Ys Dec 2014 Eng PDF

Year 12, Issue 04
December 2014
Price ` 15/-
YOG SANDESH
A research based monthly
magazine on Yoga,
Published by Divya Yog Mandir (Trust)

Haridwar, under the guidance and
encouragement of Honourable
Ayurveda, Cultural and

Spiritual message
Swami Ramdevji Maharaj
Pioneer in bringing innovative

transformations in the field of
Nation Building
Yog Sandesh 1 December 2014
Year 12, Issue 04
December 2014
Price ` 15/-
YOG SANDESH
A research based monthly
Published by Divya Yog Mandir (Trust)

Haridwar, under the guidance and
encouragement of Honourable
magazine on Yoga,
Ayurveda, Cultural and
Spiritual message
Swami Ramdevji Maharaj
Udhyam Sahasam dhairyam buddhih shakti parakramah

Shedet yatra vartante tatra dev sahaykrit.
Index
Pioneer in bringing innovative
transformations in the field of
Nation Building
Year 12 Issue 04
December 2014
Published in Hindi, English, Gujarati, Marathi, Bangla, Punjabi,
Oriya, Assamese, Telugu, Kannada, Tamil and Nepali
Editor
Acharya Balkrishna
Associate Editor
Dr. Vijay Kumar Mishra

Subscription Fee
One copy
15/Annual 150/Five Years
700/Eleven Years
1500/Abraod (Annual)
800/-
Office
Patanjali Yogpeeth
Maharishi Dayanand Gram,

Delhi-Haridwar national highway,
near Bahadarabad,
Haridwar-249402, Uttarakhand
Phone (01334) 240008,
244107, 246737
Fax (01334) 244805, 240664
e-mail yogsandesh1@gmail.com
e-mail divyayoga@rediffmail.com
on the web www.divyayoga.com
Publsihing & Distribution Office
(Dainik Bhaskar Group)

B-220, Pahse II, Noida-201305,
G.B. Nagar, U.P.
Publisher and printer Divya Yog Mandir (trust), Kripalu

Bagh Ashram, Kankhal, Haridwar-249408, Published by
Rishi offset printers, Ved Mandir, Gita Ashram, Jwalapur
Haridwar and printed at M.P. Printers, B-220, Phase II,
Noida, G.B. Nagar, U.P. Editor, Acharya Balkrisna.
RNI NO.:DELENG/2006/16626
Yog Sandesh is basically published in Hindi. Therefore some errors are
possible while translating the contents from Hindi to other languages. It
is not necessary for the editor to have coherence with the views
expressed in the contents of the magazine. All disputes are to be settled
in the court of law at Haridwar.
06
c Eternal Wisdom
03-04
c Editorial
06-07
c Olive helps you to get healthy...
08-10
c Your experience
11
c Healthy India, clean India, educated... 12-14
c Yoga guru great respect to you
15
c Training camps for Vaidya...
15
c Chronic diseases can cause caner... 16-18
c Geeta in brief
19
c Patnajali Yogpeeth spreading...
20-23
c Cruel ideals of supressing religious... 24-26
c Ayurveda
27
c Behavioral disorders in children and... 28-30
c Domestic methods for treatment
31
c Yoga, Pranayam and natural...
32-33
c Understand the core of Rishi Chikitsa 36-39
c Various programmes of the Sansthan 40-47
c How to cook rice to use it as a...
48-49
c Protect your kids from impact of...
50-52
c There are many Agnisamuh which... 54-56
c Yoga-Quiz
57
c Complete inner beauty life of celibacy 58-59
c Know and believe in
60-61
c Obtain an yield of 80 Quintal per... 62-65
c Slogan of bharat swabhiman
66
Acharyakulam :
Education programme
20
Patnajali Yogpeeth spreading message

of new era, building a new world
28
Behavioral disorders
in children and role of yoga
54
There are many Agnisamuh

which help in digestion
Read this magazine yourself, inspire five others to read and then place in five new families so that this agitation,
being inspired by seers could spread, reach and benefit every human being.
Editor
Eternal Wisdom
Eternal truth emanating out of the eternal

wisdom of respected Swamiji Maharaj
Path of yoga meant for saints

T
he saints who are pursuing the path of spiritualism, yoga and

salvation, they have many confusions, different notions and
perceptions regarding these pair of words- Yoga-Kriyagoga, ParavidyaAparavidya, Abhuyaday-Nihshreyas, Bhog-Apvarg, Shrey Marg-Prey
Marg, Success- perseverance, Purush-Purusharth, Brahma-Brahmand,
Murta Upasana, Amurt- Upasana, Shubh Karma- Divya Karma, Sakamak
Karma-Nishkamak Karma, Pravriti-Nivriti, Bhagwan-Bhagwan ka
vidhan, Vyashti-Samashti, Atma-Kalyan and Lok Kalyan etc.
meaningless. People consider

that the path of Nihshrey is
fine but we have got nothing to
do with Abhyuday, we sought
for Apavarga but Bhog is an
utter sin. Shrey or Prey, sincere
efforts and success- they are
opposite to each other.
Due to wrong kind of knowledge most of the Sadhaks have a

tendency to consider the each of the words in the pair as opposite
to each other. For example- yoga is fine but Kriyayoga is bad, they
considered paravidya as a nice thing but aparavidya is considered to be
Karma-Pravriti, Purusharth
or Dharmacharan are also
responsible for causing us
pains. Therefore, one should
refrain from making efforts or

purusharth or following the
path of Dharma.
While following the path of
Yoga, we will ensure the welfare
of ourselves. Whether others
follow the path or not, it has got
nothing to do with us.
The saints scriptures
like Veda, philosophy,
Upanishad and the company
of enlightened persons
have taught us that wrong
knowledge, insufficient
knowledge, confused
information, conduct,
behaviour, practises, activities,
efforts, penance are responsible
for the pains or agony in life.
They are also responsible for
lack of peace, poverty and
anxiety. On the other hand,
Tatva gyan (true knowledge),
behaviour, conduct, practises,
nature, efforts, Purusharth,
inclination, service take us to
prosperity, comforts, and bliss.
Therefore, a Sadhak has to be
full of true knowledge and has
also to be fully focused and
he has to practice yoga and
kriyagoga and follow the path
of spiritualism. When a Sadhak
follows the path of yoga and
kriyoga, all the hurdles of his
life get destroyed and he attains
salvation even in this life itself.
Therefore, a Sadhak must get true knowledge

and be fully focused and he needs to practice
Kriyayog or karmayog and move ahead upwards.
By practising yoga from Kriyayoga and vice
versa, a Sadhaks all hurdles get destroyed and
he gets salvation in his lifetime itself.
In the state of Yog-dhyan and Samadhi, there will be two states of a
Sadhak- Sampragyat or Asampragyat, Savikalp or Nirvikalp, Savichar or
nirvichar, Sabeej or Nirbeej samadhi. The sadhak in one of these states,
initially for a few moments and with perseverance for a long period of
time, it happens to be present in that condition.
There is a pattern of the Sadhaks efforts. He first worships the idol
of the almighty, later he subsequently begins to have inclination towards
the form of almighty which is shapeless. From Murth to Amurt, from
expressed to silent, from visible to invisible, shaped to shapeless, from
root to conscience, from Sagun to nirgun, he continues with worshiping
almighty, the Sadhak becomes Brahmamay. He becomes from Rachana
to Rachayaeta, from Shrishti to Shrashta, from Maya to Mayapati. It is a
path of journey from Brahmand to Brahma.
In Kriyayoga and Karmayoga, a Sadhak has to have these two States
only. Initially, he should follow the path of Dharma and subsequently
he should turn towards selflessness. This is the path suggested in Vedas
to get away from wrong knowledge, wrong tendency and agony. In the
state of idleness and tendency to do wrong things, a Sadhak must refrain
from falling into the state because our auspicious moment can come
in just that one moment which can build our entire personality. This
is why, each and every moment of a Sadhak has to be devoted to yoga,
kriyayoga and Karmayoga.
True words and execution of all the behaviours has to be done by
a Sadhak. His conduct, practises, nature, true knowledge, etc must
be pure. A Sadhak becomes dagdh-beej by attaining true knowledge,
knowledge of Veda, selflessness, purity of heart and mind, impartiality,
efforts, etc as they make our inner self pure, and he gets rid of all wrong
things which finally results into salvation.
December 2014 4 Yog Sandesh
November 4 (Delhi): Swami Ramdev ji and Acharya Balkrishna ji met with Prime Minister
Narendra Modi at his official residence and discussed the issue of nation building.
Editorial
Acharyakulam :
Education programme
Acharya Balkrishna
Shape of education in
Acharyakulam:
fter making path breaking developments in the field of Yoga and

Ayurveda, now it is time for beginning a revolution in the field of
education or knowledge. This revolution will prepare crores of young boys
and girls who will be truly Indian from hart and mind. They will be front
runners in the field of science and technology but at the same time, they
lifestyle will be like the great ancient saints of India. Only then we will be in a
position to retain the glorious position of the mentor of the world, which we
held in the past. It will help us to be an ideal nation, a pioneer in the world
order.
From Acharyakulam to four clan:
What kind of education will be in Acharyakulam and how will it affect the
future and career prospects of the students studying there and what will be
the pattern of education here? The issue of syllabus is also import for the
students of Acharyakulam.
What can you do for Acharyakulam in your district? How the mission of
building an great nation and a nice society will be accomplished by ensuring
best development of career and future of the kids of your family by sending
them at Acharyakulam? By setting up Acharyakulam in your district what
can be your contribution in the mission for the great revolution in the field
of spading knowledge? On all these issue, here we are going to talk in detail
in our editorial.
What ever is being taught in the syllabus

of various state education boards and CBSE,
is based on Lord Macaulay. Unfortunately,
there has been significant efforts made at
any level to make education indigenous
and remove impurity from the system of
education. We are in the process of building
a new education society which will be much
advanced than that of the CBSE. It will be an
autonomous board with a high standard of
syllabus for the students of Class I to Class
XII. It will include, both the pure Indian
and modern knowledge based on latest
science and technology and the teachings
of Vedas. This pattern will be approved by
the Central Government like the status of
CBSE. This process has started and later we
will discuss the syllabus in detail.
Eligibility to open branches of

Acharyakulam in your district
1. For establishing an Acharyakulam with

hostel, one is needed to have at least 10
acre land, resources, 40-50 dedicated
workers.
2. For day- boarding Acharyakulam, one
needs to have 2-5 acre land in prime
location, 10-20 dedicated workers,
along with local generous donors. In the
metro cities, you need to have at least
one acre land.
3. Arrangement of land by local workers,
and then associating 50-100 generous
local donors for building, school, vehicle
and other facilities. For arranging land,

first of all you need to contact capable
and dedicated persons who can donate
keenly. For this purpose, you can
contact to a farmer, trader, prosperous
persons, unmarried persons who own
land and are eager to do something
good for the society. It will also be nice
to contact such persons who want to
donate in the name of their kids and
elders for building their good name.
Those who want to do something in
the name of their parents, can also be
contacted.
4. Name of the land donor will be inscribed
on the main gate of the school along with
the name of Acharyakulam. Moreover,
names of the people who would help in
construction of the building or those
who will provide other resources like
vehicle will also be inscribed on them.
Besides, these donors will be included in
the local committees of Acharyakulam
as their members. They will be asked to
play a key role in their functioning.
5. Registration of the land will be in the
name of Acharyakulam society and it
will be run by the local committees.
6. Local committees will be allowed
to function autonomously and they
will be working according to the
guidelines, policies and decorum of the
headquarters of Acharyakulam.
7. By selecting best contestants at the
local level, best and brightest students
will be admitted in the Acharyakulam
and even their parents will be trained
there every week.
8. Of day boarding Acharyakulam, there
will be an ideal routine from 7 AM to
7 pm during which yoga, meditation,
yagna, teachings of veda, sports, dance,
good habits, knowledge of science and
technology, art, culture, etc will be
taught.
9. There will be a clear policy for
appointing teachers and other staffers
of the school and rafter their selection, they will be trained properly at
Acharyakulam headquarters. This training could be either quarterly or
yearly. The teachers will get a handsome salary package but dedication
for work will be paramount importance which will be different from the
mind set of doing a job.
10. Since the syllabus for the teachers will be new, therefore there will be a
proper syllabus for the training of the teachers which will including very
important aspects.
11. There will be arrangement for lunch and light food in the evening also at
day-boarding Acharyakulam.
Association of Patanjali Yogpeeth in the functioning

of Acharyakulam
1. From imparting education to guiding in its functioning, all these

responsibilities will lie with Yogpeeth.
2. From economic point of view, Sri Anil Agarwal ji, the head of Vedanta
group, will contribute in a great way for building and developing
Acharyakulam. Rest of the contribution will be made from local generous
persons who are keen to work for betterment of the society.
3. At the time of inauguration of Acharyakulam at the local level, Swami ji
and me (Balkrishna) will be present. While, at the time of inauguration
of big centres of Acharyakulam, it is quite possible that Prime Minister,
Finance Minister, HRD Minister, Chief Minister, other union Ministers
and reputed personalities could be present.
4. The responsibility to develop Acharyakulam as worlds best educational
institute lies on Patanjali Yogpeeth in association with all of you.
Financial aspect of Acharyakulam:
1. Acharyakulam will be a non-profitable organisation. Minimum fee which

will be necessary for running the institution will be collected from its
students. Without expectation of financial benefit, we will work on
the concept of self-sustainable model and there will be no scope for
commercial model.
2. For economically very poor students or the students with outstanding
performance, special concessions and scholarship will also be available.
Acharyakulam will be Centre for nation building
1. Besides imparting education, Acharyakulam will also be a centre for

Panchmahayagna, sixteen Sanskaars, culture, social work, coordinated
functioning of our all five organisations, yoga, Ayurveda, Swadeshi,
tradition of labour and science, etc. Where ever land will be available,
there will be cow shelter, natural farming, promotion and training of
indigenous industries, and other services will also be available. It will lay
the foundation of divine and magnificent India. In this context, we have
talked just in brief. n
Health in herbs
Acharya
Balkrishna
Scientific name :
Olea Europaea
Linn.
Family name:
Oleaceae
English name:
Olive tree
Hindi name:
Jaitoon, Kau, Kan
Urdu:
Jaitoon
Kannad:
Julipe
Tamil:
Olivu, Saidoon
Telugu:
Jaitoon
Nepalese:
Kandeloto
Arabic:
Jaitoon, Jaytoon
Persian:
Jaitoon
Olive helps you

to get healthy and
shining skin
ccording to science of Ayurveda, a medicine has to induce a sense of confidence in a patient that he will get rid of the
disease. Actually the body is directly connected to our body therefore a disease is born when there is an imbalance in
the nature around us. In such a condition, a medicine has to be found out from the nature itself. On the contrary, if we use
unnatural chemicals as medicine, then it may not show its adverse impact immediately but in long future, its wrong impact
is bound to appear.
For eternal wellness, it is necessary that medicines for physical and mental diseases should be found from natural sources. To
stop atrocities being committed on our body, the greatest blessing of almighty, in the name of treatment of diseases, Patanjali
has conducted an intense research on herbs for treatment of diseases and has also suggested medicines and their quantities for
various diseases. On the basis of the conclusion of these researches we present this series of articles under headline- health in
herbal medicines. Your relatives can read and apply these methods in detail to get a healthy and happy life. Here in this issue,
we present you information regarding herbal properties of olive.
olive tastes
astringent
and it also cures the problems
related to vaat and pitt. It
cuerhtnres
constipation,
gives strength to our body,
puyarodhi, cures urine and
blood related problems. Its fruit
is Artvajanak, cures problem of
pitt, improves appetite, cures
liver related problems and also
cures eye related problems. Oil
of its seeds gives strength and
cures the impact of poison.
Extract of its leaves happens to
be hypotensive and it also works
like anti-oxident. Oleanolic
acid, ursolic acid, uvanol,
methyl maslinate found in
extracts of its leaves also show
cardiotonic and antidysrythmic
effects. Extract of its seeds show
the property of non-oxydent.
Extracts of its leaves kill germs.
Olive is basically found in
Maditaranian region, Asia and
Syria. In India, it is found in
Jammu & Kashmir, Himalayan
region,
Andhra
Pradesh,
Karnataka and Tamil Nadu. The
oil of its fruit is best for health,
In nature,
clean, golden in colour and little

bit fragrant.
External shape:
It is about 15 metre high,

ever green and has multiple
branches. Its branch are light
and bright grey in colour. Its
leaves are simple, opposite, and
appear like guava leaves. They
are 5-6.3 cm long with different
breadth. Its leaves front part is
sharp and pointed, narrow on
its base, both of its sides are
smooth, upward straight, bright
green and a bit whit on its base.
Its flowers are fragrant and are
greenish white in colour.
Its fruits are oval in shape,
sometimes round, 1.3-2.5 cm
long and green in colour. Later
its colour changes to red like
blood, and when it is ripe, it
appears like purple. Its row
fruit is used for pickles and
spinach. It blooms between
October and April. Oleanolic
acid, Oleuropein, kaempferol
are found in its leaves while
in its seeds, unvaporized oil is
found. In its flower, ursolic acid,
Health in herbs
Skin diseases:
Sore: Applying olive seeds

oil on sores will cure the
problem. Also, paste of olive
fruits when applied on sores,
the problem is cured. One
can apply blend of olive
leaves powder and honey
on the affected area and the
problem will be cured. It can
expunge the spots of pimples
and pox.
Skin problems:
oleic acid and maslinic acid are
found.
Medicinal uses
Hair related problems:
Khalitya: Roast the raw fruit

of olive in bonfire and in its
ash add some honey and
apply it on the head, hair
problems and pustule will be
cured.
Ear problems:
Make tea of olive leaves and

drink it. It will cure problems
like diabetes and other urine
related problems.
By applying the paste of raw

fruits of olive on spots of
pimples and pox, the problem
will be cured.
Shingles, eczema and other
such problems are cured.
In case of burn in any part
of the body, applying past of
raw fruit of it is very effective.
It will also prevent skin boil.
Eczema: Take the wax of
olive tree and apply it on
the affected body part. The
problem will be cured.
For
glowing
beauty:
Applying olive oil on the
face will give you glowing
skin and you will look more
beautiful.
Bone joint problems:
All other disease:
olive oil, it will cure problems

like cough, cold and other
such problems.
Stomach related
problems:
Diarrhea: Make paste of

olive leaves and add barley
flour in it. Add some water
also and apply it on navel. It
will cure diarrhea.
In pain in ear, take 5 ml olive

leaves extract and make it
lukewarm, add some honey
in it and pour a few drops of
the preparation, the problem
will be cured.
Urine related problems:
Mouth diseases:
Aamvaat: Make paste of olive

roots and apply in affected
area. It will cure the problem.
It also cures pain.
Tooth problem: Boil raw

fruit of olive in water and
prepare its tea and do gargle
with it as it will cure teeth
and gums. It will also cure
blister in the mouth.
Chest problems:
Massage your chest with
Sweating in abundance
causes bad smell but this
problem will be cured with
you will make paste of dry
olive leaves and apply on
your entire body parts.
It is requested to wise readers of Yog Sandesh that your write ups and
suggestions regarding this magazine should be sent to our email IDyogasandesh1@gmail.com or the postal address given on the magazine.
Your experience
Got rid of dangerous

piles and fissure
hen two patients of two different diseases

could not get their problems cured anywhere,
they consulted Patanjali Yogpeeths department of
medical treatment. Here, both were treated under the
supervision of the doctors who are yoga expert. Today,
both the persons are enjoying a happy and healthy life.
Sachin Kumar Goswami who hails from Ward no 14,
Durgapur, Daltanganj, Jharkhand and he is the son of
Narendra Goswami, has been suffering from the problem
of piles for one year. He himself narrates his ordeal
saying that he went for so many treatments but could
not get cure. With the inspiration of almighty, he says,
he came to Patanjali where he was treated with Shishth
bath, ayurvedic oils and medicines available with the
Ashram. In this process, through Shisth bath was used to
clean the affected area with lukewarm water added with
Triphala powder. Later Ayurvedic oil was applied on the
affected part. His problem soon got cured. He said that
the problem was fully cured and now a days he practises
yoga and increasing the longevity of his life.
Another patient Ajit Kumar hails from Adarshnagar,
Kundanpur, Linepaar, Muradabad, UP. He writes that
he was troubled for the last two months due to fissure.
Even after a lot of treatment his problem could not be
cured. Later he visited Patanjali Ashram at Haridwar and
consulted concerned doctor of Patanjali Chikitsalaya. He
was also treated with Shisth bath, operation and herbal
oil and medicines. He soon became fine.
Now both of them are active members of the mission.
They consider their lives as blessings of Swami ji and
Acharya ji they are associating people with the sansthan
and Yog Sandesh magazine.
Yug Chintan
mothers give birth to great leaders and prophets on his sacred earth with the
blessings of almighty and some great men come on this planet as a representative
of the supreme power. Such persons have a divine duty to execute. They discharge their
duties and slowly return back to the divine world. Respected Swami ji is also like a blessing
of almighty and he is enlightening the lives of sacred souls. He has a mission- Healthy
India, clean India, educated India, prosperous India.
Brave
Healthy India, clean India,

Educated India, Prosperous India
Healthy India:
oga, Ayurveda, pure meal, divine thoughts, domestic treatment of

diseases, natural treatment, acupressure and Patanjali Yogpeeth
Haridwar is the biggest centre of all these things.
This message of our great saints has to be spread to every part of the
country, every village and every household and from India the whole
Dr Suman
world will be benefited.

