relacionada com a constante de
equilbrio:




Se a constante de equilbrio para uma determinada reao qumica for igual a 1,a
variao de energia livre-padro (G
o
) da reao ser igual a 0.
Se a K
eq
for maior que 1, G
o
ter valor negativo.
Se a K
eq
for menor que 1, G
o
ter valor positivo.
Como a relao entre G
o
e K
eq
exponenciaI, variaes relativamente pequenas no
valor de G
o
correspondem a grandes variaes na K
eq
.



S T H G =
dD cC bB aA + +
b a
d c
'
eq
] B [ ] A [
] D [ ] C [
K =
'
eq
o '
K ln RT G =
A variao real de energia livre depende das concentraes de reagentes e produtos
Cada reao qumica apresenta uma variao de energia livre-padro caracterstica,
que pode ser positiva, negativa ou igual a zero, dependendo da constante de equilbrio da
reao.
G
o
uma constante, uma vez que seu valor para uma determinada reao
caracterstico e invarivel.
Entretanto, a variao de energia livre real, G, uma funo das concentraes do
reagente e do produto, alm da temperatura.
G para qualquer reao que ocorre espontaneamente no sentido do equilbrio
sempre negativo, torna-se menos negativo medida que a reao evolui, atingindo o valor
zero no ponto de equilbrio.
Para uma reao:




No equilbrio:








G menor que zero (reao favorvel) pode no acontecer com velocidade mensurvel
necessrio romper a barreira da energia de ativao

As variaes de energia livre-padro so aditivas





Reaes Biolgicas de Oxidao-Reduo
O fluxo de eltrons nas reaes de oxidao-reduo responsvel, direta ou
indiretamente, por todo trabalho realizado pelos organismos vivos.
Embora oxidao e reduo ocorram em conjunto, conveniente que as duas metades
de uma reao de oxidao- reduo sejam representadas separadamente. Por exemplo, a
oxidao do on ferroso pelo on cprico,
pode ser descrita em termos de duas meias-reaes:



dD cC bB aA + +
] B ][ A [
] D ][ C [
ln RT G G
o '
+ =
'
eq
o '
o '
o '
K ln RT G
] B ][ A [
] D ][ C [
ln RT G
] B ][ A [
] D ][ C [
ln RT G 0
0 G
=
=
+ =
=
o '
2
o '
1
o '
3
o '
2
o '
1
G G G C A
G C B
G B A
+ =


+ + + +
+ + Cu Fe Cu Fe
3 2 2
+ +
+ +
+
+
Cu e Cu
e Fe Fe
2
3 2
Em uma reao de oxidao- reduo, a molcula doadora de eltrons denominada
agente redutor e molcula receptora de eltrons o agente oxidante
Nos sistemas biolgicos, oxidao , freqentemente, sinnimo de desidrogenao e
muitas das enzimas que catalisam reaes de oxidao so desidrogenases

Os potenciais de reduo medem a afinidade por eltrons
Quando dois pares redox conjugados esto presentes em uma soluo, a transferncia
de eltrons pode ocorrer espontaneamente. A tendncia para que a reao ocorra depende da
afinidade relativa do receptor de eltrons de cada par redox. O potencial de reduo- padro ,
E
o
, uma medida (em volts) desta afinidade, pode ser determinado experimentalmente.


Padro de referncia:

Por conveno, meia clula com a maior tendncia em adquirir eltrons atribudo
um valor positivo para E
o
.









V 0 , 0 E H
2
1
e H
o '
2
= +
+
o ' o '
-
-
o
E nF G
E nF G
] e de doador [
] e de recptor [
ln
nF
RT
E E
=
=
+ =


Transferncia de grupos fosforila e ATP
O ATP atua como a ligao entre o catabolismo e o anabolismo. Ele a moeda
energtica da clula viva. A converso exergnica do ATP em ADP e Pi, ou em AMP e Pp
i
est
acoplada a muitas reaes e processos endergnicos.
A hidrlise direta do ATP a fonte de energia nas mudanas conformacionais que
produzem a contrao muscular, mas, em geral, no a hidrlise do ATP e sim a transferncia
de grupos fosforila, pirofosforila ou adenilil do ATP para a molcula de um substrato ou de
uma enzima que transfere a energia da quebra do ATP para as transformaes endergnicas
dos substratos.
Por meio dessas reaes de transferncia de grupos o ATP fornece a energia para as
reaes anablicas, incluindo a sntese de molculas informativas e o transporte de molculas
e ons atravs de membranas e contra gradientes de potencial eltrico e de concentrao.
As clulas contm outros metablitos com energia livre de hidrlise grande e
alguns so: o fosfoenolpiruvato, o 1,3
alta energia, como o ATP, tm um potencial de transferncia do grupo fosforila grande; eles
so bons doadores desse grupo. A energia livre de hidrlise
valores grandes e negativos.
Presentes em todas as clulas, o polifosfato inorgnico pode servir como um
reservatrio de grupos fosforila com alto potencial de transferncia desse grupo.






GLICLISE, FERMENTAO E VI

Via glicoltica ou gliclise
A glicose o principal combustvel da maioria dos organismos ocupa uma posio
central no metabolismo.

Gliclise:
Glicose (6 carbonos) rompida liberando 2 molculas de piruvato (3carbonos);
Parte da energia livre liberada conservada na forma de ATP e NADH.

A gliclise uma via central quase universal do catabolismo da glicose. a via pela
qual, na maioria das clulas, ocorre o maior fluxo de carbono. Em certos tecidos e tipos
celulares de mamferos (eritrcitos, medula renal, crebro e esperma, por exemplo), a glicose,
por meio da gliclise, a principal, ou mesmo a nica, fonte de energia metablica.

Uma viso geral: a gliclise possui duas fases
A glicose degradada a piruvato, em
Os cinco primeiros passos constituem a
de pagamento.







As clulas contm outros metablitos com energia livre de hidrlise grande e
alguns so: o fosfoenolpiruvato, o 1,3-bifosfoglicerato e a fosfocreatina. Esses compostos de
alta energia, como o ATP, tm um potencial de transferncia do grupo fosforila grande; eles
so bons doadores desse grupo. A energia livre de hidrlise dos tiosteres tambm exibe

Presentes em todas as clulas, o polifosfato inorgnico pode servir como um
reservatrio de grupos fosforila com alto potencial de transferncia desse grupo.
FERMENTAO E VIA DAS PENTOSES FOSFATO
Via glicoltica ou gliclise
A glicose o principal combustvel da maioria dos organismos ocupa uma posio

Glicose (6 carbonos) rompida liberando 2 molculas de piruvato (3carbonos);
Parte da energia livre liberada conservada na forma de ATP e NADH.
A gliclise uma via central quase universal do catabolismo da glicose. a via pela
qual, na maioria das clulas, ocorre o maior fluxo de carbono. Em certos tecidos e tipos
e mamferos (eritrcitos, medula renal, crebro e esperma, por exemplo), a glicose,
por meio da gliclise, a principal, ou mesmo a nica, fonte de energia metablica.
Uma viso geral: a gliclise possui duas fases
A glicose degradada a piruvato, em uma sequncia de 10 passos.
Os cinco primeiros passos constituem a fase preparatria e o restante constitui a
As clulas contm outros metablitos com energia livre de hidrlise grande e negativa,
bifosfoglicerato e a fosfocreatina. Esses compostos de
alta energia, como o ATP, tm um potencial de transferncia do grupo fosforila grande; eles
dos tiosteres tambm exibe
Presentes em todas as clulas, o polifosfato inorgnico pode servir como um
reservatrio de grupos fosforila com alto potencial de transferncia desse grupo.
A glicose o principal combustvel da maioria dos organismos ocupa uma posio
Glicose (6 carbonos) rompida liberando 2 molculas de piruvato (3carbonos);
Parte da energia livre liberada conservada na forma de ATP e NADH.
A gliclise uma via central quase universal do catabolismo da glicose. a via pela
qual, na maioria das clulas, ocorre o maior fluxo de carbono. Em certos tecidos e tipos
e mamferos (eritrcitos, medula renal, crebro e esperma, por exemplo), a glicose,
por meio da gliclise, a principal, ou mesmo a nica, fonte de energia metablica.
e o restante constitui a fase



















Fase preparatria:
Duas fosforilaes - ATP o doador de grupo fosfato;
Frutose 1,6-bifosfato formada quebrada para liberar gliceraldedo 3-fosfato ;
Duas molculas de ATP so gastas, aumentando o contedo de energia livre dos
intermedirios.

Fase de pagamento:
Gliceraldedo 3-fosfato convertido a piruvato
A maior parte da energia conservada pela formao de quatro molculas de ATP.
Produto lquido: duas molculas de ATP por molcula de glicose
Energia tambm conservada pela formao de duas molculas de NADH.

A equao global final para a gliclise :


Glicose completamente oxidada a CO
2
e H
2
O, G
o
= -2840 KJ/mol.
Degradao da glicose na via glicoltica , G
o
= -146 KJ/mol - 5,2% da energia total.
As duas molculas de piruvato ainda rtem a maior parte da energia biolgica
disponvel na molcula de glicose.

Importncia dos intermedirios fosforilados
Todos os nove lntermedirios da gliclise situados entre a glicose e o piruvato so
fosforilados. Os grupos fosforila parecem ter trs funes:
1. Intermedirios glicolticos fosforilados no podem sair da clula.
2. Os grupos fosfato so componentes essenciais na conservao enzimtica da energia
metablica.
3. Grupos fosfato contribuem para baixar a energia de ativao.

Fase preparatria da gliclise: necessita de ATP
A fase preparatria da gliclise requer o investimento de duas molculas de ATP e
resulta na clivagem da cadeia carbnica da hexose em duas trioses fosfato
1. Fosforilao da glicose: A glicose ativada para as reaes subseqentes pela sua
fosforilao em C-6 para liberar a glicose 6-fosfato; o doador de fosfato o ATP:

irreversvel sob as condies intracelulares
Catalisada pela hexoquinase (catalisa tambm a fosforilao de outras hexoses
comuns, como a D-frutose e a D- manose).
Hexoquinase est presente em todas as clulas de todos os organismos.
Os hepatcitos tambm contm uma forma de hexoquinase chamada de hexoquinase
IV ou glicoquinase, a qual mais especfica para a glicose.

Converso da glicose 6-fosfato em frutose 6-fosfato: Catalisada pela enzima
fosfoexose isomerase (fosfoglicose isomerase)
O H 2 ATP 2 H 2 NADH 2 piruvato 2 P 2 ADP 2 NAD 2 e cos Gli
2 i
+ + + + + + +
+ +


3. Fosforilao da frutose 6 -fosfato em frutose 1,6-bifosfato: A fosfofrutoquinase-1
(PFK-1) catalisa a transferncia de um grupo fosfato do ATP para frutose 6-fosfato para liberar
a frutose 1,6-bifosfato

A reao da PFK - 1 essencialmente irreversvel nas condies celulares.
Algumas bactrias, protistas e vegetais possuem uma fosfofrutoquinase que usa o
pirofosfato (PP
i
) e no o ATP como o doador do grupo fosfato :



4. Clivagem da frutose 1,6-bifosfato: Catalisada pela enzima frutose 1,6-bifosfato
aldolase, ou apenas aldolase.
Possui uma variao da energia livre-padro fortemente positiva na direo da diviso
da frutose 1,6-bifosfato, mas produtos so removidos rapidamente pelos passos seguintes.


5. A interconverso das trioses fosfato: Apenas o gliceraldedo 3-fosfato segue nos
passos subseqentes da gliclise. Entretanto, o outro produto, a diidroxiacetona fosfato,
rpida e reversivelmente convertido em gliceraldedo 3-fosfato pela quinta enzima da
sequncia glicoltica, a triose fosfato isomerase:



mol / KJ 14 G
P bifosfato - 1,6 frutose PP fosfato - 6 frutose
o '
i i
=
+ +
Fase de pagamento:
A fase de pagamento da gliclise inclui os passos de fosforilao conservadores da
energia, nos quais parte da energia livre contida na molcula da glicose conservada na forma
de ATP.
A converso das duas molculas de gliceraldedo 3-fosfato em duas molculas de
piruvato acompanhada pela formao de quatro molculas de ATP, formadas a partir de ADP
e P
i
. Entretanto, o rendimento lquido de ATP por molcula de glicose degradada apenas
dois, porque duas molculas de ATP foram investidas na fase preparatria da gliclise para
fosforilar ambas as extremidades da molcula de hexose.

6. Oxidao do gliceraldeido 3-fosfato em 1,3-bifosfoglicerafo: Catalisada pelo
gliceraldedo 3-fosfato desidrogenase:

O grupo aldedo do gliceraldeido 3-fosfato desidrogenado em um anidrido de cido
carboxlico com o cido fosfrico. A maior parte da energia livre de oxidao do grupo
aldedo do gliceraldedo 3-fosfato conservada pela formao do grupo acilfosfato em
C-1 do 1,3- bifosfoglicerato.
O receptor de hidrognio a coenzima NAD
+
, produzindo a coenzima reduzida NADH.
O outro tomo de hidrognio aparece em soluo como H
+
.
O gliceraldedo 3-fosfato est ligado de maneira covalente desidrogenase durante a
reao catalisada pela gliceraldedo 3-fosfato desidrogenase
Como todas clulas contm quantidades limitadas de NAD
+
, a gliclise logo cessa ria
caso o NADH gerado nesse passo da via glicoltica no fosse continuamente reoxidado.

7. Transferncia do fosfato do 1,3-bifosfoglicerato para o ADP: Catlisada pela enzima
fosfogliceratoquinase :

Juntos, os passos 6 e 7 da gliclise constituem um processo acoplador de transferncia
de energia no qual o intermedirio comum o 1,3-bifosfoglicerato; ele formado na primeira
reao (que endergnica quando isolada), e na segunda reao (que fortemente
exergnica) seu grupo acilfosfato transferido ao ADP para formar ATP. A soma das duas
reaes em seqncia :
Gliceraldedo 3-fosfato + ADP + P
i
+ NAD
+
3-fosfoglicerato + ATP + NADH + H
+

G
o
= -12,5kJ/mol
Portanto, a reao global exergnica.

A energia, liberada na oxidao de um aldedo a um grupo carboxilato, conservada
pela formao concomitante de ATP com o emprego e ADP e P
i
.
A formao de ATP pela transferncia de um grupo fosfato de um substrato como o
1,3- bifosfoglicerato referida como fosforilao ao nvel do substrato, para distinguir seu
mecanismo daquele da fosforilao ligado respirao.

8. Converso do 3-fosfoglicerato em 2-fosfoglicerato: A enzima fosfoglicerato mutase
catalisa a transferncia reversvel do grupo fosfato entre C-2 e C-3 do glicerato:




9. Desidratao do 2-fosfoglicerato em fosfoenolpiruvato : A segunda reao
glicoltica que gera um composto com alto potencial de transferncia do grupo fosforila
catalisada pela enolase. Essa enzima promove a remoo reversvel de uma molcula de gua
do 2-fosfoglicerato para liberar fosfoenolpiruvato (PEP) :


10. Transferncia do grupo fosfato do fosfoenolpiruvato para o ADP: O ltimo passo
na gliclise a transferncia do grupo fosfato do fosfoenolpiruvato para o ADP, catalisada pela
piruvato quinase

Nessa reao, de fosforilao ao nvel do substrato, o produto piruvato aparece
primeiro na sua forma enol que tautomeriza de maneira rpida, embora no-enzimtica, para
a forma ceto do piruvato, a forma que predomina em pH 7.

A reao da piruvato quinase essencialmente irreversvel sob condies
intracelulares

Balano da gliclise:


As duas molculas de NADH formadas pela gliclise no citosol so, em condies
aerbias, reoxidadas em NAD
+
pela transferncia dos seus eltrons para a cadeia de
transferncia de eltrons que, nas clulas eucariticas, est localizada nas mitocndrias.


A transferncia de eltrons do NADH para o O
2
nas mitocndrias fornece a energia
para a sntese do ATP pela fosforilao ligada respirao (fosforilao oxidativa)


H evidncias de que dentro das clulas as enzimas da via glicoltica existam como
complexos multienzimticos: quando as enzimas purificadas da gliclise so combinadas in
vitro em concentraes relativamente altas, elas formam agregados funcionais e especficos,
que pode refletir o seu estado verdadeiro no interior das clulas. Esses complexos
multienzimticos garantem uma passagem eficiente do produto de uma enzima para a
prxima enzima na via.


O H 2 ATP 2 H 2 NADH 2 piruvato 2 P 2 ADP 2 NAD 2 e cos Gli
2 i
+ + + + + + +
+ +
O H 2 NAD 2 O H 2 NADH 2
2 2
+ + +
+ +









Regulao da via glicoltica:


Fosfofrutoquinase 1


Hexoquinase: inibida por glicose 6-fosfato
Piruvato quinase: inibida por ATP

Destinos do piruvato:


Em condies aerbias, o piruvato oxidado a acetato, o qual entra no ciclo do cido
ctrico e oxidado at C0
2
e H
2
O, o NADH formado pela desidrogenao do gliceraldedo 3-
fosfato reoxidado a NAD
+
pela passagem do seu eltron ao O
2
no processo da respirao
mitocondrial.
Entretanto, sob condies anaerbias, o NADH gerado pela gliclise no pode ser
reoxidado pelo O
2
. A incapacidade de regenerar o NADH em NAD
+
deixaria a clula sem
receptor de eltrons para a oxidao do gliceraldeido 3-fosfato e as reaes libertadoras de
energia da glicose cessariam.


As primeiras clulas a surgirem durante a evoluo viviam em uma atmosfera quase
desprovida de oxignio e tiveram que desenvolver estratgias para obter energia das
molculas nutrientes sob condies anaerbias. A maioria dos organismos modernos reteve a
capacidade de regenerar continuamente o NAD
+
durante a gliclise anaerbia pela
transferncia dos eltrons do NADH para receptores adequados com a formao produtos
finais reduzidos, como o lactato e o etanoI.


Fermentao o nome geral para a degradao anaerbia da glicose ou de outros
nutrientes orgnicos com o objetivo de obter energia e conserv-la como ATP.

