Você está na página 1de 225

Psicologia

Coletnea de Provas

As maiores bancas ...


30 Provas selecionadas
Gabaritos Oficiais

www.concursospsi.com

2 0 1 4

HU-UFMS - HOSPITAL UNIVERSITRIO MARIA APARECIDA PEDROSSIAN DA UNIVERSIDADE FEDERAL DO MATO GROSSO DO SUL/MS
CONCURSO PBLICO 09/2014 - EBSERH/HU-UFMS
EDITAL N 03 - EBSERH - REA ASSISTENCIAL

Concurso Pblico
REF. EDITAL N 03/2014

Cargo

NVEL SUPERIOR - MANH

PSICLOGO -REA HOSPITALAR


ATENO
O Caderno de questes possui 50
(cinquenta)
questes
objetivas,
numeradas sequencialmente, de acordo
com o exposto no quadro a seguir:

MATRIA

QUESTES

Lngua Portuguesa

01 a 10

Raciocnio Lgico e Matemtico

11 a 15

Legislao Aplicada EBSERH

16 a 20

Legislao Aplicada ao SUS

21 a 25

&RQKHFLPHQWRV(VSHFtFRV

26 a 50

INSTRUES
 1D VXD )ROKD GH 5HVSRVWDV FRQUD VHX QRPH R Q~PHUR GR VHX
GRFXPHQWRHRQ~PHURGHVXDLQVFULomR$OpPGLVVRQmRVHHVTXHoD
de conferir seu Caderno de Questes quanto a falhas de impresso e
de numerao, e se o cargo corresponde quele para o qual voc se
LQVFUHYHX4XDOTXHUGLYHUJrQFLDFRPXQLTXHDRVFDO
 2 ~QLFR GRFXPHQWR YiOLGR SDUD DYDOLDomR GD SURYD p D )ROKD GH
5HVSRVWDV6ypSHUPLWLGRRXVRGHFDQHWDHVIHURJUiFDtransparente
de cor azul ou preta para o preenchimento da Folha de Respostas, que
deve ser realizado da seguinte maneira:
 2 SUD]R GH UHDOL]DomR GD SURYD p GH  TXDWUR  KRUDV LQFOXLQGR D
marcao da Folha de Respostas. Aps 60 (minutos) do incio da
prova, o candidato estar liberado para utilizar o sanitrio ou deixar
GHQLWLYDPHQWHRORFDOGHDSOLFDomR$UHWLUDGDGDVDODGHSURYDGRV
WUrV ~OWLPRVFDQGLGDWRVVyRFRUUHUiFRQMXQWDPHQWH
 $RWpUPLQRGHVXDSURYDFRPXQLTXHDRVFDOGHYROYHQGROKHD)ROKD
de Respostas devidamente preenchida e assinada. O candidato poder
levar consigo o Caderno de Questes, desde que aguarde em sala o
WpUPLQRGDDSOLFDomR
5. As provas e os gabaritos preliminares estaro disponveis no site do
Instituto AOCP - www.institutoaocp.org.br - no dia posterior aplicao
da prova.
6. Implicar na eliminao do candidato, caso, durante a realizao
das provas, qualquer equipamento eletrnico venha emitir rudos,
mesmo que devidamente acondicionado no envelope de guarda de
pertences. O NO cumprimento a qualquer uma das determinaes
constantes em Edital, no presente Caderno ou na Folha de Respostas,
incorrer na eliminao do candidato.

Informaes Adicionais
0(xx)44 3344-4242 / www.institutoaocp.org.br / candidato@institutoaocp.org.br

( 

Estrutura.
2 Q~PHUR GH DQGDUHV GR SUpGLR KRVSLWDODU ID] SDUWH
desta Estrutura.

QUESTO 28

(A)
% 
& 
' 

(E)

Em relao ao Diagnstico na psicologia


hospitalar, assinale a alternativa INCORRETA.
A Psicologia Hospitalar, no oferece rtulos e sim uma
viso panormica.
1D3VLFRORJLD+RVSLWDODURGLDJQyVWLFRpVHPHOKDQWH
ao psicodiagnstico.
2GLDJQyVWLFRpRPRGRTXHRSVLFyORJRGLVS}HSDUD
melhor organizar o seu pensamento.
1D 3VLFRORJLD +RVSLWDODU R GLDJQyVWLFR p R
conhecimento da situao existencial e subjetiva da
pessoa.
Na Psicologia Hospitalar no diagnosticamos doenas,
mas o que acontece com as pessoas e sua relao
com a doena.

QUESTO 29

Em relao s principais fontes de informaes


sobre medicamentos acessveis ao psiclogo
hospitalar, relacione as colunas e assinale a
alternativa com a sequncia correta.

CONHECIMENTOS ESPECFICOS

QUESTO 26
Em relao insero do Psiclogo no contexto
hospitalar, assinale a alternativa INCORRETA.
(A)
O psiclogo dever adaptar sua atuao, uma vez
que os espaos e demais condies hospitalares so
GLIHUHQWHVGRTXHpSURSRVWRQDDWXDomRFOtQLFD
(B)
Para a insero do psiclogo no hospital, faz-se
QHFHVViULRTXHRSURVVLRQDOWHQKDXPERPSUHSDUR
terico e prtico.
(C)
Para a insero do psiclogo no hospital, faz-se
QHFHVViULR TXH R SURVVLRQDO SUHVWH DVVLVWrQFLD DR
SDFLHQWH p SUHFLVR FRQKHFHU D GRHQoD QmR VHQGR
necessrio conhecer a rotina a qual o paciente vai ser
submetido.
(D)
O psiclogo dever acompanhar a evoluo do
paciente quanto aos aspectos emocionais que a
doena traz.
(E)
O psiclogo deve estar disponvel para acompanhar
o paciente e suas reaes emocionais, que ocorrem
durante e depois da notcia do bito.

A.
B.
C.
D.

Posologia.
Apresentao.
Reaes adversas.
Indicaes teraputicas.

1.

Sugere as dosagens mais adequadas para


o tratamento com aquele remdio.
Menciona os efeitos colaterais mais
comumente encontrados nos pacientes
que usam o remdio.
Lista das principais doenas ou situaes
clnicas em que o remdio pode ser usado.
Relaciona
as
diferentes
formas
farmacuticas
(comprimido,
cpsulas,
xarope, pomada) em que o produto
colocado para ser vendido.

2.

3.
4.

(A)
(B)
(C)
(D)
(E)

QUESTO 27
A anlise institucional do hospital poder ser
dividida em duas partes, sendo: Estrutura Esttica
e Estrutura Dinmica. Nesta perspectiva, qual das
seguintes alternativas condiz com a Estrutura
Esttica?
$ 
6LJQLFD D HVWUXWXUD GH IXQFLRQDPHQWR GDV UHODo}HV
interpessoais da instituio.
(B)
por meio desta Estrutura que os aspectos inerentes
DRVUHODFLRQDPHQWRV GRVSURVVLRQDLVTXHDWXDPQD
instituio tornam-se claros e precisos.
&  $ WUDMHWyULD KRVSLWDODU GR SDFLHQWH p XP GRV LWHQV
importantes desta Estrutura.
'  2V FULWpULRV GH DOWD KRVSLWDODU p XP GRV LWHQV GHVWD

1A 2D 3B 4C.
1B 2A 3C 4D.
1D 2C 3B 4A.
1B 2D 3C 4A.
1A 2C 3D 4B.

Cargo: Psiclogo - rea Hospitalar

QUESTO 30

QUESTO 33
Trata-se de um iderio que se corresponde
a determinado conjunto de concepes que
norteia as prticas de determinados servios
da rede substitutiva, que possuem propostas de
DWHQGLPHQWRHTXHSRGHPVHUFODVVLFDGDVGHQWUR
das tendncias de Desinstitucionalizao como
desconstruo. Assinale a alternativa que se
refere ao enunciado.
(A)
Servios de Proteo Social Especial.
(B)
Servios de Proteo Social Bsica.
(C)
Luta Antimanicomial.
(D)
Reforma Administrativa.
(E)
Manicmio Judicirio.

De acordo com CAMON (1996), sobre as funes


do Roteiro de Avaliao Psicolgica no Hospital,
analise as assertivas e assinale a alternativa que
aponta a(a) correta(s).

(A)
(B)
(C)
(D)
(E)

I.

Funo Diagnstica.

II.

Fornecimento de dados sobre a estrutura


psicodinmica da personalidade da pessoa.

III.

Instrumento de avaliao continuada do


processo evolutivo da relao do paciente
com sua doena e a percia mdica.

IV.

Estabelecimento das condies de relao


da pessoa com seu prognstico.

QUESTO 34
considerado como Ponto de Ateno do
Componente da Ateno Especializada da Rede de
Ateno Psicossocial, destinado a proporcionar
a ateno integral e contnua a pessoas com
necessidades relacionadas ao consumo de lcool,
crack e outras drogas, com funcionamento nas 24
(vinte e quatro) horas do dia e em todos os dias da
VHPDQD LQFOXVLYH QDLV GH VHPDQD H IHULDGRV 2
enunciado refere-se a
(A)
Manicmio Judicirio.
(B)
CAPS I.
(C)
CAPS II.
(D)
CAPS III.
(E)
CAPS AD III.

Apenas I.
Apenas I e II.
Apenas I, II e III.
Apenas I, II e IV.
I, II, III e IV.

QUESTO 31

$ 
(B)
(C)
' 
(E)

No roteiro de Avaliao Psicolgica no Hospital,


encontramos a avaliao do estado emocional
geral do paciente. Nesta perspectiva, assinale a
alternativa INCORRETA.
6HX REMHWLYR p SRVVLELOLWDU XPD YLVmR JHUDO GDV
condies emocionais da pessoa hospitalizada.
Avalia-se a relao afetiva do indivduo consigo
mesmo.
Avalia-se o grau de informao que o paciente tem
sobre sua doena.
([FOXLVH D LGHQWLFDomR GD SUHVHQoD GH UXSWXUD
psictica.
Avalia-se o estado de autoconceituao do paciente
frente s implicaes que a doena e hospitalizao
lhe impuseram.

QUESTO 35
Com relao atuao do psiclogo junto
HTXLSHGHVD~GHHVXDSUiWLFDSURVVLRQDODQDOLVH
as assertivas e assinale a alternativa que aponta
a(s) correta(s).

I.

Discusso de casos refere-se participao


GR SURVVLRQDO HP UHXQL}HV VHPDQDLV
mantidas pela equipe de sade, ocultando
os aspectos emocionais dos casos
apresentados.

II.

Discusso de atitudes: o psiclogo poder


atuar no sentido de orientar discusses que
envolvam as atitudes da relao mdicopaciente, bem como processos inerentes
ao processo de hospitalizao.

III.

Grupo de estudo: refere-se aos relatos de


suas atividades coordenao do setor.

IV.

Controle
burocrtico:
refere-se

SRVVLELOLGDGHGRSURVVLRQDOGHSVLFRORJLD
orientar possveis grupos de estudo que
visem melhor compreenso das condies
fsicas e emocionais do paciente.

QUESTO 32

(A)
(B)
(C)
(D)
(E)

Na Avaliao Psicolgica aplicada ao hospital, mais


precisamente no exame psquico, encontramos a
avaliao da conscincia, incluindo o estado em
que o paciente praticamente perde a capacidade de
YHUEDOL]DUHFRPJUDQGHGLFXOGDGHGHGHPRQVWUDU
compreenso aos estmulos que lhe so impostos.
$PRWULFLGDGHQDHVWiWRWDOPHQWHFRPSURPHWLGD
e a ampla, severamente complicada, e sua ateno
voluntria comea a apresentar fortes sinais
de dispersividade. H tambm deteriorao do
pensamento conceptual, que se torna incoerente e
fragmentrio. Este estado denomina-se
Estado de Torpor.
Estado de Obnubilao.
Estado de Turvao.
Coma I ou Coma Vigil.
Coma IV.

(A)
(B)

Apenas II.
Apenas I e III.
Cargo: Psiclogo - rea Hospitalar

(C)
(D)
(E)

Apenas II e IV.
Apenas I, III e IV.
I, II, III e IV.

QUESTO 36
So reaes somticas, observadas em crianas
hospitalizadas sem suas mes:
$ 
DQJ~VWLD
(B)
sensao de abandono.
(C)
dermatoses.
(D)
inapetncia.
(E)
tristeza.

(A)
(B)
(C)
(D)
(E)

QUESTO 37
So razes dos pais para a no visitao dos
pacientes crianas internados, EXCETO
(A)
residncia longe do hospital.
(B)
ansiedade e culpa em relao doena.
&  LQFDSDFLGDGHRXGLFXOGDGHSDUDVXSRUWDURVRIULPHQWR
da criana.
(D)
negao da doena.
(E)
vnculos afetivos estveis.

(A)
(B)
(C)
(D)
(E)

A psicologia da sade a aplicao de


princpios e pesquisas psicolgicas para
a melhoria da sade e a preveno e o
tratamento de doenas.

II.

A psicologia da sade a aplicao de


princpios e pesquisas sociolgicas para
a melhoria da sade e a preveno e o
tratamento de doenas.

III.

A psicologia da sade caracteriza-se


pela evitao de princpios e pesquisas
psicolgicas para a melhoria da sade e a
preveno e o tratamento de doenas.

IV.

A psicologia da sade a aplicao de


SULQFtSLRV H SHVTXLVDV ORVyFDV SDUD
a melhoria da sade e a preveno e o
tratamento de doenas.

As motivaes do uso.

II.

A quantidade utilizada.

III.

O padro de uso.

IV.

Os efeitos obtidos.

Apenas I.
Apenas II e III.
Apenas II e IV.
Apenas II, III e IV.
I, II, III e IV.

QUESTO 40
So exemplos de manejo psiquitrico, para o
tratamento de dependncia qumica:
(A)
anamnese detalhada sobre o padro de consumo atual
e passado, bem como seus efeitos no funcionamento
biopsicossocial.
% 
DYDOLDomR PpGLFD H SVLTXLiWULFD JOREDO DQDPQHVH H
exame fsico/psquico).
(C)
motivao para abstinncia.
'  KLVWyULD GH WUDWDPHQWRV SVLTXLiWULFRV SUpYLRV H VHXV
resultados.
(E)
avaliao das condies familiares e scias.

QUESTO 38
A respeito dos fundamentos e princpios da
Psicologia da Sade, analise as assertivas e
assinale a alternativa que aponta a(s) correta(s).

I.

I.

QUESTO 41
3RGHVHDUPDUTXHVmRH[HPSORVGHLQWHUYHQo}HV
psicoterpicas para a dependncia qumica:
(A)
manejo de contingncias: incentivos ou recompensas
TXHHQFRUDMDPPHWDVFRPSRUWDPHQWDLVHVSHFtFDV
% 
LQGXomR GH UHFDtGDV LGHQWLFDomR H LQWHUYHQomR HP
situaes de risco para uso; incentivo s situaes e
comportamentos alternativos ao uso.
(C)
manejo de contingncias: incentivos ou recompensas
que reduzam metas comportamentais.
'  SUHYHQomRGHUHFDtGDVLGHQWLFDomRHLQWHUYHQomRHP
situaes de risco para uso; incentivo s situaes e
comportamentos idnticos ao uso.
(E)
falta de manejo de contingncias: incentivos ou
recompensas que encorajam metas comportamentais
HVSHFtFDV
QUESTO 42
So critrios que caracterizam a dependncia,
EXCETO
(A)
tolerncia (sndrome com sinais e sintomas tpicos de
cada substncia, que so aliviados pelo consumo).
(B)
consumo por perodo de tempo mais prolongado e em
quantidades maiores que o planejado.
(C)
desejo persistente de uso e incapacidade para
control-lo.
(D)
reduo do crculo social em funo do uso da
substncia.
(E)
persistncia do uso da substncia, apesar de prejuzos
clnicos.

Apenas I.
Apenas III.
Apenas I e IV.
Apenas II, III e IV.
I, II, III e IV.

QUESTO 39
Diante de um paciente que faz uso de substncias,
importante a caracterizao detalhada do
consumo, questionando, para todas as drogas
consumidas. Analise as assertivas e assinale a
alternativa que aponta a(s) correta(s).

Cargo: Psiclogo - rea Hospitalar

QUESTO 47
A Clula nervosa, incluindo o corpo celular, os
dendritos e o axnio (que s vezes revestido pela
bainha de mielina), denomina-se
(A)
Neurnio.
(B)
Sinapse.
(C)
Neurotransmissores.
(D)
Limiar.
( 
+LSyVH

QUESTO 43
Em relao aos objetivos da psicologia da sade,
analise as assertivas e assinale a alternativa que
aponta a(s) correta(s).

(A)
(B)
(C)
(D)
(E)

,

(VWXGDUGHIRUPDQmRFLHQWtFDDVFDXVDVH
origens de determinadas doenas.

,,

1D LGHQWLFDomR GD HWLRORJLD H


diagnstico relacionado sade,
doena e s disfunes, bem como
aperfeioamento do sistema de poltica
Sade.

QR

no
da

,,,

$WXDU QR VXVWHQWR GD SUROD[LD SHOD IDOWD


GHFRPSUHHQVmRSHGDJyJLFDHFLHQWtFD

IV.

Aplicao dos conhecimentos


tcnicas psicolgicas sade.

QUESTO 48
A Rede de neurnios em torno do ncleo central
do crebro; associado a emoes como o medo
e a agresso; inclui o hipotlamo, a tonsila e o
hipocampo, essa rede denomina-se
(A)
Cerebelo.
(B)
Medula.
(C)
Amgdala.
(D)
Sistema lmbico.
(E)
Hipotlamo.

das

Apenas I.
Apenas II e III.
Apenas II e IV.
Apenas II, III e IV.
I, II, III e IV.

QUESTO 49
Qual estrutura a seguir que est ligada memria?
(A)
Hipocampo.
(B)
Tlamo.
(C)
Formao reticular.
(D)
Medula.
(E)
Tronco.

QUESTO 44
O contexto, em que a mensagem central da
psicologia da sade que a sade e a doena esto
VXMHLWDVDLQXrQFLDVSVLFROyJLFDVGHQRPLQDVH
(A)
contexto social.
(B)
contexto biolgico.
(C)
contexto psicolgico.
(D)
contexto fsico.
( 
FRQWH[WRPpGLFR

QUESTO 50
So hormnios que estimulam o corpo em
momento de estresse:
(A)
epinefrina, norepinefrina e cortisol.
(B)
glucagon, epinefrina e norepinefrina.
&  FRUWLVROKLSyVHHKRUP{QLRV
'  FyUWH[PRWRUKLSyVHHFRUWLVRO
(E)
glndulas adrenais, hormnios e insulina.

QUESTO 45
So tendncias que moldaram a psicologia da
sade:
(A)
a diminuio da expectativa de vida em mais de 20
anos.
(B)
o reconhecimento de fatores psicolgicos e sociais na
LQXrQFLDGRVFRPSRUWDPHQWRV
&  RIRUWDOHFLPHQWRGRPRGHORELRPpGLFR
'  DLQHFLrQFLDGDVDERUGDJHQVHPSURPRomRGDVD~GH
e a preveno de doenas, com relao a cistos no
WUDWDPHQWRGHVD~GH
( 
D LQHFiFLD GH IDWRUHV SVLFROyJLFRV H VRFLDLV QD
LQXrQFLDGRVFRPSRUWDPHQWRV
QUESTO 46
Estudos descritivos, estudos observacionais,
estudos experimentais, estudos epidemiolgicos
e metanlise, so exemplos de
(A)
cenrio de pesquisa.
% 
PpWRGRGHFROHWDGHGDGRV
(C)
vantagens.
(D)
desvantagens.
( 
PpWRGRGHSHVTXLVD

10

Cargo: Psiclogo - rea Hospitalar

PROVA: EBSERH - HC - UFMS


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: AOCP

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

C
E
B
E
D
D
B
C
E
A
C
E
A

39
40
41
42
43
44
45
46
47
48
49
50

E
C
A
A
C
C
B
E
A
D
A
A

Coletnea de Provas | Concursos de Psicologia

MATERNIDADE ESCOLA ASSIS CHATEAUBRIAND DA UNIVERSIDADE FEDERAL DO CEAR - MEAC-UFC E HOSPITAL


UNIVERSITRIO WALTER CANTDIO DA UNIVERSIDADE FEDERAL DO CEAR - HUWC-UFC
CONCURSO PBLICO 6/2014 - EBSERH/MEAC-UFC E HUWC-UFC
EDITAL N 03 - EBSERH - REA ASSISTENCIAL

Concurso Pblico
REF. EDITAL N 03/2014

NVEL SUPERIOR - MANH

Cargo

PSICLOGO REA HOSPITALAR


ATENO
O Caderno de questes possui 50
(cinquenta)
questes
objetivas,
numeradas sequencialmente, de acordo
com o exposto no quadro a seguir:

MATRIA

QUESTES

Lngua Portuguesa

01 a 10

Raciocnio Lgico e Matemtico

11 a 15

Legislao Aplicada EBSERH

16 a 20

Legislao Aplicada ao SUS

21 a 25

&RQKHFLPHQWRV(VSHFtFRV

26 a 50

INSTRUES
 1D VXD )ROKD GH 5HVSRVWDV FRQUD VHX QRPH R Q~PHUR GR VHX
GRFXPHQWRHRQ~PHURGHVXDLQVFULomR$OpPGLVVRQmRVHHVTXHoD
de conferir seu Caderno de Questes quanto a falhas de impresso e
de numerao, e se o cargo corresponde quele para o qual voc se
LQVFUHYHX4XDOTXHUGLYHUJrQFLDFRPXQLTXHDRVFDO
 2 ~QLFR GRFXPHQWR YiOLGR SDUD DYDOLDomR GD SURYD p D )ROKD GH
5HVSRVWDV6ypSHUPLWLGRRXVRGHFDQHWDHVIHURJUiFDtransparente
de cor azul ou preta para o preenchimento da Folha de Respostas, que
deve ser realizado da seguinte maneira:
 2 SUD]R GH UHDOL]DomR GD SURYD p GH  TXDWUR  KRUDV LQFOXLQGR D
marcao da Folha de Respostas. Aps 60 (minutos) do incio da
prova, o candidato estar liberado para utilizar o sanitrio ou deixar
GHQLWLYDPHQWHRORFDOGHDSOLFDomR$UHWLUDGDGDVDODGHSURYDGRV
WUrV ~OWLPRVFDQGLGDWRVVyRFRUUHUiFRQMXQWDPHQWH
 $RWpUPLQRGHVXDSURYDFRPXQLTXHDRVFDOGHYROYHQGROKHD)ROKD
de Respostas devidamente preenchida e assinada. O candidato poder
levar consigo o Caderno de Questes, desde que aguarde em sala o
WpUPLQRGDDSOLFDomR
5. As provas e os gabaritos preliminares estaro disponveis no site do
Instituto AOCP - www.institutoaocp.org.br - no dia posterior aplicao
da prova.
6. Implicar na eliminao do candidato, caso, durante a realizao
das provas, qualquer equipamento eletrnico venha emitir ruidos,
mesmo que devidamente acondicionado no envelope de guarda de
pertences. O NO cumprimento a qualquer uma das determinaes
constantes em Edital, no presente Caderno ou na Folha de Respostas,
incorrer na eliminao do candidato.

Informaes Adicionais
0(xx)44 3344-4242 / www.institutoaocp.org.br / candidato@institutoaocp.org.br

QUESTO 29

CONHECIMENTOS ESPECFICOS

$ 

QUESTO 26
Sobre a promoo pblica dos servios do
psiclogo por meio individual ou coletivo (Art.20
GR &yGLJR GH eWLFD 3URVVLRQDO GR 3VLFyORJR 
assinale a INCORRETA.
(A)
O psiclogo dever informar seu nome completo, o
&53HRQ~PHURGHUHJLVWUR
(B)
O psiclogo far referncia apenas a ttulos ou
TXDOLFDo}HVSURVVLRQDLVTXHSRVVXD
&  2 SVLFyORJR GLYXOJDUi VRPHQWH TXDOLFDo}HV
DWLYLGDGHV H UHFXUVRV UHODWLYRV D WpFQLFDV H SUiWLFDV
que estejam reconhecidas ou regulamentadas pela
SURVVmR
(D)
O psiclogo no far autopromoo em detrimento de
RXWURVSURVVLRQDLV
(E)
O psiclogo poder usar o preo como forma de
propaganda.

% 

& 

' 

( 

QUESTO 30
6REUHD$QiOLVH,QVWLWXFLRQDODVVLQDOHDDOWHUQDWLYD
correta.
$ 
2 PpWRGR DQDOtWLFR VH EDVHLD QD LGHLD GH TXH DV
UHODo}HV QmR VmR PDLV EHP H[SOLFDGDV DWUDYpV GD
ao dos elementos.
(B)
As instituies no so somente os objetos ou as
regras visveis na superfcie das relaes sociais. Tm
uma face escondida, que a anlise institucional se
prope a descobrir.
(C)
A Anlise Institucional trata-se de interpretar sem
decompor as partes.
'  $LQVWLWXLomRpXPQtYHOGDRUJDQL]DomRVRFLDO UHJUDV
leis) que atua a partir do exterior para regular a vida
dos grupos ou as condutas dos indivduos.
(E)
A iluso institucional e o desconhecimento no so
necessrios para que o sistema social se mantenha.