Unfortunately,
impurity
and adulteration have become
endemic and such practises are
ruining so many lives. Moreover,
in this era of adulteration, even
sacredness of yoga has not been
spared. Many greedy people have
presented it in a deformed way,
for example- Sri Sri Yoga, power
yoga, Vikram Yoga, anger yoga,
vihangam yoga, etc. They are
trying to sale the teachings of
yoga as their parental property by
destroying the many generations
old teachings of our ancient
saints. But Swami ji has presented
this art before us without allowing
any deformity. He has given us
the teachings of yoga the way our
saints described in our ancient
scriptures. Purity is the most
credible thing in this world. When
the people found it most genuine,
they adopted it the most. Swami
ji has not named his institution
after his own name but it is after
the name of great saint and yoga
guru Maharshi Patanjali. The

kind of Sanskaar, thoughts and
Karmakand he learnt from the
saints he presented them the way
they are. However, many sons and
daughters of saints are deprived
of it and this legacy has to be
taken to them. Its means and goal
are - yoga camps and yoga classes
through which the yoga has to be
made so attractive that as it is in
reality. By fake glorification of
lust, some greedy and materialist
persons have tried to make the
whole nation dirty which is
shameful. He have to be alert to
prevent them from doing so. The
form in which people are realising
it, and it is the directive of Swami
ji to lakhs of the workers to set up
at least 10 following types of yoga
camps.
1. Yoga camp for obesity and
diabetes 2. Yoga camps for high
blood pressure, cholesterol and
also for heart diseases. 3. For back
pain, neck pain and joint pains.
4. Yoga camps for cold, cough,
asthma and stomach related
problems 5. Meditation camps 6.
Ashtang yoga camp 7. Youth camps
8. Yoga camps for inculcating
good habits in kids 9. For women
and expecting mothers 10. Stress
management yoga camps
In these camps, yoga, Ayurveda,
food, domestic treatments and
accupressure can be some of the
methods for treatment of health
related problems. The trainers
have to come at the camps with
full preparation at home.
Such processes can save lakhs and
crores of mony which are being
spent in the name of treatment
of the diseases can be saved and
they can also be utilised for some
constructive works. I am fully

confident that one day every
country man will turn to yoga,
may be it will take little more
time. And India will continue with
its legacy of being land of great
saints.
Clean India:
Maharshi Patanjali in Yogangs

has described the first rule as
cleanliness. Internal and external
cleanliness are very important
in our lives. Mother Saraswati is
present there where ever purity
is found. Impurity is the home to
demons. As much as we expand
our inner self, he tries to keep
things that much clean. This is
the reason why people throw
away dirt out of their homes. The
day, day their inner self will be
expanded to their street, locality,
district, state and the nation,
they will also think like respected
Modi ji and Swami ji to make India
clean. We have got to do this as
India is our mother. She has to be
kept clean and beautiful. For this
purpose, everyone yoga classes
at town and tehseel level have to
spot a dirty place and with the
help of local administration they
are required to work for cleaning
the area.
This way we have to make a
clean India by the means of yoga.
People in other parts of the world
learnt purity from our saints, then
why we cannot do this?
Educated India:
After the birth of a person,

his education begis from very
first moment of the life and as
the knowledge is infinite, so even
spending a whole life will not be
sufficient.
Knowledge is very important
and best training can make a
simple person into a great man.
On the other hand, without
proper education a common man
can be turned into a demon. A
persons present status is the
result of his teachings. Respected
Swami Ji Maharaj says that power
of thoughts is the biggest power
in the world. Only that person is
great in the world whose deed
is great. And only that person is
small who lacks good thinking. In
all parts of the world, India was
considered as a great nation only
due to its great education system.
And Swamiji Maharaj has vowed
to brig back those glorious days.
Whatever he vowed to do, he did
with the blessings of the god.
Whether this vow be about yoga,
Ayurveda and Swadeshi or be it
the pledge to change the system,
but mission for building the
nation can not be accomplished
only by changing the government
but real change takes place with
the building a good future for a
human being, which is possible
only through good education and
Yug Chintan
It has been planned to open 500 Acharyakulams in the

first stage and 5000 of them in the second stage. This is the
dream of Swami ji. It is interesting to note that the moment
an announcement in this regard was made, people from all
around plunged themselves for the success of the mission.
In the first stage, people who have 10 acre of land, vehicles, other
resources and have the land in a prime location are getting prevelage.
Name of a donor can be associated with the institution. Even the
Sansthan will pay a vital role in it. However, we have got offers of 100-200
acres of land which shows that people are dedicated to our rich cultural
heritage and greatness of our own Indian education system.
Sanskaar.
Respected Guru ji is of the
view that such habits should be
infused in the kids from their
early days that will include the
teachings of vedas, spiritualism,
modern
education,
science
and technology, real history,
geography, ethics, art, literature,
commerce, politics, social science,
Sanskaar, self-respect, Sanskrit,
Hindi, regional languages and
English. In short, we can say that
the education which can boost
a student physically, mentally,
morally, spiritually and socially
as well as enhance his prospective
about the nation is the best kind
of education.
It has been planned to open 500
Acharyakulams in the first stage
and 5000 of them in the second
stage. This is the dream of Swami
ji. It is interesting to note that the
moment an announcement in this
regard was made, people from all
around plunged themselves for the
success of the mission. In the first
stage, people who have 10 acre of
land, vehicles, other resources and

have the land in a prime location
are getting prevelage. Name of a
donor can be associated with the
institution. Even the Sansthan will
pay a vital role in it.
However, we have got offers
of 100-200 acres of land which
shows that people are dedicated
to our rich cultural heritage
and greatness of our own Indian
education system.
India of the dreams of crores
of brave and young Indians and
many of Indian youths will be
built with association of all of
you. This will not be just an
imagination but it will also be the
India of our dreams. That India
might not be apparent to us but
but Swami ji can see it by the
means of the power of his yoga.
This is the reason why he is taking
the mission forward at a fast pace.
Prosperous India:
Only good education brings

you permanent prosperity. High
education destroys both the

external and internal bankruptcy.
Spiritual, mental, character
related, moral, family related,
etc bankruptcy come under the
category of internal bankruptcy.
This can be shorted out only
with the help of good education,
knowledge, wisdom which has
been described as accomplishment
of Nihshreyas by our great saints.
On the other hand, lack of material
knowledge, material resources,
lack of prosperity, poverty,
helplessness,
unemployment,
starvation, laziness, criminal
mentality, slavery, etc come under
bankruptcy. In vedic education,
our saints never opposed material
prosperity. Even today, Swami
Ramdev ji is biggest supporter of
prosperity in social and national
life. This thing has been described
by our saints as Abhyuday. It our
good fortune that Swami Ramdev
ji type of great person is living
with us on this earth. Apta Purush
are described as person who
are Kritdharma, who believe in
doing favour on all living beings.
Yathabhutarthchikhyapayisha,
which means the way they
known, the same way they want
to educate others. They feel that
there is no other way besides this
to ensure welfare of the people.
It means unless the living beings,
who are in the darkness of mental
bankruptcy, will not rise above
ominous things, their welfare
cannot be ensured. With only this
perspective, Apta purush, sages,
great saint Ramdev ji has engaged
himself in making India clean,
healthy, educated and prosperous.
Let us make our lives valuable by
joining this movement n
Kavyanjali
Yoga guru great respect to you

Yoga guru, a great respect to you, born and
raised at Haridham,
For you, nation is most precious, a lot of respect to you.
You have respect for all languages, you take pride in
speaking Hindi,
Indian sanskaar is great, a lot of respect to you.
You trigger enthusiasm in youth, encourage to
become brave,
You promote Swadeshi, you deserve a lot of respect.
Your teachings will be adopted by the nation,
besides great human values,
O great sage, o gret scholar, this nation will remember you
with great respect, you deserve a great respect.
Ved Bhooshan Tripathi/ Dr Ramashray Mishra
Training camps for Vaidya (Ayurved doctors)

From January 02 to 31, 2015
The Patanjali Chikitsalayas and Arogya Centres across the country, which are
functioning with the blessings of respected Swami ji and Acharyaji, require best Vaidyas
or Ayurveda doctors. They would get Rs 20000 as monthly salary after selection through
due process. To carry forward the traditions of Charak, Sushrut, Dhanvantari and other
great sages, you join this service for the sake of humanity. You can call on the phone no.
01334-240008 or can send your bio-data at the email ID- patanjalitraining@gmail.
com. For detailed information about the training, you can log on our blog- http://
patanjalivaidya.blogspot.in/ Last date for application is December 20, 2014.
Specific diseases
famous cancer specialist had once said that a doctor while treating a patients disease, mainly focuses
A world on curing the symptoms and he considers the patient as a conglomerate comprising of different
kind of things. This is dangerous for both the patients and the doctor. Human body should not be considered as a
machine. It is a body of living being which has all its part interlinked. The centre of the entire physical activities
is our digestive system as it is responsible for providing sufficient energy to all body parts. When you have upset
stomach, the whole mechanical activities of our body gets disturbed and bones, muscles, respiratory system, blood
circulation, heart, and others become dysfunctional. Therefore, to have a better understanding of the inter-relation
of all body parts it is necessary to understand the functioning of our digestive system.
Dr Nagendra Kumar Neeraj
Chronic diseases
can cause caner too
t is often said Gastroenteritis is the main reason

for arthritis. Patients of constipation have weak
senses, joint pains, headache, etc. Many doctors have
experienced that various different things strangely
seem to be inter-connected, now it is most required
to take them seriously.
California Universitys Dr Petrokis and Dr King Davat
have concluded that constipation can cause breast
cancer and they cured the problem just by changing
the food habit. Australian Doctor Josef D Varda has
said that in the intestine, a large number of bacteria
get accumulated which are responsible

for toxicant organism which are
absorbed in the blood which happens
only due to constipation. After a lot of
research on many patients, he suggested
to give enima of lukewarm water to
the cancer patients everyday as it will
give them strength to fight against the
disease. This has
Other Indian scientists are of the
view that crores of bacteria present in
the intestine are of two kinds. First are

flora friendly bacteria and second are
disease causing pathogenic bacteria.
Bad food habit, surgery of stomach,
IBS (Irritable Bowel Syndrome) other
stomach related problems cause
constipation cause a lot of toxicants in
the stomach and after getting absorbed
in the blood, they make the whole
digestive system toxicant. Harvard
University scientists have proved that
bacterial antigens after getting into the
blood, they attack the tissues and infect
the joints and tissues badly which results
into arthritis of different kinds. Cancer
specialists have proved that pathogenic
bacteria convert fatty acids present in
our food into cancerous elements and
after getting into blood they spread in
several body parts and produce cancer
and other dangerous diseases. This way,
it can be said that all diseases are caused
due to dysfunctional digestive system.
Bad food habit and

unfriendly bacteira
Wrong food habit, pathogenic

bacteria produce chemicals which cause
diseases. Protein, fats, carbohydrates,
minerals, vitamin are affected due to
the presence of unfriendly bacteria.
Amino acid gets converted into biogenic
emines. Pathogenic bacterial produce
dangerous elements which can cause
depression, mental disturbances, and
other such problems. They also disturb
functioning of nerves and pituitary
related problems. They destroy liver
and soon enter into blood and spread
the diseases. Though friendly bacteria
have control on the spread of unfriendly
bacteria to keep us healthy. However,
in case of constipation, the number of
unfriendly bacteria increase drastically
and they overpower the friendly
bacteria.
It is also dangerous:
Following problems cause increase in the number

of the unfriendly bacteria which make our stomach
dysfunctional:1. Very processed food, sugar, Besan (gram flour), all
purpose flour, biscuits, rice flour, polished pulses.
2. Stomach and eye operations.
3. Hot and spicy food, fried food and the food cooked
for long time.
4. Such food which are not easily digested in the
body, which cause allergy.
5. Processed carbohydrates, proteins
6. Excess eating habit.
7. Reduction in the quantity of digestive juices
8. Wrong symmetry of stomach and intestine since
the time of birth.
Moreover, quality of food, quantity, your state of
mind at the time of taking food, are responsible for
increase in the number of unfriendly bacteria. People
are prone to take unhealthy diet in abundance which
are not easily digested and our stomach has to suffer.
Stomach, pancreas, liver, etc release digestive juices
but excess of food intake make their function weak
and in course of time they become dysfunctional.
Indigestion make the whole blood contaminated and
even vitamin B12 is also consumed by unfriendly
bacteria and the person become anaemic. The food
which cause you allergy are also responsible for
causing this condition.
Avoid fibre-less food
Around 1985, appendicitis created havoc in Britain

and its cause was discovered by Dr Redshot in 1920. He
had concluded that the problem is caused due to low
fibre in food a person takes. Later in France, Germany
and US, further researches were conducted. Scientists
of these countries concluded that fibre-less, crispy
and crunchy which suits to our taste buds for which
they are processed are responsible for the problems
like appendicitis and other diseases.
The scientists were of the view that processed food
might have contained infections caused due to germs
but the same food could not be digested properly in
the stomach. This undigested food gets rotten in the
stomach which gives birth to dangerous bacteria are
responsible for infection in appendices. The root cause
of all the diseases of modern time are processed food.
Specific diseases
The only solution to all these problems is to turn to
organic and natural food to keep the stomach healthy.
If the food will be digested properly in the body, you
will be healthy. You will be full of self-confidence, you
will able to take right decisions and success will come
on your way.
The food which will keep the

stomach healthy
It has been acknowledged by scientists across

the world that garlic, onion, orange, lemon, carrot,
papaya, pineapple, wheat, food stuffs rich in citric acid
and other fruits and vegetables and their juices have
immense power to destroy the bacteria which cause
deadly diseases. The medicines made of chemical in the
laboratories kill both the friendly and deadly bacteria
but the natural medicines grew in the natures lab like
garlic not only kill dangerous bacteria but they also
fortify the friendly bacteria. Fresh curd has crores of
friendly bacteria like lactobacillus acidophilus which
keep the spread of dangerous bacteria under control
and help us to keep healthy.
According to the researches conducted at various
laboratories of World, these are the vegetables which
can cure the problems like ulcer and constipation are
- 1. cabbage, its juice has to be taken in half of water,
2. cucumber juice, 3. carrot juice, 4. Bottle gourd juice,
5. coconut water and its pulp 6. Milk, 7. Ripe banana, 8.
Bel juice. Besides, fresh curd, sweet orange, vegetable
soups, papaya, watermelon, Muskmelon, Kishmish,
Munakka soaked in water, apricot , Ridge gourd, raw
papaya, raw and boiled banana.
Take lemon, honey and water when you dont have
acidity. Pure honey is very useful food stuff. To reduce
acidity, take a spoonful olive oil before taking your
diet. Always avoid over eating.
Constipation will have to be

categorised as a disease:
Constipation is a disease which is fallout of modern

days life style. This is the reason, modern doctors are
not ready to accept it as a disease. Therefore, modern
researches of the scientists have proved it that it is not
a simple disease but is a big health related problem. It
seems to be like a common disease but it is not like
that. It is root cause of all major diseases. Constipation
is the rood cause of all diseases.