Fermentao ltica:


Quando os tecidos animais no podem ser supridos com oxignio suficiente para
suportar a oxidao aerbia do piruvato e do NADH produzidos na gliclise, o NAD
+

regenerado a partir do NADH pela reduo do piruvato a lactato.
Alguns tecidos e tipos celulares, como os eritrcitos que no tm mitocndrias e,
portanto, no podem oxidar o piruvato a CO
2
, tambm produzem lactato partindo da glicose,
mesmo sob condies aerbias,
A reduo do piruvato catalisada pela lactato desidrogenase, que forma o ismero L
do cido lctico.




Na gliclise, a desidrogenao de duas molculas de
gliceraldedo 3-fosfato converte duas molculas de NAD
+

em duas de NADH. Como na reduo de duas molculas
de piruvato em duas de lactato regenera duas molculas
de NAD
+
, no ocorre variao lquida em NAD
+
ou NADH

















O lactato formado pelo msculo esqueltico em atividade (ou pelos eritrcitos) pode
ser reciclado:
Transporte at o fgado (pelo sangue)
Converso do piruvato em glicose (gliconeognese).
Lactato produzido em grandes quantidades (durante as contraes musculares
vigorosas): acidificao (ionizao do cido lctico) do msculo e no sangue - limite s
contraes vigorosas.


O H 2 ATP 2 lactato 2 P 2 ADP 2 e cos Gli
NAD 2 lactato 2 H 2 NADH 2 piruvato 2
O H 2 ATP 2 H 2 NADH 2 piruvato 2 P 2 ADP 2 NAD 2 e cos Gli
2 i
2 i
+ + + +
+ + +
+ + + + + + +
+ +
+ +
Algumas bactrias tambm produzem cido ltico partir de glicose (bactrias lticas)
e so utilizadas na produo de iogurte (Lactobacillus bulgaricus). A produo de cido ltico
provoca abaixamento do pH, que leva precipitao das protenas do leite, promovendo a
textura e o sabor cido caracterstico do iogurte.



Fermentao alcolica:


A levedura e outros microrganismos fermentam a glicose em etanol e CO
2
e no em
lactato. A glicose convertida em piruvato pela gliclise e o piruvato convertido em etanol e
CO
2
em um processo de dois passos:

No primeiro passo: descarboxilao, uma reao
irreversvel catalisada pela piruvato descarboxilase. A
piruvato descarboxilase requer Mg
2+
e tem uma
coenzima firmemente ligada, a tiamina pirofosfato.
No segundo passo, por meio da ao da lcool
desidrogenase, o acetadeldo reduzido a etanol, com o
NADH, derivado da atividade da gliceraldedo 3-fosfato
desidrogenase, fornecendo o poder redutor














A piruvato descarboxilase est presente nas leveduras de cervejaria e padaria e em
todos os outros organismos que promovem a fermentao alcolica, incluindo algumas
plantas. O CO
2
produzido na descarboxilao o responsvel pela carbonatao caracterstica
de algumas bebidas fementadas (champanhe, cerveja).
Na panificao, o C0
2
liberado pela piruvato carboxilase provoca o aumento de volume
da massa fermentada.
A lcool desidrogenase est presente em muitos organismos que metabolizam o
lcool, incluindo o homem. No fgado humano, ela catalisa a oxidao do etanol, quer seja
ingerido quer seja produzido por microrganismos intestinais, com a concomitante reduo do
NAD
+
para NADH.



Outras fermentaes:


Certos microrganismos presentes nos produtos alimentares naturais fermentam os
carboidratos e originam substncias que do a esses alimentos suas formas, texturas e sabores
O H 2 ATP 2 CO 2 ol tan e 2 P 2 ADP 2 e cos Gli
NAD 2 CO 2 ol tan e 2 H 2 NADH 2 piruvato 2
O H 2 ATP 2 H 2 NADH 2 piruvato 2 P 2 ADP 2 NAD 2 e cos Gli
2 2 i
2
2 i
+ + + + +
+ + + +
+ + + + + + +
+ +
+ +
A bactria, Propionibacterium freudenreichii, fermenta o leite produzindo cido
propinico e CO
2
; o cido propinico precipita as protenas do Ieite e o CO
2
forma as bolhas
que faz em aparecer os buracos caractersticos dos queijos suos.


Muitos outros produtos alimentares so resultantes de fermentaes , como, por
exemplo, picles, chucrute, salsichas, molho de soja (shoyu). A queda no pH associada com a
fermentao tambm ajuda a preservao dos alimentos, uma vez que muitos microrganismos
que provocam sua deteriorao no conseguem se multiplicar em pH muito cido.


Alguns subprodutos agrcolas, como o talo do milho, so empregados para alimentar
animais e sua conservao feita em grandes silos com pequeno acesso de ar; a fermentao
microbiana que ocorre produz cidos que abaixam o pH. A silagem resultante dessa
fermentao pode ser guardada por longos perodos sem se estragar e, assim, pode ser usada
como rao animal.


As fermentaes so empregadas na indstria para produzir muitos compostos
orgnicos de grande valor comercial a partir de matrias primas baratas (amido de
milho,melao) e adio de cultura pura de um microrganismo especfico. Metanol, butanol,
glicerol, isopropanol, cido frmico, actico, propinico, butrico, so exemplos decompostos
que podem ser obtidos atravs da fermentao de carboidratos por microrganismos.




Vias afluentes da gliclise:


Alm da glicose, muitos outros carboidratos encontram seu destino metablico na via
glicoltica aps sofrer transformao enzimtica em um dos intermedirios da via glicoltica.

Glicognio e amido:


Glicognio e o amido podem ser mobilizados para uso em glicose 1-fosfato dentro da
clula por meio de uma reao fosforoltica catalisada pela fosforilase do glicognio (ou
fosforilase do amido). Essas enzimas catalisam o ataque pelo P
i
na ligao glicosdica (1 4)
que une os ltimos dois resduos de glicose na ponta no redutora, gerando do glicose 1-
fosfato e um polmero diminudo de uma unidade de glicose.

A fosforlise preserva na glicose 1-fosfato, um ster fosfrico, parte da energia da
ligao glicosdica. A fosforilase do glicognio (ou a fosforilase do amido) age repetidamente
at se aproximar de um ponto de ramificao ( 1 6) onde cessa sua ao.
Uma enzima desramificadora (oligo ( 1 6) para ( 1 4) glicantransferase)
promove duas reaes sucessivas que transferem a ramificao. Uma vez transferidos os
resduos a atividade da fosforilase do glicognio pode continuar


A glicose 1-fosfato, o produto final das reaes da fosforilase do glicognio e do amido,
convertida em glicose 6-fosfato pela fosfoglicomutase, que catalisa a reao reversvel:
Glicose 1-fosfato glicose 6-fosfato
A glicose 6-fosfato formada dessa maneira pode entrar na via glicoltica ou em outra
via, como a das pentoses fosfato

Regulao da fosforilase do glicognio
A fosforilasedo glicognio existe sob duas formas conversveis entre si: a glicognio
fosforilase a, que cataliticamente ativa, e a glicognio fosforilase b, que menos ativa. A
glicognio fosforilase b predomina no msculo em repouso, mas durante a atividade muscular
vigorosa, a epinefrina provoca a fosforilao de um resduo especifico de serina na fosforilase
b, o que a converte na forma a (ativa)
A enzima responsvel pela ativao da fosforilase do glicogenio (fosforilase b quinase)
por transferncia de um grupo fosforila para um resduo de serina , ela prpria, ativada pela
epinefrina e tambm pelo glucagon



















A fosforilase do glicognio tambm regulada alostericamente:











Polissacardios e dissacardios da dieta:
O amido digerido pelas -amilases salivar e pancretica formando maltose e
maltotriose e dextrinas (fragmentos de amilopectina contendo pontos de ramificao). O
glicognio ingerido tem a mesma estrutura da amilopectina e sua digesto ocorre da mesma
forma.
Os dissacardios e as dextrinas so hidrolisados pelas enzimas presas na superfcie
externa das clulas epiteliais que recobrem o intestino delgado.


Os monossacardios assim formados so transportados ativamente para o interior das
clulas epiteliais e passam para a corrente sangnea e so transportados at os diferentes
tecidos nos quais so fosforiladose introduzidos na seqncia glicoltica.



Os monossacardios entram na via glicoltica em vrios pontos:
Na maioria dos organismos, vrias hexoses diferentes da glicose podem sofrer a
gliclise, aps suas respectivas converses para um derivado fosforilado.

Frutose:
A D-frutose, presente em muitas frutas na forma livre e formada pela hidrlise da
sacarose no intestino delgado de vertebrados, fosforilada pela hexoquinase:
Frutose + ATP frutose 6-fosfato +ADP
No fgado, a enzima frutoquinase catalisa a fosforilao da frutose, no em C-6, mas
em C- 1:
Frutose + ATP frutose 1-fosfato +ADP
A frutose 1-fosfato ento rompida para formar gliceraldedo e diidroxiacetona
fosfato pela frutose 1-fosfato aldolase.

A diidroxiacetona fosfato convertida em gliceraldedo 3-fosfato pela enzima
glicoltica triose fosfato isomerase. O gliceraldedo fosforilado pelo ATP a gliceraldedo 3-
fosfato pela ao da triose quinase
gliceraldedo + ATP gliceraldedo 3-fosfato +ADP

Galactose:
A D-galactose, derivada por hidrlise do dissacardio lactose (acar do leite),
transportada pelo sangue do intestino at o fgado, onde primeiro fosforilada pelo ATP em C-
1, e por meio da enzima galactoquinase
galactose + ATP galactose 1-fosfato +ADP
A galactose 1-fosfato convertida, ento, no seu epmero em C-4, a glicose 1-fosfato,
por um conjunto de reaes nas quais a uridina difosfato (UDP) funciona de forma semelhante
a uma coenzima como transportadora de molculas de hexose. A epimerizao envolve
primeiro a oxidao do grupo -OH em C-4 a cetona, que seguida por reduo da cetona a -OH
com inverso da configurao em C-4. O NAD o co-fator tanto da oxidao como da reduo



















Manose:
A D-manose liberada pela digesto de vrios polissacardios e glicoprotenas
presentes na alimentao, ela pode ser fosforilada em C-6 pela hexoquinase
manose + ATP manose 6-fosfato +ADP
A seguir, a manose 6-fosfato isomerizada pela ao da fosfomanose isomerase, para
liberar a frutose 6-fosfato




Via das pentoses fosfato:
Na maioria dos tecidos animais, o principal destino catablico da glicose 6-fosfato a
degradao glicoltica at piruvato. Existem, entretanto, outras vias catablicas que podem
mudar o destino da glicose 6-fosfato e que a levam a produtos especializados necessrios para
a clula.Uma destas vias via das pentoses fosfato na qual NADP
+
o receptor de eltrons e
transforma-se em NADPH.
As clulas em diviso rpida, como aquelas da pele,da medula ssea e da mucosa
intestinal, usam pentoses para sintetizar RNA, DNA e coenzimas como ATP, NADH, FADH
2
e
coenzima A. Elas obtm estas pentoses da via das pentoses fosfato, que produz pentoses e
NADP
Em outros tecidos, o produto principal da via das pentoses fosfato no so as
pentoses, mas o NADPH, que empregado nas redues biossintticas ou na defesa contra os
efeitos deletrios dos radicais do oxignio. As pentoses podem, ento, serem regeneradas a
hexoses.



A fase oxidativa produz pentoses fosfato e
NADPH
A primeira reao da via das pentoses fosfato a
oxidao da glicose 6-fosfato pela glicose 6-fosfato
desidrogenase (G6PD) para formar 6-fosfoglicono--
lactona, um ster intramolecular. O NADP
+
o receptor
de eltrons e o equilbrio final est muito deslocado na
direo da formao do NADPH
A lactona hidrolisada pela ao de uma
lactonase especfica e forma o 6-fosfogliconato, que
sofre desidrogenao e descarboxilao pela 6-
fosfogliconato desidrogenase para formar a
cetopentose ribulose 5-fosfato. essa reao que gera
a segunda molcula de NADPH . A fosfopentose
isomerase converte a ribulose 5-fosfato no seu
ismero aldose, a ribose 5-fosfato




















Em alguns tecidos, a via das pentoses fosfato termina nesse ponto e a equao final
pode ser escrita:
Glicose 6-fosfato + 2NADP
+
+ H
2
O ribose 5-fosfato + CO
2
+ 2NADPH + 2H
+

O resultado lquido a produo de NADPH para as reaes de reduo biossintticas
e a produo de ribose 5-fosfato como precursora para a sntese de nucleotdios



Fase no oxidativa:
Nos tecidos que requerem primariamente mais NADPH que ribose 5-fosfato, as
pentoses fosfato produzidas na fase oxidativa so recicladas em glicose 6-fosfato. Nessa fase
no oxidativa, a ribulose 5-fosfato epimerizada em xilulose 5-fosfato.


Ento, em uma srie de rearranjos dos esqueletos carbnicos dos acares, seis
molculas de acar fosfato de cinco tomos de carbono so convertidas em cinco molculas
de acar fosfato com seis tomos de carbono, completando o ciclo e permitindo a oxidao
contnua da glicose 6- fosfato com a produo de NADPH. Essa reciclagem contnua leva
transformao contnua da glicose 6-fosfato em seis molculas de CO
2
.




Duas enzimas, exclusivas da via das pentoses fosfato agem nessas interconverses de
acares: a transcetolase e a transaldolase. A transcelolase catalisa a transferncia de um
fragmento de dois tomos de carbono de uma cetose doadora para uma aldose receptora.
A transaldolase catalisa uma reao similar reao da aldolase na gliclise: um
fragmento de trs tomos de carbono removido da sedoeptulose 7-fosfato e condensa do
com o gliceraldedo 3-fosfato, formando frutose 6- fosfato; o fragmento remanescente de
quatro tomos de carbono da sedoeptulose a eritrose 4-fosfato. Agora, a transcetolase age
novamente











CICLO DO CIDO CTRICO

Maioria das clulas eucariticas e muitas bactrias em condies aerbias:

RESPIRAO:
No sentido fisiolgico amplo, ou macroscpico: trocas gasosas feitas por um
organismo multicelular (captao de O
Em um sentido microscpico: um processo molecular que envolve o consumo de O
a formao de CO
2
pelas clulas

A respirao celular ocorre em trs grandes estgios:


Degradao aerbia da glicose:
Estgio 1: Produo de Acetil


CICLO DO CIDO CTRICO
Maioria das clulas eucariticas e muitas bactrias em condies aerbias:

No sentido fisiolgico amplo, ou macroscpico: trocas gasosas feitas por um
organismo multicelular (captao de O
2
e a eliminao de CO
2
).
Em um sentido microscpico: um processo molecular que envolve o consumo de O
pelas clulas processos denominados de respirao celular.
A respirao celular ocorre em trs grandes estgios:


o aerbia da glicose:
Estgio 1: Produo de Acetil-CoA

Maioria das clulas eucariticas e muitas bactrias em condies aerbias:
No sentido fisiolgico amplo, ou macroscpico: trocas gasosas feitas por um
Em um sentido microscpico: um processo molecular que envolve o consumo de O
2
e
respirao celular.
Produo de acetil-CoA:
Mltiplas cpias de trs enzimas - o complexo da piruvato desidrogenas (PDH)
Mitocndria das clulas eucariticas e no citosol das procariticas
Cinco coenzimas, quatro deles derivadas de vitaminas.
Complexo multienzimtico da piruvato desidrogenase:
Intermedirios qumicos permanecem ligados superfcie da molcula das enzimas
A reao uma descarboxilao oxidativa: um carbono removido (CO
2
) e os outros
dois carbonos tornam-se o grupo acetil do acetil-CoA

O NADH formado:
Cede um on hidreto (:H-) para a cadeia respiratria at o oxignio
Nos microrganismos anaerbios o on hidreto doado para um receptor alternativo
de eltrons (sulfato ou nitrato).
A transferncia de eltrons para o oxignio gera 2,5 molculas de ATP por par de
eltrons transportados.
O complexo da piruvato desidrogenase contm trs enzimas:
piruvato desidrogenase (E1)
diidrolipoil transacetilase (E2)
diidrolipoil desidrogenase (E3),
cada uma delas presentes em mltiplas cpias.

O nmero de cpias de cada sub unidade e, portanto, o tamanho do complexo variam
de uma espcie para outra.
O complexo da piruvato desidrogenase desenvolve cinco reaes consecutivas na
descarboxilao e desidrogenao do piruvato.

No centro do mecanismo de reao do complexo PDH esto os braos mveis lipoil-Iisil
de E2, que recebem de E1 os dois eltrons e o grupo acetil, derivados do piruvato, e os passam
para E3.
Todas essas enzimas e coenzimas esto reunidas em um nico agregado, permitindo
que os intermedirios reajam rapidamente sem jamais abandonarem a superfcie do complexo
enzimtico.


A organizao do complexo da piruvato desidrogenase similar aquela dos complexos
que catalisam a oxidao do -cetoglutarato e dos -cetocidos de cadeia ramificada.

Reaes do ciclo o cido ctrico:
O acetil-CoA transfere seu grupo acetil para um composto com quatro tomos de
carbono, o oxaloacetato, para formar o citrato, um composto com seis tomos de carbono.
O citrato convertido enzimaticamente, em vrios passos, no oxaloacetato com o qual
o ciclo se iniciou.
Agora, o oxaloacetato est pronto para reagir com uma nova molcula de acetil-CoA e
iniciar uma segunda volta do ciclo
Em cada uma dessas voltas entra um grupo acetil (dois carbonos), na forma de acetil-
CoA,e saem duas molculas de CO
2
. Uma molcula de oxaloacetato empregada para formar
citrato, mas uma molcula de oxaloacetato regenerada. No ocorre nenhuma remoo final
de oxaloacetato. Quatro dos oito passos desse processo so oxidaes, e a energia nelas
liberada conservada, com alta eficincia, na formao das coenzimas reduzidas (NADH e
FADH
2
)
Todo o conjunto de reaes do cicio do cido ctrico ocorre no interior da mitocndria.
A mitocndria contm tambm todas as enzimas e protenas necessrias para o ltimo estgio
da respirao, ou seja, a transferncia de eltrons e a sntese de ATP por fosforilao oxidativa.

