Você está na página 1de 149

Universidade Federal do Rio Grande do Norte

Centro de Biocincias
Departamento de Biologia Celular e Gentica
Laboratrio de Biologia Molecular e Genmica
Programa de Ps-Graduao em Biotecnologia - RENORBIO


Anl ise protemica de Chromobacterium violaceum: acmulo
estacionrio e diferencial aps exposio luz UVC



Aluna: Viviane Katielly Silva Medeiros
Orientador(a): Prof Dr Silvia Regina Batistuzzo de Medeiros


rea de Concentrao: Biotecnologia em Sade



NATAL
DEZEMBRO/2011


VIVIANE KATIELLY SILVA MEDEIROS






Anl ise protemica de Chromobacterium violaceum: acmulo
estacionrio e diferencial aps exposio luz UVC












NATAL
DEZEMBRO/2011
Tese de Doutorado apresentada ao
Departamento de Biologia Celular e Gentica da
Universidade Federal do Rio Grande do Norte
como requisito para a obteno do ttulo de
Doutor(a) em Biotecnologia.


Orientadora: Prof.
a
Dr.
a
Silvia Regina Batistuzzo
de Medeiros



VIVIANE KATIELLY SILVA MEDEIROS



Anl ise protemica de Chromobacterium violaceum: acmulo
estacionrio e diferencial aps exposio luz UVC


Tese de Doutorado apresentada ao Departamento de Biologia Celular e
Gentica da Universidade Federal do Rio Grande do Norte como requisito para
a obteno do ttulo de Doutor(a) em Biotecnologia.














Aprovada em: / /


___________________________________________________
Prof.
a
Dr.
a
Silvia Regina Batistuzzo de Medeiros (Orientadora)
Departamento de Biologia Celular e Gentica UFRN

___________________________________________________
Prof.
a
Dr.
a
Lucymara F. Agnez Lima
Departamento de Biologia Celular e Gentica UFRN

___________________________________________________
Prof.

Dr.

J oo Paulo Matos Santos Lima
Departamento de Bioqumica UFRN

___________________________________________________
Prof.

Dr.Carlos Priminho Pirovani


Departamento de Cincias Biolgicas, Gentica e Bioqumica UESC

___________________________________________________
Prof.

Dr.

Thalles Barbosa Grangeiro
Departamento de Biologia - UFC

ii




















Aos meus pais, Louro e Socorro,
que mesmo distante sempre
estiveram ao meu lado.
iii

Agradecimentos


Agradeo Professora Silvia Batistuzzo pelos ensinamentos, pacincia
e apoio.
Aos meus anjos de Ilhus professor Priminho e ngela. Priminho, um
exemplo de pessoa e pesquisador que me ajudou no momento em que mais
precisei e com quem aprendi a ser uma pesquisadora e, acima de tudo, uma
pessoa melhor. ngela que me recebeu como uma irm, me dando fora e
coragem para no desistir frente s inmeras dificuldades.
Aos meus amigos do LBMG que tornaram os dias estressantes bem
mais alegres. Em especial ao grupo prote-chromo (Daniel e Fbio) que me
recebeu de braos abertos, sempre dispostos a ajudar e a tornar os problemas
mais fceis de serem resolvidos. Em especial a Fbio por todo o apoio e
incentivo, mesmo distncia compartilhou todos os momentos do
desenvolvimento desta tese, voc meu orgulho!
Aos colegas do grupo de clulas-tronco que participaram do primeiro
projeto da tese, obrigada pela ajuda e pelos bons momentos.
Aos amigos da UNIVASF Kyria, Luciana Andrade, Rodrigo, Serginho,
Luciana Macatro e Karen, sem vocs eu no teria conseguido. Em especial a
Lu Andrade que mais que uma amiga, como uma irm pra mim.
A Tia Milagres, Ana e Linardo que deram apoio nos momentos mais
difceis, vocs so mais que famlia.
Aos membros da banca por aceitarem participar desta defesa.
Ao CNPq pelo financiamento do projeto.
A FACEPE pela bolsa concedida.








iv


RESUMO

Chromobacterium violaceum um bacilo de vida-livre, Gram-negativo
comumente encontrado no solo e nas guas de regies tropicais e subtropicais.
Uma das principais caractersticas deste organismo sua capacidade de
produzir o pigmento violacena, o qual apresenta inmeras atividades
biolgicas. Em 2003, o genoma deste organismo foi completamente
sequenciado e revelou informaes importantes sobre a fisiologia desta
bactria. Porm, poucos estudos ps-genmicos tem sido realizados. Este
trabalho avaliou o perfil proteico de C. violaceum cultivada em meio LB a 28C,
o que permitiu a identificao de protenas relacionadas a um possvel sistema
de secreo ainda no identificado e caracterizado em C. violaceum, ao
sistema quorum sensing, a processos regulatrios da transcrio e traduo,
adaptao ao estresse e ao potencial biotecnolgico. Alm disso, a resposta
desta bactria radiao UVC foi avaliada. A comparao do perfil protico,
analisado por eletroforese 2-D, do controle versus tratado possibilitou a
identificao de 52 protenas que surgiram aps a induo do estresse. Os
resultados obtidos permitiram a elaborao de uma via de resposta de C.
violaceum ao estresse gerado pela luz UVC. Esta via, que parece ser de
resposta geral ao estresse, envolve a expresso de protenas relacionada
diviso celular, metabolismo de purinas e pirimidinas, choque trmico ou
chaperonas, fornecimento de energia, regulao da formao de biofilme,
transporte, regulao do ciclo ltico de bacterifagos, alm de protenas que
ainda no apresentam funo caracterizada. Apesar da reposta apresentar
similaridades com a SOS clssica de E. coli, ainda no podemos afirmar que C.
violaceum apresenta uma resposta SOS-like, principalmente devido a ausncia
da caracterizao de um protena LexA-like neste organismo.

Palavras-chave: C. violaceum, UVC, T6SS, proteome, resposta SOS, biofilme

v


ABSTRACT

Chromobacterium violaceum is a free-living bacillus, Gram-negative commonly
found in water and sand of tropical and subtropical regions. One of its main
characteristic it's the ability to produce the purple pigment named violacein, that
shows countless biological activities. In 2003, the genome of this organism was
totally sequenced and revealed important informations about the physiology of
this bacteria. However, few post-genomics studies had been accomplished.
This work evaluated the protein profile of C. violaceum cultivated in LB medium
at 28C that allowed the identification and characterization of proteins related to
a possible secretion system that wasn't identified and characterized yet in C.
violaceum, to the quorum sensing system, to regulatory process of transcription
and translation, stress adaptation and biotechnological potential. Moreover, the
response of the bacteria to UVC radiation was evaluated. The comparison of
the protein profile, analyzed through 2-D electrophoresis, of the control group
versus the treatment group allowed the identification of 52 proteins that arose
after stress induction. The obtained results enable the elaboration of a stress
response pathway in C. violaceum generated by the UVC light. This pathway,
that seems to be a general stress response, involves the expression of proteins
related to cellular division, purine and pirimidine metabolism, heat chock or
chaperones, energy supply, regulation of biofilm formation, transport, regulation
of lytic cycle of bacteriophages, besides proteins that show undefined function.
Despite the response present similarities with the classic SOS response of E.
coli, we still cannot assert that C. violaceum shows a SOS-like response, mainly
due to the absence of characterization of a LexA-like protein in this organism.

Key-words: C. violaceum, UVC, T6SS, proteome, SOS response, biofilm



vi



LISTA DE FIGURAS

Figura 1. Estrutura molecular da violacena. 10
Figura 2. Estrutura esquemtica do sistema de secreo tipo III indicando
protenas que formam cada componente 13



vii

LISTA DE TABELAS

Tabela 1. Principais categorias de protenas de membrana relacionadas ao
transporte anotadas no genoma de C. violaceum

17
Tabela 2. Protenas relacionadas resposta SOS em C. violaceum 19


viii

LISTA DE ABREVIATURAS

DNA: cido desoxirribonuclico
EROs: Espcies Reativas de Oxignio
MMS: metilmetanosulfonato
MMC: mitomicina-C
TTSS: sistema de secreo tipo III
UVA: radiao ultravioleta A
UVB: radiao ultravioleta B
UVC: radiao ultravioleta C


i

SUMRIO

RESUMO iv
ABSTRACT v
LISTA DE FIGURAS vi
LISTA DE TABELAS vii
LISTA DE ABREVIATURAS viii
1. INTRODUO 7
2. REVISO DA LITERATURA 8
2.1. Breve histrico 8
2.2. Chromobacterium violaceum: um organismo com alto potencial
biotecnolgico 9
2.3. A violacena e suas propriedades 10
2.4. Patogenicidade 12
2.5. Tolerncia ao estresse e adaptabilidade ambiental de C. violaceum 14
2.6. Protenas de transporte em C. violaceum 16
2.7. Sistema SOS e C. violaceum 18
2.8. Protemica como ferramenta para o entendimento do metabolismo
bacteriano 20
3. OBJ ETIVOS 22
3.1. Objetivo geral 22
3.2. Objetivos Especficos 22
4. REFERNCIAS BIBLIOGRFICAS 23
5. MANUSCRITOS 32
6. CONSIDERAES GERAIS 147
7. PERSPECTIVAS 148


7

1. INTRODUO

C. violaceum um bacilo de vida-livre, Gram-negativo, com respirao
anaerbia facultativa comumente encontrado no solo e nas guas de regies
tropicais e subtropicais ao redor do mundo, incluindo as guas e bancos de areia
do Rio Negro, principal afluente do Rio Amazonas (CALDAS, 1990). Uma das
principais caractersticas deste organismo sua capacidade de produzir um
pigmento violeta, a violacena (FENICAL, 1993; DESSAUX, 2004; ANTONIO &
CRECZYNSKI-PASA, 2004).
Esta bactria apresenta um alto potencial biotecnolgico e por isso foi
escolhida para ter seu genoma completamente seqenciado. Este estudo
permitiu a identificao de genes relacionados grande aclimatao desta
bactria de vida livre, como aqueles relacionados resposta ao estresse,
protenas de transporte, patogenicidade, motilidade e ao sistema quorum sensing
(VASCONCELOS, et. al., 2003). A despeito da importncia biotecnolgica de C.
violaceum, poucos estudos ps-genmicos tem sido realizados. Isto limita o
conhecimento acerca do potencial biotecnolgico, da fisiologia e metabolismo
desta importante bactria.
Neste trabalho, utilizamos a protemica como ferramenta para identificar
protenas que so expressas de forma basal em C. violaceum, cultivada em meio
LB a 28C, e em resposta sua exposio radiao UVC. Este trabalho
contribui para o entendimento do metabolismo desta bactria e de sua resposta
frente ao estresse gerado pela radiao UV.






8

2. REVISO DA LITERATURA


2.1. Breve histrico


As primeiras evidncias da existncia da C. violaceum, registradas na
literatura, remetem a 1867, quinze anos antes da publicao do primeiro artigo a
respeito deste microorganismo que descreve a formao de uma colorao
violeta, por um pequeno organismo, sobre um preparado de farinha
(BOISBAUDRAN, 1882). Em 1880, praticamente ao mesmo tempo e de uma
forma independente, Bergonzini enquanto trabalhava na Universidade de
Modena na Itlia, descobre acidentalmente uma pelcula densa de colorao
violeta crescida sobre amostras de albumina de ovo. Aps testes e experimentos
ele concluiu que se tratava de uma nova bactria, a qual deu o nome de
Cromobacterium violaceum (BERGONIZI, 1881). Ainda em 1881, Zimmerman
corrige a grafia da palavra para Chromobacterium (ZIMMERMAN, 1881). Porm,
por um longo tempo ela ainda foi chamada de Bacillus violaceus (TOBIE, 1934).
Em abril de 1976, quase um sculo depois, esta bactria foi descoberta
no Brasil. Anlises bacteriolgicas de coletas feitas a 30 metros de profundidade,
em frente estao de tratamento de gua da cidade de Manaus (Amazonas),
revelaram a presena de dois tipos de colnias bacterianas: as brancas e as
violetas. As ltimas foram identificadas pelo Prof. Wilson Chagas de Araujo, do
Instituto de Microbiologia da UFRJ , como sendo a C. violaceum (CALDAS, 1977;
CALDAS, et al., 1978). A teoria do Professor Caldas do Instituto de Biofsica -
UFRJ , de que o pigmento que d a colorao bactria proteja a mesma da
radiao solar, motivou alguns estudos que evidenciaram o papel fototeraputico
da violacena (DURN, & FALJ ONI-ALARIO, 1980; CALDAS, 1990; DURN,
1990).



9

2.2. Chromobacterium violaceum: um organismo com alto potencial
bi otecnolgico

C. violaceum um bacilo de vida-livre, Gram-negativo, com respirao
anaerbia facultativa comumente encontrado no solo e nas guas de regies
tropicais e subtropicais ao redor do mundo, incluindo as guas e bancos de areia
do Rio Negro, principal afluente do Rio Amazonas (CALDAS, 1990). Pertence
famlia Neisseriacea de -proteobactrias (GARRITY et al., 2001).
Uma das principais caractersticas deste organismo sua capacidade de
produzir, sob condies aerbicas, um pigmento violeta conhecido como
violacena (FENICAL, 1993; DESSAUX, 2004; ANTONIO & CRECZYNSKI-PASA,
2004), que apresenta vrias propriedades biolgicas. Alm deste pigmento, so
produzidos outros metablitos secundrios tais como o polihidroxialcanoatos e
exopolissacardeos, constituintes de biofilmes bacterianos (CORPE, 1964;
MARTIN & RICHARDS, 1963; MARTINELLI et. al., 2002). A C. violaceum possui
outras caractersticas biotecnolgicas importantes, tais como a capacidade de
hidrolisar filmes plsticos (GOURSON et.al., 1999) e de solubilizar ouro em um
processo livre de mercrio (SMITH & HUNT, 1985; CAMPBELL et. al., 2001).
Diante deste potencial biotecnolgico, surgiu o interesse de seqenciar
completamente o genoma desta bactria. Em 2003, a Rede Nacional de
Seqenciamento Nucleotdico (Projeto Genoma Brasileiro MCT/CNPq), grupo
do qual nosso laboratrio fez parte, concluiu o seqenciamento e anotao do
genoma de C. violaceum (VASCONCELOS, et. al., 2003). Este estudo revelou
que seu cromossomo circular nico possui 4.751.080 pb com uma mdia de
contedo G+C de 64,83%. 4.431 ORFs esto distribudas uniformemente e
ocupam 89% do genoma. Destas, 958 (21,6%) foram anotadas como hipotticas
e 756 (17,1%) como hipotticas conservadas. Este nmero considervel de
ORFs ainda no caracterizadas suscita a possibilidade da existncia de novos
genes com potencial biotecnolgico.
De fato, aps a finalizao do genoma desta bactria, foram identificados
vrios genes que codificam para enzimas e protenas que podem ser utilizados
em indstrias farmacuticas e biotecnolgicas. Dentre as possveis aplicaes
temos a sntese de compostos com relevncia mdica, recuperao do ouro,
10

detoxificao ambiental, aplicaes na agricultura como controle de insetos,
fungos e nematdeos, sntese de plstico biodegradvel e sntese de celulose
(CAREPO et. al., 2004).
Estudos ps-genmicos devem ser realizados com o intuito de estudar os
produtos dos genes hipotticos e/ou hipotticos conservados com a finalidade de
caracterizar outras protenas com potencial biotecnolgico.

2.3. A violacena e suas propriedades


A estrutura qumica deste pigmento foi deduzida corretamente em 1958
por meio de estudos de degradao e de comprovao da sntese (BALLANTINE
et al., 1958). Esta molcula um derivado do indol caracterizada como (3-(1,2-
dihidro-5-(5-hidrox-1H-indol-3-yl)-2-oxo-3H-pirrol-3-ilideno)-1,3-dihidro-2H-indol-2-
one) (DURN & MENCK, 2001), consistindo em trs unidades estruturais: 5-
hidroxiindol (o lado esquerdo), oxoindol (o lado direito) e um ncleo 2-pirrolidona
(a parte central) e sintetizado a partir de duas molculas modificadas de L-
triptofano (DEMOSS & EVANS, 1960; HOSHINO, et al., 1987) (Figura 1).







Fi gura 1. Estrutura molecular da violacena. Modificado de RETORI & DURN,
(2004).


Os genes relacionados sntese deste pigmento foram clonados e
sequnciados e encontram-se organizados no operon vioABCD. Os genes vioA,
C e D codificam protenas com similaridade a monooxigenases dependentes de
nucleotdeos. VioA cataliza a desaminao oxidativa da segunda molcula de
11

triptofano, VioC cataliza a oxidao intermediria da violacena e VioD parece
hidroxilar uma molcula de triptofano. J a protena VioB apresenta similaridade
com uma policetdeo sintase, protena capaz de catalisar ligaes peptdicas no
ribossomais (AUGUST et. al., 2000). Recentemente, foi demonstrado que o
produto de outro gene, o vioE, essencial para a produo da violacena
(SANCHEZ et. al., 2006)
J foram descritas na literatura inmeras propriedades biolgicas desta
molcula, tais como: antimicrobiana, contra Mycobacterium tuberculosis (SOUZA,
1999), Trypanosoma cruzi (HAUN et.al., 1992; DURAN, 1994) e Leishmania sp.
(Leon, 2006); bactericida (CALDAS, 1990; LICHSTEIN & van de SAND, 1945 e
1946; DURAN, 1983; DURAN et. al., 1990); antiviral (DURAN & MENCK, 2001);
antifngica (SHIRATA et.al., 2000); e antitumoral (UEDA et. al., 1994; MELO et.
al., 2000; FERREIRA, et.al., 2004). Recentemente foi demonstrado que esta
molcula possui propriedades antidiarreicas e um efeito protetor contra lceras
induzidas em ratos Wistar (ANTONISAMY et. al., 2009), bem como um efeito
imunomodulatrio, analgsico e antipirtico (ANTONISAMY & IGNACIMUTHU,
2009).
A funo fisiolgica deste pigmento no contexto bacteriano permanece
um mistrio e os poucos dados existentes so conflitantes. A principio acreditava-
se que a violacena estivesse relacionada patogenicidade da bactria, mas
infeces causadas por cepas no pigmentadas enfraqueceram esta hiptese
(GRIER et. al., 2004; LEE et al., 1999). Em 2006, KONZEN e colaboradores,
estudaram as propriedades antioxidantes da violacena e sua capacidade de se
incorporar em bicamadas lipdicas. Neste trabalho, eles observaram que este
pigmento capaz de se incorporar em bicamadas lipdicas com alta eficincia,
protegendo os lpidios da peroxidao causada pelo estresse oxidativo. Sendo
esta proteo menor quando a molcula encontrava-se em soluo. Este estudo
mostrou tambm que a violacena capaz de seqestrar radicais livres em
soluo e inibir enzimas oxidantes e pr-inflamatrias. Outro estudo, in silico,
evidenciou a propriedade antioxidante desta molcula, indicando que ela possui
uma grande capacidade de doar eltrons e que a transferncia de tomos de
hidrognio para outras molculas dependente de sua isomeria (CAO et. al.,
2007).
12

Outro trabalho sugere uma funo diferente para a violacena, mostrando
que ela tem propriedades pr-oxidantes em clulas eucariticas, sendo capaz de
induzir o aumento de Espcies Reativas de Oxignio (EROs) em clulas de
cncer de clon (Caco-2), levando estas a apoptose. Porm, esse aumento
significativo das EROs mediado pelo pigmento no foi observado em outra
linhagem celular (HT29) (CARVALHO et. al., 2006).
Leal e colaboradores (2011 submetido) estudaram os efeitos citotxicos
e pr-oxidantes da violacena em clulas normais e tumorais e avaliaram o
carter oxidante in vitro do pigmento. Foi observada a gerao de um estresse
oxidativo aps incubao das clulas com violacena, porm este parece no ser
suficiente para causar danos significativos aos componentes e estruturas
celulares em clulas HeLa. J em clulas CHO-K1 e MRC-5 os danos so
causados, mas somente em determinadas concentraes de violacena. No
sistema in vitro foram avaliadas a capacidade antioxidante total e a capacidade
de quelao frrica deste pigmento. Foram detectadas atividades antioxidantes
nas concentraes de 30 e 60 M do pigmento. Os resultados obtidos confirmam
que a violacena apresenta caractersticas oxidantes opostas quando analisadas
na presena ou ausncia de um sistema biolgico, e que o carter oxidante s
ocorre em altas concentraes do pigmento.
Estes resultados foram obtidos a partir de estudos in vitro ou in vivo
utilizando clulas eucariotas. Mas, at ento, nenhum trabalho analisou a funo
da violacena no contexto fisiolgico da C. violaceum.

2.4. Patogeni cidade


C. violaceum pode causar infeces em animais como porcos, macacos,
ovelhas e ces (WOOLEY, 1905, TI, et al., 1993; CHONG & LAM, 1997; DURN
et al., 2001; CHATTOPADHYAY, et al., 2002), e pode atuar como patgeno
oportunista em humanos, causando septicemia fatal de leses na pele com
abscessos no fgado e no pulmo (MARTINEZ, et al., 2000). Este organismo
considerado um agente patognico de baixo grau que infecta principalmente
13

indivduos imunossuprimidos e crianas, apesar da incidncia de infeco em
humanos ser baixa (BILTON & J OHNSON, 2000).
De acordo com o potencial patognico de C. violaceum foram
identificados genes relacionados adeso e invaso clula hospedeira, bem
como sistemas de transporte para fatores de virulncia, como componentes dos
sistemas de secreo do tipo I, II e III (VASCONCELOS et al., 2003).

Fi gura 2. Estrutura esquemtica do sistema de secreo tipo III indicando
protenas que formam cada componente. Os nomes esto de acordo com os
de Salmonella spp./Yersinia spp. Modificado de BRITO et al. (2004).


Entre os genes envolvidos com a adeso clula hospedeira, esto
aqueles que formam o pili. Mais de 40 genes esto envolvidos na formao desta
estrutura e vrios foram encontrados no genoma de C. violaceum por homologia
de sequncia com os genes pil (A-Z) de Pseudomonas aeruginosa. A respeito
dos genes relacionados invaso celular pode-se destacar aqueles que
pertencem ao sistema de secreo tipo III (TTSS), presente em trs grandes
clusters no genoma de C. violaceum. O primeiro cluster composto pelos genes
14

invFGEABCIJ -spaOPQRS e o segundo por prgHIJ K-orgA. Ambos os clusters
esto presentes na ilha de patogenicidade-1 (SPI1) de Samonella spp. na mesma
organizao, estando ausente apenas o gene invH em C. violaceum. O ltimo
cluster est envolvido com a expresso de componentes da maquinaria do TTSS
e consiste em cerca de 20 polipetdeos. A figura 2 ilustra, esquematicamente, a
organizao das protenas para formar o aparato do TTSS em C. violaceum
(Para maiores detalhes ver: BRITO et al., 2004).
Os sistemas de secreo tipo I so compostos por transportadores do tipo
ABC, que esto envolvidos com a secreo de vrias toxinas, principalmente
protenas contendo RTX, tais como as hemolisinas. O aparato de secreo
especfico de RTX consiste de uma protena de membrana interna (Protena RTX
B) e um canal transmembrana consistindo de uma protena RTX D e uma
protena de membrana externa do tipo TolC. Genes homlogos ao sistema de
secreo de hemolisina-A (HlyA) de Escherichia coli foram identificados em C.
violaceum, tais como RTX A (CV0311), RTX C (CV1917), hemolisina A
(CV1918), RTX B (CV0513) e RTX D (CV0516) (BRITO, et. al., 2004).
At o momento, outros sistemas de secreo no foram identificados em
C. violaceum.

2.5. Tolerncia ao estresse e adaptabili dade ambiental de C. violaceum


Como outros organismos de vida livre, C. violaceum est exposta a
diferentes condies ambientais, tais como variaes na oferta de nutrientes,
mudanas de temperatura, compostos txicos e raios UV. Estas variaes
exigem respostas adaptativas rpidas que so geralmente disparadas por um
ativador transcricional. Genes que controlam mecanismos de transcrio basal,
tais como a RNA polimerase e fatores sigma (
70
rpoD;
54
rpoN;
38
rpoS;
etc) esto presentes em seu genoma (Hungria, et. al., 2004). Alm disso, vrias
ORFs (117) foram identificadas como fatores transcricionais (ativadores e
repressores). Destas, vrias esto relacionadas resposta da bactria ao
estresse, como as que fazem parte das famlias LysR, AraC e TetR. Associado
ao grande nmero de reguladores transcricionais, existe a presena de um
15

grande nmero de ORFs relacionadas a mecanismos de transduo de sinais,
quando comparado a outros organismos de vida livre que tiveram seu genoma
sequenciado (VASCONCELOS et al., 2003). Esses dados sugerem uma
considervel capacidade de adaptao frente a condies ambientais adversas.
A proteo de C. violaceum contra o estresse oxidativo fornecida
principalmente por dois reguladores transcricionais: SoxR (CV2793) e OxyR
(CV3378) (VASCONCELOS, et. al., 2003). Mas outro sistema que detecta o
estresse peroxidativo est presente em um operon composto por ohrA-ohrR
(CV0209 0210), onde a protena OhrR responsvel pela sua induo. Outras
ORFs relacionadas ao estresse oxidativo incluem a protena OhrB (CV2493), a
famlia de protenas MutT/nudix (nucleosdeo difosfato associado a algum outro
moeity X) (CV0032, CV1112, CV1586, CV1767, CV3401) e diversas glutationas-
S-transferases e glutationa peroxidases.
Trinta e nove ORFs que codificam protenas com o dominio anti-freezing
foram encontradas em C. violaceum. Estas ORFs podem exercer um papel em
mecanismos que permitam a bactria sobreviver em baixas temperaturas ou
outros tipos de estresse, como condies cidas ou altas temperaturas. Vrios
genes relacionados ao choque trmico tambm foram identificados, incluindo o
operon do sistema DnaJ -DnaK-GrpE (CV1645, 1643, 1642), do sistema
GroEL/GroES (mopA and mopB, CV3233, 3232, CV4014, 4015), fatores sigma
(CV0585, CV2058, CV3332), o sistema chaperonina ClpA/B (CV3965), as co-
chaperonas HscA/B (CV1089, CV1091), HtpG (CV1318), HtpX (CV3109,
CV4263), HslO (CV2000), HslU (CV0402) e HslV (CV0401) (HUNGRIA, et. al.,
2004).
C. violaceum esta exposta luz UV e possui enzimas envolvidas no
reparo dos danos causados por este agente: uvrA, uvrB, uvrC e uvrD (CV1893,
CV3152, CV1305, CV0205) (DUARTE, et. al., 2004). Adicionalmente, existe a
evidncia que a violacena tambm contribua para a proteo contra a radiao
UV (CALDAS, 1978). Alm disso, as ORFs CV3769, CV4160, CV4192 e CV4193
que codificam provveis protenas de estresse universal podem proteger a
bactria de fatores estressantes como a exposio luz UV em ambientes
aquticos (HUNGRIA, et. al., 2004).
16

Genes que esto relacionados proteo contra a fome, dessecao e
manuteno da integridade do envelope celular sob condies de estresse
tambm esto presentes (para maiores detalhes ver: HUNGRIA, et. al., 2004).

2.6. Protenas de transporte em C. viol aceum


Segundo o Protein Transport Database (TCDB) sete prinicipais categorias
de transportadores tm sido reconhecidas: (classe 1) canais e poros; (classe 2)
transportadores que direcionam o potencial eletroqumico; (classe 3)
transportadores de atividade primria; (classe 4) grupo dos translocadores;
(classe 5) carreadores do transporte de eltrons; (classe 6) fatores acessrios
envolvidos no transporte e (classe 7) sistemas de transporte incompletamente
caracterizados.
Utilizando esta classificao, foram identificadas no genoma de C.
violaceum 539 ORFs que codificam protenas envolvidas com o transporte de
metablitos. Destas, 489 ORFs codificam sequncias proteicas que apresentam
similaridade de sequncia significativa com protenas de membrana relacionadas
ao transporte de outros organismos (Tabela 1). As outras 50 ORFs foram
anotadas como hipotticas e/ou hipotticas conservadas. Este nmero
significante de transportadores em potencial pode estar relacionado ao fato de C.
violaceum ser encontrada em diferentes ambientes de regies tropicais e
subtropicais, necessitando de adaptao a diferentes condies externas
(GRANGEIRO et al., 2004).









17

1
www.brgene.lncc.br/cviolaceum
*ORFs vlidas +ORFs hipotticas conservadas +ORFs hipotticas =4,431

Fonte: modificado de GRANGEIRO et. al. (2004).


As porinas so as principais protenas de membrana externa e servem
como stios receptores para ligao de fagos e bacteriocinas. Canais e porinas
compreendem a terceira classe mais numerosa de transportadores em C.
violaceum (62 ORFs) (Tabela 1) incluindo 17 canais tipo e 41 porinas barril-.
O segundo grupo mais abundante o de transportadores que direcionam o
potencial eletroqumico (154 ORFs) (Tabela 1). A maioria dos transportadores
identificados nesta categoria da superfamlia major facilitator (MFS) (29,9%) e
a maioria dessas protenas so transportadores de substratos gerais ou esto
relacionados resistncia multi-drogas.
O grupo mais abundante de transportadores o de transporte ativo
primrio (43,3% - 212 ORFs), dos quais 119 so do tipo ABC (ATP-binding
cassete). Transportadores do tipo ABC constituem o principal sistema de
transporte em C. violaceum, correspondendo a cerca de 2,7% de todas as ORFs
anotadas no genoma desta bactria. Quase 80% desses transportadores so
dedicados aquisio de nutrientes e o restante est relacionado resistncia
multi-drogas (GRANGEIRO, et al., 2004).
Tabela 1. Pri nci pai s categorias de protenas de membrana relacionadas ao
transporte anotadas no genoma de C. violaceum
1


Categoria de transporte
Nmero
de ORFs
anotadas
% em relao s
ORFs de transporte
anotadas
% em relao ao
total de ORFs
anotadas*
Transportadores de atividade
primria
212 43,4 4,8
Transportadores que
direcionam o potencial
eletroqumico
154 31,5 3,5
Canais e porinas 62 12,7 1,4
Outros 61 12,4 1,4
Total 489 100,0 11,1
18


2.7. Sistema SOS e C. violaceum


Danos no DNA que bloqueiam a replicao podem resultar em rearranjos
genmicos, mutagnese ou at mesmo a morte celular, quando o bloqueio da
replicao no pode ser revertido. A bactria E. coli responde a este desafio
regulando positivamente a expresso de diversos genes relacionados ao reparo
de leses no DNA, manuteno da integridade da forquilha de replicao e
preveno da diviso celular prematura. Esta resposta celular ao dano no DNA
chamada de resposta SOS (CROWLEY e COURCELLE, 2002).
Agentes que induzem a resposta SOS incluem radiao UV,
metilmetanosulfonato (MMS), mitomicina C (MMC) e muitos outros qumicos que
levam ao acmulo de danos no DNA. A induo de danos no DNA leva a
formao de DNA simples fita (ssDNA) que coberto por filamentos da protena
RecA. Aps a ligao ao ssDNA, RecA adquire uma atividade de coprotease que
facilita a autoclivagem do repressor LexA, o que leva a de-represso dos genes
regulados pelo sistema (J ANION, 2008).
O principal indutor da reposta SOS o bloqueio da forquilha de replicao.
As protenas RecA e SSB so rapidamente produzidas para estabilizar e proteger
a forquilha, enquanto outras protenas (incluindo UvrA, UvrB, YdjQ, UvrD, RecN,
RuvA e RuvB) lidam com as leses atravs do reparo por exciso de
nucleotdeos e reparo recombinacional. Caso as leses no possam ser
reparadas, ocorre a induo de trs DNA polimerases (PolB, DinB e PolV) que
so capazes de realizar a sntese transleso que sacrifica a fidelidade da
replicao em troca da viabilidade. A resposta SOS ainda age nas protenas
relacionadas diviso celular, inibindo a septao (ERILL, 2007) e na clivagem
do repressor CI do fago , induzindo o ciclo ltico deste bacterifago (J ANION,
2008).
Busca por genes envolvidos em vias de reparo de DNA em C. violaceum
foram realizadas e revelou a presena de genes relacionados reposta SOS
(Tabela 2). Porm, a presena do regulador LexA no foi observada, o que
sugere que este tipo de resposta em C. violaceum seja constitutiva ou que exista
19

outra protena regulatria ainda desconhecida que exera a funo de LexA.
Entre as -proteobactrias apenas R. solanacearum possui o gene lexA, o que
poderia indicar uma perda recente deste gene em outras -proteobacterias (C.
violaceum, Neisseria gonorrhoeae e N. meningitidis) (DUARTE, et. al., 2004).