Whatever we eat is digested in the liver
and intestines and subsequently they are
also absorbed by them. Undigested food
comes out of the body as undigested food.
If this excrements are not released out
of the body then this condition is called
constipation. There are many people
who go to clear stomach after 3-4 days
and that too with the help of medicines.
When you are not able to clear your
stomach for 1-2 days, be cautious as you
might be being caught by constipation.
This garbage inside the stomach
in the form of undigested food remains
inside the body for many days which gives
birth to dangerous bacteria and toxicant
gases. In fact this toxicant must come
out of the body but it is reabsorbed by
the intestines and toxicant gases spread
to all parts of the body which makes
the blood and all parts of the abdomens
contaminated. This is the reason, why
when this constipation persists for
some time, the person begins to have
problems like lack of vitality, headache,
gas, sleeplessness, imbalanced state of
mind, lack of appetite, indigestion, pain
in waist, etc are some of the disease
which begin to appear.
Intestine has its own peristaltic
movement
which
pushes
the
excrements forward which is the state
of constipation. Mental problems can
also cause constipation. If mothers
have mental weaknesses and tension,
their kids could have the problem of
constipation. If mother takes processed
food, then it can cause constipation to
both the mother and the son. Therefore
it is very important to protect ourselves
from constipation.
It gives birth to such diseases in the
body which make the body walls weak and
almightys blessings go away and the body
becomes home to many diseases. n
Geeta in brief
One can make even impossible things possible through power of yoga
eeta is the voice of almighty. As long as the common people, the society, the nation continue to function according to the rules of
discipline of almighty, the Geeta flows in peace. When the discipline is enfrienged, its smooth flow gets blocked. Then voice of Geeta
becomes loud. One who understands this voice, gets a high place in the society. He gets recognition as a legend, a hero, a revolutionary, a path
changer. One who is capable in understanding the voice of nature in the era of darkness.
In the Pandav era, Yogeshwar Krishna was such a person, similarly, Adi Shankar was also like the same. During freedom struggle, it were
Lokmanya Tilak and Mahatma Gandhi who worked the same way to build a new era for the betterment of the society.
When Geeta speaks, the world witnesses the phenomenon like Mahabharat in which enormous symbols of atrocities and exploitation had got
destroyed. In this situati on it becomes impossible for even almighty to stop this change. The gesture of present is the same.
Today, Swami Ramdev ji, the greatest saint of present era, has adopted the same message of Geeta for building a new era which we are
presenting here...
editor
Yachchapi sarvabhutanam
beejam tadahamarjun I
Na tadasti vina yatsyanmaya
bhutam characharam II 39II
Nantoasti mama divyanam
vibhutinam parantapa I
Aesha tooddeshatah prokto
vibhutervistaro maya II 40 II
Yogeshwar says that he is the
origin, the reason of being
of all living and non living
beings in this universe. There
is nothing on the planet which
has existence without me. O
Parantap, there is no limit of
the extent of my vibhutis.
Where ever the thing that has
blessings of mother Lakshmi,
you consider them a part of
me. O Arjun, what will you
do by knowing about my
Vibhutis? In short I would
say that I occupy the whole
universe by my self.
Yadyadwibhootimatsatvam
srimadurjitameva va I
Tatdevavagachcha twam
mama tejomashsambhawam
II 4II
Or Bahunaitena kim gyatena
tavarjuna I
Vishtabhayahamidam
kritasramekanshena sthito
jagat II 42II
Message
The last verse is based on

Purushsukta of Rig Ved.
Padoasya vishva bhutani
tripadasyamritam divi
(R.10.90.3). This is also in
Chhandogya Upanishad
(3.12.6) . Clearly, when there is
one god who has his influence
in all parts of the universe,
then it is unthinkable for
a human to imagine of an
absolute form of almighty.
In the beginning of this
chapter it has been said that
Parbrahma is the origin of the
existence of everything. You
can call it supreme power or
supreme energy. Everything
has been described in Uttam
Purush. It exists into the
existence of everything.
One who experiences it, he
knows that it is eternal and
such people are free from the
complexities of this life and
they easily get salvation.
Further Yogeshwar Krishna
has proved how Vedic
literature is important in
evolution of this universe. It
has been said in it that first of

all soul, life, mind, ego, Sapta
Rishi and Manu were born
who were instrumental in the
birth of all the subjects. They
are called sons of the almighty
on the earth. Enlightened
persons know this fact
very well and they engage
themselves in the prayer of
almighty.
Arjun says- O Lord Krishna!
Narad and Vyas say the same
things which you say. It
appears to me that you are the
creator of the whole universe.
This universe is born out of
you. I am keen to listen your
Vibhuties from your own
sweet voice.
Then Yogeshwar Krishna
describes that in all key
deities, Gandharvas and all
the living beins. In rives I am
like ganga, in mountains, I
am like Himalaya, crocodile
in fishes, lion in animals. My
vibhuties have no limit, they
are infinite. This way I am the
origin of the whole universe.
This visible world is the part
of my own power.
Yug Dharma
Patnajali Yogpeeth spreading message

of new era, building a new world
Dr Vijay Kumar Mishra
countries like France, UK, Russia and the countries of Africa saw great revolutions in the past centuries, but still
it cannot be said that their revolution was based on humanitarian grounds. Besides, many other countries of
the world saw change of Governments for so many times but the issues concerning to the common men remained addressed.
Affirmative changes were witnessed only in Buddhas Dharmachakra Parivartana and Mahatma Gandhis Swaraj Movement.
Their movements were effective and they brought changes because they were influenced by ethics, intellect, social and spiritual
ideas and philosophy of yoga. These instances prove that only external changes cannot bring real changes.
The
ven today, similar movements

are most awaited. The
revolution will have to happen
at the level of feelings, thoughts
and intentions. There has to be
launched a drive in which one
will have to blow a wave which
would make people compelled to
be a part of it. But such changes
can be brought only with the help
of philosophy of yoga and nonviolence. The movement which was
emanated from Patanjali Yogpeeth
is not confined in any time frame
and its mission will not be over just
with change of Government. This
movement has evolved out of divine
land of saints whose intentions
are pure and goal is to ensure the
welfare of the whole world. It is way
ahead of even Gandhis movement
of Charkha and Khadi.
Fight against blackmoney and
changing the system of corruption
are the two major weapons of this
movement and they guide it in the
right direction. In fact, if we look
at its flip side, its main motive is to
ensure the well-being of common
men, improve peoples character
which could be identified as

complete divine awakening. When
such factors become a part of our
life, rest of all will happen itself.
Such movements appear after
many generations which are fully
dependent upon spiritualism,
therefore it is better to call it a
movement of an era. System of
almighty is not ready to leave
the present state of the world to
destiny. The dirt of last 2000 years is
going to be removed very soon. The
fast changes apparent around us are
reflection of it. Improper things are
to be dumped and propriety is to be
restored. A clear line is seemed to be
getting drawn between idealism and
impropriety. Todays challenges are
very serious and if they are resolved
then it will again be difficult to get a
able person who could run the new
system properly. This is the reason
why Swamy ji Maharaj and respected
Acharya Balkrishna ji are on the
one hand spreading the message of
Yoga-Ayruveda-Pranayam to spread
pure knowledge, auspicious acts,
and auspicious dedication to build
able human beings who could have
a capability to lead not only the
country but the whole world. While
on the other hand impropriety,
corruption, are also being cautioned
by them. It means, their one step
moves ahead strongly, second is on
the path of Abhyuday.
As far as we could understand,
Patanjali Yogpeeths goal is not
confined to only this. It is much
wider and large. It is so huge and
large that it could be able to change
the system of whole world and make
is pure and auspicious for the sake of
welfare of all. Its mission is to build
a world where welfare of everyone
can be ensured.
In other words we can say that

the duo is making the world of
human so strong through yoga
and Ayurveda that the door for the
revolution of this era, creation of
the new world, could be ensured.
On the other hand, they are also
building such a human beings who
could be aptly able to fight against
corruption, black money and other
inhuman acts. No doubt, when
this movement of the great saint
will spread in the world, filth of
the whole world will be removed
and inhuman forces will be
destroyed and things will improve
drastically. The issues which will
be properly addressed will be the
factionalism born out of common
wars or the world wars, annexation
of the territory of a weak nation
by a powerful nation, attrocities
of the citizens of economically
and militarily weak nations, civil
war, atrocious rules, economic
dominance of powerful nations and
control of over technology.
If we look at the serous issues
confronted by the world, powerful
nations are exploiting the resources
of weak nations, which is responsible
for wars in different parts of the
world. The world is divided due to
these reasons, whether you may like
to call it nationalism or something
else. Everywhere, one and only
thing which is responsible for
exploitation, deprivation are taking
place by the use of diplomacy,
administrative manipulation, use
of arms and ammunition, and other
methods to pressurise weaker
countries.
Powerful countries are growing
ambitious everyday and they are
exploiting weaker nations. Such
things are most required to be
Are supporter
of Vasudhaiva
Kutumbakam,
believe that the whole
world is their mother
and no mother can
see her kids in bad
condition...
moreover, she produces
as much resources that if
they could be distributed
equitable, everyone will
be prosperous and happy
and basic requirements of
everyone will be
easily fulfilled.
countered. In comparison to the

era of feudalism, the things have
changed in a great way and now the
wars are fount on the dinner tables
secretly, while their aim is still the
same- to exploit the weak by using
various tricks, which are devised to
trap the weak countries to exploit
their resources.
The boundaries of variuos
nations were created on the basis of
such dirty thoughts. If a country has
something in its possession, it would
like not to relinquish it. It consider
it justified to keep hold on it. In this
context, the whole world is victim
of ill practices like blackmoney,
corruption, and all dirty acts and
policies and common people across
the world are suffering due to it.
Now the time has come to destroy
Yug Dharma
this system.
Respected Ramdev ji and
other great saints of the world
are supporter of Vasudhaiva
Kutumbakam, believe that the
whole world is their mother and
no mother can see her kids in bad
condition... moreover, she produces
as much resources that if they could
be distributed equitable, everyone
will be prosperous and happy and
basic requirements of everyone will
be easily fulfilled.
This is the basic philosophy of
Indian culture with the help of it, it
is imagined that the whole world is
a family which earned India a place
in ancient time as a head, a guardian
of the whole world. To move ahead
in the direction, the time is crying
again and again because sons and
daughters of a mother are not
able to get their right share in the
things produced by their mother.
So called capable persons who have
accumulated sources by any means
for their comforts, will not only
share the sources with deprived
people but they will also not
tolerate to see unprivileged persons
enjoying even a simple way of life. It
is not confined only to this. If it is a
matter of a family, or a country or of
the whole world, such habits can be
observed all around. Deprived and
needy people are always ignored. If
we look at the international level,
the natural resources like fuel or oil
which are available in abundance
in Middle East countries. The fuel is
under control of a few countries of
the region and their allies. However,
if we take this case in a justified
manner, mother earth is of the
whole world. With this, mineral oil
must be considered as a property
of every individual living on this
The movement which is

born out of Patanjali is
not confined in any time
frame. It will not end with
change of guard...
this movement is born out of

the land of a great yoga icon, a
great saint whose
intention is to serve the
humanity and ensure the
welfare of whole world. Its
motto is beyond Gandhis world
vision of Charkha and Khadi.
planet. Many countries like US have

a large part of land which is not in
use while the people of densely
populated countries like China
and India have scarcity of land for
habitation. People in these country
suffer a lot due to unavailability of
land for habitation. In fact, whether
it be an individual or a nation, they
have every right to earn livelihood.
But one should not spend more than
his or her basic requirement. Rest
can be used for the other deprived
persons. In fact the way we have a
feeling of kinship in our family, the
same way we should have a feeling
for the people across the world.
All are required to do
Purusharth. All should fulfill the
basic requirement of life from the
sources earned from Purusharth.
With this feeling, the circumstances
will start to change and the whole
world will be a true example of peace
and harmony. No comment should
be made over division in the name

of nationality and the nation. But
what if once a division is created,
will it be possible to change it? Such
decisions must have been made
with a view to ensure the welfare
of the world. Then why not new
contemplation should be made for
establishing new order. Future will
not be like the same. Circumstances
are changing at a fast pace. Almighty
has not made this world to have a
system in a powerful person will
rundown a weaker one. Whatever
is proper, may be it might appear
impossible, but its fulfillment is a
must. Now the change has started
to appear. If we take the example of
India. Nobody would have imagined
that people will revolt against the
wrong doings of their leaders and
the latter will have to face jail term
and disgrace for their misdeeds. But
when the people awakened then
the change continued to take place.
Around 1995, a situation arrived
when the countrys powerful leader
PV Narasimha Rao was summoned
in the court. The issue is still
relevant. Many senior office bearers
are not ready to open their mouth
in this matter. The power of Indian
judiciary is on the rise. People are
growing more and more hopeful
about the judiciary.
Once, it was the time when if
the countrys MPs and MLAs had
stood at a place, they would own
it forever, no one could dare to
take account of their property.
They owned from power to
system, everything. But soon after
a few years, the same peoples
representatives were forced to give
account of their entire property.
Now they are answerable to their
own people. Now who can suppress
the voice against blackmoney. May

be it would take some time, but
justice will be definitely done. This
is the rise of supreme power which
is almighty. Whether you call it the
need of our or anything else.
If we look in the global context,
the situation become clearer. In the
1980s, US and USSR had dominance
in the world. It seemed impossible
that US will shun its expansionist
policy. USSR was not expected to give
freedom and right to decide to the
countries which were part of its camp.
From Chinas dominant attitude
to the dominance of oil producing
countries, were on the rise. All
of them were powerful nations
and had a major say in the world
order. They considered their every
move right and justified. Nobody
could think that one day they will
lose strength and become weak.
No body had imagined that the
nations which were considered to
be weak will be able to raise their
voice at the global forums. In the
tussle between US and USSR, the
rest of the countries of the world
were like toys. Economically weak
countries were not able to assert
in the world order. Country like
Afghanistan was ruined due to
the fight for supremacy between
the two countries. But later major
changes came in the policies of
these countries.
If we turn a bit back and try to
understand the mentality of these
countries and their leaders, we
can say that a drastic change came
since then. Rise of Hitler and due
to his hawkish polices, surprising
changes were experienced in the
policies of the European countries.
Initially, geographical changes
were witnessed and in the 1980s,
changes at the level of policies

and intentions were perceived.
Now habits of these countries are
changing. Now the powerful and
expansionist countries may quite
possible change their policies and
mend their ways. These nations
may look more helpless as the
people across the world are waking
up. People in all parts of the world
consider themselves proud of being
a human. When this trend will
spread in all parts of the world, the
rampart of falsehood begin to get
destroyed. Decisions are taken on
humanitarian grounds. Majority of
the world population are poor and
deprived. They dont have access
to basic amenities, knowledge,
thought,
resources,
divine
experiences etc. If we see it from the
concept of the principle of politics
of democracy, these sections of our
society are in majority. They are
looking at future with hope.
It is also required that those
who have enough resources,
facilities and amenities, should
consider themselves as the
leader, representatives of the
deprived people. So called people
of high stature are now required
to think differently. They have
a responsibility to take care of
deprived people the way parents
take care of their children. Which
community has occupied which part
of the world is an irrelevant issue.
It is the need of hour to find a new
humanitarian ground. Now it can be
said that the world will see a faster
change and soon the whole world
can become one world. The concept
of Vasudhaiva Kutumbakam, a
long cherished dream, will be true.
Similar situation is apparent even
inside the country.
Once the US tried to pressurise

India to seek support on Vietnam
with its wheat laden ships, is now
desperate to prove itself Indias
most friendly nation. The changes
which are surfacing at a fast pace
demand significant in the world
order. The practices which were
once confined to a very smaller
part of the world is now spread all
around. People and their countries
are changing at evey level at a
fast pace. Therefore it is required
to make these changes favourable
for all countries of the world,
according to the need of hour. The
kind of changes recently witnessed
in India especially the change of
government has compelled the
leaders of powerful countries to
change their perception about India.
This development is unprecedented
in itself. The powerful countries
which were moving in an
inappropriate direction will very
soon retreat. But glory of India
will rise when great values will be
incorporated into our system. Our
leaders will have to take initiative
and move forward with the help of
common people.
It wont be surprising if sages,
yoga teachers and Patanjali
movement will guide the drive.
This the duidance of almighty.
Those who will join the drive they
will be identified as creator of a
new era and those who will keep
away from it will slip into oblivion.
Why not we utilise the opportunity
and make our family and ourselves
graced. Patanjali movement is
amalgamation of the elements
of Mahatma Buddhas spiritual
revolution and Mahatma Gandhis
moral, socio-political revolution
which is the need of hour. n
International
global level a new awareness has erupted against

Today at
terrorism and the world has began to consider the
menace as a serious threat to the mankind. It is an auspicious

sign for building a best world for us. In fact targeting the menace
of terrorism is like plucking the leaves of a tree. Terrorism is a
byproduct of suppressing religious freedom. Therefore it is
necessary to make religious freedom universal.
Cruel ideals of supressing

religious will end when
the world will turn to

spiritualism
Prof. Rameshwar Mishra Pankaj
his is a crucial issue the

same way once racism
and imperialism had vitiated
the ambience of the world.
Imperialism and colonialism
of many European countries
began to shrink. Spiritualism
not only offered a great relief
to the countries which were
victim of colonialism and
imperialism. It also offered
solace to the countries
which were proponents of
imperialism and colonialism.
Today, both groups of the
countries are more happy
and prosperous. Earlier,
both the countries would
fight against each other
and were also suspicious
about each other. Example
of only India will be enough
in this context. Centuries
back, armed troops of East
India Company and British
Government with the help
of their supporter Indian
kings and Nawabs together
suppressed the voice of
Indian rebels in 1857 but
since then the British rulers
were in fear psychosis that
their rule could be rooted
out anytime. Gandhi ji often
talked of the fear psychosis
of the British rulers.
On one hand, British queen
Victoria made following
proclamation 1. British rule will never
impose
its
protestant
Christianity on Indians and
Indians would be guaranteed
religious freedom.
2.
Earlier
intervention
by the British rulers into
the rights of Indian kings
and queens to adopt their

heir was denounced by
the British crown. It was
announced that in future,
no such intervention would
be allowed. This way it
was made clear that East
India Company was never a
representative of the British
crown and the companys
top official was never the
Governor General of India.
It was also proclaimed that
the British Government
would never intervene into
internal affairs of kings of
Indian states. On the other
hand, the British queen
expressed her expectation
from the Indian kings that
they would never invade the
part of India which was ruled
by the British Government. It
was a clear treaty and those
who call it slavery of Indians
are not well informed.
3. It was also announced that
people living in British India
will have religious freedom
and they were allowed to read
and practise their religious
texts and scriptures. With
this, parts of Ramayan and
ethics of Sanskrit scriptures
were taught in the normal
schools while in the Muslim
schools, teachings of Hadith
and Koran were taught till
1947. In rest parts of India,
the
States which were
ruled by Hindu kings were
imparting school education
according to the teachings of
Hindu scriptures and Kings
too followed their religion.
This way clearly, in both the
princely states and British
India, people had religious

freedom. But after 1947,
atheist and materialistic
people grabbed power in
the country and removed
religious teachings from
school
curriculum
and
religious freedom of the
people was hijacked. It was
done for the sake of spreading
Nehruvian philosophy. To
deceive people, this act was
termed as scientific and
logical.
Even after this, religious
freedom
continued
to
prevail in the main stream
of India. Here Adwaitvad,
Dwaitadwait,
Traitvad,
Swadvad, Shakta panth,
Shaiv Panth, Vaishnav Panth
continued to prevail.
Due to this religious
freedom, Hindus, Muslims,
Sikhs, Christians, Hebrews,
ects lived together in this
country. However, some
sinisters of course tried to
destroy the other religions
and in the influence of
greed to get a share in the
wealth looted from the
victims, others to joined
the madness. But normally,
people of all religious groups
continued to live in harmony
in this country. But this
harmony was not liked by
the rulers who believed in
materialism and in the name
of guaranteeing religious to
minorities, they breached
the religious freedom. In
turn, some people would
stall hoardings on the
roadside with a message to
spread only one religion
in the world and they felt

proud in doing so. In result,
they could claim- this is the
only way.
Some would say- Shala
Garbia La Shartiya Islamia
Islamiyaya while others
People have started to

search for the essence
of all religions of the
world. With such small
initiatives, global
spiritualism is being
restored again.
Vedas are the sources of

the same heritage.
Patanjali Yogpeeths
movement is heading in that
particular direction.
International
would say - Jesus said- I am

the path and I am the final
destination. Besides this, it
began to be announced from
public places that worshiping
Indian deities is just illusion.
This
infringement
of
religious freedom is the root
cause of terrorism.
It is important to note
that for the last 2000 years,
religious freedom in Europe
has been under suppression.
After 18th Century AD, it was
stopped and that too when
European
Governments
began to get allies in
other parts of the world.
These allies were ready to
cooperate with them for
all purposes but not for
religious purposes because
they were afraid of losing
their legitimacy in their
own society. This way, it was
due to Indias great ancient
cultural heritage and also
due to its strong society, the
Europeans forces could not
get sufficient allies in India.