1. Formao do citrato: A primeira reao do ciclo a condensao do acetil-CoA com
o oxaloacetato para formar citrato, catalisado pela citrato sintase:


2. Formao do isocitrato via cis-aconitato: A enzima aconitase (aconitato hidrolase)
catalisa a transformao reversvel do citrato em isocitrato.

Embora a mistura em equilbrio em pH 7 e 25C contenha menos que 10% de
isocitrato, na clula a reao deslocada para a direita, porque o isocitrato rapidamente
consumido no passo subsequente do ciclo, diminuindo a concentrao de equilbrio
estacionrio.

3. Oxidao do isocitraro a -cetoglutarato e CO
2
: No passo seguinte, a isocitrato
desidrogenase catalisa a descarboxilao oxidativa do isocitrato para formar o -cetoglularato:

Nas clulas existem duas formas da isocitrato desidrogenase, uma que emprega o
NAD
+
como receptor de eltrons e outra que emprega o NADP
+
. A reao global das duas
isoenzimas idntica nos demais aspectos. Em eucariotos, a enzima dependente de NAD
encontrada na matriz mitocondrial (ciclo do cido ctrico) e a dependente de NADP
encontrada na mitocondria e no citosol.

4. Oxidao do -cetoglutarato a succinil-CoA e C0
2
:
O passo seguinte outra descarboxilao oxidativa; nela o -cetoglutarato
convertido em succinil-CoA e CO
2
pela ao do complexo da -cetoglutarato desidrogenase. O
NAD
+
serve como receptor de eltrons e o CoA como carreador do grupo succinil. A energia de
oxidao do -cetoglutarato conservada pela formao de uma ligao tioster do succinil-
CoA:

O complexo da -cetoglutarato desidrogenase assemelha-se muito, em estrutura e
funo, ao complexo da piruvato desidrogenase. Ele inclui no apenas as trs enzimas
anlogas a E1, E2 e E3, mas tambm TPP, lipoato, FAD, NAD e coenzima A.

5. Converso do succinil-CoA em succinato: Como o
acetil-CoA, o succinil-CoA tem uma energia livre-padro de hidrlise de sua ligao
tioster forte e negativa. No prximo passo do ciclo do cido ctrico, energia liberada no
rompimento dessa ligao empregada para dirigir a sntese de uma ligao de anidrido
fosfrico no ATP ou no GTP. No processo. formado o succinato:

A enzima que catalisa essa reao reversvel chamada de succinil-CoA sintetase ou de
tioquinase succnica.
As clulas animais tm duas isozimas da succinil-CoA sintetase, uma especfica para
ADP, e a outra, para GDP.
A sntese de ATP (ou GTP) pela energia liberada pela descarboxilao oxidativa do -
cetoglutarato uma fosforilao ao nvel do substrato.
O GTP formado pela succinil-CoA sintetase pode entregar seu grupo fosfato terminal
para o ADP para formar ATP, por meio da ao reversvel da nucleosdio difosfato quinase:
GTP + ADP GDP + ATP G
o
= 0 kJ/mol
Assim, o resultado final da atividade de qualquer isoenzima da succinil-CoA sintetase
a conservao da energia na forma de ATP. O ATP e o GTP so energeticamente equivalentes.

6. Oxidao do succinato a fumarato: O succinato formado a partir do succinil-CoA
oxidado a fumarato pela flavoprotena succinato desidrogenase:

Nos eucariotos, a succinato desidrogenase firmemente ligada membrana
mitocondrial interna; nos procariotos, ela ligada membrana plasmtica. A enzima contm
trs diferentes agrupamentos ferro-enxofre e uma molcula de FAD ligada de forma covalente.
Os eltrons retirados do succinato passam atravs do FAD e dos centros Fe-S antes de
entrarem na cadeia transportadora de eltrons na membrana mitocondrial interna.
O fluxo de eltrons do succinato at o O
2
, o receptor final de eltrons, atravs desses
transportadores, est acoplado sntese de 1,5 molcula de ATP por par de eltrons
(fosforilao ligada respirao).

7. Hidratao do fumarato produz malato: A hidratao reversvel do fumarato em L-
malato catalisada pela fumarase (fumarato hidratase):


8. A oxidao do malato a oxaloacetato: a L-malato desidrogenase, ligada ao NAD,
catalisa a oxidao do L-malato em oxaloacetato:

O equilbrio dessa reao est muito deslocado para a esquerda sob as condies
termodinamicas-padro, mas, nas clulas intactas, o oxaloacetato continuamente removido
pela reao da citrato sintase que altamente exergnica. Isso conserva a concentrao do
oxaloacetato na clula em valores extremamente pequenos, deslocando a reao da malato
desidrogenase na direo de formao de oxaloacetato

A energia conservada no ciclo do cido ctrico:
Um grupo acetil, contendo dois tomos de carbono, foi introduzido no ciclo por
combinao com o oxaloacetato. Dois tomos de carbono emergiram do ciclo como CO
2
. A
energia liberada por essas oxidaes foi conservada na reduo de trs NAD
+
e um FAD e na
sntese de uma molcula de ATP ou de GTP. No final do ciclo foi regenerada uma molcula de
oxaloacetato
Embora o ciclo do cido ctrico diretamente gere apenas uma molcula de ATP por
volta (na converso de succinil-CoA em succinato), os quatro passos de oxidao do ciclo
fornecem um grande fluxo de eltrons para a cadeia respiratria, atravs de NADH e FADH
2
, e
esta leva formao de um grande nmero de molculas de ATP durante a fosforilao
oxidativa.
O rendimento de energia da produo de duas molculas de piruvato, a partir de uma
molcula de glicose, durante a gliclise representado por duas molculas de ATP e duas de
NADH. Na fosforilao oxidativa, a passagem de dois eltrons do NADH para o oxignio
potencia a formao de 2,5 molculas de ATP, e a passagem de dois eltrons do FADH
2
para o
oxignio potencia a formao de 1,5 molcula de ATP.
Essa estequiometria permite calcular o rendimento em ATP da oxidao completa da
glicose. Quando duas molculas de piruvato so oxidadas at 6 CO
2
por meio da ao do
complexo da piruvato desidrogenase e do ciclo do cido ctrico e os eltrons correspondentes
so transferidos para o O
2
, 32 molculas de ATP so obtidas por molcula de glicose.
Isso representa a conservao de 32 x 30,5 kJ/mol = 976 kJ/moJ, ou 34% do mximo
terico de 2.840 kJ/mol disponveis pela oxidao completa da glicose. Esses clculos
empregam as variaes da energia livre-padro; quando corrigidas para a energia livre -
verdadeira necessria para sintetizar o ATP no interior celular, a eficincia calculada do
processo chega perto dos 65%.
Os componentes do ciclo do cido ctrico so intermedirios biossintticos
importantes
Ciclo do cido ctrico via anfiblica
processos catablicos (oxidao )
processos anablicos (biossntese).

O -cetoglutarato e o oxaloacetato podem servir como precursores dos aminocidos
glutamato e aspartato por simples transaminao. Por meio do aspartato e do
glutamato, os carbonos do oxaloacetato e do -cetoglutarato so empregados para
construir as molculas de outros aminocidos, como tambm molculas de
nucleotdios de purinas e pirimidina
O oxaloacetato pode ser convertido em glicose atravs da gliconeognese ;
O succinil-CoA um componente central na biossntese do anel de porfirina do grupo
heme (transportador do oxignio na hemoglobina e na mioglobina e transportador de
eltrons nos citocromo);
O citrato sintetizado por certos organismos e usado comercialmente para vrios
propsitos.

Intermedirios do ciclo do cido ctrico so so repostos por meio das reaes
anaplerticas. Em condies normais, as reaes pelas quais os intermedirios do ciclo so
transferidos para outras vias e aquelas atravs das quais eles so fornecidos esto em
equilbrio dinmico, de tal forma que as concentraes nos intermedirios do ciclo do cido
ctrico permanecem quase que constantes.

A reao anaplertica mais importante nos tecidos heptico e renal de mamferos a
carboxilao reversvel do piruvato catalisada pela piruvato carboxilase.
Sempre que o acetil-CoA est presente em excesso, ele estimula a reao da piruvato
carboxilase para produzir mais oxaloacetato, capacitando o ciclo para usar maior quantidade
de acetil-CoA na reao da citrato sintase.
A reao catalisada pela piruvato carboxilase requer a vitamina biotina. A biotina
desempenha um papel-chave em muitas reaes de carboxilao. A carncia dessa vitamina
rara, mas pode ser provocada por uma dieta rica em ovos crus. A clara do ovo contm grande
quantidade de uma protena chamada avidina, a qual se liga fone mente biotina e impede
sua absoro no intestino. Quando os ovos so cozidos, a avidina desnaturada e inativada
As reaes anaplerticas so reguladas para manter o nvel de intermedirios alto o
suficiente para suportar a atividade do ciclo do cido ctrico. Por exemplo, a fosfoenolpiruvato
carboxilase ativada pelo intermedirio glicoltico frutose 1,6-bifosfato e seu nvel aumenta
quando o ciclo do cido ctrico opera muito vagarosamente para processar todo o piruvato
gerado pela gliclise.

Regulao do ciclo do cido ctrico:
O fluxo de tomos de carbono do piruvato para e atravs do ciclo do cido ctrico
estreitamente regulado em dois nveis: a converso de piruvato em acetil-CoA e a entrada de
acetil-CoA no ciclo (reao da citrato sintase). O ciclo tambm regulado na altura da reao
da isocitrato desidrogenase e na reao da -cetoglutarato desidrogenase





CICLO DO GLIOXILATO

Fosfoenolpiruvato pode ser sintetizado a partir do oxaloacetato na reao reversvel
catalisada pela PEP carboxiquinase:
Oxaloacetato+GTP fosfoenolpiruvato+CO
2
+GDP
O fosfoenolpiruvato convertido em glicose pela via gliconeognica. Entretanto, no
ciclo do cido ctrico no h converso lquida de acetato em oxaloacetato. Para cada dois
carbonos que entram no ciclo (acetilCoA), dois carbonos saem dele (CO
2
)
Nos vegetais, em certos invertebrados e em alguns microrganismos como a E. coli e a
levedura, o acetato pode servir tanto como um combustvel rico em energia como uma fonte
de fosfoenolpiruvato para a sntese de carboidratos. Nesses organismos, as enzimas do ciclo
do glioxilato catalisam a converso de acetato em succinato ou outros intermedirios com
quatro tomos de carbono do ciclo do cido ctrico.

2 Acetil-CoA +2 NAD
+
+ 2H
2
O succinato + 2CoA + NADH + H
+

Os vertebrados no possuem as enzimas especficas do ciclo do glioxilato (isocitrato
liase e malato sintase) e, por isso, no podem realizar a sntese lquida da glicose a partir de
lipdios.
Nos vegetais, as enzimas do ciclo do glioxilato so sequestradas em organelas presas
s membranas chamadas glioxissomos, que so peroxissomos especializados. As enzimas
comuns aos ciclos do cido ctrico e do glioxilato existem como duas isoenzimas, uma
especfica da mitocndria, outra especfica do glioxissomo.

Os glioxissomos no esto presentes em todos os tecidos da planta e em todos os
momentos. Eles se desenvolvem em sementes ricas em lipdios durante a germinao, antes
que o vegetal adquira a capacidade de sintetizar glicose por fotossntese. Os glioxissomos
tambm contm todas as enzimas necessrias para a degradao dos cidos graxos
armazenados nas sementes oleaginosas.
O acetil-CoA formado a partir de lipdios convertido em succinato atravs do ciclo do
glioxilato e o succinato exportado para a mitocndria, na qual as enzimas do ciclo do cido
ctrico o transformam em oxaloacetato, um precursor da gliconeognese.
As plantas em germinao so, portanto, capazes de sintetizar molculas de glicose
com os carbonos presentes nos lipdios das sementes.
Nas sementes em germinao, as transformaes enzimticas dos cidos dicarboxilicos
e tricarboxilicos ocorrem em trs compartimentos intracelulares: mitocndrias, glioxissomos e
citosol. Entre esses compartimentos h um intercmbio contnuo de intermedirios.
O esqueleto carbnico do oxaloacetato do ciclo do cido ctrico (na mitocndria)
transportado para o glioxissomo na forma de aspartato; o aspartato transformado em
oxaloacetato e condensa-se com o acetil-CoA derivado da quebra dos cidos graxos.


O compartilhamento de intermedirios comuns
requer que essas vias sejam reguladas de maneira
coordenada. Situado no ponto de bifurcao entre os
ciclos do cido ctrico e do glioxilato, o isocitrato um
intermedirio crucial.















CADEIA DE TRANSPORTE DE ELTRONS E FOSFORILAO OXIDATIVA

Fosforilao oxidativa: estgio final do metabolismo produtor de energia nos
organismos aerbios. Ocorre nas mitocndria e envolve a reduo do O
2
a H
2
O com eltrons
doados pelo NADH e FADH
2
.
Sntese do ATP nas mitocndrias: teoria quimiosmtica (fosforilao oxidativa,
fotofosforilao, transporte ativo atravs de membranas, movimento dos flagelos das
bactrias).

Mitocndrias:
Possuem duas membranas.
membrana mitocondrial externa: permevel a
ons e molculas pequenas que se movem
livremente atravs de canais transmembrana
membrana interna: impermevel maioria das
molculas pequenas e ons, incluindo prtons
(H
+
); a membrana interna contm os
componentes da cadeia respiratria e a ATP
sintase.
A matriz mitocondrial contm todas as vias da
oxidao dos combustveis, exceto a gliclise que ocorre
no citosol.
A membrana interna, seletivamente permevel,
segrega as enzimas e os intermedirios prprios das vias
metablicas citoslicas dos componentes dos processos
metablicos que ocorrem na matriz.
Transportadores especficos carregam piruvato, cidos graxos e aminocidos ou seus
derivados -ceto para o interior da matriz. O ADP e o P
i
so transportados especificamente
para o interior da matriz medida que o ATP recm-sintetizado transportado para fora.

Transporte de eltrons atravs da membrana:
A fosforilao oxidativa comea com a entrada de eltrons na cadeia respiratria. A
maioria desses eltrons proveniente da ao de desidrogenases que coletam eltrons das
vias catablicas e os canalizam para receptores universais de eltrons: nucleotdios de
nicotinamida (NAD
+
ou NADP
+
) ou nucleotdios de flavinas ( FMN ou FAD).
A maioria das desidrogenases associadas ao nucleotdio de nicotinamida que atuam no
catabolismo especfica para o NAD
+
. As desidrogenases ligadas ao NAD
+
removem dois
tomos de hidrognio dos seus substratos. Um deles transferido para o NAD
+
como um on
hidreto (:H
-
) e o outro liberado como H
+
no meio. O NADH e o NADPH so transportadores
de eltrons hidrossolveis que se associam reversivelmente com as desidrogenases.
O NADH carrega os eltrons derivados das reaes catablicas at seu ponto de
entrada na cadeia respiratria, o complexo da NADH desidrogenase. O NADPH geralmente
fornece eltrons para as reaes anablicas. Nem o NADH nem o NADPH podem atravessar a
membrana interna da mitocndria , mas os eltrons que elas carregam podem ser lanados
atravs dela.
As flavoprotenas possuem um nucleotdio flavina, o FMN ou o FAD, fortemente ligado
a elas, s vezes at covalentemente. O nucleotdio de flavina oxidado pode aceitar um eltron
(dando origem a uma forma semiquinona) ou dois (originando FADH
2
ou FMNH
2
).
O potencial-padro de reduo de um nucleotdio de flavina, diferentemente daquele
do NAD ou do NADP, depende da protena qual ele est associado. Interaes locais com
grupos funcionais na protena distorcem os orbitais dos eltrons no anel da flavina, alterando
as estabilidades relativas das formas oxidadas e reduzidas. Assim , o potencial de reduo-
padro relevante o da flavoprotena especfica e no o do FAD ou FMN isolado.
O nucleotdio de flavina deve ser considerado parte do stio ativo das flavoprotenas e
no um reagente ou produto na reao de transferncia de eltrons.
Como as flavoprotenas podem participar tanto na transferncia de um como de dois
eltrons, elas podem funcionar como intermedirios entre reaes onde dois eltrons so
doados e aquelas onde um eltron aceito.

Transportadores de eltrons ligados membrana:
A cadeia respiratria mitocondrial consiste de uma srie de transportadores de
eltrons que atuam sequencialmente, a maioria deles so protenas integrais de membrana
que apresentam grupos prostticos capazes de aceitar ou doar um ou dois eltrons.
Na fosforilao oxidativa ocorrem trs tipos de transferncia de eltrons: transferncia
direta de eltrons, tal como na reduo do Fe
+
a Fe
2+
; transferncia como um tomo de
hidrognio (H
+
+e
-
) e transferncia como um on hidreto (:H
-
), que possui dois eltrons.
O termo equivalente redutor usado para designar um nico equivalente de eltron
transferido na reao de oxidao-reduo
Alm do NAD e das flavoprotenas, trs outros tipos de molculas transportadores de
eltrons funcionam na cadeia respiratria: uma quinona hidrofbica (ubiquinona) e dois tipos
diferentes de protenas que contm ferro (citocromos e protenas ferro-enxofre).
A ubiquinona (tambm chamada de coenzima Q,
ou simplesmente Q) uma benzoquinona lipossolvel que
apresenta uma longa cadeia lateral isoprenide.
Como carrega tanto prtons quanto eltrons, ela
desempenha um papel central no acoplamento do fluxo
de eltrons ao movimento de prtons








Citocromos:
Os citocromos so protenas que apresentam como caracterstica uma intensa
absoro da luz visvel graas a seus grupos prostticos heme que contm ferro. As
mitocndrias contm trs classes de citocromos designados por a, b e c, que podem ser
distinguidos pelas diferenas nos seus espectros de absoro da luz.