QUESTO 27
Entendendo que a dor tambm possui
componentes emocionais, assinale a alternativa
correta.
(A)
No se deve supor que indivduos com sintomas
somatoformes estejam simulando, eles podem ser
reais.
(B)
A dor pode ser compreendida fora do contexto vital do
sujeito.
&  2FRQWH[WRPRPHQWkQHRGRVXMHLWRQmRpUHOHYDQWHQD
avaliao de sua dor.
(D)
Ao avaliar a dor, as necessidades, no momento que a
mesma ocorre, so irrelevantes.
( 
$ GRU SRGH VHU XP VLQDO SDUD XPD GHFLrQFLD
PRPHQWkQHDJHQpWLFD
QUESTO 28

$ 

% 

(C)
(D)

(E)

Assinale a alternativa INCORRETA no que diz


respeito Sade Mental e atuao do psiclogo
nesse contexto.
$VD~GHPHQWDOVHUHVWULQJHDSHQDVjSVLFRSDWRORJLDH
pode ser reduzida ao estudo e tratamento das doenas
mentais.
$3VLFRORJLD6RFLDOHD3VLFRORJLDGD6D~GHDWXDOPHQWH
PDLVVHGHGLFDPDRVHVWXGRVHWUDWDPHQWRVHP6D~GH
Mental.
$ HQWUDGD GR SVLFyORJR QR VHWRU GH VD~GH PHQWDO
aconteceu em um determinado contexto histricopoltico-econmico.
$6D~GH0HQWDOQR%UDVLODSUHVHQWDJUDQGHSUHMXt]R
nos atendimentos, pelo fato de que as equipes que
WUDEDOKDPQHVWHVHWRUVmRLQVXFLHQWHVHPUHODomRj
demanda.
*UDQGH SDUWH GRV 3URJUDPDV GH 6D~GH 0HQWDO QD
ateno primria, no conta com a presena do
SURVVLRQDOGH3VLFRORJLD

O Psiclogo, cada vez mais, vem compondo as


HTXLSHVGD$WHQomR3ULPiULDj6D~GH $36 'HVWD
forma assinale a alternativa INCORRETA.
$ HQWUDGD GR SVLFyORJR QR VHWRU S~EOLFR GH VD~GH
GiVH HP XP PRPHQWR HP TXH R PRGHOR PpGLFR
assistencial privatista encontra-se no seu pice, mas
WDPEpPHPIUDQFRHVJRWDPHQWRHGHLQ~PHUDVFUtWLFDV
do modelo asilar na rea da psiquiatria.
$ $WHQomR 3ULPiULD D 6D~GH $36  WDPEpP HVWi
YROWDGDjSURPRomRjVD~GHTXHVHULDDPHOKRULDQD
qualidade de vida da populao em vrios aspectos.
A APS preconiza aes sociais que valorizem o ser
humano em constante interao com seu meio.
A importncia do conhecimento e da utilizao dos
aspectos socioculturais e psicossociais seria relevante
DSHQDV SDUD IDFLOLWDU D UHODomR PpGLFRSDFLHQWH RX
SURJUDPDVLQVWLWXFLRQDLVHPVD~GH
preciso levar em conta os fatores econmicos,
sociais e polticos implicados na prtica da promoo
GDVD~GH

QUESTO 31
+RMH WHPRV QD UHDOLGDGH GD VD~GH R SURVVLRQDO
GD SVLFRORJLD JDQKDQGR HVSDoR H FRPSRQGR DV
equipes. Considerando essa relao, assinale a
alternativa correta.
$ 
2SVLFyORJRQDHTXLSHGHVD~GHGHYHVHPSUHLQIRUPDU
aos outros componentes da equipe informaes sobre
RVSDFLHQWHVLQGHSHQGHQWHGRVLJLORSURVVLRQDO
% 
1D FRPXQLFDomR YHUEDO RX HVFULWD WHUPRV WpFQLFRV
e palavras difceis sempre acrescentam autoridade,
SURPRYHQGR PDLRU UHVSHLWR GRV RXWURV SURVVLRQDLV
pelo psiclogo.
&  $LQWHJUDomRGDHTXLSHGHVD~GHpLPSUHVFLQGtYHOSDUD
que o atendimento e o cuidado atinjam a amplitude do
FRQFHLWRGHVD~GH
(D)
Os psiclogos no devem interferir na relao entre
PpGLFRVHSDFLHQWH
(E)
O psiclogo busca comprometer-se com questes
ligadas apenas qualidade de vida dos usurios
eximindo-se das questes relacionadas aos
SURVVLRQDLVGDHTXLSHGHVD~GH

Cargo: Psiclogo - rea Hospitalar

QUESTO 32

(A)
(B)
(C)
(D)
(E)

(A)

0DULDpXPDPXOKHUGHPHLDLGDGHTXHGHVFREULX
QDKRVSLWDOL]DomRTXHWHP'LDEHWHVWLSR'XUDQWH
VXD HVWDGLD QR KRVSLWDO WHYH VXSRUWH GD HTXLSH
GH SVLFRORJLD H DJRUD HVWi GH DOWD KRVSLWDODU H
FRQWLQXDUiRWUDWDPHQWRHDFRPSDQKDPHQWRFRP
HQGRFULQRORJLVWD IRUD GR KRVSLWDO 6HQGR DVVLP
DVVLQDOH D DOWHUQDWLYD TXH FRUUHVSRQGH j PHOKRU
FRQGXWDDVHUDGRWDGDSHORSVLFyORJRKRVSLWDODU
Avaliao Psicolgica.
Orientao Psicolgica.
Orientao para alta.
Suporte Psicolgico.
Observao Psicolgica.

(B)
& 
(D)
(E)

Restringir ao extremo o contato fsico da famlia junto


ao paciente.
Oferecer recursos audiovisuais aos pacientes.
'HVPLVWLFDURLVRODPHQWR
Orientar a esclarecer famlia e pacientes sobre a
paramentao necessria.
Ampliar o campo de viso do paciente para que no se
sinta sozinho ou abandonado.

QUESTO 36
A Psicoterapia Breve (PB) uma tcnica muito
utilizada na sade por suas adequaes de tempo
e foco. Como toda tcnica, ela tambm tem suas
OLPLWDo}HVVHQGRQHFHVViULRHQWUHYLVWDVLQLFLDLV
TXH DTXL FKDPDUHPRV GH 4XDWUR 7DUHIDV
Assinale a alternativa que NO corresponde a uma
das Quatro Tarefas em PB.
(A)
Analisar o contexto social da queixa.
% 
)RUPXODUXPDLQWHUYHQomRLQLFLDOEDVHDGDQDDQJ~VWLD
que motivou a procura por ajuda.
(C)
Reconhecer se h ou no crise.
(D)
Distinguir o foco.
(E)
Decidir a indicao.

QUESTO 33
A Avaliao em Sade um processo que
determina a extenso com a qual as metas e os
REMHWLYRVGHXPSURJUDPDHVWmRVHQGRDWLQJLGRV
provendo informaes para a tomada de
decises. Considerando esse princpio, assinale a
INCORRETA.
(A)
A avaliao ajuda na tomada de decises a indagao,
comparao e obteno de informaes.
(B)
Algumas perguntas orientadas como A ateno
FXPSUHVXDIXQomR"4XHIDWRUHVHVWmRGLFXOWDQGR
o processo? contribuem para a avaliao da
assistncia.
&  $HFLrQFLDDYDOLDDHVWUXWXUD
'  $HFiFLDDYDOLDRSURFHVVR
(E)
Os indicadores no so considerados na avaliao em
VD~GH

QUESTO 37
O setting WHUDSrXWLFR QR DPELHQWH KRVSLWDODU p
uma das particularidades da Psicologia Hospitalar.
Considerando-o mesmo, assinale a alternativa
correta.
$ 
1R KRVSLWDO Vy p SRVVtYHO UHDOL]DU LQWHUYHQo}HV
em locais com privacidade, falta de barulho, sem
interrupes e com tempo longo.
% 
2 PHOKRU KRUiULR SDUD R DWHQGLPHQWR SVLFROyJLFR p
o perodo da manh em que as cirurgias, exames,
OLPSH]DGRVTXDUWRVHYLVLWDPpGLFDDFRQWHFHP
(C)
A tarde pode no ser um bom horrio para o
DWHQGLPHQWRSVLFROyJLFRSRLVJHUDOPHQWHpKRUiULRGH
YLVLWDHQmRFRQYpPRSVLFyORJRGLVSXWDUDDWHQomRGR
paciente com seus entes queridos.
(D)
O atendimento psicolgico no hospital segue sempre
uma frequncia e uma durao regular.
(E)
O que determina a concluso do processo de
DWHQGLPHQWRSVLFROyJLFRQDSVLFRWHUDSLDKRVSLWDODUpD
condio clnica do paciente, a cura da doena.

QUESTO 34
2WUDEDOKRHPJUXSRpPXLWRXWLOL]DGRQDiUHDGD
sade, tambm na atuao do psiclogo. Sobre
Grupos Operativos, assinale a alternativa correta.
$ 
2V*UXSRV2SHUDWLYRVVmREDVHDGRVDSHQDVQDWHRULD
da Psicanlise.
% 
$WDUHIDJUXSDOpXPGRVSULQFtSLRVRUJDQL]DGRUHVGRV
*UXSRV2SHUDWLYRV
(C)
A resistncia nos grupos, especialmente nos primeiros
HQFRQWURVpSRXFRFRPXP
(D)
Ansiedade paranoide, receio em relao ao
desconhecido, vulnerabilidade e insegurana so
caractersticas do Medo de Perda.
( 
2FRRUGHQDGRUpDTXHOHTXHUHVSRQGHDVTXHVW}HVGR
grupo.

QUESTO 38
$ $QiOLVH ,QVWLWXFLRQDO p XPD DERUGDJHP TXH
busca a transformao das instituies a partir
GDVSUiWLFDVHGLVFXUVRVGRVVHXVVXMHLWRVSRGH
VH GL]HU TXH Ki JUDQGH SRWHQFLDOLGDGH SDUD R
crescimento da utilizao do seu instrumental na
sade coletiva. Sendo assim, assinale a alternativa
INCORRETA.
$ 
$ $QiOLVH ,QVWLWXFLRQDO GD VD~GH FROHWLYD SRGH
ser considerada nas dimenses da pesquisa, da
LQWHUYHQomRHGDIRUPDomRGRVSURVVLRQDLV
% 
8P GRV VLQ{QLPRV SDUD D $QiOLVH ,QVWLWXFLRQDO p D
Sociopsicanlise.
&  +iGHVHDSUHFLDUDDQiOLVHGDSUySULDVD~GHFROHWLYD
como uma instituio complexa, contraditria, sendo
HODPHVPDDWUDYHVVDGDSRULQ~PHUDVLQVWLWXLo}HV

QUESTO 35
1DV XQLGDGHV GH LQWHUQDomR KRVSLWDODU PXLWDV
vezes, encontramos pacientes em isolamento,
geralmente por infeces que podem ser
transmissveis. Acrescido s sensaes de
perda de autonomia, despessoalizao que o
SUySULR DPELHQWH KRVSLWDODU SURSRUFLRQD TXDQGR
isolado, o paciente pode apresentar sensao de
abandono e fantasias em relao ao seu estado
clnico. Considerando essa condio, assinale a
alternativa que NO corresponde possibilidade
GHDWXDomRGRSVLFyORJRKRVSLWDODU

Cargo: Psiclogo - rea Hospitalar

(D)

( 

A expresso anlise institucional no tem um sentido


~QLFRSRLVQDUHDOLGDGHHODVHFRQVWLWXLXDSDUWLUGHXP
conjunto de disciplinas e movimentos que ocorreram a
partir dos anos 40 e 50.
(PUHODomRjDQiOLVHGRSURFHVVRVD~GH[GRHQoDD
VD~GHFROHWLYDWHPWLGRFRPRGHVDRDQHFHVVLGDGHGH
incorporar novas abordagens terico-metodolgicas.

(D)

(E)

QUESTO 39
As intervenes psicossociais so muito
LPSRUWDQWHV QR WUDWDPHQWR GH GHSHQGrQFLD
TXtPLFD TXDQGR LQWHJUDGDV DR SODQR WHUDSrXWLFR
Considerando essas informaes, assinale a
alternativa correta.
$ 
$DERUGDJHPSVLFRVVRFLDOpHFD]LVRODGDPHQWH
% 
1R FDPSR GD GHSHQGrQFLD TXtPLFD Vy p SRVVtYHO
trabalhar abordagens em grupos.
(C)
Atividades vocacionais e ocupacionais nunca so
utilizadas.
(D)
As intervenes psicossociais no precisam ser
UHDOL]DGDVSRUXPSURVVLRQDOGHUHIHUrQFLD
( 
2 WUHLQDPHQWR GH KDELOLGDGHV VRFLDLV p XPD
interveno psicossocial possvel no caso de
dependncia qumica.

QUESTO 42

(A)

% 
& 

QUESTO 40

(A)

(B)
(C)
(D)

(E)

Assinale a alternativa INCORRETA. Sobre o Artigo


 GR &yGLJR GH eWLFD 3URVVLRQDO GR 3VLFyORJR
ao psiclogo, vetado,
fornecer, a quem de direito, na prestao de servios
psicolgicos, informaes concernentes ao trabalho a
VHUUHDOL]DGRHDRVHXREMHWLYRSURVVLRQDO
receber, pagar remunerao ou porcentagem por
encaminhamento de servios.
prolongar, desnecessariamente, a prestao de
VHUYLoRVSURVVLRQDLV
desviar para servio particular ou de outra instituio,
visando o benefcio prprio, pessoas ou organizaes
atendidas por instituio com a qual mantenha
TXDOTXHUWLSRGHYtQFXORSURVVLRQDO
estabelecer com a pessoa atendida, familiar ou
terceiro, que tenha vnculo com o atendido, relao
que possa interferir negativamente nos objetivos do
servio prestado.

(D)

( 

(B)

(C)

Quando a doena avana, consumindo a vida, e


DOFDQoD XP HVWiJLR HP TXH D FXUD Mi QmR p PDLV
SRVVtYHO H D PRUWH DVVRPD LQH[RUiYHO KRUL]RQWH
RXWUD PHGLFLQD YHP HP DX[tOLR GR SDFLHQWH D
medicina paliativa (Simonetti, 2007). Sobre
D DVVLVWrQFLD DR SDFLHQWH WHUPLQDO DVVLQDOH D
INCORRETA.
A melhor regra para determinar se uma criana
GHYHRXQmRYLVLWDUXPSDUHQWHHPHVWDGRWHUPLQDOp
perguntar-lhe se ela quer fazer a visita ou no.
4XDQGRQmRKiPDLVQDGDDID]HUSHODFXUDWDPEpP
no h mais o que fazer pelo paciente.
0XLWDV YH]HV R SVLFyORJR p FKDPDGR QRV FDVRV GH
SDFLHQWHV WHUPLQDLV D OLGDU FRP DV DQJ~VWLDV GRV
SURVVLRQDLV TXH HVWmR QRV FXLGDGR GLUHWR FRP RV
pacientes.
Algumas diretrizes que podem ser apontadas para
considerar uma morte digna so: estar relativamente
livre da dor, ter as funes corporais funcionando o
melhor possvel dentro dos limites, reconhecer e
UHVROYHU FRQLWRV LQWHUSHVVRDLV SDVVtYHLV GH VHUHP
manejados.
2WHUPRSDFLHQWHWHUPLQDOQmRpVLQ{QLPRGHSDFLHQWH
agonizante.

QUESTO 43

QUESTO 41

(A)

ampliado nos casos previstos em lei.


Os documentos escritos decorrentes de avaliao
psicolgica, bem como todo o material que os
fundamentou, devero ser guardados pelo prazo
mnimo de 5 anos e esse prazo poder ser ampliado
nos casos previstos em lei.
Em caso de extino do servio, os documentos
devero ser incinerados.

2SVLFyORJRQRVHXH[HUFtFLRSURVVLRQDOWHPVLGR
solicitado a apresentar informaes documentais
FRPREMHWLYRVGLYHUVRV3DUDDHODERUDomRGHVVHV
GRFXPHQWRV R &RQVHOKR )HGHUDO GH 3VLFRORJLD
apresentou uma resoluo em 2003, CFP 007/2003.
Sendo assim, sobre a guarda dos documentos e a
condio de guarda, assinale a alternativa correta.
Somente os documentos escritos decorrentes de
avaliao psicolgica devero ser guardados pelo
prazo de 5 anos.
Todo documento relacionado ao paciente dever
VHU HQWUHJXH D HOH QmR FDQGR FRP R SVLFyORJR D
responsabilidade da guarda.
Somente o laudo psicolgico dever ser guardado
pelo prazo mnimo de 5 anos, esse prazo poder ser

$ 
(B)
& 
(D)

(E)

A UTI (Unidade de Tratamento Intensivo) um setor


PXLWR GHOLFDGR GR KRVSLWDO SHOD VXD LQWHQVLGDGH
nos cuidados, por seus pacientes graves e
pela fantasia de morte que evoca. Alm disso,
JHUDOPHQWHpXPDiUHDUHVWULWDDSURVVLRQDLVTXH
no fazem parte da equipe da UTI e, muitas vezes,
restritas tambm aos familiares dos pacientes. Uma
das indicaes para internao em UTI o pscirrgico imediato de procedimentos complexos e
GH ULVFR 6REUH D DWXDomR MXQWR DR SDFLHQWH SyV
cirrgico em UTI, assinale a alternativa correta.
$ LQYHVWLJDomR H SUHVHQoD GH GRU QR SyVFLU~UJLFR p
LUUHOHYDQWHSRLVRSyVFLU~UJLFRUHDOPHQWHGyL
Faz-se importante esclarecer questes acerca de sua
chegada na UTI e orient-lo quanto s rotinas do setor.
1mRpQHFHVViULRH[SOLFDUVREUHDFRQWHQomRQROHLWR
pois o mesmo ainda estar confuso e agitado.
Ajuda na reduo do estresse do paciente orient-lo
diante da impossibilidade de realizao de qualquer
necessidade sua, pois, na UTI, s se realiza o que a
equipe julga necessrio.
O paciente no precisa ser orientado quanto sua
evoluo clnica e recuperao, ele mesmo tem
conhecimento de seu corpo e observa isso.

Cargo: Psiclogo - rea Hospitalar

QUESTO 44
Uma doena nunca a mesma para diferentes
pessoas; ela no nica em suas manifestaes
e igualmente provoca reaes singulares em cada
paciente, que tambm diferente e nico (Camon,
2003). Buscando compreender essas diferentes
formas de lidar com a doena, procura-se discutir
RVSURFHVVRVGHUHVLOLrQFLD6REUHHVVHFRQFHLWR
assinale a alternativa INCORRETA.
$ 
$ SHUVSHFWLYD GD 5HVLOLrQFLD p GHIHQGLGD SHOD
Psicologia Positiva e busca uma compreenso do
indivduo a partir de seus potenciais, motivaes e
capacidades, rompendo com a tendncia de perceber
o ser humano dentro da abordagem reducionista da
psicopatologia.
% 
2 VLJQLFDGR GD UHVLOLrQFLD HVWi UHODFLRQDGR
com processos psicossociais, que favorecem o
desenvolvimento sadio do indivduo, mesmo quando
este se encontra frente a adversidades e problemas.
&  3DUD0RUDLVH.ROOHU  DUHVLOLrQFLDpHQWHQGLGD
FRPR XPD UHDUPDomR GD FDSDFLGDGH KXPDQD HP
VXSHUDUDGYHUVLGDGHVPDVLVWRQmRVLJQLFDGL]HUTXH
o indivduo saia da crise ileso.
'  2WHPDGDUHVLOLrQFLDGHQWURGDSVLFRORJLDpDQWLJRH
sua relevncia frente ao estudo do desenvolvimento
KXPDQRpSHTXHQD
( 
0XLWRVDXWRUHVFLWDPRWHUPRH[LELOLGDGHLQWHUQDSDUD
PDQHMDU GLFXOGDGHV H FRQVHJXLU UHVLJQLFDU VXD
YLGD WUDoDQGR VHX FDPLQKR DWUDYpV GH VDtGDV QmR
depressiva.

(A)
(B)
(C)
(D)
(E)

Campo / Preveno / Hospital


Objeto / Tratamento / Doente
Campo / Preveno / Ambiente Hospitalar
Conceito / Compreenso / Paciente
Campo / Tratamento / Adoecimento

QUESTO 47
A famlia, estrutura constituda como um todo
organizado, sofre mudanas importantes e impacto
HPRFLRQDO UHOHYDQWH GXUDQWH D KRVSLWDOL]DomR GH
um de seus membros. No contato com essa nova
VLWXDomR D IDPtOLD SRGH VH GHIURQWDU FRP YiULDV
GLFXOGDGHV $VVLQDOH D DOWHUQDWLYD TXH 12
FRUUHVSRQGHDXPDGHVVDVGLFXOGDGHV
(A)
Falta de informaes adequadas sobre o estado de
VHXHQWHTXHULGRQHPVHPSUHDHTXLSHGHVD~GHVDEH
o que informar famlia sobre o estado do paciente,
ou mesmo tem disponibilidade interna e/ou externa
para tal.
(B)
No ritmo de vida incompatvel com horrios
KRVSLWDODUHVDIDPtOLDVHYrIUHQWHDGHVDRVQDKRUD
de eleger o(s) membro(s) que acompanhar(o) o
paciente em sua estada no hospital.
(C)
Papel do paciente na dinmica familiar: em alguns
casos, o paciente desempenha fundamental papel de
DSRLR QDQFHLUR HRX HPRFLRQDO GD IDPtOLD FDQGR
esta sem com ele poder contar.
'  &RQWDWR IiFLO FRP R PpGLFR UHVSRQViYHO SHOR FDVR H
JUDQGHDSRLRGHVWHSURVVLRQDOQRHQIUHQWDPHQWRGH
situaes crticas.
(E)
Responsabilidade frente a decises difceis: no raro,
a famlia se v frente a exigncias de tomadas de
decises angustiantes (amputaes, medicamentos,
procedimentos invasivos, internao em CTI, etc),
enfrentando situaes com intenso nvel de ansiedade
HG~YLGDV

QUESTO 45
Assinale a alternativa INCORRETA sobre os
aspectos psicolgicos e a ateno aos pacientes
pr-cirrgicos.
$ 
2 DPELHQWH KRVSLWDODU p SUySULR j LPDJLQDomR H
IDQWDVLDV 'LDQWH GH XPD VLWXDomR FLU~UJLFD DV
IDQWDVLDVSRGHPDXPHQWDUHVHUHPIRQWHVGHDQJ~VWLD
e medos, que nada ajudaro na recuperao.
(B)
Uma das necessidades mais importantes na ateno
DRSDFLHQWHSUpFLU~UJLFRpDFODUH]D
&  2 SDFLHQWH FLU~UJLFR WHQGH D PXGDU VXDV UHDo}HV
IUHQWHjFLUXUJLDUHQDPVHXDXWRFRQWUROHHQHJDPR
SHULJRRTXHVLJQLFDTXHMiQmRVHQWHPPDLVPHGR
ou sofrimento frente ao procedimento.
(D)
O paciente acreditar que as pessoas que esto
proporcionando a assistncia fazem o melhor
corrobora para que ele acredite que ir se sair bem da
H[SHULrQFLD FLU~UJLFD e PXLWR LPSRUWDQWH TXH HOH VH
sinta seguro com a equipe.
(E)
Momentos que antecedem cirurgia podem ser de
agonia para o paciente, podendo lev-lo ao pnico,
R TXH SRGH UHVXOWDU HP VpULRV SUREOHPDV QR SyV
operatrio.

QUESTO 48
'XUDQWH D KRVSLWDOL]DomR R VXMHLWR YLYH DV
adaptaes ao adoecimento e ao ambiente
KRVSLWDODU VHQGR LVVR WXGR VHQWLGR FRP FHUWDV
peculiaridades em cada fase da vida. Considerando
DDGROHVFrQFLDTXHSRUVLMiWHPVXDVDOWHUDo}HV
PXGDQoDV H FRQLWRV DVVLQDOH D DOWHUQDWLYD TXH
FRUUHVSRQGH j SDUWLFXODULGDGH GD YLYrQFLD GR
DGROHVFHQWHQRKRVSLWDO
(A)
s vezes, o adolescente, mesmo sentindo dor e
sofrendo, nega esses sintomas.
(B)
O adolescente refugia em si diante de uma doena
podendo ter humor deprimido.
&  $ UHGH GH DSRLR VRFLDO H IDPLOLDU p PXLWR LPSRUWDQWH
para o adolescente hospitalizado.
'  $GRUItVLFDSRGHVHUQHJDGDHPYLUWXGHGDGLFXOGDGH
em elaborao do luto pelo corpo infantil.
(E)
Mgoas, remorsos e culpa podem levar ao
adoecimento.

QUESTO 46
3UHHQFKDV DV ODFXQDV H DVVLQDOH D DOWHUQDWLYD
TXH PHOKRU FRPSOHWD D GHQLomR GH 3VLFRORJLD
Hospitalar dada por Simonetti (2007).
3VLFRORJLD KRVSLWDODU p R BBBBBBBB GH
HQWHQGLPHQWR H BBBBBBBBBB GRV DVSHFWRV
SVLFROyJLFRVHPWRUQRGRBBBBBBBB

QUESTO 49
A reao depressiva pode alterar o curso clnico
GH XPD GRHQoD H WRUQDUVH XP IRUWH HPSHFLOKR
para bons resultados no processo de reabilitao,

10

Cargo: Psiclogo - rea Hospitalar

$ 
% 

& 
(D)
(E)

WRUQDQGRR PRURVR RX GLItFLO 3RU RXWUR ODGR Ki


aspectos positivos da depresso (Bellkiss,1994).
Assinale a alternativa que NO corresponde aos
aspectos positivos da reao depressiva.
$UHDomRGHSUHVVLYDFRQGX]DSHVVRDDUHHWLUVREUH
sua vida de maneira mais real.
8PD IDVH GHSUHVVLYD p VDXGiYHO H QHFHVViULD FRPR
meio para instrumentalizar o indivduo a torn-lo
renovado e fortalecido.
'LFXOGDGHVHPWRPDUGHFLV}HVMXVWDPHQWHSRUTXHR
sujeito rev sua escala de valores.
Culpa pela ausncia de pequenas atitudes.
Diminuio no apetite e na volio.

QUESTO 50

(A)
(B)
(C)
(D)
(E)

$ HYROXomR HP SURQWXiULR LQWHUGLVFLSOLQDU GH


SURFHGLPHQWRVHVSHFtFRVGDSVLFRORJLDDOpPGH
promover a comunicao na instituio, tambm
registra o estado emocional do paciente para que
o mesmo possa ser percebido e avaliado em sua
totalidade. Para tanto, em busca de uma boa
evoluo algumas atitudes devem ser evitadas.
Assinale a alternativa INCORRETA sobre o que
evitar.
Falta de clareza ou linguagem inadequada para
compreenso da equipe composta por vrias reas.
Informaes desnecessrias ou irrelevantes para a
conduta da equipe.
Escrever com objetividade.
Quebra de sigilo.
Ausncia de sntese.

11

Cargo: Psiclogo - rea Hospitalar

PROVA: EBSERH - UFC


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: AOCP

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

E
A
D
X
B
C
B
E
B
A
A
X
B

39
40
41
42
43
44
45
46
47
48
49
50

E
A
D
B
B
D
C
E
D
C
E
C

Coletnea de Provas | Concursos de Psicologia

HU-UFGD - HOSPITAL UNIVERSITRIO DA UNIVERSIDADE FEDERAL


DE GRANDE DOURADOS / MATO GROSSO DO SUL
CONCURSO PBLICO 8/2013 - EBSERH/HU-UFGD
EDITAL N 3 - EBSERH - REA ASSISTENCIAL

Concurso Pblico
REF. EDITAL N 3/2013

NVEL SUPERIOR - MANH

Cargo

PSICLOGO REA HOSPITALAR


ATENO
O Caderno de questes possui 50
(cinquenta)
questes
objetivas,
numeradas sequencialmente, de acordo
com o exposto no quadro a seguir:

MATRIA

QUESTES

Lngua Portuguesa

01 a 10

Raciocnio Lgico e Matemtico

11 a 15

Legislao Aplicada EBSERH

16 a 20

Legislao Aplicada ao SUS

21 a 25

&RQKHFLPHQWRV(VSHFtFRV

26 a 50

INSTRUES
 1D VXD )ROKD GH 5HVSRVWDV FRQUD VHX QRPH R Q~PHUR GR VHX
GRFXPHQWRHRQ~PHURGHVXDLQVFULomR$OpPGLVVRQmRVHHVTXHoD
de conferir seu Caderno de Questes quanto a falhas de impresso e
de numerao, e se o cargo corresponde quele para o qual voc se
LQVFUHYHX4XDOTXHUGLYHUJrQFLDFRPXQLTXHDRVFDO
 2 ~QLFR GRFXPHQWR YiOLGR SDUD DYDOLDomR GD SURYD p D )ROKD GH
5HVSRVWDV6ypSHUPLWLGRRXVRGHFDQHWDHVIHURJUiFDtransparente
de cor azul ou preta para o preenchimento da Folha de Respostas, que
deve ser realizado da seguinte maneira:
 2 SUD]R GH UHDOL]DomR GD SURYD p GH  TXDWUR  KRUDV LQFOXLQGR D
marcao da Folha de Respostas. Aps 60 (minutos) do incio da
prova, o candidato estar liberado para utilizar o sanitrio ou deixar
GHQLWLYDPHQWHRORFDOGHDSOLFDomR$UHWLUDGDGDVDODGHSURYDGRV
WUrV ~OWLPRVFDQGLGDWRVVyRFRUUHUiFRQMXQWDPHQWH
 $RWpUPLQRGHVXDSURYDFRPXQLTXHDRVFDOGHYROYHQGROKHD)ROKD
de Respostas devidamente preenchida e assinada. O candidato poder
levar consigo o Caderno de Questes, desde que aguarde em sala o
WpUPLQRGDDSOLFDomR
5. As provas e os gabaritos preliminares estaro disponveis no site do
Instituto AOCP - www.institutoaocp.org.br - no dia posterior aplicao
da prova.
6. Implicar na eliminao do candidato, caso, durante a realizao
das provas, qualquer equipamento eletrnico venha emitir ruidos,
mesmo que devidamente acondicionado no envelope de guarda de
pertences. O NO cumprimento a qualquer uma das determinaes
constantes em Edital, no presente Caderno ou na Folha de Respostas,
incorrer na eliminao do candidato.