If they found people like
Ram Mohan Roy, they came
up with a new spiritual idea.
Even he could not dare to
support Christianity openly.
It was the result of the
strength of Indian society.
Due to this very strength, the
atheist and materialist forces
which grabbed power post
Independence were afraid.
Due to this reason, they tried
to isolate Indian traditions
from education and law of
the land. They did not try to
make Indian Government as
a representative of the true
Indian society they divided
the society in small pieces.
They encouraged nuclear
family instead of joint family
based on Indian tradition. For
this, various methods were
adopted. In this process,
in the name of promoting
scientific ideas, a nonreligious, atheist, anarchist
concept was presented. They
did not stop there. They also
tried to weaken Indias main
society-Sanatan Dharmi or
Vedic society. For this the
ideas which favoured ban
on religious freedom was
protected and promoted.
This is why the terrorism
which has been persistent
in Europe and Africa with
various different identities,
it was apparent for the first
time in India in the last 40
years. The most important
thing is that the root of
this menace lies outside
the country therefore, no
effective way is in sight to
destroy it. Only development

of religious and spiritual
freedom can be a right
and effective initiative in
this direction. Moreover,
ban on spiritual and
religious freedom should be
denounced internationally
as a crime.
If an initiative has to be
made from India, the most
able person for this purpose
is Yoga Guru Swami Ramdev
ji. His personality is widely
respected and he has an
international influence and
he has through yoga and
Ayurveda, made religion
according to the need of
life. Today, his yoga has
affected the ideas and
views of the masses and
now they have come out of
religious
inappropriation
and now they have turned
towards
spiritualism.
People have started to
search for the essence of
all religions of the world.
With such small initiatives,
global spiritualism is being
restored again. Vedas are the
sources of the same heritage.
Patanjali
Yogpeeths
movement is heading in that
particular direction. Such
religion will not threaten
any one and this way every
individual will himself or
herself attain religious
freedom and his life will be
free from any king of political
prejudice. Therefore Baba ji
is most capable to launch an
international drive for this
purpose. Why not we too
join it. n
Ayurveda
Secrets of Ashtang Ayurveda
Kayabalgrahordhvaangshalyadashtrajaravrishan I
Ashtavangani tasyahushchikitsa yeshu sanshrita I
Anvay- Tasya ashtau aganani kayabalgrahordhvangashlyadanshtrajaravrishan aahuh, yeshu chikitsa
Sanshrita I
Word meaning; -(Maharshyaha= sages like Atrai and Punarvashu), Tasya= Of that Ayurveda, Ashtau= Eight,
Anganani= Body parts, kayabalgrahordhvangashlyadanshtrajar vrishan= Body, hair, graha, urdhavang
(Shalakya), surgery, Danshtra (Agad), Jara (chemical) and Vrish (Vajikaran), Ahuh: Said, Yeshu= The eight
body parts, Chikitsa= medical treatment, Sanshrita= dependent.
Meaning: Atrey, Punarvashu and other saints have described about eight parts of Ayurveda. They are
- Kayachikitsa, Kaumarvritya, Bhootvidya, Shalaktantra, Shalyatantra, Agadtantra, Rasayantantra and
Vajikarantantra, which together make the whole Ayurveda, which is like this1. Kayachikitsa: Kayachikitsanam sarvangsanshritanam vyadhinam jwarraktapittashoshonomadaapasm
ar-kushthaamehatisaradinamupashmanartham I It means the sections of Ayurveda in which treatment
for the diseases like fever, raktapitts, shosh, hysteria, apasmar, leprosy, diarrhea, etc have been described.
This is called body treatment. (S.S. 1/6)
2. Diseases in kids: Kaumarbhrityam naam kumarbharandhatrikshirdoshsanshodhanartham
dushtastanyagrahasamuthanam cha vyadhinamupashmanartham. It means the part of Ayurveda which
describes the nutritoin of a kid, the test of dhatri, methods to counter balgraha and treatment of diseases
have been described, is called Bal Rog or Kaumarbhritya _ (S. S. 1/8)
3. Graha (Bhoot vidya)- Bhutvidyanaaamdevasuryaksharakshahpitripishashnaaggrahdyupsrishtachetsaam
Shantikarma-baliharanadigrahopashmanartham I It means, the part of Ayurveda in which methods like
sacrifice, worship, etc have been described to treat curses of divine powers is called bhoot vidya. (S.S. 1/7)
4. Urdhvank (Shalakya)- Shalakyam namordhvajtrugatanam roganam
shravanvadananahynaghranadisanshritanam vyadhinamupashmanartham. It means the part of Ayurveda
which describes about the treatment of the diseases in ear, eye, mouth, nose, etc which are called
Udhvajtrugat parts of body, is called Shalakyatantra. (S.S. 1/5)
5. Surgery: Tatra shalyam nama vividhtrinakashthpashanpashulohloshtasthibalnakhpooyastra
adushtavranantagarbhashalyoddharanarth, yantrashastraksharaganipranidhanavinishcharyarthanch. It
means the part of Ayurveda which describes about treatment to remove grass, wood, stone, etc from the
body by surgery is called Shalyatantra. (S.S. 1/4)
6. Danshtra (Agadtantra)- Agadtantra naama sarpakeetlutamushakadidashvishvyanjanarth. It means the
part of Ayurveda which describes the treatment of snake bite or sting of mosquitoes or other insects or the
other effects of poison, is called Agadtantra. (S.S. 1/9)
7. Old age ( RASAYAN TANTA)- Rasayantantranam vyah sthapanmayurmebhabalkarma
rogapaharansamarthancha. The part of Ayurveda which talks of maintaining young age for a long time,
keep fit and fine in old age and improve immune system, it is called Rasayan tantra. (S.S. 1/10)
Charak has described Ayurveda as- Labhopayo hi shastanam rasadinam rasayanam (CH. CH. 1/18)
8. Vrish (Vajikaran tantra)- Vajikarantantram
namalpdushtakshinavishushkaresamapyaynaprasadopachaynanimitam praharshjananartha cha. It means
the part of Ayurveda which talks about treatment of alpavirya, dushtavir, kshinavirya, shushkavirya, and
strengthening of sperm, purification of sperm, and sex capacity is called Vajikaran tantra (S.S. 1/11)
(Compliments from Ashtang hridayam)
Research
Behavioral disorders
in children and role of yoga

Dr. Shirley Telles and Nilkamal Singh
parents are anxious for their child to be excellent at their school work and well
Nowadays behaved as well. Unfortunately with increased city living, nuclear families and
many families in which both parents go to work, children have to spend extra time with their
grandparents or other relatives, and in the absence of such support they spend their after-school
time at day-care centers or learning dance, music and other crafts. Very often children spend the
greater part of their day indoors and stories of playing outdoors seem unreal to the tech savvy
child of today.
owever all these changes can

lead to behavioral disorders.
At least three types of distressing
behavioral disorders will be described
here. These disorders are
1. Oppositional Defiant Disorder
(ODD)
2. Conduct Disorder (CD)
3. Attention Deficit Hyperactive
Disorder.
What is very important is that these troublesome and

distressing behavioral disorders can be managed with yoga and
changes in the way of living. Three case histories will make this
more clear.
Vijay is a thirteen year old boy living in a city in India. He
lives with his parents who have busy jobs which involve working
late and having to travel often. Of late Vijay has started bullying
younger boys at school. When his class teacher told him to stop he
answered back, rudely. At home his mother was sad to discover
that Vijay would finish all the snacks in the fridge and never eat
any of the carefully cooked meals she had kept for him. Also Vijays
marks had started dropping and his teachers were concerned. At
this stage Vijay has Oppositional Defiant Disorder (ODD), a mild
form of a behavioral disorder.
If Oppositional Defiant Disorder (ODD) is not managed
successfully it can lead to Conduct Disorder (CD) which can also be
caused by other factors.
Anita.was a fourteen year old girl. Till a year ago her life
had seemed very happy. Her father was a busy doctor but her
mother was a happy housewife. She had a younger brother and
sister. They lived in the suburbs of a big city in India and were
very happy. The one year ago her parents started to have bitter
disagreements. Anita hated to hear her parents fight with each
other. She would try to console her younger brother and sister.
Then one day her father left home. Anitas life was shattered as
her parents got ready to get divorced. She missed school, was rude
to her parents and preferred the company of older boys and girls.
She started taking money from home to be able to spend as much
as her older, college-going friends. Anita. had a conduct disorder,
a more severe behavioral disorder, which can still be managed
with counseling, kindness and yoga.
Poonam is an eleven year old girl. She comes from a happy
family with healthy and normal parents. The problem with
Poonam is she cannot keep still even for a few moments. She
seems to have endless energy. Her parents are tired looking after
her. Though her intellect is normal she cannot go to a normal
school as she never sits still long enough to pay attention to
her teachers. Poonam has ADHD. This condition which is tiring
and distressing for the parents and teachers can be managed by
lifestyle (especially diet) changes and yoga.
Behavioral Disorder
Childhood is a very important phase in our life. In fact the

foundations of almost all psychological patterns in our adult life
are laid during our childhood. Children who are brought up in a
physically and mentally healthy environment are more likely to
become healthy and responsible citizens in future. In contrast
those brought up in a unhealthy environment are more prone
to become unhealthy adults (physically or mentally). Hence it is
very important to nurture our children in the correct manner.
However in life there are many events which occur during our
childhood and some can cause problems in a childs mind. Some
of these problems are temporary for example during examination
stress a child can become angry or tense but these reactions fade
away when the examination is over. Such temporary problems
are not to be taken very seriously. If problems such as patterns
of hostility, aggressiveness, or disruptive behaviors persist for
more than 6 months without any

specific cause of stress than a child
is considered to be suffering from a
behavioral disorder. Early signs of a
behavioral disorder are:
Harming or threatening themselves,
other people or pets
Damaging or destroying property
Lying or stealing
Not doing well in school, skipping
school
Early smoking, drinking or drug use
Early sexual activity
Frequent tantrums and arguments
Consistent hostility towards
authority figures
These early signs are important
for parents as it can help them to
recognize that there is something
wrong with their child. The cause for
behavioral disorders in children can
be due to biological and psychological
factors.
Biological factors are:
Physical illness or disability
Improper nourishment
Brain damage or injury
Hereditary factors
Psychological factors are:
Divorce or other emotional upsets
at home
Coercion from parents, especially to
perform well
An unhealthy or inconsistent
discipline style
Poor attitude toward education or
schooling
If the early signs of behavioral
disorders are not handled properly
there is a possibility that the disorder
can become more serious and it can
be handled only with the help of a
psychiatrist and medication. Some of
the common behavioral problems are
described below.
Research
Oppositional Defiant
Disorder (ODD)
Many children with Attention Deficit

Hyperactive Disorder (ADHD) display
oppositional behaviors at times.
Oppositional defiant disorder is
defined in the American Psychiatric
Associations Diagnostic and Statistical
Manual of Mental Disorders, Fourth
Edition (DSM-IV) as including
persistent symptoms of negativistic,
defiant, disobedient, and hostile
behaviors toward authority figures. A
child with ODD may argue frequently
with adults; lose his temper easily;
refuse to follow rules; blame others for
his own mistakes; deliberately annoy
others; and otherwise behave in an
angry, resentful, and vindictive way.
He is likely to encounter frequent social
conflicts and disciplinary situations
at school. In many cases, particularly
without early diagnosis and treatment,
these symptoms worsen over time
sometimes becoming severe enough
to eventually lead to a diagnosis of
conduct disorder.
Conduct Disorder (CD)
Conduct disorder is a more extreme

condition than ODD. Defined in the
DSM-IV as a repetitive and persistent
pattern of behavior in which the
basic rights of others or major age
appropriate social rules are violated,
CD may involve serious aggression
toward people or the hurting of
animals, deliberate destruction of
property (vandalism), stealing, running
away from home, skipping school, or
otherwise trying to break some of the
major rules of society without getting
caught. Many children with CD were or
could have been diagnosed with ODD
at an earlier age, particularly those
who were physically aggressive when
they were younger. As the CD symptoms become evident, these

children usually retain their ODD symptoms (argumentativeness,
resistance, etc) as well. This cluster of behaviors, combined with
the impulsiveness and hyperactivity of ADHD, sometimes causes
these children to be viewed as delinquents, and they are likely to be
suspended from school and have more police contact than children
with ADHD alone or ADHD with ODD.
Attention Disorder Hyperactivity

Disorder (ADHD)
According to DSM IV around 6-7% of children in the world are

affected by ADHD, with boys outnumbering girls by three to one.
The characteristics of ADHD can include:
Inattention: difficulty concentrating. Forgetting instructions,
moving from one task to another without completing anything.
Impulsivity: talking over the top of others, having a short
temper, being accident-prone.
Overactivity: constant restlessness and fidgeting
How Yoga Can Help Children with

Behavior Disorder
The practice of yoga when performed under the supervision of

a trained teacher can be useful for children having behavioral
disorders. As we have seen above stress is one of the main
contributors in behavioral disorder. Practicing yoga can release
certain chemicals (hormones, neurotransmitters) in our body
which can make us feel happy and calm. There are scientific studies
which show that those who practice yoga have higher resilience
to stress (ability to manage stress better than those who do not
practice yoga) and better self regulation by adopting healthy coping
strategies. Hence children who practice yoga can face the challenges
of life without suffering the negative effects of stress. Certain yoga
breathing practice like anulom-vilom pranayama can calm down
the brain and can give a relaxing effect to the body. Hence anulomvilom pranayama can be useful for children with ADHD. However
we can make certain modifications, like children with ADHD can
practice anulom-vilom with eyes open as they become more restless
if they are asked to close their eyes. Children with disruptive
behavior have unstable breathing patterns (fluctuation in breath
rate, cessation of breath, and thoracic or abdominal predominance)
yoga meditation was shown to be useful for these children as it can
make the breath stable and decrease the fluctuations.
Children with behavioral disorders should ideally be seen by
a trained yoga therapist and individual practices, including
asanas, kriyas, pranayamas, and meditation, should be suggested
for each child. n
Domestic methods for treatment
Use and see effect

Sore :
Take 500 gm of cow ghee and boil in it neem

leave until their colour turns black and make
paste of the preparation and apply it on the sore
everyday. The problem will be cured very soon.
Ejaculation in dream or problems

related to sperm
Remove pip from Amla fruit, beat it to powder.

Now take one part of Amla powder and two parts
of jaggery powder and store it properly. Take two
spoons of it everyday half an hour before going
to bed with plain water. Taking this preparation
for two weeks will cure the problem. It also cures
other problems related to sperm disorder. It also
purifies your blood.
For increasing milk in

lactating mother:
Take white cumin, fennel seeds, sugar candy and

make their powder separately and mix them in
equal quantity. Take this preparation thrice a
day with milk. It will increase milk in lactating
mother.
Menstruation related problem:
If excess blood comes out in menstruation, then

take two spoons of coriander and boil it in water.
When the water gets cool, just filter it and
take the water everyday before 6:00 am in the
morning. Continue it till the problem is cured.
Malaria:
Take 24 leaves of Tulsi, 5 gm of Neem giloy, 10

gm saunth (dry ginger), 10 nug of small peepal,
and make their paste and boil them in 200 gm
water. After it is cold, take it thrice a day. It will
be very useful in the fiver. n
Education
Yoga, Pranayam and natural treatment

must be mandatory since primary classes
Shanta Kumar (MP)
has achieved great things in all fields and has arranged all comforts of life. Scientists are
doing new inventions everyday and moving ahead and in result the human has scaled
heights of the space and depth of oceans.
Human
uman has achieved a lot of things but peace is still elusive in life.
People have lost harmony in relations and life has become tensed.
New and great achievements are being made in the field of medical science
and our doctors have defeated many a deadly diseases but the blessing has
turned into curse. Recently, a WHO report said that half of the deaths caused
in the world is due to the problems related to the side effects of the diseases.
This has become a new challenge for doctors across the world. Unnecessary
use of antibiotic medicines are giving birth to new diseases. Such deaths are
high even in the advanced countries like USA. These medicines have given
birth to a new disease called Adverse Drug Reaction. Excess use of medicines
is making other medicines ineffective. Adulteration in medicines or spurious
medicines are further aggravating the situation and to address the problem
the Government of India has issued guidelines so that the medicines should
not be used by people in excess quantity. Newly discovered medicines are no
doubt a blessing but their unnecessary use can turn to be a curse.
On one hand people are getting more and more prosperous and on the
other hand a vast section of our society are starving and development has
failed to ensure social justice. Gap between the poor and the rich is on the
rise and according to a report of International Red Cross, more than 100 crore
people in the world sleep every night empty stomach while 150 crore people
have health related complications due to over-eating. 24 crore people die due
to only this problem.
Even in India, on one hand prosperity is on the rise and on the other hand
a large part of Indias population is forced to live under extreme poverty.
Health care facilities have not yet reached to a large number of villages and
if there are some small hospitals somewhere, they are deprived of doctors or
medicines. Large number of villages have not yet been connected with roads
due to which patients fail to reach to hospitals or doctors in time and a large
number of poor patients die every year in the country.
In this context, yoga, Pranayam and natural treatment become very
important for a country like India. Their regular practice keeps us healthy
and and even if any disease strikes, they are not that serious. This is the
New and great achievements are being made in the field of