Os co-fatores heme dos citocromos a e b esto fortemente ligados s suas protenas
associadas, embora de forma no covalente; os grupos heme dos citocromos do tipo c esto
ligados covalentemente por meio de resduos de cistena.
O potencial de reduo-padro do tomo de ferro presente no heme de um citocromo
depende da sua interao com as cadeias laterais da protena e, portanto, diferente para
cada citocromo.
Os citocromos dos tipos a e b e alguns do tipo c so protenas integrais da membrana
interna da mitocndria. O citocromo c da mitocndria uma protena solvel que se associa
com a superfcie externa da membrana interna da mitocndria por meio de interaes
eletrostticas.

Protenas ferro-enxofre:
Nas protenas ferro-enxofre o ferro est presente associado a tomos de enxofre
inorgnico ou a tomos de enxofre de resduos de cistena na protena, ou ambos. Esses
centros de ferro-enxofre (FeS) variam desde estruturas simples com um nico tomo de Fe
coordenado a quatro grupos -SH de cistenas, at centros de Fe-S mais complexos com dois ou
quatro tomos de Fe.


Na reao completa catalisada pela cadeia respiratria mitocondnal, os eltrons
movem-se do NADH, do succinato ou de algum outro doador primrio de eltrons atravs das
flavoprotenas, ubiquimona, protenas ferro-enxofre, citocromo e finalmente para o O
2
. Para
determinar a sequncia de atuao desses carregadores, primeiro o potencial de reduo
padro de cada um dos carregadores foi determinado experimentalmente.

Podemos supor que os carregadores funcionem em ordem crescente do potencial de
reduo, uma vez que os eltrons fluem espontaneamente dos arregadores de E
o
menor para
carregadores com E
o
maior. A sequncia dos carregadores deduzida por esse raciocnio :
NADH Q citocromo b citocromo c
1
citcromo c citocromo a citocromo a
3
O
2

Um segundo mtodo envolve a reduo experimental da cadeia completa de
carregadores quando se fornece uma fonte de eltrons, mas nenhum receptor de eltrons
(nenhum O
2
). Quando o O
2
introduzido abruptamente no sistema, a velocidade com que
cada transportador de eltrons se oxida mostra a ordem na qual os transportadores
funcionam.
Para confirmao final foram empregados agentes que bloqueiam o fluxo de eltrons
atravs da cadeia de forma combinada com medidas do grau de oxidao de cada
transportador. Na presena de O
2
e de um doador de eltrons, os transportadores que atuam
antes da etapa bloqueada ficam totalmente reduzidos, e aqueles que atuam depois do
bloqueio ficam completamente oxidados.
A sequncia observada para os dois experimentos foi a mesma predita com base no
potencial de reduo.

Complexos cadeia de transporte de eltrons:

Complexo I - NADH at ubiquinona: O complexo I, tambm chamado de NADH:
ubiquinona oxidorredutase, ou NADH desidrogenase, uma enzima grande cuja molcula
composta por 42 cadeias polipeptdicas diferentes, incluindo uma flavoprotena ligada a FMN e
pelo menos seis centros de Fe-S.
O complexo I catalisa simultnea e obrigatoriamente dois processos acoplados: a
transferncia exergnica para a ubiquinona de um on hidreto do NADH e um prton da
matriz:
NADH+H
+
+Q NAD
+
+QH
2

E a transferncia endergnica de
quatro prtons da matriz para o espao
intermembranas.
Assim, o complexo I uma bomba de
prtons movida pela energia da transferncia
de eltrons e a reao que ele catalisa
vetorial: ela movimenta os prtons em uma
direo especfica de um local (a matriz, que
se torna negativamente carregada com a
sada de prtons) para outro (o espao
intermembranas, que se torna positivamente carregado).
Para enfatizar a natureza vetorial do processo, a reao global geralmente escrita
com subscritos que indicam a localizao dos prtons: P para o lado positivo da membrana
interna (o espao intermembranas), N para o lado negativo (a matriz):
NADH + H
+
N
+ Q + 4H
+
N
NAD
+
+ QH
2
+ 4H
+
P

O amital (uma droga barbitrica), a rotenona (um produto vegetal usado como
inseticida) e a piericidina A (um antibitico) inibem o fluxo de eltrons dos centros de Fe-S do
complexo I para a ubiquinona e por isso bloqueiam todo o processo de fosforilao oxidativa.


O ubiquinol (QH
2
) difunde-se na membrana interna, do complexo I at o III, onde
oxidado a Q em um processo que envolve o movimento de prtons para o lado externo.



Complexo II - Sucinato at ubiquinona: A enzima succinato desidrogenase, a nica
enzima do ciclo de Krebs que liga da membrana, contm cinco grupos prostticos de dois
tipos e quatros subunidades proticas diferentes. As subunidades C e D so protenas integrais
de membrana, cada uma com trs hlices transmembrana. Elas contm um grupo heme, heme
b, e um stio de ligao para a ubiquinona
As subunidades A e B estendem se no interior da matriz; elas contm trs centros 2Fe-
2S, FAD ligado e um stio de ligao para o substrato, o succinato.
Outros substratos para as desidrogenases mitocondriais tambm passam eltrons para
a cadeia respiratria ao nvel da ubiquinona, mas no atravs do complexo II . Na oxidao dos
acil-CoA graxos, a acil-CoA desidrogenase transfere eltrons do substrato para o FAD da
desidrogenase, depois para uma flavoprotena transferidora de eltrons (ETF) que passa os
eltrons para a ETF: ubiquinona oxidorredutase, que passa para a ubiquinona.
O glicerol 3-fosfato oxidado pela gliceroI 3-fosfato desidrogenase. Essa enzima uma
flavoprotena localizada na superfcie externa da membrana mitocondrial interna e canaliza
eltrons para a cadeia respiratria reduzindo a ubiquinona.

Complexo III - Ubiquinona at citocromo c: tambm chamado de complexo dos
citocromos bc
1
ou ubiquinona: citocromo c oxidorredutase . Ele acopla a transferncia de
eltrons do ubiquinol (QH
2
) para o citocromo c com o transporte vetorial de prtons da matriz
para o espao intermembranas.

O citocromo c uma protena solvel do espao intermembranas. Aps se nico heme
aceitar um eltron do complexo III, o citocromo c move-se em direo ao complexo IV para
doar o eltron para um centro de cobre binuclear.

Complexo IV - Citocromo c at O
2
: tambm chamado citocromo oxidase. Transporta
dois eltrons do citocromo c para o oxignio molecular, reduzindo-o a H
2
O. O complexo IV
uma protena grande (13 subunidades). As bactrias possuem uma forma mais simples, com
somente trs ou quatro subunidades.
A subunidade II mitocondrial contm dois ons cobre complexados com os grupos -SH
de dois resduos de cistena em um centro binuclear (Cu
A
) que lembram as protenas dos
centros 2Fe-2S. A subunidade I contm dois grupos heme designados a e a
3
e um on cobre
(Cu
B
). O heme a
3
e o Cu
B
formam um segundo centro binuclear que aceita eltrons do heme a
e ento os transfere para o O
2
ligado ao heme a
3
.

A reao global catalisada pelo complexo IV :
4 cit c (reduzido) + 8H
N
+ O
2
4 cit c(oxidado) + 4H
P
+ 2H
2
0



Conservao de energia pela transferncia de eltrons:
A transferncia de eltrons do NADH para o oxignio libera uma energia livre padro
de 220 KJ/mol
A maior parte desta energia empregada para impulsionar prtons para fora da
matriz, criando um gradiente de prtons que conserva esta energia temporariamente.
A energia armazenada neste gradiente, denominada fora prton-motora, apresenta
dois componentes: a energia qumica devido a diferena de concentrao de prtons e a
energia eltrica, pela separao de cargas.




Quando os prtons se deslocam espontaneamente a favor do seu gradiente
eletroqumico, a energia disponibilizada para produzir trabalho. Nas mitocndrias,
cloroplastos e bactrias aerbias, a energia eletroqumica do gradiente de prtons direciona a
sntese de ATP a partir de ADP e P
i
.

Sntese de ATP:
De acordo com o modelo quimiosmtico proposto por Mitchell a energia
eletroqumica inerente diferena de concentrao de prtons e da separao de cargas
atravs da membrana mitocondrial interna, a fora prton-motriz , dirige a sntese de ATP
medida que os prtons fluem passivamente de volta para a matriz atravs de um poro para
prtons associado ATP sintase.

+ = ZF
C
C
ln RT G
2
1
+ = ZF pH RT 3 , 2 G
A sntese de ATP e o fluxo de eltrons esto acoplados. Quando inibidores do fluxo de
eltrons so adicionados a mitocndrias intactas,a sntese de ATP tambm inibida e quando
inibidores da ATP sintase so adicionados, o fluxo de eltrons tambm interrompido.
Entretanto, certas condies e reagentes podem desacoplar a oxidao da fosforilao.
Quando mitocndrias intactas so rompidas com detergentes ou cisalhamento fsico, os
fragmentos de membrana resultantes ainda podem catalisar a transferncia de eltrons, mas
nenhuma sntese de ATP acoplada a essa respirao.
Certos compostos qumicos causam o desacoplamento sem romper a estrutura
mitocondrial. Entre os desacopladores qumicos esto os cidos fracos com propriedades
hidrofbicas (p.e. 2,4-dinitrofenol) se difundam rapidamente atravs da membrana da
mitocndria. Aps entrarem na matriz na forma protonada, eles podem liberar um prton, e
com isto dissipam o gradiente de prtons.
Inforos (p.e. a valinomicina) permitem que ons inorgnicos passem facilmente
atravs das membranas. Eles desacoplam a transferncia de eltrons da fosforilao oxidativa
dissipando a contribuio eltrica do gradiente eletroqumico atravs da membrana da
mitocndria .
Mamferos recm-nascidos e animais que hibernam possuem um tecido adiposo
chamado tecido adiposo marrom que possuem em suas mitocndrias uma protena chamada
termogenina, que permite a entrada de prtons na matriz mitocondrial sem a produo de
ATP. A energia liberada na forma de calor, que utilizado para manter a temperatura do
corpo.

ATP sintase:
A ATP sintase executa a "catlise rotativa", nela o fluxo
de prtons atravs de F
0
faz com que cada um de trs stios de
ligao para o nucleotdio em F
1
execute um ciclo entre as
conformaes que se ligam com ADP + P
i
, que se ligam com o
ATP e que permanecem vazias. A formao do ATP na
superfcie da enzima requer pouca energia; o papel da fora
prton-motiva deslocar o ATP de seu stio de ligao na
sintase.

A razo entre o nmero de molculas de ATP sintetizadas por 0
2
reduzido a H
2
0 (a
razo P/O) de aproximadamente 2,5 quando os eltrons entram na cadeia respiratria
atravs do complexo I, e 1,5 quando eles entram na coenzima Q

Lanadeiras do NADH citoslico:

Lanadeira malato-aspartato (Fgado rim e corao)


Lanadeira Glicerol 3-fosfato (msculo esqueltico e crebro)


Exerccios Terceira prova
1. Se uma soluo 0,1 mol.L
-1
de glicose-1-fosfato incubada com uma quantidade
cataltica da enzima fosfoglicomutase, a 25C e pH=7,0, a glicose-1-fosfato transformada em
glicose-6-fosfato at que o equilbrio da reao seja atingido. As concentraes de equilbrio
so:
[glicose-1-fosfato] = 4,5 x 10
-3
mol.L
-1

[glicose-6-fosfato] = 9,6 x 10
-2
mol.L
-1

Pergunta-se:
a) Qual o valor da Keq da reao?
b) Qual o valor de G

da reao?
c) Qual o valor de G da reao se a reao inicia com soluo 0,1 mol.L
-1
de glicose-
1-fosfato e 0,05 mol de glicose 6-fosfato? Em que direo a reao ocorreu at atingir o
equilbrio?
d) Qual o valor de G da reao se a reao inicia com soluo 0,1 mol.L
-1
de
glicose-1-fosfato e 0,2 mol de glicose 6-fosfato? Em que direo a reao ocorreu at atingir o
equilbrio?

2. A enzima lcool desidrogenase catalisa a reao:

acetaldedo + NADH + H
+
etanol + NAD
+

Os valores de potencial de reduo padro (E
0
) para os pares redox NAD
+
/NADH e
acetaldedo/etanol so 0,320v e 0,197v, respectivamente. Baseado nesses dados responda:
a- Qual par tem maior tendncia a ganhar eltrons?
b- Qual o agente oxidante mais forte?
c- Calcule o valor de G
0
da reao?
d- Nas condies padro, em que direo a reao se processar?
e- Calcule o valor da K
eq
da reao?
f- Se as concentraes do NAD
+
, acetaldedo, etanol e NADH forem
respectivamente, 0,1; 1,0; 0,1 e 1,0 mol/L, em que direo a reao se processar?

3. A via glicoltica possui duas fases. Citar os nomes

4. Quais so os pontos de regulao da via? Citar as enzimas envolvidas e seus
respectivos moduladores (inibidores e ativadores).

5. Quais so os substratos das reaes que produzem ATP na via glicoltica?

6. Dar a equao balanceada completa da gliclise.

7. Esquematizar a formao de etanol e lactato, via fermentaes alcolica e lctica, a
partir do piruvato.

8. Qual a finalidade da Via das Pentoses-fosfato? Responder citando os produtos.

9. O tecido muscular consome grande quantidades de ATP durante uma
atividade intensa quando comparado com situao de repouso. Suponha que um
msculo esqueltico destitudo de lactato desidrogenase esteja em condio de
anaerobiose. Poder ele desenvolver atividade fsica muito intensa? Poder gerar ATP
por meio da gliclise? Explicar.

10. Qual a produo lquida de ATP quando uma clula procaritica fermenta
maltose a etanol? E qual a produo de NADH?

11. Como o dmero da fosforilase do glicognio pode ser ativado?

12. Qual a finalidade da Via das Pentoses-fosfato? Responder citando os produtos.

13. D a reao geral catalisada pelo complexo da piruvato desidrogenase. Para que
vias sero conduzidos os produtos?

14. O que fosforilao nvel de substrato? Em que passo do ciclo de Krebs esta
reao ocorre?

15. Quantos ATP (GTP) so formados no ciclo do cido ctrico, partindo-se de uma
molcula de glicose, considerando que este est acoplado cadeia transportadora de
eltrons? (Mostre os clculos). E se for de uma molcula de piruvato?

16. Por que na ausncia de oxaloacetato na matriz mitocondrial no acontece o ciclo
do cido ctrico, mesmo na presena de todas as enzimas que participam deste?

17. Embora o oxignio no participe diretamente do ciclo do cido ctrico, o mesmo
acontece apenas em condies aerbicas. Por qu?

18. Uma indstria produz cido ctrico utilizando um microrganismo
mutante. Esta mutao faz com que a clula produza citrato em excesso e que as
membranas celulares permitam a sada deste composto da clula (do interior da
matriz mitocondrial e posteriormente do citosol). Sugerir vias metablicas que estejam
envolvidas neste processo.

19. Considerando o microrganismo mutante utilizado na produo de cido
ctrico citado no exerccio anterior, discutir sobre:
a) O Ciclo do cido Ctrico continuar funcionando mesmo com a retirada
do citrato (intermedirio)?
b) Como reabastecer o ciclo?
c) possvel produzir cido ctrico a partir de cido ltico? Se for possvel, sugerir
vias, rotas, reaes envolvidas

20. Explique como se d a regulao do complexo da piruvato desidrogenase. E do
ciclo do cido ctrico?

21. O ciclo do cido ctrico uma via anfiblica. Discuta esse conceito dando exemplos.

22. D a reao geral do ciclo do glioxalato. Que vias utilizaro seus produtos?

23. Diferencie os termos: fosforilao oxidativa de fosforilao a nvel de substrato

24. Descrever a Hiptese Quimiosmtica de Mitchell, desenhando um esquema na
membrana interna da mitocndria com os complexos ordenados em srie, descrevendo o
fluxo de eltrons acoplado a sntese de ATP.

25. A oligomicina um inibidor do complexo ATP sintase e foi adicionada a uma
suspenso de mitocndrias, diminuindo drasticamente a velocidade de transferncia de
eltrons (medida pelo consumo de O
2
) e a velocidade da produo de ATP. Em seguida, foi
adicionado a esta mesma suspenso de mitocndrias 2,4-dinitrofenol, um desacoplador da
fosforilao oxidativa. Quais os efeitos esperados no consumo de O
2
e na produo de ATP?
Justifique.
OXIDAO DE CIDOS GRAXOS
As clulas podem obter cidos graxos combustveis de trs fontes:
gorduras ingeridas na alimentao;
gorduras armazenadas nas clulas na forma de gotculas gordurosas;
gorduras sintetizadas em um rgo para serem exportadas para outro.
Em alguns rgos, os triacilgliceris fornecem mais que metade da energia necessria,
particularmente o fgado, o corao e o msculo esqueltico em repouso.
Os triacilgliceris armazenados so virtualmente a nica fonte de energia dos animais
em hibernao e dos pssaros durante a migrao.
Os protistas obtm gorduras pelo consumo de organismos mais abaixo na cadeia
alimentar, e alguns tambm armazenam gorduras em gotculas lipdicas citoslicas.
As plantas superiores mobilizam as gorduras armazenadas em suas sementes, durante
o processo de germinao, mas, fora isso, no dependem de gorduras para a obteno de
energia

Digesto e absoro de gorduras:




Nos vertebrados, antes que possam ser absorvidos atravs da parede intestinal, os
triacilgliceris ingeridos precisam ser convertidos de partculas gordurosas macroscpicas
insolveis em micelas microscpicas finamente dispersas. Essa solubilizao realizada por
sais biliares sintetizados no fgado a partir do colesterol. A formao de micelas aumenta a
frao de molculas lipdicas acessveis ao das lipases hidrossolveis no intestino e a ao
dessas enzimas converte os triacilgliceris em monoacilgliceris, diacilgliceris, cidos graxos
livres e glicerol. Esses produtos da ao das lipases difundem-se para o interior das clulas
epiteliais que recobrem a superfcie intestinal interna (mucosa intestinal), onde eles so
reconvertidos em triacilgliceris e agrupados com o colesterol da dieta e com protenas
especficas, formando agregados lipoproticos chamados quilomicrons. Os quilomicrons
migram para os tecidos atravs do sistema linftico e corrente sangunea. Nos capilares, a
lipoprotena libera cidos graxos e glicerol. Os cidos graxos entram nas clulas onde so
oxidados para produo de energia ou reesterificados para armazenamento.