Informaes Adicionais
0(xx)44 3344-4242 / www.institutoaocp.org.br / candidato@institutoaocp.org.br

CONHECIMENTOS ESPECFICOS

QUESTO 26

(A)
(B)
(C)
(D)
( 

7pFQLFD SVLFRWHUiSLFD XWLOL]DGD SULQFLSDOPHQWH


QD iUHD GD VD~GH SRU FRQWHPSODU XP setting
HVSHFtFR XWLOL]DQGRVH SULQFLSDOPHQWH GH IRFR
nmero limitado de atendimentos, planejamento
GRWUDWDPHQWRHVHVV}HVFRPLQLFLRPHLRHP
$GHQLomRDSUHVHQWDGDUHIHUHVHj
Psicoterapia Breve.
Anlise Social.
Apoio Psicolgico.
Ludoterapia.
3VLFRWHUDSLDGD6D~GH

QUESTO 27

(A)

(B)

(C)

(D)

(E)

$ HYROXomR QR SURQWXiULR p DOpP GR UHJLVWUR


GRFXPHQWDOSDUDRSDFLHQWHXPDIRUPDGRVYiULRV
SURVVLRQDLV GD HTXLSH VH FRPXQLFDU 3DUD WDQWR
p QHFHVViULR XPD FRPXQLFDomR HFD] VHQGR
FODUDREMHWLYDTXHQmRURPSDFRPRVLJLORHQmR
exponha o paciente, evitando termos tcnicos
pouco conhecidos alm de constar data, hora,
DVVLQDWXUD H Q~PHUR GR UHJLVWUR GR SURVVLRQDO
TXHDUHDOL]RX6HQGRDVVLPDVVLQDOHDDOWHUQDWLYD
TXHDSUHVHQWDRH[HPSORTXHFRUUHVSRQGHDHVVHV
critrios.
02/05/12, 8h. Paciente pouco receptivo ao
DWHQGLPHQWRSRXFRFRQWDFWXDQWHHFRPGLFXOGDGHGH
entendimento da doena, racionalizando e projetando
QD HTXLSH FDXVDQGR FRQLWRV 3VLFyORJR 7DO &53
00/00000).
02/05/12, 8h. Paciente pouco receptivo ao
DWHQGLPHQWR SRXFR FRQWDFWXDQWH H FRP GLFXOGDGH
de entendimento da doena, sua famlia no contou o
real motivo da internao e est com medo de contar.
$SUHVHQWD DQVLHGDGH H[DJHUDGD H GLFXOGDGHV QR
enfrentamento pois imagina que tem uma doena
diferente da que realmente tem. (Psiclogo Tal- CRP
00/00000).
02/05/12, 8h. Paciente receptivo ao atendimento,
contactuante e orientado sobre a doena. Apresenta
ansiedade esperada para a situao e enfrentamento
adequado. (Psiclogo Tal- CRP 00/00000).
02/05/12, 8h. Paciente receptivo ao atendimento,
contactuante e orientado sobre a doena. Apresenta
DQVLHGDGH HVSHUDGD SDUD D VLWXDomR H GLFXOGDGHV
QR HQIUHQWDPHQWR &RQLWRV IDPLOLDUHV H[LVWHQWHV
especialmente com o padrasto que no assume ser
SHGyOR 3VLFyORJR7DO&53 
02/05/12, 8h. Paciente no receptivo ao atendimento,
contactuante e desorientado sobre a doena. No
apresenta ansiedade esperada para a situao e
enfrentamento adequado. (Psiclogo Tal)

QUESTO 28
$DWXDomRGRSVLFyORJRQRKRVSLWDOHVWiVXMHLWDD
LQWHUFRUUrQFLDVPpGLFDVHTXDQGRHODVDFRQWHFHP
cabe ao psiclogo dar espao para o mdico e

Cargo: Psiclogo - rea Hospitalar

(A)
% 
& 
' 

(E)

VH UHWLUDU H[SOLFDQGR SDUD R SDFLHQWH TXH YROWDUi


depois, encerrando o atendimento. Assinale a
DOWHUQDWLYDTXHMXVWLFDDSURSRVLomRDFLPD
a partir de pequenas cordialidades que o paciente
se sente mais seguro com a equipe.
*HUDOPHQWH RV PpGLFRV QmR VH VHQWHP FRQIRUWiYHLV
FRPDOJXpPDQDOLVDQGRRVHXWUDEDOKR
2SDFLHQWHVHVHQWHPDLVFRQIRUWiYHOFRPRPpGLFR
)D]VHQHFHVViULRGDUHVSDoRDRPpGLFRFRODERUDQGR
com os atendimentos para causar uma boa convivncia
na equipe.
O primeiro motivo pelo qual o paciente procurou o
KRVSLWDO p FOtQLFR VHQGR DVVLP R PpGLFR GHYH DWXDU
em primeira instncia.

QUESTO 31

O luto nem sempre realizado da maneira mais


VDXGiYHO TXDQGR VH SHUGH DOJXpP RX DOJXPD
FRLVDVLJQLFDWLYD$SHUGDGDVD~GHpYLYHQFLDGD
FRPR XPD H[SHULrQFLD GRORURVD H TXH SDVVD
SHOD HODERUDomR  9iULRV DXWRUHV HP SVLFRORJLD
HVWXGDP H HVWXGDUDP FRPR VH Gi R OXWR QD
tentativa de estabelecer fases de elaborao.
Assim, correlacione as colunas dos exemplos e
GDVIDVHVHDVVLQDOHDDOWHUQDWLYDFRPDVHTXrQFLD
correta.
( )

QUESTO 29

(A)

(B)
(C)
(D)
(E)

A Avaliao Psicolgica um instrumento muito


ULFRGDQRVVDSURVVmR0XLWDVYH]HVQDLQVWLWXLomR
HODpVROLFLWDGDSRUGLIHUHQWHVSURVVLRQDLVVHQGR
muito importante o feedback. Assinale a alternativa
TXHMXVWLFDHVVDLPSRUWkQFLD
O feedback dado ao solicitante, aps a avaliao,
responde as perguntas do mesmo, pois se solicitou
tinha algum motivo, bem como contribui para planejar
e avaliar os procedimentos a serem executados de
acordo com os resultados apresentados.
O feedback pLPSRUWDQWHSRLVSURPRYHDFRPXQLFDomR
entre os membros da equipe.
O feedback VypLPSRUWDQWHSDUDRSDFLHQWHSRLVFDEH
a ele saber sobre si.
O feedback pode ser dado a qualquer membro da
equipe independente do solicitante.
O feedback p LPSRUWDQWH SRLV WUDQVPLWH j HTXLSH D
YLGDHRVFRQLWRVSUHVHQWHVQRDYDOLDGR

 

( )

( )

QUESTO 30

(A)

(B)

(C)

(D)

( 

$FRPXQLFDomRGHPiVQRWtFLDVpXPDWDUHIDGLItFLO
YLYHQFLDGDSHODHTXLSHHPJHUDO$OJXQVWUDEDOKRV
apontam diretrizes e orientaes para a realizao
GD PHVPD DX[LOLDQGR RV SURVVLRQDLV QHVVH
momento. Sobre o tema, assinale a alternativa
INCORRETA.
Faz-se importante um grupo de apoio equipe de
VD~GHTXHYLYHQFLDRSURJQyVWLFRUXLPVXDQRWtFLDH
sua evoluo.
A comunicao dessas notcias se torna mais
FRPSOLFDGDjPHGLGDTXHRVSURVVLRQDLVVHYLQFXODP
afetivamente com o paciente.
Apesar da equipe se envolver e fazer parte da
FRPXQLFDomRVmRRPpGLFRRSURVVLRQDOUHVSRQViYHO
para dar a notcia e prestar possveis esclarecimentos.
A comunicao de ms notcias deve ser ampla e
FODUDSRVVLELOLWDQGRRVWHUPRVWpFQLFRVSURWHJHQGRRV
SURVVLRQDLVGDVD~GH
$FRPXQLFDomRGHPiVQRWtFLDVWRUQDVHPDLVHFD]
medida que a equipe est preparada e consegue
LGHQWLFDUVHXVVHQWLPHQWRVHGLFXOGDGHVHPUHODomR
a cada caso que se apresenta.

( )

A.
B.
C.
D.
E.
(A)
(B)
(C)
(D)
(E)

M. acabou de receber o resultado de


VXD ELySVLD SDUD FkQFHU R UHVXOWDGR IRL
SRVLWLYRSRUpPWHPWRWDOFRQYLFomRGHTXH
RODERUDWyULRHVWiHQJDQDGR
- VRIUHX XP DFLGHQWH GH PRWR HP TXH
estava sozinho e acabou batendo em um
posto num segundo de bobeira e a nica
FRLVDTXHFRQVHJXHIDODUpVREUHFRPRVH
VHQWH LQMXVWLoDGR H TXH LVVR QmR SRGHULD
WHU DFRQWHFLGR FRP HOH Mi TXH QmR HVWDYD
alcoolizado.
P. acabou de sofrer seu segundo infarto e
QmR PXGD VHXV KiELWRV DOLPHQWDUHV H VHX
HVWLOR GH YLGD DJRUD TXH VH YLX GLDQWH GD
PRUWHPDLVXPDYH]SHGHRWHPSRWRGRTXH
Deus o deixe viver para pelo menos ver
seu netinho crescer.
Aps sofrer um Acidente Vascular Cerebral
$9&  $ HVWi HP REVHUYDomR QD 87,
do hospital, nunca tinha sido internada
anteriormente e acredita, falando o tempo
WRGRTXHQmRFRQVHJXLUiVREUHYLYHUHQHP
HQIUHQWDU R WUDWDPHQWR TXH p GHPRUDGR H
exige muito de sua disposio.
D. sofre um grave acidente automobilstico
H WHYH VXD SHUQD HVTXHUGD HVPDJDGD H
DJRUD WHUi GH SDVVDU SRU XPD DPSXWDomR
ainda choroso consegue falar sobre a
LPSRUWkQFLD GH UHDOL]DU R SURFHGLPHQWR
bem como planejar o uso de prteses e
QRYDVIRUPDVGHDGHTXDUVXDVDWLYLGDGHV
Revolta.
Negao.
Barganha.
Aceitao.
Depresso.

A B C D E.
B A C E D.
C D E A B.
B D C A E.
D C E A B.

Cargo: Psiclogo - rea Hospitalar

QUESTO 32

(A)
(B)
(C)
(D)
(E)

O foco do atendimento psicolgico na sade


p GH VXPD LPSRUWkQFLD H QRUWHLD R WUDEDOKR GR
psiclogo. Sendo assim, assinale, dentre as
DOWHUQDWLYDVRIRFRDGHTXDGRSDUDRFDVRGHVFULWR
a seguir.
0 p XPD PHQLQD GH  DQRV TXH ID] WUDWDPHQWR
SDUD FkQFHU (OD DSUHVHQWD PXLWD GLFXOGDGH HP
FDUORQJHGRVSDLVHVHPSUHLQWHUQDLQGHSHQGHQWH
GH WHU VHVV}HV GH TXLPLRWHUDSLD SURJUDPDGD
6HXV SDLV TXH DFRPSDQKDP H GHVGH D SULPHLUD
LQWHUQDomRGmRDHODXPEULQTXHGRFRPRIRUPDGH
compensar o sofrimento vivenciado.
Possibilidade de morte.
Ganhos secundrio da Internao.
Relao com a famlia.
Enfrentamento dos pais e perspectiva de cura.
Limitaes do tratamento.

( 

QUESTO 35

(A)
(B)
(C)
(D)
(E)

(B)

(C)

(D)

(E)

%UXQRpXPMRYHPGHDQRVTXHIRLLQWHUQDGRQR
KRVSLWDO DSyV DSUHVHQWDU TXDGURV GH SQHXPRQLD
UHFRUUHQWHV H IHULGDV SHOR FRUSR TXH QmR VH
FXUDYDP $SyV H[DPHV FRQVWDWRXVH TXH HOH
portador do vrus do HIV. Ele mora sozinho e
DVVLP TXH VHXV SDLV FDUDP VDEHQGR GH VXD
LQWHUQDomR IRUDP YLVLWiOR QR KRVSLWDO 'LDQWH GD
VLWXDomR H[SRVWD DVVLQDOH D DOWHUQDWLYD TXH 12
corresponde a uma possibilidade de atuao para
o psiclogo.
Acolher o paciente deixando-o livre para falar de suas
DQJ~VWLDVHPHGRVGLDQWHGRGHVFREHUWR
importante que o psiclogo se disponha a ouvir
R VRIULPHQWR GR SDFLHQWH OLYUH GH SUpFRQFHLWRV H
discriminaes.
Oferecer suporte psicolgico durante a internao
H RULHQWDo}HV VREUH GLFXOGDGH QR WUDWDPHQWR H
estigmas ainda existentes.
Caso Bruno queira falar com seus pais e se sinta
inseguro da forma como faz-lo, o psiclogo pode
oferecer suporte emocional participando como
coadjuvante desse momento de dar a notcia.
Conversar com os pais do paciente sobre o diagnstico,
investigando a possibilidade de ele ter transmitido a
DOJXpPDLQGDTXH%UXQRQmRTXHLUDIDODU

$ 
(B)
(C)
(D)
(E)

(B)
& 

' 

Com relao Entrevista Psicolgica, assinale a


alternativa correta.
6XD~QLFDQDOLGDGHpGHLQYHVWLJDomR
No se faz necessrio preparar a entrevista, pois ela
deve ocorrer de forma livre.
um instrumento que pode ser utilizado em vrios
contextos como hospital e escola.
A verdadeira Entrevista Psicolgica s pode ser do
tipo no estruturada.
A Entrevista Psicolgica s acontece na Psicanlise.

QUESTO 37
Sobre os Deveres Fundamentais do Psiclogo,
VHJXQGR R &yGLJR GH eWLFD 3URVVLRQDO $UW 
assinale a alternativa INCORRETA.
(A)
Assumir responsabilidade sobre atividades das quais
no esteja capacitado pessoalmente e tecnicamente.
(B)
Prestar servios psicolgicos em condies de
WUDEDOKRHFLHQWHV
(C)
Prestar servio em situaes de emergncia e
FDODPLGDGHS~EOLFDVHPYLVDUEHQHItFLRVSHVVRDLV
'  6XJHULU VHUYLoRV GH RXWURV SURVVLRQDLV TXDQGR SRU
algum motivo, no puder ser continuado por quem
assumiu inicialmente.
(E)
Participar de movimentos da categoria que visem
SURPRomRGDSURVVmR
QUESTO 38
A partir do caso apresentado a seguir assinale a
DOWHUQDWLYD TXH DSUHVHQWD R IRFR PDLV DGHTXDGR
para o atendimento psicolgico.
D. um homem de meia idade e sua paixo sempre
IRL PRWRV /RJR TXH FRPSURX XPD PDLRU IRL GDU
uma volta com sua esposa e num deslize acabou
derrapando na pista e a moto caiu sobre sua perna
esmagando-a. Sua esposa sofreu ferimentos
leves e ele foi encaminhado direto para o hospital.
Aps a primeira cirurgia, o mdico comenta com
o paciente a grande possibilidade de amputao.
(A)
Culpa pelo acidente.
(B)
Paixo por motos.
(C)
Possibilidade de amputao.

QUESTO 34

$ 

'RFXPHQWRTXHYLVDLQIRUPDURFRUUrQFLDGHIDWRV
ou situaes objetivas relacionada ao atendimento
psicolgico, segundo CFP (doc. 007/2003), diz
respeito
declarao.
ao relatrio.
ao laudo.
ao atestado.
ao parecer.

QUESTO 36

QUESTO 33

(A)

R TXH p HVWDU FRP VD~GH RX VHQWLUVH GRHQWH EHP


FRPRDVSUiWLFDVSURVVLRQDLVYHPVHGHVHQYROYHQGR
compreendendo o usurio como um agente, portador
de vontades e desejos.
$$QiOLVH,QVWLWXFLRQDOWDPEpPSRGHVHUGHQLGDFRPR
Socioanlise.

6REUH D $QiOLVH ,QVWLWXFLRQDO QD VD~GH FROHWLYD


assinale a alternativa correta.
$$QiOLVH ,QVWLWXFLRQDO QD 6D~GH p QRYD H DLQGD QmR
WHP LGHLDV PXLWR EHP GHQLGDV FDQGR D PHUFr GH
quem a aplica.
Anlise Institucional analisa como as instituies se
FRPSRUWDPVHKiHVSDoRItVLFRHSUpGLRDGHTXDGRV
1DVD~GHFROHWLYDKiPXLWDGLFXOGDGHGHHQFRQWUDU
uma abordagem que norteie as prticas e a Anlise
Institucional traz consigo a possibilidade de adentrar
as instituies como hospitais, unidade bsica de
VD~GHHFHQWURVGHUHIHUrQFLDV
%XVFDSUREOHPDWL]DURTXHpVD~GHRTXHpFROHWLYR

Cargo: Psiclogo - rea Hospitalar

(D)
(E)

Hospitalizao.
Causas do acidente

QUESTO 42

QUESTO 39

$ 
% 
(C)

' 

(E)

Atualmente percebemos o psiclogo inserido


MXQWRjHTXLSHGHVD~GHQRVKRVSLWDLVFRQWXGRD
HVSHFLDOLGDGHHTXLYDOHQWHD3VLFRORJLD+RVSLWDODU
ainda muito recente. Sobre a mesma, assinale a
alternativa INCORRETA.
$3VLFRORJLD+RVSLWDODUpXPDHVSHFLDOLGDGHH[LVWHQWH
apenas no Brasil.
$ DWXDomR GR 3VLFyORJR +RVSLWDODU p YROWDGD DSHQDV
SDUDDDWHQomRVHFXQGiULDHWHUFLiULDHPVD~GH
O Psiclogo Hospitalar realiza atividades como
avaliao diagnstica e psicodianstica, grupos
psicoteraputicos e atendimentos em ambulatrios.
$ 3VLFRORJLD +RVSLWDODU SRU YH]HV WDPEpP p
GHQRPLQDGD 3VLFRORJLD GD 6D~GH VHQGR VLQ{QLPRV
da mesma prtica.
A Psicologia Hospitalar se ocupa das relaes do
paciente/famlia/equipe com a doena e hospitalizao.

$ 

(B)

& 

' 

(E)

QUESTO 40
$V HTXLSHV GH DWHQomR SULPiULD j VD~GH $36  D
SRXFRWHPSRSDVVDUDPDFRQWDUFRPRSURVVLRQDO
da psicologia em sua composio. Sobre a
LQVHUomRGHVVHSURVVLRQDOQDHTXLSHDVVLQDOHD
alternativa correta.
(A)
A insero do psiclogo na APS j vem de longa data
e tem bases slidas.
% 
2 SVLFyORJR p XP SURVVLRQDO TXH DJUHJD j HTXLSH
SRLVWUDEDOKDDSHQDVFRPSURPRomRGHVD~GH
&  $SVLFRWHUDSLDFRPXQLWiULDpRUHIHUHQFLDOWHyULFRTXH
mais se aplica prtica na APS.
(D)
No cabe ao psiclogo realizar visitas domiciliares,
HVVDSDUWHFDFRPRDVVLVWHQWHVRFLDO
(E)
O psiclogo na APS contribui para a valorizao do
ser humano e sua integrao ao meio.

QUESTO 43

$ 

(B)

(C)

' 

QUESTO 41

(A)

% 
(C)

(D)

(E)

O diagnstico do paciente muito importante para


FDGD SURVVLRQDO HOH p XP LQGLFDGRU GD FRQGXWD
a ser seguida, das possibilidades de tratamento e
tambm colabora para prospectar o prognstico.
Sobre o mesmo, assinale a alternativa correta.
$ IDPtOLD p XP HOHPHQWR LPSRUWDQWH QR SURFHVVR
de diagnstico acrescentando dados histria do
paciente.
O diagnstico serve para estabelecer a patologia
apresentada, para tanto, os exames so os mais
importantes em todas as situaes.
2 SVLFRGLDJQyVWLFR p XPD HVSHFLDOLGDGH GHQWUR GR
GLDJQyVWLFR SRUpP HOH p LPSRUWDQWH VRPHQWH SDUD R
SURVVLRQDOGHSVLFRORJLD
6RPHQWH R PpGLFR p FDSDFLWDGR SDUD UHDOL]DU
R GLDJQyVWLFR R SUySULR $WR 0pGLFR SUHYr VXD
exclusividade.
O diagnstico multiaxial possibilita que o paciente se
apresente de vrias formas diferentes, considerando
sua relao com as pessoas de vrios mbitos em sua
vida.

(E)

A psicoterapia de grupo muito utilizada pelo


SVLFyORJR QD VD~GH 6REUH D SUiWLFD FRP JUXSRV
assinale a alternativa INCORRETA.
imprescindvel que o coordenador do grupo acredite
em seu trabalho pois os outros membros so capazes
de perceber a descrena.
$ SVLFRWHUDSLD GH JUXSR DWLQJH YiULRV FRQWH[WRV H p
contemplada por diferentes referenciais tericos.
Faz-se necessrio uma formao continuada para
TXH R WHUDSHXWD FRQVLJD OLGDU GH IRUPD WpFQLFD H
SURVVLRQDO FRP DVYiULDV VLWXDo}HV TXH VXUJLUmR QR
grupo.
As comparaes sociais que existem no grupo servem
apenas para promover desigualdade e sentimentos
nocivos entre os participantes.
O terapeuta busca facilitar a interao e a participao
dos membros, promovendo a exposio de seus
sentimentos e pensamentos.

$UHVSHLWRGDDWXDomRGR3VLFyORJRMXQWRjHTXLSH
de sade, assinale a alternativa INCORRETA.
3URJUDPDV GH $WHQomR j VD~GH GR WUDEDOKDGRU HP
VD~GH SRGHP VHU GHVHQYROYLGRV H FRRUGHQDGRV SRU
psiclogos, o Humaniza SUS preconiza essa ao.
O psiclogo pode ser um facilitador na relao
da equipe com o paciente oferecendo um olhar
diferenciado sobre as situaes vividas, possibilitando
a compreenso das mesmas.
O psiclogo pode trabalhar de forma conjunta
equipe, sendo capaz de participar da elaborao de
SROtWLFDVGHVD~GH
(ODERUDomRHFRRUGHQDomRGHWUHLQDPHQWRVHPVD~GH
mental e programas educativos no so ofcios do
SVLFyORJRGDVD~GH
importante que o psiclogo possa acolher a equipe
HPPRPHQWRVGLItFHLVEXVFDQGRLGHQWLFDUDUHODomR
GDV GLFXOGDGHV FRP D H[HFXomR GR WUDEDOKR H R
resultado para os pacientes.

Cargo: Psiclogo - rea Hospitalar

QUESTO 44

(A)

(B)

(C)

(D)

(E)

QUESTO 46

Diante da situao problema relatada a seguir,


assinale a possibilidade de interveno psicolgica
HVXDMXVWLFDWLYDDGHTXDGD
) p XPD PHQLQD GH  DQRV TXH WHP Sndrome
de Down. Segundo sua famlia, a menina sempre
WHYHXPDVD~GHGHIHUURHQXQFDFRXLQWHUQDGD
+i XPD VHPDQD FRPHoRX D DSUHVHQWDU GRU GH
JDUJDQWD H GLFXOGDGH SDUD FRPHU &RPR QmR
melhorava, a famlia levou-a para ser consultada
no pronto socorro e logo aps o atendimento ela
foi internada. Durante a hospitalizao, muitos
H[DPHVIRUDPUHDOL]DGRVHFRQVWDWRXVHTXH)WHP
leucemia. Aps o mdico conversar com a famlia
VREUHRGLDJQyVWLFRDHTXLSHVROLFLWDR6HUYLoRGH
Psicologia.
Acolhimento e Avaliao Psicolgica. Primeiro acolher
o momento de desestabilidade emocional da famlia
para poder avaliar a atitude da famlia diante da
situao, recursos psquicos para o enfrentamento,
principais mecanismos de defesa estabelecendo ao
PDFRQGXWDSVLFROyJLFDDVHUWRPDGD
Orientao Psicolgica. Como aps receber notcias
GLItFHLV DV SHVVRDV FRVWXPDP FDU HP HVWDGR GH
choque, a orientao seria importante para esclarecer
G~YLGDV
Acolhimento. Diante de uma notcia difcil cabe ao
psiclogo ser solidrio e acolher a famlia, mostrandose compadecido da situao.
Observao Psicolgica. Por ser um momento muito
GHOLFDGRQRSyVQRWtFLDpLPSRUWDQWHDSHQDVREVHUYDU
como a famlia reage.
Manejo Situacional. Entendendo o impacto do
GLDJQyVWLFRVHQWLGRSHODIDPtOLDpLPSRUWDQWHEXVFDU
XPPDQHMRGDVDQJ~VWLDVHDQVLHGDGHV

$ 

% 

& 

' 

( 

QUESTO 47

(A)

% 

& 

QUESTO 45

$ 

(B)

(C)
' 

(E)

$ 5HVLOLrQFLD p XP FRQFHLWR PXLWR LPSRUWDQWH


em psicologia e muito usado na sade. Sobre
R PHVPR DVVLQDOH D DOWHUQDWLYD TXH D GHQH
corretamente.
5HVLOLrQFLD p XP WHUPR GD TXtPLFD TXH LQGLFD XP
HVWDGR GD PDWpULD TXH DSyV VRIUHU XPD SUHVVmR
retorna a mesma condio original.
5HVLOLrQFLDpXPWHUPRGDTXtPLFDHPSUHVWDGRSHOD
SVLFRORJLDSDUDLQGLFDUDFDSDFLGDGHTXHXPDPDWpULD
possui, aps sofrer uma presso, voltar a seu estado
original.
5HVLOLrQFLDpXPWHUPRGDItVLFDTXHGL]UHVSHLWRDR
PRYLPHQWRGDVPDWpULDVHDFDSDFLGDGHGHSURPRYHU
alteraes ao longo do tempo.
5HVLOLrQFLD p XP WHUPR TXH D SVLFRORJLD HPSUHVWRX
das cincias naturais que indica a capacidade do
homem de se adaptar a novas realidades.
5HVLOLrQFLDpXPWHUPRGDItVLFDTXHLQGLFDDFDSDFLGDGH
GH XPD PDWpULD SRGHU YROWDU DR VHX HVWDGR RULJLQDO
aps sofrer uma presso, e a psicologia o emprestou
acrescentando um estado melhor que o anterior.