medical science and our doctors have defeated many a deadly
diseases but the blessing has turned into curse. Recently, a WHO
report said that half of the deaths caused in the world is due to
the problems related to the side effects of the diseases. This has
become a new challenge for doctors across the world.
reason why yoga is getting more and more popular in the world and new
researches are being conducted on naturopathy for example- a call is being
heard all around to get more and more close to the nature. Similarly another
call can be made in India to get more and more close to yoga and natural way
of treating diseases. Such facilities can be made available to a large number of
people at a very low cost.
Achievements in the field of yoga, pranayam and naturopathy show
that the dream of fully healthy India will be realised very soon if they are
made mandatory in school education from primary level. They can be easily
included in the curriculum and also in sports competitions.
Swami Ramdev ji in a very short span of time has done a revolutionary
work through Astha channel in making India healthy. Crores of Indians are
turning to yoga after watching it on Astha channel and attending Swamijis
yoga camps and defeating dangerous diseases without use of any medicines.
In a way he is doing a great service to the nation. He deserves to be
rewarded for rendering this service to the nation. If his work becomes a part
of the governments duty, the dream to make India completely healthy will
soon be fulfilled. Nearly 35 years back I was at Bangalores natural treatment
center. I was in severe pain due to spondilities and there were several other
problems too. My wife had pain in her knee but after some days of treatment
we received great benefit. There I thought that such a centre must be in
Himanchal Pradesh. Readers must remember that when I became Chief
Minister for the first time, I would wear spectacles which I used for 20 long
years but I could increase my eyesight by doing specific yoga and pranayam
meant for this purpose. Today I am 80 years old but I dont need to wear
spectacles. The problem of spondilities is also under control and I am fully
healthy.
Two years back I visited New York to attend a UN session with a team of
Parliamentarians. I stayed there for 15 days. My friend and Indias ambassador
during Atal jis rule, Mr Bhishma Agnihotri had invited me. After the
programme, I came across a lady named Sameer Chehal who told me that her
husband was unwell. She was disappointed as all treatments had failed to help
him recuperate and she wanted to come with him at Kayakalp in Himachal.
This is the same Kayakalp which was inaugurated by Swami ji. A person
brought her husband Sahib Singh Chehal who was sitting on a wheel chair.
This Punjabi family was settled in US

for the last 30 years. After some days,
I received a phone call from that lady.
I could not recognise her immediately
but I after some time, I remembered
the meeting with her. She told me
that she had been at Kayakalp for the
last two months. She wanted to meet
me. I remembered how her husband
was sitting in the wheel chair after
that programme in US. She came to
me in the evening and said, Do you
remember my husband in the wheel
chair. He has come here on his foot.
Behind her, I saw her husband who
was standing. I was surprised. At once I
could not trust . In fact yoga, Ayurveda
and naturo pathy devised by our great
saints has such a great effect that a
person can get his natural form by
taking to them. This treatment opens
the new and happy ways of life.
The person in the wheel chari is
an example for me. This is the reason
why Swami ji moves from one place to
other to tell people to practice yoga at
least for one hour everyday.
On the basis of my 35 years of
experience I advise every one to
make yoga and pranayama and
naturoropathy a part of your life to
always keep yourself healthy. I spend
two hours everyday on yoga and
pranayam. Once a scholar asked the
secrets of my good health. My answer
was that I keep away from doctors.
In fact, one needs a doctor but in
rare cases. Normally, good healthy is
possible with just yoga, Pranayam.
In India, we have largest number of
poor and deprived people of the world.
Besides allopathy, l would suggest that
yoga, pranayam and natural treatment
are the best ways for good health. This
is the way to make India healthy. Lets
come and vow to make naturopathy a
part of our life. n

Healthy India
Prosperous India
Patanjalis international quality certificate

Protect yourself and others from the deadly
effects of adulteration, use Patanjalis pure
and healthy products.
Countrys wealth must remain in the country and

should be used in the service of fellow countrymen.
Therefore, you must use Patanjalis products.
Patanjalis best cow ghee

Ghritam vai ayuh (Charak)
Use Patanjalis pure desi ghee in your kitchen everyday to
keep yourself healthy and get long life. Besides, use it also
for Aarti while doing worship to almighty. Embark on a new
and healthy tradition with cow ghee, kesar chyavanprash,
tasty Sonpapri made of navratna aata, Badam Pak etc by
presenting them to your loved ones as gift instead of harmful
and toxicant sweets from the market.
Eat Patanjalis pure and healthy desi ghee and protect your family
and yourself from the dangers of adulterated products
Patanjali Shilajeet capsule

Shilajeet gives us
energy, freshness and
power. It cures sex related
problems, impotency, gastric
and related problems,
arthritis, cough, asthma,
allergy, urine and sperm
related complications,
weakness of bone, diabetes,
etc. It is equally good for
both men and women. It
also gives us long life.
Badam Pak and honey

Weakness of mind and body can be easily cured with the
use of Patanjalis Badam Pak. Patanjali honey is a best
blood purifier and can also be used as an antiseptic.

Healthy India
Prosperous India
Many of our products were tested by the Government with bad intentions
but we emerged upright in every test. This is

the proof of the purity of our products.
Patanjali Dant Kanti

For strong and healthy teeth, we present
Patanjali Dant Kanti which contains 13 herbs
neem ( Azadirachta indica), babool (Acacia),
Akarkara, cloves, turmeric, vajradanti, etc.
Saffron based Patanjali chyavanprash

This best preparation
is in use since ancient
time. Its use can cure
all kinds of mental
and physical problems
and makes heart and
lungs stronger. It also
strengthens all the
seven metals of the
body and cures cough,
allergy, asthma, lack
of appetite, digestion
related problems etc.
It improves strength,
mental abilities, sperm,
skin glare and makes
you full of power and
energy.
Patanjali herbal soap, Patanjali body cleanser and herbal hand wash
Body cleanser contains many herbs which give the
body cleanliness and freshness and also keeps it
soft and naturally beautiful.
Tulsi and neem added and very effective herbal

hand wash.
Secrets of Rishi chikitsa-1
Understand the core

of Rishi Chikitsa
Acharya Maheshanand Vidyalankar
a lot of modern equipments and other
Despite facilities for the treatment of diseases, the
diseases remain out of control. Incurable diseases are

on rise. Despite spending a lot of money and visiting top
medical centres and hospitals, good health remains evasive.
It is a fact that even after new and innovative discoveries
and great achievements in the treatment of diseases, new
diseases, health related issues continue to persist in the
society. This situation has caused a great predicament for
both the patients and the medical world.
iven this situation, the methods devised by

our great saints for treatment of diseases
and their various forms like - Yog Chikitsa,
Ayurved Chikitsa, Marma Chikitsa, Sparsh
Chikitsa and Yagna Chikitsa are the only ways
to good health and hence happy life. It is high
time to reinvent those methods of treatment
of diseases and popularise them. With this
the dream of healthy society, nation and the
world will be fulfilled. One of such a methods
of treatment is Marm-Chikitsa. There are some
specific points on our body which are when
pressed, we feel pain. These points are called
Marm. For example- Samanyalakshamanam
punarmarmanda-pidite rujotpattirvishamama
cha spandanam (A. S. S. 7.26) . Thousands of
years back our great saints by applying their
farsightedness discovered 107 Marmakendra
or Urja energy centres and adopted the science
inherent in them. They used them for good
health, self safety and self realization. They also
devised simple methods

to uses them for good life.
Indian tradition of Panch
Mahayagna, 16 Sanskaar,
daily yoga practice, ideal
daily life style, discharging
responsibilities, ways
of clothing and wearing
jwelaris, fashion and war
style have been based on
science.
What is Marma
Chikitsa?
It is a method of treatment
of diseases with the use
of Ans, Karpur (camphor)
etc to stimulated 107
different points. It is
surprising method based
on the teachings of Vedas
which has been devised by
our great saints. It gives
immediate relief and can
cure pain, sore, nervous
Well A humans good health is not

confined to his or her physical well being
but it has to do with his social, mental
and spiritual upiftment to a great deal.
In Marma Chikitsa, all segments of
good health is taken care of therefore
an individual attains good health.
Marma Chikitsa takes care of the bodys
functioning at cellular level for example
it takes care of various functioning like
digestion, respiration, blood circulation,
excretion etc. In result, a person
remains physically healthy.
problems, lack of vitality, fatigue, joint
pains, knee pains and paralysis quickly. It
is fully scientist method of treatment of
diseases which is generations old and have
been in use since ancient time. It makes
very good impact on all parts of life and
when all the methods of treatment become
ineffective, the patient can recover with
the use of Marma /Chikitsa. In many of
disease it has proved to be panesia
A highway to complete health

In fact Artha, Dharma, Kama and Moksha
are the four duties of a human described
in ancient scriptures. Their main
foundation is good health. For example,
Dharmarthkaamamokshanamarogyam
moolamuttamam (CH.S.S. 1.15) and to
maintain it completely is the main motive
of Marma Chikitsa. A humans good health
is not confined to his or her physical
well being but it has to do with his social,
mental and spiritual upiftment to a great
deal. In Marma Chikitsa, all segments of
good health is taken care of therefore an
individual attains good health.

Marma Chikitsa takes care of the
bodys functioning at cellular
level for example it takes care of
various functioning like digestion,
respiration, blood circulation,
excretion etc. In result, a person
remains physically healthy. It
also has a very positive impact at
psychological level and it enhances
affirmative ideas in the mind. It
also maintains a good balance
between nervous system and
endocrine system and keeps an
individual psychologically healthy.
It can cure psychosomatic ailments
without use of any medicine. At
sociological level it keeps a person
sensitive.
Regular practise of yoga and
Asanas, Pranayam, Mardan,
Indian way of exercise, evening
meditation, yagna, smear on the
middle of the forehead, wearing
clothes and ornaments according
to Indian tradition we can take care
of our health according to Marma
Chikitsa.
Special methods of
stimulating the Marma
or sensitive points
By stimulating the points or

Marma Sthan of our body one
can cure incurable diseases. All
humans can get good health if the
methods suggested by experts
is followed. Following are such
methods- stimulation or supression
of Marma by pressure, Marma
massage, Marma treatment with
herbal paste, aroma therapy,
energy healing over Marmas,
Marma therapy by biomagnetics,
Marma therapy by blood letting,
Marmapuncture, applying slight
Secrets of Rishi chikitsa-1

rajah sattavatamansi ca I
Marmasu Prayashah punsam
bhootatma chavatishthate II
Marmasvabhihatastasmanna
jivanti sharirinah (S.S.S.
6.46). Therefore, dont apply
extra pressure on these very
sensitive points.
Some natural
experiments:
heat near Marma points like maxibustion,

applying herbal alkalies near Marma points like
chemical cautery etc.
Marma points must be pressed carefully and
no extra pressure should be applied. Therefore,
apply the method suggested by experts and
dont press it more than what is advisable. If
the pressure is applied in a wrong way, one can
have health related complications like vertigo,
delirium, collapse, dazed state, unconsciousness,
rise of temperature, flaccidity of extremities,
fainting, breathlessness, severe pain, fatigue
in body organs, etc. Sudden death can also be
caused due to wrongly pressure application. From
our experience, we advise that one should avoid
applying extra pressure through needle, wooden
block, thumb, etc. Some people advise that one
should repeatedly apply more pressure on the
part of the body which has pain. But it is not
true. Where ever is Marma points in the body,
you will feel pain if they are pressed. Saints have
named these points as Marma Kendra and when
they are pressed, the result could be healing
of problem to death. For example- Maryantiti
Marmani (Dalhan); Api cha marnakaritvanmarma
(A.H.S. 7). In fact, Marmas have in themselves
Agni, Som, Vaayu, Sattava, Raj, Tam and
Jeevatma, for example - Somamarutatejansi
For good health, one should

press the Marma points
everyday as per advice of
the experts. Besides, one
should every day practise
hastyog mudra, focusing
on Marma points and
Manii Bandh should be
treated. By tying Kalwa on
wrist is also very effective
as it keeps Magma well
treated. Mothers and
sisters must wear garments
and ornaments according
to Indian traditions like
applying Bindi on the
forehead, Sindoor in the
middle of hair. It has been
observed that such lifestyle
protects women from
emotional ups and downs
and depression and they
also dont have feelings
like to commit suicide. You
know why the lives of our
women is getting more
and more problematic?
It is so because they are
getting away from Indian
traditions and life style.
Living according to Indian
traditions and adopting
Indian fashion will keep you
healthy and energetic. Such
methods work themselves
like medical treatment. This
Different Points of Marm Chikitsa
has been confirmed by experts too.
This is the way of

Marm Chikitsa
Halhriday marm in the problem of blood

pressure, Karpoor Marm in the problems
of obesity, hiccups, diabetes, hyper
cholesterol, Kshipra Marm in tonsil, Ans
Marm in cervical spondylitis, Kshipra
Marma of feet in knee pain and also try
indrabasti marma, you will get surprising
results. It will be better if you will treat
Marma points yourself, after learning
it properly. At once, one should press
Marma points for 16 times with thumb
gently.
You can massage the Marma points with
Patanjali Rogan Badam or Patanjalis pure
desi ghee. Avoid pressing Marma points
soon after meal or after doing physical
works.
Key to stimulate
Atindriya powers
In the modern era, science too

proves that various energy points
can be stimulated in the body to
sense clairvoyance, clairaudience.
Dr Guiseppe Joseph Calligairis of
the Royal University of Romes
neurology department had for the
first time disclosed. On the basis
of these revelations it can easily
be imagined that if proper and
high level research is done then a
new door way can be opened for
good health. It can also be possible
to stimulate immense power of
Pindastha. It is also hoped that
in the future, this could help to
improve surgery.
Good health is our birth right. Sutra
too yields good results only then. n
Various
programmes of
the Sansthan
Initiative of Kedarnath valley
for reconstruction of
Kedarnath valley
atanjali Yogpeeth took initiative for the

reconstruction of Kedarnath and welfare of
the people living in the area. A day before Diwali
(November 22), Uttarakhand Chief Minister Harish
Rawat called Swami ji on phone and sought his
association for reconstruction of Kedarnath temple
and the surrunding areas. Besides he also requested
to Swamiji to visit in the flood ravaged area to
understand the problem. Later Swamiji and Acharyaji
visited there and performed yagna for the peace of the
soul died in the the flood and vowed to reconstruct
the area.
Addressing media at Patanjali Yogpeeth, respected
Swamiji appealed all parties rise above political
differences and work for the reconstruction.
Patanjali Yogpeeth promised to make all necessary
contribution for this purpose.
Swamiji said that if the Congress Governments of
different states performed well, he will stand with
them. He said that to serve the people, both the Centre
and State should work together for the betterment of
the country. He said that as a saint he played his role
in the political arena too as a part of his responsibility
towards the nation and even in future, Patanjali will
continue to make it contribution in the time of need.
He said that his institution has given health, education
and political education to the people of the country.
Now the rest of the responsibility lies with the people
and they have to decide.
He added that talks on party-politics is right till the
time of election. After the election, it is the duty
of the people to rise above it for the welfare of the
country. The way Modi ji is the Prime Minister of

the country, the same way Harish Rawat is the Chief
Minister of Uttarakhand and the Prime Minister, the
Chief Minister and we all are together over the issue
of our ancient heritage.
He vowed to make Uttarakhand free from calamity
and said that Harish ji extended his hands all of us
came together to move for 100 km. We will move
even further in this mission, he added.
While talking over the issue of tourism in Uttarakhad,
he said that the State has huge potential for tourism
for religious purposes, health and natural beauty. He
said that it is the time for both the centre and the
state to move together in this direction.
Patanjali has been already

active in Kedarnath
It is to be noted that Bharat Swabhiman had since

beginning of the natural disaster been running
its drive for relief and rehabilitation of the people
under the guidance of Acharya Balkrishna ji. In this
Himalayan tsunami, when even governments staffers
could not reach to the region above Guptakashi,
Patanjalis workers spotted 40 villages and provided
immediate relief to them.
They set up Patanjali Sevashram to help hundreds of
innocent kids and women of the priest of Kedarnath
who had been serving the devotees for generations.
Patanjalis workers used moles to help them. Swamiji
and Acharya ji have been takinng care of them as
a guardian. The orphaned kids have been getting
education at Patanjali Sevashram and Narayan Koti
with the help of Yogpeeth.
One bus and two vans have been engaged to carry
the kids from their place of living to the school.
Proper arrangement has been made for their
education. Proper arrangement has been made for
their education from primary to class 9 and girls are
Various
programmes of
the Sansthan
getting higher secondary education at an institute
located at 7 km away from there.
Their routine is very unique. They begin their day
with chanting of Vedic mantras, yagna, yoga and
exercises. Everyday after the school, all the kids go to
computer lab for learning computer. Arrangements
for volleyball, tennis, yoga and football have also been
made for good health and mind. All these students
have excelled well in all fields and have performed
well in several competition.
The women and girls who have faced the calamity
are being trained in stitching in sewing by Patanjali
sansthan so that their life could be brought back on
the track. It is a mission to make them self dependent.
Through labour contribution, to lift the living
standard of the victims, they are being trained into
agricultural activities and they are learning various
techniques for this purpose.
Message of Pollution free Diwali

from Acharyakulam:
Where more than thousand kids are living, it will be

impossible there to not to let them play with crackers
on Diwali. But kids of Acharyakulm with their spiritual
guardians Acharya ji and Swami ji celebrated Diwali in
the ambiance of yagna and this way they presented a
great example of pollution free Diwali.
Swami ji also appealed to the kids to celebrate Diwali
the same way in future too with peace and harmony. At
the Yagyashala (the place where yagna is performed)
, Swami ji, along with all the students held Sharadiya
Navasasyeshti Yagna on the occasion. In the peaceful
and pollution free ambience, the sages-duo wished
all the country men a happy Diwali. Small kids also
participated there to hold the festivity. The entire
ambience was looking awesome.
The country will get rid of Lord

Macaulays system of education
Patanjali Yogpeeth will start 500 Acharyakulam

Vidyalays (School) where besides of the students
their parents too will get weekly Vedic education.
With this resolve, two yoga camps - Advance Yoga
and Meditation Camp, each of three days between
November 1 and November 3 and November 7 and
November 9 were held. These who attended the
camp, vowed to hold similar camps in all the villages
to prepare a ground for Patanjalis Gyan Kranti and
associate at least 20 families in each of the villages
with Yog Sandesh Magazine. In the first camp, at least
five thousand workers from each of the states like
Himachal, Jharkhand, Jammu & Kashmir, Chandigarh,
Haryana, Punjab, and Uttarakhand participated.
Similar number of participants attend the second
camp from Odisha and Madhya Pradesh. At the yoga
camps organised by Patanjali Yogapeeth, it was
advised to those who attended to live a scientific way
of life and resolve the problems of their day to day life.
Patanjalis efforts at National

Institute of Mumbai
On October 31, visually challenged students of National

Institute of Mumbai visited Patanjali Yogpeeth with
their mentor Dr Shankar ji and discussed various issues
with Swamiji. During interaction between the whole
ambience turned to be full of emotion. Swami ji guided
them how to find the solution of various problems of
life without getting depressed and dejected.
On behalf of Patanjali Yogpeeth, a yoga teacher and
a Vanprasthi were appointed for the institute. Their
duty will be to teach the students yoga and Pranayam
and help them to find solution solution to various
problems of life.
Various
programmes of
the Sansthan
Patanjali Yogpeeths Sanskrit
speech camp
Haridwar, November 8: 10-day Sanskrit speech

camp of Patanjali Yogpeeth was held in a happy and
harmonious ambience. On this occasion, Swamiji had
given certificates to the students who were trained at
the camp and encouraged them to work for the well
being of their nation. The success of the camp was
evident from the way students presented group song
in Sanskrit and interacted with each other in Sanskrit.
Successful students were rewarded. As many as 83
students participated in the camp.
Minister for Social Justice visited