Tabela 2. Protenas relacionadas resposta SOS em C. viol aceum
Protena ORF Funo
DinG CV1991 DNA helicase dependente de ATP
DinB CV4363 Subunidade da DNA polimerase IV
Umu-D CV2332 Subunidade da DNA polimerase V
Umu-C CV2612 Subunidade da DNA polimerase V
DnaA CV0001 Provvel fator de iniciao da replicao
DnaA CV3614 Provvel fator de iniciao da replicao
NrdB CV2284 Cadeia beta do ribonucleosdeo difosfato redutase
MucB CV2060 Regulador negativo para a biossntese do alginato
NrdA CV2287 Provvel ribonucleosdeo redutase 1 (cadeia maior)
Protena oxidoredutase
RecA CV1607 Coprotease, DNA ATPase-dependente
Lex-A - Protena regulatria do sistema SOS
Fonte: modificado de DUARTE, et. al., 2004.


Recentemente, foi identificado em N. gonorrhoeae um ortlogo de lexA
(NG1427) que ativado por oxidao frente ao estresse oxidativo, em uma
resposta independente de RecA. J a exposio da bactria MMS e MMC leva
ativao de NG1427 dependente de RecA (SCHOOK, et. al., 2011). Estudos
acerca da existncia e funcionalidade deste ortlogo em C. violaceum ainda no
foram realizados, o que seria importante para a caracterizao da resposta SOS
neste organismo.

2.8. Protemica como ferramenta para o entendimento do metaboli smo
bacteriano

20

Atravs da anlise protemica possvel obter o perfil protico de um
organismo ou comparar mudanas no nvel de expresso de muitas protenas, ao
mesmo tempo, sob condies ambientais e genticas distintas. Alm disso,
essas protenas diferencialmente expressas podem ter seus peptdeos
seqenciados, o que possibilita a identificao e posterior busca pelo seu gene.
Essa busca torna-se mais fcil quando se tm o genoma completamente
seqnciado, como o caso da C. violaceum.
Um exemplo da aplicabilidade desta tcnica inclui a comparao das
fraes do proteoma extracelular, da superfcie celular e do citosol de bactrias
biotecnologicamente importantes como Corynebacterium efficiens YS-314 e
Corynebacterium glutamicum ATCC 13032, que permitiu a comparao dos
mapas protemicos desses dois mais importantes produtores de aminocidos
industriais, revelando interessantes especificidades entre as espcies e insights
da fisiologia das corinebactrias (HANSMEIER, et. al., 2006).
Anlises da expresso protica basal permitiram a elaborao de gis de
referncia de bactrias com importncia ecolgica e econmica como
Bradyrhizobium japonicum (BATISTA, et. al., 2010) e de bactrias patognicas
como Vibrio vulnificus, Streptococcus suis e Bartonella henselae, que foram teis
na busca por protenas relacionadas virulncia (LEE, et. al., 2006; J ING, et. al.,
2008; EBERHARDT, et. al., 2009). Alm disso, esses mapas protemicos podem
fornecer evidncias experimentais para aquelas protenas anotadas como
hipotticas (DUMPALA, et. al., 2009; BATISTA, et. al., 2010).
Protemica diferencial de organismos expostos a diferente tipos de
estresse tambm possibilitam o entendimento dessas respostas, como a
tolerncia de cepas de Clostridium acetobutylicum ao butanol (MAO, et.al., 2010),
a resposta de Pseudomonas putida KT2440 ao phenol (SANTOS, et.al., 2004),
mudanas protemicas em Synechocystis sp. aps exposio prolongada a luz
UV-B (GAO, et. al., 2009) e a resposta da bactria Sphingopyxis alaskensis a
radiao solar (MATALLANA-SURGET, et. al., 2009).
Apenas um trabalho, at o momento, utilizou a abordagem protemica
para analisar a resposta de C. violaceum sob determinada condio de cultivo.
Neste estudo, Barana e colaboradores (2011) investigaram o efeito do cianeto
no metabolismo desta bactria atravs da anlise da expresso diferencial e
21

concluram que o cianeto promove a expresso de enzimas que combatem o
estresse oxidativo e reprimem enzimas do ciclo do cido ctrico, afetando
fortemente o metabolismo energtico da clula.
Outros estudos analisando o perfil protico de C. violaceum poderiam
auxiliar na descoberta de novos produtos com aplicaes biotecnolgicas, como
tambm na compreenso da fisiologia da bactria.























3. OBJETIVOS



22

3.1. Objetivo geral


O objetivo geral deste trabalho foi identificar o perfil proteico de
Chromobacterium violaceum a 28C e sua resposta radiao ultravioleta C.


3.2. Objetivos especfi cos


Realizar a anlise protemica da C. violaceum cultivada a 28C;
Analisar a expresso protica diferencial da bactria exposta ou no a
radiao UVC, utilizando tcnicas protemicas;
Separar as protenas identificadas de acordo com sua categoria funcional;
Realizar a re-anotao das protenas identificadas como hipotticas;
Analisar se as ORFs identificadas como hipotticas se encontram em
operon.

23

4. REFERNCIAS BIBLIOGRFICAS


ANTONISAMY, P.; KANNAN, P.; IGNACIMUTHU, S. Anti-diarrhoeal and ulcer-
protective effects of violacein isolated from Chromobacterium violaceum in Wistar
rats. Fundamental & Clinical Pharmacology 23(4):483-90, 2009.
ANTONISAMY, P.; IGNACIMUTHU, S. Immunomodulatory, analgesic and
antipyretic effects of violacein isolated from Chromobacterium violaceum.
Phytomedicine. 17(3-4):300-4. Epub 2009 J ul 2, 2010.
AUGUST, P.R.; GROSSMAN, T.H.; MINOR, C.; DRAPER, M.P.; MACNEIL, I.A.;
PEMBERTON, J .M.; CALL, K.M.; HOLT, D.; SOSBURNE, M.S.; Sequence
analyses and functional characterization of the violacein biosynthetic pathway
from Chromobacterium violaceum. J . Mol. Microbiol. Biotechnol. v.4, pp. 513-519,
2000.
BALLANTINE, J .A., BEER, R.J .S., CRUTCHLEY, D.J ., DODD, G.M., & PALMER,
D.R. The synthesis of violacein and related compounds. J . Chem. Soc. p.232
233, 1958.
BARANA, R.A., CIPRANDI, A., SANTOS, A.V., CAREPO, M.S.P.,
GONALVES, E.C., SCHNEIDER, M.P.C. and SILVA, A. Proteomics Analysis of
the Effects of Cyanate on Chromobacterium violaceum Metabolism. Genes, 2,
736-747, 2011.
BATISTA, J .S.S., TORRES, A.R and HUNGRIA, M. Towards a two-dimensional
proteomic reference map of Bradyrhizobium japonicum CPAC 15: Spotlighting
hypothetical proteins. Proteomics 10, 31763189, 2010.
BERGONIZI, C. Sopra un nuovo bacterio colorato. Annuar Soc. Nat. Modena,
Series 2, v. 14, p. 149-158, 1881.
BOISBAUDRAN, L. Matire colorante se formant dans la colle de farine. Comp.
Rend. Acad. Sci. v. 94, p.562-562, 1882.
24

BRITO, F.A., CARVALHO, C.M.B., SANTOS, F.R., GAZZINELLI, R.T.,
OLIVEIRA, S.C., AZEVEDO, V. & TEIXEIRA, S.M.R. Chromobacterium
violaceum genome: molecular mechanisms associated with pathogenicity. Genet
Mol Res 3(1): 148-161, 2004.
BILTON, B.D. & J OHNSON, L.W. Recurrent nonfatal Chromobacterium
violaceum infection in a nonimmunocompromised patient. Infect. Med. 17: 686-
692 (2000).
CAO, W.; CHEN, W.; SUN, S.; GUO, P.; SONG, J . & TIAN, C. Investigating the
antioxidant mechanism of violacein by density functional theory method. J ournal
of Molecular Structure: Theochem. v. 817, p. 14, 2007.
CALDAS, L.R. Photochemistry and photobiology in a virgin land, Photochem.
Photobiol. V. 26, p 1-2, 1977.
CALDAS, L.R.; LEITO, A.A.C.; SANTOS, S.M. & TYRRELL, R.M. Preliminary
experiments on the photobiological properties of violacein. Intern. Symp. Curr.
Topics Radiol. Photobiol. Acad. Brasil. Cienc. Rio de J aneiro, p. 121-123, 1978.
CALDAS, L.R. Um pigmento nas guas negras. Cinc. Hoje 11: 56-67, 1990.
CAMPBELL, S.C.; OLSON, G.J .; CLARK, T.R.; MCFETERS, G.J . Biogenic
production of cyanide and its application to gold recovery Ind. Microbiol.
Biotechnol. 26, 134139, 2001.
CAREPO, M.S.P.; AZEVEDO, J .S.N.; PORTO, J .I.R.; BENTES-SOUSA, A.R.;
SILVA BATISTA, J .; SILVA, A.L.C. & SCHNEIDER, M.P.C. Identidication of
Chromobacterium violaceum genes with potential biotechnological application in
environmental detoxification. Genetics and Molecular Research. 3(1), p.181-194,
2004.
CARVALHO, D.; COSTA, F.; DURN N. & HAUN, M. Cytotoxic activity of
violacein in human colon cancer cells. Toxicology in vitro. v. 20, p.15141521,
2006.
25

CHATTOPADHYAY, A.; KUMAR, V.; BHAT, N. & PLNG RAO. Chromobacterium
violaceum infection: A rare but frequently fatal disease. J . Pedriatic Surgery, v.37,
N.1, p.108-110 (J anuary), 2002.
CHONG, C. Y. & LAM, M. S. Case report and review Chromobacterium sepsis- a
gram negative sepsis mimicking melioidosis. Singapore Med. J . v. 38, p.263-365,
1997.
CORPE, W.A. Factors influencing growth and polysaccharide formation by strains
of Chromobacterium violaceum. J Bacteriol 88:14331441, 1964.
CROWLEY, D.J . & COURCELLE, J . Answering the call: coping with DNA damage
at the most inoppor tune time. J Biomed Biotechnol 2: 6674, 2002.
DEMOSS, R.D.; EVANS, N.R. Incorporation ofC14-labeled substrate in to
violacein, J . Bacteriol. 79: 729733, 1960.
DESSAUX, Y.; ELMERICH, C.; FAURE, D. Violacein: a molecule of biological
interest originating from the soil-borne bacterium Chromobacterium violaceum.
Rev Med Interne 25: 659-662, 2004.
DUMPALA, P.R., LAWRENCE, M.L. and KARSI, A. Proteome analysis of
Edwardsiella ictaluri. Proteomics 9, 13531363, 2009.
DURN, N. & FALJ ONI-ALARIO, A. Bacterial Chemistry I: Studies of a
potencial phototherapeutic substance from Chromobacterium violaceum, An.
Acad. Brasil. Cien. v.52, p.297-302, 1980.
DURN, N.; ANTONIO, R.V.; HAUN, M.; PILLI, R.A. Biosynthesis of a
trypanocide of Chromobacterium violaceum. World J . Microbiol. Biotechnol. 10:
686690, 1994.
DURN, N.; ERAZO, S.; CAMPOS, V. Bacterial chemistry. II. Antimicrobial
photoproduct from pigment of Chromobacterium violaceum. An. Acad. Bras. Cien.
55, 231234, 1983.
26

DURN, N. Violacena: A descoberta de um antibitico. Cienc. Hoje 11, 5860,
1990.
DURN N, MENCK CFM. Chromobacterium violaceum: a review of
pharmacological and industrial perspectives. Crit Rev Microbiol. 27:201-222,
2001.
EBERHARDT, C., ENGELMANN, S., KUSCH, H., ALBRECHT, D., HECKER, M.,
AUTENRIETH, I.B., and KEMPF, V.A.J . Proteomic analysis of the bacterial
pathogen Bartonella henselae and identification of immunogenic proteins for
serodiagnosis. Proteomics 9, 19671981, 2009.
ERILL, I., CAMPOY, S. and BARBE, J . Aeons of distress: an evolutionary
perspective on the bacterial SOS response. FEMS Microbiol Rev 31: 637656,
2007.
FENICAL, W. Chemical Studies of Marine Bacteria: Developing a New Resource.
Chem. Rev. 93(5): 1673, 1993.
FERREIRA, C.V.; BOS, C.L.; VERSTEEG, H.H.; J USTO, G.Z.; DURAN, N.;
PEPPELENBOSCH, M.P. Molecular mechanism of violacein-mediated human
leukemia cell death. Blood 104,1459-1464, 2004.
GAO, Y.; XIONG, W., LI, X.; GAO, C.; ZHANG, Y.; LI, H. & WU. Q. Identication
of the proteomic changes in Synechocystis sp. PCC 6803 following prolonged
UV-B irradiation. J ournal of Experimental Botany, v. 60, n. 4, p. 11411154, 2009
GARRITY, G.M.; WINTERS, M.; SEARLES, D.B. Taxonomic outline of the
prokaryotic genera, Bergeys Manual of Systematic Bacteriology. 2a ed. Springer-
Verlag, New York, NY, USA, p. 1-39, 2001.
GOURSON, C.; BENHADDOU, R.; GRANET, R.; KRAUSZ, P.; VERNEUIL, B.;
BRANLAND, P.; CHAUVELON, G.; THIBAULT, J .F.; SAULNIER, L. Valorization
of maize bran to obtain biodegradable plastic films. J ournal of Applied Polymer
Science 74: 30403045, 1999.
27

GRANGEIRO, T.B., J ORGE, D.M.M., BEZERRA, W.M., VASCONCELOS, A.T.R.
e SIMPSON, A.J .G. Transport genes of Chromobacterium violaceum: an
overview. Genet. Mol. Res. 3(1): 117-133, 2004.
GRIER, D.D.; QIU, J .; RAND, K.; DONNELY, W.H. Phatologic quiz case: a 13-
year-old boy with a 2day history of fever, vomiting and mental status changes.
Chromobacterium violaceum bacteremia. Arch. Phatol. Lab. Med. v.128, p. 131-
132, 2004.
HANSMEIER, N., CHAO, T.C., PHLER, A., TAUCH, A. and KALINOWSKI, J .
The cytosolic, cell surface and extracellular proteomes of the biotechnologically
important soil bacterium Corynebacterium efficiens YS-314 in comparison to
those of Corynebacterium glutamicum ATCC 13032. Proteomics 6, 233250,
2006.
HAUN, M.; PEREIRA, M.F.; HOFFMAN, M.E.; J OYAS, A.; CAMPOS, V.;
LIZARDI, L.D.; DE CASTRO, S.; DURN, N. Bacterial chemistry. VI: Biological
activities and cytotoxicity of 1,3-dihydro-2H-indol-2-one derivatives. Biol. Res. 25:
21-25, 1992.
HOSHINO, T.; KONDO, T.; UCHIYAMA, T.; OGASAWARA, N. Biosynthesis of
violacein: a novel rearrangement in tryptophan metabolism with a 1,2-shift of the
indole ring, Agric. Biol. Chem. 51: 965968, 1987.
HUNGRIA, M.; NICOLS, M. F.; GUIMARES, C. T.; J ARDIM, S. N.; GOMES, E.
A.; VASCONCELOS, A.T.R. Tolerance to stress and environmental adaptability of
Chromobacterium violaceum. Genet. Mol. Res., v. 3 (1), p. 102-116, 2004.
J ANION, C. Inducible SOS Response System of DNA Repair and Mutagenesis in
Escherichia coli. Int. J . Biol. Sci., 4: 338-344, 2008.
J ING, H.B., YUAN, J ., WANG, J ., YUAN, Y., ZHU , L., LIU, X. K., ZHENG, Y. L.,
WEI, K.W., ZHANG, X.M., GENG, H. R., DUAN, Q., FENG, S.W., YANG, R.F.,
CAO, W.C., WANG, H. L. AND J IANG, Y.K. Proteome analysis of Streptococcus
suis serotype. Proteomics 2008, 8, 333349
28

KOLKER, E.; PICONE, A.F.; GALPERIN, M.Y.; ROMINE, M.F.; HIGDON, R.;
MAKAROVA, K.S.; KOLKER, N.; ANDERSON, G.A.; QIU, X,; AUBERRY, K.J .;
BABNIGG, G.; BELIAEV, A.S.; EDLEFSEN, P.; ELIAS, D.A.; GORBY, Y.A.;
HOLZMAN, T.; KLAPPENBACH, J .A.; KONSTANTINIDIS, K.T.; LAND, M.L.;
LIPTOND,M.S.; MCCUE, L.; MONROE, M.; PASA-TOLIC, L.; PINCHUK, G.;
PURVINE, S.; SERRES, M.H.; TSAPINK, S.; ZAKRAJ SEK, B.A.; ZHU, W.;
ZHOU, J ; LARIMER, F.W.; LAWRENCE, C.E.; RILEY, M.; COLLART, F.R.;
YATES, J .R.; SMITH, R.D.; GIOMETTI, C.S.; NEALSON, K.H.; FREDRICKSON,
J .K. & TIEDJ E, J .M. Global profiling of Shewanella oneidensis MR-1: Expression
of hypothetical genes and improved functional annotations. PNAS v.102, n.6,
p.2099-2104, 2005.
KONZEN, M.; De MARCO, D.; CORDOVA, C.A.S.; VIEIRA ,T.O.; ANTNIO,
R.V.; CRECZYNSKI-PASA, T.B. Antioxidant properties of violacein: Possible
relation on its biological function. Bioorganic & Medicinal Chemistry. v. 14. p.
8307-8313, 2006.
LEAL, A.M.S., Queiroz, J .D.F., Batistuzzo de Medeiros, S.R. and Agnez-Lima,
L.F. Evaluation of pro-oxidant effects of violacein in cell culture. Chemico-
Biological Interactions 2011 in submission.
LEE, J .; KIM, J .S.; NAHM, C.H.; CHOI, J . W.; KIM, J .; PAI, S. H.; MOON, K. H.;
LEE, K.; CHONG, Y. Two Cases of Chromobacterium violaceum infection after
Injury in a Subtropical Region. J ournal of Clinical Microbiology. v. 37(6), p. 2068-
2070, 1999.
LEE, A.Y., PARK, S.G., J ANG, M., CHO, S., MYUNG, P.K., KIM, Y.R., RHEE,
J .H., LEE, D.H. and PARK, B.C. Proteomic analysis of pathogenic bacterium
Vibrio vulnificus. Proteomics 6, 12831289, 2006.
LICHSTEIN, H.C.; VAN DE SAND, V.F. Violacein, an antibiotic pigment produced
by Chromobacterium violaceum. J . Infect. Dis. 76, 4751, 1945.
LICHSTEIN, H.C.; VAN DE SAND, V.F. The antibiotic activity of violacein,
prodigiosin, and phthiocol. J . Bacteriol. 52, 145146, 1946.
29

MAO, S., LUO,Y., ZHANG, T., LI, J ., BAO, G., ZHU, Y., CHEN, Z., ZHANG, Y., LI,
Y. and MA, Y. Proteome Reference Map and Comparative Proteomic Analysis
between a Wild Type Clostridium acetobutylicum DSM 1731 and its Mutant with
Enhanced Butanol Tolerance and Butanol Yield. J ournal of Proteome Research 9,
30463061, 2010.
MARGALITH, P.Z. In Pigment Microbiology; Chapman & Hall: London, 1992.
MARTIN, J .P.; RICHARDS, S.J . Decomposition and binding action of a
polysaccharide from Chromobacterium violaceum in soil. J Bacteriol 85:1288
1294, 1963.
MARTINELLI, D.; BACHOFEN, R.; BRANDL, H. Effect of medium composition,
flow rate, and signaling compounds on the formation of soluble extracellular
materials by biofilms of Chromobacterium violaceum. Appl Microbiol Biotechnol
59:278283, 2002.
MARTINEZ, R.; VELLUDO, M.A.S.L.; SANTOS, V.R. & DINAMARCO, P.V.
Chromobacterium violaceum infection in Brazil. A case report. Revista do Instituto
Tropical de So Paulo. v.42, n.2, p. 111-113, 2000.
MATALLANA-SURGET, S., J OUX, F., RAFTERY, M.J . and CAVICCHIOLI, R.
The response of the marine bacterium Sphingopyxis alaskensis to solar radiation
assessed by quantitative proteomics. Environmental Microbiology 11(10), 2660
2675, 2009.
MELO, P.S.; MARIA, S.S.; VIDAL, B.C.; HAUN, M.; DURAN, N. Cytotoxicity and
induction of apoptosis in V79 cells. In Vitro Cell Dev. Biol. Anim. 36, 539543,
2000.
MOSTERTZ, J .; SCHARF, C.; HECHER, M.; HOMUTH, G. Transcriptome and
proteome analysis of Bacillus subtilis gene expression in response to superoxide
and peroxide stress. Microbiology 150, 497-512, 2004.
RAVANAT, J .L.; DOUKI, T.; CADET. J . Direct and indirect effects of UV radiation
on DNA and its components. J . Photochem. Photobiol. B. v. 63, p. 88-102, 2001.
30

SANCHEZ, C.; BRANA, A.F.; MENDEZ, C.; SALAS, J .A. Reevaluation of the
violacein biosynthetic pathway and its relationship to indolocarbazole
biosynthesis. Chembiochem. v. 7, p. 1231-1240, 2006.
SANTOS, P.M., BENNDORF, D. and S-CORREIA, I. Insights into Pseudomonas
putida KT2440 response to phenol-induced stress by quantitative proteomics.
Proteomics, 4, 26402652, 200.
SCHOOK, P.O.P. STOHL, E.A., CRISS, A.K. and SEIFERT, H.S. The DNA-
binding activity of the Neisseria gonorrhoeae LexA orthologue NG1427 is
modulated by oxidation. Molecular Microbiology. 79(4), 846860, 2011.
SHIRATA, A.; TSUKAMOTO, T.; YASUI, H.; HATA, T.; HAYASAKA, S.; KOJ IMA,
A.; KATO, H. Isolation of bacteria producing bluishpurple pigment and use for
deyeing. J apan Agric. Res. Quart. 34, 131-140, 2000.
SILVA, R., ARARIPE, J .R., EDSON RONDINELLI, E. and RMNYI, T.P. Gene
expression in Chromobacterium violaceum. Genet. Mol. Res. 3: 64-75, 2004.
SOUZA, A.O.; AILY, D.C.G.; SATO, D.N.; DURN, N. Atividade da violacena in
vitro sobre o Mycobacterium turbeculosis H37RA. Rev. Inst. Adolfo Lutz 58: 59
62, 1999.
SMITH, A.D. & HUNT, R.J . Solubilisation of gold by Chromobacterium violaceum.
J . Chem. Technol. Biotechnol. 35: 110116, 1985.
TI, T.Y.; TAN, W. C.; CHONG, A. P. & LEE, E. H. Nonfatal and fatal infections
caused by Chromobacterium vioolaceum. Clin. Infect. Dis. v.17, p. 505-507, 1993.
TOBIE, W. C. The pigment of Bacillus violaceus. III The apparent relation of
violacein to indigo. Soc. Am. Bacteriolol. 39 th General meeting, p. 11-12, 1934.
Vasconcelos, A.T.R.; Almeida, D.F.; Hungria, M.; Guimares, C.T.; Antnio, R.V.;
Almeida, F.C.; Almeida, L.G.P.; Almeida, R.; Gomes, J .A.; Andrade, E.M.;
Araripe, J .; Araujo, M.F.F.; Astolfi Filho, S.; Azevedo, V.; Baptista, A.J .; Bataus,
L.A.M.; Baptista, J .S.; Belo, A.; Berg, C.V.D.; Bogo, M.; Bonatto, S.; Bordingnon,
31

J .; Brigido, M.M.; Brito, C.A.; Brocchi, M.; Buryti, H.A.; Camargo, A.A.; Cardoso,
D.D.P.; Carneiro, N.P.; Carraro, D.M.; Carvalho, C.M.B.; Cascardo, J .C.M.;
Cavada, B.S.; Chueire, L.M.O.; Creczynski-Pasa, T.B.; Cunha J unior, N.C.;
Fagundes, N.; Falco, C.L.; Fantinatti, F.; Farias, I.P.; Felipe, M.S.S.; Ferrari,
L.P.; Ferro, J .A.; Ferro, M.I.T.; Franco, G.R.; Freitas, N.S.A.; Furlan, L.R.;
Gazzinelli, R.T.; Gomes, E.A.; Gonalves, P.R.; Grangeiro, T.B.; Grattapaglia, D.;
Grisard, E.C.; Hanna, E.S.; J ardim, S.N.; Laurino, J .; Leoi, L.C.T.; Lima, L.F.A.;
Loureiro, M.F.; Lyra, M.C.C.P.; Madeira, H.M.F.; Manfio, G.P.; Maranho, A.Q.;
Martins, W.S.; Mauro, S.M.Z.; Medeiros, S.R.B.; Meissner, R.V.; Moreira, M.A.M.;
Nascimento, F.F.; Nicolas, M.F.; Oliveria, J .G.; Oliveira, S.C.; Paixo, R.F.C.;
Parente, J .A.; Pedrosa, F.O.; Pena, S.D.J .; Pereira, J .O.; Pereira, M.; Pinto,
L.S.R.C.; Pinto, L.S.; Porto, J .I.R.; Potrich, D.P.; Ramalho Neto, C.E.; Reis,
A.M.M.; Rigo, L.U.; Rondinelli, E.; Santos, E.B.P.; Santos, F.R.; Schneider,
M.P.C.; Seuanez, H.N.; Silva, A.M.R.; Silva, A.L.C.; Silva, D.W.; Silva, R.;
Simes, I.C.; Simon, D.; Soares, C.M.A.; Soares, R.B.A.; Souza, E.M.; Souza,
K.R.L.; Souza, R.C.; Steffens, M.B.R.; Steindel, M.; Teixeira, S.R.; Urmenyi, T.;
Wassen, R.; Zaha, A.; Simpson, A.J .G. The complete genome of
Chromobacterium violaceum reveals remarkable and exploitable bacterial
adaptability. Proc. Natl. Acad. Sci. USA v.100, p. 11660-11665, 2003.
UEDA, H.; NAKAJ IMA, H.; HORI, Y.; GOTO, T.; OKUHARA, M. FR901228, a
novel antitumor bicyclic depsipeptide produced by Chromobacterium violaceum.
Biosci. Biotechnol. Biochem. 58, 15791583, 1994.
WOOLEY, P.G. Bacillus violaceus manila (a pathogenic organism). Bull J ohn
Hopkins Hospital v. 16, p. 89-93, 1905.
ZIMMERMAN, B. Review of Bergonizi on Chromobacterium, Bo. Centralbl. v.4, p.
1528-1530, 1881.





32

5. MANUSCRITOS

















MANUSCRITO I













33

Proteomic Profile of Chromobacterium violaceum ATCC 12472: New Perspectives 1
in the Post-genomic Era 2
3
Viviane Katielly Silva Medeiros
1,3
, Andr da Silva Santiago
2
, Helena Costa
2
, Carlos 4
Priminho Pirovani
2
, Silvia Regina Batistuzzo de Medeiros
1
5

6
1
Laboratrio de Biologia Molecular e Genmica, Departamento de Biologia Celular e 7
Gentica, Universidade Federal do Rio Grande do Norte, Natal, Rio Grande do Norte, 8
Brasil 9
2
Laboratrio de Protemica, Universidade Estadual de Santa Cruz, Ilhus, Bahia, Brasil 10
3
Colegiado de Medicina, Universidade Federal do Vale do So Francisco, Petrolina, 11
Pernambuco, Brasil 12
13
Correspondence: Dra Silvia Regina Batistuzzo de Medeiros, Laboratrio de Biologia 14
Molecular e Genmica, Departamento de Biologia Celular e Gentica, Universidade 15
Federal do Rio Grande do Norte, Natal, Rio Grande do Norte, Brasil. 16
Email: sbatistu@cb.ufrn.br 17
Fax number: +55 85 3215 3346 18
19
Runnig title: Proteome profile of Chromobacterium violaceum 20
21
Keywords: proteome, C. violaceum, basal metabolism, quorum sensing, violacein, 22
T6SS, biofilm. 23
24
25
26
27
28
29
30
31
32
33
34
34

Abstract 35
36
Chromobacterium violaceum is a free-living bacillus found in soil and waters of tropical 37
and subtropical regions. This bacterium has biotechnological properties and its purple 38
color is due to the presence of violacein, a pigment with various biological properties. 39
The sequencing of its genome paved the way for a deeper understanding of the 40
bacterium. Yet, few post-genome studies have been conducted. This is the first study to 41
analyze the proteomic profile of C. violaceum using 2-D electrophoresis and analysis by 42
nano LC-MS/MS, thus allowing the identification of 206 proteins with basal expression, 43
at 28C. These proteins were classified according to clusters of orthologous groups and 44
their subcellular locations were predicted. In addition, 30 proteins annotated as 45
hypothetical in the genome and/or conserved hypothetical were re-annotated and the 46
prediction that they are organized in probable operons was assessed. This study has 47
identified proteins associated with a possible secretion system as yet unidentified and 48
not characterized in C. violaceum, the quorum sensing system, the regulatory processes 49
of transcription and translation, adaptation to stress and biotechnological potential. This 50
work provides the base for studying the biology of this bacterium with the aim of 51
obtaining further knowledge of biotechnological applications. 52
53
54
55
56
57
58
59
60
61
62
63
35

Introduction 64
65
Chromobacterium violaceum is a free-living gram-negative bacterium found in soil and 66
waters of tropical and subtropical regions around the world (Durn and Menck, 2001). 67
This organism belongs to the family Neisseriacea of -proteobacteria (Garrity et al., 68
2001) and is generally considered non-pathogenic, although infections by C. violaceum 69
are characterized by rapid spread and high mortality (Brito et al., 2004). The purple 70
color (characteristic of the bacterium) is explained by the presence of a pigment 71
(violacein) that has several biological properties (for a review see: Durn and Menck, 72
2001). Due to the presence of genes with high potential for pharmacology, 73
bioremediation and agriculture, the genome of this bacterium has been completely 74
sequenced (Vasconcelos et al., 2003). Analysis of the genome has identified several 75
genes that may be used in the synthesis of compounds of medical importance, gold 76
recovery, environmental detoxification, agricultural applications such as control of 77
insects, fungi and nematodes, synthesis of biodegradable plastic, and cellulose synthesis 78
(Carepo et al., 2004). 79
The completion of C. violaceum genome paved the way for understanding the 80
physiology of this organism and its biotechnological potential. Some studies have 81
focused on the functions of violacein and thereby demonstrated that this molecule has 82
antidiarrhoeal properties, a protective effect against ulcers induced in Wistar rats 83
(Antonisamy et al., 2009), besides being immunomodulatory, analgesic and antipyretic 84
(Antonisamy and Ignacimuthu, 2009). A study that primarily focused on this bacterium 85
has shown evidence of cellulose on the extracellular matrix component of bacterial 86
biofilms, which is thought to be produced by genes organized into two operons similar 87
to those of other bacteria that produce cellulose (Recouvreux et al., 2008); also, it has 88
been documented the characterization of an arsRCB-type operon associated with 89
arsenic resistance (Azevedo et al., 2008). In addition, studies focused on understanding 90
of the regulation of quorum sensing system in this organism have been undertaken; as 91
an example, the study conducted by Stauff and Bassler (2011) has defined a DNA 92
consensus sequence required for recognition of the promoter region of genes regulated 93
by the transcriptional factor protein CviR, which activates the expression of quorum 94
sensing system-related genes after binding to C
10
-homoserine lactone. After directly 95
measuring the activation of promoters that contain consensus sequences, it was found 96
36

that CviR controls the expression of the promoter for a chitinase, a type VI secretion- 97
related gene, a transcriptional regulator gene, a guanine deaminase gene and cviI (Stauff 98
and Bassler, 2011). 99
Despite the great biotechnological potential of C. violaceum, few post-genomic 100
studies have been performed so far. This is one of the first studies in the field of 101
proteomics and it will facilitate future studies of proteins involved in the response of 102
bacteria to the wide variety of stimuli, including environmental stresses, resistance to 103
metals, understanding the physiological function of violacein, biofilm formation, 104
interactions between bacteria and quorum sensing system. Furthermore, a better 105
understanding of the metabolic and molecular basis of this bacterium should be useful 106
in the discovery of new products with biotechnological potential and with a wide 107
applicability in the pharmaceutical, agricultural and environmental fields. 108
109
Results 110
Theoretical protein map 111
The theoretical 2-D map was designed to estimate the distribution of 4,431 112
predicted proteins encoded by ORFs identified in the genome project of C. violaceum 113
(Vasconcelos et al., 2003) and to determine the optimum pH range for 2-D gel-based 114
proteome analysis. As shown in Figure S1, most ot the predicted proteins of C. 115
violaceum are distributed in the pH range of 4-12. According to the theoretical 116
distribution, pH 3-10 IPG strips were employed to determine the total protein content of 117
this bacterium, under in vitro growth conditions. 118
119
Spot identification and characterization 120
With the aid of the ImageMaster 2D Platinum software Version 6.0 (Fig. S1), a 121
total of 325 spots were detected in the three gels, whereof 229 were excised and 156 had 122
their proteins identified by nano LC-MS/MS analysis, representing a total of 206 123
different proteins. This is due to the fact that some spots contained more than one 124
protein close to a given pI and MW. Thirty proteins annotated as hypothetical and/or 125
conserved hypothetical in the Brazilian Genome have been identified (Table 1). 126
Twenty-nine proteins were found in multiple spots at different positions on 2-D 127
gels (Table 1), thus suggesting post-translational modifications. 128
129
37