Alguns pacientes chegam a um estado da doena


HPTXHQmRpPDLVSRVVtYHODPHGLFLQDUHYHUWHUR
TXDGURFOtQLFR0XLWDVYH]HVDSRVWXUDDGRWDGDpD
GRV&XLGDGRV3DOLDWLYRVTXHEXVFDPSURSRUFLRQDU
conforto ao paciente terminal, poupando o mesmo
de dores e procedimentos invasivos. Sobre a
possibilidade de interveno nesse caso, assinale
a alternativa correta.
$ LQWHUYHQomR p LPSRVVtYHO SRLV JHUDOPHQWH HVVH
tipo de paciente j no fala por estar em coma ou por
resistncia.
Uma das possibilidades, mesmo quando o paciente
HQFRQWUDVH HP FRPD p UHDOL]DU RULHQWDo}HV
autopsquicas, alopsquica, temporal e espacial.
importante no estimular que conversem com o
paciente para que esse no se agite.
$ IDPtOLD p D ~QLFD SRVVLELOLGDGH SDUD LQWHUYLU
psicologicamente
podendo
oferecer
suporte
psicolgico aos membros.
No se indica falar com o paciente, ainda que sedado,
sobre o momento em que est vivendo e sobre a
morte.

' 

(E)

6REUH D TXHVWmR GRV 'HSHQGHQWHV 4XtPLFRV H D


possibilidade de atuao da psicologia, assinale a
alternativa correta.
O problema da dependncia qumica est associado
s questes sociais, sendo assim os maiores riscos
esto em comunidades de baixa renda.
$OpP GR WUDEDOKR GH UHFXSHUDomR p SRVVtYHO
desenvolver trabalho de preveno, visando orientar
sobre os tipos de drogas (lcitas e ilcitas), seus efeitos
sobre o corpo e os riscos que seu uso pode acarretar.
$ TXHVWmR UHOLJLRVD VHUYH SDUD OHYDU R VXMHLWR DWp
R SVLFyORJR H R PpGLFR WHP SRXFD LPSRUWkQFLD
na recuperao, os aspectos psquicos e os
medicamentos so insubstituveis.
$SyV LQLFLDU XP WUDWDPHQWR R ~QLFR UHVSRQViYHO
SRU VXD FRQGXWD p R GHSHQGHQWH VHQGR DVVLP QmR
podemos dizer que o meio (famlia, amigos, trabalho,
HWF SRGHLQXHQFLDUGHIRUPDQHJDWLYD
Poucos dependentes qumicos tm seu primeiro
FRQWDWR HP FDVD p VHPSUH QD UXD TXH FRQKHFHP
as drogas. Por isso a famlia e o ambiente familiar tem
pouca importncia na preveno.

QUESTO 48

$ 

(B)

(C)

10

$5HIRUPD3VLTXLiWULFDFRQWULEXLXSDUDXPDQRYD
forma de pensar a ateno Sade Mental. Com
UHIHUrQFLDDRWHPDDVVLQDOHDDOWHUQDWLYDFRUUHWD
$5HIRUPD3VLTXLiWULFDQR%UDVLOIRLLQXHQFLDGDSHOD
ocorrida na Frana e coordenada por Franco Basaglia.
Essa buscava abandonar prticas violentas e dar
direitos aos portadores de doenas mentais.
A Reforma Psiquitrica no Brasil ocorreu junto
Reforma Sanitria, muito tempo aps a criao do
686 6LVWHPDQLFRGH6D~GH 
Aps o fechamento dos hospitais psiquitricos, foram
criados os CAPS (Centro de Ateno Psicossociais) a
Cargo: Psiclogo - rea Hospitalar

(D)
(E)

PGHDEVRUYHUDSRSXODomRTXHFDYDLQWHUQDGDQRV
hospitais e poder dar continuidade aos tratamentos
clnicos.
A normatizao e a adaptao so os preceitos
EiVLFRVGDDWXDomRQRSVLFyORJRQD6D~GH0HQWDO
A Reforma Psiquitrica inaugura outra forma de pensar
a loucura e prope a desistitucionalizao da mesma,
buscando tratar o doente mental e oferecer condies
dignas para sua vida.

(D)

(E)

criana consegue organizar seus pensamentos e


vivncias simblicas elaborando-as no real.
Ao encarar a brincadeira enquanto uma produo da
FULDQoDpSRVVtYHOLGHQWLFDUHLQWHUSUHWDUSURMHo}HVH
dinmicas da personalidade.
O brincar no hospital colabora para minimizar
DQJ~VWLDV DQVLHGDGHV H PHGRV GDV FULDQoDV H VHXV
familiares.

QUESTO 49

(A)

(B)

& 

(D)

( 

As Unidades de Tratamento Intensivo (UTIs) por si


Vy Mi HYRFDP R WHPRU GD PRUWH FRQVLGHUDQGR D
87,QHRQDWDOpSRVVtYHOLGHQWLFDUDGXDOLGDGHYLGD
e morte. Considerando o caso descrito a seguir
assinale a alternativa correta.
= WHYH VHX SULPHLUR EHEr DSyV D EROVD URPSHU
TXDQGRDLQGDHVWDYDGHVHPDQDV$OpPGHVHU
XP EHEr SUHPDWXUR DSHQDV TXDQGR HOH QDVFHX
p TXH FRX VDEHQGR TXH HOH DSUHVHQWD XPD
VtQGURPH TXH FDXVD PiV IRUPDo}HV $SyV 
horas do nascimento Z, teve alta do hospital e seu
OKRSHUPDQHFHXQD87,QHRQDWDO3DVVDQGRWUrV
dias, a me ainda no tinha retornado ao hospital
SDUDYLVLWDUVHXOKRHREHErVySLRUDYD
A interveno do psiclogo nesse caso seria para
a me aceitar a morte do beb, considerando a
SUHPDWXULGDGHHDVPiVIRUPDo}HVFRQJXUDQGRXP
caso irreversvel.
O fato da me no voltar para visitar o beb pode
demonstrar o quanto ela no estava pronta para ser
me, encarar a maternidade e o amor incondicional.
1R FDVR DFLPD p SRVVtYHO SHQVDU QD GLFXOGDGH
e no medo da me de estabelecer um vnculo e o
EHEr PRUUHU$R PHVPR WHPSR p SRVVtYHO WUDEDOKDU
D GLFXOGDGH GD PmH HP DFHLWDU D GLIHUHQoD GR
beb real com o beb idealizado na gestao e a
importncia do cuidado maternal para a sobrevivncia
HRGHVHQYROYLPHQWRSVtTXLFRGRUHFpPQDVFLGR
Na UTI neonatal, a equipe tem um papel fundamental
e cabe enfermagem conscientizar a me de seu
SDSHOGHFXLGDGRUDHUHVSRQViYHOSRUVHXOKR
$WpKRMHQmRKiQHQKXPDSURYDGHTXHRSVLTXLVPR
do beb reage falta da me e de estmulos como no
FDVR GH UHFpPQDVFLGRV TXH FDP PXLWR WHPSR HP
UTI.

QUESTO 50

(A)

(B)
(C)

Consideramos o brincar uma das formas da


FULDQoD HODERUDU VXDV TXHVW}HV H FRQLWRV 1R
ambiente hospitalar, no diferente, o brincar
uma forma de enfrentar a hospitalizao e o
DGRHFLPHQWR 6REUH HVVD SUiWLFD DVVLQDOH D
INCORRETA.
O envolvimento dos pais nas brincadeiras durante a
LQWHUQDomRSRGHPLQXHQFLDUGHIRUPDQHJDWLYDSRLV
a criana pode se sentir inibida na expresso de seus
sentimentos.
Ao brincar no hospital, esse ambiente assume um
carter mais familiar e menos ameaador.
Na brincadeira e em especial no faz de conta, a

11

Cargo: Psiclogo - rea Hospitalar

PROVA: EBSERH - UFGD


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: AOCP

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

A
C
E
A
D
B
B
E
D
A
C
X
C

39
40
41
42
43
44
45
46
47
48
49
50

D
E
D
A
D
A
B
E
B
E
C
A

Coletnea de Provas | Concursos de Psicologia

HC - UFMG - HOSPITAL DAS CLNICAS DA UNIVERSIDADE FEDERAL DE MINAS GERAIS


CONCURSO PBLICO 5/2014 - EBSERH/HC-UFMG
EDITAL N 03 - EBSERH - REA ASSISTENCIAL

Concurso Pblico
REF. EDITAL N 03/2014

NVEL SUPERIOR - MANH

Cargo

PSICLOGO REA HOSPITALAR


ATENO
O Caderno de questes possui 50
(cinquenta)
questes
objetivas,
numeradas sequencialmente, de acordo
com o exposto no quadro a seguir:

MATRIA

QUESTES

Lngua Portuguesa

01 a 10

Raciocnio Lgico e Matemtico

11 a 15

Legislao Aplicada EBSERH

16 a 20

Legislao Aplicada ao SUS

21 a 25

&RQKHFLPHQWRV(VSHFtFRV

26 a 50

INSTRUES
 1D VXD )ROKD GH 5HVSRVWDV FRQUD VHX QRPH R Q~PHUR GR VHX
GRFXPHQWRHRQ~PHURGHVXDLQVFULomR$OpPGLVVRQmRVHHVTXHoD
de conferir seu Caderno de Questes quanto a falhas de impresso e
de numerao, e se o cargo corresponde quele para o qual voc se
LQVFUHYHX4XDOTXHUGLYHUJrQFLDFRPXQLTXHDRVFDO
 2 ~QLFR GRFXPHQWR YiOLGR SDUD DYDOLDomR GD SURYD p D )ROKD GH
5HVSRVWDV6ypSHUPLWLGRRXVRGHFDQHWDHVIHURJUiFDtransparente
de cor azul ou preta para o preenchimento da Folha de Respostas, que
deve ser realizado da seguinte maneira:
 2 SUD]R GH UHDOL]DomR GD SURYD p GH  TXDWUR  KRUDV LQFOXLQGR D
marcao da Folha de Respostas. Aps 60 (minutos) do incio da
prova, o candidato estar liberado para utilizar o sanitrio ou deixar
GHQLWLYDPHQWHRORFDOGHDSOLFDomR$UHWLUDGDGDVDODGHSURYDGRV
WUrV ~OWLPRVFDQGLGDWRVVyRFRUUHUiFRQMXQWDPHQWH
 $RWpUPLQRGHVXDSURYDFRPXQLTXHDRVFDOGHYROYHQGROKHD)ROKD
de Respostas devidamente preenchida e assinada. O candidato poder
levar consigo o Caderno de Questes, desde que aguarde em sala o
WpUPLQRGDDSOLFDomR
5. As provas e os gabaritos preliminares estaro disponveis no site do
Instituto AOCP - www.institutoaocp.org.br - no dia posterior aplicao
da prova.
6. Implicar na eliminao do candidato, caso, durante a realizao
das provas, qualquer equipamento eletrnico venha emitir ruidos,
mesmo que devidamente acondicionado no envelope de guarda de
pertences. O NO cumprimento a qualquer uma das determinaes
constantes em Edital, no presente Caderno ou na Folha de Respostas,
incorrer na eliminao do candidato.

Informaes Adicionais
0(xx)44 3344-4242 / www.institutoaocp.org.br / candidato@institutoaocp.org.br

QUESTO 28

$ 
% 

(C)

' 

( 

CONHECIMENTOS ESPECFICOS

QUESTO 29
O momento da internao faz com que o indivduo
e seus familiares passem por diversas perdas,
trazendo dor e sofrimento diante da iminncia da
PRUWH FRQJXUDQGR PXLWDV YH]HV R SURFHVVR GH
luto antecipatrio. Sobre este processo, assinale
a alternativa INCORRETA.
(A)
Esto envolvidos no processo de luto antecipatrio
apenas o paciente e sua famlia.
% 
2 OXWR DQWHFLSDWyULR p EDVWDQWH UHFRUUHQWH HP FDVRV
que o paciente passa muito tempo em internao de
alto risco.
(C)
O luto antecipatrio tem as mesmas caractersticas e
sintomatologia das primeiras fases de luto.
'  $ HODERUDomR GR OXWR DQWHFLSDWyULR p HVVHQFLDO WDQWR
para o paciente quanto para a famlia.
( 
2 OXWR DQWHFLSDWyULR p YLYLGR HQWUH R GLDJQyVWLFR H D
morte propriamente dita.

QUESTO 26

$ 

(B)

(C)

' 

(E)

M. uma criana de trs anos que chegou ao


KRVSLWDOFRPPXLWDGLFXOGDGHSDUDUHVSLUDU$SyV
exames, diagnosticaram uma m formao e a
indicao para a correo foi tratamento cirrgico.
Ao dar a notcia famlia, o mdico ouve dos pais
que eles no aceitam a cirurgia, pois se Deus a fez
assim, ele ter que a curar.. Considerando o caso,
assinale a alternativa que corresponde possvel
atuao do psiclogo.
$ Ip GHYH VHU WUDWDGD FRPR FUHQoD PHQRU VHP VHU
levada em considerao.
$PHOKRUHVWUDWpJLDpRXYLUDIDPtOLDFULDQGRFRQGLo}HV
para que surja o certo do paciente e no apenas o
errado da situao.
Cabe ao psiclogo evidenciar a importncia da cirurgia
para a criana, fazendo os pais mudarem de ideia
quanto a conduta.
1mR Ki R TXH ID]HU TXDQGR D IDPtOLD QmR FRQD QD
equipe, por isso seria em vo e perda de tempo investir
nesse caso.
$ FRQGXWD PDLV HFLHQWH VHULD FKDPDU R UHOLJLRVR GD
igreja a que a famlia pertence para conversar com o
PpGLFR

Para um efetivo tratamento em Psicoterapia Breve,


alguns autores apontam Quatro Tarefas para se
realizar na avaliao inicial do paciente. Assinale
a alternativa que contempla as tarefas na ordem
correta de realizao.
)RUPXODU LQWHUYHQomR LQLFLDO EDVHDGD QD DQJ~VWLD
principal do paciente; Distinguir o foco; Reconhecer se
h crise; Decidir a indicao.
Reconhecer se h crise; Formular interveno inicial
EDVHDGDQDDQJ~VWLDSULQFLSDOGRSDFLHQWH'LVWLQJXLU
o foco; Decidir a indicao.
Decidir a indicao; Formular interveno inicial
EDVHDGDQDDQJ~VWLDSULQFLSDOGRSDFLHQWH'LVWLQJXLU
o foco; Reconhecer se h crise.
)RUPXODU LQWHUYHQomR LQLFLDO EDVHDGD QD DQJ~VWLD
principal do paciente; Reconhecer se h crise;
Distinguir o foco; Decidir a indicao.
Distinguir o foco; Formular interveno inicial baseada
QDDQJ~VWLDSULQFLSDOGRSDFLHQWH'HFLGLUDLQGLFDomR
Reconhecer se h crise.

QUESTO 27

(A)
(B)
& 
(D)
(E)

SIMONETTI (2007) distingue em seus escritos


quatro eixos de diagnstico em Psicologia
Hospitalar. Assinale a alternativa que NO
corresponde a um desses eixos.
Reacional.
Social.
0pGLFR
Situacional.
Transferencial.

Cargo: Psiclogo - rea Hospitalar

QUESTO 30

$ 

% 
(C)

(D)
(E)

& 

Os seres humanos dispem de maneiras para


enfrentar crises, receber notcias ruins, lidar com
mudanas, encarar a morte e reagir a doenas. A
negao uma postura que pode ser adotada para
enfrentar essas situaes. Sobre ela, assinale a
alternativa INCORRETA.
4XDQGRDOJXpPQHJDDGRHQoDQmRRID]GHSURSyVLWR
PDV VLP SRUTXH QDTXHOH PRPHQWR p D ~QLFD IRUPD
capaz de enfrentar a situao.
8PD GDV IRUPDV TXH D QHJDomR SRGH DVVXPLU p
enxergar a doena no outro.
A negao deve ser confrontada a qualquer custo e a
qualquer hora, pois no corresponde realidade dos
fatos.
Na posio de negao, a pessoa pode agir como se
a doena simplesmente no existisse.
Algumas pessoas recorrem ao sono como mecanismo
de negao.

(D)
(E)

&yGLJRGHeWLFD3URVVLRQDO
4XDQGR HP VHUYLoR PXOWLSURVVLRQDO R UHJLVWUR GHYH
VHUUHDOL]DGRHPSURQWXiULR~QLFR
Devem ser registradas apenas as informaes
necessrias ao cumprimento dos objetivos do trabalho.
Para atendimento em grupo no eventual, o psiclogo
deve manter apenas os registros dos atendimentos.

QUESTO 33
De acordo com a resoluo do CFP n. 02/2001,
que dispe sobre a especialidade Psicologia
Hospitalar, assinale a alternativa que NO
corresponde descrio das atividades realizadas
por esse especialista.
$ 
$WXDU HP LQVWLWXLo}HV GH VD~GH SDUWLFLSDQGR GD
prestao de servios apenas de nvel tercirio da
DWHQomRjVD~GH
(B)
Atuar em instituies de ensino superior e/ou centros
de estudo e de pesquisa, visando ao aperfeioamento
RXjHVSHFLDOL]DomRGHSURVVLRQDLVHPVXDiUHDGH
competncia.
(C)
Oferecer e desenvolver atividades em diferentes
nveis de tratamento, tendo como sua principal tarefa
a avaliao e acompanhamento de intercorrncias
psquicas dos pacientes que esto ou sero
VXEPHWLGRVDSURFHGLPHQWRVPpGLFRV
'  3URPRYHULQWHUYHQo}HVGLUHFLRQDGDVjUHODomRPpGLFR
paciente.
(E)
Pode desenvolver diferentes modalidades de
interveno, dependendo da demanda e da formao
GRSURVVLRQDOHVSHFtFR

QUESTO 31
Considerando o Art. 15 do Cdigo de tica
3URVVLRQDO GR 3VLFyORJR VREUH D LQWHUUXSomR
do trabalho do psiclogo por qualquer motivo,
assinale a alternativa correta.
(A)
Quando o trabalho for interrompido por extino do
servio, cabe ao psiclogo dar destino aos arquivos
FRQGHQFLDLVJXDUGDQGRRVHPFDVDSRUDQRV
(B)
Em caso de demisso, o psiclogo responsvel dever
HQWUHJDU RV DUTXLYRV FRQGHQFLDLV DR &RQVHOKR
Regional de Psicologia.
(C)
Quando exonerado, o psiclogo dever entregar
RV DUTXLYRV FRQGHQFLDLV j LQVWLWXLomR SDUD VHUHP
incinerados.
(D)
Em caso de demisso, o psiclogo responsvel
GHYH SDVVDU RV DUTXLYRV FRQGHQFLDLV DR VHX FKHIH
imediato.
(E)
Em caso de demisso ou exonerao, o psiclogo
dever repassar todo o material ao psiclogo que vier
a substitu-lo, ou lacr-lo para posterior utilizao pelo
psiclogo substituto.

QUESTO 34
Assinale a alternativa que satisfaz ao Objetivo
Geral da Psicologia Hospitalar.
(A)
Realizar avaliao diagnstica em psicologia em
SDFLHQWHVIDPtOLDHHTXLSHGHVD~GH
(B)
Orientar psicologicamente a famlia e a equipe de
VD~GH
(C)
Acolher e trabalhar com pacientes de todas as faixas
etrias, bem como suas famlias, em sofrimento
psquico decorrente de suas patologias, internaes e
tratamentos.
(D)
Intervir de modo psicoteraputico individualmente ou
em grupo.
( 
5HDOL]DU SHVTXLVDV FLHQWtFDV QD iUHD GH VD~GH H
publicaes.

QUESTO 32
O registro documental, alm de valioso para o
psiclogo, para quem recebe o atendimento e,
ainda, para as instituies envolvidas, tambm
instrumento til produo e ao acmulo de
FRQKHFLPHQWR FLHQWtFR j SHVTXLVD DR HQVLQR
como meio de prova idnea para instruir processos
disciplinares, e defesa legal (Resoluo CFP
n. 001/2009). Considerando os registros em
pronturios, segundo a mesma citada resoluo
do Conselho Federal de Psicologia, assinale a
alternativa INCORRETA.
(A)
Fica garantido ao usurio ou representante legal
o acesso integral s informaes registradas, pelo
psiclogo em seu pronturio.
(B)
A guarda dos registros de atendimento individual ou de
JUXSRpGHUHVSRQVDELOLGDGHGRSURVVLRQDOSVLFyORJR
RX UHVSRQViYHO WpFQLFR H REHGHFH DR GLVSRVWR QR

QUESTO 35

(A)
(B)
(C)
(D)
(E)

um documento que informa: Comparecimentos


do atendido e/ou do seu acompanhante, quando
necessrio; Acompanhamento psicolgico do
atendido; Informaes sobre as condies do
atendimento (tempo de acompanhamento, dias ou
horrios). Segundo o CFP (doc. 007/2003), tratase do
parecer psicolgico.
atestado psicolgico.
declarao psicolgica
laudo psicolgico.
relatrio psicolgico.
Cargo: Psiclogo - rea Hospitalar

(B)

QUESTO 36

$ 

(B)

(C)

' 

( 

A hospitalizao
de
criana
tem
suas
SDUWLFXODULGDGHV $LQGD TXH KDMD GLFXOGDGHV GH
DOJXQV SURVVLRQDLV HP UHFRQKHFHU R LPSDFWR
do adoecimento e da hospitalizao para a
criana, muitas vezes considerando somente sua
famlia, ela tambm sofre. Assinale a alternativa
INCORRETA sobre as reaes emocionais de
crianas hospitalizadas.
$ UHDOLGDGH KRVSLWDODU PXLWDV YH]HV p GHVFRQKHFLGD
SDUDDFULDQoDJHUDQGRXPFOLPDGHVXVSHQVHDOpP
disso, a desinformao faz aumentar as fantasias e
temores das crianas.
A criana pode encarar a doena como uma punio
e sentir culpa por acreditar que errou e est sendo
punida.
O espao fsico limitado, a falta de estimulao e a
prpria rotina do hospital geram entristecimento s
crianas.
4XDQGRDFULDQoDFDSHUWRGHVXDPmHHVVDSDVVD
DFDUPDLVPDQKRVDGLFXOWDQGRRWUDWDPHQWRHRV
cuidados da enfermagem.
([DPHVHFRQGXWDVDJUHVVLYDVSRGHPLQWHQVLFDUDV
dores e o sofrimento fsico da criana.

& 

(D)

( 

As idas e vindas no hospital para exames antes


GD FLUXUJLD FRODERUDP SDUD GLVVLSDU DQJ~VWLDV H
familiarizar o paciente ao ambiente hospitalar.
2V DWHQGLPHQWRV SVLFROyJLFRV GH SUHSDUR SUp
FLU~UJLFR REMHWLYDP DSHQDV HVFODUHFHU R SDFLHQWH
VREUH R SURFHGLPHQWR TXH VHUi UHDOL]DGR SRU LVVR p
LPSRUWDQWHTXHRPpGLFRFLUXUJLmRWDPEpPSDUWLFLSH
interessante considerar que uma cirurgia simples
sempre ser enfrentada de forma simples, e uma
cirurgia complexa, de forma mais dramtica.
$ DYDOLDomR GR SDFLHQWH DQWHV GD FLUXUJLD p PXLWR
importante, pois o estado emocional do paciente (medo
elevado, ansiedade, tenso, estresse, depresso etc)
QRSUpRSHUDWyULRDWXDGLUHWDPHQWHVREUHDVFRQGLo}HV
da pessoa para a cirurgia.

QUESTO 39

QUESTO 37
A Entrevista Psicolgica considerada um
momento crucial no diagnstico e tratamento
em sade mental. Quando bem conduzida, esse
primeiro contato produz no paciente sensao de
FRQDQoD H DOtYLR GR VRIULPHQWR 3RUpP PXLWDV
vezes, o silncio do paciente se revela. Assinale
a alternativa INCORRETA sobre como o psiclogo
pode proceder nesses casos.
(A)
O psiclogo far perguntas e colocaes breves
sinalizando sua presena afetiva e demonstrando
tranquilidade para ouvir.
(B)
Deve-se evitar perguntas muito direcionadas e
que podem ser respondidas com sim ou no
categricos.
(C)
So sempre melhores intervenes como explique
melhor, conte um pouco mais sobre isso,
estimulando a fala do paciente.
(D)
importante buscar em cada paciente o tipo de
interveno que facilita a continuidade de sua fala.
(E)
O silncio no precisa ser evitado, pois apesar de
JHUDU WHQVmR H DQJ~VWLD QR SDFLHQWH QmR DIHWD D
produtividade da entrevista.

$ 

(B)

(C)

' 

(E)

D. uma menina de 16 anos que chegou ao


hospital com muitas dores no peito, fadiga e perda
de cabelo. Aps alguns dias e muitos exames,
constatou-se o diagnstico de Lpos Eritomatoso
Sistmico (LES), uma doena crnica autoimune.
Junto com o diagnstico, vieram as restries e
o tratamento, que so para a vida toda. Sobre os
possveis aspectos psicolgicos do caso relatado,
assinale a alternativa INCORRETA.
&RP D GRHQoD FU{QLFD ' FDUi OLPLWDGD HP VXDV
Do}HVSRULVVRpLPSRUWDQWHTXHVXDIDPtOLDHVWHMDDR
seu lado e faa tudo para ela.
A doena pode ser sentida por D. como uma agresso,
gerando abalo na condio do ser e tornando o futuro
incerto.
O LES poder afastar D. do convvio social e
familiar, isolando-a de seu meio ambiente e gerando
sofrimento.
$ LQWHUQDomR TXH SRGH YLU D DFRUUHU DR P GH
tratamento, refora a condio de dependncia e vai
contra os aspectos vividos na adolescncia de busca
de identidade e dependncia dos pais.
Com a aquisio da doena, h um luto pelo corpo
saudvel e ativo quando, nesse caso, j est se
vivendo o luto pelo corpo infantil.

QUESTO 38

$ 

O aparecimento da doena agravado com


a internao hospitalar pode gerar vrios
sentimentos confusos e dolorosos no sujeito.
Acrescido a isso, quando o tratamento cirrgico,
algumas peculiaridades podem surgir. Sobre
o atendimento psicolgico cirrgico no properatrio assinale a correta.
2VVHQWLPHQWRVGHDQJ~VWLDHDPELYDOrQFLDGRSDFLHQWH
VXUJHPDSHQDVKRUDVDQWHVGDFLUXUJLDGLFXOWDQGRD
LQWHUYHQomRGRSVLFyORJRQRSUpRSHUDWyULR

Cargo: Psiclogo - rea Hospitalar

(A)

QUESTO 40

(A)

(B)

(C)

' 
(E)

O Pronto-Socorro (PS) um servio obrigatrio


de atendimento hospitalar no Brasil, no servio
pblico e privado, considerado porta de
entrada dos hospitais e tambm onde chegam as
emergncias. Considera-se emergncia quando
o paciente chega com risco iminente de morte.
Considerando o PS e as emergncias, assinale
a alternativa que corresponde possibilidade de
atuao do psiclogo.
O psiclogo vai trabalhar com o paciente e sua famlia,
buscando criar um clima de suportabilidade e no
DPHDoDGRU SURSRUFLRQDQGR TXH R SDFLHQWH DWUDYpV
de um domnio maior da situao, possa expressar
seus sentimentos.
No PS, o psiclogo no precisa conhecer muito os
pacientes, pois as intervenes so mais breves que
RFRPXPGHYLGRDRSRXFRWHPSRTXHRSDFLHQWHFD
no setor.
O atendimento dos psiclogos em situaes de
emergncia no difere muito do atendimento nas
HQIHUPDULDVSRLVpSRVVtYHOFRQWDUTXDVHVHPSUHFRP
vrios encontros de longa durao.
1R 36 p R SDFLHQWH TXH YDL DR SVLFyORJR VHQGR D
solicitao muitas vezes dele ou de sua famlia.
No processo de internao em emergncia, o paciente
no precisa estabelecer relaes cognitivas com seu
contexto e relaes psico-fsico-sociais-suportivas
FRP VXD UHDOLGDGH FDQGR D DWXDomR GR SVLFyORJR
limitada famlia.