Mobilizao dos triacilgliceris armazenados:















Os lipdios neutros so armazenados nos adipcitos na forma de gotculas lipdicas que
possuem uma poro central de steres esterides e triacilgliceris envolvida por uma
monocamada de fosfolipdios. A superfcie dessas gotculas recoberta com perilipinas, uma
famlia de protenas que restringem o acesso aos lipdios do interior da gotcula e previne sua
mobilizao. Quando certos hormnios (epinefrina e glucagon) sinalizam que o organismo
necessita de energia metablica, os triacilgliceris armazenados no tecido adiposo so
mobilizados e transportados para aqueles tecidos (msculo esqueltico, corao e crtex
renal) nos quais os cidos graxos podem ser oxidados para a produo de energia. Os
hormnios ativam a adenilatociclase na membrana plasmtica do adipcito,aumentando a
concentrao intracelular de cAMP. Uma protena quinase dependente de cAMP (PKA)
fosforila a perilipina A e esta protena fosforilada faz com que lipase hormnio-sensivel no
citosol se mova at a superfcie da golicula onde ela comea a hidrolisar os triacilglicerispara
libertar cidos graxos e glicerol. A protena quinase tambm fosforila a lipase hormnio-
sensvel aumentando sua atividade. A medida que a lipase hormnio-sensvel hidrolisa os
triacilgliceris dos adipcitos, os cidos graxos liberados passam do interior do adipcito para
o sangue, onde se ligam protena sangnea albumina ou soroalbumina. Ligados a essa
protena solvel os cidos graxos so transportados para os tecidos como o msculo
esqueltico, o corao e o crtex renal. Neles, os cidos graxos dissociam-se da albumina e
difundem-se para o citosol das clulas nas quais serviro como combustvel.

Prximo de 95% da energia
biologicamente disponvel dos triacilgliceris
reside no seus trs cidos graxos de cadeia longa;
apenas 5% fornecido pelo glicerol. O glicerol
fosforilado pela glicerol quinase e resulta em
gliceroI 3-fosfato, que oxidado em
diidroxiacetona fosfato. A enzima glicoltica triose
fosfato isomerase converte esse composto em
gliceraldedo 3-fosfato, que oxidado atravs da
via glicoltica.









Ativao de cidos graxos e transporte para o interior da mitocndria:
As enzimas da oxidao dos cidos graxos nas clulas dos animais esto localizadas na
matriz mitocondrial. Os cidos graxos com 12 tomos de carbono ou menos podem penetrar
na mitocndria sem o auxlio de transportadores de membrana.
Aqueles que possuem 14 ou mais carbonos no podem atravessar diretamente a
membrana mitocondrial e necessitam sofrer antes a srie de trs reaes enzimticas do
transportador da carnitina.
A primeira catalisada por uma famlia de isoenzimas (diferentes e especfias para
cidos graxos com cadeia carbnica curta, intermediria ou longa) presentes na membrana
mitocondrial externa, as acil-CoA sintetases, que promovem a reao geral:
Acido graxo + CoA + ATP Acil-CoA graxo + AMP +PP
i
As acil-CoA sintetases catalisam a formao de uma ligao tioster entre o grupo
carboxila do cido graxo e o grupo tiol da coenzima A para produzir um acil-CoA graxo; ao
mesmo tempo, o ATP sofre clivagem em AMP e PP
i
. O pirofosfato formado na reao de
ativao imediatamente hidrolisado por uma segunda enzima, uma pirofosfatase inorgnica,
que fora a reao de ativao na direo da formao do acil-CoA graxo



Os steres dos acil-CoA graxos formados no lado citoslico da membrana mitocondrial
externa podem ser transportados para o interior da mitocndria e oxidados para produzir ATP
ou ser empregados no citosol para sintetizar Iipdios de membrana.

Os cidos graxos destinados para a oxidao mitocondrial so ligados de forma
transitria ao grupo hidroxila da carnitina formando o derivado acil-graxo carnitina - a segunda
reao do sistema transportador. Essa transesterificao catalisada pela carnitina
aciltransferase, presente na face externa da membrana externa. A passagem para o interior do
espao intermembranas ocorre atravs de poros grandes (formados pela protena porina) na
membrana externa. O ster acil-carnitina graxo cruza a membrana mitocondrial interna e
chega na matriz por difuso facilitada atravs do transportador acil-carnitina/ carnitina No
terceiro passo, o grupo acil-graxo transferido enzimaticamente da carnitina para a coenzima
A intramitocondrial pela carnitina aciltronsferase II. Esta isoenzima est localizada na face
interna da membrana mitocondrial interna, onde ela regenera o acil-CoA graxo e o libera,
juntamente com a carnitina livre, na matriz mitocondrial. A carnitina reentra no espao entre
as membranas mitocondriais intern a e externa atravs do transportador acil-
carnitina/carnitina.






-oxidao mitocondrial:
A oxidao mitocondrial dos cidos graxos ocorre em trs estgios

-oxidao de cidos graxos saturados:
Quatro reaes catalisadas por enzimas esto envolvidas no primeiro estgio da
oxidao dos cidos graxos.

Os quatro passos da -oxidao so repetidos para produzir acetil-CoA e ATP:
Em uma passagem atravs da sequncia de reaes da oxidao so removidos do
acil-CoA graxo de cadeia longa uma molcula de acetil-CoA, dois pares de eltrons e quatro
prtons (H
+
), diminuindo a cadeia em dois tomos de carbono.
A equao para uma passagem, comeando com o ster de coenzima A de palmitato,
:

Palmitoil-CoA + CoA + FAD + NAD
+
+ H
2
O miristoil-CoA +acetil-CoA + FADH
2
+ NADH
+
+H
+


O miristoil-CoA pode, agora, passar pelo conjunto de quatro reaes da -oxidao, de
forma anloga ao primeiro, para liberar uma segunda molcula de acetil-CoA e o lauroil-CoA
(12 tomos de carbono).
No final, sete passagens atravs da sequncia de reaes da -oxidao so
necessrias para oxidar uma molcula de palmitoil-CoA em oito molculas de acetil-CoA.


A equao global :
Palmitoil-CoA + 7CoA + 7FAD + 7NAD
+
+ 7H
2
O 8 acetil-CoA + 7FADH
2
+ 7NADH + 7H
+

A equao global final :
Palmitoil-CoA + 7CoA + 7O
2
+ 28ADP + 28P
i
8 acetil-CoA + 28ATP + 7H
2
O


8 acetil-CoA no ciclo do cido ctrico:
8 acetil-CoA + 16O
2
+ 80ADP + 80P
i
8CoA + 80ATP +16CO
2
+ 16H
2
O


A equao global final para oxidao completa :
Palmitoil-CoA + 23O
2
+ 108ADP + 108P
i
CoA + 108ATP + 16CO
2
+ 23H
2
O



Como a ativao do palmitato em palmitoil- CoA quebra as duas ligaes fosfoanidrido
do ATP, o custo energtico de ativar um cido graxo equivalente a duas molculas de ATP e o
ganho lquido por molcula de palmitato igual a 106 molculas de ATP.
A variao da energia livre-padro para a oxidao do palmitato at CO
2
+ H
2
0 est
prxima de 9.800 kJ/mol . Sob condies-padro, 30,5 x 106 = 3.230 kJ/mol, aproximadamente
33% do mximo terico so recuperados na forma de ligaes fosfato ricas em energia de ATP.
Entretanto, quando as variaes de energia livre so calculadas, a recuperao de energia livre
est acima de 60%.

Oxidao de cidos graxos insaturados:
As ligaes duplas dos cidos graxos insaturados esto na configurao cis e no
podem sofrer a ao da enoil-CoA hidratase. So necessrias duas enzimas auxiliares para a
oxidao dos cidos graxos insaturados comuns: uma isomerase e uma redutase




Oxidao de cidos graxos com nmero mpar de carbonos:
Embora o maior nmero de lipdios de
ocorrncia natural contenha cidos graxos com
um nmero par de tomos de carbono, os
cidos graxos com um nmero mpar de
carbonos so comuns nos lipdios de muitos
vegetais e de organismos marinhos
cidos graxos de cadeia longa e
nmero mpar de tomos de carbono so
oxidados pela mesma via dos cidos com
nmero par de tomos de carbono. Entretanto,
o substrato para o ltimo passo atravs da
sequncia de -oxidao um acil-CoA graxo
que tem cinco tomos de carbono. Quando
esse cido clivado, os produtos so acetil-CoA
e propionil-CoA. O acetil -CoA pode ser oxidado
pela via do cido ctrico, mas o propionil-CoA
tomauma via enzimtica diferente, envolvendo
trs enzimas:
Regulao da oxidao de cidos graxos:
A concentrao do malonil-CoA, o primeiro intermedirio na biossntese citoslica dos
cidos graxos de cadeia longa a partir do acetil-CoA, aumenta sempre que o animal bem
suprido com carboidratos; qualquer excesso de glicose que no pode ser oxidado ou
armazenado como glicognio convertido em cidos graxos citoslicos para estocagem, na
forma de triacilglicerol.
A inibio da carnitina aciltransferase I pelo malonil-CoA assegura que a oxidao dos
cidos graxos seja diminuda sempre que o fgado apresenta amplo suprimento de glicose para
usar como combustvel e, ao mesmo tempo, est fabricando ativamente triacilgliceris a partir
dessa glicose em excesso.
Duas das enzimas da -oxidao tambm so reguladas por metablitos que sinalizam
o suprimento suficiente de energia. Quando a relao [NADH]/[NAD
+
] est alta, a -hidroxiacil-
CoA desldrogenase inibida; alm disso, altas concentraes de acetil-CoA inibem a tiolase.

Glioxissomos e peroxissomos tambm realizam -oxidao :
Nos peroxissomos, no primeiro passo da oxidao, os eltrons so tramsferidos
diretamente para o O
2
, produzindo H
2
O
2
. A gua oxigenada um oxidante forte, sendo
imediatamente decomposta em H
2
O e O
2
pela enzima catalase.

Os peroxissomos dos tecidos animais so especializados na oxidao de cidos graxos
de cadeia muito longa , como o cido hexacosanico (26:0), e cidos graxos com cadeia
ramificada, como os cidos fitnico e pristnico.
Os glioxissomos ocorrem apenas durante a germinao das sementes e podem ser
considerados como peroxissomos especializados. O papel biolgico da -oxidao que ocorre
nos glioxissomos fornecer precursores biossintticos que se originam de lipdios
armazenados, no energia.

-oxidao:
Ocorre no retculo endoplasmtico;
Oxidao do carbono (mais distante da carbonila), em lcool ,aldedo e cido
carboxlico, produzindo cidos graxos com duas carboxilas;
Qualquer uma das carboxilas pode se ligar a CoA e sofrer -oxidao;
cidos dicarboxlicos com 6C formados podem entrar no ciclo do cido ctrico.

-oxidao:
Ocorre nos peroxissomos;
Oxidao cidos graxos de cadeia ramificada;
Quando o C est metilado, no pode ser oxidado;
O C hidroxilado, ocorre uma descarboxilao formando um aldedo com um C e o
C , agora sem o grupo substituinte pode ser oxidado pela -oxidao.

Corpos cetnicos:
Durante a oxidao dos cidos graxos no fgado dos seres
humanos e da maioria dos outros mamferos, o acetil-CoA formado
pode entrar no ciclo do cido ctrico, ou ser convertido nos chamados
corpos ce tnicos- acetona, acetoacetato e D--hidroxibutirato, que
so exportados para outros tecidos atravs da circulao sangunea.
A acetona, produzida em menores quantidades que os
outros corpos cetnicos, exalada. O acetoacetato e o D--
hidroxibutirato so transportados pelo sangue at os tecidos extra-
hepticos, onde so convertidos em acetil -CoA e oxidados no ciclo
do cido ctrico.
Tecidos como o crtex renal, msculos esquelticos e cardaco utilizam estes
compostos para obter energia. Mesmo o crebro, que normalmente utiliza apenas a glicose
como combustvel, em condies de fome crnica ou jejum prolongado, pode adaptar-se para
usar o acetoacetato ou o D--hidroxibutirato na obteno de energia
No fgado


Nas pessoas saudveis, a acetona formada em quantidades muito pequenas a partir
do acetoacetato. Como as pessoas com diabetes no tratado produzem grandes quantidades
de acetoacetato, seu sangue contm quantidades significativas de acetona, a qual txica e
voltil. Por isso, ela eliminada no ar expirado e confere odor caracterstico que, algumas
vezes, til no diagnstico do diabetes.
Em tecidos extra-hepticos

A produo e a exportao dos corpos cetnicos pelo fgado permitem a oxidao
continuada dos cidos graxos com um a oxidao mnima do acetil- CoA no prprio fgado.
Quando os intermedirios do ciclo do cido ctrico esto sendo retirados para serem
empregados na sntese da glicose atravs da gliconeognese, a oxidao dos intermedirios do
ciclo do cido ctrico diminui e o mesmo ocorre com a oxidao do acetil-CoA.
O fgado contm uma quantidade limitada de coenzima A e, quando a maior parte dela
est ligada nas molculas do acetil-CoA, a -oxidao dos cidos graxos diminui de velocidade
por falta dessa coenzima livre. A produo e a exportao dos corpos cetnicos liberam a
coenzima A, permitindo que a oxidao dos cidos graxos continue.
A produo em excesso dos corpos cetnicos no diabetes melito no tratado ou
durante a reduo grave da ingesto calrica pode levar cetose e acidose.


CATABOLISMO DE AMINOCIDOS E DEGRADAO DE BASES NITROGENADAS

CATABOLISMO DE AMINOCIDOS
Energia metablica obtida por oxidao dos aminocidos varia muito:
Carnvoros, imediatamente aps uma refeio, podem obter da oxidao dos
aminocidos at 90% das suas necessidades de energia.
Os herbvoros podem obter apenas uma pequena frao de suas necessidades
energticas.
A maioria dos microrganismos pode retirar aminocidos do seu ambiente e
estes podem ser oxidados quando necessrios.
Nos animais, os aminocidos podem sofrer degradao oxidativa em trs
circunstncias metablicas diferentes:
1 . Durante a sntese e degradao normais das protenas celulares (renovao);
2. Quando a dieta rica em protenas e a quantidade de aminocidos ingeridos maior
que as necessidades corporais de biossntese;
3 . Durante o jejum prolongado ou o diabetes melito.
Os aminocidos perdem seus grupos amino e os -cetocidos formados podem sofrer
oxidao at CO
2
e H
2
O.
Esses -cetocidos tambm fornecem unidades de trs e quatro tomos de carbono
que so convertidas em glicose pela gliconeognese, glicose que pode suprir as necessidades
energticas das funes do crebro, dos msculos e de outros tecidos






Degradao de protenas da alimentao:


Destino metablico dos grupos amino:
Os aminocidos presentes nos alimentos so a fonte da maioria dos grupos amino e a
maioria dos aminocidos metabolizada no fgado. Parte da amnia assim gerada reciclada e
empregada em uma grande variedade de processos biossintticos; dependendo do tipo de
organismo considerado, o excesso de amnia excretado diretamente ou convertido ou em
uria ou em cido rico.
O primeiro passo no catabolismo da maioria dos L-aminocidos que chegam ao figado
a remoo dos grupos -amino promovida por enzimas chamadas aminotransferases ou
transaminases. Nessas reaes de transaminao, o grupo -amino transferido para o tomo
de carbono do -cetoglutarato, produzindo o respectivo -cetocido anlogo do aminocido

Todas as aminotransferases possuem um grupo prosttico comum e o mesmo
mecanismo de reao. O grupo prosttico o piridoxal fosfato (PLP), a forma de coenzima da
piridoxina ou vitamina B
6
.
O piridoxal fosfato funciona como um transportador intermedirio d e grupos amino
no stio ativo das aminotransferases.
Nos hepatcitos, o glutamato transportado do cilosol para o interior das
mitocndrias onde ele sofre desaminao oxidativa catalisada pela L-glutamato
desidrogenase. A ao combinada de uma aminotransferase e da glutamato desidrogenase
referida como uma transdesaminao. Alguns poucos aminocidos contornam a via de
transdesaminao e sofrem desaminao oxidativa direta.
Em muitos tecidos, incluindo o crebro,
alguns processos como a degradao de
nucleotdios geram amnia livre. Na maioria
dos animais, a maior parte dessa amnia livre
convertida em um composto no-txicos antes
de ser exportada, atravs do sangue, dos
tecidos extra-hepticos para o fgado ou rins. A
amnia livre produzida nos tecidos
combinada enzimaticamente com o glulamato
para liberar glutamina por meio da ao da
gIutamina sintetase.






Na maioria dos animais terrestres, a
glutamina em excesso da quantidade necessria
para as reaes biossintticas transportada pelo
sangue para o intestino, para o fgado e para os rins
para processamento. Nesses tecidos, o nitrognio
do grupo amida liberado como amnia nas
mitocndrias, na qual a enzima glutaminase
converte a glutamina em glutamato e NH
4
+
.

A alanina tambm desempenha um papel
especial no transporte para o fgado dos grupos
amino em uma forma no-txica, atravs do ciclo
da glicose-alanina.










Excreo de nitrognio e ciclo da uria:
Quando no so empregados para a sntese de novos aminocidos ou outros
compostos nitrogenados, os grupos amino so canalizados para a formao de um nico
produto final, a uria.
A maioria das espcies aquticas, como a dos peixes sseos, excreta o nitrognio do
grupo amino como amnia e, por isso, so chamados de animais amoniotlicos. A grande
quantidade de gua do meio ambiente dilui a amnia e sua toxidez.
Os animais terrestres necessitam de formas de excreo do nitrognio que minimizem
no s a toxicidade da amnia, como tambm a perda de gua.
A maioria dos animais terrestres so ureotlicos, eles excretam o nitrognio originrio
dos grupos amino na forma de uria; os pssaros e os rpteis excretam o nitrognio amino
como cido rico e so chamados uricotlicos.
Nos organismos ureotlicos a amnia convertida em uria nas mitocndrias dos
hepatcitos, atravs do ciclo da uria.