Patanjali Yogpeeth with his
whole family
Haridwar, November 11: Sri Vijay Sapla, Minister

for Social Justice visited Patanjali Yogpeeth and met
specially with Swami ji and Acharya Balkrishna ji. He
praised the activities of the institute and it work in
the field of yoga and Ayurveda.
Punjabs saint Sukhdev ji visited

Patanjali Yogpeeth
Haridwar, November 10: Punjabs famous saint

Sukhdev ji from Terarumi Wala, Puchchhokala
Bathinda visited the main institutes of Patanjali
Yopeeth. During his meeting with Swami ji and
Acharyha ji he discussed various issues concerning to
social and national building. He was impressed with
the way the institute was spreading the message of
yoga, Ayurveda and great Indian culture and praised
them a lot.
He also met with Acharyakulam students and learnt
about the system of education there. n
Swami ji Maharaj with students of Delhi Public School, Ranipur, Haridwar.
Speaking Pictures
Acharya Balkrishna ji as the representative of Patanjali Yogpeeth
at sixth World Ayurved Congress, held at Delhis Pragati Maidan.
Speaking Pictures
In the direction of making healthy India, clean India,
a sustained effort of Patanjali Yogpeeth Haridwar.
Cooking
How to cook
rice
to use it as a
medicine
we use some raw material to make some recipe, then it will have a different property due to its
When nature. Sometimes, due to mutual association of different matters their original properties are
changed. Therefore, the food has also impact on the health of the person who takes it. Due to this reason,
he develops a different kind of mindset about the food which is not proper. To help you free from such
prejudices, we present you a portion of Bhojankutuhalam. Lets start with rice.
or example the old rice after

being cooked happens to be
Laghu while Poha or Khichada
cooked from the same is Dirgha.
Hence the process followed in
making Khidchada is responsible for
its Dirgha nature while in original
nature, the same rice happens to be
laghu. Similarly, banana and Ghee
are guru in nature but when they
are joined together, they become
easily digestible stuff. Lets come
and known such properties in
detail:
Cooking rice:
The rice which is cooked in water six

times more than its quantity is also
known as Dalia or porridge which
happens to be good for health, gives
you a lot of strength, satisfying, and
cures gastric like problems.
Vilepi cha ghana sivaithaih
siddha rire chaturgune I
Vilepi tarpani vrishya
madhura pittanashini II
The rice cooked in four times more

water is called Vilepi due to its
thickness. It is satisfying, sweet,
cures pitt related problems, etc.
Dravadhika swalpasiktha
chaturdashgune jale I
Siddha peya budhairgyeya
yashah kinchidghanastatah II
On cooking porridge of barley or
wheat or rice, in 14 times more
water, the light stuff eatable is
called drinkable. A bit more thick
than it is called yush.
Peya laghutara gyeya grahini
dhatupushtida I
Yoosho balyastatah kanthyo
laghuh pake kafawahah II
The drinkable stuff is light and easy
to digest and strengthens blood
juice. Yoosh is more healthy than it.
It is good for throat, easy to digest
and causes cough.
Ath bhaktagunah
Sudhautastandulan sfistantoye
panchgune pachet I
Tabhdkatam prastunam
choshna vishadam
gunavattaram II
Cook washed rice in five times more
water. After it is cooked, this rice
appears prominent and it is very
good for health.
Bhaktam vahnikaram pathyam
tarpana rochanam laghu I
Adaiyotamasnutam sheetam
gurvaruchyam kafapradam II
Boiled rice is good for jatharagni, it
is pathya, satisfying, good in taste
and light. Unwashed rice when it
is cooked, or the rice from which
water has not been removed,
then it happens to be bad in taste,
causes cough and heavy to digest.
Moreover,
Ushnodano
bhramamdatyayaraktapittamehpradah kri miharah
kasnartinighnah I
Aadhgulmapavanakshayak
-asahikka-shwasapahashcha
kafakrillaghudeepanashcha II
(Vasantatilaka chhanda)
Hot rice make you feel dizziness,
excess of intoxication and may also
cause rakta pitt and diabetes. At the
same times it kills worms, reduces
the pain at the time of coughing,
gastric is cured, and also good in the
problems like cough, hiccuping and
asthma. It may also cause cough and
happens to be light in nature.
Sheetodanam sheetalamaganisadshwasprekanilaviavibandhaan I
Kuryaadsripittarharam
cha moh-murchhabhramachchhardimadam
-ayaghram II
(Indravajra Chhand)
Cold rice is cool in nature, it reduces
the Jatharagni, causes asthma,
makes you drop saliva from mouth,
cures the problems like gastric
and constipation, cures raktapitta,
reduces your mental agility,
delirium, vomiting and intoxication.
Kechitu-jale chaturdashgune
tandulanam chatushpalam I
Vipachetstravayenmandam sa
bhakto madhuro laghuh II Iti II
Some people say that rice cooked in
14 times water the rice remains after
removing starch it happens to be
sweet and light.
Healthy Khichadi
Rice- Moong khichadi happens to be

cool, tasty, good for heart, easy to
digest and also cures the problems
like Aamshool, Grahani and piles,
gives you strength.
Tandula Dalisnayukta
Lavanadrakhinghabhih I
Yuktashcha salile siddhah
krisara kathita buddhaih II
Add pulses in rice besides salt,
ginger, asafoetida and cook it in
water. It is the recipe of Khichadi.
It is also called Mishrodan and

Krisara.
Krisara Shatruphala balya
pittakafaprada I
Durjara bahuvishtmbham
-alamutrakari smrita II
Khichadi, Mishrodanam I
Mishraishshookashimbheedhanyairodanno mishroko
matah Ityabhidhanat I
Krisara or Khichadi strengthens
sperm, gives strength to your
body, enhances pitta and cough. It
is heavy, digested with difficulty,
causes constipation, causes you
to produce more urine. It can
also be prepared with cooking
rice, Nadi shookdhanya, moong,
shimbidhanya, etc, it is also called
Mishrodan.
Dhrite haridrasanyuktamashanam
bharjayedvatih I
Tandulanshchapi nirdhautaan
sahaiva parivarteyet II
Siddhayogyam jalam tatra
nikshipya kushalah pachet I
Lavanardrakahingooni matraya
tatra nikshipet II
Nutritious Tahari
(Taahari)
Fry urad badis or chunks in ghee

and in this process, added rice
properly washed in water and
continue to cook it. Then add water
for proper cooking and add salt,
ginger,asafoetida in it.
Aesha siddhim samayata pronkta
taaphari buddhaih I
Bhavettapahari balya vrishya
sleshmanamachareta II
Brihani tarpani ruchya gurvi
tattadguna smrita I
Taaphaari ! Taaphaarityottareshu
prasiddha II
This way cooked food maintains
Krisara or Khichadi strengthens

sperm, gives strength to your
body, enhances pitta and cough.
It is heavy, digested with difficulty,
causes constipation, causes you
to produce more urine. It can
also be prepared with cooking
rice, Nadi shookdhanya, moong,
shimbidhanya, etc, it is also
called Mishrodan.
body temperature, gives strength,
causes cough, happens to be
satisfying, interesting and is also
guru. If instead of Urad, moong
chunks are taken, its nature has
to be understood according to the
properties of moong. However, it is
famous as Taaphaari in north India.
Besides, there are many other
ways to cook rice. But when it is
cooked with many different stuffs,
it is called with different names. It
has six categories- 1. Paramanna,
2. Haridranna, 3. Dadhyanna, 4.
Krisarodanna, 5. Gudodanna, 6.
Mudganna. Their description will
be given in the next issue. n
Seasons
Protect your kids

from impact of
changing season
Dr Jyoti Arya
born out of cold weather like cold and
cough, sneezing are very common and
our minors easily get affected by these problems. If the
problem is not treated timely, they can worsen the condition
and you and your kid can be caught by fever, black cough,
flue, asthma, pneumonia, etc. These diseases reduce
longevity of life and make our body weak. Winter has is
its worst impact on kids, physically weak persons and old
age persons and severity of these diseases can prove to be
deadly. According to season, Divya Yog Mandirs Dr Jyoti Arya
presents ways to prevent their ill effects.
Diseases
n India, the cycle of six seasons is a great

blessing of almighty. In every season, you
are required to follow different routines.
Our saints have advised different ways and
food according to seasons. The main reason
of a disease is - incompatibility between
the season and the food taken. This makes
us devoid of the benefits we can get in a
particular season. Therefore, it is necessary
to adopt some of the simple but important
habits and also to understand the nature of
seasonal diseases.
Primary safety through

food habits
A. In winter, cold air leads to decline in

atmospheric temperature. Therefore it
is necessary to ensure that the kids must
wear woollen garments, especially they
must wear cap and socks.
B. Dont let your kids go out in cold wave or
rain.
C. If it is very necessary to go out in extreme
cold wave then wrap ear and face in
mufflers so that your face and ear could
remain protected from direct impact of
the cold wave.
D. After summer, we feel less thirst in winter
but need for water in the body remains
the same, therefore drink sufficient
quantity of water and its better to take
lukewarm water.
E. Those who are prone to cold and cough,
they should avoid eating banana, stuffs
made of all purpose flour, rice, etc as they
can increase your problem. Taking cured
or butter milk in the night is also harmful.
F. Expose your body as much in sunlight as
it is possible. This privides relief in cough
related diseases as well as it also provides
sufficient quantity of Vitamin D to your
body.
Food related precautions
In winter, we should introduce two changes

in the food of our kids
In winter, cold air leads to decline

in atmospheric temperature.
Therefore it is necessary to ensure
that the kids must wear woollen
garments, especially they must
wear cap and socks.
A. Take nutritious food and they could
increase the seven metals in the body.
B. Take such eatables which do not allow
growth of cold related diseases.
On the basis of above mentioned two
categories, following stuffs can be taken as
food, which are as effective as medicines for
the winter seasons.
1. Maintain optimum quantity of liquids in
the body. For this, take lukewarm water,
Amla sharbat, fruit juices, vegetable soup
and Divya Pey in winter and autumn.
2. Boil Munakka, turmeric or pepper in
milk before taking it. These preparations
are very good for health.
3. Taking dates, dry fruits or saffron in hot
water is very useful in winter.
4. Giving chyavanprash, Divya shilajeet,
Ashwagandha, Patanjali Kesar etc is very
useful.
5. Take 100 gm almond, pepper 5 gm,
sugar candy or Mishri-20 gm, 2 gm of
small peepali and bay leaf and make
their powder and store it in a pot. In the
night take one spoon with lukewarm
milk everyday will keep the diseases like
increase in size of tonsil, flue, cough,
asthma, etc away from you and your kids.
6. Instead of giving junk or fast food to your
kids, give laddus of dry fruits, Jaggery
and sesame seeds and other dry fruits to
your kids to eat.
7. To increase the quantity of haemoglobin in

the blood, and also to maintain the quantity of
vitamin C and to keep away eye problems, take
fruit juices. Be careful that the fruits have to be
fresh and should be taken in the afternoon while
sitting in sunlight. In this season mainly apples,
carrot, beets, pomegranate, carrot, ginger,
orange, Amla etc juices must be taken.
Ayurvedic treatment:
Sneeze: If your kids are caught by sneeze, cough and
cold then administering antibiotics to them is not a
right kind of treatment. Many a times it has been seen
that minors are frequently administered medicines
especially antibiotics which is in itself endangering
the health of the kids. In foreign countries, it is the
policy of health department that if it is not very
important, kids should not be given antibiotics
course twice within a six month period. While in
our country, there is no such standard due to which
our kids are seen facing so many problems in future.
However, in cold related problems, respected Swamiji
and Acharya Balkrishna ji have directed following
medicines in Aushadhi Darshan which must be taken.
1. Make tea of Shwasari and Mulethi and drink it.
2. Mix Divya Swasari Ras, Divya Abrak Bhasma,
Divya Prawal Pishti, Divya Trikattu Churna and
Divya Shitopaladi Chura together and make small
packets of the mixture and take each while empty
stomach.
3 Take Lakshmi Vilas Ras and Sanjivani Vati in the
morning and evening with lukewarm water.
4. Shvasari Pravahi in liquid form when added
in milk, it is very effective but dont give it to
diabetes patients as it contains mainly honey.
These medicines can be easily purchased from
Patanjali Chikitsalay and doctors present there
can advise you proper dose of these medicines. For
exampleA. Patanjali Chyavanprash, Giloy ghanvati, Arogya
Vati, Swasari Pravahi, etc are such effective
medicines which should be taken regularly by
kids and elderly to keep healthy. They improve
immune system.
Seasons
in the length of nose bones etc can cause
congestion in a minors nose. Pour a few
drops of a bit warm Rogan Badam in the
nostrils. Massage with Patanjali mustard
oil on palm and sole of the feet.
Special care
B. If you have problems like lack of appetite,

decreasing weight and breathlessness, then
immediately consult an Ayurveda doctor. It can
be a serious disease like pneumonia, Asthma,
Tuberculosis, etc.
C. Gastric patients and those who feel fatigue and
want to gain weight, are advised to take pulses and
vegetables when they are warm and add 1-2 spoon
of ghee in it. Add Shatavar and Ashwagandha and
Patanjali Badam Pak in milk to take it. Such diet
will help you gain weight.
D. Those who feel a lot of cold, they should take
cow milk added with Patanjalis saffron. It is very
effective. Besides, taking some domestic herbs
can help you defeat cold related diseases likecold, cough, etc.
Following are some of the methods to treat such
diseases:
1. Take Patanjali honey in lukewarm water in the
morning regularly. It will help you keep your
stomach clear.
2. Take tea of tulsi, ginger, pepper regularly.
3. Divya pey, herbal tea, green tea, are best for
health.
4. If the minors have cough congestion in chest, give
them steam of hot water. If the problem is severe,
you can give 2-2 drops of Divya Dhara with steam.
5. Pouring a few drops of a bit warm Patanjalis cow
ghee or Patanjali in nose before going to bed is
very effective in cold related problems.
6. Cold, tonsil problems, problems due to increase
A. In cough, cold and other breathing

problems, minors and elderly people
should avoid taking steroid or inhalers.
Instead, they should take steam of warm
water. Steam added with a few drops of
Divya Dhara is also effective.
B. Never keep room temperature too hot or
too cool. Never keep heater or Angithi in
a packed room while sleeping.
Yoga and Pranayam
In winter, mainly contraction of blood ducts

can cause breathing problems. Therefore
doing yoga and pranayam in this season
ample quantity of blood and oxygen is
provided to concerned body parts. Kids must
do light exercises, walk and play games in
this season to keep healthy.
Besides, yogic jogging, Surya Namaskar,
Sarvangasana, Shirshasana, Trikonasana,
ect suggested by Swamiji, and all the eight
Pranayams must be done regularly. For
special benefit for respiratory system,
respected Yog Rishi suggested Bhastrika
pranayam, Kapalbhanti, Anulom-Vilom are
specially useful. Ujjai is the best Pranayam
for winter season. To learn these Pranayams,
you must visit Patanjalis Yoga classes in your
vicinity or you can buy a CD from Patanjali
Chikitsalaya for this.
Regular exposure to sunlight, regular yoga,
exercises, Pranayam, timely healthy meal,
a bit of care for good health will keep you
healthy and fit in all the seasons. This is the
reason why our saints have advised- Jeevem
Sharadah Shatam. We all must be committed
to see 100 winters. With above mentioned
methods, be healthy and full of energy. n
Health Science
There are many Agnisamuh

which help in digestion
Acharya Balkrishna
category is five types of Bhutagnis.
Jatharaganis:
elements which stimulate the
process which converts food
according to the need of the body is
Agni (fire) and this whole process is
called metabolic process.
The
or this digestion process, the

Agni helps release of several
digestive juices in the organs like
liver, stomach and Dhatukosh.
With the help of these juices, all
kinds of solid, semi solid and other
eaten stuffs convert into metals
and excrements. If fire is not there,
neither food could be cooked, nor
juices will be secreted. According
to Ayurveda, if fire of our body is
destroyed, it will result into death.
If the fire is deformed, a human
becomes ill while if the fire is even
then he will keep healthy and will
be able to live for so many years. In
our body, there are 13 types of fires
which are categorised into three
groups. First is jatharagni, second
are seven Dhatvagnis, and their third
It is also called digestive Agni or Kayagni. It is located

between large and small intestines. The way sun with the
help of its heat, absorbs the water of pond, lakes and rivers
the same way this fire or Agni located in the navel area
help in digestion of the food. All the stuffs we eat, this Agni
helps in breaking them into small parts for the sake of
digestion.
By the process of cooking, it triggers initial changes in the
food and helps increasing age, beauty, energy, physical
growth, enthusiasm and optimum body temperature. To
be helpful in all these functions, it is necessary for the Agni
to remain in equilibrium. The Jatharagni has four stages:
1. Vishamagni:
This fire sometimes becomes very active, while sometims

it becomes very slow. It has an impact on our digestive
system. Hence, digestion of food is sometimes very fast
and sometimes very slow. In result, we have sometime
severe pain, gastric, constipation, heaviness, diarrhoea,
etc.
2. Tikshagni:
In this stage, whatever a person eats gets digested

very fast. It is also known as Bhasmak or Atyagni. This
Jatharagni is a special stage and pitt related problems are
on the rise. Due to this, throat, lips and jaws seem to have
become dry. In fact, after the meal is digested, this agni
causes dryness in these body parts.
3. Mandagni:
It is not able to digest the food which has been eaten

in small quantity. This is caused due to excess of cough
related problems. Due to this, heaviness is felt in head,
besides other symptoms like cough, breathing problems,
excess secretion of saliva, vomiting and weakness.
4. Samagni:
It aptly helps in digestion of optimum food taken in a

proper timewise manner. In this condition, the cough, vaat
and pitt is balanced hence it is called Samagni.
Second Agni group (Bhootagni)
This group of fire is located in liver. On the basis of

five Mahabhootas, these are- 1. Bhaumagni 2. Apyagni
3. Agneyagni 4. Vayavagni 5. Akashyagni. Their main
function is to turn the food which has been broken into
small pieces into the juices according to the requirement
of the body. Each of these Agnis, convert the mahabhuts
like Bhumi (the earth), Jal (the water) etc into their
respective Mahabhoot and turn them according to the
need of the body. This way the food is converted into
five different groups and after associating with the
Mahabhoots of the different body parts, they provide them
nutrition.
After this, inside the stomach the