% 

(C)
(D)

( 

Famlia pode ser entendida como uma unidade social


conectada ao paciente com laos afetivos, podendo
ter ou no laos legais ou de consanguinidade.
4XDQGRXPPHPEURGDIDPtOLDpKRVSLWDOL]DGRDEDOD
se a organizao familiar e, por vezes, pode ocorrer
WURFDGHSDSpLV
As crises e desajustes familiares ocorrem apenas no
momento do aparecimento da doena.
Os familiares precisam ter a oportunidade de falar da
doena, de seus medos, fantasias sobre a morte e
evoluo da doena, expressando seus sentimentos.
(VWDUjEHLUDGROHLWRGHXPSDFLHQWHJUDYHpSDUDD
famlia, muitas vezes, viver o desamparo e o medo.

QUESTO 43
A Unidade de Terapia Intensiva (UTI) um setor
delicado do hospital, envolvendo fantasias dos
pacientes e acompanhantes sobre ele. Assim, a
presena do psiclogo na UTI ganha fora com
o reconhecimento dos sentimentos e sofrimento
vividos por ambas as partes. Assinale a alternativa
que NO corresponde s possibilidades de
interveno do psiclogo na UTI.
(A)
Favorecer a expresso no verbal do paciente
intubado ou sem possibilidade de comunicao
DWUDYpVGHWpFQLFDVDGDSWDWLYDVjVLWXDomR
% 
$PSOLDUXVDQGRWpFQLFDVSVLFROyJLFDVDFRQVFLrQFLD
adaptativa do doente frente ao ambiente estressor.
(C)
Acompanhar e preparar psicologicamente familiares
de pacientes em situaes crticas, como morte
HQFHIiOLFDFRPDHPRUWHV~ELWD
(D)
Promover humanizao da tarefa no cuidado intensivo,
melhorando a qualidade de vida do paciente, da famlia
HGDHTXLSHGHVD~GH
(E)
Orientar a famlia a no se aproximar do paciente nem
WRFiORDPGHQmRGHVHVWDELOL]DURPHVPR

QUESTO 41
N. uma mulher de 38 anos que chegou ao hospital
desacordada e acompanhada pelo marido. Ela
faz tratamento psiquitrico para depresso h
 PHVHV GHVGH TXH SHUGHX R OKR DGROHVFHQWH
em um acidente de carro. Aps uma briga com o
marido, ela tomou uma dose superelevada dos
seus remdios psiquitricos. Considerando o
caso, assinale a alternativa INCORRETA sobre os
procedimentos que o psiclogo pode adotar em
seu atendimento.
$ 
%XVFDQGR FRPSUHHQGHU R SDFLHQWH VXLFLGD p
LPSRUWDQWHREWHUGDGRVGDKLVWyULDGRSDFLHQWHDWUDYpV
do marido.
% 
e PXLWR LPSRUWDQWH FDU DWHQWR D XPD QRYD
possibilidade de tentativa de suicdio ainda no hospital.
&  1HVVHV FDVRV QmR p QHFHVViULR DFRPSDQKDPHQWR
SVLTXLiWULFR SRLV HOD Mi WRPDYD UHPpGLR H PHVPR
assim tentou contra a prpria vida.
'  &DEH DR SVLFyORJR LGHQWLFDU DV PDQLIHVWDo}HV
motivacionais da paciente para us-las como estmulo
vida.
(E)
O psiclogo poder atuar frente s atitudes
autodestrutivas indiretas, como a negligncia no
tratamento.

QUESTO 44
Sobre a Dependncia Qumica e a atuao do
psiclogo junto aos dependentes qumicos,
assinale a alternativa correta.
(A)
A Dependncia Qumica no pode ser considerada
doena, pois faz parte da marginalidade.
% 
2REMHWLYRPDLRUGRSODQRGHWUDWDPHQWRpDPHOKRUD
do funcionamento psicossocial do paciente a partir da
abstinncia e reabilitao.
(C)
Essencialmente, deve-se considerar que h apenas
um modelo efetivo de tratamento.
(D)
Os medicamentos no so importantes e por isso
podem ser suspensos.
(E)
Apenas o psiquiatra e o psiclogo so capazes de
avaliar a gravidade da dependncia.
QUESTO 45
A Psicologia Hospitalar uma especialidade
considerada nova e foi reconhecida h pouco
tempo pelo Conselho Federal de Psicologia como
tal. Sobre a Psicologia Hospitalar, sua histria e
precursores, assinale a alternativa INCORRETA.
(A)
A Psicologia Hospitalar surgiu no Brasil em resposta s
novas tendncias que assinalavam a necessidade de

QUESTO 42
Considerando o papel da famlia na hospitalizao
de um dos membros e a sua importncia nesse
momento, assinale a alternativa INCORRETA.

10

Cargo: Psiclogo - rea Hospitalar

% 

(C)

(D)

(E)

expanso do saber biopsicossocial na compreenso


do fenmeno da doena.
$ 3VLFRORJLD +RVSLWDODU p XPD GHVFHQGHQWH GD
3VLFRORJLDGD6D~GHDVVLPFRPRD3VLFRRQFRORJLD
a Psicocardiologia e a Psiconeurologia.
As primeiras intervenes psicolgicas que se tem
conhecimento, que depois ganharam o nome de
Psicologia Hospitalar, no Brasil, foram por Matilde
Neder junto s pacientes de ortopedia e traumatologia,
e por Bellkiss Wilma Romano Lamosa, com pacientes
cardacos.
A Psicologia Hospitalar j era consolidada em outros
pases quando chegou ao Brasil, e aqui sofreu
DGHTXDo}HVSDUDDUHDOLGDGHGDVD~GHHVSHFLDOPHQWH
GDVD~GHS~EOLFD
A Psicologia no contexto hospitalar foi gerada
PDUJHP GR PRGHOR ELRPpGLFR VRIUHQGR LQXrQFLDV
GD PRGHUQD 0HGLFLQD &LHQWtFD GR SHQVDPHQWR
cartesiano, da relao causa e efeito.

( 

portadoras de transtornos mentais tem sido uma das


TXHVW}HVTXHGL]UHVSHLWRj3VLFRORJLDHjELRpWLFD
6mR TXHVW}HV UHODFLRQDGDV j PRUWH H j ELRpWLFD
eutansia, ortotansia e distansia j fazem parte
da realidade nos hospitais junto ao desenvolvimento
WHFQROyJLFRHDUDFLRQDOL]DomRGDDVVLVWrQFLDjVD~GH

QUESTO 48
A criana v a hospitalizao como ameaadora
e causadora de ansiedade e manifestao de
reaes adversas. Quando h necessidade de
ser submetido a procedimentos invasivos, como
as cirurgias, por exemplo, estas reaes so
potencializadas. Considerando a preparao
psicolgica para a cirurgia peditrica, assinale a
alternativa INCORRETA.
$ 
2REMHWLYRGDSUHSDUDomRpSURPRYHUDSRVVLELOLGDGHGH
manejar os eventos, antecipando-os e compreendendo
VHXVREMHWLYRVVLJQLFDGRVHSURSyVLWRV
(B)
Na preparao psicolgica para a cirurgia peditrica,
SRGHP VHU XWLOL]DGDV  WpFQLFDV FRPR LQWHUYHQo}HV
comportamentais cognitivas breves (exerccios de
respirao, de imaginao, modelao, reforamento
e ensaio comportamental).
(C)
A entrevista motivacional da abordagem humanista
WDPEpP SRGH VHU XWLOL]DGD QD SUHSDUDomR SDUD
procedimento.
'  $ SUHVHQoD GD PmH p QHFHVViULD H LVVR SRU VL Vy
sem uma preparao da criana e da prpria me,
Mi FRQWULEXL H PXLWR FRP D FULDQoD QD VLWXDomR SUp
FLU~UJLFD
( 
2VSURJUDPDVGHSUHSDUDomRSUpRSHUDWyULRVSRGHP
ser representados por informao narrada, escrita,
YLVLWDKRVSLWDODUYtGHRVLQIRUPDWLYRVWpFQLFDVFRPXVR
GHERQHFRVWpFQLFDVGHUHOD[DPHQWRRXWHDWUDOL]DomR
FRPDSDUWLFLSDomRGDVFULDQoDVVLPXODQGRRPpGLFR
ou o paciente.

QUESTO 46
H muita discusso sobre o valor e limites do
diagnstico psiquitrico: se por um lado ele
rotula, por outro o norteador das prticas
psiquitricas. Contudo, sem um diagnstico
psicopatolgico aprofundado, no se pode nem
compreender adequadamente o paciente e seu
sofrimento, nem escolher o tipo de estratgia
teraputica mais adequada. Sobre o diagnstico
em Psicopatologia, assinale a alternativa correta.
$ 
1RGLDJQyVWLFRHP3VLFRSDWRORJLDpSRVVtYHOGLVWLQJXLU
trs tipos de fenmenos em relao possibilidade
GH FODVVLFDomR   DVSHFWRV H IHQ{PHQRV TXH
encontramos em todos os seres humanos; 2) Aspectos
e fenmenos que encontramos em algumas pessoas,
no em todas; 3) Aspectos que encontramos em
apenas um ser humano em particular.
% 
2 GLDJQyVWLFR SVLFRSDWROyJLFR Vy p ~WLO SDUD D
FODVVLFDomR
&  2GLDJQyVWLFRSVLFRSDWROyJLFRGLFXOWDDFRPXQLFDomR
SUHFLVDHQWUHSURVVLRQDLVHSHVTXLVDGRUHV
'  'RSRQWRGHYLVWDFOtQLFRHHVSHFtFRGD3VLFRSDWRORJLD
no h aspectos particulares a serem considerados.
(E)
Todo
diagnstico
psicopatolgico
baseia-se
IXQGDPHQWDOPHQWH QR SHUO GH VLQDLV H VLQWRPDV
apresentados pelo paciente na histria da doena e
no momento da entrevista.

QUESTO 49

(A)
(B)
(C)
(D)
(E)

QUESTO 47
Assinale a alternativa INCORRETA sobre a biotica
na sade.
$ 
$ELRpWLFDSUHRFXSDVHHPH[SOLFLWDUTXHWRGDSUiWLFD
HPVD~GHpLQYDULDYHOPHQWHXPDWRpWLFRTXHQHFHVVLWD
VHUMXVWLFDGRHVXS}HXPDUHVSRQVDELOLGDGHPRUDO
% 
2V SULQFtSLRV pWLFRV H DV TXHVW}HV ELRpWLFDV VmR
DSOLFiYHLVDSHQDVjViUHDVELRPpGLFDV
&  $ELRpWLFDpXPDSRQWHHQWUHDVFLrQFLDVGDVD~GHH
RVIXQGDPHQWRVpWLFRVHORVyFRVTXHGHYHPUHJHU
o modo de agir dos que esto comprometidos com a
DVVLVWrQFLDjVD~GH
'  2 DFRQVHOKDPHQWR JHQpWLFR HQYROYHQGR SHVVRDV

11

Joo est internado na UTI de um hospital h


 GLDV SRU PRWLYR GH LQVXFLrQFLD UHVSLUDWyULD
aguda. Pela manh, o mdico lhe deu alta,
porm aps o almoo sua alta foi suspensa com
a chegada de novos exames. Diante do caso,
assinale a alternativa que corresponde melhor
conduta a ser adotada pelo psiclogo hospitalar.
Preparao psicolgica para procedimento.
Orientao psicolgica.
Orientao para alta.
Suporte psicolgico.
Observao psicolgica.

Cargo: Psiclogo - rea Hospitalar

QUESTO 50

(A)

(B)

(C)

(D)

( 

O corao um rgo de grande simbolismo


cultural, sendo a ele atribudo a sede dos
sentimentos, alm de ser um rgo vital e centro
motor da circulao sangunea. Sobre seu
simbolismo e aspectos psicolgicos dos pacientes
cardacos, assinale a alternativa INCORRETA.
Muitos pacientes cardacos acabam correndo grandes
ULVFRVGHYLGDSHODGLFXOGDGHHPDFHLWDUDGRHQoDH
SURFXUDUDMXGDPpGLFD
No raro coronariopatas infartados negam a sua
situao e continuam seguindo uma vida estressante
sem cuidar do fumo e da alimentao.
Muitos
homens
escolhem
inconscientemente
uma crise cardaca a mostrar as suas fraquezas e
vulnerabilidades.
Os doentes coronarianos apresentam uma facilidade
em se entregar s fantasias: sonhos so comuns e as
trocas interpessoais so ricas, no transferindo a sua
carga emocional para o soma.
2VXMHLWRFRPSUREOHPDVFDUGtDFRVTXHpDJUHVVLYR
ou que tem anseios reprimidos de dependncia, pode,
GLDQWHGRPDOHVWDUDVVXPLUXPDDWLWXGHGHGHVDR
no qual se expor ao perigo.

12

Cargo: Psiclogo - rea Hospitalar

PROVA: EBSERH - UFMG


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: AOCP

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

D
B
B
A
C
E
E
A
C
C
D
E
E

39
40
41
42
43
44
45
46
47
48
49
50

X
A
C
C
E
B
D
E
X
D
B
D

Coletnea de Provas | Concursos de Psicologia

HU-UFS - HOSPITAL UNIVERSITRIO DA UNIVERSIDADE FEDERAL DE SERGIPE


CONCURSO PBLICO 9/2013 - EBSERH/HU-UFS
EDITAL N 3 - EBSERH - REA ASSISTENCIAL

Concurso Pblico
REF. EDITAL N 3/2013

NVEL SUPERIOR - MANH

Cargo

PSICLOGO REA HOSPITALAR


ATENO
O Caderno de questes possui 50
(cinquenta)
questes
objetivas,
numeradas sequencialmente, de acordo
com o exposto no quadro a seguir:

MATRIA

QUESTES

Lngua Portuguesa

01 a 10

Raciocnio Lgico e Matemtico

11 a 15

Legislao Aplicada EBSERH

16 a 20

Legislao Aplicada ao SUS

21 a 25

&RQKHFLPHQWRV(VSHFtFRV

26 a 50

INSTRUES
 1D VXD )ROKD GH 5HVSRVWDV FRQUD VHX QRPH R Q~PHUR GR VHX
GRFXPHQWRHRQ~PHURGHVXDLQVFULomR$OpPGLVVRQmRVHHVTXHoD
de conferir seu Caderno de Questes quanto a falhas de impresso e
de numerao, e se o cargo corresponde quele para o qual voc se
LQVFUHYHX4XDOTXHUGLYHUJrQFLDFRPXQLTXHDRVFDO
 2 ~QLFR GRFXPHQWR YiOLGR SDUD DYDOLDomR GD SURYD p D )ROKD GH
5HVSRVWDV6ypSHUPLWLGRRXVRGHFDQHWDHVIHURJUiFDtransparente
de cor azul ou preta para o preenchimento da Folha de Respostas, que
deve ser realizado da seguinte maneira:
 2 SUD]R GH UHDOL]DomR GD SURYD p GH  TXDWUR  KRUDV LQFOXLQGR D
marcao da Folha de Respostas. Aps 60 (minutos) do incio da
prova, o candidato estar liberado para utilizar o sanitrio ou deixar
GHQLWLYDPHQWHRORFDOGHDSOLFDomR$UHWLUDGDGDVDODGHSURYDGRV
WUrV ~OWLPRVFDQGLGDWRVVyRFRUUHUiFRQMXQWDPHQWH
 $RWpUPLQRGHVXDSURYDFRPXQLTXHDRVFDOGHYROYHQGROKHD)ROKD
de Respostas devidamente preenchida e assinada. O candidato poder
levar consigo o Caderno de Questes, desde que aguarde em sala o
WpUPLQRGDDSOLFDomR
5. As provas e os gabaritos preliminares estaro disponveis no site do
Instituto AOCP - www.institutoaocp.org.br - no dia posterior aplicao
da prova.
6. Implicar na eliminao do candidato, caso, durante a realizao
das provas, qualquer equipamento eletrnico venha emitir ruidos,
mesmo que devidamente acondicionado no envelope de guarda de
pertences. O NO cumprimento a qualquer uma das determinaes
constantes em Edital, no presente Caderno ou na Folha de Respostas,
incorrer na eliminao do candidato.

Informaes Adicionais
0(xx)44 3344-4242 / www.institutoaocp.org.br / candidato@institutoaocp.org.br

CONHECIMENTOS ESPECFICOS

QUESTO 29
Uma das solicitaes muito frequentes nos
hospitais em relao ao puerprio a avaliao
da relao me e beb. Sobre os tema, assinale a
alternativa INCORRETA.
(A)
A importncia da avaliao da relao me e beb se
MXVWLFDDRFRQVLGHUDUTXHDTXDOLGDGHGHVVDUHODomR
implica no desenvolvimento psquico e cognitivo
saudveis.
% 
3HVTXLVDV Mi DSRQWDP TXH HP FDVRV GH EHEr SUp
termos, que necessitam de cuidados intensivos, a
presena dos pais com o investimento de afeto no
UHFpPQDVFLGRFRQWULEXLSDUDDPHOKRUDFOtQLFD
(C)
Ao avaliar a relao me e beb alguns itens so
contemplados como: como a me segura o beb, o
modo de oferecer o seio e como olha para o beb.
(D)
O cuidado adequado so sinais de carinho e zelo,
VHQGRDVVLPpSUHFLVRPXLWDVYH]HVRULHQWDUDVPmHV
FRQVLGHUDQGRTXHDPDWHUQLGDGHpLQVWLQWLYD
(E)
Algumas teorias do desenvolvimento corroboram que
o beb ao nascer vai se dando conta, ao longo das
VHPDQDVTXHMiQmRpSDUWHGDPmHLVVRMXVWLFDD
importncia de se ter uma boa qualidade no vnculo
entre os dois.

QUESTO 26
A Psicoterapia Breve uma tcnica muito usada
pelos psiclogos na sade. Sobre esse assunto,
assinale a alternativa correta.
(A)
O nome Psicoterapia Breve demonstra a caracterstica
GDWpFQLFDTXHpRWHPSRFXUWRGDVVHVV}HV
% 
(VVDWpFQLFDWmRHVSHFtFDTXHpD3VLFRWHUDSLD%UHYH
VypSRVVtYHOQDOLQKDWHyULFDGDSVLFDQiOLVH
(C)
Dentre os principais conceitos da Psicoterapia Breve,
podem-se destacar: experincia emocional corretiva,
aliana teraputica e foco.
'  $3VLFRWHUDSLD%UHYHpRULHQWDGDSHODDVVRFLDomROLYUH
sem apresentar qualquer tipo de planejamento para o
tratamento.
( 
4XDOTXHUSDFLHQWHpDGHTXDGRSDUDXPD3VLFRWHUDSLD
Breve, sem restries.
QUESTO 27
Em relao Gesto em Sade, assinale a
alternativa INCORRETA.
$ 
$R SUREOHPDWL]DU D *HVWmR HP 6D~GH Ki GH VH
considerar que no s os trabalhadores esto
HQYROYLGRV HP VXDV TXHVW}HV PDV WDPEpP RV
usurios so responsveis.
% 
$VHWDSDVGR3ODQHMDPHQWRHP6D~GHVmRGLDJQyVWLFR
monitorao e avaliao.
&  &RPSUHHQGHPR6LVWHPDGH6D~GHRVYiULRVQtYHLV
municipal, estadual e federal, e esses esto ligados
entre si.
(D)
A Avaliao dos Recursos Possveis e dos Recursos
'LVSRQtYHLVpXPHL[RLPSRUWDQWHSDUDD*HVWmR
( 
2LQGLFDGRUpGHH[WUHPDLPSRUWkQFLDQD*HVWmRHP
6D~GH SRLV UHHWH XPD VLWXDomR GH LQWHUHVVH QXP
determinado momento.

QUESTO 30
O transplante de rgos tem crescido no Brasil e
essa comea a ser uma realidade cada vez mais
prxima nos hospitais. A partir do caso a seguir,
assinale a alternativa correta em relao atuao
do psiclogo.
Joo um menino de 13 anos que nasceu com
uma m formao no rim esquerdo. Aps muitos
tratamentos, sua ltima chance o transplante
renal. A primeira busca por compatibilidade foi em
seu ncleo familiar principal, porm sem sucesso.
Diante da angstia e sofrimento da famlia, outros
familiares se apresentaram enquanto doadores
at que uma tia materna foi constatada enquanto
compatvel e aceitou doar um dos seus rins.
(A)
O ponto mais importante para a atuao no psiclogo
HP FDVRV GH WUDQVSODQWH p WHU XP ERP YtQFXOR H
UHODFLRQDPHQWRFRPRPpGLFRFLUXUJLmR
% 
2 SUHSDUR SVLFROyJLFR SDUD R WUDQVSODQWH p PDLV
importante para a famlia que para o paciente, pois a
famlia j estava angustiada.
&  (VFODUHFHU G~YLGDV H GLVVLSDU DQJ~VWLDV H PHGRV p
XPD WDUHID H[FOXVLYD GR PpGLFR QmR SRGHQGR VHU
realizada por outro.
'  1mR p QHFHVViULR UHDOL]DU TXDOTXHU SUHSDUR FRP R
UHFHSWRU SRLV VXD DOHJULD H HVSHUDQoD QD YLGD p R
mais importante.
( 
2 WUDEDOKR FRP R GRDGRU p PXLWR LPSRUWDQWH H YLVD
LGHQWLFDUQtYHLVPRWLYDFLRQDLVVHQWLPHQWRVGHFXOSD
retaliao ou barganha para a doao.

QUESTO 28

$ 

% 

(C)
(D)
( 

Durante a vida, passa-se por processos que


envolvem perdas, e com essas vem o luto. Ao
pensar no ambiente hospitalar e o que o cerca
possvel referir muitas perdas. Sobre as perdas e
o luto, assinale a alternativa correta.
$SHUGDGDVD~GHGHSDUWHVGRFRUSRGDDXWRQRPLD
DOpP GD SHUGD GD YLGD  D PRUWH  VmR SURFHVVRV
dolorosos e que envolvem o luto.
$HODERUDomRGROXWRpXPSURFHVVRHSRULVVRSDUD
alguns estudiosos das perdas e morte, envolvem
fases, sendo elas: euforia, aceitao e medo.
O luto e a melancolia so designaes distintas para o
mesmo processo de elaborao.
A sensao de vazio inicial, quando presente no luto,
sinaliza algo patolgico.
2 OXWR p XP SURFHVVR GRORURVR H TXH QmR FRQWULEXL
para a constituio do psiquismo, apenas torna as
coisas mais difceis.

Cargo: Psiclogo - rea Hospitalar

% 
QUESTO 31

(A)

(B)

& 

(D)

( 

Uma das possibilidades de trabalho em grupo muito


comum na sade so os Grupos Operativos. Sobre
o assunto, assinale a alternativa INCORRETA.
No Grupo Operativo, bem como em qualquer
interveno em grupo, o psiclogo assume a funo
GHFRRUGHQDGRUHVXDIXQomRpUHVSRQGHUDVTXHVW}HV
postas pelo grupo.
Os principais princpios dos Grupos Operativos so: o
vnculo e a tarefa, proporcionando que cada integrante
compartilhe as necessidades em torno de objetos
comuns.
8P GDV SRVVtYHLV UHDo}HV QR JUXSR p R 0HGR GR
Ataque, ou seja, um receio frente ao desconhecido
gerando insegurana e instabilidade.
No Grupo Operativo um elemento que muito ajuda o
FRRUGHQDGRUpR2EVHUYDGRUHOHpHOHPHQWRSRLVQD
ntegra, no faz parte do grupo.
eLPSRUWDQWHLGHQWLFDUQR*UXSRDOJXQVSDSpLVFRPRR
porta-voz, depositante, depositrio e sabotador.

(C)

(D)

(E)

QUESTO 34
Abandonando a ideia cartesiana, as cincias
voltam seu olhar para a constituio holstica do
homem, assim no se separa mais mente e corpo.
Pensando nessa relao, assinale a alternativa
correta sobre Psicossomtica.
$ 
8PD GRU SVLFROyJLFD IUXWR GH XP FRQLWR QmR p
possvel de se sentir no corpo, assim a causa orgnica
pVHPSUHPDLVLPSRUWDQWH
% 
$RHQWHQGHURVLJQLFDGRGHXPVLQWRPDpSRVVtYHO
estabelecer sua causa e consequentemente sua cura.
&  3RGHVHFRQVLGHUDU TXH DVRPDWL]DomR pXPD IRUPD
de manifestao de mensagens emocionais que no
so registradas ou transmitidas, quando se cala o
corpo sofre.
(D)
Muitas doenas so resultados da transformao de
DQJ~VWLDHPHVWDGRVItVLFRVPHQRVDPHDoDGRUHV
(E)
Hoje os estudos e consideraes sobre a
Psicossomtica so psicanalticos, predominando a
busca por causas inconscientes.

QUESTO 32

(A)

(B)
& 
' 

( 

1mRpLPSRUWDQWHTXHDFULDQoDVDLEDGRGLDJQyVWLFRH
GRTXHOKHRFRUUHFRQVLGHUDQGRTXHpFULDQoDSRXFR
vai entender sobre o que est acontecendo.
A mudana do funcionamento do corpo, o contato
FRPPpGLFRVH[DPHVKRVSLWDLVHVVDVPXGDQoDVQD
rotina causam uma desorganizao e, para dar conta
de tanta novidade, a criana mescla sua vivncia com
fantasias.
Diante da situao de adoecimento da criana, a
IDPtOLD WDPEpP DGRHFH VHQGR DVVLP p LPSRUWDQWH
considerar o sofrimento destes e poder colaborar para
o enfrentamento da doena.
A reao da criana ao receber o diagnstico de
FkQFHU p LQWHUIHULGD SHOD UHDomR GH VHXV SDLV DR
receber o mesmo, sendo assim a forma como a famlia
lida com a notcia e o tratamento interferem no mesmo.