Functional assignment of the identified protein of C. violaceum 130
The identified proteins were classified into four categories according to their 131
predicted functions. The categories were: metabolism (44%), information storage and 132
processing (32%), cellular processes and signaling (19%) and poorly characterized (5%) 133
(Table 1). 134
Prominent functional classes of the identified proteins are involved in 135
translation, ribosomal structure and biogenesis (COG category J 27%), energy 136
production and conversion (COG category C 15%) and amino acid transport and 137
metabolism (COG category E 12%) (Table 1). 138
139
Cellular localization 140
Despite the fact that most proteins are present in the cytosol, identification of 141
proteins from membrane, outer membrane, extracellular membrane and periplasmic 142
membrane (Table 1) indicates that the methodology was able to provide a representation 143
of all cellular compartments. 144
145
Multiple sequence alignment, search for conserved domains and interaction network 146
The ORFs CV1820 and CV4055 were subjected to multiple sequence alignment 147
and had their conserved domains searched; the latter had the interactome with open 148
reading frames present in the genome of C. violaceum analyzed (Fig. 4). Figure 5A 149
shows that, when aligned with the sequences of Haemophilus influenzae and 150
Escherichia coli, the protein encoded by ORF CV4055 shows conservation in two 151
motifs of conserved sequence, as well as in the recognition site of the enzyme. On the 152
other hand, when the ribonuclease (RNase) E (CV1820) is aligned with the amino acid 153
sequence of the same protein of E. coli, a high conservation in the region of the N- 154
terminal domain is seen (Fig. 5B). The result of the search for functional domains has 155
revealed that CV4055 shares 18 out of the 21 identified areas with Pyrococcus furiosus 156
hybrid cluster protein (Figures S3A and B), while CV1820 shares all nine identified 157
domains with the protein from H. influenza (Figures S3C and D). The interactome of 158
CV4055 showed that the protein interacts with seven proteins also identified in this 159
study (Fig. 4). 160
161
Energy metabolism 162
38

Enzymes that participate in central and intermediary metabolic pathways have 163
been identified, including those involved in the Embden-Meyerhof route, citric acid 164
cycle and pyruvate metabolism (n=18), and oxidative phosphorylation (n=9) (Table 1). 165
Proteins related to the transport and metabolism of amino acids (n=22), 166
nucleotides (n=10), carbohydrates (n=16), lipids (n=6), coenzymes (n=4), inorganic 167
ions (n=5) and the catabolism, transport and biosynthesis of secondary metabolites have 168
been identified (Table 1). 169
170
Information storage and processing 171
A total of 34 proteins related to translational capacity, biogenesis and ribosomal 172
structure have been identified, including aminoacyl-tRNA synthetase (n=11), 173
transcription elongation factors (n=4) and ribosomal proteins (n =13). Two proteins 174
related to the categories of replication, recombination and repair have also been 175
identified: RdgC (CV3548) and Dps (CV4253), two RNA polymerase subunits (RpoA 176
and RpoB), proteins related to transcription termination and elongation (repectively 177
Grebe and Rho) and two regulatory proteins, OmpR and GlpR1 (Table 1). 178
179
Cellular processes and sinaling 180
One protein involved in cell cycle control, cell division, chromosome 181
partitioning (MRP) and another involved in cell motility (FlaD) have been identified. 182
Ten proteins involved in cell wall/membrane/envelope biogenesis and 17 proteins 183
involved in posttranslational modification, protein turnover, chaperones; among the 184
latter, there were proteins encoded by the ORFs related to DnaJ -DnaK-GrpE heat-shock 185
(CV1642 and CV1643), GroEL/GroES (CV4014 3 CV4015) and ClpX protease 186
(CV2557) have also been identified (Table 1). 187
188
"Hypothetical" proteins 189
Thirthy out of the total proteins identified were annotated as hypothetical and/or 190
conserved hypotetical by the Brazilian Genome 191
(http://www.brgene.lncc.br/cviolaceum/) (Table 1) (Vasconcelos et al., 2003). After 192
further analysis of these ORFs using the softwares BLASTp (NCBI and Transpot 193
Protein Database-TCDB) and Conserved Domain Database (CDD) with a view of 194
updating the annotation, it was possible to demonstrate that none of these proteins falls 195
39

into the category of hypothetical and/or conserved hypothetical, since the e-value ranges 196
from 2e-
42
to 0.0 in proteins whose functions are already characterized (Table 2). 197
The ORFs were subjected to analysis by MicrobesOnline Operon Predictions 198
and it was found that CV3817, CV1197, CV2983, CV4035, CV1763, CV0971, 199
CV1431, CV2204, CV2036, CV3276, CV3333, CV4055 and CV4329 were organized 200
into probable operons, with proteins that fall into the category of hypothetical even after 201
the annotation update (Table 3, Figure S2). 202
203
Discussion 204
205
Transporters 206
The transport-related membrane proteins act as mediators between direct 207
metabolic interactions of bacteria and the complex environment they inhabit. Currently, 208
seven major categories of transporters have been recognized according to the Transport 209
Classification Database: Class 1) channels and pores, class 2) electrochemical potential- 210
driven transporters, class 3) primary active transporters, class 4) group translocators, 211
class 5) transmembrane electron carriers, class 6) involved in transport accessory factors 212
and class 7) incompletely characterized transport systems (Saier et al., 2009). After 213
sequencing the genome of C. violaceum, 496 ORFs related to transport were identified. 214
The largest number of ORFs corresponds to class 3, whereof 119 belong to the ATP- 215
binding Cassette (ABC) Superfamily (Vasconcelos et al., 2003). Four ORFs annotated 216
as hypothetical and that belonged to this superfamily have been identified in this study, 217
namely: CV4329, CV2983, CV1197 and CV3360. 218
The analysis of TCDB by BLASTp showed that the probable oligopeptide ABC 219
transporter system, substrate-binding protein (CV4329) has sequence homology with 220
the periplasmic oligopeptide-binding protein precursor in Salmonella typhimurium 221
(Table 2). This ORF is probably organized in an operon with genes oppB (CV4328), 222
oppC (CV4327), oppD (CV4326), oppE (CV4325) and oppF (CV4324) (Fig. S2N). A 223
range of functions have been described for bacterial opp systems. In addition to 224
providing essential amino acids (Fournier et al., 2001; Charbonnel et al., 2003), these 225
systems are related to cell wall turnover in E. coli (Park et al., 1998), modulation of cell 226
surface in Mycobacterium tuberculosis (Flores-Valdez et al., 2009), development of 227
natural competence in Streptococcus thermophilus Strain LMD-9 (Gardan et al., 2009), 228
40

mediated signaling by peptides in Bacillus subtilis and Enterococcus faecalis 229
(Lazazzera, 2001) and are capable of performing roles in the virulence of some Gram- 230
positive pathogenic bacteria (Wang et al., 2005; Gominet et al., 2001; Slamti and 231
Lereclus, 2002). Studies involving the Moraxella catarrhalis protein (oppA) suggest 232
that it could be used to produce vaccines against this pathogen that causes otitis in 233
children and lower respiratory tract infections in adults (Yang et al., 2011). 234
In order to prevent dehydration under hypertonic growth conditions and bursting 235
under hypotonic conditions, the microorganisms must adjust their intracellular solute 236
pools (Booth and Louis, 1999). Most bacteria perform this task through the 237
accumulation of ions, particularly K
+
, and specific organic osmolytes in high osmolarity 238
(Kempf and Bremer, 1998; Welsh, 2000). Osmoregulatory ABC transporters contribute 239
to bacterial adaptation to hyperosmolarity (Angelidis et al., 2002), comprising the 240
systems OpuA, OpuB and OpuC of B. subtilis (Kappes et al., 1999). A protein 241
identified in the reference gel showed sequence homology with a glycine 242
betaine/choline OpuC ABC transporter, ATP-binding protein of Pseudomonas syringae 243
pv. Tomato. This ORF (CV1197) is probably organized in an operon with the ORFs 244
CV1196, 1195 and 1194 (Figure S2B); BLAST analysis showed that these genes are, 245
likewise, no longer hypothetical, classed as being respectively Glycine betaine/choline 246
OpuC ABC transporter permease protein, periplasmic substrate-binding protein and 247
Glycine betaine/carnitine/choline transport system permease protein opuCB (Table 3). 248
249
Pathogenicity 250
The ORF CV3977 (Hcp1family) was identified in the reference gel and is likely 251
to be in an operon with CV3978 (EvpB/VC_A0108 family) and CV3979 (VC_A0107 252
family) (Table 3; Fig S2J ). These three genes belong to the type VI secretion system 253
(T6SS), which was recently discovered and contains from 12 to 20 genes varying in 254
composition and organization among the species (Cascales, 2008). After identifying the 255
Hcp1 protein in the reference gel, the genomic context of this ORF was analyzed and 256
found to be located next to other ORFs encoding proteins also related to T6SS, thus 257
forming a probable pathogenicity island that includes the core components of this 258
system: the T4SS IcmF and ICMH-like proteins (CV3980, CV3976), CV3971 that 259
aligns with a probable lipoprotein, CV3965, which bears similarities to ClpV-like 260
AAA
+
ATPase, Hcp1family (CV3977) and VgrG proteins (CV3975 and CV3986). In 261
addition to these, there are other T6SS-related ORFs and also hypothetical ORFs, which 262
41

can usually be found in the pathogenicity islands of other organisms (Cascales, 2008) 263
(Table 4, Figure 2). Despite C. violaceum is an opportunistic pathogen (Durn and 264
Menck, 2001), the sequencing of its genome has revealed the presence of types I, II and 265
III secretions systems. Based on the results of proteomic and bioinformatics analysis, 266
this study allowed proposing the presence of another secretion system, the T6SS. 267
The T6SS system has been identified in pathogenic bacteria, as well as in 268
opportunistic pathogens (Cascales, 2008) such as C. violaceum. The functions 269
performed by the T6SS have been little studied and are related to various processes such 270
as biofilm formation (Aschtgen et al., 2008; Enos-Berlage et al., 2005), conjugation 271
(Das et al., 2002), regulation of quorum sensing (Weber et al., 2009), and promotion 272
and limitation of virulence factor (Cascales, 2008; Filloux, 2009; Pukatzki et al., 2009). 273
Thus, the presence of T6SS in C. violaceum paves the way for the study of these 274
processes in bacteria, as well as the role of violacein in the context of bacterial 275
physiology, since the production of this pigment is regulated by quorum sensing 276
(McDougald et al., 2007). In addition, new evidence on the role of T6SS in the 277
interaction between bacteria has emerged; this is the case of the T6SS encoded by the 278
opportunistic pathogen Pseudomonas aeruginosa, which targets a toxin to other P. 279
aeruginosa cells, but not to eukaryotic cells (Cascales, 2008). 280
281
Quorum sensing and biotechnological potential 282
The protein codified by CV1683 was identified in the reference gel. The hcnB 283
gene is part of hcnABC operon involved with the production of cyanide and is regulated 284
by quorum sensing (Vasconcelos et al., 2003). Strains of C. violaceum NCIB 9131 can 285
produce cyanide and detoxify it via -cyanoalanine synthase (Rodgers, 1982). Thanks to 286
the capacity of production and detoxification of cyanide, C. violaceum has the potential 287
to be used in ecological Au recovery methods such as recovery of Au from discarded 288
eletric devices, as well as in the microbiological mobilization of other metals from solid 289
materials (Faramarz et al., 2004; Kita et al., 2006). 290
Despite C. violaceum strain ATCC 12472 shows the hcnABC operon, no study 291
has thus far demonstrated the production of these three proteins by bacteria. Hydrogen 292
cyanide synthase HcnB been identified in this study, but the -cyanoalanine synthase 293
enzyme has not been identified in the genome annotation of this strain, neither when 294
BLAST analyses was performed. A conserved hypothetical protein CV3588 showing 295
sequence similarity to Rhodaneses has been identified in the reference gel (thiosulfate: 296
42

cyanide sulfurtransferases or TSTs, EC 2.8.1.1) (Table 2). This protein catalyzes the 297
transfer of sulfane sulfur from a donor molecule to a thiophilic acceptor and is widely 298
distributed in plants, animals and bacteria; also, this protein has been associated with 299
various biological processes such as detoxification of cyanide, sulfur and selenium 300
metabolism, synthesis and repair of iron-sulfur proteins (Cipollone et al., 2007). The 301
probable rhodanese encoded by ORF CV3588 could potentially help in the 302
detoxification of cyanide and play the role of -cyanoalanine synthase in this strain. 303
The protein encoded by ORF CV0130 showed 100% sequence identity with the 304
Xaa-Pro dipeptidase of Lutiella nitroferrum 2002. Prolidases are dipeptidases that 305
cleave dipeptides with C-terminal proline (NH2-X-/-Pro-COOH) (Theriot et al., 2009). 306
These enzymes have many biotechnological properties and can be used in the dairy 307
industry as a cheese-ripening agent (Bockelmann, 1995) and also to detoxify and 308
decontaminate surfaces exposed to organophosphorus compounds (OPs) (Theriot et al., 309
2010). OPs are the most common components in pesticides and chemical weapons and 310
highly toxic and difficult to degrade. Exposure to OP compounds can irreversibly 311
inhibit the peripheral and central nervous system acetylcholinesterase (AChE) and lead 312
to serious nerve agent poisoning, convulsions, respiratory diseases, coma and death 313
(Wetherell et al., 2006). This study showed that C. violaceum produces a basal variant 314
form of Xaa-Pro dipeptidase that shares multiple functional domains with the prolidase 315
of P. furiosus (Fig. S3A and S3B). The study of new prolidases can be useful for a more 316
effective application of these enzymes in the detoxification of OPs and possible new 317
biotechnological applications. 318
319
Translational and transcriptional regulation 320
The probable sigma-54 modulation protein (CV3333) has sequence similarity 321
with other sigma-54 modulation proteins (YfiA). These proteins have the ribosome- 322
associated inhibitor A domain (RaiA) and are also known as Protein Y (PY), YfiA and 323
SpotY; they are stress response proteins that bind to the ribosomal subunit interface and 324
stop the translation by interfering with binding site A of aminoacyl-tRNA. Moreover, it 325
is believed that YfiA may control mismatch at site A. thus reducing error rates during 326
the translation process ([cd00552] - Marchler-Bauer et al., 2011). During the stationary 327
growth phase of E. coli, there is the conversion of 70S ribosomes into 100S ribosome 328
dimers, a formation promoted by the RMF protein (Wada et al., 1995). It is known that 329
YfiA is a binding protein involved in the regulation of dimer formation. In vitro studies 330
43

show that these proteins increase in the cell during the transition from exponential to 331
stationary phase of E. coli growth. In vivo studies using yfiA genes carrying mutations 332
showed that this strain is capable of producing RMF and HPF protein (YhbH) and that, 333
in stationary phase, they produce more 100S particles than the wild-type strain, thus 334
suggesting that the function of HPF is to promote and stabilize the formation of 100S 335
ribosome dimers. The hpf mutant gene, in turn, expresses the proteins YfiA and RMF, 336
but is unable to form 100S dimers, hence suggesting that the function of YfiA is to 337
prevent the dimer-forming of 70S ribosomes by RMF (Ueta et al., 2005). 338
Another protein that is possibly related to translational regulation is that encoded 339
by the ORF CV4055 (Table 1). This ORF was annotated in the Brazilian Genome 340
Project as a hypothetical conserved protein, but it shows 100% sequence identity with 341
the protein EngD of Laribacter hongkongensis HLHK9 (Table 2). The protein EngD or 342
YchF belongs to subfamily of Obg-like proteins. This gene is dispensable in E. coli and 343
its disruption leads to a decrease in bacterial growth and a temperature-sensitive 344
phenotype (Brown, 2005). The ability to bind to the ribosome suggests a role of this 345
protein in the translational process (Tomar et al., 2011). This hypothesis is strengthened 346
by its co-expression, as a bicistronic messenger RNA that participates in the recycling 347
of tRNAs in stalled ribosomes (Das and Varshney, 2006). Although YchF was studied, 348
its biological role is not yet clear. In C.violaceum, the ORF CV4055 is situated next to a 349
pth (CV4056), forming a possible operon with two ORFs: CV4057 and 4058 (Table 3, 350
Figure S2M). After analysis of the interaction network using the STRING software, it 351
was found that the protein encoded by CV4055 interacts with proteins identified in the 352
reference gel, which are also related to the translation process: t-RNA synthetase, pheS 353
(CV1352), thrS (CV1348), ribosomal proteins 50S and 30S: rplI (CV3637) and rpsF 354
(CV3640), respectively; elongation factors such as efp (CV1378) and tsf (CV2197), and 355
the ATP synthase subunit atpD (CV0672) (Fig. 3) . 356
GTPases act as molecular switches in a wide variety of biochemical processes. 357
Leipe et al (2002) have phylogenetically classified P-loop GTPases and related ATPases 358
into two broad classes: TRAFAC (translation factor-related) and SIMBI (signal 359
recognition particle), with three major subgroups, the YchF belonging to the first class. 360
Figure 4 shows comparison of protein YchF (CV4055) with those of E. coli and H. 361
influenza, which had its crystal structure resolved. One should note that the protein of C. 362
violaceum has two conserved sequence motifs that are typical for this class: the N- 363
terminal Walker A motif GxxxxGK [ST], consisting of a flexible loop that has the 364
44

function of positioning the triphosphate moiety of the nucleotide and the Walker B 365
motif hhDxxG, where h is a hydrophobic amino acid and glycine amide interacts with - 366
phosphate (Brown, 2005). The structure of the protein recognition site of H. influenza to 367
GTP is somewhat unusual: N
207
VNE
210
, but it is consistent with the specificity of YchF 368
guanine (Teplyakov et al., 2003); furthermore, this recognition site is present in the 369
primary sequence of C. violaceum YchF (Fig. 5A). 370
The probable ribonuclease E (CV1820) showed 100% sequence identity with 371
multiple ribonucleases E (RNase E), including bacteria of the family Neisseriacea. 372
RNase E is an RNase involved in the degradation of mRNA, RNA processing 373
(Deutscher et al., 2006; Carpousis et al., 2009) and the gene silencing mediated by 374
small non-coding RNAs and by RNA chaperone Hfq (Morita et al., 2005; Waters and 375
Storz, 2009). In E. coli and other proteobacteria, RNase E is organized in a 376
multienzymatic complex known as DNA degradosome. 377
In addition to RNase E, other important enzymes of this complex are 378
polynucleotide phosphorylase, DEAD-box RNA helicase RhlB and enolase (Carpousis, 379
2007). The protein of E. coli has 1061 amino acid residues, where residues of 1-529 380
correspond to the catalytic domain of the enzyme, which is associated to form a 381
tetrameric holoenzyme (Callaghan et al., 2005) and the remaining residues correspond 382
to the non-catalytic region that forms a scaffold for interaction with other proteins of the 383
complex (Callaghan et al., 2004). The RNase E of C. violaceum shares many functional 384
domains with the protein of E. coli, has a similar size (981 amino acids), and shows 385
high conservation in the region of the functional domain located at the N-terminal 386
portion (Fig.S3C and S3D; Fig. 5B). The RNAses containing non catalytic domains 387
have plasticity in their primary sequences, while the few degradosomes identified in 388
other proteobacteria have variable composition. As an example, the Rhodobacter 389
capsulatus complex consists of RNase E, two DEAD-box proteins and the Rho 390
transcription termination factor (Carpousis, 2007). Thus, one can hypothesize that the 391
RNase E of C. violaceum could interact with other proteins in order to form a 392
degradosome. Along with proteins Pnp (CV1466) and Rho (CV1585), the co-expression 393
of basal RNAse E was seen as part of the degradosome of other proteobacteria, hence 394
suggesting that they can interact with the RNase E of C. violaceum. Yet, assays such as 395
the co-immunoprecipitation should be held in order to test this hypothesis. 396
397
Stress adaptation 398
45

In addition to the basal expression of heat-shock DnaJ , DnaK, and GroEL1 399
GroES1 proteins in C. violaceum, it was possible to identify the only binding chaperone 400
at the ribosomat tunnel known in bacteria: the trigger factor (CV2559) (Table 1). This 401
protein also has a domain with peptidyl-prolyl cis-trans isomerase activity and belongs 402
to the FKBP family of PPIases (Hoffmann et al., 2010). Yet, the importance of this 403
domain to the function of proteins is still unknown. 404
Proteins regulated by OxyR Regulon - which responds to oxidative stress 405
generated by hydrogen peroxide - have also been identified: Dps (CV4253), probable 406
peroxidase (CV3739), which has sequence similarity with alkyl hydroperoxide 407
reductases, and the probable peroxiredoxin/glutaredoxin family protein (CV2036) that 408
has similarity with the glutaredoxin-family domain protein (Table 1). In this study, Dps 409
protein showed very low expression (Figure 1), consistent with the observations for E. 410
coli, where there is a low level of expression during the logarithmic phase of growth 411
(Calhoun and Kwon, 2010). In this phase, negative regulation occurs at the 412
transcriptional level through the nucleoid-associated proteins H-NS and Fis, and 413
translationally by protease ClpX (Calhoun and Kwon, 2010), a protein also identified in 414
this study. 415
Our study describes the first proteomic analysis of C. violaceum and will 416
certainly provide the basis for a more extensive proteomic analysis of the metabolism of 417
this bacterium in order to obtain further knowledge of biotechnology products. 418
419
Experimental procedures 420
Bacterial strains and growth conditions 421
The C. violaceum strain ATCC 12472 was used to establish a 2-D reference 422
map. The bacterium was cultured aerobically in LuriaBertani (LB) broth (0.5 % yeast 423
extract, 1 % tryptone, 0.5 % NaCl) at 28 C with 180 rpm agitation in a shaking 424
incubator, for approximately 16 h. 425
426
Cell growth and preparation of dry cell powder 427
Cultures were diluted at proportion 1:10 and cultured until reaching the 428
exponential phase of growth (OD
600
of 0.6 0.8). The preparation of the cells was based 429
on the protocol described by Wang and colaborators (2003) with modifications. Cells 430
were harvested by centrifugation (2.300 x g; 4 C; 15 min) and then stocked at 80 C. 431
46

The pellet was placed in microtubes (0.10.2 g cells per 2.0 mL microtube) and then 432
resuspended in 2.0 mL cold acetone. After vortexing thoroughly for 30 s, the tubes were 433
centrifuged at 10 000 x g for 3 min at 4 C. The resultant pellet was washed once more 434
with the same volume of cold acetone. After centrifugation, the pellet was dried at room 435
temperature for approximately 20 min. The dried powder was washed three or four 436
times with 10% TCA in acetone until the supernatant was colorless. At every step of the 437
protocol described above, the pellet was completely resuspended by sonication (5 pulses 438
of 5 s each, 40% output, with 10 s intervals) on an Ultrasonic processor (Gex 130, 130 439
W), and then centrifuged at 10 000 x g for 3 min at 4 C (Pirovani et al., 2008). Finally, 440
the powder was washed once in 10% TCA in water and sonicated (5 pulses of 5 s each, 441
70% output, with 10 s intervals), and then washed once in 80% acetone. The final pellet 442
was dried at room temperature and used for protein extraction. 443
444
Protein extraction 445
Protein extraction was based on the protocol described by Wang et al (2003). 446
The final pellet was dried and dissolved in a 2-D rehydration solution (7 M urea, 2 M 447
thioureia, 2% CHAPS, 0.002 % bromophenol blue). The protein concentration was 448
determined using the 2-D Quant kit (GE Healthcare) and done in triplicate. 449
450
Two-dimensional poliacrilamide gel electrophoresis 451
2-D was performed using the immobiline/polyacrylamide system. IEF was 452
performed on an Ettan IPGphor system (GE Healthcare) with 13 cm Immobiline 453
DryStrip (pH 310; GE Healthcare). Protein samples were diluted to a final 454
concentration of 300 g in 250 L of 2-D rehydratation solution (7 M urea, 2 M 455
thioureia, 2% CHAPS w/v, 0.5% v/v IPG buffer pH 3-10, 7 mg DTT and 0.002% 456
bromophenol blue w/v) and applied on DryStrips using the in-gel sample rehydratation 457
technique according to the manufacturers instructions. The rehydration was performed 458
for 12 h at 20 C with no voltage. Isoeletric focusing was then performed by a voltage 459
gradient initiating with 500 V for 1 h, 1000 V for 1:04 h, 8000 V for 2:30 h and 8000 V 460
for 22 min. After focusing, each strip was equilibrated for 15 min in 6 mL equilibration 461
buffer (6 M urea, 2% SDS w/v, 29.3% glycerol v/v, 75 mM Tris-Cl pH 8.8 and 0.002% 462
bromophenol blue w/v) supplemented with 60 mg DTT and then, in 6 mL equilibration 463
buffer, supplemented with 150 mg iodoacetamide for another 15 min. The second 464
dimension was performed on a 12.5% polyacrylamide gel in a Ruby SE600 System (GE 465
47

Healthcare): 15 min at 10 mA/gel, 20-30 min at mA/gel and 150 min at 50 mA/gel, at a 466
constant temperature of 14 C. The Low Molecular Weight Calibration Kit for SDS 467
Electrophoresis (Amersham Biociensce) was used to provide standards. Extraction and 468
gel electrophoresis were run in biological triplicate. After electrophoresis, proteins were 469
visualized with 0.1% w/v colloidal Coomassie G 250 (Neuhoff et al., 1988) and 470
unstained with double deionized water. Gel scanning was carried out using an 471
ImageScanner II device. For spot selection, image and statistical analysis the 472
ImageMaster 2D Platinum v6.0 sofware was used (GE Healthcare). 473
474
In-gel protein digestion and nano ESI-TOF MS/MS analysis 475
The spots were excised and distained with 200 L of NH
4
HCO
3
50 mM in 50% 476
acetonitrile. The supernatant was discarded and the gel fragments were dehydrated with 477
100 L of 100% acetonitrile for 5 min and vacuum-dried for 10 min. The gel pieces 478
were rehydrated with 4 L of trypsin (25 ng/ ]L) and then 25 mM NH
4
HCO
3
was 479
added until they were covered. Digestion was carried out at 37 C for 12 h. The peptide- 480
containing supernatant was recovered and the gel pieces washed with 50% acetonitrile 481
containing 0.1% formic acid by vortexing for 15 min. The supernatant was recovered 482
and joined with the supernatant from the first washing. The volume was vacuum- 483
adjusted to 10 L in a SpeedVac. 484
The tryptic peptides were separated in a nanoAcquity UPLC ESI (Waters MA, 485
USA) equipped with a Strong Cation Exchange (SCX) column 5 m, 180 m x 20 mm 486
in combination with a BEH300 C18 column 1.7 100 m x 100 mm (Waters, MA, 487
USA.). Mobile phase (A) consisted of 0.1% formic acid (FA) in ultrapure water and 488
mobile phase (B) consisted of 0,1% FA in acetonitrile (ACN). The mobile phase 489
gradient was programmed as follows: 1-50% B for 40 min, with a flow rate of 0.6 490
L/min, then from 50.0 - 85.0% B for 5 min, holding for 2 min, then from 85 -1% B in 491
3 min, in a total running time of 50 minutes. The column was re-equilibrated to the 492
inicial conditions for 10 min. Column temperature was maintained at 35 C. The UPLC 493
system was in line with a Q-TOF-Micro (Waters, MA USA) . The lock mass used was 494
derived from phosphoric acid, delivered by the auxiliary pump of the nanoAcquity to 495
reference sprayer of the NanoLockSpray source of the mass spectrometer. 496
Peptides were ionized under 3000 V, fragmented with collision energy range 497
from 20 to 95 eV according to m/z of the peptides. All analyses were performed using 498
positive nanoelectrospray ion mode. The MS settings used were the following: mass 499
48

range, 2002000 m/z; MS/MS, m/z 50-2000. The minimum relative intensity was set to 500
10 counts, and the 3 most intense ions in each scan (1 s) were analyzed. 501
502
Protein identification 503
The spectra with the fragmentation patterns were analyzed in the software 504
ProteinLynx Global Server 2.4 (Waters) and the MS and MS/MS spectra were searched 505
against the Swissprot databank using the MASCOT 2.1. Search parameters were, 506
maximumone site-missed cleavage, carbamidomethylation of cysteine and 507
maximalmass error of 0.3 Da. 508
509
In silico analysis 510
For in silico plotting of 2-D gel of C. violaceum proteins the J VirGel 2.0 511
software was used (Hiller et al., 2006). The proteins identified by MS were classified 512
according to the Clusters of Orthologous Groups (COG) based on functional categories, 513
according to the database (http://www.ncbi.nlm.nih.gov/COG/) (Tatusov et al., 1997). 514
The software PSORTb v.2.0 (Gardy et al., 2005) has been used for prediction of sub- 515
cellular localization, whereas the Basic Local Alignment Search Tool (Blast) 516
(http://Blast.ncbi.nlm.nih.gov/Blast.cgi) has been employed for comparison between 517
hypothetical and/or conserved hypothetical ORFs and the sequences stored in the 518
database of the NCBI. Comparative sequence analysis was held using the ClustalW 519
software (Thompson et al., 1994) and visualization was conducted using BioEdit v 520
7.0.8. The prediction of operons was performed using the software MicrobesOnline 521
Operon Predictions (Price et al., 2005), and the analysis of interaction networks was 522
made using the software STRING 9.0 (http://string-db.org/); finally, the visualization of 523
the conserved domains was performed using the conserved domain database (CDD) 524
(http://www.ncbi.nlm.nih.gov/cdd). 525
526
Acknowledgements 527
528
Labotatrio de Protemica (UESC) is supported by the Conselho Nacional de 529
Desenvolvimento Cientfico e Tecnolgico (CNPq, Brazil), the Fundao de Amparo 530
Pesquisa da Bahia (FAPESB, Brazil), and the Financiadora de Estudos e Projetos 531
(FINEP, Brazil). The work of VKS Medeiros was supported by the CNPq, Brazil. We 532
49

thank Dr. Martin Brendel (UESC, Ilhus-BA, Brazil) for critical reading of the 533
manuscript. 534
535
References Cited 536
537
Angelidis, A. S., Smith, L. T., Hoffman, L. M. and Smith, G. M. (2002) Identication of 538
OpuC as a chill-activated and osmotically activated carnine transporter in Listeria 539
monocytogenes. Appl Environ Microbiol 68: 26442650. 540
541
Antonisamy, P., Kannan, P. and Ignacimuthu, S. (2009) Anti-diarrhoeal and ulcer 542
protective effects of violacein isolated from Chromobacterium violaceum in Wistar 543
rats. Fundam Clin Pharm 23: 483-490. 544
545
Antonisamy, P. and Ignacimuthu, S. (2010) Immunomodulatory, analgesic and 546
antipyretic effects of violacein isolated from Chromobacterium violaceum. 547
Phytomedicine 17: 300-304. 548
549
Aschtgen, M.S., Bernard, C.S., De Bentzmann, S., Lloubs, R. and Cascales, E. (2008) 550
SciN is an outer membrane lipoprotein required for type VI secretion in 551
enteroaggregative Escherichia coli. J Bacteriol 190: 7523-7531. 552
553
Azevedo, J .S., Silva-Rocha, R., Silva, A., Carepo, M.S.P. and Schneider, M.P.C. (2008) 554
Gene expression of the arsenic resistance operon in Chromobacterium violaceum 555
ATCC 12472. Can J Microbiol 2008 54:137-42. 556
557
Bockelmann, W. (1995) The proteolytic system of starter and nonstarter bacteria: 558
components and their importance for cheese ripening. Int Dairy J 5: 977994. 559
560
Booth, I. R. and Louis, P. (1999) Managing hyperosmotic stress: aquaporins and 561
mechanosensitive channels in Escherichia coli. Curr Opin Microbiol 2: 166169. 562
563
Brito, C.F., Carvalho, C.B., Santos, F., Gazzinelli, R.T., Oliveira, S.C., Azevedo, V. and 564
Teixeira, S.M.R. (2004) Chromobacterium violaceum genome: molecular 565
50

mechanisms associated with pathogenicity. Genet Mol Res 3: 148161. 566
567
Brown, E.D. (2005) Conserved P-loop GTPases of unknown functionin bacteria: an 568
emerging and vital ensemble in bacterial physiology. Biochem. Cell Biol 83: 738 569
746. 570
571
Calhoun, L.N. and Kwon, Y.M. (2010) Structure, function and regulation of the DNA- 572
binding protein Dps and its role in acid and oxidative stress resistance in Escherichia 573
coli: a review. J Appli Microbiol 110: 375386. 574
575
Callaghan, A.J ., Aurikko, J .P., Ilag, L.L., Gunter Grossmann, J ., Chandran, V., et al. 576
(2004) Studies of the RNA degradosome-organizing domain of the Escherichia coli 577
ribonuclease RNase E. J Mol Biol 340: 965979. 578
579
Callaghan, A.J ., Marcaida, M.J ., Stead, J .A., McDowall, K.J ., Scott, W.G. and Luisi, 580
B.F. (2005) Structure of Escherichia coli RNase E catalytic domain and implications 581
for RNA turnover. Nature 437: 11871191. 582
583
Carepo, M.S.P., Azevedo, J .S.N., Porto, J .I.R., Bentes-Sousa, A.R., Silva Batista, J ., 584
Silva, A.L.C. and Schneider, M.P.C. (2004) Identidication of Chromobacterium 585
violaceum genes with potential biotechnological application in environmental 586
detoxification. Genet Mol Res 3: 181-194. 587
588
Carpousis, A.J . (2007) The RNA degradosome of Escherichia coli: an mRNA- 589
degrading machine assembled on RNase E. Annu Rev Microbiol 61: 7187. 590
591
Carpousis, A. J., Luisi, B. F. and McDowall, K. J . (2009) Endonucleolytic initiation of 592
mRNA decay in Escherichia coli. Prog Mol Biol Transl Sci 85: 91135. 593
594
Cascales, E. (2008) The type VI secretion toolkit. EMBO reports 9: 735-741. 595
596
Cipollone, R., Ascenzi, P. and Visca, P. (2007) Common themes and variations in the 597
rhodanese superfamily. IUBMB Life 59: 51-59. 598
599
51