impact of pitt gives birth to acidic
juices from where the food through
small intestine reaches to duodenum
when the Jatharagni functions
with normal gas and digestive pitt.
Digestive pitt absorbs the liquid
part of the food. It turns the food
in a solid form which is called Pind.
In this stage acrid juice and gas are
formed.
Here the food is divided into two
parts- 1. Saar or Prasad 2. Aasar or
Kitt Bhag. The part of food which
is easily digested and happens to
be in liquid form is called Saar part
which is the bodys first juice or
the first metal which happens to be
smooth due to Jatharagni. This Metal
nourishes the next metal.
If Jatharagni is slow, then
aforementioned food juice is not
Third Agni group (Dhatvagni)
Food juice which has got converted into five Bhoots with
the help of Jatharagni and Bhootagni when reaches to
Dhatvashya (Rasvah, Raktavah, etc) then the Agnis present
there digest them again due to which this Annaras (food
juice) is converted into Rakta Dhatu (blood metals). Since
the metals are seven in numbers, therefore their Agni is
also seven in number: 1. Rasagni 2. Raktagni 3. Mansagni
4. Medogni 5. Asthyagni 6. Majjagni 7. Shukragni (in
male) 8. Rajogni (in female). They naturally carry on the
digestion process due to which some excrements besides
some Dhatus are also formed. Due to weak Mandagni their
concerned Dhatus grows fast which lead to their decay.
Agni in Pachan pran
When the food reaches into mouth, saliva from tongue and
throat get assimilated into it which make the food tasty.
From here, the food reaches to Amashaya where soft and
smooth juices gets assimilated into it and the food become
from solid to soft and liquid form. In this first stage of
digestion, leather cough and sweet juice is formed.
Health Science
By the process of cooking, it

triggers initial changes in the
food and helps increasing age,
beauty, energy, physical growth,
enthusiasm and optimum
body temperature.
digested properly and hence it will
not turn sweet. Instead, it will be
sour or acidic which is also called
Aamras or Aam. It is toxicant and
bad for health. Second part of the
food which is not digested is called
kitt or Asaar. Its solid part in Purish
form and liquid part in urine form
enter into Duodenum. In this stage,
five Bhootagnis become active and
they make impact on their respective
Mahabhoots and turn them into
according to the need of the body.
Due to this, in various body part,
the Prithvi Mahabhoot is nourished
and now the food juice in the form
of Rasdhatu roams in all body parts.
This way it reaches into all body
parts as a nourishing juice in which
the essence of all the seven metals
are present.
Due to digestion process of
Dhatvagnis, with each metal a special
extract is produced which is called
Oaj.
In the whole digestion process of
the food, pitt has a special role. This
is the reason why many Ayurveda
experts consider Pitt and Agni the
same. However, all seven Dhatvagnis
help in their functioning. Agni
contains other properties too besides pitt which help

in completion of the whole digestion process. On this
Khadya-ras (food juice), all the seven food juices have their
respective reaction which leads to formation of seven
different Dhatus.
Thes Dhatus have mainly three parts:
1. Voluminous,
2. subtle,
3. excrements.
Of them, subtle part nourishes the same Dhatu while
the subtle part nourishes the next Dhatu and the
excrements which is formed in this way, nourishes the
same excrements. Hence, each in result of the reaction
of the each of Dhatvagnis, any of the excrements are
formed. For example, the essence of the food juice which
is a Ras Dhatu, when the Ras Dhatvagni reacts then the
voluminous part forms the juice and the excrements
part forms cough and mucus. Similarly other Dhatvagnis
function which is as follows:
Dhatu, Updhatu, Dhatvaganis and

their functions
DhatSr.
vagni/
no.
Dhatu
Updhatu
Nutrition Construction
(By
(By subtle
voluminous
part)
part)
Excrement
Ras Dhatu
Rakta Dhatu
Cough
Rakta
Stanya,
Aarttava
Kandara,
Sira
Rakta Dhatu
Flesh Dhatu
Pitta
x.
Flesh
Fats, skin
Flesh Dhatu
Med dhatu
y.
Med
Pituitary
Med Dhatu
Bone Dhatu
z.
Bone
Bones
Marrow
{.
Marrow
Marrow
Dhatu
Sperm Dhatu
|.
Sperm
Sperm
v.
Juice
w.
Excrement
of nose and
ear
Swed
Hair, Lom,
Nails
Excrement
of eyes and
Skin
Yoga-Quiz
The efforts made by Patanjali Yog Peeth in the fields of Yoga-Ayurveda has triggered interest of the
masses about them. A book of Acharya Balkrishna is on these topics is under publication and it contains
thousands of questions and answers. Here we bring for you some of the questions and their answers with
the help of Yog Sahityanusandhan Vibhag (Yoga Literature and Research Department).
13. In which of the chapters of Srimadbhagvad, Samatva has
been described as yoga?
a. First
b. Seventh
c. Second
d. Sixth
14. Under Ashtang yoga, which of the following is the part of
Bahirang yoga?
a. 3
b. 4
c. 8
d. 5
15. Which of the parts of yama is Astey?
a. First
b. Third
c. Fifth
d. Sixth
16. Which of them is part of Antrang yoga?
a. Pratyahaar, Pranayam, Dhyan
b. Dharana, Dhyan, Samadhi
c. Prnayam, Dharana, Samadhi
d. Dharana, Pratyahaar, Samadhi
17. Which of the following is the part of Kriya yog?
a. Shauch, Swadhyay, Ishwarpranidhan
b. Tap, Santosh, Ishwarpranidhan
c. Santosh, tap, swadhyay
d. Tap, swadhyay, Ishwarpranidhan
18. Vedant darshan is also known as
a. Uttar Mimansa
b. Vigyanvaad
c. Poorva Mimansa
d. Madhyamik Shoonyavad
19. In the Pranayam package suggested by Swami Ramdevji,
how many Pranayams are there?
a. 4
b. 10
c. 5
d. 8
20. Which of the following are five souls a. Pran, Apan, Samaan, Vyan, Udan
b. Naag, Kurma, Krikar, Devdatt, Dhanmajay
c. Pran, Apan, naag, Samaan, Udan
b. None of the above
1. C, 2. a, 3. c, 4-c, 5-b, 6-a, 7-a, 8-d, 9-c, 10-c, 11- d,
12-b, 13-c, 14-d, 15-b, 16-b, 17-d, 18-a, 19-d, 20-a.
Answers:
1. Who is the first proponent of Yoga?

a. Maharshi Patanjali
b. Yogrishi Ramdev
c. Hiranyagarbh
d. Maharshi Dayanand
2. Who is the writer of prominent yoga book Yogsutra?
a. Maharshi Patanjali
b. Maharshi Charak
c. Guru Gorakshanath
d. Maharshi Vashishth.
3. Which of the following are not Augh of Yam?
a. Truth
b. Celibacy
c. Penance
d. Aprigraha
4. Which of the following groups is Kriyayog?
a. Klesh-Karma-Aparigraha b. Aasan-Shadkarma-Mudra
c. Tap-Swadhyay-Ishwar Pranidhan d. Tap-Shauch-Santosh
5. Which of the following scriptures come under Shaddarshan?
a. Hathyog-Ratnawali
b. Mimansasutra
c. Krishnavatar
d. Kalpasutra
6. What is the basic cause of Panchklesh?
a. Lack of knowledge
b. Lust
c. Abhinivesh
d. Envy
7. In Hathyog, what kind of Shadkarma do we practice?
a. For purification
b. for stability
c. For the sake of Laghuta d. For the sake of meditation
8. Which of the following parts comes under Shadkarma?
a. Clearing stomach
b. self study
c. Dharana
d. Selflessness
9. Which of the following is not the intimate means of yoga?
a. Samadhi
b. Meditation
c. Pratyahaar
d. Dharana
10. Who is the writer of Mimansasutra?
a. Maharshi Kapil
b. Maharshi Kanad
c. Maharshi Jaimini
d. Maharshi Gautam
11. What is the total number of Tatvas in Sankhya Darshan?
a. 23
b. 31
c. 24
d. 25
12. Who has described about five Bhumis?
a. Patanjali
b. Vyas
c. Charak.
d. None of them -
Spiritualism
Complete inner beauty

Acharya
Pradhumnji Maharaj
life of celibacy
says the various forms Im seeing, Im touching, Im hearing, Im smelling, my thought process in my
Shri Maharaj mind, by all these activities if Im getting nutrition then it should be understood that Im drinking my
mothersmilk. On the contrary, if the result of all these actions give birth to depression/sorrows, then it means I ve become a
sensualist with mother nature. In that situation, this a shameful thing for me, Mother and sensual! When the imagination of the
meaning in itself is terrifying, to give this a form of action, obviously a picture of mass destruction will appear in front of our eyes.
aharaj says- Breastfeeding is the

only parenting behaviour that only
the mother can do her baby, creating a
unique powerful and emotional connection.
Mothers cannot be sensual. If this vision
gets developed in anyone, then there is no
respite for being a non celibate. Nevertheless
drink mothers milk and have fun. Like
saint Tulsidas once started seeing Lord
Ram(siyarammay) everywhere in the whole
universe. Similarly, maharaj also sees the
whole world as the form of Lord/almighty.
Maharaj gives a citation on the topic
of celibacy. Once Lord karthikey had seen
something on the back of his mother ParvatiOh Mother! who hit you so that you have
this mark on your back? Parvati replied-.......
my son, just now you hit me with the whip,
how did you forget so soon? Karthikey
questioned-........mother, why you blame
me for this? I never ever did so, neither i
can do so, i cant even think of doing this.
Mother parvati explained..., listen child, just
some while ago did you hit that cat or not?
Karthikey replied- ......yes! I hit the cat only.
Mother says- ...thats the reason......the
whole womankind is only my form. It is said,
after hearing this from mother, karthikey
decided at the same time to be a celibate
always.
Once a disciple of Mahatma Buddha was
passing by. Looking at the radiant face, sariputr and mogalyayan named two
friends, started asking- BHIKSHU! Where are you getting that holy radiance
from? He answered...... from jetavan vihar near sravasti nagari. Both
companions, without even informing their parents straight away reached
the place of buddha. It was evening, both started offering prayers to godLord buddh says- ok, Live a life so, where the beginning is also beautiful, the
end is also beautiful and the mid-phase is also beautiful. He says- SAMPOORN
SARVAANG SUNDAR meaning complete beauty of life within. Again they
asked, Lord, can you make it clear? Mahatma buddh answered- Celibacy.
In the real sense celibacy is related to devotion and devotion is a thing
which comes from heart. Celibacy is an expression related to feeling, it
has got nothing in relation to peoples ideas or lives. Feeling is the state
of mind, when ideas get meaningfully transmitted into the body, inner
and outer self of complete existence, mind, life, physical body and that
latent center, which is called heart, when it reaches overall, only then it
gets adapted, that is the state when the conceptualised thought becomes
drenched with devotion.
To talk about the glory of celibacy, mahabharat has got some sacred
themes where we have an illustration of ganga putr, devvrat, who vowed to
live a life of celibate always, but he comes across a strange situation, when
his mother satyavati says bhism- Dharmagya! My son, your brother will
go to heaven without having an offspring. Ambika and ambalika both the
queens are endowed with blooming youthfulness and they are competent
of bearing a child. Hey Bharat! Let them generate offspring for our family.
Hey mahabhaag! obey my words and get engaged in this religion. Anoint
yourself in the state and protect the bharat.
Dharmatma(saint like) bhishm says his mother satyavati after listening
to her words-......hey mother! no doubt you talked of dharm(what is
principles righteous living), but in relation to having a child, you know
about my ultimate pledge. You also know what happened before your
marriage, what compensation your father had asked for and what incident
took place at that time? Hey satyavati! today i am truly vowing in front of
you. I will leave trilok, I will sacrifice the state of gods, and more than these
two I will sacrifice anything, but will not leave truth. Let the earth leave its
smell, air leave its nature of being felt, sun leave its impact, fire leave its
heat, sky leave its nature of communicating, som leave its cold beam of light,
indra leave his power, but I cannot ever leave the truth. So, bhishm was firm
on his celibacy.
Similarly in mahabharat, in the context of yayatis character description,
a short witty episode took place between Brihaspati s handsome son Kach
and Shukracharya s daughter devyani.
Having taken the lessons from guru shukracharya on the practice of
Brahmacharya(celibacy), Kach was about to come back after his convocation.
Devyani, guru shukracharyas daughter proposed kach for marriage. Kach
answered,.....Hey sundari! I have high respects and regards for your father
and similarly you are venerable too. You are as dearer as life to Bhargav
shukracharya and being a daughter to my guru, dharmataha...abiding by the
principles..., you are also venerable... Hey devayani, you saying it, is not fair.
But devayani was not ready to accept his logic. She said, Hey kach! .....if you
cannot accept my offer .....which is permitted by dharma then the teachings
you learnt from my father will not be fruitful to you . After hearing this from
devayani kach kept himself composed and replied, you are the daughter of
my revered guru, I can never speak anything ill about you. Oh devayani.....
i have said what great hermitages and saints have approved of dharmas,
even then you cursed me. What instigated you to curse was kama(desire)
not dharma(righteousness). Whatever your intentions are, cannot not be
fulfilled by me. You said, sanjivani vidya will be of no use to me, but i will
pass the teachings of guru to sombody else who may be benefitted.It will be
fruitful for him. After saying this to devayani, kach came back to devlok. The
story of kach is an extraordinary example of devotional celibacy.
In the real sense, tapais the deemed to be the name of brahmacharya.
What else can be derived from it?

Heavenliness is a trait not relating to a man
but of someone, yoked by the gods.
Rodin has presented it in the form of
statue which is called eternal idol. The statue
portrays a lady who is sitting on her knees.
The lady sliding backwords but pushing
her body forward, her arms hanging down
loosely. She is having a beard mans face in
between her breasts, who is looking at her
face passionately with a strong sexual desire,
with a posture kneeling down before her.
In reality, hardly one in lakhs who, to get
the love of their sweet hearts, just cannot
sacrifice all those principles, the insight and
certain things, which are a representation of
the paramatma, for him. It is said that if a
person wants to conquer the world, he should
choose the path of self-imposed celibacy. To
have control over the senses of body one
has to follow the path of brahmcharya and
to conquer the devil, accept the submission.
Our Sri maharaj looks at the nature in
the form of a mother. The godmother, who
in the human form gives birth to the entire
universe. Sri maharaj says that there is no
existence of desires(kama) and anger, like
cleanliness which is covered by dust, once it
is removed, clarity is proved. Like the nature
of water is pleasantly cool, but it becomes
warm externally. Or, as the nature of water is
to keep flowing or remain still, but by force,
water can be flown in an opposite direction
at a higher level too.
In th same way, the real nature of human
being is filled with peace, knowledge, light,
love, compassion, immortality and celibacy...
but desires creep in between like garbage
and we inadvertantly assume it to be an
integral part of our existence. If we are able
to make an entry deep inside our heart, then
we get to know, that there is no ailment, it is
full of ultimate peace.
Living a life of celibate, one can restore
the same state of inner peace. Lets follow the
path of celibacy and have the priviledge of
being a divine son of this macrocosm. n
Ankur Dutta
Know and believe in
a well known fact that our body is made of five natural elements - Earth, Water,
It isFire,
Air and Sky. When someone dies, we normally say that the deceased has got
assimilated into the five elements. Some other say that the body made of soil has got
assimilated into the same.
hen we build a building, what do will use

and how much for this purpose. Similar is
the case of our body. The way only making a home
is not sufficient, but a home is complete when
it is full of happiness, kinship among the people
living there and above all spiritualism is also
required to be there. Similarly, conscience and its
development is most important for a happy and
satisfied life.
In fact, when do we see ourselves? When we
stand in front of a mirror. Now you raise your hand
before the mirror and ask what is this. The answer
will be- its hand. Whose hand? The answer will be
your hand. Whose feet are these, the answer will
be your feet. Whose eyes are these? Answer will

be your eyes. Similarly, you touch your body parts
and ask whom they belong to. The answer will that
they belong to you. Now the next question which
will be crop up will be - Who are you?
When all the body parts belong to you then who
in fact are you? Me and mine are the two feelings
which appear in two or more things. It means, it is
your body but it has been proved that it is not your
body but it is something else.
Lets come and contemplate a bit more about
this body and discuss how the five elements got
into us without letting us know about it. It is a fact
that food has its own rule. After assimilating with
Sperms caused birth of a child. In the

uterus, the embryo survives on nutritious
meal which it gets there. From birth to
death, his biggest requirement is
associated with meal.
In absence of meal, body growth will

stop, the person will begin to starve
and finally he will die. Hence it is
proved that food is very importance
for existence of human body.
our saliva, it forms juices, juices form flesh, flesh
turns into marrow and it finally turns into sperm.
Sperms caused birth of a child. In the uterus, the
embryo survives on nutritious meal which it gets
there. From birth to death, his biggest requirement
is associated with meal. In absence of meal, body
growth will stop, the person will begin to starve
and finally he will die. Hence it is proved that food
is very importance for existence of human body.
Lets have a contemplation on food and other
stuffs which we take for nutrition from beginning.
Whether we are vegetarian or non-vegetarian, we
largely depend upon food. When we saw seeds in
the soil, all the elements which are in accordance
with the seed help it to grow into a huge tree and
all these stuffs get stored in it. All the nutrients
present in the soil are taken by us in our diet
when we eat fruits and vegetables and some of
them happen to be roots and stems of a plant. To
prepare any food stuff, all the five elements - Earth,
Water, Fire, Air and Sky- are required. They are
also required in cooking the food and its digestion
too. Food is in fact a form of all the five elements
when they join together. Our many of the previous
generations survived only due to the food. This
food builds our body which proves that our body is
made of the five elements. Their energy provide us
our respective properties like power to smell from

earth, Rasna from water, beauty from fire, feeling
of touch from air, words from sky.
It means, these five elements are not only in
voluminous form but are also in subtle form. This
is the reason, why in the last stage of life, the body
becomes cold as the fire is extinguished. Words go
into the sky and the body is burnt and hence all
the gases contained in the body are released in the
sky, water of the body is dried down, rest of all is
dissolved in the nature. It is just like toys made of
clay for kids and after some time it is destroyed
and another toy is formed.
The hands in which we are holding books to
read get strength from the food, power from the
earth, blessings of almighty and labour of a farmer.
We cannot assess and hence, we cannot prepare
blood in any laboratory. Flesh, marrow, sperm, etc
cannot be formed in the laboratory. No laboratory
can form grain by using all the five elements but a
farmers labour and nature can together do it.
Now stand before a mirror and look at your
body. What is this body, which you wash everyday
and take care of it a lot. Why is it in existence?
What is its source? Are we obliged to the sources?
Are we not showing disrespect to the nature, food
grains and the farmers.
We believe that we can purchase everything
with money. But how will we purchase the nature
if it ceases to exist one day.
How will you buy food grains if it ceases to
grow? Where will you go to buy a farmer if he will
not be in existence.
There are things which dont have any price,
they are precious. We need to show respect and
awareness about them. Therefore, whenever you
see your body in a mirror, then think about your
body, your kids and the generations to come and
ask- what will be our legacy to them? Then you
will have one and only feeling to be obliged to all
the constituents of the nature which nourished
you and pay it your respect from the bottom of
your heart. Do as much work as it is possible for
you to do.
We in fact believe in all the things but dont
try to know about it. It is most required that if we
believe in something, we must know about it. n
Patanjali toxin-less farming 10
Obtain an yield of 80 Quintal per acre of Brinjal