R. uma mulher de 42 anos que, a quatro, vem


WUDWDQGRXPWLSRGHFkQFHUQRVRVVRV$SyVFDU
seis meses sem deteco de clulas cancergenas,
um exame recente comprovou a existncia de
tumores em outros rgos. A mais de um ms
internada com muitas dores e desconforto j se
apresenta confusa e a medicina no v cura para
seu caso. Diante do quadro, a famlia aceita os
cuidados paliativos.
Com relao aos Cuidados Paliativos, assinale a
alternativa correta.
Os Cuidados Paliativos ainda so uma realidade
SRXFR FRQKHFLGD QRV KRVSLWDLV GHYLGR j GLFXOGDGH
GR PpGLFR HP DFHLWDU TXH QmR Ki PDLV FXUD SDUD R
paciente.
A medicina paliativa, ao abandonar o carter curativo,
abrevia a vida do paciente.
$ORVRDGRV&XLGDGRV3DOLDWLYRVSULYLOHJLDRGRHQWH
e no a doena.
2 SVLFyORJR p R UHVSRQViYHO SHOD UHDOL]DomR GRV
&XLGDGRV3DOLDWLYRVHQWHQGHQGRTXHHVVHSURVVLRQDO
tem um olhar humanizado para o paciente.
$ HVFROKD SHOR &XLGDGR 3DOLDWLYR p XPD IRUPD GD
famlia abandonar o doente e se eximir dos cuidados
com o mesmo.

QUESTO 35
O registro do atendimento psicolgico tornouse obrigatrio a partir da resoluo do CFP
(n001/2009)
em
2009.
Sobre
registros
psicolgicos em pronturio interdisciplinar
assinale a alternativa correta.
(A)
relevante para o registro no pronturio onde outros
SURVVLRQDLV WHUmR DFHVVR VRPHQWH j LQIRUPDomR GH
planejamento teraputico.
% 
2 PRGHOR GH FDGD FKD TXH FRPS}H R SURQWXiULR p
~QLFRHIRUQHFLGRSHOR0LQLVWpULRGD6D~GH
(C)
As cpias de outros documentos referentes ao
paciente e que no constam no pronturio podem ser
descartadas.
(D)
O registro documental se aplica somente aos
psiclogos que trabalham em instituies.
( 
2UHJLVWURGHYHREHGHFHUjpWLFDHDRVLJLORIRUQHFHQGR
dados importantes a equipe sem expor o paciente.

QUESTO 33
Um dos tipos de cncer muito frequente em
crianas a leucemia. Pesquisas j revelam
que as chances de cura existem e quanto antes
descoberto so maiores. Em relao aos aspectos
psicolgicos do cncer na infncia, assinale a
alternativa INCORRETA.
(A)
Uma das possibilidades de atuao junto criana
KRVSLWDOL]DGD p R EULQFDU XP LQVWUXPHQWR PXLWR
YDOLRVR SDUD DMXGDU D GLVVLSDU PHGRV H DQJ~VWLDV
DOpP GH SURPRYHU D TXDOLGDGH GH YLGD H IXQFLRQDU
FRPRHVWUDWpJLDGHHQIUHQWDPHQWR

QUESTO 36

A Entrevista Psicolgica muito utilizada no


contexto hospitalar, sobre ela assinale a alternativa
INCORRETA.

Cargo: Psiclogo - rea Hospitalar

$ 

% 
(C)

' 
( 

$ (QWUHYLVWD 3VLFROyJLFD QR FRQWH[WR KRVSLWDODU p


XVDGD SDUD HVFODUHFHU RV FRQLWRV H DV DQJ~VWLDV
causados na infncia.
$ (QWUHYLVWD QR PRGHOR 'LUHWLYR  )HFKDGR p PDLV
utilizada em pesquisas.
Os objetivos da Entrevista Psicolgica podem
ser vrios, entre eles o de diagnstico e de
aconselhamento.
4XDQGRD(QWUHYLVWD3VLFROyJLFDpIHLWDFRPFULDQoDV
DGHYROXWLYDpUHDOL]DGDFRPRVSDLV
$R WpUPLQR GD (QWUHYLVWD 3VLFROyJLFD IRUPXODVH D
Hiptese Diagnstica.

C.
D.
E.

Relatrio.
Laudo.
Parecer.

( )

Aps processo de avaliao psicolgica,


MXVWLFD HVWDU DSWR RX QmR SDUD DWLYLGDGHV
HVSHFtFDV
Descreve sobre as condies psicolgicas
e suas determinaes histricas, sociais,
polticas e culturais pesquisadas durante a
Avaliao Psicolgica de forma didtica e
detalhada.
No deve conter registro de sintomas,
situaes ou estado psicolgicos.
Apresenta uma resposta esclarecedora,
atravs da avaliao especializada de uma
situao problema, visando diminuir
dvidas que interferem em uma deciso.
o mesmo que Relatrio.

( )

( )
QUESTO 37

(A)

(B)

(C)

' 

( 

( )

Vivemos uma realidade na sade em que muitas


vezes o psiclogo no trabalha sozinho. A
respeito dessas relaes, assinale a alternativa
INCORRETA.
Chamamos de equipe INTERDISCIPLINAR quando
DOJXQV SURVVLRQDLV GH iUHDV GLIHUHQWHV GLVFXWHP D
situao de um paciente sobre aspectos comuns a
mais de uma rea.
considerada equipe MULTIDISCIPLINAR quando h
YiULRVSURVVLRQDLVDWHQGHQGRRPHVPRSDFLHQWHGH
forma independente entre si.
As equipes TRANSDICIPLINARES trabalham e
GHQHP Do}HV GH IRUPD FRQMXQWD LQGHSHQGHQWH GD
rea de atuao.
3DUD R ERP IXQFLRQDPHQWR GD HTXLSH p LPSRUWDQWH
que as outras reas se familiarizem e compreendam
os termos da psicologia, facilitando a comunicao.
8PDGDVGLFXOGDGHVSDUDRWUDEDOKRHPHTXLSHQR
FRQWH[WRKRVSLWDODUpDIDOWDGHFODUH]DHPUHODomRj
DWULEXLomRGHFDGDSURVVLRQDO

( )
$ 
% 
& 
' 
( 

QUESTO 40

$ 
(B)

QUESTO 38
Considerando o caso a seguir, assinale a
alternativa que corresponde temtica possvel
trabalhada pelo psiclogo.
M. um menino de 5 anos que sofreu um acidente
em casa e foi socorrido pelo Corpo de Bombeiros,
chegou ao hospital ainda consciente e foi
encaminhado diretamente para a sala de cirurgia.
Seus pais acompanharam ele at o hospital e no
tm ideia da extenso do ferimento, eles aguardam
QDVDODGHHVSHUDHUHIHUHPTXHROKRQXQFDWLQKD
estado em um hospital.
(A)
Suporte psicolgico com o paciente.
(B)
Acolhimento com os pais e supresso de ansiedade.
&  3UHSDURSUpFLU~UJLFRLQIDQWLO
(D)
Orientao sobre normas e rotinas do hospital.
(E)
Ajudar a famlia a contatar outros familiares.

(C)
(D)
(E)

Sobre as orientaes em relao cobrana de


KRQRUiULRV SURVVLRQDLV SUHVHQWHV QR &yGLJR GH
eWLFD3URVVLRQDOGR3VLFyORJR &RQVHOKR)HGHUDO
de Psicologia), assinale a alternativa correta.
2V KRQRUiULRV GHYHP UHVSHLWDU XPD WDEHOD ~QLFD
promovendo a igualdade perante cada paciente.
S se fala dos honorrios aps realizar os servios,
SRLVDQWHVQmRpSRVVtYHOSUHYHURGLVSrQGLRTXHGDUi
DRSURVVLRQDO
Os honorrios devero ter alto valor para que o
reconhecimento seja proporcional.
O preo dos atendimentos pode ser utilizado como
propaganda.
O psiclogo no aceitar para si salrios que no
VHMDP[DGRVFRPGLJQLGDGH

QUESTO 41

$ 
% 
& 
' 

QUESTO 39
Considerando o tema, relacione as colunas e
assinale a alternativa com a sequncia correta. A
elaborao de documentos em psicologia ainda
uma questo sria e que merece muita ateno.

A.
B.

$%&'(
%'$&(
%&$('
&'$(%
'(%&$

(E)

Considerando a Anlise Institucional e sua


importncia na Sade Coletiva, assinale a
alternativa INCORRETA.
1D $QiOLVH ,QVWLWXFLRQDO D VD~GH p FRQVLGHUDGD
enquanto instituio e problematizada como tal.
%OHJHUpXPGRVHVWXGLRVRVGD3VLFRORJLD,QVWLWXFLRQDO
GDQGRrQIDVHjVD~GHHjSUHYHQomR
3DUD /DSDVVDGH D FULVH p PXLWR LPSRUWDQWH SRLV
oportuniza novas relaes sociais.
$$QiOLVH,QVWLWXFLRQDOWDPEpPSRGHVHUGHQRPLQDGD
Socioanlise.
Guilhon de Albuquerque prope o mapeamento das
relaes institucionais.

Declarao.
Atestado Psicolgico.

Cargo: Psiclogo - rea Hospitalar

QUESTO 45
Os psiclogos tm conquistado um espao muito
importante nos hospitais, nas Unidades e Centros
de Tratamento Intensivo (UTI e CTI). Sobre a
DWXDomRGHVVHSURVVLRQDOQD87,DGXOWRDVVLQDOH
a alternativa correta.
(A)
O cuidado psicolgico pouco interfere no resultado do
tratamento fsico, ainda mais considerando um setor
HPTXHDSUREDELOLGDGHGRSDFLHQWHPRUUHUpJUDQGH
% 
2 VHQWLPHQWR GH GHVDPSDUR p YLYLGR SHOD IDPtOLD
dos pacientes internado e merece a ateno do
SURVVLRQDOSVL
(C)
A perda do controle ativo sobre as prprias aes no
pVHQWLGDSHORVSDFLHQWHVQD87,SRLVHVVHVPXLWDV
vezes, se encontram sonolentos ou sedados.
(D)
Em casos de pacientes na UTI, o atendimento com
esses e familiares sempre ocorrer de forma separada.
( 
8P GRV REMHWLYRV GR SVLFyORJR GD VD~GH QDV 87,V
p IDYRUHFHU D H[SUHVVmR QmR YHUEDO GH SDFLHQWHV
entubados ou sem possibilidades de comunicao
XWLOL]DQGRVH GH WpFQLFDV DGDSWDWLYDV j VLWXDomR
aliviando o estresse e como forma de preveno na
VD~GHPHQWDO

QUESTO 42
Sobre o papel das equipes multidisciplinares
na Dependncia Qumica, assinale a alternativa
correta.
$ 
3URJUDPDU
HVWUDWpJLDV
GH
HQIUHQWDPHQWR
potencializando mudana de vida do usurio e
IDPLOLDUHVpXPGRVREMHWLYRVGDDWXDomRPXOWLGLVFLSOLQDU
no caso da dependncia qumica.
% 
$ FRPSOH[LGDGH GRV FDVRV HP VD~GH WHP FRPR
consequncia a fragmentao dos saberes.
&  $V~QLFDVDOWHUQDWLYDVWHUDSrXWLFDVQDDVVLVWrQFLDDR
dependente qumico so a internao em hospital
SVLTXLiWULFRHJUXSRVGHP~WXDDMXGD
'  $LGHQWLFDomRSUHFRFHGHXVXiULRVGHiOFRROpGDGD
por meio de aconselhamento.
(E)
O desenvolvimento de habilidade no usurio/paciente
GLFXOWDRWUDWDPHQWR
QUESTO 43
A Reforma Psiquitrica ecoou no Brasil e, a partir
dessas ideias, alguns documentos foram criados
SHOR 0LQLVWpULR GD 6D~GH D P GH VHUYLU GH EDVH
para mudana. Sobre esses documentos, assinale
a alternativa INCORRETA.
$ 
$VSULPHLUDVOHLVIHGHUDLVDLQGDQRPGDGpFDGDGH
QRYHQWD GR VpFXOR SDVVDGR DSRLDYDP D FULDomR GH
cooperativas sociais para pessoas em desvantagem.
% 
'HVGHDGpFDGDGHGRVpFXORSDVVDGRDVSHVVRDV
acometidas de transtornos mentais tinham direito a
receber um auxlio reabilitao.
(C)
As Residncias Teraputicas foram criadas
para garantir assistncia a pacientes com grave
dependncia institucional e promover reinsero
vida comunitria de pacientes com longas internaes
psiquitricas.
(D)
Os CAPs (Centro de Ateno Psicossocial) so
servios de ambulatrio de ateno diria que
independem da estrutura hospitalar.
(E)
A equipe bsica prevista nos Centros de Ateno
Psicossocial no tem o psiclogo como obrigatoriedade
em sua constituio.

QUESTO 46

QUESTO 44
A ateno sade remete tambm doena
e essa nos lembra dor. A respeito do manejo
psicolgico do paciente com dor, assinale a
alternativa correta.
$ 
$ VHQVDomR GH GRU p XQLFDPHQWH LQXHQFLDGD SHOD
percepo do estmulo doloroso em nvel de crtex
cerebral.
% 
$ GRU p VHQWLGD GH IRUPD XQLIRUPH DVVLP D GRU GH
XPDLQIHFomRXULQiULDRXPHVPRDGRUGRSDUWRpD
mesma para todos.
&  $ GRU p XP SUREOHPD FRPSOH[R TXH HQYROYH
componentes sensoriais, emocionais, cognitivos,
comportamentais, interpessoais, culturais e sociais.
'  $V LQWHUYHQo}HV IDUPDFROyJLFDV VmR DV ~QLFDV
possveis em relao dor.
(E)
Ao avaliar um paciente com dor, cabe ao psiclogo
HQFDPLQKiOR DR PpGLFR SDUD TXH VHMD VXEVWLWXtGR R
DWHQGLPHQWRSVLFRWHUiSLFRSHORPpGLFR

$ 

(B)

(C)

(D)

10

A partir do caso exposto a seguir escolha a


alternativa que corresponde a melhor conduta a
ser seguida pelo psiclogo em relao cirurgia.
J. um paciente de meia idade, homem, fumante e
de vida sedentria. Apesar de ter diabetes melittus
e hipertenso arterial nunca aceitou tratamento e
faz de tudo para no ir ao hospital. A cerca de 2
anos perdeu sua mulher por cncer de intestino e
depois disso comeou a piorar sua dieta, no quis
mais sair de casa e muito menos ir ao mdico.
6HXV OKRV VHPSUH WHQWDYDP FXLGDU GR SDL PDV
o mesmo no aceitava. Aps passar muito mal
GHSRLVGHXPDOPRoRGHGRPLQJRFRPRVOKRV
DOPRoRTXHHOHIRLIRUoDGRDLURVOKRVROHYDUDP
ao Pronto Atendimento e os exames detectaram
que ele estava enfartando. Dessa forma, o mdico
internou J. na UTI e marcou a cirurgia com
urgncia, porm o paciente mostrava-se contra e
inseguro.
&RQVLGHUDQGRDGLFXOGDGHHPVHFXLGDUHDGLFXOGDGH
WDPEpP GRV OKRV HP FXLGDU GR SDL R PHOKRU
procedimento a seguir seria orientar e sensibilizar a
famlia para o cuidado.
Entendendo que o humor depressivo pode colaborar
de forma negativa para a evoluo do paciente e
desenrolar da cirurgia, seria prudente primeiro elucidar
RVFRQLWRVHGLVVLSDUDVDQJ~VWLDVDQWHVGHUHDOL]DUR
SURFHGLPHQWRFLU~UJLFR
O melhor a fazer nesse caso, seria realizar logo a
cirurgia evitando maior ansiedade do paciente e, como
seus problemas so crnicos, o mesmo continuaria
com as mesmas condutas.
Seria prudente conversar com a famlia, oferecendo
suporte psicolgico, para que essa decida sobre
a cirurgia mesmo o paciente estando orientado e
Cargo: Psiclogo - rea Hospitalar

(E)

(C)

consciente.
O mais coerente seria sensibilizar o paciente para o
DXWRFXLGDGRQRSyVFLU~UJLFR

(D)
QUESTO 47

(A)

% 

& 

(D)

( 

A atuao do psiclogo junto a pacientes cirrgicos


uma realidade no contexto hospitalar. Sobre a
mesma, assinale a alternativa INCORRETA.
O perodo que antecede a cirurgia pode ser chamado
GH WUDQVRSHUDWyULR H p XP PRPHQWR LPSRUWDQWH SDUD
avaliar os recursos psquicos para a realizao do
SURFHGLPHQWRFLU~UJLFR
7UDWDPHQWRV FLU~UJLFRV VmR HQWHQGLGRV FRPR XPD
agresso ao corpo e muitas vezes uma mutilao para
o paciente, dessa forma o psiclogo pode colaborar
com a elaborao da perda e reestruturao da
imagem corporal.
1R SHUtRGR TXH DQWHFHGH D FLUXUJLD p LPSRUWDQWH
a realizao de uma avaliao e de um preparo
psicolgico para o manejo da cirurgia que exigir
adaptaes na vida.
possvel que a famlia participe de preparo
SVLFROyJLFRSDUDDFLUXUJLDREMHWLYDQGRYHULFDURQtYHO
de suporte oferecido pela mesma.
$V FUHQoDV H DV H[SHFWDWLYDV SRVLWLYDV LQXHQFLDP
positivamente na postura adotada pelo paciente em
VHXWUDWDPHQWRFOtQLFRRXFLU~UJLFRHQDHYROXomRGR
mesmo.

( 

QUESTO 50

$ 
(B)

(C)
(D)

(E)
QUESTO 48

(A)

% 

& 

(D)
( 

A psicologia hospitalar considera que o estar


GRHQWHpXPIDWRUGHGHVHTXLOtEULRSDUDRVXMHLWRGH
desarmonia.
O campo de estudo da psicologia no hospital pode ser
GHQLGR SHOR GRHQWH H VXD KLVWyULD D UHODomR GHVVH
doente com a internao e intervenes teraputicas
voltadas ao doente, famlia, equipe e a interao do
doente e sua famlia com a equipe e a instituio.
$DWXDomRGRSVLFyORJRKRVSLWDODUpVHPSUHFRQGX]LGD
individualmente, pois cada doente vive sua doena
sua prpria maneira.

A clnica
com Adolescentes
tem
suas
HVSHFLFLGDGHV H QD VD~GH QmR SRGHULD VHU
diferente. Assinale a alternativa correta sobre o
Adolescente no hospital.
Uma das caractersticas que facilita o enfrentamento
GHXPDGRHQoDHKRVSLWDOL]DomRpEXVFDUHPSHULJRV
HGHVDRVPRVWUDUVXDLPRUWDOLGDGH
(PFDVRVGHGRHQoDVJUDYHVFLUXUJLDVHDWpPHVPR
nos cuidados dirios de uma hospitalizao, os pais
no devem ser includos, pois o adolescente vive um
momento de ruptura com os pais da infncia.
2 DIDVWDPHQWR GRV JUXSRV VRFLDLV DPLJRV HVFROD p
vivido com mais intensidade e sofrimento nos casos
de internao hospitalar.
As perdas tpicas da prpria adolescncia so to
GRORULGDVTXHDGRHQoDHRWUDWDPHQWRFDPSHTXHQRV
$HTXLSHWDPEpPGHYHHVWDUSUHSDUDGDSDUDOLGDUFRP
o paciente adolescente, se a equipe sabe lidar com os
pacientes crianas logo sabero com os adolescentes.

$VGRHQoDVFU{QLFDVWrPVXDVHVSHFLFLGDGHVSRU
tratarem da ausncia de cura e com isso tm um
impacto psquico diferente de uma doena aguda.
Sobre a doena crnica e os aspectos psicolgicos
e seus portadores assinale a alternativa correta.
'LDQWH GH XPD GRHQoD TXH QmR WHP FXUD D ~QLFD
SHUVSHFWLYDpDFHLWDUDPRUWH
Para melhor entender o modo de relao do paciente
com sua doena crnica, o mais importante so as
condies biolgicas.
Apesar de a doena crnica gerar limitaes e
restries, essas so passageiras.
pouco comum que pacientes com doenas crnicas
se encontrem no estado de negao da mesma, pois
percebem dia a dia a evoluo da mesma.
Alguns pacientes com longo perodo de internao,
para obter cuidados que no teriam fora do hospital,
PDQWpPXPDFURQLFLGDGHGHVXDVGRHQoDV

QUESTO 49
A Psicologia Hospitalar uma especialidade que
tem suas caractersticas prprias. Com relao
aos fundamentos da prtica do psiclogo no
hospital, assinale a alternativa INCORRETA.
$ 
$SVLFRORJLDKRVSLWDODUYDLFRQWUDRPRGHORELRPpGLFR
e busca expandir o saber biopsicossocial que privilegia
a viso holstica do homem.
% 
$SVLFRORJLDKRVSLWDODUpXPDHVWUDWpJLDGDSVLFRORJLD
GD VD~GH TXH YLVD j SURPRomR H PDQXWHQomR GD
VD~GHWDQWRQDSUHYHQomRFRPRQRWUDWDPHQWR

11

Cargo: Psiclogo - rea Hospitalar

PROVA: EBSERH - UFS


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: AOCP

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

C
B
A
D
E
X
C
B
C
E
A
D
B

39
40
41
42
43
44
45
46
47
48
49
50

C
E
X
A
B
C
X
X
A
C
X
E

Coletnea de Provas | Concursos de Psicologia

HOSPITAL UNIVERSITRIO DE SANTA MARIA DA UNIVERSIDADE FEDERAL DE SANTA MARIA - HUSM-UFSM


CONCURSO PBLICO 1/2014 - EBSERH/HUSM-UFSM
EDITAL N 03 - EBSERH - REA ASSISTENCIAL

Concurso Pblico
REF. EDITAL N 03/2014

NVEL SUPERIOR - MANH

Cargo

PSICLOGO - REA HOSPITALAR


ATENO
O Caderno de questes possui 50
(cinquenta)
questes
objetivas,
numeradas sequencialmente, de acordo
com o exposto no quadro a seguir:

MATRIA

QUESTES

Lngua Portuguesa

01 a 10

Raciocnio Lgico e Matemtico

11 a 15

Legislao Aplicada EBSERH

16 a 20

Legislao Aplicada ao SUS

21 a 25

&RQKHFLPHQWRV(VSHFtFRV

26 a 50

INSTRUES
 1D VXD )ROKD GH 5HVSRVWDV FRQUD VHX QRPH R Q~PHUR GR VHX
GRFXPHQWRHRQ~PHURGHVXDLQVFULomR$OpPGLVVRQmRVHHVTXHoD
de conferir seu Caderno de Questes quanto a falhas de impresso e
de numerao, e se o cargo corresponde quele para o qual voc se
LQVFUHYHX4XDOTXHUGLYHUJrQFLDFRPXQLTXHDRVFDO
 2 ~QLFR GRFXPHQWR YiOLGR SDUD DYDOLDomR GD SURYD p D )ROKD GH
5HVSRVWDV6ypSHUPLWLGRRXVRGHFDQHWDHVIHURJUiFDtransparente
de cor azul ou preta para o preenchimento da Folha de Respostas, que
deve ser realizado da seguinte maneira:
 2 SUD]R GH UHDOL]DomR GD SURYD p GH  TXDWUR  KRUDV LQFOXLQGR D
marcao da Folha de Respostas. Aps 60 (minutos) do incio da
prova, o candidato estar liberado para utilizar o sanitrio ou deixar
GHQLWLYDPHQWHRORFDOGHDSOLFDomR$UHWLUDGDGDVDODGHSURYDGRV
WUrV ~OWLPRVFDQGLGDWRVVyRFRUUHUiFRQMXQWDPHQWH
 $RWpUPLQRGHVXDSURYDFRPXQLTXHDRVFDOGHYROYHQGROKHD)ROKD
de Respostas devidamente preenchida e assinada. O candidato poder
levar consigo o Caderno de Questes, desde que aguarde em sala o
WpUPLQRGDDSOLFDomR
5. As provas e os gabaritos preliminares estaro disponveis no site do
Instituto AOCP - www.institutoaocp.org.br - no dia posterior aplicao
da prova.
6. Implicar na eliminao do candidato, caso, durante a realizao
das provas, qualquer equipamento eletrnico venha emitir ruidos,
mesmo que devidamente acondicionado no envelope de guarda de
pertences. O NO cumprimento a qualquer uma das determinaes
constantes em Edital, no presente Caderno ou na Folha de Respostas,
incorrer na eliminao do candidato.

Informaes Adicionais
0(xx)44 3344-4242 / www.institutoaocp.org.br / candidato@institutoaocp.org.br

(E)

O diagnstico situacional diz respeito posio que o


sujeito assume em relao doena.

QUESTO 28

$ 
% 

CONHECIMENTOS ESPECFICOS

& 

QUESTO 26
A Psicoterapia Breve uma tcnica muito utilizada
QD VD~GH H FRX FRQKHFLGD SULQFLSDOPHQWH
pela sua relao com o limite de tempo. Sobre
a temporalidade na PB, assinale a alternativa
INCORRETA.
$ 
2WHUPR3VLFRWHUDSLD%UHYHQmRpGHWRGRDGHTXDGR
SRLVRWUDWDPHQWRSRGHGXUDUDWpXPDQR
(B)
Na Psicoterapia Breve, o tempo de durao de cada
VHVVmRQmRpIXQGDPHQWDO
&  2Q~PHURGHVHVV}HVVHPDQDLVHPXPSURFHVVRGH
PB, pode variar, podendo chegar a cinco vezes por
semana.
'  2Q~PHURGHVHVV}HVRXPHVHVGHXPDWHUDSLDEUHYH
pRTXHGHQHHDFRQJXUDFRPRWDOSRULVVRGHYHVH
respeitar o padro internacional de 40 sesses.
(E)
Nem toda terapia que dura alguns meses pode ser
considerada PB.

(D)

( 

QUESTO 29
O luto antecipatrio um processo vivido
SULQFLSDOPHQWH HP FDVRV GH SDFLHQWHV TXH FDP
muito tempo hospitalizado e que j no respondem
de forma satisfatria ao tratamento. Sobre esse
processo e as possibilidades de atuao do
Psiclogo Hospitalar nessas situaes, assinale a
alternativa correta.
(A)
A tristeza antecipatria diminui medida que a perda
se torna eminente.
% 
(VVH SURFHVVR p YLYLGR DSHQDV SHORV IDPLOLDUHV GR
paciente hospitalizado.
&  3DUDLGHQWLFDUDH[LVWrQFLDGROXWRDQWHFLSDWyULRp
importante conversar abertamente sobre a morte.
(D)
O luto antecipatrio colabora de forma positiva para
o ajustamento inicial aps a perda.
(E)
A vivncia do luto antecipadamente exime os familiares
de sentir culpa quando o paciente morre, pois h um
preparo anterior.