Charbonnel, P., Lamarque, M., Piard, J .C., Gilbert, C., J uillard, V. and Atlan, D. (2003) 600
Diversity of oligopeptide transport specificity in Lactococcus lactis species. A tool to 601
unravel the role of OppA in uptake specificity. J Biol Chem 278: 14832-14840. 602
603
Das, S., Chakrabortty, A., Banerjee, R. and Chaudhuri, K. (2002) Involvement of in 604
vivo induced icmF gene of Vibrio cholerae in motility, adherence to epithelial cells, 605
and conjugation frequency. Biochem Biophys Res Commun 295: 922-928. 606
607
Das, G. and Varshney, U. (2006) Peptidyl-tRNA hydrolase and its critical role in 608
protein biosynthesis. Microbiology 152: 21912195. 609
610
Deutscher, M. P. (2006) Degradation of RNA in bacteria: comparison of mRNA and 611
stable RNA. Nucleic Acids Res 34: 659666. 612
613
Durn, N. and Menck, C.F.M. (2001) Chromobacterium violaceum: a review of 614
pharmacological and industrial perspectives. Crit Rev Microbiol 27:201-222. 615
616
Gardan, R., Besset, C., Guillot, A., Gitton, C. and Monnet, V. (2009) The oligopeptide 617
transport system is essential for the development of natural competence in 618
Streptococcus thermophilus strain LMD-9. J Bacteriol 191: 4647-4655. 619
620
Gardy, J .L., Laird, M.R., Chen, F., Rey, S., Walsh, C.J ., Ester, M. and Brinkman, F.S. 621
(2005) PSORTb v.2.0: expanded prediction of bacterial protein subcellular 622
localization and insights gained from comparative proteome analysis. Bioinformatics 623
21: 617-623. 624
625
Garrity, G.M., Winters, M. and Searles, D.B. (2001) Taxonomic outline of the 626
prokaryotic genera, Bergeys Manual of Systematic Bacteriology. 2a ed. New York: 627
Springer-Verlag, pp. 1-39. 628
629
Gominet, M., Slamti, L., Gilois, N., Rose, M. and Lereclus, D. (2001). Oligopeptide 630
permease is required for expression of the Bacillus thuringiensis plcR regulon and for 631
virulence. Mol Microbiol 40: 963975. 632
633
52

Gourson, C., Benhaddou, R., Granet, R., Krausz, P., Verneuil, B., and Branland, P. 634
(1999) Valorization of maize bran to obtain biodegradable plastic films. J Appl Polym 635
Sci 74: 30403045. 636
637
Hiller, K., Grote, A., Maneck, M., Mnch, R. and J ahn, D. (2006) J VirGel 2.0: 638
computational prediction of proteomes separated via two-dimensional gel 639
electrophoresis under consideration of membrane and secreted proteins. 640
Bioinformatics 22: 2441-2443. 641
642
Hoffmann, A., Bukau, B. and Kramer, G. (2010) Structure and function of the 643
molecular chaperone Trigger Factor. Biochim et Biophys Acta 1803: 650661 644
645
Enos-Berlage, J .L., Guvener, Z.T., Keenan, C.E. and McCarter, L.L. (2005) Genetic 646
determinants of biofilm development of opaque and translucent Vibrio 647
parahaemolyticus. Mol Microbiol 55: 1160-82. 648
649
Faramarzi, M.A., Stagars, M., Pensini, E., Krebs, W. and Brandl, H. (2004) Metal 650
solubilization from metal-containing solid materials by cyanogenic Chromobacterium 651
violaceum. J Biotechnol 113: 321-326. 652
653
Filloux, A. (2009) The type VI secretion system: a tubular story. EMBO J 28: 309-310. 654
655
Flores-Valdez, M.A. Morris, R.P., Laval, F., Daffe, M. and Schoolnik, G.K. (2009) 656
Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease 657
(Opp) transport system. FASEB J 23: 4091-4104. 658
659
Fournier, B., Klier, A. and Rapoport, G. (2001) The two-component system 660
ArlS-ArlR is a regulator of virulence gene expression in Staphylococcus 661
aureus. Mol Microbiol 41: 247261. 662
663
Kempf, B. and Bremer, E. (1998) Uptake and synthesis of compatible solutes as 664
microbial stress responses to high osmolality environments. Arch Microbiol 170: 665
319330. 666
667
53

Kita, Y., Nishikawa, H. and Takemoto, T. (2006) Effects of cyanide and dissolved 668
oxygen concentration on biological Au recovery. J Biotechnol 124: 545-551. 669
670
Lazazzera, B. A. (2001). The intracellular function of extracellular signaling 671
peptides. Peptides 22: 15191527. 672
673
Leipe, D.D., Wolf, Y.I., Koonin, E.V. and Aravind, L. (2002) Classification and 674
evolution of P-loop GTPases and related ATPases. J Mol Biol 317: 41-72. 675
676
Marchler-Bauer, A., Lu, S., Anderson, J .B., Chitsaz, F., Derbyshire, M.K., DeWeese- 677
Scott, C., et al. (2011) CDD: a Conserved Domain Database for the functional 678
annotation of proteins. Nucleic Acids Res 39: 225-229. 679
680
McDougald, D., Rice, S.A. and Kjelleberg, S. (2007) Bacterial quorum sensing and 681
interference by naturally occurring biomimics. Anal Bioanal Chem 387: 445453. 682
683
Neuhoff, N.V., Taube, A.D. and Ehrhardt, W. (1998) Improved staining of proteins in 684
polyacrylamide gels including isoelectric focusing gels with clear background at 685
nanogram sensitivity using Coomassie Brilliant Blue G-250 and R-250. 686
Electrophoresis 9: 255262. 687
688
Park, J .T., Raychaudhuri, D., Li, H., Normark, S. and Mengin-Lecreulx, D. (1998). 689
MppA, a periplasmic binding protein essential for import of the bacterial cell wall 690
peptide L-alanyl-gamma-D-glutamyl-meso-diaminopimelate. J Bacteriol 180:1215 691
1223. 692
693
Pirovani, C.P., Carvalho, H.A., Machado, R.C., Gomes, D.S., Alvim, F.C., Pomella 694
A.W. et al. (2008) Protein extraction for proteome analysis from cacao leaves and 695
meristems, organs infected by Moniliophthora perniciosa, the causal agent of the 696
witches' broom disease. Electrophoresis 29: 2391-2401. 697
698
Price, M.N., Huang, K.H., Alm, E.J . and Arkin, A.P. (2005) A novel method for 699
accurate operon predictions in all sequenced prokaryotes. Nucleic Acids Res 33: 880- 700
892. 701
54

702
Pukatzki, S., McAuley, S.B., Miyata, S.T. (2009) The type VI secretion system: 703
translocation of effectors and effector-domains. Curr Opin Microbiol 12: 11-17. 704
705
Recouvreux, D.O.S., Carminatti, C.A., Pitlovanciv, A.K., Rambo, C.R., Porto, L.M. and 706
Antnio, R.V. (2008) Cellulose Biosynthesis by the Beta-Proteobacterium, 707
Chromobacterium violaceum. Curr Microbiol 57: 469476. 708
709
Rodgers, P.B. (1982) Cyanide metabolism and -cyanoalanine formation by washd, 710
nonproliferating cultures of Chromobacterium violaceum. J Gen Microbiol 128: 711
2983-2989. 712
713
Saier, M.H. J r., Yen, M.R., Noto, K., Tamang, D.G., Elkan, C. (2009) The Transporter 714
Classification Database: recent advances. Nucl. Acids Res 37: D274-8. 715
716
Slamti, L. and Lereclus, D. (2002) A cell-cell signaling peptide activates the PlcR 717
virulence regulon in bacteria of the Bacillus cereus group. EMBO J 21: 45504559. 718
719
Stauff, D.L. and Bassler, B.L. (2011) Quorum Sensing in Chromobacterium violaceum: 720
DNA Recognition and Gene Regulation by the CviR Receptor. J Bacteriol 193: 3871- 721
3878. 722
723
Tatusov, R.L., Koonin, E.V. and Lipman, D.J . (1997) A genomic perspective on protein 724
families. Science 278: 631-637. 725
726
Teplyakov, A., Obmolova, G., Chu, S.Y., Toedt, J ., Eisenstein, E., Howard, A.J . and 727
Gilliland, G.L. (2003) Crystal Structure of the YchF Protein Reveals Binding Sites for 728
GTP and Nucleic Acid. J of Bacteriol 7: 40314037. 729
730
Theriot, C.M., Tovea, S.R. and Grunden, A.M. (2009) Biotechnological applications of 731
recombinant microbial prolidases. Adv Appl Microbiol 68: 99-132. 732
733
Theriot, C.M., Du, X., Tove, S.R. and Grunden, A.M. (2010) Pyrococcus prolidases for 734
detoxification of organ ophosphorus nerve agents over a broad range of temperatures 735
55

Appl Microbiol Biotechnol 87: 1715 1726. 736
737
Thompson, J .D., Higgins, D.G. and Gibson, T.J . (1994) CLUSTAL W: improving the 738
sensitivity of progressive multiple sequence alignment through sequence weighting, 739
position specific gap penalties and weight matrix choice. Nucleic Acids Res 22: 4673- 740
4680. 741
742
Tomar, S.K., Kumar, P. and Prakash, B. (2011) Deciphering the catalytic machinery in 743
a universally conserved ribosome binding ATPase YchF. Biochem Biophys Res 744
Commun 408: 459464. 745
746
Ueta, M., Yoshida, H., Wada, C., Baba, T., Mori, H., and Wada, A. (2005) Ribosome 747
binding proteins YfiA and YhbH have opposite functions during 100S formation in 748
the stationary phase of Escherichia coli . Genes Cells 10: 110312. 749
750
Vasconcelos, A.T.R., Almeida, D.F., Hungria, M., Guimares, C.T., Antnio, R.V., 751
Almeida, F.C., et al. (2003) The complete genome of Chromobacterium violaceum 752
reveals remarkable and exploitable bacterial adaptability. Proc Natl Acad Sci USA 753
100: 11660-11665. 754
755
Wada, A., Kazuei, I., Yoshimura, S., Aimoto, S. & Ishihama, A. (1995) Ribosome 756
modulation factor: stationary growth phase-specific inhibitor of ribosome functions 757
from Escherichia coli. Biochem Biophis Res Commun 214: 410-417. 758
759
Wang, W., Scali, M., Vignani, R., Spadafora, A., Sensi, E., Mazzuca, S. and Cresti, M. 760
(2003) Protein extraction for two-dimensional electrophoresis from olive leaf, a plant 761
tissue containing high levels of interfering compounds. Electrophoresis 24: 236-375. 762
763
Wang, C. H., Lin, C.Y., Luo, Y.H., Tsai, P.J ., Lin, Y.S., Lin, M.T., et al. (2005) 764
Effects of oligopeptide permease in group a streptococcal infection. Infect Immun 73: 765
28812890. 766
767
Weber B, Hasic M, Chen C, Wai SN, Milton DL. (2009) Type VI secretion modulates 768
quorum sensing and stress response in Vibrio anguillarum. Environ Microbiol 11: 769
56

3018-3028. Epub 2009 J ul 14. 770
771
Welsh, D. T. (2000) Ecological signicance of compatible solute accumulation by 772
microorganisms: from single cells to global climate. FEMS Microbiol Rev 24: 263 773
290. 774
775
Wetherell, J ., Price, M. and Mumford, H. (2006) A novel approach for medical 776
countermeasures to nerve agent poisoning in the guineapig. Neurotoxicology 27: 485- 777
491. 778
779
Yang, M., J ohnson, A. and Murphy, T.F. (2011) Characterization and evaluation of the 780
Moraxella catarrhalis oligopeptide permease a as a mucosal vaccine antigen. Infect 781
Immun 79: 846857. 782
783
784
Tables 785
786
Table 1. List of C. violaceum ATCC 12472 proteins identified by MS. Hypothetical 787
and/or conserved hypothetical proteins are highlighted in red. 788
Spot ID ORF
Number
Gene Protein Description Cellular location
Metabolism
C - Energy production and conversion
3 CV1074 lpdA2 Dihydrolipoamide dehydrogenase Cytoplasmic
5 CV2543 narG Respiratory nitrate reductase alpha chain Cytoplasmic Membrane
7 CV1137 adhE Bifunctional acetaldehyde-CoA/alcohol dehydrogenase Unknown
a

8, 10 CV0526 aceE Pyruvate dehydrogenase Cytoplasmic
13a, 18,
29a
CV1412 pflB Formate C-acetyltransferase Cytoplasmic
15 CV0947 nuoG NADH dehydrogenase subunit G Cytoplasmic
a

23c, 52 CV0670 atpA F0F1 ATP synthase subunit alpha Cytoplasmic
24a CV1530 pta Phosphate acetyltransferase Cytoplasmic
27, 60,
140c
CV0528 lpdA1 Dihydrolipoamide dehydrogenase Cytoplasmic
14, 34a,
36
CV0916 maeB NADP-dependent malate dehydrogenase Cytoplasmic
57

42 CV1067 sdhA Succinate dehydrogenase, flavoprotein subunit Cytoplasmic Membrane
53, 155 CV2019 - Probable aldehyde dehydrogenase Cytoplasmic
57 CV1499 astD Succinylglutamate 5-semialdehyde dehydrogenase Cytoplasmic
58,
139a
CV0672 atpD H+-transporting two-sector ATPase, beta subunit Cytoplasmic
a

62 CV2056 prpC Citrate synthase 2 Cytoplasmic
65c CV0944 nuoD NADH-ubiquinone oxidoreductase, chain D Cytoplasmic
a

69a CV1531 ackA acetate kinase Cytoplasmic
73b CV1075 sucC succinyl-CoA synthetase, beta subunit Cytoplasmic
89, 90 CV1062 mdh Malate dehydrogenase Unknown
120 CV3372 ppa Inorganic diphosphatase Cytoplasmic
132 CV3817 - Probable electron transfer flavoprotein alpha subunit Unknown
134a CV1068 sdhB Succinate dehydrogenase iron-sulfur protein Cytoplasmic Membrane
151a CV0943 nuoC NADH-ubiquinone oxidoreductase, chain C Cytoplasmic
a

156a CV0673 atpC H+-transporting two-sector ATPase, epsilon subunit Cytoplasmic
a

E - Amino acid transport and metabolism
4 CV4038 gltB Glutamate synthase subunit alpha Cytoplasmic
26 CV0876 prlC Oligopeptidase A Cytoplasmic
29b CV2876 speA Arginine decarboxylase Unknown
a

33 CV4329 oppA Probable oligopeptide ABC transporter system, substrate-
binding protein
Periplasmic

41 CV0144 edd Phosphogluconate dehydratase Cytoplasmic
48a CV0130 - Probable Xaa-Pro aminopeptidase Cytoplasmic
55a CV2694 pepD Aminoacyl-histidine dipeptidase precursor Cytoplasmic
61a CV1286 glyA Glycine hydroxymethyltransferase Cytoplasmic
64b, 65a,
68a
CV3782 arcA Arginine deiminase Cytoplasmic
67, 70a,
73a, 78a,
108,
127a,
127b,
139b,
149, 150a
CV4188 tufA Translation elongation factor Tu Cytoplasmic
69b CV1197 - Probable ABC-type proline/glycine betaine transport
systems, ATPase component
Cytoplasmic Membrane
77 CV1498 astA arginine N-succinyltransferase Cytoplasmic
80 CV0588 ilvC ketol-acid reductoisomerase Cytoplasmic
83a CV1497 aruF Arginine N-succinyltransferase Cytoplasmic
91 CV2094 ilvE Branched-chain-amino-acid transaminase Cytoplasmic
58

93 CV3780 arcC Carbamate kinase Cytoplasmic
95 CV0490 speB Agmatinase Cytoplasmic
96 CV3561 cysK cysteine synthase Cytoplasmic
104 CV3587 aroE Shikimate 5-dehydrogenase Cytoplasmic
133b CV0450 dapD 2,3,4,5-tetrahydropyridine-2-carboxylate N-
succinyltransferase
Cytoplasmic
138b CV2983 - Probable amino acid ABC transporter, periplasmic-binding
protein
Periplasmic
153 CV3578 dapA Dihydrodipicolinate synthase Cytoplasmic
F - Nucleotide transport and metabolism
40c CV3457 pyrG CTP synthase Cytoplasmic
64a,
65b,
68b
CV3700 deoA Thymidine phosphorylase Cytoplasmic
106,
133a
CV3343 adk Adenylate kinase Cytoplasmic
110,
129a
CV3698 deoD Purine nucleoside phosphorylase Cytoplasmic
114 CV3542 ndk Nucleoside-diphosphate kinase Extracellular
122 CV3900 hpt Hypoxanthine phosphoribosyltransferase Cytoplasmic
126 CV3894 - Probable purine-nucleoside phosphorylase Cytoplasmic
148a CV3551 pydA Dihydroorotate oxidase Cytoplasmic
G - Carbohydrate transport and metabolism
11 CV3709 ppsA Phosphoenolpyruvate synthase Cytoplasmic
41 CV0144 edd Phosphogluconate dehydratase Cytoplasmic
46 CV0249 pykF Pyruvate kinase Cytoplasmic
47 CV0149 pgi2 Glucose-6-phosphate isomerase Cytoplasmic
50, 85a CV3038 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase Cytoplasmic
59a CV0145 zwf Glucose-6-phosphate 1-dehydrogenase Cytoplasmic
74 CV0189 pgk phosphoglycerate kinase Cytoplasmic
75 CV1745 pfkA 6-phosphofructokinase Cytoplasmic
81, 82b CV0560 gapA Glyceraldehyde-3-phosphate dehydrogenase Cytoplasmic
82a CV0187 agaY fructose-bisphosphate aldolase Cytoplasmic
85b CV4035 - Probable nucleotide sugar dehydratase Cytoplasmic
117 CV1260 rpiA Ribose 5-phosphate isomerase A Cytoplasmic
130 CV0143 eda 2-dehydro-3-deoxy-phosphogluconate aldolase Cytoplasmic
135a CV0112 glpR1 Glycerol-3-phosphate regulon repressor Cytoplasmic
H - Coenzyme transport and metabolism
80 CV0588 ilvC ketol-acid reductoisomerase Cytoplasmic
91 CV2094 ilvE Branched-chain-amino-acid transaminase Cytoplasmic
59

137 CV0884 - hypothetical protein Unknown
152a CV1588 nadC Nicotinate-nucleotide pyrophosphorylase Cytoplasmic
I - Lipid transport and metabolism
16 CV2720 fadB 3-hydroxyacyl-CoA dehydrogenase Cytoplasmic
56 CV0985 accC biotin carboxylase protein Cytoplasmic
94 CV3190 accA Acetyl-CoA carboxylase carboxyl transferase subunit
alpha
Cytoplasmic
99 CV1583 fabL Enoyl-[acyl-carrier-protein] reductase (NADH) Cytoplasmic Membrane
135b CV1763 - Probable enoyl-CoA hydratase Cytoplasmic
154 CV3183 fadL Long-chain fatty acid transport protein precursor Outer Membrane
P - Inorganic ion transport and metabolism
20 CV1491 - probable outer membrane receptor Outer Membrane
33 CV4329 oppA Probable oligopeptide ABC transporter system, substrate-
binding protein
Periplasmic
35 CV3573 cysI Sulfite reductase hemoprotein, beta subunit Cytoplasmic
113 CV2504 sodB1 Superoxide dismutase, iron Periplasmic
146b CV3588 - Conserved hypothetical protein Cytoplasmic
Q: Secondary metabolites biosynthesis, transport and catabolism
83b CV0971 - Probable fumarylacetoacetate hydrolase Unknown
109 CV2364 phaB Acetoacetyl-CoA reductase Cytoplasmic
118 CV3414 fabG1 3-oxoacyl-(acyl-carrier-protein) reductase Cytoplasmic
Information storage and processing
J - Translation, ribosomal structure and biogenesis
1 CV1820 - Probable ribonuclease E Cytoplasmic
9 CV0505 leuS Leucyl-tRNA synthetase Cytoplasmic
13b,
55b,
152b
CV4189 fusA Elongation factor G (EF-G) Cytoplasmic
17, 19 CV1466 pnp Polynucleotide phosphorylase/polyadenylase Cytoplasmic
23a,
140b
CV1206 metG Methionyl-tRNA synthetase Cytoplasmic
23b,
24b,
140a
CV1656 glyS Glycyl-tRNA synthetase, beta chain Cytoplasmic
25 CV0574 proS Prolyl-tRNA synthetase Cytoplasmic
28 CV3740 aspS Aspartyl-tRNA synthetase Cytoplasmic
30 CV1348 thrS Threonyl-tRNA synthetase Cytoplasmic
37, 39,
128
CV3046 rpsA 30S ribosomal protein S1 Cytoplasmic
38 CV1742 glnS Glutaminyl-tRNA synthetase Cytoplasmic
60

40a, 44,
45
CV1060 lysS Lysyl-tRNA synthetase Cytoplasmic
40b CV1962 argS Arginyl-tRNA synthetase Cytoplasmic
59b CV1937 gltX Glutamyl-tRNA synthetase Cytoplasmic
67, 70a,
73a, 78a,
108,
127a,
127b,
139b,
149, 150a
CV4188 tufA Translation elongation factor Tu Cytoplasmic
63b CV4289 proA glutamate-5-semialdehyde dehydrogenase Cytoplasmic
77 CV1498 astA arginine N-succinyltransferase Cytoplasmic
84 CV1352 pheS Phenylalanyl-tRNA- synthetase alpha chain V Cytoplasmic
88 CV4183 rplB 50S ribosomal protein L2 Cytoplasmic
92,
148b
CV2197 tsf Elongation factor Ts (EF-Ts) Cytoplasmic
98 CV2196 rpsB 30S ribosomal protein S2 Cytoplasmic
101 CV1378 efp elongation factor EF-P Cytoplasmic
103 CV2397 Map1 Methionyl aminopeptidase Cytoplasmic
105a CV4185 rplD 50S ribosomal protein L4 Cytoplasmic
115,
131
CV3637 rplI 50S ribosomal protein L9 Cytoplasmic
116,
132
CV3640 rpsF 30S ribosomal protein S6 Cytoplasmic
125 CV2199 frr Ribosome recycling factor Cytoplasmic
138a CV4196 rplA 50S ribosomal protein L1 Cytoplasmic
141a CV3672 rplS 50S ribosomal protein L19 Cytoplasmic
141b CV4172 rpsH 30S ribosomal protein S8 Cytoplasmic
141c CV3696 rpsI 30S ribosomal protein S9 Cytoplasmic
142 CV0849 rpmA 50S ribosomal protein L27 Cytoplasmic
143b CV4190 rpsG 30S ribosomal protein S7 Cytoplasmic
143a CV4169 rpsE 30s ribosomal protein S5 Cytoplasmic
145 CV3333 - Probable sigma-54 modulation protein Cytoplasmic
L - Replication, recombination and repair
78b CV3548 rdgC Recombination associated protein RdgC Cytoplasmic
156b CV4253 dps DNA-biding stress protein Cytoplasmic
K Transcription
2 CV4193 rpoB DNA-directed RNA polymerase, beta subunit Cytoplasmic
61b CV1585 rho Transcription termination factor rho Cytoplasmic
61

76 CV4160 rpoA DNA-directed RNA polymerase (alpha subunit) Cytoplasmic
107 CV3107 ompR Transcriptional regulatory protein ompR Cytoplasmic
121b CV3384 greB Transcription elongation factor GreB Cytoplasmic
123 CV4198 nusG Transcription antitermination protein NusG Cytoplasmic
135a CV0112 glpR1 Glycerol-3-phosphate regulon repressor Cytoplasmic
Cellular processes and sinaling
D - Cell cycle control, cell division, chromosome partitioning
82c CV1204 mrp Mrp protein Cytoplasmic Membrane
M - Cell wall/membrane/envelope biogenesis
6 CV1431 - probable Rhs-family protein Unknown
12 CV2204 omp85 probable outer membrane protein Outer Membrane
31a CV3354 prc Carboxy-terminal processing protease Cytoplasmic Membrane
50, 85a CV3038 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase Cytoplasmic
85b CV4035 - probable nucleotide sugar dehydratase Cytoplasmic
105b CV3571 rmpM Outer membrane protein A precursor Unknown
131 CV2747 kdsA 2-dehydro-3-deoxyphosphooctonate aldolase Cytoplasmic
136 CV0758 - Hypothetical protein Outer Membrane
147b CV4229 IMP Organic solvent tolerance protein Outer Membrane
153 CV3578 dapA Dihydrodipicolinate synthase Cytoplasmic
79 CV3011 flaD flagellin D Extracellular (Flagellar)
O - Posttranslational modification, protein turnover, chaperones
21, 22,
32
CV1643 dnaK Heat shock protein DnaK; chaperone protein Cytoplasmic
31b CV2553 ppiD Probable peptidyl-prolyl cis-trans isomerase Cytoplasmic Membrane
34b CV1175 - Conserved hypothetical protein Cytoplasmic
43a CV1318 hptG Probable chaperone heat shock protein hptG Cytoplasmic
43b,
48b, 49
CV4014 groEL1 Chaperonin 60kD subunit Cytoplasmic
54 CV2559 tig Trigger factor Cytoplasmic
72 CV1645 dnaJ Heat shock protein dnaJ Cytoplasmic
97 CV2813 trxB Thioredoxin reductase Cytoplasmic
102 CV2036 - Probable peroxiredoxin/glutaredoxin family protein Unknown
111,
129b,
151b
CV3739 - Probable peroxidase Cytoplasmic
119 CV3185 - probable peptidyl-prolyl cis-trans isomerase Cytoplasmic
121a CV1642 grpE Heat shock protein GrpE Cytoplasmic
127a CV0234 pcm2 Protein-L-isoaspartate(D-aspartate) O-methyltransferase Cytoplasmic
133c CV1413 pflA Pyruvate formate lyase activating enzyme Cytoplasmic
146a, CV4015 groES1 Chaperonin 10kD subunit Cytoplasmic
62

147a
150b CV2557 clpX ATP-dependent Clp protease ATP-binding subunit ClpX Cytoplasmic

T: Signal transduction mechanisms
107 CV3107 Transcriptional regulatory protein ompR Cytoplasmic
134b CV3647 - Probable transcription regulator protein, Crp/Fnr family Cytoplasmic
Poorly characterized
R: General function prediction only
43c, 86,
87
CV3360 - Probable ABC transporter ATP-binding protein Cytoplasmic
51 CV1683 hcnB hydrogen cyanide synthase HcnB Cytoplasmic
70b CV4055 - Conserved hypothetical protein Cytoplasmic
109 CV2364 phaB Acetoacetyl-CoA reductase Cytoplasmic
118 CV3414 fabG1 3-oxoacyl-(acyl-carrier-protein) reductase Cytoplasmic
124 CV3977 - Conserved hypothetical protein Extracellular
S: Function unknown
100 CV3850 - conserved hypothetical protein Cytoplasmic
144 CV3276 - conserved hypothetical protein Unknown
a: these proteins may have multiple location sites. 789
63

Table 2. Analysis of hypothetical proteins identified in the reference gel 790
Spot
ID
ORF Protein E-value Organism Protein Query
coverage
(%)
Sequence
Identity
(%)
01 52,
155
CV2019 probablealdehyde dehydrogenase 0.0 Lutiella
nitroferrum 2002
aldehyde dehydrogenase 100 80
02 132 CV3817 probableelectron transfer flavoprotein
alpha subunit
2e
-139
Lutiella
nitroferrum 2002
Electron transfer
flavoprotein alpha subunit
100 86
03 33 CV4329 probableoligopeptideABC transporter
system, substrate-binding protein
e
-120
* Salmonella
typhimurium
periplasmic oligopeptide-
binding protein precursor
96 44
04 48a CV0130 probableXaa-Pro aminopeptidase 0.0 Lutiella
nitroferrum 2002
Xaa-Pro dipeptidase 99 74
05 69b CV1197 probableABC-typeproline/glycinebetaine
transport systems, ATPasecomponent
e
-129
*

Pseudomonas
syringae pv.
Tomato
glycinebetaine/choline
OpuC ABC transporter,
ATP-binding protein
99 63
06 138 CV2983 probableamino acid ABC transporter,
periplasmic-binding protein
6e
-54
*

Bacillus subtilis Probableamino-acid ABC
transporter extracellular
binding protein yckK
precursor
90 45
07 126 CV3894 Probablepurine-nucleosidephosphorylase 6e
-74
Limnobacter sp.
MED105
5'-methylthioadenosine
phosphorylase
95 59
64

08 85b CV4035 Probablenucleotidesugar dehydratase 5e
-155
Pseudomonas
aeruginosa PA7
NAD-dependent
epimerase/dehydratase
100 83
09 137 CV0884 hypothetical protein 5e
-84
Laribacter
hongkongensis
HLHK9
hypothetical protein
LHK_02343
98 66
6e
-49
Rhodospirillum
rubrum ATCC
1170.
methyltransferase 96 46
10 135b CV1763 probableenoyl-CoA hydratase 9e
-112
Lutiella
nitroferrum 2002
Enoyl-CoA
hydratase/isomerase
99 79
11 20 CV1491 probableouter membranereceptor 3e
-165
Burkholderia
ambifaria AMMD
TonB-dependent receptor,
plug
95 45
12 146b CV3588 conserved hypothetical protein 4e
-54
Lutiella
nitroferrum 2002
Rhodanesedomain protein 100 66
9e
-49
Thauera sp. MZ1T Rhodanese 100 60
13 83b CV0971 probablefumarylacetoacetatehydrolase 3e
-147
Lutiella
nitroferrum 2002
fumarylacetoacetate(FAA)
hydrolase
100 80
14 1 CV1820 probableribonucleaseE 0.0 Lutiella
nitroferrum 2002
ribonuclease, Rne/Rng
family
73 75
15 145 CV3333 probablesigma-54 modulation protein 2e
-42
Lutiella
nitroferrum 2002
sigma54 modulation
protein/ribosomal protein
100 78
65