(Eggplant) by natural methods of cultivation
Rajesh Jain
family of brinjal we have is more popular
and prevailing one. The botanical
species of brinjal can be categorised into three:
1. Long species, (Serpentium snake eggplant) 2.
Pear-shaped, blue-black in colour, (Depressum
dwarf eggplant) 3. Round, oval or elongated oval
in shape, (Esculentum)
The
English name
Botanical name
Total

Brinjal or Egg Plant

SOLANUM MELONGENA
SOLANACEAE
he plant is originally believed to have its birth

place in the hot zonal belts of India and China.
Generally, brinjal is said to have low nutrional value
among the vegetables, but this belief or fact is not
scientifically proved. According to Ayurveda, the fruits

of white brinjal have medicinal value for diabetics.
Climate:
For the production of seeds the climatic temperature

during the total harvest should be between 150C
to 250C. Because an brinjal dies out of frost in cold
temperature. Although the impact of frost is less
on round fruit varieties rather than on long fruit
varieties.
Soil:
Normally the crop of brinjal can be cultivated in any

sort of land.It completes its life cycle successfully, but
from the point of view of seed production, SANDY
LOAM SOIL is the most suitable one for brinjal. The
land or soil should have a pH between 6 to 7.5 and the
soil should not be swampy. The soil should not have
high clayey content.
Because of rain or any other reason, if water gets

stagnated on land, there should be a proper system for
drainage otherwise the plants may die because of the
roots getting rotten and also because of the outbreak
of stem rot disease.
Field preparation before crop:
The field gives more yield in brinjal cultivation

when Green manures are harvested in the land
before the harvest of brinjal crop. That is why,
40days before the transplantation of brinjal
in the main field, the seeds of green manure
inclusive of 6kg dicotyledons(dvibeejapatri), 3kg
monocotyledons(ekbeejapatri) and 1kg oilseeds
should be sown. When the Green manure crops
complete 40days interval, then Mulching should
be done in the fields. Afterwards, native method
of ploughing is adopted to make the land again
ready for tillage and thereby the level of land also
made uniform. Now, at the rate of tons of dung of
decayed manure is to be littered and also 1000Ltrs of
restorative manure (SANJIVAK KHAAD) is put in the
field. Ploughing is done again and the level of field
made uniform.
Note: Green manure is the name given to cover crops
that add nutrients and organic matter to soil.
Right time for sowing:
In the brinjal nursery, the right time for sowing
seeds is third week of february month in North

and Central India.
The method of preparing the

nursery:
For one acre of crop, 200gms of healthy and native

species of brinjal seeds are enough to be sown in
20X20metre area where the saplings are made
ready. In the nursery, beds should be prepared before
sowing of seeds is done. 15cm in height and 1metre
in width and accordingly the length of the bed is
created. Between two beds 30cm width space should
be left which will be helpful for irrigation purpose and
drainage.
Afterwards, per bed 2 kilograms of decayed dung
manure or 10Ltr restorative manure(sanjivak khaad)
is to be put in the upper surface. After this, 500gm
neem oil cake and 1kg coal per bed is put. Then sowing
of Beejamrit treated seeds is done in a row. Row by
row the distance of 6cm must be kept. After sowing
the seeds, they should be covered by 1cm thick layer
of compost manure. While sowing the seeds, the
depth is very much taken care of. The seeds should
not be sown deeper than 1cm. After sowing the seeds,
just lightly water the surface with sprinklers, use the
dried leaves and dried grass to cover the surface of the
bed. While irrigating morning and evening, mix 2Ltr
restorative manure(sanjivak khaad) in 8Ltr water.
When the seeds greminate, remove the dried leaves
Patanjali toxin-less farming 10

from cowdung, is very necessary.
Disease and their management:
Damping off:
It is a horticultural disease or condition caused
by mildew which often affect the saplings in the
nursery. Just above the ground level the stems of
the saplings get the lesions. When affected by this
disease, the saplings first start fading and afterwards
go dry.
Pest Control
Prevention:
The experiments of
Patanjali natural cultivation
department have been put to
tests such that upto 80percent
of the diseases is controlled
by NIMBADI JAIVIK
INSECTICIDE.
and grasses from the bed.
To protect the saplings from this at the nursery,

weekly twice, NIMBADI insecticide measuring 1Ltr
in 5Ltr water is mixed and put near the roots of
the saplings. If this disease has infected samplings
in larger number, then HINGADI INSECTICIDE
measuring 20ml per plant is to be put in the roots.
The experiments of Patanjali natural cultivation
department have been put to tests such that,upto
80percent of the diseases is controlled by NIMBADI
JAIVIK INSECTICIDE.
Transplantation in the main field:
Leaf spots:
Irrigation:
Prevention:
One day before taking the plants from nursery,

light irrigation is to be done, so that the plants
get offrooted with ease and the roots are not
damaged. According to Patanjali natural farming
department 28days to 35 days old plant become
eligible for transplantation. Evening time is said
to be reasonable for transplantation of brinjal in
the main field. Pits should be made at a distance of
60X60cm and then the plants are transplanted. Per
pit, 2kg of compost manure or dried Biogas slurry,
100gms of copper sulphate powder should be used.
Immediately after transplantation, irrigation is done
with 1000Ltr restorative manure(sanjivak khaad). It
is necessary to maintain a distance of 300metres in
between two varieties.
Usually, the crops of brinjal should be irrigated once
a week in summers and with an interval of 15days in
winters. If there were no rains in monsoon season,
then also irrigation is necessary to avoid the loss of
moisture content in the soil. While irrigating, the
use of 1000Ltr restorative manure(Sanjivak Khaad)
or 1000Ltr biogas slurry or 10gms of JIVAMRIT, made
The disease which can be found in the leaves of

saplings is caused by mildew. Primarily the following
four species of mildew are the factors of this disease:1. Alternaria melongenae,
2. Alternaria solani,
3. Cercospora solani,
4. Cercospora melonganae.
Of the above mentioned, both species of alternaria
mildew makes irregular shapes of brown spots on
the leaves. These spots later get dense to occupy
enough space on it, as a result of which the leaves
gets dry and fall of the sapling. On the other hand,
Cercospora mildew makes spots in the corner of the
leaves, which are beigish in colour. In this case also
the leaves become dry and fall of.
To protect from the above mentioned disease,
equal quantities of Karanjadi and Nimbadi, both
insecticides are to be mixed in 10Ltr water and should
be sprayed in the morning and evening, as soon as
the leaves start developing these spots. Within 3days
we can get rid of the harmful effects of the above
mentioned mildew.
Brinjal shoot and fruit borer:
The crops of brinjal should
be irrigated once a week in

summers and with an interval
of 15days in winters.
If there were no rains in monsoon

season, then also irrigation is
necessary to avoid the loss of moisture
content in the soil.
For a land measuring one acre, in 50Ltrs of water,

equal proportions of both insecticides measuring
10Ltrs are to be mixed and sprayed. That is,
5LTRS NIMBADI + 5Ltrs KARANJADI + 50Ltrs water
Toot knot nematode:
This nematode disease is caused by many species

of its kind. Because of this disease, the roots of the
plants turn into swollen glands and also the diseased
plant remains a dwarf plant. The leaves turn yellow
and start hanging, and thus the plant stop producing
proper flower and fruits.
Prevention:
To protect the plants from this Root knot disease,

during transplantation a mixture of neem oil cake,
rosewood or beechwood sawdust and copper sulphate
powder should be used to put in pits, afterwards
karanjadi insecticide and sour buttermilk should also
be used. The following is the measurement given per
pit:
500gms of rosewood/beechwood sawdust
200gms of neem oil cake
10 gms of copper sulphate powder
Per Feet
100ml karanjadi insectide
100ml sour buttermilk
The above mentioned contents should be mixed
properly and put in the pits before the transplantation
of brinjal is done in the evening. The above mentioned
components protects the brinjal crop from this Root
knot disease for a period of 3years.
Also called celletotrichum fruit rot disease. It is an

important pest of an brinjal crop. This pest is pinkish
in colour. It has got purple streaks on its back. The
pest makes holes with its trunk in the new branches
of an brinjal to make its entry and sucks the pulp of
those branches. Reason which the branches get faded
and the plants growth comes to a stand still.
When the plants start bearing fruits, these pests make
holes in the fruits and consume the pulp in them. This
disease is completely at its peak in monsoon season.
Prevention:
In case of this disease,KARANJADI insecticide is the

most effective one. When this pest attacks the brinjal
crop, the same day a mixture of karanjadi insecticide
and water in 1:1 proportion should be made and
sprayed on the crop. For a crop per acre, 30 Ltrs of
water should be mixed and sprayed on the crop
weekly twice so that the crop is safe and protected
from the shoot borer pest.
for the shine of brinjal:
A mixture of 5Ltrs of cow urine, 2kg dried cowdung

cake(uppal), 50ml Patanjali Bio Research Institutes
CHETNA medicine and 50Ltrs of water is prepared
to be sprayed on crop per acre, so that the brinjals
bear bright and attractive fruits.
Time for plucking fruits for

seed purpose:
When the fruit actually starts changing completely

into yellow colour, its the time to start the plucking of
fruits. Ripe fruits are put in salt water to make them
rot and then seeds are collected. The pulp is removed,
clean seeds are collected and dried in the shade. If the
seeds are dried in high temperatures, the moisture
level is to be taken care of. 8percent moisture level is
to be maintained certainly.
From the experiments of PATANJALI NATURAL
AGRICULTURE DEPARTMENT, by KUDRAT SHYAM
and KUDRAT RADHIKA species, in one acre area
approximately 80 quintal of production of brinjal
was made possible. 18 kilograms of seeds were also
obtained. Why not we also benefit from the natural
methods of cultivation? n
slogan of
bharat swabhiman
When the slogan of bharat swabhiman will
reach every corner,
Patanjali yoga will cure all the sins and
sorrows
We are follower of ascetic culture
We sing the song of vande mataram
Get up early in the morning
Listen to the tune of yoga
Life is always great
Courage,energy virtue, warmth, blossoms
We remain hale and hearty
We are the protector of ayurveda
Let the good deeds be useful
Moral knowledge will convert into pious
karma
and radiate each and every life.
Become a member of
Yog Sandesh a monthly magazine

published by Divya Yog Mandir (Trust)
Office: Patanjali Yogpeeth, Maharshi Dayanand Gram, DelhiHaridwar national highway, near Bahadarabad, Haridwar
Phone: 01334-244107, 246737, 240008
Fax: 01334-244805, 240664
email:divyayoga@rediffmail.com
Yog Sandesh monthly magazine is available in following
12 Languages
Hindi English Gujarati Marathi Bangla Punjabi Oriya

Assamese Telugu Kannada Nepali Tamil
Sir,
I hereby pay Rs. ................ as the annual /
five
years/
Yog
Eleven
Sandesh
.......................
Years
subscription
by
cash/M.D./D.D./Payslip
dated
....................
fee
for
Therefore
please send me Yog Sandesh in ..........................

language
every
month
at
the
address
given
below.
Name .............................................................
Father/Husband name .......................................
Swami ji is stout
Let the ascetic culture attain fame
Acharyasri is raising his voice
The world will read the great ayurveda
Every home will do the pious worship
The time is coming
The one who believes in oneness
Will be the satyuga
Then the divine surge will arise from heart
And fill us with inner strength.
There should be one religion
There should not be any difference in male
and female
Humanity should be free from inequality
Everyone get justice
The broken expectations of centuries
Will again rise
The throes of one world
Is giving the message from centuries
Everybody will think about
the making of divine earth
patanjali yoga will cure all the sins and
sorrows of the world.
Dr. Vijay kumar Mishra
Address ...........................................................
........................................................................
........................................................................
........................................................................
Post Office .......................................................
District ....................... State .............................
Pin Code...................... Phone ..........................
email ...............................................................
(Special rules)
1. Subscriprion fee-1 year-150/- 5 years-700/- 11 years1500/2. D.D. should be in favour of Yog Sandesh payable in
Haridwar.
3. The D.D. payable on other places than Haridwar send
Rs. 70 extra.
4. Please fill your name and address in neat & clean handwriting
5. The subscription in abroad initially for one year. The
subscription fee for such members Rs. 800/- or USD
20/- or GBP 10/6. Subscription fee may be deposited in the A/c no.
30721914467 (SBI Patanjali Yogpeeth, Shantarshah,
Bahadarabad, Haridwar).
7. Membership form must be fill in Hindi or English only.
The Patanjali Products

useful in daily life
Patanjali Kanti Aloe vera
Patanjali Kanti Panchagavya

Panchagavya (cow urine,
cow dung, curd, ghee, milk)
components and exclusive
good herbal soap.
For an absolute and fresh

feeling, use this product,
ultimate in skincare with
aloe vera and other herbs.
Patanjali Saumya Haldi chandan
Patanjali Kanti Neem
(Body Cleanser)
Patanjali Ojas kanti

neem is manufactured
with Neem, Amla and
other herbs.
Use this body cleanser to have all

the good properties of turmeric,
sandalwood and other herbals
and have a glowing skin.
Patanjali Ojas Mogra
Patanjali Ojas Multani Mitti
(Body Cleanser)
(Body Cleanser)
Traditional fragrance of
Mogra (Arabian jasmin)
Body Cleanser provides
great nourishment to skin
and it protects the humidity
of the skin.
Patanjali Ojas Mint
This product is enriched

with Multani Mitti
properties, for bright
skin and to get rid of
from skin diseases.
Patanjali Ojas Aqua Fresh
(Body Cleanser)
(Body Cleanser)
Use this product every day for bright

and glowing skin, nourisher, eradicates
skin diseases, skin dryness and
roughness of skin. Skin allergies can be
get rid of by using turmeric, neem and
aloe vera. Cosmetics using various kinds
of herbals enrich the beauty of the skin
and cherish its glow.
Including refreshing pudin

transparent Body Cleanser.
It is beneficial for a healthy,
beautiful and refreshing
skin. And it protects the
natural humidity of the
skin. Very soft and contains
medical qualities.
Patanjali Detergent powder (with herbal)
Patanjali Detergent cake (herbal)
Patanjali Herbal hand wash

Contained Tulsi and Neem.
It is very effective natural
herbal hand wash protects
100% from bacteria.
YOG SANDESH ()
RNI No. DELENG/2006/16626
Healthy India, prosperous India
Patanjali Body Cleanser and herbal Hand Wash

Body cleanser, made of
herbs, cleanses your body,
gives natural beauty with
freshness.
Our very
effective hand
wash is made
of Neem and
Tulsi.
Herbal Hair Cleanser and Conditioner

We have brought to
you five kind of herbal
shampoos and five kind
of conditioners made of
Shikakai, Ritha, Amla,
Neem, Tagar, Aloe
vera, hena and herbs to
vitalize your hair and
cure hair problems like
hair fall and dandruff.
Patanjali Dantkanti, Divya Dant Manjan and Patanjali Tooth Brush
These are
Patanjalis special
products to clean
your clothes and
keep your hands
safe. Use of Neem
and lemon make
the detergent cake
capable in cleaning
your clothes with
shining.
Akarkara and Babool

(Vachellia nilotica)
used in these products
make our gums strong.
Clove, turmeric and
Neem make our mouth
and teeth germ free.
Mint and Pipalli give
freshness. Peeloo and
Majuphal make the
teeth roots strong.
Patanjali Detergent Powder, cake and Super Dish-Wash Bar
For the beauty of your face, we bring you the products like aloe vera, Saundarya, honey orange, lemon honey, neem and tulsi face wash
Besides diet, the use of
chemical products like
face wash, soaps, shampoo,
conditioners and creams
release poison in our body
which result in health
hazards. Therefore,
use pure and
herbal products
of Patanjali.
Patanjali Ayurved and Divya Pharmacy Haridwar, Uttarakhand, Ph: - 91-1334-240008,

Website:- www.patanjaliayurved.org, Email:- - divyayoga@divyayoga.com

Ys Dec 2014 Eng PDF

Enviado por

Dados do documento

Descrição original:

Título original

Direitos autorais

Formatos disponíveis

Compartilhar este documento

Compartilhar ou incorporar documento

Opções de compartilhamento

Você considera este documento útil?

Este conteúdo é inapropriado?

Direitos autorais:

Formatos disponíveis

Ys Dec 2014 Eng PDF

Enviado por

Direitos autorais:

Formatos disponíveis

Year 12, Issue 04

Published by Divya Yog Mandir (Trust)

Ayurveda, Cultural and

Swami Ramdevji Maharaj

Pioneer in bringing innovative

Yog Sandesh 1 December 2014

Year 12, Issue 04

Published by Divya Yog Mandir (Trust)

Swami Ramdevji Maharaj

Udhyam Sahasam dhairyam buddhih shakti parakramah

Yog Sandesh 1 December 2014

Dr. Vijay Kumar Mishra

Maharishi Dayanand Gram,

(Dainik Bhaskar Group)

Publisher and printer Divya Yog Mandir (trust), Kripalu

Patnajali Yogpeeth spreading message

There are many Agnisamuh

Eternal truth emanating out of the eternal

Path of yoga meant for saints

he saints who are pursuing the path of spiritualism, yoga and

meaningless. People consider

Due to wrong kind of knowledge most of the Sadhaks have a

Yog Sandesh 3 December 2014

refrain from making efforts or

Therefore, a Sadhak must get true knowledge

December 2014 4 Yog Sandesh

Yog Sandesh 5 December 2014

fter making path breaking developments in the field of Yoga and

From Acharyakulam to four clan:

December 2014 6 Yog Sandesh

What ever is being taught in the syllabus

Eligibility to open branches of

1. For establishing an Acharyakulam with

and other facilities. For arranging land,

Association of Patanjali Yogpeeth in the functioning

1. From imparting education to guiding in its functioning, all these

Financial aspect of Acharyakulam:

1. Acharyakulam will be a non-profitable organisation. Minimum fee which

Acharyakulam will be Centre for nation building

1. Besides imparting education, Acharyakulam will also be a centre for

Yog Sandesh 7 December 2014

Olive helps you

December 2014 8 Yog Sandesh

clean, golden in colour and little

It is about 15 metre high,

Yog Sandesh 9 December 2014

Sore: Applying olive seeds

Hair related problems:

Khalitya: Roast the raw fruit

Make tea of olive leaves and

By applying the paste of raw

Bone joint problems:

All other disease:

olive oil, it will cure problems

Diarrhea: Make paste of

In pain in ear, take 5 ml olive

Urine related problems:

Aamvaat: Make paste of olive

Tooth problem: Boil raw

Massage your chest with

Got rid of dangerous

hen two patients of two different diseases