A estequiometria da sntese de uria :
CO
2
+ NH
4
+
+ 3 ATP + aspartato + 2H
2
O Uria + 2ADP + 2P
i
+ AMP + PP
i
+ fumarato
O PP
i
rapidamente hidrolisado e, desse modo, so consumidas quatro ligaes
fisfodister.


Assim , a equao global final do ciclo da uria :
CO
2
+ 2NH
4
+
+ 3 ATP + 2H
2
O Uria + 2ADP + 4P
i
+ AMP
Entretanto, o ciclo da uria tambm faz a converso lquida do oxaloacetato em
fumarato (via aspartato) e a regenerao do oxaloacetato produz NADH que pode gerar ATP
durante a respirao mitocondrial, reduzindo muito o custo energtico da sntese de uria

Regulao do ciclo da uria:
A primeira enzima na via, a carbamoil fosfato sintetase I, ativada alostericamente por
N-acetilglutamato, que sintetizado de acetil-CoA e glutamato pela N-acetilglutamato sintase


Destino dos esqueletos de carbono dos aminocidos:
Os aminocidos so degradados a compostos que podem ser metabolizados at CO
2
e
H
2
O ou usados na gliconeognese.
Os aminocidos padro so catabolizados a um ou mais dos seguintes intermedirios:
piruvato, -cetoglutarato, succinil-CoA, fumarato, oxaloacetato, acetil-CoA ou acetoacetato.
A estratgia de degradao dos aminocidos formar intermedirios metablicos
importantes que possam ser transformados em glicose ou oxidados pelo ciclo do cido ctrico.
Os aminocidos podem ser divididos em dois grupos, tendo como base suas rotas
metablicas:
Aminocidos glicognicos: os quais so degradados a piruvato, -cetoglutarato,
succinil-CoA, fumarato ou oxaloacetato,sendo precursores da glicose;
Aminocidos cetognicos: so degradados a acetil-CoA ou acetoacetato e podem se
converter emciodsgraxos ou corpos cetnicos, mas no em glicose.


Degradao de bases nitrogenadas
Bases Pricas





























Bases Pirimdicas
Produo de amnia e uria














Doena Gota
Durante muito tempo a causa doena gota foi atribuda ao fato de seus portadores
terem "vida boa e fcil"; na verdade, ela uma doena das articulaes provocada por
elevada concentrao de cido rico no sangue e nos tecidos. Devido a um depsito
anormal de cristais de urato de sdio nas articulaes elas inflamam, tornam-se dolorosas e
artrticas. Os rins so afetados porque o cido rico tambm depositado nos tbulos renais.
A causa precisa da gota no conhecida, mas frequentemente ela envolve uma
excreo diminuda de urato. Uma deficincia gentica de alguma enzima que atua no
metabolismo das purinas tambm pode ser um fator em alguns casos.
A gota pode ser tratada com eficcia por uma combinao de terapias nutricionais
e farmacuticas. Grandes melhoras se seguem ao emprego da droga alopurinol, um inibidor
da xantina oxidase.



GLICONEOGNESE
Via metablica importante

Gliconeognese
Sntese de Glicose Nova
Ocorre no fgado e rins
importante quando:
Jejum prolongado
Consumo inadequado de CHO

Origem da Glicose durante o Jejum
Estudos com marcao isotpica mostraram que a gliconeognese responsvel por
64 % da produo total de glicose durante as primeiras 22 horas de
praticamente toda a produo de glicose aps 46 horas.
Ocorre em todos os animais, vegetais, fungos e microrganismos.
Os precursores importantes da glicose nos animais so o lactato, o piruvato, o glicerol
e a maioria dos aminocidos.
Via metablica importante

Sntese de Glicose Nova
e rins
importante quando:
Jejum prolongado
Consumo inadequado de CHO
Origem da Glicose durante o Jejum
Estudos com marcao isotpica mostraram que a gliconeognese responsvel por
64 % da produo total de glicose durante as primeiras 22 horas de jejum e responde por
praticamente toda a produo de glicose aps 46 horas.
Ocorre em todos os animais, vegetais, fungos e microrganismos.
Os precursores importantes da glicose nos animais so o lactato, o piruvato, o glicerol

Estudos com marcao isotpica mostraram que a gliconeognese responsvel por
jejum e responde por
Os precursores importantes da glicose nos animais so o lactato, o piruvato, o glicerol

Durante o exerccio:
Gliconeognese significativa
Fornecer glicose adicional ao corao e msculo esqueltico:
Ciclo de Cori
Ciclo Glicose - alanina










Lactato liberado pelo msculo ativo convertido em glicose no fgado, jogada na
circulao e captada pelo msculo, que novamente a transforma em lactato e assim por diante


Nas sementes em germinao, as gorduras e as protenas armazenadas so
convertidas em sacarose por vias que incluem a gliconeognese, a qual distribuda para as
partes do vegetal em desenvolvimento. A glicose e seus derivados so precursores na sntese
da parede celular, nucleotdios e coenzimas.
Em muitos microrganismos, a gliconeognese comea com compostos orgnicos
simples presentes em seu meio de cultura, estes compostos tm dois ou trs carbonos, como
acetato, lactato e propionato.
As reaes da gliconeognese so as mesmas em todos os organismos vivos;
O contexto metablico e a regulao da via diferem de espcie para espcie e de
tecido para tecido.

Gliclise e gliconeognese:
vias compartilham vrios passos intermedirios;
no so vias idnticas fluindo em direes opostas;
sete das 10 reaes enzimticas da gliconeognese so inverses de reaes da
gliclise
Ciclo de Cori
Fgado Sangue Msculo

Glicose Glicose
2 NAD
+
2 NAD
+
2 NADH 2 NADH
6 ~P 2 ~P

2 Piruvato 2 Piruvato
2 NADH 2 NADH
2 NAD
+
2 NAD
+


2 Lactatos 2 Lactatos
A gliconeognese utiliza quase todas as enzimas
da via oposta (gliclise) para a sntese de glicose
com exceo paras as reaes irreversveis:
Piruvato fosfoenolpiruvato
Frutose 1,6-bifosfato frutose 6-fosfato
Glicose 6-fosfato glicose

Na gliconeognese, esses trs passos so contornados por um conjunto separado de
enzimas que catalisa reaes que so suficientemente exergnicas para ser efetivamente
irreversveis na direo da sntese da glicose.
Gliclise e gliconeognese so processos irreversveis.
Nos animais, as duas vias ocorrem principalmente no citosol e necessrio que ambas
sejam reguladas de forma coordenada e recproca.

Converso do piruvato em fosfoenolpiruvato:



A fosforilao do piruvato
conseguida por uma seqncia de
reaes que, nos mamferos e em
alguns outros organismos, requer a
participao de enzimas existentes
tanto no citosol quanto no interior
das mitocndrias.












A piruvato carboxilase, uma enzima
mitocondrial que requer a coenzima biotina,
converte o piruvato em oxaloacetato:



A membrana mitocondrial no tem transportador para o oxaloacetato e o oxaloacelato
formado do piruvato precisa ser reduzido a malato pela malato desidrogenase mitocondrial,
com o consumo de NADH:
Oxaloacetato + NADH + H
+
L-malato + NAD
+

A seguir, o malato abandona a mitocndria atravs de um transportador especifico
presente na membrana mitocondrial interna e, no citosol, reoxidado em oxaloacetato, com a
produo de NADH citoslico:
L-malato + NAD
+
oxaloacetato + NADH + H
+


O oxaloacetato convertido a fosfoenolpiruvato
pela fosfoenolpiruvato carboxiquinase por meio de uma
reao dependente de Mg
2+
, no qual GTP funciona como
doador do grupo fosforila.





Piruvato + ATP + GTP + HCO
3
-
Fosfoenolpiruvato + ADP + GDP + P
i
+ CO
2

Piruvato + ATP + GTP Fosfoenolpiruvato + ADP + GDP + P
i

Para fosforilar uma molcula de piruvato em fosfoenolpiruvato precisam ser
consumidos dois grupos fosfato de alta energia
Existe uma lgica na ocorrncia dessas reaes no interior da mitocndria. A relao
[NADH]/[NAD
+
] no citosol 8 x 10
-4
, prximo de 10
5
vezes menor que na mitocndria. Como o
consumo citoslico de NADH obrigatrio na gliconeognese (na converso de 1,3-
bifosfoglicerato em gliceraldedo 3-fosfato), a biosntese da glicose no pode ocorrer at que o
NADH esteja disponvel.
O transporte do malato da mitocndria para o citosol e sua converso para
oxaloacetato tm o efeito de remover equivalentes redutores para o citosol, onde eles so
escassos. Portanto, essa transformao do piruvato em fosfoenolpiruvato providencia um
importante equilbrio entre a produo e o consumo de NADH no citosol durante a
gliconeognese.


Um segundo desvio
piruvato fosfoenolpiruvato
predomina quando o lactato
o precursor gliconeognico. A
converso do lactato em
piruvato no citosol do
hepatcito libera NADH e no
mais necessria a exportao
de radicais redutores (como
malato) da mitocndria para o
citosol.








Converso da frutose 1,6-bifosfato em frutose 6-fosfato:
A segunda reao da via glicoltica que no pode participar do processo da
gliconeognese a fosforilao da frutose 6-fosfato pela fosfofrutoquinase 1.
A gerao de frutose 6-fosfato a partir de frutose 1,6-bifosfato calalisada por uma
enzima diferente: a frutose 1,6-bifosfatase, dependente de Mg
2+
, que promove a hidrlise
irreversvel do fosfato no C-1 (no ocorre a transferncia do grupo fosforila para o ADP):
Frutose 1,6-bifosfato + H
2
O Frutose 6- fosfato + P
i


Converso da glicose 6fosfato em glicose livre:
A reverso simples da reao da hexoquinase requereria a transferncia de um grupo
fosforila da glicose 6- fosfato para o ADP, com formaO de ATP, uma reao energeticamente
desfavorvel. A reao catalisada pela glicose 6-fosfatase no requer a sntese de ATP e a
hidrlise simples de um ster fosfrico:
Glicose 6-bifosfato + H
2
O glicose + P
i

A gliconeognese energeticamente custosa:
2 Piruvato + 4ATP + 2GTP + 2NADH + 2H
+
+ 4H
2
O glicose + 4ADP + 2GDP + 6P
i
+ 2NAD
+

De glicose a piruvato:
Glicose + 2ADP + 2Pi + 2NAD
+
2 piruvato + 2ATP + 2NADH + 2H
+
+ 2H
2
O

A via biossinttica at a glicose permite a sntese lquida de glicose no apenas de
piruvato, mas tambm dos intermedirios do ciclo do cido ctrico com quatro, cinco e seis
tomos de carbono.
Muitos aminocidos derivados de protenas so convertidos em piruvato ou em
intermedirios do ciclo do cido ctrico. Tais aminocidos podem sofrer uma converso real em
glicose (glicognicos).

Formao de glicognio:
Os nucleotdios de acar so substratos para as reaes de polimerizao dos
monossacardios em dissacardios, e em glicognio, amido, celulose e outros polissacardios.
A adequao dos acares de nucleotdios para participar de reaes biossintticas
provm de vrias de suas propriedades:
Sua sntese irreversvel e contribui para a irreversibilidade das vias biossintticas nas
quais eles so intermedirios
A poro nucleotdica tem muitos grupos que podem participar de interaes no-
covalentes com as enzimas
O fosfato facilitando o ataque nucleoflico pela ativao do carbono do acar ao qual
est ligado
Empregando grupos nucleotdicos como marcadores de algumas hexoses, as clulas
podem reuni-Ias em grupos para um determinado propsito (sntese do glicognio,
por exemplo) e assim separ-Ias das demais hexosesfosfato destinadas a outro
propsito.

O ponto de partida para a sntese do glicognio a glicose 6-fosfato.
Para iniciar a sntese do glicognio, a glicose 6-fosfato convertida em glicose1-fosfato
pela reao catalisada pela fosfoglicomutase:
Glicose 6-fosfato glicose 1-fosfato
O produto dessa reao e convertido em UDP-glicose pela ao da UDP-glicose
pirofosforilase
Glicose 1-fosfato + UTP UDP-glicose + PP
i
A UDP-glicose a doadora de resduos de glicose na reao catalisada pela glicognio
sintase, e ela promove a transferncia do resduo de glicose da UDP-glicose para a ponta no-
redutora de uma ramificao na molcula do glicognio.





A glicognio sintase no pode sintetizar as ligaes ( 1 6) encontradas nos pontos
de ramificaao. Essas ligaes so formadas pela enzima de ramificaao do glicognio. Esta
enzima catalisa a transferncia de um fragmento de 6 ou 7 resduos de glicose de uma ponta
no-redutora de um ramo do glicognio que tem ao menos 11 resduos at o grupo hidroxila
do C 6 de um resduo de glicose em uma posio mais interior da mesma ou de outra cadeia de
glicognio



A glicognio sintase no pode iniciar uma cadeia nova de glicognio a partir de
molculas de glicose. Ela necessita de um molde previamente existente, e este , em geral,
uma cadeia pr-formada de molculas de glicose unidas por ligaes ( 1 4) e com um
nmero mnimo de oito resduos.
A glicogenina, uma protena, inicia a sntese do glicognio. O primeiro passo a
transferncia de um resduo de glicose da UDP-glicose para o grupo hidroxila de um resduo de
tirosina da glicogenina, isto catalisado pela atividade glicosiltransferase intrnseca dessa
protena. A cadeia nascente aumentada pela adio sequencial de mais sete resduos de
glicose fornecidos pela UDP-glicose; essas reaes so catalisadas pela atividade de extenso
da cadeia da glicogenina.












A partir da, a glicognio sintase assume seu papel cataltico e continua a estender a
cadeia do glicognio. A glicogenina permanece sepultada dentro da partcula de glicognio,
ligada de forma covalente na nica extremidade redutora da molcula do glicognio.



Regulao da gliclise e gliconeognese:
Caso fosse permitido que a gliclise (a converso da glicose em piruvato) e a
gliconeognese (a converso do piruvato em glicose) ocorressem simultaneamente e com
grande velocidade,o resultado seria o consumo de ATP e a produo de calor.
Por exemplo, as enzimas fosfofrutoquinase- 1 (PFK-1) e a frutose 1,6-bifosfato
fosfatase (FBPase-1) catalisam reaes opostas:
ATP + frutose 6-fosfato ADP + frutose 1,6-bifosfato
Frutose 1,6-bifosfato + H
2
O Frutose 6- fosfato + P
i

A soma destas duas reaes :
ATP + H
2
0 ADP + P
i
+ calor
As duas vias so reguladas de tal forma que, quando o fluxo da glicose atravs da
gliclise aumenta, o fluxo do piruvato em direo glicose diminui, e vice-versa.
Regulao da gliclise:
Hexoquinase:
Msculo: inibida por glicose 6-fosfato
Fgado: modulada por uma protena e durante o jejum a frutose 6-fosfato aciona a
inibio da hexoquinase.
Fosfofrutoquinase 1:
Inibida por ligao a um sitio alostrico e, com isso, diminui a afinidade da enzima pela
frutose 6-fosfato;
Tem atividade aumentada quando ADP e AMP se acumulam;
Concentraes altas de citrato aumentam o efeito inibidor do ATP;
O regulador alostrico mais importante a frutose 2,6- bifosfato que ativa fortemente
a enzima.
Piruvato quinase:
Concentraes altas de ATP, acetil-CoA e cidos graxos de cadeia longa inibem
alostericamente todas as isoenzimas da piruvato quinase;
A isoenzima heptica (forma L) submetida a regulao adicional por fosforilao, o
que no ocorre com a isoenzima do tecido muscular (forma M): liberao do glucagon
ativa a protena quinase dependente de cAMP que fosforila a isoenzima L da piruvato
quinase e a inativa.

Regulao da gliconeognese:
Piruvato carboxilase:
A concentrao aumentada do acetil-
CoA inibe o complexo da piruvato
desidrogenase fazendo diminuindo a formao
de acetil-CoA proveniente do piruvato e
estimula a gliconeognese pela ativao da
piruvato carboxilase: permitindo que o excesso
de piruvato seja convertido em glicose.








Frutose 1,6-bifosfatase 1:
Inibida por AMP;
Inibida por frutose 2,6-bifosfato


Regulao da gliclise e gliconeognese por frutose 2,6-bifosfato:
Quando o nvel de glicose no sangue diminui, o hormnio glucogon avisa ao fgado
para produzir e liberar mais glicose e diminuir seu consumo para satisfazer suas necessidades
prprias. Uma das fontes de glicose o glicognio estocado no fgado; a outra fonte a
gliconeognese heptica.
A regulao hormonal da gliclise e da gliconeognese mediada pela frutose 2,6-
bifosfato, um efetor alostrico das enzimas PFK-1 e FBPase-1.

A concentrao celular da frutose 2,6-bifosfato determinada pelas velocidades de
sua formao e de sua quebra. Ela formada pela fosforilao da frutose 6-fosfato, que
catalisada pela fosfofrutoquinase-2 (PFK-2), e hidrolisada pela frutose 2,6-bifosfatase-2
(FBPase- 2)

A PFK-2 e a FBPase-2 so duas atividades enzimticas diferentes de uma nica protena
bifuncional. O equilbrio dessas duas atividades no fgado determina o nvel celular da frutose
2,6-bifosfato, e ele regulado pelo glucagon e pela insulina.
O glucagon estimula a adenilil ciclase do hepatcito que produz o cAMP. O cAMP ativa
a protena quinase dependente de cAMP que transfere o grupo fosforila do ATP para a
protena bifuncional PFK-2/FBPase-2. A fosforilao dessa protena ativa sua atividade FBPase-
2 e inibe a atividade de PFK-2. Com isso, o glucagon diminui o nvel celular de frutose 2,6-
bifosfato inibindo a gliclise e estimulando a gliconeognese.

A insulina tem efeito oposto por estimular a atividade da fosfoprotena fosfatase que
catalisa a remoo do grupo fosforila da protena bifuncional PFK-2/FBPase-2 e, assim, ativar
sua atividade de PFK-2 e aumentar o nvel de frutose 2,6-bifosfato que estimula a gliclise e
inibe a gliconeognese.