S30EA
16 6 CV1431 probableRhs-family protein 0.0 Burkholderia sp.
383
Rhs family protein 92 43
17 12 CV2204 probableouter membraneprotein 0.0 Lutiella
nitroferrum 2002
outer membraneprotein
assembly complex, YaeT
protein
100 74
18 136 CV0758 hypothetical protein 8e-22 C. violaceum
ATCC 12472
hypothetical protein
CV_1445
85 38
2e-12 Sideroxydans
lithotrophicus ES-1
OmpA domain protein
transmembraneregion-
containing protein
100 31
19 31b CV2553 probablepeptidyl-prolyl cis-trans
isomerase
2e
-169
Laribacter
hongkongensis
HLHK9
peptidyl-prolyl cis-trans
isomerase
98 51
2e
-119
Lutiella
nitroferrum 2002
PpiC-typepeptidyl-prolyl
cis-trans isomerase
55 62
20 34b CV1175 conserved hypothetical protein 0.0 Lutiella
nitroferrum 2002
peptidaseM61 domain
protein
98 73
21 43a CV1318 probablechaperoneheat shock protein
hptG
0.0 Lutiella
nitroferrum 2002
heat shock protein Hsp90 97 83
22 102 CV2036 probableperoxiredoxin/glutaredoxin 2e-
122
Lutiella glutaredoxin-family domain 100 84
66

family protein nitroferrum 2002 protein
23 111,
129b,
151b
CV3739 probableperoxidase 2e
-100
Lutiella
nitroferrum 2002
alkyl hydroperoxide
reductase/ Thiol specific
antioxidant/ Mal allergen
100 87
24 119 CV3185 probablepeptidyl-prolyl cis-trans
isomerase
5e
-76
Lutiella
nitroferrum 2002
peptidyl-prolyl cis-trans
isomerasecyclophilin type
100 84
25 134b CV3647 probabletranscription regulator protein,
Crp/Fnr family
9
-114
Lutiella
nitroferrum 2002
transcriptional regulator,
Crp/Fnr family
98 80
26 43c CV3360 putativeABC transporter ATP-binding
protein
3e
-71
*

Escherichia coli
(strain K12)
ABC transporter ATP-
binding protein uup
32
27 70b CV4055 conserved hypothetical protein 0.0 Laribacter
hongkongensis
HLHK9
GTP-dependent nucleic
acid-binding protein EngD
100 88
28 124 CV3977 conserved hypothetical protein 4e
-87
Lutiella
nitroferrum 2002
typeVI secretion system
effector, Hcp1 family
100 92
29 100 CV3850 conserved hypothetical protein 3e
-129
Lutiella
nitroferrum 2002
protein of unknown function
DUF1732
100 80
1e
-83
Neisseria subflava
NJ 9703
K+-transporting ATPase, F
subunit
98 58
30 144 CV3276 conserved hypothetical protein 4e
-77
Tolumonas auensis
DSM 9187
YceI family protein 100 73
*Blast pelo site TCDB 791
67

Table 3. Results of the analysis of hypothetical proteins that are probably situated in the operon. The proteins identified in the 792
reference gel are in bold. 793
ORF Protein E-
value
Organism Protein Query
coverage
Sequence
Identity (%)
CV3817 probable electron transfer flavoprotein
alpha subunit
2e
-139
Lutiella nitroferrum
2002
Electron transfer
flavoprotein alpha subunit
100 86
CV3818 probableelectron transfer flavoprotein,
beta subunit
1e
-124
Lutiella nitroferrum
2002
Electron transfer flavoprotein
alpha/beta-subunit
100 92
CV1196 probablebinding-protein-dependent
transport system
2e
-41
*

Pseudomonas syringae
pv. Tomato
Glycinebetaine/cholineOpuC
ABC transporter, permease
protein
79 48
CV1197 probable ABC-type proline/glycine
betaine transport systems, ATPase
component
e
-129
*

Pseudomonas syringae
pv. Tomato
glycine betaine/choline
OpuC ABC transporter,
ATP-binding protein
99 63
CV1195 probableABC transporter periplasmic
binding protein
1e
-64
*

Pseudomonas syringae
pv. Tomato
Glycinebetaine/cholineOpuC
ABC transporter, periplasmic
substrate-binding protein
72 47
CV1194 probableABC-typetransport system,
permeasecomponent
1e
-26
*


Bacillus subtilis Glycine
betaine/carnitine/choline
transport system permease
protein opuCB
67 41
CV2981 probablecystinetransport ATP-binding 2e
-61
* Bacillus subtilis Probableamino-acid ABC 93 49
68

protein transporter ATP-binding
protein yckI
CV2982 probableamino-acid transport system
permeaseABC transporter protein
2e
-42
*

Escherichia coli Inner membraneamino-acid
ABC transporter permease
protein yecS
94 44
CV2983 probable amino acid ABC transporter,
periplasmic-binding protein
6e
-54
*

Bacillus subtilis Probable amino-acid ABC
transporter extracellular
binding protein yckK
precursor
90 45
CV4027 hypothetical protein 7e
-21
Bacteroides sp. 20_3 hypothetical protein
HMPREF9008_04759
76 28
CV4029 conserved hypothetical protein 4e
-41
Pseudoalteromonas
tunicata D2
hypothetical protein
PTD2_12074
99 32
CV4030 probablesugar-phosphatenucleotide
transferase
4e
-107
Hahella chejuensis
KCTC 2396
nucleoside-diphosphate-sugar
pyrophosphorylase
98 57
CV4032 conserved hypothetical protein 5e
-22
Bacteroides sp. D1 predicted protein 88 27
CV4034 probableaminotransferase 2e
-161
Pseudomonas
aeruginosa
ORF_6; similar to
DegT/DnrJ /EryC1/StrS
family
98 71
CV4035 probable purine-nucleoside
phosphorylase
5e
-155
Pseudomonas
aeruginosa PA7
NAD-dependent
epimerase/dehydratase
100 61
CV4036 hypothetical protein 0.0 C. violaceum ATCC hypothetical protein CV_4036 100 100
69

12472
CV1760 probabletranscriptional regulator
(AraC/XylS family)
9e
-47
Lutiella nitroferrum
2002
transcription activator effector
binding protein
99 55
CV1761 conserved hypothetical protein 2e
-37
Desmospora sp. 8437 tetratricopeptide(TPR)
domain protein
94 52
CV1762 probableacyl-coA carboxylasesubunit 0.0 Lutiella nitroferrum
2002
Carbamoyl-phosphate
synthaseL chain ATP-
binding
100 79
CV1763 probable enoyl-CoA hydratase 9e
-112
Lutiella nitroferrum
2002
Enoyl-CoA
hydratase/isomerase
99 79
CV1764 probablepropionyl-CoA carboxylase
(beta subunit)
0.0 Lutiella nitroferrum
2002
Propionyl-CoA carboxylase 100 91
CV1765 conserved hypothetical protein 1e
-20
Shewanella baltica
OS195
hypothetical protein
Sbal195_1026
92 43
CV0971 probable fumarylacetoacetate
hydrolase
3e
-147
Lutiella nitroferrum
2002
fumarylacetoacetate (FAA)
hydrolase
100 80
CV0972 probableglutathionetransferasezeta 1 4e
-71
Lutiella nitroferrum
2002
maleylacetoacetateisomerase 99 67
CV1430 hypothetical protein 4e
-15
Escherichia fergusonii
ECD227
hypothetical protein
ECD227_1828
88 43
CV1431 probable Rhs-family protein 0.0 Burkholderia sp. 383 Rhs family protein 92 43
CV1432 probablevgr-related protein 0.0 Chromobacterium Vgr-likeprotein (CV3986) 84 96
70

violaceum ATCC 12472
0.0 Chromobacterium
violaceum ATCC 12472
Vgr-likeprotein (CV3975) 84 94
0.0 Chromobacterium
violaceum ATCC 12472
Vgr-likeprotein (CV0023) 84 84
0.0 Chromobacterium
violaceum ATCC 12472
Vgr-likeprotein (CV0016) 85 82
0.0 Chromobacterium
violaceum ATCC 12472
Vgr-likeprotein (CV1223) 88 75
0.0 Lutiella nitroferrum
2002
probablevgr-related protein
(typeVI secretion systemVgr
family protein
85 70
CV2203 conserved hypothetical protein 3e
-137
Lutiella nitroferrum
2002
membrane-associated zinc
metalloprotease
100 57
CV2204 probable outer membrane protein 0.0 Lutiella nitroferrum
2002
outer membrane protein
assembly complex, YaeT
protein (Omp85)
100 74
CV2205 conserved hypothetical protein 2e
-46
Ralstoniapickettii 12J Uracil-DNA glycosylase
superfamily protein
94 59
CV2211 conserved hypothetical protein 2e
-46
Ralstoniapickettii 12J Uracil-DNA glycosylase
superfamily protein
94 59
CV2212 hypothetical protein 2e-21 Lutiella nitroferrum conserved hypothetical 92 71
71

2002 protein
5e
-164
Burkholderia cepacia Asp/Glu-specific
aminopeptidase

CV2036 probable peroxiredoxin/glutaredoxin
family protein
2e-
122
Lutiella nitroferrum
2002
glutaredoxin-family domain
protein
100 84
CV2037 probabledihydrolipoamide
dehydrogenase
0.0 Ralstonia eutropha H16 dihydrolipoamide
dehydrogenase
99 75
CV3977 conserved hypothetical protein 4e
-87
Lutiella nitroferrum
2002
type VI secretion system
effector, Hcp1 family
100 92
CV3978 conserved hypothetical protein 0.0 Lutiella nitroferrum
2002
typeVI secretion protein,
EvpB/VC_A0108 family
99 92
CV3979 conserved hypothetical protein 4e
-77
Lutiella nitroferrum
2002
typeVI secretion protein,
VC_A0107 family
95 89
CV3276 conserved hypothetical protein 4e
-77
Tolumonas auensis
DSM 9187
YceI family protein 100 73
CV3277 conserved hypothetical protein 3e
-56
Methylotenera mobilis
J LW8
YceI family protein 93 62
CV3278 conserved hypothetical protein 3e
-64
Methylotenera mobilis
J LW8
cytochrome B561 99 66
CV3327 probableKpsF/GutQ family protein 6e
-105
Lutiella nitroferrum
2002
KpsF/GutQ family protein 99 67
CV3328 conserved hypothetical protein 5e
-59
Lutiella nitroferrum 3-deoxy-D-manno- 100 66
72

2002 octulosonate8-phosphate
phosphatase, YrbI family
CV3329 conserved hypothetical protein 9e
-59
Lutiella nitroferrum
2002
protein of unknown function
DUF1239
98 56
CV3330 conserved hypothetical protein 7e
-48
Lutiella nitroferrum
2002
lipopolysaccharidetransport
periplasmic protein LptA
89 61
CV3331 probableABC transporter, ATP-binding
protein
1e
-110
Lutiella nitroferrum
2002
ABC transporter related
protein
100 85
CV3332 RNA polymeraseN (sigma54) factor
CV3333 probable sigma-54 modulation protein 2e
-42
Lutiella nitroferrum
2002
sigma 54 modulation
protein/ribosomal protein
S30EA
100 78
CV3334 probablePTS system, fructose-specific II
ABC componen
2e
-66
Lutiella nitroferrum
2002
PTS IIA-likenitrogen-
regulatory protein PtsN
100 80
CV3335 probablekinase/phosphatase 2e
-164
Chromobacterium
violaceumATCC 12472
HPr kinase/phosphorylase 100 99
CV3336 conserved hypothetical protein 4e
-116
Lutiella nitroferrum
2002
conserved hypothetical
protein
99 72
CV3337 3-octaprenyl-4-hydroxybenzoatecarboxy-
lyase

CV3338 conserved hypothetical protein 5e
-133
Lutiella nitroferrum
2002
carbohydratekinase, YjeF
related protein
97 61
73

*Blast pelo site TCDB 794
CV4055 conserved hypothetical protein 0.0 Laribacter
hongkongensis HLHK9
GTP-dependent nucleic
acid-binding protein EngD
100 88
CV4056 aminoacyl-tRNA hydrolase(Pth)
CV4057 50S ribosomal protein L25 (RplY)
CV4058 ribose-phosphatediphosphokinase(PrsA)
CV4325 oligopeptideABC transport systemATP-
binding protein (OppF)

CV4326 oligopeptidetransport systemATP-
binding protein (oppD)

CV4327 oligopeptidetransport systempermease
protein (oppC)

CV4328 oligopeptidetransport systempermease
protein (oppB)

CV4329 probable oligopeptide ABC transporter
system, substrate-binding protein
e
-120*


Salmonella
typhimurium
Periplasmic oligopeptide-
binding protein precursor
96 44
74

Table4. ORFs that arepart of theprobablepathogenicity island of theT6SS in C. violaceum. 795
ORF Protena E-value Organismo Query
coverage
(%)
Sequence
Identity
(%)
01 CV3963 typeVI secretion-associated protein, ImpA family 6e
-170
Lutiella nitroferrum 2002 98 66
02 CV3964 hypothetical protein CV_3964
03 Cv3965 typeVI secretion ATPase, ClpV1 family 0.0 Lutiella nitroferrum 2002 100 85
04 CV3966 conserved hypothetical protein 5e
-47
Ralstonia sp. 5_7_47FAA 92 45
05 CV3967 typeVI secretion protein, VC_A0111 family 4e
-147
Lutiella nitroferrum 2002 96 67
06 CV3968 hypothetical protein CV_3968
07 CV3969 typeVI secretion protein, VC_A0110 family 0.0 Lutiella nitroferrum 2002 100 80
08 CV3970 conserved hypothetical protein 3e
-25
Burkholderia ambifaria MEX-5 90 38
09 CV3971 hypothetical protein PACG_02222 3e
-96
Pseudomonas aeruginosa C3719 95 35
10 CV3972 hypothetical protein CV_3973 8e
-70
ChromobacteriumviolaceumATCC
12472
98 74
virulenceprotein virA 2e
-10
Escherichiacoli M863 81 33
11 CV3973 hypothetical protein CV_3972 8e
-70
ChromobacteriumviolaceumATCC
12472
96 74
virulenceprotein virA 6e
-12
Escherichiacoli M863 81 32
12 CV3974 hypothetical protein PA14_21460 1e
-29
Pseudomonas aeruginosa UCBPP-PA14 99 38
75

796
13 CV3975 Rhs element Vgr protein 0.0 Lutiella nitroferrum 2002 66 71
14 CV3976 OmpA/MotB domain protein 6e
-04
Anaeromyxobacter dehalogenans 2CP-1 85 32
15 CV3977 typeVI secretion systemeffector, Hcp1 family 4e
-87
Lutiella nitroferrum 2002 100 92
16 CV3978 typeVI secretion protein, EvpB/VC_A0108 family 0.0 Lutiella nitroferrum 2002 99 92
17 CV3979 typeVI secretion protein, VC_A0107 family 4e
-77
Lutiella nitroferrum 2002 95 89
18 CV3980 typeVI secretion protein IcmF 0.0 Lutiella nitroferrum 2002 100 67
19 CV3981 peptidaseM15B and M15C DD-carboxypeptidase
VanY/endolysin
8e
-62
Lutiella nitroferrum 2002 63 67
20 CV3982 typeVI secretion lipoprotein, VC_A0113 family 2e
-34
Lutiella nitroferrum 2002 92 46
21 CV3983 typeVI secretion protein, VC_A0114 family 0.0 Lutiella nitroferrum 2002 100 75
22 CV3984 typeIV / VI secretion systemprotein, DotU family 2e
-91
Lutiella nitroferrum 2002 100 75
23 CV3985 typeVI secretion systemlysozyme-related protein (EvpE-like) 8e
-66
Lutiella nitroferrum 2002 97 85
24 CV3986 typeVI secretion systemVgr family protein 0.0 Lutiella nitroferrum 2002 98 71
25 CV3987 conserved hypothetical protein 4e
-50
Lutiella nitroferrum 2002 66 55
26 CV3988 hypothetical protein CV_3988
27 CV3989 conserved hypothetical protein 5e
-49
Lutiella nitroferrum 2002 87 60
28 CV3990 conserved hypothetical protein 2e
-166
Lutiella nitroferrum 2002 74 71
76

Figure Captions

Figure 1. Virtual 2-D gel of C.violaceum ATCC 12472 proteins. For generation of the
gel, the proteins were plotted according to their theoretical molecular masses (kDa) and
calculated pIs.

Figure 2. Two-dimensional electrophoresis of total proteins of C. violaceum ATCC
12472 grown at 28 C.

Figure 3. Schematic drawing of the probable pathogenicity island of T6SS in C.
violaceum. The gene order is shown as it appears in the genome of the bacterium.
Details on the proteins are shown in Table 4. CHP: conserved hypothetical protein; HP:
hypothetical protein.

Figure 4. Interaction network of ORF CV4055 performed using the software STRING.
Stronger associations are represented by thicker lines. Proteins found in the reference
gel with which interaction occurs: pheS (CV1352), thrS (CV1348), rplI (CV3637),
rpsF (CV3640), efp (CV1378), tsf (CV2197) e atpD (CV0672). Stronger associations
are represented by thicker lines.

Figure 5. Analysis of amino acid sequence similarity. (A) Sequence alignment of YchF
from C. violaceum (CHRVIO) with those from E. coli (ESCOLI) and H. influenza
(HAEINF). The conserved motifs Walker A and B are highlighted in gray. The
recognition site of the protein to GTP is underlined in black. (B) Sequence alignment of
RNase from C. violaceum (CHRVIO) with the RNase E of E. coli (ESCOLI), thus
showing the sequence conservation of the catalytic domain (N-terminal). In all
sequences, identical residues are highlighted in black, whereas conserved residues are
highlighted in gray.






77

Figures







Medeiros et. al., 2011. Figure 1.
78










Medeiros et. al., 2011. Figure 2.


79







Medeiros et. al., 2011. Figure 3.
80






.














A
81




















Medeiros et. al., 2011. Figure 4.
B)
82



Supplementary Material








Proteomic profile of Chromobacterium violaceum ATCC 12472: new
perspectives in the post-genomic era.










Viviane Katielly Silva Medeiros, Andr da Silva Santiago, Helena Costa, Carlos
Priminho Pirovani, Silvia Regina Batistuzzo de Medeiros







83

Supplementary figures





Figure S1. Representation of 2-D gel separation of C. violaceum proteome according to
predicted pI and molecular masses of all potential ORFs of C. violaceum ATCC 12472.













84

Figure S2. Schematic drawing of the predicted operons from the "hypothetical proteins"
identified in the reference gel. Black: the hypothetical ORFs had their protein identified
in the reference gel, Gray: ORFs that are probably in the operon second analysis in
MicrobesOperon Predictions Online; Arrow: indicates direction of transcription of the
probable operon.





























B
CV1197
CV1196
CV1195
CV1194
100pb
CV3818
CV3817
A
100pb
C
100pb
CV2983 CV2982 CV2981
CV4032 CV4031 CV4029
CV4028
CV4027 CV4030 CV4033 CV4034
CV403
CV403
CV4037 CV4038
D
100pb
F
E
100pb
CV176
CV1758 CV1759
CV176
CV1762
CV176
3
CV1764
CV176
CV0969 CV0970 CV0971 CV0972
100pb
CV1431 CV1432
CV1430
100pb
G
85




N
100pb
M
100pb
CV4055 CV4056 CV4057 CV4058
CV4329 CV4328 CV4327 CV4326 CV4325
K
100pb
L
J
100pb
I
100pb
CV2036 CV2037
CV3977 CV3978 CV3979
CV3278 CV3277 CV3276
CV3328
CV3327
CV3337
CV3335CV3336
CV333
CV3334 CV3331
CV3330
CV3327
CV3329
CV3332
100pb
H
100pb
CV2212
CV2211
CV2210
CV2209
CV2208
CV2207
CV2206
CV2205
CV2204 CV2203
CV2201
CV2200
CV219
9
CV2198
CV2197
CV2196
CV2202
86

Figure S3. Analysis of functional domains using the CDD. A: functional domains of the protein Xaa-Pro dipeptidase (C. violaceum), B:
functional domains of the protein Xaa-Pro dipeptidase (P. furiosos); C: Ribonuclease E domain (C. violaceum); D: Ribonuclease E domain (E.
coli).

















A
87





















B
88





















C
D
89









MANUSCRITO II
90

Anlise da resposta de Chromobacterium violaceum luz UV: uma abordagem 1
mica 2
3
Viviane Katielly Silva Medeiros*
1,3
, Delanne Sena Fontinele*
1
, Andr da Silva 4
Santiago
2
, Carlos Priminho Pirovani
2
,

Lucymara Fassarella Agnez-Lima
1
, Silvia Regina 5
Batistuzzo de Medeiros
1
. 6
7
*Os autores tiveram a mesma contribuio para o artigo. 8
9
1
Laboratrio de Biologia Molecular e Genmica, Departamento de Biologia Celular e 10
Gentica, Universidade Federal do Rio Grande do Norte, Natal, Rio Grande do Norte, 11
Brasil 12
2
Laboratrio de Protemica, Universidade Estadual de Santa Cruz, Ilhus, Bahia, Brasil 13
3
Colegiado de Medicina, Universidade Federal do Vale do So Francisco, Petrolina, 14
Pernambuco, Brasil 15
16
Correspondence: Dra Silvia Regina Batistuzzo de Medeiros, Laboratrio de Biologia 17
Molecular e Genmica, Departamento de Biologia Celular e Gentica, Universidade 18
Federal do Rio Grande do Norte, Natal, Rio Grande do Norte, Brasil. 19
Email: sbatistu@cb.ufrn.br 20
Fax number: +55 85 3215 3346 21
22
23
24
25
Resumo 26
27
Chromobacterium violaceum um bacilo de vida-livre, Gram-negativo 28
comumente encontrado no solo e nas guas de regies tropicais e subtropicais. Este 29
organismo de vida livre est sujeito as mais diferentes condies ambientais e apresenta 30
inmeras propriedades biotecnolgicas. Porm, pouca ateno tem sido dada a anlise 31
da resposta de C. violaceum frente a diferentes tipos de estresse. Este trabalho analisa a 32
resposta desta bactria a radiao UVC atravs de abordagem protemica e genmica. 33
Para isto, culturas de C. violaceum foram expostas a radiao UVC e recuperadas por 34
91

30min. A comparao do perfil protico, analisado por eletroforese 2-D, do controle 35
versus tratado possibilitou a identificao de 52 protenas que surgiram aps a induo 36
do estresse. Na anlise genmica, foi avaliada a sobrevivncia e taxa de mutagnese de 37
cepas de E. coli RecA
-
contendo clones pr-selecionados em uma biblioteca genmica 38
de C. violaceum. Todos os clones apresentaram uma taxa de sobrevivncia 39
estatisticamente significativa na dose de 5 J /m
2
. Trs clones apresentaram diferena 40
signifivativa nos ensaios de mutagnese e apresentaram uma resposta dose 41
independente. Neste trabalho foi proposta uma via de reposta ao estresse induzido pela 42
radiao UVC em C. violaceum, onde participam protenas relacionadas inibio da 43
diviso celular, sntese transleso, metabolismo de purinas e pirimidinas, choque 44
trmico ou chaperonas, fornecimento de energia, formao de biofilme, transporte, 45
regulao do ciclo ltico de bacterifagos, alm de protenas que ainda no apresentam 46
funo caracterizada. 47
48
49
50
1. Introduo 51
52
Chromobacterium violaceum uma -proteobacteria Gram-negativa que habita 53
regies tropicais e subtropicais incluindo as guas e bancos de areia do Rio Negro, o 54
principal afluente do Rio Amazonas (Durn and Menck, 2001). A C. violaceum possui 55
caractersticas biotecnolgicas importantes, tais como a capacidade de hidrolisar filmes 56
plsticos (Gourson et.al., 1999) e de solubilizar ouro em um processo livre de mercrio 57
(Smith & Hunt, 1985; Campbell et. al., 2001). 58
Uma das caractersticas desta bactria sua capacidade de produzir o pigmento 59
violacena, que confere a colorao violeta suas clulas. A funo fisiolgica deste 60
pigmento desconhecida, porm diversas propriedades biolgicas tm sido descritas, 61
tais como: antimicrobiana, contra Mycobacterium tuberculosis (Souza, 1999), 62
Trypanosoma cruzi (Haun et.al., 1992) e Leishmania sp. (Leon, 2006); bactericida ( 63
Lichstein & van de Sand, 1945 e 1946; Durn, 1983); antiviral (Durn & Menck, 2001); 64
antifngica (Shirata et.al., 2000); e antitumoral (Ueda et. al., 1994; Melo et. al., 2000; 65
Ferreira, et.al., 2004). Recentemente foi demonstrado que esta molcula possui 66
propriedades antidiarreicas e um efeito protetor contra lceras induzidas em ratos 67
Wistar (Antonisamy et. al., 2009), bem como um efeito imunomodulatrio, analgsico e 68
92

antipirtico (Antonisamy & Ignacimuthu, 2009). Alm da violacena, outros metablitos 69
secundrios so produzidos tais como polihidroxialcanoatos e exopolissacardeos, 70
constituintes de biofilmes bacterianos (Corpe, 1964; Martin & Richards, 1963; 71
Steinbchel, et. al., 1993; Kolibachuk, et. al., 1999; Martinelli et. al., 2002; Recouvreux, 72
et. al., 2008). 73
Por apresentar caractersticas biotecnolgicas interessantes, o genoma de C. 74
violaceum ATCC 12472 foi completamente sequnciado em 2003 por um consrcio de 75
laboratrios Brasileiros (Vasconcelos et. al., 2003). Por ser um organismo de vida livre 76
esta bactria est submetida a diferenas ambientais, tais como mudanas na 77
temperatura, variabilidade e oferta de nutrientes, exposio a compostos txicos e 78
radiao UV (Hungria et al., 2004). Com o intuito de sobreviver em variadas condies 79
ambientais, as clulas tm um repertrio de genes que elas podem escolher para 80
expressar ou silenciar quando necessrio. Entre esta vasta coleo de vias metablicas 81
controladas geneticamente a resposta SOS um sistema de reparo de DNA induzvel, 82
que permite a bactria sobreviver quando repentinamente o dano no DNA aumenta 83
(Michel, 2005). 84
Agentes capazes de induzir a resposta SOS so aqueles que quebram o DNA, 85
bloqueiam sua sntese e a diviso celular, e levam ao acmulo de fita simples de DNA 86
(ssDNA) (J anion, 2008). A resposta SOS foi caracterizada primeiramente no modelo de 87
estudo Escherichia coli, onde a protena LexA reprime vrios genes relacionados a 88
diferentes processos celulares como: inibio da diviso celular e replicao propensa a 89
erro ou reparo por exciso. Esta protena se liga a motivos palindromicos, denominados 90
box SOS, localizados nas sequncias promotoras dos genes por ela regulados. Quando 91
LexA est ligada ao box SOS ocorre o bloqueio do incio da transcrio e 92
consequentemente a represso gnica (Erill, et al., 2007). Quando a bactria exposta 93
ao estresse que gera ssDNA, como a radiao UV, ocorre a montagem de RecA nas 94
ssDNAs. Quando isso acontece, RecA adquire uma atividade de coprotease que facilita 95
a self-cleavage da protena LexA resultando na derepression dos genes regulados pelo 96
sistema SOS (J anion, 2008). 97
Duarte e colaboradores (2004), atravs de busca por similaridade contra 98
sequncias conhecidas depositadas em bancos de dados, observaram a presena vrias 99
vias metablicas relacionadas ao reparo de DNA incluindo as ORFs que apresentavam 100
similaridade com os genes dinG (CV1991), dinB (CV4363), umuD (CV2332), umuC 101
(CV2612), dnaA (CV0001 e CV3614), nrdB (CV2284), mucB (CV2060), nrdA 102
93

(CV2287) e recA (CV1607), que esto relacionados a resposta SOS. Porm, nenhum 103
homlogo da protena LexA ou do box SOS foi identificado no genoma de C. 104
violaceum. Por ser uma bactria de vida livre, estando constantemente exposta ao dano, 105
foi sugerido que existncia de uma via constitutiva, como proposto por Black e 106
colaboradores (1998) para Neisseria gonorrhoeae, que pertence mesma famlia deC. 107
violaceum (Duarte et al., 2004). Porm, estudos para comprovar esta hiptese ainda no 108
foram realizados. 109
Com o intuito de identificar ORFs que esto relacionadas com a resposta de C. 110
violaceum a radiao UVC foi realizada uma busca por protenas e ORFs responsivas a 111
este tipo de estresse, atravs de tcnicas protemica e genmica, respectivamente. Este 112
o primeiro trabalho que avaliou a resposta da C. violaceum luz UV utilizando duas 113
abordagens diferentes e complementares e que prope um modelo da via de resposta 114
desta bactria ao estresse gerado pela radiao. A via sugere que em a resposta ao 115
estresse gerado pela radiao UV envolva ORFs relacionadas com a diviso celular, 116
sntese transleso, metabolismo de purinas e pirimidinas, heat shock ou chaperonas, 117
fornecimento de energia, transporte, regulao do ciclo ltico de bacterifagos, 118
formao de biofilme e protenas que ainda no apresentam funo caracterizada. 119
120
2. Material e Mtodos 121
122
Cepas bacterianas e condies de crescimento 123
Chromobacterium violaceum ATCC 12472 foi cultivada aerobicamente em 5 124
mL de meio LuriaBertani (LB) (0,5% de extrato de levedura, 1% de triptona, 0,5% de 125
NaCl) 28 C sob agitao de 180 rpm em um shaker incubador, por aproximadamente 126
16 horas. Posteriormente, a cultura foi diluda na proporo de 1:10 e cultivada como 127
citado anteriormente at alcanar a D.O.
600
entre 0.6 e 0.8. 128
A cepa selvagem AB1157 (Dewitt and Adelberg, 1962) utilizada como controle, 129
bem como, a mutante DH10B (recA
-
), ambas de E. coli, cresceram em meio LB a 37C. 130
Se necessrio 50 g/mL do antibitico apropriado foi adicionado. 131
132
Exposio UVC, extrao de protenas e ensaio de seleo funcional 133
As culturas foram centrifugadas a 2.300 g por 10 min a 25 C, o sobrenadante foi 134
descartado e o precipitado ressuspendido em MgSO
4
0.1 M, incubado no gelo por 7 135
min, e exposto a 116 J /m
2
UV light (254 nm) em placas de Petri (9 cm de dimetro) em 136
94

um gabinete de UV (23 cm height, 23 cm width, 31 cm length BOITON). Aps a 137
irradiao, as amostras foram centrifugadas nas condies citadas anteriormente. O 138
sobrenadante foi descartado e o precipitado ressuspendido em 50 mL de meio LB sem 139
antibiticos para recuperao por 30 min. Aps a recuperao, as culturas tratadas 140
foram centrifugadas a 2.300 g, 4 C por 10 min. O sobrenadante foi novamente 141
descartado e o precipitado ressuspendido em tampo de lise (0, 1M de Tris-HCl, pH 8,0 142
contendo 1% de Triton X-100) e estocado a -20 C. 143
A partir de biblioteca genmica de DNA de C. violaceum previamente 144
construda (in press Sena, 2011) em E. coli DH10B, foi realizado ensaio de seleo 145
funcional com luz UVC. Os clones da biblioteca genmica foram submetidos a 146
diferentes doses de luz UV (1; 2,5; 5; 9;10 J /m
2
) (Miller, 1992). Aps seleo funcional 147
foram escolhidos quatro clones para serem analisados neste estudo: PLE1G, PLE7B, 148
PLE10B e PLE12H. 149
150
Eletroforese bi-dimensional em gel de poliacrilamida 151
O gel 2-D foi realizado utilizando o sistema immobiline/polyacrylamide. IEF foi 152
realizado em um sistema Ettan IPGphor (GE Healthcare) com tiras de pH imobilizado 153
de 13 cm (pH 310; GE Healthcare). As amostras proticas foram diludas em uma 154
concentrao final de 300 g em 250 L de soluo de reidratao 2-D (7 M ureia, 2 M 155
tioureia, 2% CHAPS w/v, 0,5% v/v IPG buffer pH 3-10, 7 mg DTT e 0,002% 156
bromophenol blue w/v) e aplicado em tiras utilizando a tcnica da reidratao de acordo 157
com as instrues do fabricante. A reidratao foi realizada Durnte 12 h a 20 C sem 158
voltagem. A focagem isoeltrica foi realizada por um gradient de voltage, iniciando com 159
500 V por 1 h, 1000 V por 1:04 h, 8000 V por 2:30 h e 8000 V por 22 min. Terminada a 160
focagem cada tira foi equilibrada por 15 min em 6 mL de tampo de equilbrio (6 M 161
ureia, 2% SDS w/v, 29,3% glicerol v/v, 75 mM Tris-Cl pH 8.8 e 0,002% de bromofenol 162
blue w/v) suplementado com 60 mg de DTT e depois em 6 mL de tampo de equilbrio 163
suplementado com 150 mg de iodoacetamida por mais 15 min. A segunda dimenso foi 164
realizada em gel de poliacrilamida 12.5% em um sistema Ruby SE600 (GE Healthcare): 165
15 min a 10 mA/gel, 20-30 min a mA/gel e 150 min a 50 mA/gel, a uma temperatura 166
constante de 14 C. O Kit Low Molecular Weight Calibration Kit para SDS 167
Electrophoresis (Amersham Biociensce) foi utilizado como marcador. A extrao e a 168
eletroforese em gel foram realizadas em triplicatas biolgicas. Depois da eletroforese as 169
protenas foram visualizadas com 0.1% w/v de Coomassie G 250 coloidal (Neuhoff, et. 170
95

al., 1988) e descoradas com gua deionizada. O escaneamento do gel e as anlises das 171
imagens foram realizadas com o softwares ImageScanner II e ImageMaster 2D 172
Platinum v6.0 (GE Healthcare), respectivamente, para anlise e seleo dos spots. 173
174
Digesto proteica in-gel e nanoLC MS/MS 175
Os spots foram excisados e descorados com 200 L de NH
4
HCO
3
50 mM em 176
acetonitrila 50,0%, o sobrenadante foi descartado e os fragmentos do gel foram 177
reidratados com 100 L de acetonitrila 100,0% por 5 min e secado a vcuo por 10 min. 178
Os pedaos do gel foram reidratados com 4 L de tripsina 25 ng/L e ento NH
4
HCO
3
179
25 mM foi adicionado at cobr-los. A digesto foi realizada a 37 C Durnte 12 h. O 180
sobrenadante contend os peptdeos foi recuperado e os pedaos do gel lavados com 181
acetonitrila 50,0% cido frmico 0,1% em agitador pro 15 min. o sobrenadante foi 182
recuperado e misturado ao mesmo da primeira lavagem. O volume foi ajustado a vcuo, 183
em SpeedVac, at alcanar 10 L. 184
Os peptdeos foram cromatograficamente separados em um nanoAcquity UPLC 185
(Waters) em duas colunas alinhadas com um Q-TOF-Micro (Micromass), sob um fluxo 186
de 0,6 L/min Durnte 50 min. O primeiro, chamado trapping column, tem m, 180 m 187
x 20 mm e o segundo, 1,7 m 100 m x 100 mm. O gradiente de acetonitrila foi inciado 188
com 1,0% por 1 min, aumentando para 1,0% para 50,0% at 40 min e de 50,0% para 189
85.0%, at 45 min. 190
Os peptdeos foram ionizados sob 3000 V, fragmentados com energia de coliso 191
numa faixa de 20 at 95 eV de acordo com a m/z e o tamanho dos peptdeos, o estado da 192
carga foi de 2+at 4+. 193
194
Indentificao das protenas 195
O espectro com os padres de fragmentao foram analisados no software 196
ProteinLynx Global Server 2.4 (Waters) e as sequncias peptidicas foram comparadas 197
com o banco de dados do Swissprot ajustados para a digesto triptica com um stio de 198
clivagem perdido e um erro igual mximo de 30 ppm. Para esta pesquisa foi utilizada a 199
verso 2.1.0 do MASCOT (Matrix Science). 200
Ensaios de complementao Curva de crescimento 201
202
Para a anlise da complementao funcional dos quatro clones selecionados a 203
partir de biblioteca genmica foram realizados ensaios de curva de crescimento. 204
96