QUESTO 27

$ 
(B)
& 
' 

Considerando o caso descrito a seguir, assinale a


alternativa INCORRETA.
Mrcia uma mulher de 39 anos que est
hospitalizada por trabalho de parto prematuro
com 21 semanas. A paciente fez 9 anos de
tratamento para engravidar e durante esse tempo
teve 3 abortos espontneos. Encontra-se muito
ansiosa e seu mdico solicitou acompanhamento
psicolgico, porm no falou Mrcia. Sendo
assim, ao chegar para atend-la, Mrcia diz ao
psiclogo que no pediu para ser atendida e
recebe mal o atendimento psicolgico.
*HUDOPHQWHDVROLFLWDomRGHDWHQGLPHQWRSVLFROyJLFDp
IHLWDSHORPpGLFRHQIHUPDJHPHIDPtOLD
8PDHVWUDWpJLDXVDGDSHORSVLFyORJRQHVVHFDVRp
conversar com a paciente sobre os supostos motivos
TXH OHYDUDP R PpGLFR D SHQVDU TXH R DWHQGLPHQWR
SVLFROyJLFRVHUiEHQpFR
)D]VHLPSRUWDQWHFRQYHUVDUFRPDSDFLHQWHDPGH
H[SOLFDURTXHpRDWHQGLPHQWRSVLFROyJLFRGHVID]HQGR
possveis fantasias em relao Psicologia.
Mesmo se a paciente, aps apresentao do Servio
GH 3VLFRORJLD DLQGD VH UHFXVDU DR DWHQGLPHQWR p
LPSRUWDQWH DR SURVVLRQDO VH FRORFDU j GLVSRVLomR H
informar onde poder ser encontrado no hospital, uma
vez que a paciente pode mudar de ideia.
1mRpFRUUHWRRSVLFyORJRVHRIHUHFHUDRDWHQGLPHQWR
SRLVpVHPSUHRSDFLHQWHTXHSURFXUDRSVLFyORJR

Diagnosticar o instante de ver, seguido pelo


tempo de entender que leva ao momento de
intervir, no necessariamente nessa ordem, mas
necessariamente ligados. (SIMONETTI, 2007,
p.33). Considerando o diagnstico em Psicologia
da Sade e Hospitalar, assinale a alternativa
correta.
2GLDJQyVWLFRpXPDYHUGDGHDEVROXWDSRULVVRGHYH
VHUIHLWRGHIRUPDFULWHULRVDHFRPPXLWDpWLFD
O instrumento de diagnstico em Psicologia Hospitalar
pRROKRFOtQLFRGRSVLFyORJR
6HSDUDU GLDJQyVWLFR H WHUDSrXWLFD p H[WUHPDPHQWH
importante para o sucesso do tratamento.
$WXDOPHQWH R GLDJQyVWLFR SVtTXLFR Vy p YDORUL]DGR
SHOD SVLTXLDWULD SRU PHLR GR VLVWHPD FODVVLFDWyULR
operacional CID e DSM.

Cargo: Psiclogo - rea Hospitalar

QUESTO 33

QUESTO 30

(A)

(B)
(C)
(D)
( 

A doena um evento que se instala de forma


central na vida das pessoas e a forma como ela
HQIUHQWDGDLQXHQFLDHPVHXWUDWDPHQWRHYROXomR
e prognstico. Assim, o psiclogo hospitalar
EXVFD LGHQWLFDU FRPR R SDFLHQWH HQIUHQWD HVVD
crise, sendo a depresso uma das posies
possveis de enfrentamento. Sobre a depresso,
assinale a alternativa correta.
O sujeito nessa posio no teme a morte e nem
a vida, sendo um equvoco pensar que por essa
indiferena no esteja sofrendo.
Essa costuma ser uma fase de desespero.
Quando um paciente encontra-se deprimido, o melhor
DID]HUpHQFRUDMiORDROKDURODGRSRVLWLYRGDVFRLVDV
A depresso sempre se mostra da mesma forma: um
risco de suicdio para o paciente.
$WULVWH]DpHTXLYDOHQWHjGHSUHVVmRHDRVHXSULPHLUR
sinal deve ser medicada.

(A)
% 
& 
(D)
(E)

QUESTO 34

$ 
(B)

QUESTO 31

(A)

(B)
& 
' 
( 

Assinale a alternativa que corresponde funo


GR&yGLJRGHeWLFD3URVVLRQDOGR3VLFyORJR
Estabelecer padres esperados quanto s prticas
UHIHUHQGDGDVSHODUHVSHFWLYDFDWHJRULDSURVVLRQDOH
pela sociedade.
Responsabilizar o Conselho de Classe (CRP) por
Do}HVHVXDVFRQVHTXrQFLDVQRH[HUFtFLRSURVVLRQDO
1RUPDWL]DUDQDWXUH]DWpFQLFDGRWUDEDOKR
6HUYLUFRPRXPFRQMXQWR[RGHQRUPDVHVHULPXWiYHO
no tempo.
$IDVWDUVHGHXPLQVWUXPHQWRGHUHH[mRYDORUL]DQGR
as normas preestabelecidas.

& 
' 

(E)

(B)

(C)

(D)

(E)

A Psicologia Hospitalar uma especialidade


reconhecida no Brasil e, como outras
HVSHFLDOLGDGHV WHP VXDV HVSHFLFLGDGHV 6REUH
essa rea de conhecimento e atuao, assinale a
alternativa INCORRETA.
$JUHJD R FRQKHFLPHQWR HGXFDFLRQDO FLHQWtFR H
SURVVLRQDOGDGLVFLSOLQD3VLFRORJLD
Por estar inserido no hospital somente, atende a
DWHQomRWHUFLiULDHPVD~GHQmRVHQGRXWLOL]DGDSDUDD
promoo e preveno.
$ 3VLFRORJLD +RVSLWDODU WDPEpP FRQWULEXL SDUD R
DSHUIHLoRDPHQWRGRVLVWHPDGHSROtWLFDGHVD~GH
2FDPSRGHDWXDomRGRSVLFyORJRQRKRVSLWDOVHGHQH
pela considerao de que a doena desarmoniza a
pessoa.
A atuao do psiclogo hospitalar est diretamente
determinada por limites institucionais, pela instituio
HPVLHVXDVUHJUDVURWLQDVHFRQGXWDVHVSHFtFD

QUESTO 35

QUESTO 32

(A)

Assinale a alternativa que NO corresponde a um


objetivo da Psicologia Hospitalar.
Assistir a pacientes, famlias e equipes.
5HDOL]DU *UXSRV 2SHUDWLYRV FRP D HTXLSH GH
enfermagem.
5HDOL]DUVXSHUYLVmRHOHLWXUDWpFQLFDFRPHVWDJLiULRV
Intervir de modo psicoteraputico com os pacientes
apenas individualmente.
Realizar triagem.

Considerando o Captulo intitulado Das


Responsabilidades do Psiclogo segundo o
&yGLJR GH eWLFD 3URVVLRQDO YLJHQWH DVVLQDOH D
alternativa INCORRETA.
dever fundamental do psiclogo prestar servios
SURVVLRQDLVHPVLWXDo}HVGHFDODPLGDGHS~EOLFDRX
de emergncia, sem visar benefcio pessoal.
vetado ao psiclogo induzir a convices polticas,
ORVyFDV PRUDLV LGHROyJLFDV UHOLJLRVDV GH
orientao sexual ou a qualquer tipo de preconceito,
TXDQGRGRH[HUFtFLRGHVXDVIXQo}HVSURVVLRQDLV
O psiclogo, ao participar de atividade em veculos
de comunicao, zelar para que as informaes
prestadas disseminem o conhecimento a respeito das
DWULEXLo}HV GD EDVH FLHQWtFD H GR SDSHO VRFLDO GD
SURVVmR
Caber aos psiclogos docentes ou supervisores
esclarecer, informar, orientar e exigir dos estudantes
a observncia dos princpios e normas contidas no
&yGLJRGHeWLFD3URVVLRQDO
O psiclogo poder utilizar o preo do servio como
forma de propaganda, atingindo as classes menos
favorecidas.

(A)
(B)
(C)
(D)
(E)

Um documento expedido pelo psiclogo, que


FHUWLFD XPD GHWHUPLQDGD VLWXDomR RX HVWDGR
SVLFROyJLFR WHP FRPR QDOLGDGH MXVWLFDU IDOWDV
e/ou impedimentos e informar se o indivduo est
DSWR RX QmR SDUD DWLYLGDGHV HVSHFtFDV DSyV D
realizao de um processo de avaliao psicolgica
dentro do rigor tcnico e tico que subscreve a
legislao, alm de solicitar o afastamento e/ou
a dispensa do solicitante, segundo o CFP (doc.
007/2003). O enunciado diz respeito
ao parecer psicolgico.
ao atestado psicolgico.
ao laudo psicolgico.
declarao psicolgica.
ao relatrio psicolgico.

QUESTO 36

Considerando o caso descrito a seguir, assinale a


alternativa que NO corresponde situao.
J. uma recm-nascida prmatura. Quando sua
me ainda estava na 27 semana de gestao,
que era de risco, devido ao aumento da presso
arterial, foi preciso realizar cesrea devido s
condies de sade da gestante. Sendo assim, o
EHEr SUHFLVRX FDU QD 87, SUpQDWDO SRU  GLDV
Durante esse tempo, sua me e a famlia em geral
visitaram J. apenas durante os trs primeiros dias,
quando a me ainda estava hospitalizada no pscesrea.

Cargo: Psiclogo - rea Hospitalar

$ 

(B)

(C)

' 
(E)

0XLWRVSURVVLRQDLVGDVD~GHDLQGDWrPGLFXOGDGHV
em reconhecer e considerar as necessidades afetivas
dos bebs, ainda que muitas pesquisas atuais
demonstrem essas.
A privao materna ocorrer se o beb for afastado
dos cuidados de sua me e ser relativamente suave
se essa criana passar a receber cuidados de outros
indivduos conhecidos.
O fato da criana receber mais visitas da me e
ter mais contato com a equipe aumenta o nvel de
infeces.
$OpPGRVFXLGDGRVGHKLJLHQHHDOLPHQWDomRWDPEpP
pQHFHVViULRDIHWRHHVWtPXORVDEHErVHFULDQoDV
Segundo Spitz (1945), se a privao durar mais
de quatro ou cinco meses, os danos podem ser
irreversveis.

(A)

% 

& 

' 
(E)

QUESTO 37

$ 

(B)
(C)
(D)

(E)

A entrevista psicolgica muito utilizada tambm


na sade, sendo a entrevista Inicial um momento
crucial para o diagnstico e o tratamento em
sade mental. Sobre a postura do psiclogo nas
entrevistas, assinale a alternativa correta.
1mRpLPSRUWDQWHHVFODUHFHUDRSDFLHQWHDVTXHVW}HV
de sigilo, pois quando ele se encontra diante do
psiclogo, o sigilo e a descrio j esto subentendidos.
Para um bom resultado no processo teraputico,
DSHQDVRSURVVLRQDOGHYHWUDEDOKDUDWLYDPHQWH
O sigilo pode ser rompido no caso de ideias, planos ou
atos seriamente auto e heterodestrutivos.
A primeira entrevista serve apenas para colher dados
GHLGHQWLFDomRGRSDFLHQWHFRPRQRPHLGDGHGDWD
de nascimento, naturalidade, procedncia, estado civil
etc.
Durante a(s) primeira(s) entrevista(s), o psiclogo
precisa fazer silncios e pausas prolongados,
colaborando para diminuir os nveis de ansiedade do
paciente.

tratamento, que inclui vrias internaes e uso de


corticoides . Sobre os aspectos psicolgicos da
doena crnica, assinale a alternativa correta.
No so s as doenas incurveis que so crnicas,
Ki WDPEpP SDFLHQWHV TXH DSyV ORQJR WHPSR GH
internao, mantm a cronicidade de sua doena,
muitas vezes para obterem cuidados que no teriam
fora do ambiente hospitalar.
4XDQGR R SDFLHQWH HQFRQWUDVH HP FRQLWR FRP D
doena crnica, no pode se esquecer de focar a
situao na doena e em suas consequncias fsicas.
$ GRHQoD p DOJR TXH YHP GH IRUD QmR WHP OLJDomR
FRP R VXMHLWR p XP LQLPLJR H[WHUQR TXH GHYH VHU
combatido.
3DUD TXH RFRUUD XP ERP WUDWDPHQWR R SURVVLRQDO
deve considerar a doena, no um sujeito doente.
O doente crnico nunca conseguir conviver com
a doena de forma mais amena, adaptando-se ao
possvel da nova condio do ser doente.

QUESTO 40

(A)
(B)
& 

(D)

( 

A dor uma sensao vivida intensamente no


ambiente hospitalar, contudo ela conta com vrios
aspectos. A respeito dos aspectos psicolgicos da
dor, assinale a alternativa INCORRETA.
A dor no pode ser compreendida integralmente fora
do contexto vital do sujeito.
Deve-se considerar o contexto momentneo do sujeito
ao avaliar a sua dor.
$RFRQVLGHUDUDGRULQWHJUDOPHQWHWDPEpPKiGHVH
considerar a hierarquia das necessidades no momento
em que ela ocorre.
Os sintomas somatoformes no podem ser
considerados como reais, devendo-se considerar a
simulao do sujeito.
$ GRU SRGH VHU XP VLQDO SDUD XPD GHFLrQFLD
momentnea ou crnica no contato do organismo com
o meio.

QUESTO 38

(A)
(B)
& 
(D)
(E)

O paciente precisar passar por um processo


psicolgico de elaborao de perda e reestruturao
de sua imagem corporal e, consequentemente,
reorganizao do seu eu fsico.
O psiclogo hospitalar depara-se com vrias
situaes em sua atuao. A partir da descrio
apresentada, assinale a alternativa INCORRETA
acerca do procedimento correspondente.
Amputao de membro inferior.
Mastectomia (retirada da mama).
+LVWHUHFWRPLD UHWLUDGDGR~WHUR 
Polidactilia (retirada de dedo extranumerrio).
Endoscopia.

QUESTO 39

R. uma mulher de 48 anos, que est em tratamento


por prpura trombocitopnica idioptica h dois
anos. Sempre muito vaidosa, quando descobriu
as primeiras manchas roxas em seu corpo, como
elas vinham com facilidade, entrou em choque. Ao
longo dos anos tambm teve que se adaptar ao

Cargo: Psiclogo - rea Hospitalar

% 
QUESTO 41
A partir do caso a seguir, assinale a alternativa
INCORRETA.
Maria uma mulher de 67 anos muito ativa,
participativa na comunidade e na igreja. Quando
WLQKDDQRVVXDOKDPDLVQRYDPRUUHXHPXP
acidente de carro, deixando uma beb de 50 dias
de nascida. Meses depois, a paciente descobriu
um cncer de mama e, com o tratamento, se curou.
Agora passa por outro momento difcil para ela:
D VHSDUDomR GH VHX OKR PDLV YHOKR 5HWRUQD DR
hospital com fortes dores de cabea e viso turva;
o diagnstico foi de tumor cerebral.
(A)
Apenas as perdas reais podem ser compreendidas
FRPRIDWRUHVGHHVWUHVVHHSRVVtYHLVGLFXOGDGHVGH
adaptao, levando formao do cncer.
% 
(PRQFRORJLDRFRQLWRSVLFROyJLFRLQFLGHHPFRPRRV
pacientes manejam seus afetos e suas experincias
de perdas.
(C)
H estudos apontando que sujeitos que desenvolvem
cncer geralmente so pessoas que assumem em
suas vidas uma vocao de servio, no sentido de
servir.
(D)
Atitudes de desistncia frente vida, observadas em
paciente com cncer, podem ser representadas por
desamparo ou desistncia.
(E)
A forma como o sujeito reage s vivncias de
VLWXDo}HV HVWUHVVDQWHV p IDWRU SUHSRQGHUDQWH DR
desenvolvimento da doena e, depois, ao tratamento.

& 
(D)
(E)

QUESTO 44

$ 
(B)

& 
' 
(E)

% 

& 

' 

(E)

$DWXDomRGRSURVVLRQDOSVLFRPSRQGRHTXLSHV
PXOWLSURVVLRQDLV QR WUDWDPHQWR GH GHSHQGrQFLD
qumica vem ganhando espao cada dia mais.
Entretanto, alguns pressupostos bsicos so
importantes quando se trata do dependente
qumico. Sobre isso, assinale a INCORRETA.
1HQKXPWUDWDPHQWRpHIHWLYRSDUDWRGDVDVSHVVRDV
O tratamento necessita ser constantemente avaliado
H PRGLFDGR GH DFRUGR FRP DV QHFHVVLGDGHV GR
paciente.
2 XVR GH PHGLFDPHQWR p LPSRUWDQWH SULQFLSDOPHQWH
se combinado com psicoterapia.
$GHVLQWR[LFDomRpVRPHQWHRFRPHoRGRWUDWDPHQWR
As comorbidades devem ser tratadas de forma
isolada.

QUESTO 45
Considerando a atuao do psiclogo na ateno
primria sade, assinale a alternativa correta.
$ 
2 SVLFyORJR QD DWHQomR SULPiULD j VD~GH FRQVHJXH
WUDEDOKDUDSHQDVFRPVD~GHPHQWDO
% 
$DWXDomRGRSVLFyORJRGDVD~GHQDDWHQomRSULPiULDp
PXLWROLPLWDGDSRLVQmRpSRVVtYHOWUDEDOKDUTXHVW}HV
do psiquismo na preveno.
(C)
Um dos enfoques de trabalho do psiclogo na ateno
SULPiULD p R UHHVWDEHOHFLPHQWR GR EHP HVWDU GD
comunidade.
'  $ SVLFRORJLD p XPD GLVFLSOLQD GH SRXFD UHOHYkQFLD
social, no sendo importante para a promoo da
VD~GH
( 
2 DFRQVHOKDPHQWR TXH PXLWDV YH]HV p HPSUHJDGR
QD DWHQomR SULPiULD QmR p XP UHFXUVR WpFQLFR GD
psicologia.

QUESTO 42

$ 

3ULPHLUDPHQWHRULHQWDUVREUHD87,GHVPLVWLFDQGRR
setor, ainda que a famlia estivesse presente quando
a paciente teve a parada.
7HQWDU FRQYHUVDU H DFDOPDU D SDFLHQWH SRLV HOD Mi
estava de alta.
Conversar com a famlia buscando ressaltar as coisas
positivas da recuperao, negando o risco de morte.
Preparar a famlia para a morte da paciente,
HQWHQGHQGR TXH HVVH p R ~QLFR SURJQyVWLFR SDUD R
caso.

Sobre a relao entre a famlia do paciente e a


hospitalizao, assinale a alternativa correta.
$R LQLFLDU R DWHQGLPHQWR FRP D IDPtOLD p LPSRUWDQWH
evidenciar como era a estrutura familiar antes e como
HODVHFRQJXUDFRPRVXUJLPHQWRGDGRHQoD
1RFDVRGHGRHQoDDJXGDQmRpQHFHVViULRPXGDQoDV
de estrutura e reorganizao da famlia, pois o evento
certamente passar rpido e a famlia no vai sofrer.
4XDQGRVHWHPXPDGRHQoDFU{QLFDpSRVVtYHOQRWDU
que a famlia tem um tempo curto para se adaptar
crise.
$R IDODU GH XP HYHQWR GH ~QLFR HSLVyGLR p SRVVtYHO
dizer que pouco afeta a famlia e que acaba no
esquecimento da histria familiar.
A famlia vive a doena de uma criana, adolescente e
adulto da mesma maneira.

QUESTO 46

$ 

QUESTO 43
E. uma senhora de 72 anos que fez uma cirurgia
ortopdica sem intercorrncias. Aps isso, ela
segue para o quarto com a famlia e, no segundo dia
de internao, quando estava j de alta, comeou a
passar mal e teve uma parada cardiorrespiratria,
VHQGR OHYDGD jV SUHVVDV j 87, D P GH VHU
reanimada. Diante do caso apresentado, assinale
a alternativa que corresponde possvel conduta
do psiclogo.
(A)
Acolher e orientar a famlia diante da eminncia da
PRUWHEXVFDQGRGDUHVSDoRjVDQJ~VWLDVGHVVD

% 

(C)

' 
(E)

10

Sobre a sade mental e a importncia do psiclogo


em seus programas, assinale a alternativa correta.
$ VD~GH PHQWDO SRGH VHU UHGX]LGD DR HVWXGR H
tratamento das doenas mentais.
$ PDLRULD GR SURJUDPDV EUDVLOHLURV GH VD~GH PHQWDO
QD DWHQomR SULPiULD FRQWD FRP XP SURVVLRQDO GD
Psicologia na equipe.
Existe uma lei federal que assegura um tratamento
mais digno, humanizado e de reinsero social s
pessoas que sofrem de transtorno mental.
$ SUHVHQoD GR SVLFyORJR p GLVSHQViYHO SRLV D
WHUDSrXWLFDpH[FOXVLYDPHQWHPHGLFDPHQWRVD
Aes para reconhecimento e tratamento precoce
GH WUDQVWRUQRV PHQWDLV VmR LQ~WHLV QD SUHYHQomR GR
suicdio, pois no h como prevenir esse evento.
Cargo: Psiclogo - rea Hospitalar

QUESTO 47

(A)
(B)

& 

(D)

(E)

QUESTO 50
A pesquisa em sade indispensvel ao
crescimento e desenvolvimento de povos e naes.
6HMDP S~EOLFDV RX SULYDGDV FRP RX VHP QV
lucrativos, as pesquisas em sade e as pesquisas
mdicas contribuem para a sade diretamente e
indiretamente. Sendo assim, assinale a alternativa
que NO contempla uma das funes do sistema
de pesquisa.
(A)
Acompanhamento e gesto.
% 
9HQGDGHWHFQRORJLDVHPVD~GH
(C)
Financiamento.
'  *HUDomRGHFRQKHFLPHQWR
(E)
Construo de capacidade.

Assinale a alternativa INCORRETA sobre Anlise


Institucional.
A Anlise Institucional se prope a descobrir e revelar
o no dito.
Para Durkheim, as instituies so uma coao
exterior, impostas pela sociedade como uma
necessidade de regulao social.
$R UHDOL]DU D$QiOLVH ,QVWLWXFLRQDO GD VD~GH FROHWLYD
FRQVLGHUDVH D VD~GH FROHWLYD FRPR LQVWLWXLomR
problematizando a prpria constituio de seu campo
como um conjunto de saberes e prtica.
Na proposta da Anlise Institucional, a formao
terica e social tornam-se dissociadas: um momento
pRGDSHVTXLVDHRXWURGDSURGXomRWHyULFD
Uma das etapas da Anlise Institucional consiste na
QHJDomR GD QHJDomR H p XP SURFHVVR LQVSLUDGR QD
GLDOpWLFDGH+HJHO

QUESTO 48

$ 

% 

& 

(D)

(E)

2 SURVVLRQDO GD 3VLFRORJLD DR VHU UHFRQKHFLGR


na rea da sade e adentrar em hospitais, unidades
bsicas de sade, entre outros, passa a compor a
equipe de sade. Sobre essa relao, assinale a
alternativa INCORRETA.
&DEHDRSVLFyORJRQDHTXLSHGHVD~GHFRQYHUVDUH
analisar o caso de seus pacientes de forma conjunta,
sempre mantendo o sigilo e preservando seus
pacientes.
(QWHQGHQGR TXH D HTXLSH GH VD~GH p FRPSRVWD SRU
SURVVLRQDLV GH YiULRV VDEHUHV p LPSRUWDQWH TXH R
psiclogo utilize em seu dilogo/escrita linguagem
FODUDHREMHWLYDHYLWDQGRWHUPRVWpFQLFRVHHVSHFtFRV
da Psicologia.
$LQWHJUDomRGDHTXLSHGHVD~GHpLPSUHVFLQGtYHOSDUD
que o atendimento e o cuidado atinjam a amplitude do
FRQFHLWRGHVD~GH
Os psiclogos muitas vezes ocupam o lugar
GH WUDGXWRUHV HQWUH RV PpGLFRV H RV XVXiULRV
possibilitando uma melhor qualidade na relao entre
eles.
A Psicologia Hospitalar busca comprometer-se com
questes ligadas apenas qualidade de vida dos
usurios, eximindo-se das questes relacionadas aos
SURVVLRQDLVGDHTXLSHGHVD~GH

QUESTO 49

(A)
(B)
(C)
(D)
(E)

F. uma mulher de meia idade que, aps


internao com problemas renais, precisar
realizar hemodilise. Como ela nunca fez
procedimento parecido e pouco conhece sobre o
assunto, encontra-se muito ansiosa com a notcia
recm-recebida, sendo que a primeira sesso
ser no dia seguinte. Diante do caso, assinale a
alternativa que corresponde melhor conduta a
ser adotada pelo psiclogo hospitalar.
Anlise conceitual.
Orientao psicolgica.
Orientao para alta.
Suporte psicolgico.
Observao psicolgica.

11

Cargo: Psiclogo - rea Hospitalar

PROVA: EBSERH - UFSM


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: AOCP

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

D
B
E
C
A
A
E
D
B
B
C
C
E

39
40
41
42
43
44
45
46
47
48
49
50

A
D
A
A
X
E
C
C
D
E
D
B

Coletnea de Provas | Concursos de Psicologia

CEFET

29

CEFET

EDITAL No 0011/2014,
DE 25 DE MARO DE 2014

CARGOS DE CLASSE E

PSICLOGO
LEIA ATENTAMENTE AS INSTRUES ABAIXO.
01 - O candidato recebeu do fiscal o seguinte material:
a) este CADERNO DE QUESTES, com o enunciado das 50 (cinquenta) questes objetivas, sem repetio ou falha, com a
seguinte distribuio:
CONHECIMENTOS BSICOS
LNGUA
PORTUGUESA

MATEMTICA E
RACIOCNIO LGICO

INFORMTICA

LEGISLAO

CONHECIMENTOS
ESPECFICOS

Questes

Pontuao

Questes

Pontuao

Questes

Pontuao

Questes

Pontuao

Questes

Pontuao

1 a 10

1,0 cada

11 a 15

1,0 cada

16 a 20

1,0 cada

21 a 25

1,0 cada

26 a 50

1,0 cada

Total: 10,0 pontos

Total: 5,0 pontos

Total: 5,0 pontos

Total: 5,0 pontos

Total: 25,0 pontos

Total: 50,0 pontos


b) CARTO-RESPOSTA destinado s respostas das questes objetivas formuladas nas provas.
02 - O candidato deve verificar se este material est em ordem e se o seu nome e nmero de inscrio conferem com os que
aparecem no CARTO-RESPOSTA. Caso no esteja nessas condies, o fato deve ser IMEDIATAMENTE notificado ao
fiscal.
03 - Aps a conferncia, o candidato dever assinar, no espao prprio do CARTO-RESPOSTA, com caneta esferogrfica de
tinta preta, fabricada em material transparente.
04 - No CARTO-RESPOSTA, a marcao das letras correspondentes s respostas certas deve ser feita cobrindo a letra e
preenchendo todo o espao compreendido pelos crculos, com caneta esferogrfica de tinta preta, fabricada em material
transparente, de forma contnua e densa. A leitura tica do CARTO-RESPOSTA sensvel a marcas escuras, portanto,
os campos de marcao devem ser preenchidos completamente, sem deixar claros.
Exemplo:
05 - O candidato deve ter muito cuidado com o CARTO-RESPOSTA, para no o DOBRAR, AMASSAR ou MANCHAR. O
CARTO-RESPOSTA SOMENTE poder ser substitudo se, no ato da entrega ao candidato, j estiver danificado em suas
margens superior e/ou inferior - DELIMITADOR DE RECONHECIMENTO PARA LEITURA TICA.
06

- Para cada uma das questes objetivas, so apresentadas 5 alternativas classificadas com as letras (A), (B), (C), (D) e (E); s
uma responde adequadamente ao quesito proposto. O candidato s deve assinalar UMA RESPOSTA: a marcao em mais
de uma alternativa anula a questo, MESMO QUE UMA DAS RESPOSTAS ESTEJA CORRETA.