FOTOSSNTESE
1. Luz como fonte de energia
A luz solar per si no uma energia muito til, visto
que ela no gera trabalho, alm disso, ela no pode ser
armazenada. Para ser plenamente utilizada, a energia solar
deve ser convertida em outras formas de energia. E
exatamente isso que ocorre na fotossntese, as plantas
convertem a energia solar em formas de energia que podem
ser armazenadas e utilizadas posteriormente.



Todas as nossas necessidades energticas nos so fornecidas pelos vegetais, seja
diretamente, ou atravs dos animais herbvoros
A fotossntese ocorre em uma grande
variedade de bactrias eucariotos
unicelulares (algas), bem como em plantas
vasculares.
Processo que utiliza a energia
luminosa para reduo de carbono.
CO
2
+ H
2
O O
2
+ (CH
2
O)


Nas plantas, a fotossntese abrange dois processos: as
reaes dependentes da luz ou reaes luminosas, que
ocorrem apenas quando as plantas so iluminadas; e as
reaes de assimilao (ou de fixao do carbono)






Nas plantas, tanto as reaes dependentes da luz como as de fixao do carbono
ocorrem nos cloroplasto.
Embebidos nas membranas dos tilacides esto os pigmentos fotossintticos e os
complexos enzimticos que promovem as reaes luminosas e a sntese do ATP. O estroma
contm a maioria das enzimas requeridas para as reaes de assimilao do carbono
luz

Como a luz absorvida?
A luz visvel a radiao eletromagntica com comprimentos de onda entre 400 e
700nm, uma pequena parte do espectro eletromagntico, indo do violeta ao vermelho. A
energia de nico fton (um quantum
na extremidade vermelha.
Quando um fton absorvido, um eltron da molcula que o absorveu deslocado
para um nvel superior de energia. Um eltron deslocado para um orbital superior de energia
usualmente retorna rapidamente ao seu orbital de menor energia. A molcula excitada cai
para o estado fundamental estvel, fornecendo o quantum absorvido como luz ou calor ou
usando-o para realizar um trabalho qumico.
Os mais importantes pigmentos que absorvem luz na
clorofilas, pigmentos verdes com estruturas policclicas planas, que se assemelham
protoporfirina da hemoglobina, exceto que o Mg
Como a luz absorvida?
A luz visvel a radiao eletromagntica com comprimentos de onda entre 400 e
700nm, uma pequena parte do espectro eletromagntico, indo do violeta ao vermelho. A
quantum de luz) maior na extremidade violeta do espectro que
Quando um fton absorvido, um eltron da molcula que o absorveu deslocado
para um nvel superior de energia. Um eltron deslocado para um orbital superior de energia
torna rapidamente ao seu orbital de menor energia. A molcula excitada cai
para o estado fundamental estvel, fornecendo o quantum absorvido como luz ou calor ou
o para realizar um trabalho qumico.
Os mais importantes pigmentos que absorvem luz nas membranas tilacides so as
clorofilas, pigmentos verdes com estruturas policclicas planas, que se assemelham
protoporfirina da hemoglobina, exceto que o Mg
2+
, e no o Fe
2+
, ocupa a posio central


A luz visvel a radiao eletromagntica com comprimentos de onda entre 400 e
700nm, uma pequena parte do espectro eletromagntico, indo do violeta ao vermelho. A
aior na extremidade violeta do espectro que

Quando um fton absorvido, um eltron da molcula que o absorveu deslocado
para um nvel superior de energia. Um eltron deslocado para um orbital superior de energia
torna rapidamente ao seu orbital de menor energia. A molcula excitada cai
para o estado fundamental estvel, fornecendo o quantum absorvido como luz ou calor ou
s membranas tilacides so as
clorofilas, pigmentos verdes com estruturas policclicas planas, que se assemelham
, ocupa a posio central
As cianobactrias e as algas vermelhas utilizam as ficobilinas, tal como a
ficoeritrobilina e a ficocianobilina, como pigmentos coletores de luz.
Alm das clorofilas, as membranas tilacides contm pigmentos secundrios que
absorvem luz chamados pigmentos acessrios ou carotenides. Os carotenides podem ser
amarelos, vermelhos ou purpreos.

Os pigmentos que absorvem a luz das membranas tilacides ou das bactrias esto
arranjados em conjuntos funcionais chamados fotossistemas.
Todas as molculas dos pigmentos em um fotossistema podem absorver ftons, mas
apenas algumas poucas molculas de clorofila associadas ao centro de reao fotoqumico so
especializadas para transformar a luz em energia qumica.
As molculas dos outros pigmentos em um fotossistema so chamadas de molculas
coletoras de luz ou molculas antena. Elas absorvem a energia luminosa e a transmitem rpida
e eficientemente para o centro de reao















Como energia luminosa transformada em energia qumica
As membranas tilacides dos cloroplastos apresentam dois tipos diferentes de
fotossistemas.
No fotossistema ll (FSII), a excitao do centro de reao P680 impulsiona eltrons
com o movimento concomitante dos prtons atravs da membrana tilacide. O fotossistema I
apresenta um centro de reao denominado P700.
Nas plantas, esses dois centros de reao atuam em sequncia para catalisar o
movimento dos eltrons impulsionados pela luz da H
transportados entre os dois fotossistemas pela protena sol
de um eltron funcionalmente similar ao citocromo c da mitocndria. Para substituir os
eltrons que se movem do FSII atravs do FSI para o NADP
produzindo O
2

O esquema Z descreve a rota
NADP
+
.
Para cada dois ftons absorvidos (um para cada fotossistema) um eltron transferido
da H
2
0 para o NADP
+
. Para formar uma molcula de O
eltrons de duas H
2
0 para dois NADP
para cada fotossistema.
Os eltrons temporariamente armazenados no plastoquinol resultantes da excitao
do P680 em FSII so transportados para o P700 de FSI atravs do complexo do
da protena solvel plastocianina.
Tal como o complexo II da mitocndria, o citocromo b
quinona reduzida para uma protena solvel que transporta um eltron (citocromo c na
mitocndria e plastocianina nos clorop
Nas plantas, esses dois centros de reao atuam em sequncia para catalisar o
movimento dos eltrons impulsionados pela luz da H
2
O para o NADP
+
. Os eltrons so
transportados entre os dois fotossistemas pela protena solvel plastocianina, um carregador
de um eltron funcionalmente similar ao citocromo c da mitocndria. Para substituir os
eltrons que se movem do FSII atravs do FSI para o NADP
+
ocorre oxidao da H

O esquema Z descreve a rota completa atravs da qual os eltrons fluem da H
Para cada dois ftons absorvidos (um para cada fotossistema) um eltron transferido
. Para formar uma molcula de O
2
, que requer a transferncia de quatro
0 para dois NADP
+
, um total de oito ftons devem ser absorvidos, quatro
Os eltrons temporariamente armazenados no plastoquinol resultantes da excitao
do P680 em FSII so transportados para o P700 de FSI atravs do complexo do
da protena solvel plastocianina.
Tal como o complexo II da mitocndria, o citocromo b
6
f transporta eltrons de uma
quinona reduzida para uma protena solvel que transporta um eltron (citocromo c na
mitocndria e plastocianina nos cloroplastos).
Nas plantas, esses dois centros de reao atuam em sequncia para catalisar o
. Os eltrons so
vel plastocianina, um carregador
de um eltron funcionalmente similar ao citocromo c da mitocndria. Para substituir os
ocorre oxidao da H
2
0,

completa atravs da qual os eltrons fluem da H
2
0 para o
Para cada dois ftons absorvidos (um para cada fotossistema) um eltron transferido
, que requer a transferncia de quatro
, um total de oito ftons devem ser absorvidos, quatro
Os eltrons temporariamente armazenados no plastoquinol resultantes da excitao
do P680 em FSII so transportados para o P700 de FSI atravs do complexo do citocromo b
6
f
f transporta eltrons de uma
quinona reduzida para uma protena solvel que transporta um eltron (citocromo c na
Tal como na mitocndria, a passagem dos eltrons resulta no bombeamento de
prtons atravs da membrana; nos cloroplastos, a direo do movimento de prtons do
compartimento estromal para o lmen tilacide.
Tanto a reao de quebra da gua como
citocromo b
6
f so acompanhados por bombeamento de prtons atravs da membrana
tilacide. A fora prton-motiva assim criada energiza a sntese do ATP por um complexo CF0
CF1 similar ao complexo mitocondrial F0 F1

Reao geral da fase clara da fotossntese
O fluxo de eltrons atravs dos fotossistemas produz NADPH e ATP na proporo
aproximada de 2:3. Um segundo tipo de fluxo de eltrons (fluxo cclico) produz apenas ATP e
permite variaes na proporo ent

Fixao do CO
2
: fase qumica da fotossntese
Nas reaes de assimilao do CO
para reduzir o CO
2
a trioses fosfato. Essas reaes ocorrem em trs estgios: a prpria reao
de fixao, catalisada pela rubisco; reduo do 3
regenerao da ribulose 1,5-
Tal como na mitocndria, a passagem dos eltrons resulta no bombeamento de
prtons atravs da membrana; nos cloroplastos, a direo do movimento de prtons do
compartimento estromal para o lmen tilacide.
Tanto a reao de quebra da gua como o fluxo de eltrons a travs do complexo do
f so acompanhados por bombeamento de prtons atravs da membrana
motiva assim criada energiza a sntese do ATP por um complexo CF0
CF1 similar ao complexo mitocondrial F0 F1.
Reao geral da fase clara da fotossntese
O fluxo de eltrons atravs dos fotossistemas produz NADPH e ATP na proporo
aproximada de 2:3. Um segundo tipo de fluxo de eltrons (fluxo cclico) produz apenas ATP e
permite variaes na proporo entre as quantidades formadas de ATP e NADH

: fase qumica da fotossntese
Nas reaes de assimilao do CO
2
(o ciclo de Calvin), ATP e NADPH so empregados
a trioses fosfato. Essas reaes ocorrem em trs estgios: a prpria reao
de fixao, catalisada pela rubisco; reduo do 3- fosfoglicerato a gliceraldedo 3
bifosfato com o emprego das trioses fosfato.
Tal como na mitocndria, a passagem dos eltrons resulta no bombeamento de
prtons atravs da membrana; nos cloroplastos, a direo do movimento de prtons do
o fluxo de eltrons a travs do complexo do
f so acompanhados por bombeamento de prtons atravs da membrana
motiva assim criada energiza a sntese do ATP por um complexo CF0


O fluxo de eltrons atravs dos fotossistemas produz NADPH e ATP na proporo
aproximada de 2:3. Um segundo tipo de fluxo de eltrons (fluxo cclico) produz apenas ATP e
re as quantidades formadas de ATP e NADH
(o ciclo de Calvin), ATP e NADPH so empregados
a trioses fosfato. Essas reaes ocorrem em trs estgios: a prpria reao
fosfoglicerato a gliceraldedo 3-fosfato; e


1
a
Etapa: fixao do CO
2


A enzima rubisco condensa o CO
2
com a ribulose 1,5-bifosfato formando uma hexose
bifosfato instvel que se rompe em duas molculas de 3-fosfoglicerato. A rubisco ativada por
modificao cova lente carbamoilao de um resduo de lisina - catalisada pela rubisco
ativase e inibida por um anlogo natural do estado de transio cuja concentrao aumenta no
escuro e diminui durante a luz do dia

2
a
Etapa: reduo

3
a
Etapa: Regenerao do aceptor

As enzimas do estroma, incluindo transcetolase e transaldolase, rearranjam os
esqueletos carbnicos das triose fosfato gerando intermedirios de trs, quatro, cinco, seis e
sete tomos de carbono, e produzindo, no final, pentoses fosfato. Essas pentoses fosfato so
convertidas em ribulose 5-fosfato e, depois, fosforiladas em ribulose 1,5-bifosfato para
completar o ciclo de Calvin.
O custo da fixao de trs CO
2
em uma triose fosfato de nove moles de ATP e seis
NADPH; todos eles so fornecidos pelas reaes da fotossintese energizadas pela luz.

Um contra transportador da membrana interna do cloroplasto troca Pi do citosol por
3- fosfoglicerato ou diidroxiacetona fosfato produzidos pela assimilao do CO
2
no estroma.



Fotorrespirao
Quando a rubisco usa o O
2
em lugar do
CO
2
como substrato, o 2- fosfoglicolato que ento
se forma descartado atravs de uma via
dependente de oxignio. Disso resulta um
consumo aumentado de O
2
, que chamado de
fotorrespirao ou, mais corretamente, ciclo
fotossinttico oxidativo do carbono, ou ciclo C2.















Atravs de uma via que envolve
enzimas presentes no estroma do
cloroplasto, no peroxissomo e na
mitocndria, o 2-fosfoglicolato convertido
em glioxilato, em glicina e, ento, em serina
.







A" fotorrespirao" no conserva energia e pode inibir a formao da biomassa em at
50%. Isso levou a algumas adaptaes evolucionrias no processo de assimilao do carbono,
particularmente nas plantas que evoluram em climas quentes.
Nas plantas C4, a via de assimilao do carbono minimiza a fotorrespirao: o CO
2

fixado primeiro em um composto com quatro tomos de carbono no interior das clulas
mesoflicas; esse composto passa para as clulas envoltrias do feixe vascular e libera o CO
2

em altas concentraes. Esse CO
2
fixado pela rubisco e as demais reaes do ciclo de Calvin
ocorrem como nas plantas C3.








A via de assimilao do CO
2
nos vegetais C4 tem um custo energtico maior que nos
vegetais C3. Para cada molcula de CO
2
fixada na via C4, uma molcula de PEP precisa ser
regenerada ao custo de dois grupos fosfato de alta energia do ATP. Assim, os vegetais C-4
precisam de um total de cinco molculas de ATP para fixar uma molcula de CO
2
, enquanto
nos vegetais C3 gastam apenas trs (nove por triose fosfato).
medida que a temperatura aumenta (e a afinidade da rubisco por CO
2
diminui), um
ponto alcanado (prximo de 28 a 30C), no qual o ganho em eficincia pela eliminao da
fotorrespirao nas planta C4 mais que compensa seu custo energtico.
As plantas suculentas como os cactos e o abacaxi (plantas CAM ou MAC, metabolismo
cido crassulceo), nativos de ambientes muito quentes e secos, possuem outra variao de
fixao fotossinttica do CO
2
que reduz a perda de vapor de gua atravs dos poros
(estomatos) pelos quais o CO
2
precisa entrar no tecido das folhas.
Nas plantas CAM, o CO
2
fixado no malato nos perodos escuros do dia e estocado em
vacolos at o incio do perodo diurno, quando os estomatos se fecham (minimizando a perda
de gua ) e o malato passa a servir como fonte do CO
2
para a rubisco.


Biossntese do amido e da sacarose
A amido sintase nos cloroplastos e nos amiloplastos catalisa a adio de resduos
unitrios de glicose, doados por ADP-glicose, na ponta redutora de uma molcula de amido
por meio de um mecanismo de insero composto por dois passos. As ramificaes na
amilopectina so introduzidas por uma segunda enzima.
A sacarose sintetizada no citosol utilizando UDP-glicose e frutose 1-fosfato em um
processo de dois passos.
















O destino das trioses fosfato para a sntese da sacarose ou para a sntese do amido
regulado pela frutose 2,6- bifosfato (F2,6BP), que um efetor alostrico das enzimas que
determinam o nvel de frutose 6-fosfato. A concentrao de F2,6BP varia de forma inversa
velocidade do processo de fotossntese, e F2,6BP inibe a sntese da frutose 6-fosfato, o
precursor da sacarose




























A enzima reguladora-chave da sntese de amido a ADPglicose pirofosforilase,que
ativada pelo 3- fosfoglicerato e inibida por Pi (que se acumula quando a condensao entre
ADP e Pi, energizada pela luz diminui). Quando a sntese da sacarose diminui , o 3-
fosfoglicerato formado pela fixao do CO
2
se acumula, provocando a ativao dessa enzima e
estimulando a sntese do amido.


BIOSSNTESE DE LIPDIOS

Biossntese de cidos graxos:
A biossntese dos cidos graxos e a sua oxidao ocorrem por vias totalmente
diferentes, so catalisadas por conjuntos diferentes de enzimas e ocorrem em compartimentos
distintos da clula. Um intermedirio de trs tomos de carbono, o malonil-CoA, participa na
biossntese dos cidos graxos, mas no na sua degradao oxidativa.
Formao de Malonil-CoA:
A partir do acetil-CoA
Processo irreversvel
Catalisado pela acetil-CoA carboxilase.
Essa enzima contm uma molcula de biotina como grupo prosttico ligado
covalentemente por meio de uma ligao amida ao grupo -amino de um resduo de lisina. O
grupo carboxila, derivado do bicarbonato (HCO
3
-
), primeiro transferido para a biotina em
uma reao dependente de ATP. O grupo biotinil funciona como um transportador temporrio
do CO
2
transferindo-o para o acetil-CoA na segunda etapa e liberando o malonil-CoA.

As longas cadeias carbnicas dos cidos graxos so montadas em uma seqncia
repetitiva de reaes com quatro etapas:













O grupo acil saturado produzido durante esse conjunto de reaes se transforma no
substrato de uma nova condensao com o grupo malonil ativado. Cada uma das passagens
atravs do ciclo aumenta a cadeia do grupo acil graxo de dois tomos de carbono. Quando o
comprimento da cadeia atinge 16 tomos de carbono, o produto formado abandona o ciclo.

As reaes so catalisadas por um complexo multienzimtico, a cido graxo sintase.
Embora os detalhes da estrutura enzimtica sejam diferentes nos procariotos, como a
Eschericllia coli, e nos eucariotos, o processo de quatro passos idntico em todos os
organismos.
O ncleo da cido graxo sintase da E. coli consiste de sete polipeptdios e ao menos
trs outras protenas agem em algum estgio do processo. Essas protenas agem em conjunto
para catalisar a formao de cidos graxos a partir de acetil-CoA e malonil-CoA. Por meio de
todo o processo, os intermedirios permanecem covalentemente ligados como tiosteres a
um dos dois grupos tiis do complexo da sintase.
Antes que possam comear as reaes de condensao que constroem a cadeia do
cido graxo, os dois grupos tiis do complexo enzimtico precisam ser carregados com os
grupos acil corretos. Primeiro, o grupo acetil do acetil-CoA transferido para o grupo -SH da
cistena na -cetoacil-ACP sintase (KS). Essa reao calalisada pela a acetil-CoA-ACP
transacetilase (AT).