Culturas saturadas foram diludas na proporo 1:50 em meio LB lquido contendo o 205
antibitico adequado, em seguida foram crescidas sob agitao a 37 C at atingir a 206
DO
600
de 0,4. As culturas foram centrifugadas a 2.254 g por oito minutos a temperatura 207
ambiente. O precipitado foi ressuspendido em MgSO
4
0,1 M, distribudo em placas e 208
exposto a diferentes doses (0; 2,5; 5 e 10 J /m
2
) de UVC (lmpada 6 W; G8T8 GE). Em 209
seguida as clulas em suspenso foram diludas na proporo 1:20 em meio LB lquido 210
e mantidas sob agitao a 180 rpm. Para acompanhar o crescimento foram realizadas 211
leituras em espectofotmetro (absorbncia, 600 nm) em intervalos de uma hora, 212
partindo do tempo zero (0) at trs horas (3 h) seguintes (Miller, 1992). Utilizou-se o 213
programa grfico GraphPad Prism 5.0 e aplicou-se o teste estatstico two-way ANOVA 214
para a avaliao de diferenas significativas (P <0,05) nos valores das mdias. 215
216
Ensaio de mutagnese (Rifampicina) 217
O ensaio de mutagnese direta com rifampicina foi realizado com os quatro 218
clones analisados neste estudo. A C. violaceum e as cepas de E. coli AB1157 e DH10B 219
com pBC-SK sem inserto foram utilizadas como controles. As linhagens utilizadas 220
foram preparadas com descrito na sesso anterior (Ensaios de complementao Curva 221
de crescimento) e expostas a doses crescentes de luz UVC (0; 2,5 e 5 J /m
2
). Em seguida 222
as clulas em suspenso foram diludas na proporo 1:20 em meio LB lquido e 223
mantidas sob agitao a 180 rpm, 37 C (E. coli) ou 30 C (C. violaceum) Durante 16 h. 224
Para a realizao do teste de mutagnese direta 100 L, para cada cultura (tratado e no 225
tratado), foram adicionados em placas com LB gar com rifampicina (100 g/mL), sob 226
abrigo da luz e calor. As placas foram incubadas por 16 h a 37 C ou 30 C, as colnias 227
contadas e a taxa entre o nmero de colnias existentes no meio com e sem rifampicina 228
foi utilizada para o clculo da frequncia de mutao. 229
230
Anlise in silico 231
As protenas identificadas por MS foram categorizadas de acordo com o Clusters 232
of Orthologous Groups (COG) baseadas nas categorias funcionais consistentes com o 233
banco de dados (http://www.ncbi.nlm.nih.gov/COG/) (Tatusov, et. al., 1997) O Basic 234
Local Alignment Sequence Tool (BLAST) foi utilizado para buscas contra bancos de 235
dados de protenas (Altschul, et. al., 1997). A busca por domnios funcionais foi 236
realizada pelo Conserved Domain Database - CDD 237
(http://www.ncbi.nlm.nih.gov/Structure/cdd/cdd.shtml) (Marchler-Bauer, et. al., 2011) e 238
97

PFAM (http://pfam.sanger.ac.uk/) (Finn, et. al., 2010). A predio de provveis operons 239
utilizou o programa MicrobesOnline Operon Prediction 240
(http://www.microbesonline.org/operons/) (Price, et. al., 2005) e para anlise de 241
alinhamento mltiplo foi utilizado o programa CLUSTALW2 242
(http://www.ebi.ac.uk/Tools/es/cgi-bin/clustalw2). 243
Os clones da biblioteca genmica obtidos a partir de seleo funcional tiveram 244
seu DNA verificado por seqenciamento (MegaBace500, Amersham), seguido de 245
anlises por ferramentas de bioinformtica, citadas anteriormente, tendo em vista o 246
alinhamento para identificao de seqncias e predio de possveis funes. As 247
seqncias geradas puderam ser comparadas diretamente com as seqncias genmicas 248
de C. violaceum devido ao genoma estar disponvel em bancos de dados pblicos 249
(http://www.brgene.lncc.br/cviolaceum/). 250
3. Resultados e Discusso 251
252
Neste trabalho foram utilizadas duas abordagens diferentes e complementares 253
para identificar ORFs relacionadas reposta de C. violaceum ao estresse induzido pela 254
luz UVC. A anlise protemica avaliou o perfil proteico antes e aps induo do 255
estresse em C. violaceum (Figura 1 e Tabela 1) e a abordagem genmica investigou a 256
expresso de ORFs de C. violaceum em uma cepa de E. coli deficiente em recA 257
(DH10B) e, portanto, deficiente na induo do sistema SOS. A anlise da resposta se 258
deu atravs da sobrevivncia e frequncia de mutagnese de E. coli DH10B 259
transformada com cada um dos clones investigados (Figura 2 e 3). 260
Para entender a resposta fisiolgica de C. violaceum luz UVC, as bactrias 261
foram expostas a 116 J /m
2
de luz UV (254 nm), recuperadas por 30 min, e as protenas 262
totais foram analisadas atravs de eletroforese bi-dimensional (2-D). Setenta e trs spots 263
foram detectados na bacteria no exposta e 45 spots surgiram depois do tratamento. 264
Cada um destes 45 spots foram excisados e analisados (Figure 1 e Tabela 1). Foram 265
identificados quarenta e um (91,11%) dos 45 spots diferencialmente expressos, que 266
correspondem a 52 protenas diferentes. Isto aconteceu, pois nove spots continham 267
vrias protenas massa molecular (MW) e/ou pI muito prximos. As duas protenas 268
HtpG (CV1318) e porin signal peptide (CV3104) foram encontradas em diferentes 269
posies no gel 2-D gel (Figura 1 e Tabela 1). Isto tambm foi observado na anlise 270
protmica de Pseudomonas putida KT2440 (Santos, et. at., 2004). Os resultados 271
sugerem que estas protenas foram alvo de modificaes ps traducionais. J ing e 272
98

colaboradores (2008) e Zhou e colaboradores (2009), estudando o proteoma de 273
Streptococcus suis serotype 2 e Haemophilus parasuis serovar 5, respectivamente, 274
tambm observaram spots com mltiplas protenas e protenas iguais em diferentes 275
posies no gel. 276
Baseado no COG, as protenas que surgiram aps o tratamento com a radiao 277
foram agrupadas em 16 categorias funcionais, das quais 52,63% esto envolvidas com a 278
converso de produo de energia (Categoria COG: C, 22,81%), transporte e 279
metabolismo de aminocidos (Categoria COG: E, 17,54%) e traduo e biognese e 280
estrutura ribossomal (Categoria COG: J , 12,28%). Neste cenrio esperado que aps o 281
estresse ocorra um aumento no metabolismo para permitir a recuperao e/ou 282
sobrevivncia das clulas. Protenas relacionadas com modificaes ps-traducionais, 283
turnover proteico e chaperonas (Categoria COG: O), metabolismo e transporte de 284
carboidratos (Categoria COG: G) e metabolismo e transporte de nucleotideos (Categoria 285
COG: F) e biognese do envelope, membrana e parede celular (Categoria COG: M), 286
representaram 8,77%, 7,02% e 5,26%, respectivamente. As categorias com menor 287
representao foram quelas relacionadas ao metabolismo e transporte de lipdeos 288
(Categoria COG: I), metabolismo e transporte de ons inorgnicos (Categoria COG: P) e 289
predio da funo geral (Categoria COG: R) com 3,51%, cada. J as protenas 290
relacionadas partio cromossmica, diviso celular e controle do ciclo celular 291
(Categoria COG: D), transcrio (categoria COG: K), motilidade celular (Categoria 292
COG: N), catabolismo, transporte e biossntese de metablitos secundrios (Categoria 293
COG: Q), trfico intracelular, secreo e transporte vesicular (Categoria COG: U) e 294
mecanismos de transduo de sinais (Categoria COG: T) cada um representando 1,75%. 295
Na estratgia genmica por busca de ORFs deC. violaceum responsivas UVC 296
foi construda uma biblioteca genmica com aproximadamente 1.100 clones. Foi 297
realizada uma seleo funcional, utilizando como critrio a sobrevivncia nas doses de 298
10 e 20 J /m2 de UVC, que resultou na seleo de cinco clones: PLE1G, PLE7B, 299
PLE10B, PLE12H e PLH6A. No total, estes clones apresentam 11 ORFs: CV1667 300
(PLE1G), CV0390-0391 (PLE7B), CV1311-1313 (PLE10B), CV4160 (PLE12H) e 301
CV3721-3724 (PLH6A) (in press, Sena, 2011). Por meio das duas abordagens micas 302
utilizadas neste trabalho, uma ORF em comum foi identificada: CV4160, que codifica a 303
protena RpoA. Alm disso, tambm foram encontradas protenas da famlia Thij/PfpI, 304
onde a CV2336 foi encontrada na anlise protemica e a CV1313 na anlise genmica. 305
99

Todos os clones analisados neste trabalho complementaram a funo da cepa de 306
E. coli deficiente em RecA (DHD10) na dose de 5 J /m
2
(Figura 2). A anlise da 307
mutagnese, utilizando o ensaio de mutagnese direta com rifampicina, mostrou que 308
somente o clone PLE1G no apresentou diferena significativa na frequncia de 309
mutao (Figura 3). Houve aumento expressivo na frequncia de mutao dos clones 310
PLE10B e PLE7B (Figura 3) e aquele que apresentou a maior frequncia de mutao, 311
semelhante a C. violaceum na dose 2,5 J /m
2
, foi o PLE7B (Figura 3). A diferena na 312
mutagnese observada nos trs clones mostrou ser dose independente. 313
Para avaliar os resultados da anlise genmica necessrio levar em 314
considerao que as ORFs de C. violaceum esto sendo estudadas em um sistema 315
diferente do de C. violaceum, e que a cepa de E. coli utilizada deficiente na resposta 316
SOS e, at o momento, no sabemos se C. violaceum possui todos os componentes 317
necessrios para desencadear a resposta SOS. Foi observado que esta bactria no 318
possui o gene lexA, nem o box SOS, sugerindo uma possvel expresso constitutiva dos 319
genes relacionados a este sistema ou que estes genes possam ser regulados por outra 320
protena ainda desconhecida (Duarte, et. al., 2004), ou at mesmo que a resposta ao 321
estresse que normalmente desencadeia a resposta SOS, como a luz UV, possa ocorrer 322
atravs de um sistema diferente. 323
De fato, apesar da aparente universalidade da resposta SOS, algumas excees 324
so vistas, como a ausncia de sequncias homlogas a lexA em classes e filos 325
bacterianos. Apesar de quase todas as classes de proteobacterias apresentarem 326
homlogos funcionais de LexA, nenhum foi identificado no grupos Bacterioidetes- 327
Green sulfur ou na subclasse Epsilonproteobacteria. Esta ausncia sugere uma histria 328
evolucionria mais rica do que aquela pensada para uma resposta universal e gera 329
inmeras questes que ainda carecem de resposta. Alm disso, foi visto que alguns 330
organismos que no possuem LexA parecem possuir mecanismos alternativos para 331
coordenar algumas de suas respostas ao dano de DNA. Como exemplo, a bactria 332
Streptococcus pneumoniae parece ter co-optado pelo regulon de competncia, envolvido 333
principalmente na transformao natural de DNA, sugerindo que parte do sistema de 334
resposta ao dano de DNA especfico fornecido por RecA-LexA possa ser algumas vezes 335
substitudo pela adaptao de outras redes regulatrias sensveis ao estresse (Erill, et al., 336
2007). Neste trabalho sero fornecidas evidncias para o entendimento da via de 337
resposta de C. violaceum ao estresse gerado pela luz UV. 338
339
100

Ausncia da resposta SOS clssica na famlia Neissericea 340
Estudos acerca do reparo por exciso de nucleotdeos (NER) e do reparo 341
recombinacional mostraram que estas vias esto relacionadas ao aumento da resistncia 342
de N. gonorrhoeae aps dano no DNA induzido por UV (Black et al., 1995; Hill et al., 343
2000), sendo NER a principal via de reparo. Cepas de E. coli recA
-
so extremamente 344
sensveis a UV, o que pode ser atribudo a sua inabilidade em desencadear a resposta 345
SOS. J cepas de N. meningitidis mutantes em recA mostram uma sensibilidade 346
moderada a UV, quando comparadas com o tipo selvagem, sugerindo que esta bactria 347
seja menos dependente de RecA para reparar os danos no DNA induzveis por UV, 348
quando comparado a E. coli (Davidsen et al., 2007). Hiptese reforada pela 349
observao da ausncia de um sistema SOS-like em N. gonorrhoeae aps exposio 350
UV e MMS (Black et al., 1998). 351
Apesar da proposta de ausncia de um sistema SOS em Neisseria recentemente 352
foi identificado um ortlogo de LexA (NG1427) em N. gonorrhoeae, que responde a 353
diferentes tipos de estresse de uma maneira independente ou dependente de RecA. 354
Frente ao estresse oxidativo, NG1427 responde independente de RecA e sua ativao se 355
d por oxidao, j quando a bactria foi exposta MMS e MMC a ativao de NG1427 356
mostrou-se RecA-dependente (Schook, et. al., 2011). 357
Como esta bactria pertence mesma famlia de C. violaceum, uma busca por 358
homlogos de NG1427 foi realizada utilizando o software Blastp. Aps anlise, foi 359
identificado o regulador transcricional CV0356 que apresenta e-value de 1e
-65
e os 360
mesmos domnios conservados que NG1427 (Figura 4). Estudos avaliando a resposta de 361
NG1427 UV no foram realizados emN. gonorrhoeae, assim no podemos afirmar 362
que esta protena esteja relacionada a este tipo de estresse. Alm disso, N. gonorrhoeae 363
e N. meningitidis so bactrias patognicas (Edwards and Apicella, 2004, Stephens et 364
al., 2007) e no esto constantemente expostas luz UV como C. violaceum. Desta 365
forma, a resposta das duas pode ser diferente ao mesmo tipo de estresse, ou o ortlogo 366
de LexA pode ser regulado de uma forma diferente, visto que as bactrias sofrem 367
presses seletivas diferentes. Assim, torna-se necessrio a realizao de estudos para 368
analisar a funcionalidade do ortlogo de LexA em C. violaceum e sua possvel relao 369
com a resposta a UV e a outros tipos de estresse. 370
371
Protenas relacionadas diviso celular 372
373
101

Utilizando a abordagem protemica foi possvel identificar, aps exposio luz 374
UVC, a protena de diviso celular FstZ (CV4338) (Tabela 1 e Figura 1). Anlise feita 375
pelo MicrobesOperon online revelou que esta ORF encontra-se em provvel operon 376
com as ORFs CV4335-CV4352 (Figura 5 e Tabela 2). Neste provvel operon foram 377
encontradas protenas relacionadas ao processo de diviso celular (FtsZ, FtsA, FtsQ, 378
FtsW, FtsI), a produo de peptidoglicano (DdlB, MurC, MurG, FtsW, MurD, MraY, 379
MurF e MurE), alm de protenas anotadas como hipotticas: CV4336, CV4350, 380
CV4351 e CV4352 (Tabela 2). Aps a re-anotao neste trabalho, estas ORFs 381
hipotticas foram classificadas como protena hipottica conservada, protena de diviso 382
celular FtsL e protenas S-adenosil-metiltransferase MraW e MraZ, respectivamente 383
(Tabela 2). 384
Na resposta SOS clssica a irradiao com luz UV normalmente induz uma 385
parada na diviso celular que decorrente da ligao de SulA protena FtsZ, 386
impedindo a polimerizao de FtsZ e consequente formao do anel citocintico 387
(Mukherjee, et al., 1998). 388
Anlises realizadas com a sequncia proteica de SulA, contra as protenas 389
preditas de C. violaceum, revelou que este gene no est presente em seu genoma. Em 390
bactrias que no possuem sulA outras protenas exercem esta funo, como no caso de 391
DivS em Corynebacterium glutamicum (Ogino, et al., 2008), SidA em Caulobacter 392
crescentus (Modell, et al., 2011), Rv2719c em M. tuberculosis (Chauhan, et. al., 2006) e 393
YneA em Bacillus subtilus (Kawai, et al, 2003). Porm, no foi possvel observar, 394
atravs de ferramentas de bioinformtica, homlogos destes genes no genoma de C. 395
violaceum. 396
O mecanismo de inibio da diviso celular difere entre estas protenas. Na 397
inibio mediada por DivS possvel observar um anel de FtsZ (anel-Z) no centro da 398
clula, porm a protena no interage com FtsZ, assim DivS pode inibi-la apenas 399
indiretamente (Ogino, et al., 2008). SidA no interage com FtsZ e as evidncias 400
sugerem que seu mecanismo de inibio acontea atravs da ligao com FtsW, o que 401
previne a constrio final do anel citocintico (Modell, et al., 2011). Rv2719c interfere 402
provavelmente de uma forma indireta na formao do anel-Z, localiza-se nos stios de 403
sntese de peptidoglicano nascente e apresenta uma atividade de hidrolase da parede 404
celular est relacionada sua funo inibitria (Chauhan, et. al., 2006). J YneA 405
provavelmente interfere na montagem das protenas de diviso que seguem a formao 406
do anel-Z (Kawai, et al, 2003). Em resumo, apenas em E. coli no observada a 407
102

formao do anel-Z e as outras protenas em questo no inibem a diviso atravs de 408
uma interao direta com FtsZ. Desta forma, mesmo que esteja acontecendo a inibio 409
da diviso celular em C. violaceum, por qualquer um desses mecanismos, os nveis de 410
FtsZ podem estar aumentados na clula, como observado neste trabalho (Tabela 1). 411
Protenas relacionadas inibio da diviso celular em C. violaceum aps exposio 412
UV ainda no foram identificadas. 413
Na anlise protemica foi identificada a protena hipottica codificada pela ORF 414
CV1365. Aps a re-anotao neste trabalho, foi verificado que esta protena apresenta 415
um e-value de 0.0 com vrias carboxipeptidases de funo exata ainda no estabelecida. 416
Esta protena apresenta vrios domnios preditos pelo CDD, um deles o da famlia 417
M14 de metalocarboxipeptidases (MCPs) e protenas relacionadas (cd00596) (e-value: 418
3,97e-
28
). MCPs podem ser classificadas baseadas no seu envolvimento com processos 419
fisiolgicos especficos. A subfamlia C inclui um tipo excepcional de atividade na 420
famlia MCP, que a de dipeptidil-peptidase do gamma-glutamyl-(L)-meso- 421
diaminopimelate peptidase I que est envolvido com o metabolismo da parede 422
bacteriana (cd00596). Hidrolases de peptidoglicanos podem ser classificadas como 423
muramidases, glicosaminidases, amidases, endopeptidases e carboxypeptidases, 424
dependendo da ligao especfica do peptidoglicano que ela cliva. Alm de um papel no 425
crescimento da parede celular, tem sido proposto que essas hidrolases estejam 426
envolvidas na separao da clula depois da diviso, no turnover da parede celular e na 427
reciclagem de muropeptideos (Scheffers e Pinho, 2005). 428
A protena inibitria Rv2719c de M. tuberculosis apresenta atividade de 429
hidrolase da parede celular que parece ser necessria para o remodelamento desta 430
Durante o crescimento da clula. Alm disso, apresenta o domnio de ligao ao 431
peptidoglicano de parede celular LysM, comum em protenas que exercem esta funo. 432
Porm, em Rv2719c, a deleo deste domnio no altera a atividade de hidrolase. Foi 433
prosposto que o mecanismo pelo qual Rv2719c regula a diviso celular ocorre pela 434
interferncia na sntese dos precussores de peptidoglicanos atravs da atividade de 435
hidrolase da parede celular (Chauhan, et. al., 2006). Devido presena do domnio 436
cd00596, que possui uma subfamlia envolvida com o metabolismo da parede 437
bacteriana, da carboxipeptidase identificada neste trabalho (CV1365) e na ausncia de 438
homlogos dos genes inibitrios da diviso celular, frente ao estresse em C. violaceum, 439
sugerimos a carboxipeptidase (CV1365) como uma protena candidata a um estudo mais 440
103

aprofundado acerca do seu papel na inibio da diviso celular frente ao estresse gerado 441
pela luz UVC emC. violaceum. 442
A protena hipottica YceG (CV3724) foi identificada por Sena (in press, 2011) 443
em um estudo onde a expresso desta ORF aumentou a resistncia da cepa de E. coli 444
recA
-
10 J /m
2
de luz UVC, porm sem aumento na taxa de mutagenicidade. Esta 445
protena hipottica possui um domnio da famlia YceG-like (e-value: 9.80e-116) na 446
poro N-terminal. Os nicos dados relacionados sua funo, alm dos de Sena e 447
colaboradores, so o da super-expresso em E. coli, que resulta na formao anormal de 448
biofilme e em retardo parcial do crescimento da bactria (Tenorio et al., 2003). A 449
protena inibitria da diviso celular frente ao estresse (YneA) de Bacillus subtilus 450
tambm possui o domnio YceG-like (8.32e-03) na poro N-terminal. A deleo de 451
yneA em Listeria monocytogenes resulta em elongao celular (van der Veen, et. al., 452
2010) e diminuio da formao de biofilme sob condies de fluxo contnuo (van der 453
Veen e Abee, 2010). J que a ORF CV3724 leva a um aumento da sobrevivncia em 454
uma cepa recA
-
exposta luz UVC, compartilha o mesmo domnio que a protena 455
inibitria YneA e como ambas esto relacionadas a formao de biofilme, sugerimos 456
que o aumento da sobrevivncia frente a luz UVC possa estar relacionado a ao desta 457
protena na inibio da diviso da bactria e/ou produo de biofilme em C. violaceum 458
submetida ao estresse. 459
Na resposta SOS, a parada da diviso celular ocorre para que leses geradas no 460
DNA sejam reparadas por um sistema livre de erro e para que aquelas leses que 461
bloqueiam a replicao, sejam reparadas atravs de um sistema propenso a erro que 462
promove o aumento da mutagnese, chamado de sntese transleso (TLS). As 463
polimerases relacionadas TLS so PolII (polB), PolIV (dinB) e PolV (umuC, umuD) 464
(Butala et. al., 2009). No estudo realizado por Sena (in press 2011), foi identificado o 465
clone PLH6A que possui as ORFs CV3721-3724. Este clone foi capaz de complementar 466
a cepa de E. coli recA
-
na dose de 9 J /m
2
de radiao UVC. Uma dessas ORFs, a 467
CV3722, corresponde subunidade da DNA polimerase III (holB). Isoladamente, 468
esta ORF apresentou uma alta frequncia de mutao. Sena (in press 2011) sugere que a 469
expresso de CV3722 em DH10B possa afetar o conjunto de clamp ativo favorecendo 470
a TLS e a restaurao da replicao aps o estresse genotxico induzido por tratamento 471
UV, o que justificaria o aumento expressivo da mutagnese apresentada por esta ORF. 472
473
Protenas envolvidas com a formao de biofilme 474
104

475
Atravs da anlise protemica foi identificada a protena phosphoenolpyruvate- 476
protein phosphotransferase (CV0980) ou enzima I (EI) e a provvel hidrolase (CV3605) 477
phosphohistidine phosphatase (SixA) (Tabela 1 e Figura 1). J na anlise genmica, foi 478
identificado o clone PLE1G que corresponde a ORF CV1667, uma protena hipottica 479
com domnio diguanilato ciclase/fosfodiesterase (GGDEF). 480
EI a primeira enzima de uma cascata de fosfotransferncia multicomponente 481
que medeia o transporte e fosforilao de acares selecionados, denominado sistema 482
fosfoenolpiruvato fosfotransferase (PTS) (Deutscher, et al., 2006). EI a enzima chave 483
do PTS requerida para o transporte de todos os substratos do sistema. A via de 484
fosfotransferncia tem incio quando o fosfoenolpiruvato transfere o grupo fosfato para 485
EI, que o transfere para outro componente da via, a protena histidina (Hpr). Muitos 486
genomas bacterianos codificam um homlogo de Hpr, a protena Fpr, que 487
preferencialmente transporta frutose. Hpr e Fpr transportam o grupo fosfato para as 488
enzimas II, que so complexos associados membrana com funo de transportar e 489
fosforilar os substratos especficos do PTS. As enzimas II compreendem subunidades 490
mltiplas (EIIA, EIIB, EIIC e algumas vezes EIID) (Titgemeyer, 1993). 491
O surgimento da enzima chave do PTS (EI), aps tratamento com UVC, 492
levantou a hiptese da existncia dessa via em C. violaceum. Utilizando ferramentas de 493
bioinformtica, uma busca por ORFs de C. violaceum homlogas aos componentes 494
(relacionados ao transporte de acares) do PTS de Vibrio cholerae foram realizadas. C. 495
violaceum apresenta as protenas Hpr, Fpr e enzimas da famlia II (EIIA e IIB/C) e no 496
possui protenas homlogas envolvidas no transporte de manitol, ascorbato e chitobiose 497
(Tabela 3 e Figura 6). A presena dos principais componentes desta via sugere que ela 498
seja funcional em C. violaceum, porm estudos mais aprofundados so necessrios para 499
testar esta hiptese. Este o primeiro trabalho mostrando evidncias da presena do 500
sistema PTS nesta bactria. Por esse sistema estar relacionado formao de biofilme 501
em diversos organismos (Loo, et al., 2003; Barriere, et al., 2005; Abranches, et al., 502
2006; Houot, et al., 2008; Munoz-Elias, et al., 2008) sugerimos que a funo dele na 503
resposta UV em C. violaceum esteja relacionada a regulao da formao do biofilme, 504
provavelmente como um mecanismo de proteo. 505
O alinhamento da protena hipottica com domnio GGDEF no CLUSTALW2 506
revelou resduos de ligao a GTP conservados na protena predita, alm de outros 507
105

resduos conservados presentes tambm em protenas da famlia GGDEF, o que permite 508
justificar sua funo na biossntese do nucleotdeo c-di-GMP (Figura 7). 509
Na maioria das enzimas o domnio GGDEF est relacionado funo GTPase, 510
converte GTP em cyclic di-guanosine-monophosphate (c-di-GMP), e sua expresso 511
estimulada a partir de sinais ambientais e intracelulares (oxignio, luz, pequenos 512
ligantes, sinal derivado de membrana) e gera respostas como a formao de biofilme, 513
ejeo de flagelo, mobilidade celular e regulao da expresso de diversos genes. Alm 514
disso, o c-di-GMP participa como segundo mensageiro na modulao do crescimento 515
bacteriano sobre superfcies, na interao clula-clula e clula-superfcie (J enal, 2004). 516
A protena codificada pela ORF CV1667 pode se ligar a uma variedade de 517
componentes efetores e controlar essas atividades, o que justifica seu envolvimento com 518
a patogenicidade e a adaptao de diversas bactrias. Ele coordena a expresso de 73 519
genes envolvidos com virulncia, motilidade e formao de biofilme (Ryjenkov et al., 520
2005; Hengge, 2009), como a ORF CV3721 que codifica a protena type 4 fimbrial 521
biogenesis (pilZ) que foi identificada na resposta de C. violaceum ao estresse gerado 522
pela radiao UVC (in press Sena, 2011). 523
Na bactria Acetobacter xylinum o c-di-GMP atua como ativador alostrico na 524
biossntese de celulose (Weinhouse, et. al., 1997). Em C. violaceum o nucleotdeo c-di- 525
GMP est envolvido no somente na formao da celulose, mas tambm na atividade do 526
flagelo e formao de fmbrias, todas essas funes relacionadas formao de biofilme 527
(Recouvreux, et.al., 2008). Auxiliando na hiptese da formao de biofilme em resposta 528
ao estresse em C. violaceum, foi visto que, frente inibio da replicao, a bactria 529
Pseudomonas aeruginosa tende a formar biofilme via fosfodiesterase Arr, que sintetiza 530
c-di-GMP. Os autores sugerem ainda que a resposta SOS possa estar envolvida na 531
formao do biofilme, neste caso, visto que a inibio da replicao normalmente 532
dispara uma reposta deste tipo (Gotoh et al., 2008). Um mecanismo similar pode estar 533
ocorrendo em C. violaceum. 534
Sugerimos que a complementao e ausncia de mutagnese (Figura 2 e 3) da 535
ORF CV1667 est relacionada funo do domnio GGDEF. Embora E. coli possua 536
protenas com a mesma funo, a de C. violaceum deve permitir um aumento na 537
expresso de protenas responsveis pela manuteno da integridade celular 538
favorecendo a sobrevivncia do organismo na condio de estresse imposta. Assim, as 539
ORFs CV1667 (GGDEF) e CV3721 (PilZ) possivelmente esto relacionadas resposta 540
de C. violaceum radiao UVC atravs da produo de biofilme. 541
106

Entre suas funes da protena SixA est a de desfosforilar ArcB que faz parte 542
do three component system: ArcA/ArcB/RssB. Neste sistema, ArcB tem a funo de 543
fosforilar ArcA e RssB. ArcA fosforilada capaz de reprimir diretamente a transcrio 544
de
S
(RpoS) e RssB de promover a sua protelise. Isto mantm os nveis basais de 545
RpoS na clula no exposta ao estresse (Mika and Hengge, 2005). Como a funo de 546
SixA a de desativar ArcB atravs de sua desfosforilao, o aumento da quantidade de 547
SixA em C. violaceum pode levar a inibio da transcrio e protelise de RpoS, 548
aumentando a quantidade desta protena regulatria na clula. 549
RpoS controla diversos genes que codificam protenas GGDEF e estas protenas 550
GGDEF devem exercer um papel na associao da formao de biofilme com a induo 551
da resposta ao estresse celular RpoS-dependente. Estudos de protemica e genmica 552
funcional j mostraram que um grande nmero de genes RpoS-dependentes esto 553
relacionados a resistncia ao estresse celular, proteo do DNA, dano oxidativo, a 554
produo de estruturas extracelulares e formao do biofilme . Alm disso, foi 555
observado que a deleo de rpoS afeta negativamente a formao de biofilme em E. coli 556
(Landini, 2009). 557
Sugerimos que frente ao estresse gerado pela luz UVC em C. violaceum, ocorra 558
a induo da produo de SixA que leva a produo de RpoS. Esta protena controla a 559
expresso de GGDEF que promove a sntese do segundo mensageiro c-di-GMP. O c-di- 560
GMP age como um regulador alostrico da celulose sintase de C. violassem induzindo a 561
produo deste EPS que contribuem para a formao do biofilme. A funo deste 562
biofilme como proteo radiao UVC deve ser melhor investigada. Mas, evidncias 563
da hiptese do estabelecimento de uma forma resistente aos estresses ambientais 564
atravs da produo de biofilme foram observadas em bactrias Gram-positivas, onde 565
peptdeos Quorum sensing podem induzir a esporulao em Bacillus spp., enquanto 566
estimulam a formao de biofilme em bactrias que no esporulam, como Streptococcus 567
e Staphylococcus spp., sugerindo que a produo de biofilme em bactrias que no 568
esporulam funcione tambm como um mecanismo de defesa (Landini, 2009). 569
570
Protenas relacionadas ao transporte 571
Neste trabalho foi identificado, por meio da anlise protemica, o surgimento de 572
dois spots, um para uma protena porin signal peptide (CV3104) e outro para uma 573
protena de aglutinao (CV0308) (Tabela 1 e Figura 1). A primeira apresenta 574
similaridade com a proteina OmpC da prpria C. violaceum (CV3424) e a segunda 575
107

apresenta um e-value de 3e
-169
com uma protena de membrana externa da famlia TolC. 576
Ambas no se encontram organizadas em provveis operons. 577
A resposta SOS clssica diminui a produo das protenas de membrana OmpC 578
e TolC. Porm, essas protenas, no presente trabalho, tiveram suas expresses 579
aumentadas, o que sugere que elas possam exercer funes distintas na resposta a UV 580
em C. violaceum. De fato, foi observado que OmpC teve sua expresso aumentada 581
Durnte a formao de biofilme (Schembri, et al., 2003) e Durnte o attachment de E. 582
coli em superfcies abiticas (Prigent-Combaret et al., 1999). J Egler e colaboradores 583
(2005) propuseram que o aumento da expresso de OmpC estaria relacionada ao 584
estresse induzido por metais, onde a resposta seria mediada pelo regulon RpoE. Alm 585
disso, foi visto uma relao direta entre OmpC e RpoE, onde esta protena de membrana 586
externa ativa a protease DegS, que cliva RseA (Alba et al., 2004). RseA um fator anti- 587
sigma que pode formar um complexo inibitrio com RpoE bloqueando sua ligao 588
RNA polimerase (Campbell et al., 2003). Se RseA clivada, RpoE pode ento ligar-se a 589
RNA polimerase e ativar os genes por ele regulados. Sugerimos que o aumento da 590
expresso de OmpC possa estar relacionado formao de biofilme e ativao do 591
regulador da resposta ao estresse do envelope RpoE, frente ao estresse induzido pela 592
radiao UV. 593
Rosner and Martin (2009) propuseram que em cepas de E.coli selvagem o 594
metabolismo normal gera certos metabolitos intracelulares que induzem a regulao 595
positiva dos ativadores transcricionais MarA, SoxS, e Rob. Esses ativadores, por sua 596
vez, regulam positivamente tolC, aumentando a capacidade de excreo de metabolites 597
via TolC, resultando na diminuio das concentraes dos trigger metabolites (TMs) 598
e, consequentemente, na restauraao dos nveis basais dos ativadores. A natureza desses 599
TMs ainda no foi estabelecida, mas comparaes de metabolomas de cepas selvagem e 600
mutante em tolC poderiam ser teis nesta identificao. Neste contexto, sugerimos que 601
a protena de aglutinao (CV0308), que apresenta similaridade com uma protena de 602
membrana externa da famlia TolC, possa ser til na secreo de TMs produzidos direta 603
e/ou indiretamente pela exposio radiao UVC. 604
605
Protenas relacionadas ao ciclo de bacterifagos 606
Neste trabalho foram identificadas, na anlise protemica, trs ORFs 607
relacionadas ao ciclo de bacterifagos: CV0350, uma phage sheath protein, relacionada 608
ao bacterifago CvP1 (Almeida, et. al., 2004), CV0409 uma bacteriophage tail sheath 609
108

protein relacionada ao fago CvP2 (Almeida, et. al., 2004) e CV4160, que codifica a 610
subunidade alfa da RNA polimerase (rpoA) (Tabela 1 e Figura 1). A ltima tambm foi 611
identificada no screening genmico (clone PLE12H) onde foi capaz de complementar a 612
funo da cepa recA
-
e aumentar a frequncia de mutao (Figuras 2 e 3). 613
A protena RpoA bastante conservada na maioria dos organismos e em E. coli, 614
apresenta dois domnios, um N-terminal (alpha-NTD) e um C-terminal (alpha-CTD), o 615
primeiro essencial a formao da RNA polimerase e para a transcrio basal, enquanto 616
o segundo est envolvido na interao com reguladores transcricionais e com elementos 617
promotores (Kedzierska et al., 2007). 618
Kedzierska e colaboradores (2007) observaram que RpoA era necessria para a 619
produo do repressor (CI), a partir da ligao ao prprio promotor de CI, o que leva a 620
manuteno do ciclo lisognico do fago. Tambm foi observado que RpoA interage 621
com a protena ribossomal L2 (RPL2) formando um complexo transcricional 622
multiprotico, onde RPL2 age como ativador transcricional de um operon ribossomal 623
aps interao com RpoA (Rippa et al., 2010). Sugerimos que frente ao estresse gerado 624
pela radiao UVC, uma protena seja produzida e interaja com RpoA (CV4160), 625
modulando negativamente a expresso do repressor do ciclo ltico dos bacterifagos 626
CvP1 (CV0350) e CvP2 (CV0409). Este o primeiro trabalho que indica que RpoA 627
importante na resposta de C. violaceum a este tipo de estresse. Futuros estudos so 628
necessrios para estabelecer a funo de RpoA neste contexto. 629
630
Protenas hipotticas 631
Duas ORFs que codificam protenas da famlia Thij/PfpI foram identificadas 632
neste estudo. A ORF CV2336 foi identificada na anlise protemica e a ORF CV1313, 633
pela anlise da biblioteca genmica (in press Sena, 2011). A ltima est presente no 634
clone PLE10B que possui mais duas ORFs hipotticas sem domnios funcionais. 635
Embora estejam em sequncia, a anlise pelo MicrobesOnline Operon Prediction 636
mostrou que estas ORFs no fazem parte de uma mesma unidade transcricional. A ORF 637
CV1313 apresenta e-value de 2e
-89
e identidade mxima de 61% com a isonitrile 638
hydratase de Ralstonia sp. 639
A superfamlia DJ -1/ThiJ /PfpI inclui protenas que exercem muitas funes 640
incluindo as de chaperona/peptidase (Malki, et. al., 2003; Quigley, et. al., 2003; Sastry, 641
et. al., 2002) protease (Blumentals, et. al., 1990; Du, et. al., 2000), catalase (Lee, et. al., 642
2003) resposta geral ao estresse (Abdallah, et. al., 2006) e biossntese de tiamina 643
109

(Bandyopadhyay and Cookson, 2003). Pouco se sabe a respeito da funo das protenas 644
desta famlia, mas a maior parte das que j foram caracterizadas est envolvida na 645
resposta a diferentes tipos de estresse. YhbO, por exemplo, protege E. coli contra 646
muitos estresses ambientais. Na ausncia desta protena a bactria apresenta uma maior 647
sensibilidade ao estresse oxidativo, trmico, cido, alcalino, osmtico e aquele gerado 648
pela luz UVC (Abdallah, et. al., 2006). Em P. aeruginosa os genes PA14-04650 e 649
PA0355 (seu ortlogo em PAO1, com 99,0% de identidade) codifica uma funo 650
antimutator que est envolvida na resistncia ao estresse, incluindo oxidao, calor, 651
salinidade e radiao UVC. Alm disso, a ausncia desses genes diminui a capacidade 652
de formao de biofilme quando comparada com a bactria selvagem (Rodrguez-Rojas, 653
et. al., 2009). Nos ensaios de mutagnese realizados neste trabalho, a ORF CV2336 654
aumentou a frequncia de mutao no sistema de E. coli deficiente na resposta SOS 655
(Figura 3). Possivelmente este aumento na mutagnese possa refletir um mecanismo de 656
defesa da bactria, onde a mutagnese aumentada para permitir a sobrevivncia da 657
bactria frente ao estresse e este mecanismo pode ser diferente daquele observado nos 658
genes PA14-04650 e PA0355 os quais apresentam uma funo antimutator. Todavia, 659
deve-se levar em considerao que ainda no se tem conhecimento acerca da presena 660
ou ausncia do sistema SOS em C. violaceum, assim no seria surpreendente se a 661
resposta da protena da famlia ThiJ /PfpI gerasse outro fentipo quando analisado no 662
prprio sistema deC. violaceum. 663
O alinhamento entre as sequencias proteicas de membros da famlia ThiJ /PfpI de 664
C. violaceum CV1313 e CV2336, Ralstonia sp., P. putida (PPIhydr), P. aeruginosa 665
PAO1 (PAOThPf), P. aeruginosa UCBPP-PA14 (PAUThPf), Photorhabdus 666
asymbiotica (PAAraCf), C. crescentus (CCThPff) e Ralstonia pickettii (RPThPff) 667
(Figura 8), mostra a conservao do resduo de cistena, o qual apresenta a atividade 668
cataltica e que caracteriza os membros desta famlia (Du et al., 2000). 669
Dada a ampla variedade de funes dos membros da famlia ThiJ /PfpI e a 670
presena do resduo conservado de cistena (C-100/138) ser comum a todas as diferentes 671
protenas que apresentam este domnio(Goda et al., 2002), a funo das duas ORFs na 672
reposta de C. violaceum radiao UV pode estar associada a um amplo espectro de 673
atividades. Estudos posteriores so necessrios para caracterizar a funo destas 674
protenas neste contexto. 675
Na anlise genmica foi identificado o clone PLE7B que contm a ORF 676
CV0390, uma protena hipottica com domnio isocitrato liase e fosfoenolpiruvato 677
110

mutase (ICL/PEPM) e a ORF CV0391, a protena ADA (Methylated-DNA-[protein]- 678
cysteine S-methyltransferase). 679
Em bactrias a enzima isocitrato liase (AceA) que representa o primeiro domnio 680
na ORF CV0390, participa do metabolismo de carboidratos, convertendo isocitrato a 681
succinato mais glioxilato, o primeiro passo da via do glioxilato (Matsuoka e Mcfadden, 682
1988). O segundo domnio desta protena est presente em enzimas fosfoenolpiruvato 683
mutase (PEPM) que catalisa a converso de fosfoenolpiruvato a fosfonopiruvato, o 684
passo inicial na formao de muitos compostos fosfonatos. Estes so amplamente 685
distribudos na natureza como componentes de lipdeos, oligossacardeos e protenas, 686
alm de diversos metablitos secundrios com atividade antibacteriana, antimalria e 687
herbicida (Mukhamed e Glushenkova, 2000). A protena ADA est relacionada ao 688
reparo de danos no DNA gerados por estresse oxidativo e alquilao e encontra-se 689
duplicada no genoma de C. violaceum (Duarte et al., 2004). 690
O aumento da frequncia de mutao deste clone provavelmente no est 691
relacionado funo de ADA, j que a presena desta protena diminue a freqncia de 692
mutagnese espontnea (Taverna e Sedgwick, 1996). Sugerimos que o aumento de 693
mutagenicidade observado com este clone deve-se a atuao da protena hipottica com 694
domnio isocitrato liase e fosfoenolpiruvato mutase (CV0390) envolvida no 695
fornecimento de energia essencial aos processos celulares de defesa e sobrevivncia. 696
Porm, a anlise das ORFs separadamente ajudar a responder esta questo. 697
698
Protenas relacionadas resposta LexA-independente de E. coli 699
A resposta independente de LexA, em E. coli, mostra o aumento da expresso de 700
genes relacionados a maquinaria de replicao, metabolismo das purinas e pirimidinas, 701
protenas heat shock ou chaperonas, diversos genes envolvidos com o metabolismo de 702
RNA e muitos transcritos que apresentam pouca ou nenhuma caracterizao funcional, 703
at o momento do estudo (Courcelle et al., 2001). Na anlise protemica de C. 704
violaceum aps tratamento com UVC, como observado na resposta LexA-independente 705
de E.coli, surgiram protenas relacionadas ao metabolismo de purinas (CV0546 e 706
CV4058) e pirimidinas (CV3804) e protena de choque trmico ou chaperonas 707
(CV1643, CV1318 e CV4014) (Figura 1 e Tabela 1). 708
As vias de resposta identificadas neste trabalho so em parte tambm observadas 709
na resposta SOS clssica, como a inibio da diviso celular, aumento da mutagnese 710
associada TLS e induo do ciclo ltico de bacterifagos. J a produo de biofilme e 711
111

o aumento da expresso das protenas de transporte das famlias TolC e OmpC no so 712
observadas nesta tipo de resposta. Apesar de parte dessa resposta ser semelhante 713
encontrada na resposta SOS clssica, ainda no se tem dados suficientes para afirmar 714
que C. violaceum possui uma resposta SOS-like, principalmente pela ausncia de 715
evidncias que demonstrem a atividade de uma protena LexA-like neste organismo. 716
Assim, sugerimos que a resposta de C. violaceum luz UV ocorra atravs de um 717
mecanismo geral de resposta ao estresse que induz a inibio da diviso celular 718
(CV4338, CV1365 e/ou CV3724) para permitir o reparo dos danos causados ao DNA, 719
inclusive por um reparo propenso a erro com a participao de CV3722 (HolB). Nesta 720
reposta, o ciclo ltico dos bacterifagos CvP1 (CV0350) e CvP2 (CV0409) disparado 721
com a participao de CV1667 (RpoA) e com o envolvimento de uma possvel protena 722
regulatria ainda desconhecida. Protenas relacionadas produo de biofilme tambm 723
participam. O mecanismo regulatrio envolve o aumento da produo de SixA, que 724
induz o aumento da quantidade da protena regulatria RpoS que induz a produo da 725
protena hipottica com domnio GGDEF (CV1667). CV1667 promove a produo do 726
segundo mensageiro c-di-GMP que age induzindo a produo de celulose que contribui 727
para a formao do biofilme, juntamente com PilZ (CV3721) e OmpC (CV3104). O 728
sistema PTS (CV0980) tambm participa da regulao da produo desse biofilme. O 729
excesso de metablitos gerados pelos danos causados pelo estresse gerado pela luz UV 730
so excretados via TolC (CV0308). Protenas relacionadas com o metabolismo das 731
purinas e pirimidinas (CV0546, CV3804, CV4058), as protenas de choque trmico ou 732
chaperonas (CV1643, CV1318 e CV4014) e de protenas relacionadas ao fornecimento 733
de energia (CV0390) tambm tem sua expresso aumentada (Figura 9). Alm destas, 734
temos as protenas com funo ainda no estabelecida, como as da famlia ThiJ /PfpI 735
(CV2336 e CV1313), que parecem exercem um papel importante nessa resposta, visto 736
que foram identificadas nas duas abordagens utilizadas neste trabalho. Futuros estudos 737
sero teis para entender mais detalhadamente a via e confirmar as hipteses levantadas 738
neste trabalho. 739
740
4. Referncias 741
742
112

Abdallah, J ., Kern, R., Malki, A., Eckey, V. and Richarme, G. Cloning, expression, and 743
purification of the general stress protein YhbO from Escherichia coli. Protein Expr 744
Purif. 47(2):455-60, 2006. 745
746
Abranches, J ., Candella, M. M., Wen, Z. T., Baker, H. V. and. Burne. R. A.Different 747
roles of EIIABMan and EIIGlc in regulation of energy metabolism, biolm 748
development, and competence in Streptococcus mutans. J. Bacteriol. 188: 37483756, 749
2006. 750
751
Alba, B.M., and Gross, C.A. Regulation of the Escherichia coli sigma E-dependent 752
envelope stress response. Mol. Microbiol. 52: 613619, 2004. 753
754
Almeida, A., Trevilato, P.B., Bartoleti, L.A., Proena-Mdena, J . L., Hanna, E.S., 755
Gregoracci, G.B. and Brocchi, M. Bacteriophages and insetion sequences of 756
Chromobacterium violaceum ATCC 12472. Genet Mol Res 3(1): 76-84, 2004. 757
758
Altschul, S.F., Madden, T.L., Schffer, A.A., Zhang, J ., Zhang, Z., Miller, W. and 759
Lipman, D.J . Gapped BLAST and PSI-BLAST: a new generation of protein database 760
search programs, Nucleic Acids Res, 25 (1997) 3389-3402. 761
762
Antonisamy, P., Kannan, P. and Ignacimuthu, S. Anti-diarrhoeal and ulcer-protective 763
effects of violacein isolated from Chromobacterium violaceum in Wistar rats. 764
Fundamental & Clinical Pharmacology 23(4):483-90, 2009. 765
766
Antonisamy, P.; Ignacimuthu, S. Immunomodulatory, analgesic and antipyretic effects 767
of violacein isolated from Chromobacterium violaceum. Phytomedicine. 17(3-4):300-4, 768
2010. 769
770
Bandyopadhyay, S. and Cookson, M.R. Evolutionary and functional relationships 771
within the DJ 1 superfamily. BMC Evol. Biol. 4: 612, 2004. 772
773
Barriere, C., Veiga-da-Cunha, M., Pons, N., Guedon, E., van Hijum, S. A., Kok, J ., 774
Kuipers, O. P., Ehrlich, D. S. and Renault, P. Fructose utilization in Lactococcus lactis 775
113

as a model for low-GC gram-positive bacteria: its regulator, signal, and DNA-binding 776
site. J. Bacteriol. 187: 37523761, 2005. 777
Black, C. G., Fyfe, J . A. and Davies, J . K. A promoter associated with the neisserial 778
repeat can be used to transcribe the uvrB gene from Neisseria gonorrhoeae. J. 779
Bacteriol. 177:19521958, 1995. 780
781
Black, C.G., Fyfe, J .A.M and Davies, J .K.. Absence of an SOS-like system in Neisseria 782
gonorrhoeae. Gene 208: 6166, 1998. 783
784
Blumentals, I.I., Robinson, A.S. and Kelly, R.M. Characterization of sodium dodecyl 785
sulfate-resistant proteolytic activity in the hyperthermophilic archaebacterium 786
Pyrococcus furiosus. Appl Environ Microbiol. 56(7):1992-8, 1990. 787
788
Brito, F. A., Carvalho, C.M.B., Santos, F.R., Gazzinelli, R. T., Oliveira, S.C., Azevedo, 789
V. and Teixeira, S.M.R. Chromobacterium violaceum genome: molecular mechanisms 790
associated with pathogenicity. Genet Mol Res 3(1): 148-161, 2004. 791
792
Butala, M., Zgur-Bertok, D. and Busby, S.J . The bacterial LexA transcriptional 793
repressor. Cell. Mol. Life Science, 66(1): 82-93, 2009. 794
795
Campbell, S.C., Olson, G.J ., Clark, T.R. and Mcfeters, G.J . Biogenic production of 796
cyanide and its application to gold recovery. Ind. Microbiol. Biotechnol. 26: 134139, 797
2001. 798
799
Campbell, E. A., Tupy, J . L., Gruber, T. M., Wang, S., Sharp, M. M., Gross, C. A. and 800
Darst, S. A. Crystal structure of Escherichia coli sigmaE with the cytoplasmic domain 801
of its anti-sigma RseA. Mol. Cell 11: 10671078, 2003. 802
803
Chauhan, A., Lofton, H., Maloney, E., Moore, J ., Fol, M., Madiraju, M.V., and 804
Rajagopalan, M. Interference of Mycobacterium tuberculosis cell division by Rv2719c, 805
a cell wall hydrolase. Mol Microbiol 62: 132147, 2006. 806
807
Corpe, W.A. Factors influencing growth and polysaccharide formation by strains of 808
Chromobacterium violaceum. J Bacteriol 88:14331441, 1964. 809
114

Courcelle, J ., Khodursky, A., Peter, B., Brown, P.O. and Hanawalt, P.C. Comparative 810
gene expression proles following uv exposure in wild-type and SOS-Decient 811
Escherichia coli. Genetics 158: 4164, 2001. 812
813
Davidsen, T., Tuven, H.K., Bjrs, M., Rdland E.A. and Tnjum, T.. Genetic 814
interactions of dna repair pathways in the pathogen Neisseria meningitides. Journal of 815
Bacteriology, 189(15): 57285737, 2007. 816
817
Deutscher, J ., Francke, C. and Postma, P. W. How phosphotransferase system-related 818
protein phosphorylation regulates carbohydrate metabolism in bacteria. Microbiol. Mol. 819
Biol. Rev. 70: 9391031, 2006. 820
821
Dewitt, S.K. and Adelberg, E.A. The Occurrence of a Genetic Transposition in a Strain 822
of Escherichia coli. Genetics, 47(5):577-585, 1962. 823
824
Du, X., Choi, I.G., Kim, R., Wang, W., J ancarik, J ., Yokota, H. and Kim, S.H. Crystal 825
structure of an intracellular protease from Pyrococcus horikoshii at 2-A resolution. Proc 826
Natl Acad Sci U S A. 97(26):14079-84, 2000. 827
828
Duarte, F.T., Carvalho, F.M., Bezerra, e Silva U., Scortecci, K.C., Blaha, C.A., Agnez- 829
Lima, L.F. and Batistuzzo de Medeiros, S.R. DNA repair in Chromobacterium 830
violaceum. Genet Mol Res. 3(1):167-80, 2004. 831
832
Durn, N., Erazo, S. and Campos, V. Bacterial chemistry. II. Antimicrobial 833
photoproduct from pigment of Chromobacterium violaceum, An. Acad. Bras. Cien. 55: 834
231234, 1983. 835
836
Durn N. & Menck, C.F. Chromobacterium violaceum: a review of pharmacological 837
and industrial perspectives. Crit. Rev. Microbiol. 27: 201222, 2001. 838
839
Edwards, J .L. and Apicella, M.AThe molecular mechanisms used by Neisseria 840
gonorrhoeae to initiate infection differ between men and women. Clin Microbiol Rev 841
17: 965981, 2004. 842
115

Egler, M., Grosse, C., Grass, G. and Nies, D.H.. Role of the extracytoplasmic function 843
protein family sigma factor RpoE in metal resistance of Escherichia coli. Journal of 844
Bacteriology, 187(1): 22972307, 2005. 845
846
Erill, I., Campoy, S. and Barbe, J . Aeons of distress: an evolutionary perspective on the 847
bacterial SOS response. FEMS Microbiol Rev 31: 637656, 2007. 848
849
Ferreira, C.V., Bos, C.L., Versteeg, H.H., J usto, G.Z., Durn, N. and Peppelenbosch, 850
M.P. Molecular mechanism of violacein-mediated human leukemia cell death. Blood 851
104: 1459-1464, 2004. 852
853
Finn, R.D., Mistry, J ., Tate, J ., Coggill, P., Heger, A., Pollington, J .E., Gavin, O.L., 854
Gunasekaran, P., Ceric, G., Forslund, K., Holm, L., Sonnhammer, E.L., Eddy, S.R. and 855
Bateman, A. The Pfam protein families database. Nucleic acids research 38: D211-22, 856
2010. 857
858
Fujii, S., Isogawa, A. and Fuchs, R.P. RecFOR proteins are essential for Pol V-mediated 859
translesion synthesis and mutagenesis. The EMBO Journal 25: 57545763, 2006. 860
861
Goda, M., Hashimoto, Y., Takase, M., Herai, S., Iwahara, Y., Higashibata, H. and 862
Kobayashi, M. Isonitrile Hydratase from Pseudomonas putida N192. Cloning, 863
sequencing, gene expression, and identification of its active amino acid residue. 864
Journal of Biological Chemistry, 277(48): 45860-45865. 2002. 865
866
Gotoh, H., Zhang, Y., Dallo, S.F., Hong, S., Kasaraneni, N. and Weitao, T. 867
Pseudomonas aeruginosa, under DNA replication inhibition, tends to form biofilms via 868
Arr. Res Microbiol. 159(4): 294-302, 2008. 869
870
Gourson, C., Benhaddou, R., Granet, R., Krausz, P., Verneuil, B., Branland, P., 871
Chauvelon, G., Thibault, J .F. and Saulnier, L. Valorization of maize bran to obtain 872
biodegradable plastic films, Journal of Applied Polymer Science, 74: 30403045, 1999. 873
874
116

Haun, M., Pereira, M.F., Hoffman, M.E., J oyas, A., Campos, V., Lizardi, L.D., de 875
Castro, S. and DURN, N. Bacterial chemistry. VI: Biological activities and 876
cytotoxicity of 1,3-dihydro-2H-indol-2-one derivatives. Biol. Res. 25: 21-25, 1992. 877
878
Hill, S. A. Neisseria gonorrhoeae recJ mutants show defects in recombinational repair 879
of alkylated bases and UV-induced pyrimidine dimers. Mol. Gen. Genet. 264:268275, 880
2000. 881
882
Houot, L. and Watnick, P. I. A novel role for enzyme I of the Vibrio cholerae 883
phosphoenolpyruvate phosphotransferase system in regulation of growth in a biolm. J . 884
Bacteriol. 190: 311320, 2008. 885
886
Hungria, M., Nicols, M. F., Guimares, C. T., J ardim, S. N., Gomes, E. A. and 887
Vasconcelos, A. T. R. Tolerance to stress and environmental adaptability of 888
Chromobacterium violaceum. Genet. Mol. Res. 3(1): 102-116, 2004. 889
890
J anion, C. Inducible SOS response system of DNA repair and mutagenesis in 891
Escherichia coli. Int. J. Biol. Sci. 4: 338-344, 2008. 892
893
J enal, U. Cyclic di-guanosine-monophosphate comes of age: a novel secondary 894
messenger involved in modulating cell surface structures in bacteria? Current 895
Opinion in Microbiology 7(2): 185-191, 2004. 896
897
J ing, H.B., Yuan, J ., Wang, J ., Yuan, Y., Zhu, L., Liu, X.K., Zengh, Y.L., Wei, K.H., 898
Zhang, X.M., Geng, H.R., Duan, Q., Feng, S.Z., Yang, R.F., Cao, W.C., Wang, H.L. 899
and J iang, Y.Q. Proteome analysis of Streptococcus suis serotype 2. Proteomics 8 333- 900
349, 2008. 901
902
Kawai, Y., Moriya, S. and Ogasawara, N.. Identication of a protein, YneA, responsible 903
for cell division suppression during the SOS response in Bacillus subtilis. Molecular 904
Microbiology 47(4): 11131122, 2003. 905
906
Kedzierska, B., Szambowska, A., Herman-Antosiewicz, A., Lee, D.J ., Busby, S.J .W., 907
Wegrzyn, G. and Thomas, M.S. The C-terminal domain of the Escherichia coli RNA 908
117

polymerase subunit plays a role in the CI-dependent activation of the bacteriophage 909
p
M
promoter. Nucleic Acids Research, 35(7): 23112320, 2007. 910
911
Kolibachuk, D., Miller, A. and Dennis, D. Cloning, molecular analysis, and expression 912
of the polyhydroxyalkanoic acid synthase (phaC) gene from Chromobacterium 913
violaceum. Applied and Environmental Microbiology, 8, 65: 35613565, 1999. 914
915
Landini, P. Cross-talk mechanisms in biolm formation and responses to environmental 916
and physiological stress in Escherichia coli. Research in Microbiology, 160:259-266, 917
2009. 918
919
Lee, S.J ., Kim, S.J ., Kim, I.K., Ko, J ., J eong, C.S., Kim, G.H., Park, C., Kang, S.O., 920
Suh, P.G., Lee, H.S. and Cha, S.S. Crystal structures of human DJ -1 and Escherichia 921
coli Hsp31, which share an evolutionarily conserved domain. J Biol Chem. 922
278(45):44552-9, 2003. 923
924
Leon, L.L., Miranda, C.C., de Souza, A.O. and Durn, N. Antileishmanial activity of 925
the violacein extracted from Chromobacterium violaceum. J Antimicrob Chemother. 926
48(3):449-50, 2001. 927
928
Lichstein, H.C. and van de Sand, V.F. Violacein, an antibiotic pigment produced by 929
Chromobacterium violaceum, J . Infect. Dis. 76 (1945) 4751. 930
931
Lichstein, H.C. and van de Sand, V.F. The antibiotic activity of violacein, prodigiosin, 932
and phthiocol. J. Bacteriol. 52: 145146, 1946. 933
934
Loo, C. Y., Mitrakul, K., Voss, I. B., Hughes, C. V. and Ganeshkumar, N. Involvement 935
of an inducible fructose phosphotransferase operon in Streptococcus gordonii biolm 936
formation. J. Bacteriol. 185: 62416254, 2003. 937
938
Malki, A., Kern, R., Abdallah, J . N and Richarme G. Characterization of the 939
Escherichia coli YedU protein as a molecular chaperone. Biochem Biophys Res 940
Commun. 301(2):430-436, 2003. 941
118

Marchler-Bauer, A., et. al. CDD: a Conserved Domain Database for the functional 942
annotation of proteins. Nucleic Acids Res, 39: D225D229, 2011. 943
944
Martin, J .P. and Richards, S.J . Decomposition and binding action of a polysaccharide 945
from Chromobacterium violaceum in soil. J Bacteriol 85:12881294, 1963. 946
947
Martinelli, D. Bachofen, R. and Brandl, H. Effect of medium composition, flow rate, 948
and signaling compounds on the formation of soluble extracellular materials by biofilms 949
of Chromobacterium violaceum. Appl Microbiol Biotechnol 59:278283, 2002. 950
951
Matsuoka, M. and Mcfadden, B.A. Isolation, Hyperexpression, and Sequencing of the 952
aceA Gene Encoding Isocitrate Lyase in Escherichia coli. Journal of Bacteriology, 953
170(10): 4528-4536, 1988. 954
955
Melo, P.S., Maria, S.S., Vidal, B.C., Haun, M. and Durn, N. Cytotoxicity and 956
induction of apoptosis in V79 cells in Vitro. Cell Dev. Biol. Anim. 36: 539543, 2000. 957
Michel, B. After 30 years of study, the bacterial SOS response still surprises us. PLoS 958
Biol 3(7): e255, 2005. 959
960
Mika, F. and Hengge, R. A two-component phosphotransfer network involving ArcB, 961
ArcA, and RssB coordinates synthesis and proteolysis of (RpoS) in E. coli. Genes & 962
Development 19:27702781, 2005. 963
964
Miller, J .H. A short course in bacterial genetics (A laboratory manual and handbook for 965
Escherichia coli and related bacteria). Cold Spring Harbor Laboratory Press, 1992. 966
967
Modell, J .W., Hopkins, A.C. and Laub M.T. A DNA damage checkpoint in Caulobacter 968
crescentus inhibits cell division through a direct interaction with FtsW. Genes Dev. 969
25(12):1328-43, 2011. 970
971
Mukhamed, K.S. and Glushenkova, A.I. Natural phosphonolipids. Chemistry of 972
Natural Compounds 36(4): 329-341, 2000. 973
119