Etapa 1 Condensao:
Os grupos ativados acetil e malonil so
condensados para formar o cetoacetil-ACP, um grupo
acetoacetil ligado ACP pelo grupo -SH da fosfopantetena;
ao mesmo tempo, produzida uma molcula de CO
2
. Nessa
reao, catalisada pela -cetoacil-ACP sintase (KS), o grupo
acetil transferido do grupo Cys-SH dessa enzima para o
grupo malonil no -SH da ACP, tornando-se a unidade de dois
carbonos metilterminal do novo grupo acetoacetil.
O tomo de carbono presente no CO
2
que se forma
nessa reao o mesmo tomo de carbono que foi
originalmente introduzido no malonil-CoA a partir do HCO
3
-

pela reao da acetil-CoA carboxilase. Assim, a ligao
covalente do CO
2
durante a biossntese dos cidos graxos
apenas transiente, sendo removida logo aps cada unidade
de dois carbonos ser inserida na cadeia.
Por que as clulas se do ao trabalho de adicionar C0
2
para formar um grupo se logo
aps perdem o mesmo CO
2
durante a formao do acetoacetato?
O emprego de grupos malonil ativados, em lugar dos grupos acetil, torna a reao de
condensao termodinamicamente favorvel. A energia extra necessria para fazer a sntese
do cido graxo favorvel fornecida pelo ATP usado para sintetizar o malonil-CoA a partir do
acetil-CoA e do bicarbonato

Etapa 2 Reduo do grupo carbonila:
O acetoacetil-ACP formado no passo
de condensao sofre reduo do grupo
carbonila em C-3 para formar D--
hidroxibutiril-ACP. Essa reao catalisada
pela -cetoacil-ACP redutase (KR) e o doador
de eltrons o NADPH.



Etapa 3 Desidratao:
Os elementos da gua so removidos de
C-2 e C-3 do D--hidroxibuliril-ACP para formar
uma dupla ligao no produto, trans-
2
-butenoil-
ACP. A enzima que catalisa essa desidratao a
-hidroxiacil-ACP desidratase (HD).






Etapa 4 Reduo da dupla ligao:
A dupla ligao do trans-
2
-butenoil-ACP reduzida
(saturada) para formar butiril-ACP pela ao da enoil-ACP
redutase (ER); tambm aqui o NADPH o doador de
eltrons.





A produo de um acil graxo-ACP saturado de
quatro tomos de carbono completa uma etapa por
meio do complexo da cido graxo sintase. Agora, o
grupo butiril transferido do grupo - SH da
fosfopanteteina da ACP para o resduo Cys-SH da -
cetoacil-ACP sintase, a qual, inicialmente, carregava o
grupo acetil.
Para iniciar o prximo ciclo das quatro reaes
que aumentar a cadeia por dois tomos de carbono,
outro grupo malonil ligado no grupo -SH desocupado
da fosfopantetena da ACP. A condensao ocorre
medida que o grupo butiril, agindo exatamente como o
grupo acetil no primeiro ciclo, unido a dois carbonos
do grupo malonil-ACP e com a perda concomitante de
CO
2
.







O produto dessa condensao um grupo acil de seis tomos de carbono, ligado
covalentemente ao grupo -SH da fosfopantetena. O seu grupo -ceto reduzido nos trs
passos subseqentes do ciclo da sintase para liberar o acila com cadeia saturada de seis
tomos de carbono, tudo como no primeiro ciclo de reaes.
Sete ciclos de condensao e reduo produzem o grupo palmitoil saturado com 16
carbonos, ainda ligado ACP. O palmitato livre separado da molcula de ACP pela ao de
uma atividade hidroltica existente no complexo da sintase.
A reao global para a sntese do palmitato a partir de acetil-CoA:
7 Acetil-CoA + 7C0
2
+ 7ATP 7 malonil-CoA + 7ADP + 7P
i

Acetil-CoA + 7 malonil-CoA + 14NADPH + 14H
+
palmitato + 7CO
2
+ 8CoA + 14NADP
+
+ 6H
2
O
8Acetil-CoA + 7ATP + 14NADPH + 14H
+
palmitato + 8CoA + 7ADP + 7P
i
+ 14NADP
+
+ 6H
2
0

Diferenas entre as cido graxo sintases de diferentes espcies


Localizao da sntese de cidos graxos:
Eucariotos: citosol NADPH gerado pela via das pentoses e enzima mlica





Vegetais: cloroplasto NADPH
gerado pela fotofosforilao.




Transporte de grupo acetil para fora da mitocndria:
Nos eucariotos que no realizam a fotossntese, quase todo acetil-CoA empregado na
sntese de cidos graxos oriundo da oxidao do piruvato e do catabolismo dos esqueletos
carbnicos dos aminocidos nas mitocndrias
Como a membrana mitocondrial interna impermevel ao acetil -CoA, um
transportador indireto transfere os equivalentes do grupo acetil atravs da membrana interna:
o citrato.


Regulao da biossntese de cidos graxos:
A acetil-CoA carboxilase um stio importante de regulao:
Em vertebrados:
o palmitoil-CoA age como um inibidor;
o citrato um ativador alostrico;
Fosforilao: inibida por glucagon epinefrina.

Citrato:
Ativa a aceti l-CoA carboxilase
Inibe a fosfofru toquinase- 1

A acetil-CoA carboxilase em vegetais:
Ativada por aumento de pH estromal e [Mg
2+
] planta iluminada.
Em bactrias:
Envolve nucleotdios de guanina sntese da membrana celular.

cidos graxos de cadeia longa e insaturados:
cidos graxos de 18C ou mais, saturados so produzidos por sistemas de alongamento
dos cidos graxos presentes no retculo endoplasmtico liso e na mitocndria. O mecanismo
de alongamento no retculo endoplasmtico idntico quele empregado na sntese do
palmitato: a doao de 2C pelo malonil-COA, seguido por reduo, desidratao e reduo do
produto saturado com 18 C, o estearoil-CoA.
Uma dupla ligao introduzida na cadeia do cido graxo por uma reao oxidativa
catalisada pela acil-graxo-CoA dessaturase, uma oxidase de funo mista. Dois substratos
diferentes, o cido graxo e o NADH ou o NADPH, sofrem, simultaneamente, oxidao por dois
eltrons.
Palmitoleato, 16:1 (
9
), e o oleato, 18:1 (
9
) so produzidos a partir do 16:0 e 18:0

Mamferos conseguem introduzir duplas na posio nove, mas no conseguem inserir
duplas adicionais. cidos graxos linoleico 18:2 (
9, 12
) e linolnico 18:3 (
9, 12, 15
) so essenciais.
As plantas realizam estas dessaturaes.

Biossntese de eicosanides:
Sinalizadores
Resposta a estmulos hormonais


Biossntese de eicosanides:
Em vegetais: cido jasmnico relacionado a defesa de plantas a insetos


Biossntese dos Triacilgliceris (TAG) e glicerofosfolipdios:
Os triacilgliceris e os glicerofosfolipdios, compartilham tanto dois precursores (os
acil-graxos-CoA e o L-glicerol 3-fosfato) como vrios passos enzimticos em suas respectivas
vias de biossntese.
Glicerol3-fosfato derivado da diidroxiacetona fosfato (DHAP). No fgado e no rim, ele
tambm formado do glicerol pela ao da glicerol quinase.
Acil graxos-CoA so formados dos cidos graxos pelas acilCoA sintetases.


A sntese e a degradao dos TAG so reguladas por hormnios. A insulina promove a
converso de carboidratos em TAG.
A mobilizao e a reciclagem das molculas de TAG resultam em um ciclo do
triacilglicerol. Mesmo durante perodos de jejum, os TAG so ressintetizados a partir de cidos
graxos livres e glicerol 3-fosfato. A diidroxiacetona fosfato a precursora do glicerol 3-fosfato
e origina-se do piruvato atravs da via da gliceroneognese

Biossintese do Colesterol, dos Esterides e dos Isoprenides:
O colesterol uma molcula indispensvel em muitos animais, inclusive no homem,
mas ele no necessrio estar presente na dieta dos mamferos porque todas as clulas so
capazes de sintetiz-lo a partir de precursores simples.
Todos os seus tomos de carbono so fornecidos por um nico precursor - o acetato.
As unidades de isopreno, que o intermedirio essencial na via que vai do acetato at o
colesterol, so tambm precursores de muitos outros lipdios naturais

O processo de sntese do colesterol ocorre em quatro etapas:

Etapa 1 - Sntese do mevalonato a partir do acetato: condensao de trs molculas
de acetil-CoA. Participao de trs enzimas: tiolase, -hidroxi--metilglutaril -CoA (HMG-CoA)
sintase e HMG-CoA redutase.





















Etapa 2 - Converso do
mevalonato em duas unidades de
isopreno ativado: trs grupos
fosfatos so transferidos de trs
molculas do ATP para o mevalonato.
Um grupo fosfato e o grupo carboxila
prximo saem, deixando uma dupla
ligao no produto de cinco tomos
de carbono.

Etapa 3 - A condensao de seis unidades de isopreno ativadas para formar o
esqualeno:











Etapa 4 - Converso do esqualeno no ncleo esteride com quatro anis:












Nos vertebrados a maior parte da sntese do colesterol ocorre no fgado:
Uma pequena frao do colesterol incorporada nas membranas dos hepatcitos
A maior parte dele exportada
colesterol biliar,
cidos biliares
steres do colesterol.
Os steres do colesterol so formados no fgado pela enzima acil-CoA-colesterol
aciltransferase (ACAT). Essa enzima catalisa a transferncia de um cido graxo da coenzima A
para o grupo hidroxila do colesterol, convertendo o colesterol em uma substncia ainda mais
hidrofbica. Os steres do colesterol ou so armazenados no fgado ou transportados para
outros tecidos que empregam colesterol incorporado em partculas lipoproticas secretadas.



A regulao em resposta aos nveis de colesterol mediada por um sistema de
regulao da transcrio do gene que codifica a HMG-CoA redutase.
Vrios outros mecanismos tambm regulam a sntese do colesterol:

Na espcie humana, a produo desregulada de colesterol pode levar a srios
problemas. Quando a soma das quantidades do colesterol sintetizado e daquele obtido na
dieta excedem a quantidade necessria para satisfazer as snteses de membranas, as s biliares
e esterides, podem desenvolver-se acmulos patolgicos de colesterol nas paredes dos vasos
sangneos (placas aterosclerticas), resultando em obstruo desses vasos sangneos
(aterosclerose).

Hormnios esterides:
Na espcie humana os hormnios esterides so derivados do colesterol. Duas classes
de hormnios esterides so sintetizadas no crtex adrenal: mineralocorticdes, que
controlam a reabsoro de ons inorgnicos pelos rins, e glicocorticides, que ajudam a regular
a gliconeognese e tambm reduzem a resposta inflamatria .
Os hormnios sexuais so produzi dos nas gnadas de ambos os sexos e na placenta.
Eles incluem a progesterona, que regula o ciclo reprodutivo feminino, os andrgenos (como a
testosterona) e os estrgenos (como o estradiol) que influenciam o desenvolvimento das
caractersticas sexuais secundrias masculinas e femininas, respectivamente.

























Os intermedirios na biossntese do colesterol tm muitos destinos alternativos


Exerccios

1. Quais as 3 fontes de cidos graxos para as clulas que utilizam a energia da oxidao dos
cidos graxos? Quais rgos nos vertebrados utilizam a energia da oxidao dos cidos graxos?

2. Como o glicerol originado dos triacilgliceris metabolizado para obteno de energia?

3. Como acontece a ativao dos cidos graxos e o transporte para o interior das
mitocndrias? H gasto de ATPs ?

4. Quantos ATPs so gastos para ativar um cido graxo de 16 carbonos? E um cido de 32
carbonos? Justificar.

5. Descrever os 3 estgios necessrios para a oxidao dos cidos graxos e o nome das vias
envolvidas.

6. Conceituar beta-oxidao e citar as quatro reaes bsicas da beta-oxidao dos
cidos graxos saturados

7. Suponha que voc precisa sobreviver com uma dieta consistindo exclusivamente de gordura
de baleia ou foca, sem nenhum, ou muito pouco, carboidrato.
a) Qual o efeito da privao de carboidratos sobre a utilizao de gorduras para a obteno de
energia?
b) Se sua dieta for totalmente desprovida de carboidratos, qual tipo de cido graxo seria
melhor consumir: aqueles com nmero par ou mpar de tomos de carbono? Explique.

8. Qual o saldo de ATP na oxidao completa de um cido graxo saturado de 18 carbonos? E de
trs molculas de glicose (18 Carbonos). Por que os cidos graxos levam a uma maior
produo de ATP do que carboidratos, considerando o mesmo nmero de carbonos?

9. Explicar como ocorre a formao dos corpos cetnicos, qual a sua causa e as funes destes
compostos.

10. Descreva em 5 linhas como as protenas da dieta so enzimaticamente degradadas em
aminocidos nos seres humanos.

11. Os 3 carbonos do lactato e da alanina possuem estados de oxidao idnticos e os animais
podem usar qualquer uma das duas fontes de carbono como combustvel metablico.
Comparar a produo lquida de ATP (moles de ATP por mol de substrato) para a oxidao
completa (at CO
2
e H
2
O) do lactato e da alanina quando includo o custo da excreo na
forma de uria.

12. Se a sua alimentao for rica em alanina, mas pobre em aspartato, voc apresentar sinais
de deficincia em aspartato? Explicar bioquimicamente.

13. Responder s perguntas abaixo sobre o ciclo da uria
a) Quantas molculas de amnia e de CO
2
so consumidas em uma volta do ciclo e quais
as molculas doadoras?
b) Qual a funo desse ciclo e em qual tecido nos vertebrados ele ocorre?
c) Em qual(is) compartimento(s) celular(es) ocorre este ciclo?

14. Os aminocidos sofrem a perda de seus amino-grupos, formando compostos de carbono
que podem ser utilizados tanto para fins energticos como para a biossntese de glicose. Dar
dois exemplos de compostos de carbono oriundos da degradao dos aminocidos (citar
reaes, se necessrio).

15. Nos animais superiores, em que rgos ocorre a gliconeognese? Justifique a necessidade
absoluta dessa via nos mamferos.

16. Quando o piruvato um precursor gliconeognico ele convertido atravs de uma srie de
reaes em glicose. A figura 19-2 mostra as duas vias opostas: gliclise e gliconeognese.
a ) Cite as 4 reaes da gliconeognese que contornam os passos irreversveis da gliclise.
E d o nome das enzimas.
b) Porque no primeiro desvio da gliconeognese o oxaloacetato reduzido a malato na
matriz mitocondrial, e logo em seguida o malato oxidado a oxaloacetato no citosol?
c) D a reao geral da gliconeognese.

17. Nos mamferos, os cidos graxos de nmero par de tomos de carbono podem dar origem
glicose? Justifique. Nos vegetais, como os cidos graxos de nmero par de tomos de
carbono podem dar origem glicose? Esquematize as vias envolvidas.

18. Como a adio de citrato em excesso a uma cultura de clulas in vitro influenciar na
ocorrncia da gliclise? E na ocorrncia da gliconeognese?

19. A via da gliconeognese consiste inteiramente nas reaes da gliclise, operando na
direo reversa. Esta afirmativa verdadeira? Explique

20. Descreva resumidamente (mximo de 8 linhas) a sntese do glicognio

21. Explique como eltrons obtidos a partir da oxidao da gua podem promover a
fosforilao do ADP e participar da reduo de molculas de NADP
+
utilizando a energia obtida
da luz solar.

22. Quais so os dois processos ou etapas da fotossntese, onde cada uma ocorre e quais
substratos e os produtos de cada etapa?

23. Qual a funo das clorofilas e dos pigmentos carotenides nos fotossistemas?

24. Quando os cloroplastos so tratados com o 3-(3,4-diclorofenil)-1, 1- dimetiluria (DCMU ou
diuron), um potente herbicida, a produo de O
2
e a fotofosforilao cessam. Como o DCMU
age como matador de ervas daninhas? Sugira uma localizao para a ao inibitria desse
herbicida

25. A fase escura ou bioqumica da fotossntese dividida em trs etapas. Quais so essas
etapas? Qual a importncia de cada uma delas para fixao do CO2 e para manuteno do
processo.

26. possvel a ocorrncia da fase bioqumica no escuro? Por qu?

27. O que fotorrespirao? Por que o fosfoglicolato formado e como ele recuperado,
originando produtos teis ao metabolismo celular?

28. Quando um p de milho iluminado na presena do gs
14
C0
2
, depois de 1 segundo cerca
de 90% de toda a radioatividade incorporada nas folhas encontrada nos tomos C-4 do
malato, aspartato e oxaloacetato. Somente aps 60 segundos o
14
C aparece no tomo C- 1 do
3-fosfoglicerato. Explique.

29. Por que a biossntese de triacilgliceris um processo muito ativo nos animais? Em que
situaes fisiolgicas ela ocorre intensamente?

30. Qual a participao do malonil-CoA na biossntese de cidos graxos?

31. Como o acetil-CoA citosslico se origina do acetil-Coa mitocondrial? Este composto capaz
de atravessar as membranas mitocondriais?

32. Um indivduo que tem uma dieta isenta de colesterol pode apresentar nveis significativos
deste no sangue? Por qu?
Como possvel uma pessoa engordar partindo-se de uma dieta rica em carboidratos apenas?
Cite as vias envolvidas e os intermedirios que conectam estas vias.

33. Como uma semente de soja obtm glicose e aminocidos necessrios ao incio da
germinao? Cite as vias envolvidas e os intermedirios que conectam estas vias.

34. Explique o metabolismo energtico do fgado em um indivduo sob jejum severo.