Mukherjee, A., Cao, C. and Lutkenhaus, J . Inhibition of FtsZ polymerization by SulA, 974
an inhibitor of septation in Escherichia coli. Proc Natl Acad Sci U S A. 95(6): 2885-90, 975
1998. 976
977
Munoz-Elias, E. J ., Marcano, J . and Camilli, A. Isolation of Streptococcus pneumoniae 978
biolm mutants and their characterization during naso-pharyngeal colonization. Infect. 979
Immun. 76: 50495061, 2008. 980
981
Neuhoff, V. , Arold, N., Taube, D. and Ehrhardt, W. Improved staining of proteins in 982
polyacrylamide gels including isoelectric focusing gels with clear background at 983
nanogram sensitivity using Coomassie Brilliant Blue G-250 and R-250, 984
Electrophoresis, 9 255262, 1988. 985
986
Quigley, P.M., Korotkov, K., Baneyx, F., Hol, W.G. The 1.6-A crystal structure of the 987
class of chaperones represented by Escherichia coli Hsp31 reveals a putative catalytic 988
triad. Proc Natl Acad Sci U S A. 100(6):3137-42, 2003. 989
990
Rippa,V., Cirulli, C., Di Palo, B., Doti, N., Amoresano, A. and Duilio, A. The 991
Ribosomal Protein L2 Interacts with the RNA Polymerase Subunit and Acts as 992
a Transcription Modulator in Escherichia coli. Journal of Bacteriology, 192(7): 1882- 993
1889, 2010. 994
995
Rodrguez-Rojas, A. and Blazquez, J. The Pseudomonas aeruginosa pfpI Gene Plays an 996
Antimutator Role and Provides General Stress Protection. J ournal of Bacteriology 997
191(3): 844850, 2009. 998
999
Ryjenkov, D.A., Tarutina, M., Moskvin, O.V. and Gomelsky, M. Cyclic 1000
Diguanylate Is a Ubiquitous Signaling Molecule in Bacteria: Insights into 1001
Biochemistry of the GGDEF Protein Domain. Journal of Bacteriology, 187(5): 1792 1002
1798, 2005. 1003
1004
Santos, P.M., Benndorf, D. and S-Correia, I. Insights into Pseudomonas putida 1005
KT2440 response to phenol-induced stress by quantitative proteomics, Proteomics, 4 1006
26402652, 2004. 1007
120

Sastry MS, Korotkov K, Brodsky Y, Baneyx F. Hsp31, the Escherichia coli yedU gene 1008
product, is a molecular chaperone whose activity is inhibited by ATP at high 1009
temperatures. J Biol Chem. 277(48):46026-34, 2002. 1010
1011
Sena, D.C.C. Identificao de genes em Chromobacterium violaceum Relacionados 1012
Resposta ao Estresse. 88 p. 2011. 1013
1014
Schook, P. O. P., Stohl, E.A, Criss, A.K. and H. Seifert, S. The DNA-binding activity of 1015
the Neisseria gonorrhoeae LexA orthologue NG1427 is modulated by oxidation. 1016
Molecular Microbiology 79(4), 846860, 2011. 1017
1018
Smith, A.D. and Hunt, R.J . Solubilisation of gold by Chromobacterium violaceum. J. 1019
Chem. Technol. Biotechnol. 35: 110116, 1985. 1020
1021
Souza, A.O., Aily, D.C.G., Sato, D.N. and Durn, N. Atividade da violacena in vitro 1022
sobre o Mycobacterium turbeculosis H37RA. Rev. Inst. Adolfo Lutz 58: 5962, 1999. 1023
1024
Ogino, H., Teramoto, H., Inui, M. and Yukawa, H. DivS, a novel SOS-inducible cell- 1025
division suppressor in Corynebacterium glutamicum. Molecular Microbiology (2008) 1026
67(3): 597608, 2008. 1027
1028
Price, M.N., Huang, K.H., Alm, E.J . and. Arkin, A.P.A Novel Method for Accurate 1029
Operon Predictions in All Sequenced Prokaryotes. Nucleic Acids Research 33:880-892, 1030
2005. 1031
1032
Prigent-Combaret, C., Vidal, O., Dorel, C., and Lejuene, P. Abiotic surface sensing and 1033
biolm-dependent regulation of gene expression in Escherichia coli. J Bacteriol 181: 1034
59936002, 1999. 1035
1036
Ptashne, M. Genetic Switch: Phage Lambda Revisited. 2nd edn. Cold Spring Harbor, 1037
NY Cold Spring Harbor Laboratory Press. 2004. 1038
1039
121

Recouvreux, D.O.S., Carminatti, C.A., Pitlovanciv, N.A., Rambo, C.R., Porto, L.M. and 1040
Antnio, R.V. Cellulose Biosynthesis by the Beta-Proteobacterium, Chromobacterium 1041
violaceum. Current Microbiology, 57(5): 469-476, 2008. 1042
1043
Rosner, J .L. and Martin, R.G. An excretory function for the Escherichia coli outer 1044
membrane pore TolC: upregulation of MarA and SoxS transcription and RoB activity 1045
due to metabolites accumulated in tolC mutants. Journal of Bacteriology, 52835292, 1046
2009. 1047
1048
Scheffers, D.J . and Pinho, M.G. Bacterial cell wall synthesis: new insights from 1049
localization studies. Microbiology and Molecular Biology Reviews, 69(4):585-607, 1050
2005. 1051
1052
Schembri, M.A., Kjrgaard, K and Klemm, P. Global gene expression in Escherichia 1053
coli biofilms. Molecular Microbiology 48(1): 253267, 2003. 1054
1055
Shirata, A., Tsukamoto, T., Yasui, H., Hata, T., Hayasaka, S., Kojima, A. and Kato, H. 1056
Isolation of bacteria producing bluishpurple pigment and use for deyeing. Japan Agric. 1057
Res. Quart. 34: 131-140, 2000. 1058
1059
Steinbchel, A., Debzi, E-M., Marchessault, R. H. and Timm, A. Synthesis and 1060
production of poly(3-hydroxyvaleric acid) homopolyester by Chromobacterium 1061
violaceum. Appl. Microbiol. Biotechnol. 39:443449, 1993. 1062
1063
Stephens, D.S, Greenwood, B. and Brandtzaeg, P. Epidemic meningitis, 1064
meningococcaemia and Neisseria meningitidis. Lancet 369:21962210, 2007. 1065
1066
Tatusov, R. L., Koonin, E. V. and Lipman, D. J ., A genomic perspective on protein 1067
families, Science, 278 (5338) 631637, 1997. 1068
1069
Taverna, P, and Sedgwick, B. Generation of an Endogenous DNA-Methylating 1070
Agent by Nitrosation in Escherichia coli. Journal of Bacteriology, 178(17): 5105 1071
5111, 1996. 1072
122

Tenorio, E., Saeki, T., Fujita, K., Kitakawa, M., Baba, T., Mori, H. and Isono, 1073
K. Systematic characterization of Escherichia coli genes/ORFs affecting biofilm 1074
formation. FEMSMicrobiol. Lett., 225(1): 107-114, 2003. 1075
1076
Titgemeyer, F. Signal transduction in chemotaxis mediated by the bacterial 1077
phosphotransferase system. J. Cell Biochem. 51: 6974, 1993. 1078
1079
Ueda, H., Nakajima, H., Hori, Y., Goto, T. and Okuhara, M. FR901228, a novel 1080
antitumor bicyclic depsipeptide produced by Chromobacterium violaceum. Biosci. 1081
Biotechnol. Biochem. 58: 15791583, 1994. 1082
1083
Van der Veen, S., van Schalkwijk, S., Molenaar, D., de Vos, W. M., Abee T., and 1084
Wells-Bennik, M. H. J . The SOS response of Listeria monocytogenes is involved in 1085
stress resistance and mutagenesis. Microbiology 156:374384, 2010. 1086
1087
Van der Veen, S. and Abee, T. Factor YneA Dependence of Continuous-Flow Biolm 1088
Formation by Listeria monocytogenes EGD-e on SOS Response. Applied and 1089
Environmental Microbiology, 76(6): 19921995, 2010. 1090
1091
Weinhouse, H., Sapir, S., Amikam, D., Shilo, Y., Volman, G., Ohana, P. and Benziman, 1092
M. c-di-GMP-binding protein, a new factor regulating cellulose synthesis in 1093
Acetobacter xylinum. FEBS Lett. 416(2): 207-11, 1997. 1094
1095
Zhou, M., Zhang, A., Guo, Y., Liao, Y., Chen, H. and J in, M. A comprehensive 1096
proteome map of the Haemophilus parasuis serovar 5, Proteomics, 9(10): 27222739, 1097
2009. 1098
123

Spot ID Nmero da
ORF
Nome Descrio da protena pI MW
(KDa)
C Produo e converso de energia
2b CV1412 PflB FormateC acetyltransferase 5,2 76,9
3 CV0916 maeB NADP-dependent malatedehydrogenase 5,4 82,3
7a CV1067 sdhA Succinatedehydrogenase flavoprotein subunit 5,95 67,4
12a CV2019 - Aldehydedehydrogenase 5,6 52,9
12b CV0670 atpA F0F1 ATP synthasesubunit alpha 5,6 54,7
19b CV1075 sucC Succinyl CoA synthetasesubunit beta 4,8 41,4
24 CV2728 - Alcohol dehydrogenase 6,1 39,2
27 CV1062 mdh Malatedehydrogenase 5,9 35,0
28 CV3372 ppa Inorganic diphosphatase 4,7 19,5
31 CV3817 - Electron transfer flavoprotein alphasubunit 5,1 31,4
33 CV3476 fumA Fumaratehydratase 5,6 55,0
34 CV0886 fpr Ferredoxin NADP reductase 5,4 29,4
35 CV1076 sucD Succinyl CoA synthetasesubunit alpha 7,3 30,5
D Controle do ciclo cellular, diviso cellular e partio
cromossmica
17b CV4338 ftsZ Cell division protein 4,7 42,2
E Transporte e metabolismo de aminocidos
9 CV0323 hutU Urocanatehydratase 5,8 60,8
14 CV0325 hutH Histidineammonialyase 5,3 53,8
15b CV4112 AspA Aspartateammonialyase 5,4 50,3
16 CV4188 tufA Translation elongation factor Tu 4,9 43,0
Tabela 1. Protenas que surgiram aps tratamento de C. violaceum com a luz UVC. A protina hipottica
identificada est destacada em vermelho.
124

17a CV4200 tufB Translation elongation factor Tu 4,9 43,0
19a CV1365 - Conserved hypothetical protein 4,6 45,1
20 CV1498 astA ArginineN succinyltransferase 5,3 38,5
22b CV3804 carA Carbamoyl phosphatesynthasesmall subunit 6,2 40,3
26 CV4058 prsA Ribosephosphatepyrophosphokinase 5,4 35,2
38 CV3180 phhA Phenylalanine4 monooxygenase 4,6 33,6
F - Transporte e metabolismo de nucleotideos
11 CV0546 purH Bifunctional phosphoribosylaminoimidazolecarboxamide
formyltransferaseIMP cyclohydrolase
5,9 56,0
22b CV3804 carA Carbamoyl phosphatesynthasesmall subunit 6,2 40,3
26 CV4058 prsA Ribosephosphatepyrophosphokinase 5,4 35,2
G - Transporte e metabolismo de carboidratos
2a CV0980 - Phosphoenolpyruvateprotein phosphotransferase 5,0 87,3
19c CV0564 talA Transaldolase 4,6 37,8
22a CV0560 gapA Glyceraldehyde3 phosphatedehydrogenase 6,1 35,8
32 CV0187 agaY Fructose1 6 bisphosphatealdolase 5,6 38,3
I - Transporte e metabolismo de lipdeos
18 CV2719 fadA Acetyl-CoA C-acyltransferase 6,2 42,1
41 CV2790 phaA Acetyl-CoA C-acetyltransferase 6,4 40,1
J Traduo, estrutura e biognese ribossomal
2c CV4189 fusA Elongation factor G 5,1 86,6
8 CV1962 argS Arginyl tRNA synthetase 5,4 63,5
16 CV4188 tufA Translation elongation factor Tu 4,9 43,0
17a CV4200 tufB Translation elongation factor Tu 4,9 43,0
125

29 CV3696 - 30S ribosomal protein S9 10,9 14,4
36a CV4195 rplJ 50S ribosomal protein L10 7,5 17,4
37 CV4174 rplE 50S ribosomal protein L5 9,8 50,6
K Transcrio
21a CV4160 rpoA DNA directed RNA polymerasesubunit alpha 5,1 35,9
M Biognese da parede, membrane e envelope celular
23 CV3104 - Porin signal peptideprotein 9,2 38,3
25 CV3104 - Porin signal peptideprotein 9,2 38,6
40 CV0308 - Agglutination protein 7,4 52,5
N Mobilidade celular
40 CV0308 - Agglutination protein 7,4 52,5
O Chaperonas, turnover proteico e modificaes ps-
traducionais
4 CV1643 dnaK Heat shock protein DnaK 4,8 69,1
5 CV1318 hptG Chaperoneheat shock protein hptG 5,0 70,7
6 CV1318 hptG Chaperoneheat shock protein hptG 5,0 70,7
10 CV4014 groEL1 Chaperonin 60kD subunit 4,9 57,4
13 CV1955 - Protease 5,5 50,0
P - Transporte e metabolismo de ons inorgnicos
7b CV0494 - Outer membranereceptor protein 5,95 64,2
15a CV0350 - Phagesheath protein 5,4 49,3
Q Transporte, catabolismo e biosntese de metabolites
secundrios
21b CV0971 - Fumarylacetoacetatehydrolase 5,1 35,1
126





















R Predio geral da funo
30 CV2336 - ThiJ PfpI family protein 5,6 19,4
39 CV0409 - Bacteriophagetail sheath protein 6,0 50,6
T Mecanismos de transduo de sinais
36b CV3605 - Hydrolase protein 5,6 19,4
U Transporte intracelular, secreo e trfego vesicular
1 CV4281 secA Preprotein translocasesubunit SecA 5,1 101,2
127

Tabela 2. Lista das ORFs que fazem parte do provvel operon juntamente com o gene ftsZ. 1099
ORF Protena Gene E-
value
Organismo Proteina Identidade Cobertura
CV4335 molybdenumcofactor biosynthesis
protein C
moaC
CV4336 hypothetical protein - 6e
-09
Lutiella nitroferrum
2002
conserved hypothetical
protein
51 91
CV4337 UDP-3-O-[3-hydroxymyristoyl] N-
acetylglucosaminedeacetylase
lpxC
CV4338 cell division protein ftsZ ftsZ
CV4339 cell division protein ftsA ftsA
CV4340 cell division transmembrane
protein
ftsQ
CV4341 D-alanine--D-alanineligase ddlB
CV4342 UDP-N-acetylmuramate-alanine
ligase
murC
CV4343 peptidoglycan glycosyltransferase murG
CV4344 cell division protein ftsW ftsW
CV4345 UDP-N-acetylmuramoylalanine-D-
glutamateligase
murD
CV4346 phospho-N-acetylmuramoyl-
pentapeptide-transferase
mraY
128

CV4347 UDP-N-acetylmuramoylalanyl-D-
glutamyl-2,6-diaminopimelate--D-
alanyl- D-alanyl ligase
murF
CV4348 UDP-N-acetylmuramoylalanyl-D-
glutamate-2,6-diamino-pimelate
ligase
murE
CV4349 penicillin-binding protein 3
precursor
ftsI
CV4350 conserved hypothetical protein - 2e
-38
Pseudogulbenkiania
sp. NH8B]
cell division protein
FtsL
69 98
CV4351 conserved hypothetical protein - 0.0 Pseudogulbenkiania
sp. NH8B]
S-adenosyl-
methyltransferaseMraW
79 99
CV4352 conserved hypothetical protein - 1e-83 Lutiella nitroferrum
2002
MraZ protein 81 100
Tabela 3. Protenas de C. violaceum que apresentam similaridade de sequncia com protenas do PTS de V. cholerae O1 biovar. 1100
129

Nome Proteina (V. cholerae) Gene ORF E-value Proteina (C. violaceum) Identidade
(%)
Cobertura
(%)
Vc0965 Phosphoenolpyruvate-protein
phosphotransferase
ptsA CV0980 2e
-128
Phosphoenolpyruvate-protein
Phosphotransferase
39 97
ptsA CV0816 1e
-115
Phosphoenolpyruvate-protein
phosphotransferase
35 96
Vc0966 phosphocarrier protein HPr ptsH CV0815 7e
-13
Sugar transport PTS system
phosphocarrier protein HPr
30 97
Vca0518 PTS system, fructose-specific
IIA/FPR component
fruB CV3052 2e
-22
Phosphotransferasesystem 45 80
Vc0964 PTS system, glucose-specific IIA
component
- CV0558 1e
-30
Phosphoenolpyruvate-protein
phosphotransferase
35 85
Vc1820 PTS system, fructose-specific IIA
component
- CV3334 2e
-11
PTS systemfructose-specific
transporter subunit IIABC
28 82
Vc1822 EIIA-2 (fructose) PTS systemfructose-specific
transporter subunit IIABC
frwC CV2309 1e
-78
Protein-N p-phosphohistidine-
sugar phosphotransferase
45 52
Vc1826 EIIA-2 (manose) PTS systemfructose-specific
transporter subunit IIABC
fruA CV3054 2e
-101
Protein-N p-phosphohistidine-
sugar phosphotransferase
43 72
Vca0245 EIIA2 PTS system, IIA component - - - - - -
Vca1045 EIIA2 (mannitol) PTS system, mannitol-specific
IIABC component
- - - - - -
Vc0910 (threalose) PTS systemtrehalose(maltose)-
specific transporter subunits IIBC
treB CV3300 2e
-100
Protein-N p-phosphohistidine-
sugar phosphotransferase
41 96
130



Vc0207
(NAG)
3-deoxy-D-manno-octulosonic-
acid kinase
- - - - - -
Vca0653 (sucrose) PTS system, sucrose-specific IIBC
component
treB CV3300 2e
-143
Protein-N p-phosphohistidine-
sugar phosphotransferase
48 96
Vc0995 (NAG) PTS systemN-acetylglucosamine-
specific transporter subunit IIABC
nagE CV0559 8e
-162
Protein-N p-phosphohistidine-
sugar phosphotransferase
48 95
Vc2013 (glicose) PTS systemglucose-specific
transporter subunits IIBC
ptsG CV0979 0.0 Protein-N p-phosphohistidine-
sugar phosphotransferase
58 95
Vca0516 (frutose) PTS system, fructose-specific IIBC
component
fruA CV3054 1e
-167
Protein-N p-phosphohistidine-
sugar phosphotransferase
50 98
Vc1821 (frutose) PTS systemfructose-specific
transporter subunit IIBC
frwC CV2309 6e
-73
Protein-N p-phosphohistidine-
sugar phosphotransferase
43 69
Vc0246 (ascobate) Lipopolysaccharide/O-antigen
transport protein
- - - - - -
Vc1823 (frutose) PTS systemfructose-specific
transporter subunit IIB
frwB CV2310 8e
-33
PTS system, fructose-like-2 IIB
component 1
53 94
Vc1281 (chitobiose) PTS systemcellobiose-specific
transporter subunit IIB
- - - - - -
Vc1282: chitobiose PTS systemcellobiose-specific
transporter subunit IIC
- - - - - -
131

Legendas das figuras

Figura 1. Eletroforese bi-dimensional das protenas totais de C. violaceum ATCC
12472 expostas luz UVC. (a) controle (b) tratado. As setas indicam as protinas que
apareceram depois da exposio radiao UVC. Os nmeros correspondem s
protenas listadas na Tabela 1.

Figura 2. Ensaio de complementao funcional a UVC dos clones PLE1G, PLE7B,
PLE12H e PLE10B. Curvas de crescimento dos clones resistentes, (a) PLE7B, (b)
PLE1G, (c) PLE12H e (d) PLE10B (5 J /m2). Culturas celulares de DH10B
transformadas com pBC-SK vazio foram usadas como controle. Os tempos utilizados
para leitura em espectrofotmetro foram de 60, 120 e 180 min. Barras: Desvio Padro
(SD). O teste estatstico utilizado foi o two-way ANOVA.

Figura 3. Ensaio de mutagnese (Rifampicina) com os clones PLE1G, PLE7B,
PLE12H e PLE10B, DH10B (pBC-SK), C. violaceum e AB1157 expostas luz
UVC. Culturas celulares de DH10B transformadas com pBC-SK vazio foram usadas
como controle. Barras: SD. O teste estatstico utilizado foi o two-way ANOVA.

Figura 4. Domnios conservados relacionados funo da protena LexA. (a)
domnios do ortlogo de LexA (NG1427) em N. gonorrhoeae e (b) domnios do
regulador transcricional de C. violaceum codificado pela ORF CV0356.

Figura 5. Desenho esquemtico do provvel operon de ftsZ. Anlise feita no
MicrobesOperon Predictions Online; Seta: indica a direo da transcrio do provvel
operon; a ORF correspondente ao gene ftsZ est destacada em preto.

Figura 6. Diagrama esquemtico dos componentes do PTS em C. violaceum.
Protenas que pertencem mesma superfamlia EIIA esto representadas com a mesma
cor (superfamlia da glicose: azul; superfamlia da frutose: violeta).

Figura 7. Alinhamento de seqncia com protenas que apresentam o domnio
diguanilato ciclase/fosfodiesterase (GGDEF) utilizando o programa CLUSTALW2.
C. violaceum (CV1667Hyp), L. nitroferrum (LNDCyclpp), P. aeruginosa
132

(PAWspRpro), E. coli (ECDcyclas) e R. solanacearum (RSDcyclas). Os resduos de
ligao a GTP so destacados em branco. Outros resduos conservados em protenas da
famlia GGDEF so destacados em caixas de texto. Resduos de aminocidos so
representados por *. A poro inicial do alinhamento no est representada.

Figura 8. Alinhamento de seqncia com protenas que apresentam o domnio da
famlia ThiJ/PfpI utilizando o programa CLUSTALW2. C. violaceum (CV1313 e
CV2336), Ralstonia sp. (RSIhydr), P. putida (PPIhydr), P. aeruginosa PAO1
(PAOThPf), P. aeruginosa UCBPP-PA14 (PAUThPf), P. asymbiotica (PAAraCf), C.
crescentus (CCThPff) e R. pickettii (RPThPff). O stio cataltico de cistena (C-
100/138) comuns aos membros da famlia ThiJ /PfpI so destacados em em caixa de
texto. ORF presente no clone PLE10B. Resduos idnticos so representados por *.

Figura 9. Resposta de C. violaceum ao estresse gerado pela radiao UVC. Os raios
representam a luz UVC, que induz o aumento de protenas relacionadas produo de
energia, ao choque trmico ou chaperonas e quelas relacionadas ao metabolismo de
purinas e pirimidinas. A inibio da diviso celular ocorre provavelmente com a
participao das ORFs CV1365 e/ou CV3724. A parada da diviso celular permite a
continuao da replicao atravs da TLS. A protena RpoA est relacionada, com a
participao de uma protena ainda desconhecida, induo do ciclo ltico dos
bacterifagos Cvp1 e Cvp2. Protenas relacionadas com a formao de biofilme incluem
SixA que induz o aumento de RpoS. RpoS regula a produo da protena hipottica com
domnio GGDEF que atravs da produo de c-di-GMP regula a produo do biofilme.
As protenas PilZ e OmpC e o sistema PTS tambm participam da produo deste
biofilme. O excesso de metablitos gerados so excretados atravs da protena
transportadora TolC.


133



















Medeiros et. al., 2011. Figura 1
















2a/2b/2c
1
3
4
5 6 7a/7b
8
9
10
12a/12b
13 14
15a/15b
16
17a/17b
19a/19b/19c
20
21a/21b
22a/22b
24 25 26
27
28
30
32
34
29
36a/36b
37
39
40
41
35 38
33
23
97
10.0 3.0
pH
66
45
30
14,4
a) b)
134






















Medeiros et. al., 2011. Figura 2.
a)
b)
c)
d)
135















Medeiros et. al., 2011. Figura 3.
136















Medeiros et. al., 2011. Figura 4.
a)
b)
137












Medeiros et. al., 2011. Figura 5.











b)

CV4352
CV4351
CV4350
CV4349
CV4648
CV4347
CV4346
CV4345
CV4343 CV4342
CV4340
CV4339
CV433
8
CV4337
CV4336
CV4335
CV4341 CV4344
138

































Medeiros et. al., 2011. Figura 6.

Famlia
Enzima I
EI
CV098
0
Hpr
CV0815
Fpr
CV3052
Glicose
Sacarose
NAG

Frutose

Famlia
Hpr
Famlia
Enzima IIB/C
CV3300
CV0559
CV0979
CV3054
CV2310
Famlia
Enzima IIA
EIIA
Glc

CV0558
EIIA-2
CV3334
EIIA-2
CV2309
(Sacarose)
(NAG)
(Glicose)
(Fructose)
(Fructose)
(Fructose)
(Fructose)
Citoplasma Periplasma MI
139











Medeiros et. al., 2011. Figura 7.


140






















Medeiros et. al., 2011. Figura 8.


PAOThPf - - - - - - - - - - - - - - - - - - - - - - - - - - - - - MTQSLHGKVVAALVTDGFEQVELTGPKKALE 31
PAUThPf - - - - - - - - - - - - - - - - - - - - - - - - - - - - - MTQSLHGKVVAALVTDGFEQVELTGPKKALE 31
RSI hydr - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - MTTSPFI VVFALYNRVTQLDFTGPHEVFW29
RPThPf f - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - MTTSPFI VVFALYNRVTQLDFTGPHEVFW29
CV1313 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - MNPPYTI VFALYPGVTQLDFTGPLEFLS 28
CCThPf f MADALAEI AGTMSFPPAPRRVI FTLDCDGDHRMSQTLQI VI ALFPGVTHLDFTGPHQVLC 60
PAAr aCf - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - MSNKMTI VMPVYNGVTQLDFTGPHQFFS 28
PPI hydr - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - MALQI GFLLFPQVQQLDLTGPYDVLA 26
CV2336 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - MKRAI TI LTENFSDWETALI NSCCR 25
: . . : : .

PAOThPf DAGATVRI LSDKAGEVRGWNHHQPAEAFRVDGTFEDASL- - DDYDALLLPGGVI NSDQI R 89
PAUThPf DAGATVRI LSAKAGEVRGWNHHQPADAFRVDGTFEDASL- - DDYDALLLPGGVI NSDQI R 89
RSI hydr RLPGAQCVVASAAGGE- - - - - I HADGGLTI SNVQRLADI - - PHADLI CVPGGFGVI EAME 82
RPThPf f RLPGAQCVVASAAGGE- - - - - I HADGGLTI SNVQRLADI - - PHADLI CVPGGFGVI EAME 82
CV1313 KLPHARCVLASSRGED- - - - - I RADGGI VFADI ARLGAI - - ERCDLLLVPGGLGTI EAME 81
CCThPf f RLPGAKVTVASLAGGE- - - - - I EADG- LVFARLPKLSDI - - ETCDVLI VPGGFGTTQAMG 112
PAAr aCf RVPDVEVI VASVDGQS- - - - - I AADG- LHFASLADLTQL- - THCDI LCVPGGSGCVEAMQ 80
PPI hydr SLPDVQVHLVWKDLVP- - - - - VTSSTGLQLKPTTTFEDC- - PVLDVI CVPGGAGVGPLME 79
CV2336 GYYGFDVRFAAPGGRP- - - - - VTSSGGLMVTPHLAI EAI RLERLDLLI VCGG- - TI WKTP 78
. . : . * : : **

PAOThPf SLAKAQELAI RAEQASKPVAVI CHGAWLLI SAGLVQGRTLTSWPSLKDDI NNAGGHWVDQ 149
PAUThPf SLAKAQELAI RAEQASKPVAVI CHGAWLLI SAGLVQGRTLTSWPSLKDDI NNAGGHWVDQ 149
RSI hydr DAEFVRQVRRLADGA- RYVTSVCSGSLVLGAAGLLQGKRAACHWAWRNLLPAFGATVDEA 141
RPThPf f DAEFVRQVRRLADGA- RYVTSVCSGSLVLGAAGLLQGKRAACHWAWRNLLPAFGATVDEA 141
CV1313 DAELLAQLRRLAASA- DYVSSVCTGSLLLGAAGLLKGRRAACHWAWLDSLAAFGAQPCPD 140
CCThPf f DPDFI AEI RRLADGA- RYVCSVCTGSLVLAAAGLLKGKRAACHWAWRDQLALFGAVPDAA 171
PAAr aCf SPHYMHAVKTLAQSA- RYI TSVCSGSLI LGAAGLLVDKRAACHWSWRSLLSLFGAI SDSR 139
PPI hydr DEQTLDFI RSQAAQA- RYVTSVCTGSLVLGAAGLLQGKRATTHWAYHDLLPTLGAI PVKD 138
CV2336 QAPDVAGLVAAAHAQGTVVAGI CDGTRALAQAGVLNAVGHTSN- SADNLAAVSGYAGAAR 137
. : * : : * *: * **: : : : . *

PAOThPf EVAVDGKLVSSRKPEDI PAFNRRFI EI LAG- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 179
PAUThPf EVAVDGKLVSSRKPEDI PAFNRRFI EI LAG- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 179
RSI hydr RVVRDGNLI TGGGVTAGI DMALTVMADI AGAEHAQAVQLGI EYAPAPPFDCGRPERAAPE 201
RPThPf f RVVRDGNLI TGGGVTAGI DMALTVMADI AGAEHAQAVQLGI EYAPAPPFDCGRPERAAPE 201
CV1313 RVVVDGKLI SGGGVTAGI DMALTLMAEI AGPQFAQTAQLTLEYAPAPPFASGRPELASPE 200
CCThPf f RVARDGRYI TGGGVTAGI DFALTLI AELAGDAVAQGI QLAVEYAPAPPFNSGRPETAPAE 231
PAAr aCf RVVKDGNI I TGGGVTAGI DFALTVI AEI YGKETAQSI QLGLEYAPSPPFNAGRPETAPVA 199
PPI hydr RVVRDGNLFTGGGI TAGI DFALTLAQELVGVDTAQLVQLQLEYAPAPPFDSGSPDTAPSA 198
CV2336 YQDVPCAVGDNGVVSAPGTAPVSFMAKI LAALGI GGADLDAYLAQHAAEHCGQG- - - - - - 191
. . : .

PAOThPf - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
PAUThPf - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
RSI hydr I LAAVTSRLDHLRADRHDAVQRAAQRL- - - 228
RPThPf f I LEAVTSRLDRLRADRHDAVQRAAQRL- - - 228
CV1313 VLAAARQGI DQVRDRREAAVI RAAAACL- - 228
CCThPf f VLERI TALYGQGMDERVAAAKAAAGVL- - - 258
PAAr aCf I REMAEKRVAASI DSRRALFERI AQSF- - - 226
PPI hydr VVDEARKRAAPSLKLRTEI TERAAAKLNLR 228
CV2336 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
141




















Medeiros et. al., 2011. Figura 9.
















CV1365e/ou
CV3724
GGDEF
c-di-GMP
PilZ
FORMAO DE
BIOFILME
SixA

ArcA/ArcB/RssB

Protelise de
RpoS
RpoS
DANO NO DNA
OmpC
TolC
TMs
PARADA DA
DIVISO CELULAR
METABOLISMO DE
PURINAS E PIRIMIDINAS
HEAT SHOCK OU
CHAPERONAS
PRODUO DE
ENERGIA
TSL
RpoA +?
Ciclo ltico
(CvP1 e CvP2)
PTS
142

6. CONSIDERAES GERAIS


Os resultados obtidos nos dois manuscritos apresentados auxiliaram no
entendimento mais detalhado acerca do metabolismo basal de C. violaceum e
nas mudanas deste metabolismo frente ao estresse gerado pela radiao UV.
Os artigos so pioneiros no estudo protemico deste organismo e abre
possibilidades no que se refere aos estudos ps-genmicos realizados at
ento.

























143

7. PERSPECTIVAS


Outros experimentos alm dos apresentados nesta tese foram
realizados. Entre eles podemos citar a protemica de uma cepa mutante no
operon de sntese da violacena, exposta ou no a radiao UVC.
A protemica desta cepa mutante sem exposio radiao UVC foi
realizada com o intuito de auxiliar no entendimento da funo deste pigmento
no contexto fisiolgico bacteriano. O gel de referncia das protenas desta
bactria mutante apresentou 365 spots. Quando comparado com o gel de
referncia da cepa selvagem (Artigo: Medeiros, et. al., 2011) foram observados
apenas 165 spots em comum. Os resultados da expresso diferencial na
ausncia da violacena mostram que este pigmento bloqueia a produo de
algumas protenas, todavia na sua ausncia surgem 200 spots, os quais j
foram tripisinisados e esto sendo identificados por MS.
A exposio da cepa mutante radiao UVC tambm foi realizada. No
controle foram identificados 148 spots e 243 no tratado, onde apenas 81 spots
foram comuns a ambas. Todos os spots que sugiram aps o tratamento foram
tripsinisados e 73 foram identificados, correspondendo a 57 protenas
diferentes. A anlise da resposta da bactria na ausncia da violacena poder
ser til para verificar a existncia de um possvel papel protetor deste pigmento
frente ao estresse gerado pela luz UVC.
Estes resultados possibilitaro a publicao de, pelo menos, mais dois
artigos cientficos oriundos desta tese de doutorado.