07 - As questes objetivas so identificadas pelo nmero que se situa acima de seu enunciado.
08

09
10
11

12

- SER ELIMINADO deste Concurso Pblico o candidato que:


a) se utilizar, durante a realizao das provas, de aparelhos sonoros, fonogrficos, de comunicao ou de registro, eletrnicos ou no, tais como agendas, relgios no analgicos, notebook, transmissor de dados e mensagens, mquina
fotogrfica, telefones celulares, pagers, microcomputadores portteis e/ou similares;
b) se ausentar da sala em que se realizam as provas levando consigo o CADERNO DE QUESTES e/ou o CARTO-RESPOSTA;
c) se recusar a entregar o CADERNO DE QUESTES e/ou o CARTO-RESPOSTA, quando terminar o tempo estabelecido;
d) no assinar a LISTA DE PRESENA e/ou o CARTO-RESPOSTA.
Obs. O candidato s poder ausentar-se do recinto das provas aps 1 (uma) hora contada a partir do efetivo incio das
mesmas. Por motivos de segurana, o candidato NO PODER LEVAR O CADERNO DE QUESTES, a qualquer
momento.
- O candidato deve reservar os 30 (trinta) minutos finais para marcar seu CARTO-RESPOSTA. Os rascunhos e as marcaes assinaladas no CADERNO DE QUESTES NO SERO LEVADOS EM CONTA.
- O candidato deve, ao terminar as provas, entregar ao fiscal o CADERNO DE QUESTES e o CARTO-RESPOSTA e
ASSINAR A LISTA DE PRESENA.
- O TEMPO DISPONVEL PARA ESTAS PROVAS DE QUESTES OBJETIVAS DE 4 (QUATRO) HORAS, j includo o tempo para marcao do seu CARTO-RESPOSTA, findo o qual o candidato dever, obrigatoriamente, entregar o
CARTO-RESPOSTA e o CADERNO DE QUESTES.
- As questes e os gabaritos das Provas Objetivas sero divulgados no primeiro dia til aps sua realizao, no endereo
eletrnico da FUNDAO CESGRANRIO (http://www.cesgranrio.org.br).

PSICLOGO

CEFET

CONHECIMENTOS ESPECFICOS

29
Uma avaliao de desempenho implica a construo de critrios que podem ser qualificados como tericos ou reais.

26
Em uma organizao de trabalho, cada vez que um colaborador alcana as metas de desempenho mensais, propostas por sua gerncia, ele tem a possibilidade de escolher um dia da semana em que trabalhar apenas meio
perodo, no ms seguinte, sem perda de remunerao.
Essa reduo da carga horria vigora por um ms, at
seu desempenho ser novamente avaliado, de tal modo
que o seu meio perodo de folga seja mantido ou modificado.

Um critrio real exemplificado no caso em que um desempenho avaliado como bom o de um


(A) professor que ministra conhecimentos relevantes e
claros aos seus alunos.
(B) vendedor que alcana a meta de vendas estabelecida
pela gerncia de sua loja.
(C) policial que contribui para garantir a ordem e a segurana da populao.
(D) escritor que produz livros relevantes e interessantes
para seu pblico.
(E) motorista que conduz veculos de maneira segura e
eficaz.

De acordo com a teoria da aprendizagem, o comportamento no sentido de cumprir as metas mensais de um


funcionrio, cuja carga horria foi reduzida, est sendo
(A)
(B)
(C)
(D)
(E)

reforado negativamente
reforado positivamente
modelado vicariamente
estimulado aversivamente
apreendido cognitivamente

30
Um psiclogo, trabalhando em um programa de treinamento, realiza um trabalho nas seguintes etapas: desenvolve uma srie de critrios comparativos para estabelecer
um padro; produz um projeto de estudos especificando
como os dados sero coletados e quais sero as medidas
utilizadas para avaliar os critrios inicialmente produzidos;
coleta dados com os sujeitos aos quais o treinamento se
dirige e, finalmente, analisa os dados e interpreta resultados.

27
Em uma organizao de trabalho, os colaboradores de
uma determinada funo recebem seu salrio-base mensalmente, acrescido de um diferencial proporcional sua
produtividade naquele ms.

Pela anlise do trabalho descrito acima, conclui-se que o


psiclogo se encontra na seguinte etapa do programa de
treinamento:

De acordo com a teoria da aprendizagem, o programa de


reforamento que est sendo utilizado o esquema de
(A) reforo contnuo
(B) intervalo e razo fixos
(C) intervalo fixo e razo varivel
(D) intervalo e razo variveis
(E) intervalo varivel e razo fixa

(A)
(B)
(C)
(D)
(E)

28

Avaliao do treinamento
Avaliao das necessidades de treinamento
Aplicao do treinamento
Definio dos objetivos do treinamento
Projeto de treinamento

31

Em um ambiente de trabalho, duas equipes esto diante


de uma negociao sobre uma meta de carter trivial em
que a barganha integrativa impossvel. Apesar de a resoluo dessa questo ter igual importncia para ambas
as partes, e no haver presso de tempo, h forte presena de conflitos interpessoais, com ameaa de rupturas
irreversveis durante o processo de negociao, independente do resultado.

Em paralelo s estratgias motivacionais utilizadas oficialmente, a psicodinmica do trabalho demonstrou que


o zelo no trabalho e o comprometimento com a produtividade so promovidos, largamente, pela manipulao de
ameaas veladas e pela gesto do medo do trabalhador.
O zelo no trabalho, nesse contexto, descrito como a
(A) submisso estrita e literal s instrues recebidas dos
superiores para a execuo das tarefas.
(B) ao transgressora e clandestina que subverte as
regras prescritas para viabilizar o trabalho real.
(C) vigilncia discreta e permanente que controla os colegas que executam funes anlogas s do trabalhador.
(D) comunicao clara e frequente entre produo e superviso que informa sobre possveis melhorias dos
procedimentos.
(E) conformao ativa e intencional dos recursos fsicos
e psquicos do trabalhador para superao das metas
de produo.

Havendo um problema muito mais importante a ser resolvido em um futuro prximo, o qual necessitar da atuao
engajada e articulada das duas equipes, a estratgia de
gerenciamento de conflitos mais adequada a ser tomada,
nesse momento, por quem estiver no comando de uma
dessas equipes a
(A) competio
(B) colaborao
(C) conciliao
(D) evaso
(E) benevolncia

PSICLOGO

CEFET

32

35

Pode-se perguntar o qu, no trabalho, fonte especfica de nocividade para a vida mental. A luta pela sade
do corpo conduzia denncia das condies de trabalho. Quanto ao sofrimento mental, ele resulta da organizao do trabalho.

O supervisor de um grupo aponta uma falha cometida


por um trabalhador, reclamando, veementemente, da
recorrncia dessa falha. Esse trabalhador, aps o constrangimento pblico, e imediatamente aps assumir a responsabilidade pelos problemas causados, abre um surto
psictico.
De acordo com a psicodinmica do trabalho proposta por
Dejours, a relao entre o trabalho e a ecloso do surto se
explica pelo(s) seguinte(s) fato(s):
(A) Uma srie de fatores psquicos e fisiolgicos, sendo
contingente a relao entre surto e trabalho.
(B) A superviso representar um papel ocupado pela
figura paterna e a reprovao recebida dessa figura
promover a desestruturao da personalidade.
(C) O trabalho ser estruturante da personalidade em
nossa cultura, e a distncia experimentada entre o
trabalho realizado e o prescrito ter causado a psicose.
(D) A estrutura da personalidade do trabalhador j ser
psictica e o episdio no ambiente do trabalho ter
operado como fator desencadeante dos sintomas.
(E) As relaes sociais garantirem ou impedirem a sade
mental e a perda das garantias posio social
ocupada pelo trabalhador o condenarem patologia.

DEJOURS, Christophe. A loucura do trabalho. So Paulo:


Cortez, 2012. p. 25.

O setor que mais cresce, atualmente, o setor tercirio,


e, com isso, o modelo taylorista perdeu relevncia. Novas
questes surgiram para aqueles que lidam com a relao
entre sade e trabalho. No trecho citado, encontra-se uma
importante distino imposta por essas transformaes
do mundo do trabalho.
De acordo com a abordagem representada, um exemplo
de problema relacionado organizao do trabalho seria a
(A) submisso a nveis elevados de rudo
(B) presena de vrus, fungos e bactrias no local de
trabalho
(C) assuno da responsabilidade pela vida de outras
pessoas
(D) exposio a situaes de risco necessrias execuo da tarefa
(E) inadequao das caractersticas antropomtricas do
posto de trabalho

36
Um psiclogo chamado a sugerir modificaes na
forma como o trabalho realizado em um contexto organizacional.
Se o objetivo o aumento da motivao dos trabalhadores, e o psiclogo orientado por uma das clnicas do
trabalho, ele dever sugerir
(A) aumento da remunerao que o trabalhador recebe
pelo trabalho que realiza.
(B) permisso para que o trabalhador exera maior controle sobre os ritmos de seu trabalho.
(C) estabelecimento de perodos de inatividade obrigatria dentro da jornada normal de trabalho.
(D) minimizao das variaes das funes exercidas por
cada trabalhador, padronizando as tarefas.
(E) divulgao dos critrios utilizados para avaliao e
gratificao do desempenho dos trabalhadores.

33
Com a globalizao e com as novas formas de contrato de
trabalho, a distino da incluso e da excluso do mundo
do trabalho vem sendo cada vez mais difcil de sustentar.
No contexto contemporneo, mesmo um trabalhador com
vnculo estvel pode experimentar a precarizao subjetiva de seu trabalho quando
(A) o equipamento utilizado inadequado s caractersticas do corpo humano.
(B) o exerccio de sua funo pode exp-lo a situaes
em que h risco de ele ser assaltado ou sequestrado.
(C) os recursos necessrios para responder s exigncias
de seu trabalho no esto sendo garantidos.
(D) a possibilidade de crescimento e evoluo na carreira
e a adeso aos treinamentos oferecidos pela organizao esto vinculadas.
(E) as condies ambientais em que as tarefas vo ser
realizadas esto aqum do limite da salubridade.

37
A posio de Vygotsky sobre a relao entre desenvolvimento e aprendizagem que o
(A) desenvolvimento dependente da maturao e condiciona o aprendizado.
(B) desenvolvimento definido como a substituio de
respostas inatas a partir do aprendizado.
(C) aprendizado e o desenvolvimento so coincidentes e
contemporneos.
(D) aprendizado alavanca o desenvolvimento devido ao
estabelecimento das relaes sociais.
(E) processo de desenvolvimento da criana independente do aprendizado.

34
As culturas organizacionais podem ser qualificadas como
fortes ou fracas. Cada uma dessas conformaes traz
vantagens e desvantagens.
Comparando-se uma cultura organizacional forte com
uma fraca, percebe-se que a cultura mais forte favorece a
(A) estabilidade do sistema social
(B) aquisio de outras empresas
(C) diversidade de seus funcionrios
(D) flexibilidade em relao a mudanas
(E) formalizao das regras de comportamento

PSICLOGO

CEFET

38

41

Do ponto de vista especfico da psicodinmica do trabalho, a sade mental do trabalhador depende da

Um psiclogo foi contratado por uma escola para fazer


uma interveno em uma turma onde frequente a ocorrncia de bullying. Depois de um primeiro momento com
os professores, o psiclogo percebeu que, em sua prtica,
os docentes da referida escola associam esses comportamentos indisciplina e s dificuldades de aprendizagem,
embora pensem que a soluo do problema seria tarefa
do Conselho Tutelar ou da Polcia Militar.

(A) relao de poder estabelecida entre trabalhadores e


supervisores de uma organizao de trabalho.
(B) percepo, no trabalho, da justia distributiva e atributiva na forma como as tarefas e os trabalhadores so
alocados.
(C) adequao das condies ambientais em que o
trabalho realizado s preferncias e peculiaridades
do trabalhador.
(D) inexistncia, no ambiente de trabalho, de ameaas
reais ou potenciais segurana psicolgica e fsica
do trabalhador.
(E) possibilidade de encontrar, no trabalho, vias convenientes de descarga da energia psquica e psicomotora do trabalhador.

A partir das ferramentas conceituais da anlise institucional, uma possibilidade de ao a ser proposta pelo psiclogo seria o(a)
(A) uso estratgico da soluo pensada pelos professores como foco de reflexo sobre sua posio frente ao
problema do bullying.
(B) implementao de atividades com os professores
para aumentar a confiana, a coeso e a abertura entre eles.
(C) investigao da dinmica escolar com o intuito de melhorar o desempenho dos professores em relao ao
problema.
(D) investigao da dinmica escolar com o intuito de melhorar o desempenho dos alunos em relao ao problema.
(E) criao de uma dinmica entre os grupos de professores e de alunos com a ideia de mudar atitudes e
esteretipos desenvolvidos.

39
A situao abaixo ilustra um conflito que envolve um dos
componentes das relaes interpessoais, tais como so
descritas pela psicologia organizacional.
O coordenador de um grupo de pesquisa precisa selecionar
um membro de sua equipe para uma importante viagem
de intercmbio, que tem carter emergencial e durao
indeterminada. O pesquisador adequado para a tarefa
tambm seu genro, cujo filho est prestes a nascer.
O conflito em questo relativo

42

(A) socializao
(B) comunicao
(C) interdependncia
(D) equidade
(E) aos papis

Considere as situaes descritas a seguir.


Situao 1
Os inspetores de uma empresa devem, ao final do dia,
reportar-se ao gerente de seu departamento para terem
seu trabalho avaliado.

40

Situao 2

Em uma pesquisa acerca do desenvolvimento, um


psiclogo coloca frente de duas crianas 4 quadrados
azuis, 4 quadrados vermelhos e 4 crculos azuis, cortados
em cartolina. O investigador afirma que algum disse que
todos os crculos so azuis e pergunta o que as crianas
acham disso. A criana A diz que isso falso, pois tambm
h quadrados azuis. A criana B diz que verdade, pois
no h crculos vermelhos.

Os funcionrios de uma Universidade uniram-se com o


intuito de reivindicar melhores condies salariais.
Situao 3
Aos domingos, um grupo de operrios de uma empresa
metalrgica rene-se para assistir aos jogos de seu time
de futebol.

De acordo com a teoria piagetiana, essas duas crianas


esto, respectivamente, nos seguintes estgios de seu
desenvolvimento:

Ao se classificarem os grupos em formais e informais,


percebem-se 4 tipos especficos. A partir desse modo de
classificao, verifica-se que caracterstica do grupo da
situao

(A) operacional formal; pr-operacional


(B) operacional formal; operacional concreto
(C) operacional concreto; operacional formal
(D) pr-operacional; operacional concreto
(E) sensrio-motor; operacional formal

(A)
(B)
(C)
(D)
(E)

1 ser informal de amizade.


2 ser formal de comando.
2 ser informal de interesse.
3 ser formal de tarefa.
3 ser formal de comando.

PSICLOGO

CEFET

43

45

O Plano Nacional de Educao em Direitos Humanos tem


entre seus objetivos o exerccio da cidadania e a formao de sujeitos que possam compreender e fortalecer os
direitos humanos. Esse Plano tem 5 eixos estratgicos
importantes para o alcance de seus objetivos.
Considere os aspectos descritos em 2 desses eixos.

Considere as seguintes situaes descritas a seguir:


Situao 1
O grupo de professores do curso de Fsica da Universidade X demonstra uma grande coeso em suas decises
sobre as vicissitudes do curso e uma forte proximidade
relacional entre seus membros.

Descrio 1

Situao 2

Eixo estratgico que se caracterizou pela maior incidncia da ao de movimentos sociais e organizaes no
governamentais (ONG). Os movimentos sociais tiveram
grande importncia na constituio de um fortalecimento
de aes em direitos humanos, e as ONG, com aes que
se preocupam com as violaes e a fortificao dos direitos humanos, ajudaram na construo de um espao de
ensino profissionalizante.

A empresa Y possui um grupo experiente de contadores.


Esse grupo formou-se ao longo dos anos a ponto de sua
funcionalidade estruturada encontrar-se estabelecida e
consolidada, possibilitando ao grupo voltar seus esforos
compreenso de tarefas e aos objetivos a serem realizados.
A partir do modelo de 5 estgios de desenvolvimento de
grupo, os grupos apontados nas situaes 1 e 2 encontram-se, respectivamente, nos seguintes estgios:

Descrio 2
Eixo estratgico que perpassa todos os eixos do PNEDH.
Ele visa articulao dos conhecimentos de direitos humanos nos mbitos da investigao cientfica, da criao,
da crtica e da produo e sistematizao de novos conhecimentos em direitos humanos.

(A)
(B)
(C)
(D)
(E)

As descries 1 e 2 referem-se, respectivamente, aos seguintes eixos estratgicos:

normatizao; tormenta
normatizao; desempenho
formao; normatizao
formao; interrupo
interrupo; tormenta

(A) Educao dos Profissionais de Justia e Segurana;


Educao e Mdia
(B) Educao Bsica; Educao Superior
(C) Educao no formal; Educao Superior
(D) Educao Superior; Educao dos Profissionais de
Justia e Segurana
(E) Educao e Mdia; Educao Bsica

46

44

Tendo-se em vista as diferentes tticas de desenvolvimento organizacional, a descrita na situao classificada como ttica de

Um psiclogo foi contratado por uma empresa para intervir


institucionalmente. Esse consultor rene-se com um grupo
de gerentes da empresa. Seu trabalho consiste em identificar os parmetros positivos observveis na dinmica
organizacional, com o intuito de utiliz-los como ponto de
partida para a melhoria do desempenho desses gerentes.

Com a influncia no s dos movimentos de crticas aos


paradigmas psicolgicos no perodo posterior ditadura,
mas tambm do mbito decorrente da esfera poltico-social
brasileira, a psicologia escolar fortificou-se como campo de
atuao, apresentando como diretrizes de trabalho a(o)

(A)
(B)
(C)
(D)
(E)

(A) utilizao da psicometria como principal instrumento


do contexto escolar para a promoo social dos mais
aptos.
(B) investigao fechada em laboratrios anexados s
escolas, com o objetivo de implementao de atividades de experimentao.
(C) compreenso do contexto escolar a partir de uma
perspectiva adaptacionista, percebendo os alunos
como indivduos que devem ser ajustados.
(D) compreenso da realidade concreta do ambiente escolar luz de uma interpretao multirreferencial, levando em conta a relao dialtica entre individuo e
sociedade.
(E) desenvolvimento de prticas psicodiagnsticas com o
intuito de fortalecer a construo de uma mo de obra
de reserva para o modo de produo capitalista.

PSICLOGO

construo de equipes
consultoria de processo
investigao apreciativa
treinamento de sensibilidade
desenvolvimento intergrupos

47
A teoria do Arco Normando de Super tem grande importncia no desenvolvimento da Orientao Profissional.
Nesse modelo, existem 2 pilares sustentados pelas bases
geogrficas e biolgicas.
Os aspectos contemplados no pilar esquerdo do Arco
Normando so
(A)
(B)
(C)
(D)
(E)

10

emprego e self
inteligncia e escola
famlia e mercado de trabalho
valores e aptides
papis dos auto-conceitos e self

CEFET

48

50

O psiclogo escolar atua em diversas situaes cotidianas no mbito da escola. Considere as situaes 1 e 2 em
que esse profissional atuou.

Ao tratar da questo do pensamento, Piaget afirma a diferena entre o pensamento dirigido e o pensamento autstico, situando o pensamento egocntrico em relao queles. Seus trabalhos iniciais so cuidadosamente lidos e
criticados por Vigotski.
As crticas s concluses de Piaget ocorrem porque, para
Vigotski, a(o)
(A) fala egocntrica compreende uma tentativa de comunicao.
(B) desenvolvimento da linguagem e do pensamento partem do individual para o social.
(C) desenvolvimento do pensamento e da linguagem no
esto vinculados.
(D) desenvolvimento ocorre da fala social para a egocntrica, que se transformar em fala interior.
(E) pensamento egocntrico infantil deve ser enfatizado e
no tomado como transitrio e secundrio.

Situao 1
O psiclogo props um plano de incentivo qualidade de
vida para os funcionrios do colgio X.
Situao 2
Em um colgio da zona norte da cidade, o psiclogo escolar, a partir das demandas da instituio, foi instado a elaborar um plano para fortificar a articulao entre as teorias
da aprendizagem e as prticas de ensino utilizadas, alm
de implementar reunies visando orientao de pais e
familiares sobre a dinmica escolar.
A partir da anlise das situaes, verifica-se que o foco da
interveno na situao
(A)
(B)
(C)
(D)
(E)

1 recai sobre a comunidade.


1 recai sobre a escola como administrao.
1 recai sobre os professores e a comunidade.
2 recai sobre os alunos e a comunidade.
2 recai sobre os alunos.

49
Em uma escola de Ensino Mdio, os alunos de uma das
turmas de 1o ano apresentam alto grau de agressividade
e de rebeldia em relao aos professores. Para tentar solucionar o problema, o psiclogo escolar foi chamado para
elaborar algumas estratgias.
Em relao s estratgias a serem sugeridas por esse
profissional, considere as afirmativas a seguir.
I

- Esse prossional deve viabilizar um debate com o


objetivo de resgatar o valor social do educador.
II - A Escola deve implementar o Sistema de Medio
Semestral.
III - A Escola deve criar regras bem denidas para sua
adequada aplicao no ambiente da sala de aula.

SC

correto o que se afirma em


(A)
(B)
(C)
(D)
(E)

II, apenas
III, apenas
I e II, apenas
II e III, apenas
I, II e III

SC

11

PSICLOGO

PROVA: CEFET - RJ
ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: CESGRANRIO

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

A
C
D
B
A
B
C
C
A
D
B
D
E

39
40
41
42
43
44
45
46
47
48
49
50

E
D
A
C
C
D
B
C
D
B
B
D

Coletnea de Provas | Concursos de Psicologia

||TCDF14_003_05N204203||

CESPE/UnB TCDF/ANAP Aplicao: 2014

CONHECIMENTOS ESPECFICOS
Em relao tica profissional do psiclogo clnico e biotica na
sade, julgue os itens a seguir.


!

"

Na rea da psicologia, em pesquisas que envolvam seres


humanos, deve-se seguir um protocolo determinado por um
comit de tica, e o pesquisador deve ter o compromisso
prvio de tornar pblico os resultados da pesquisa.
A relao existente entre a interveno do psiclogo clnico e
a biotica pressupe uma viso de homem no dicotomizada,
que trata o objetivo e o subjetivo, o geral e o particular da
complexidade humana como foras complementares, e no
excludentes.
Como referencial tico, o princpio da beneficncia estabelece
que os atos diagnsticos ou teraputicos devam, alm de no
causar, evitar danos ao paciente, ao passo que o princpio da
no maleficncia pressupe a oferta da melhor assistncia
possvel ao paciente com o intuito de prevenir, remover ou
evitar o malefcio.
O princpio da autonomia, por pressupor a capacidade do
indivduo de entender e agir intencionalmente sobre o seu
problema, assegura que o direito de consentir ou recusar o
tratamento cabe ao paciente, ou sua famlia caso o paciente
seja incapaz de tomar decises.

Um adolescente de quatorze anos de idade, analfabeto e


com histrico de desmaios desde os seis anos de idade, aps agredir
o irmo com uma faca e posteriormente tentar suicdio, foi levado
pela famlia ao servio de psicologia clnica do hospital geral da
cidade onde mora. O profissional que realizou o atendimento
observou que o paciente apresentava dificuldades na fala e na
compreenso de algumas perguntas, alm de restries motoras e
sensoriais.

No que se refere ao processo de avaliao psicolgica, julgue os


prximos itens.
&

Na avaliao psicolgica, o objetivo da classificao


nosolgica investigar as irregularidades ou inconsistncias
do quadro sintomtico do paciente, para possibilitar a
diferenciao das alternativas diagnsticas, os nveis de
funcionamento ou a natureza da patologia do paciente.

$'

Na emisso de um laudo psicolgico, o psiclogo dever


respeitar o direito do indivduo de conhecer os resultados da
avaliao psicolgica, as interpretaes feitas por esse
profissional e as bases nas quais se fundamentam suas
concluses.

Caso haja extino do servio de psicologia de determinado


hospital, o psiclogo responsvel pelo servio dever informar
ao Conselho Regional de Psicologia e este providenciar a
destinao correta dos arquivos confidenciais.

Acerca da interveno do psiclogo, julgue os itens subsequentes.


$

Nos casos de pacientes em tratamento para cirurgia da


obesidade, a anamnese realizada na avaliao psicolgica
pr-operatria busca identificar, entre outros fatores, a
existncia de padres de compulso alimentar, ansiedade e
depresso.

$!

As causas da obesidade so multifatoriais, e a eficcia do


tratamento preconiza o trabalho multidisciplinar, no entanto

Considerando a situao hipottica apresentada acima, a avaliao


psicolgica e o psicodiagnstico, julgue os seguintes itens.

so responsabilidades especficas do mdico o diagnstico e a


indicao do tratamento.

#



Por considerar fatores como faixa etria, dificuldades motoras


e verbais e nvel de escolaridade do paciente, o teste Wais
indicado para esse paciente.
Na situao hipottica apresentada acima, a entrevista
estruturada o modelo apropriado para ser realizado pelo
psiclogo, pois lhe possibilita obter informaes de modo
profundo e padronizado e lhe proporciona uma grande
aproximao com o paciente, o que resulta em uma grande
eficcia na avaliao psicolgica e no psicodiagnstico.

$"

sintomatologias e patologias de forma a reduzir o sofrimento


do indivduo e diminuir as ocorrncias de delitos.
$#

%

domstica.

Ao realizar uma entrevista sistmica, o psiclogo poder


utilizar o genetograma, que consiste em um instrumento clnico
de investigao inter- e transgeracional, para avaliar a estrutura
e a psicodinmica da famlia do paciente.
Na avaliao psicolgica inicial, o psiclogo que atender a esse
adolescente dever priorizar a aplicao de testes a fim de
verificar o grau de comprometimento cognitivo e motor do
paciente.

O psiclogo que atua na comunidade deve abster-se de intervir


em situaes de crise, como divrcio parental e violncia

$
$

Compete ao psiclogo forense o diagnstico e tratamento de

Se o psiclogo, na avaliao inicial, perceber sinais de


violncia contra o paciente idoso e constatar perigo iminente,
dever agir de forma a garantir a integridade e a segurana do
paciente.

$$

A Escala de Depresso Geritrica o instrumento mais


conhecido para o diagnstico da depresso em pacientes
idosos, sendo o seu uso restrito a mdicos e psiclogos.


||TCDF14_003_05N204203||

CESPE/UnB TCDF/ANAP Aplicao: 2014

Com relao ao tratamento e preveno da dependncia qumica,

humor e da energia, hipersonia, sintomas depressivos,

Dora, com sete anos de idade, foi atendida por um pediatra


que constatou que ela havia perdido peso, andava chorando
facilmente e apresentava medo de se alimentar, razo por que a
encaminhou para acompanhamento psicolgico. Nas primeiras
entrevistas realizadas pelo psiclogo, a me de Dora relatou que os
sintomas constatados pelo pediatra haviam comeado
aproximadamente seis semanas antes, aps um episdio de engasgo.
A partir de ento, Dora passou a mostrar-se ansiosa e a relatar medo
de morrer. Alm disso, Dora apresenta dificuldades em se separar
da me quando chega escola, reluta em ficar em casa quando a
me no est presente, tem pesadelos recorrentemente e acorda com
dores abdominais, chorando e dizendo que est com medo de que
a me morra.

arrependimento pelo uso da droga e esgotamento fsico.

Considerando essa situao hipottica, julgue os itens subsecutivos.

Na entrevista motivacional para o tratamento da dependncia

A preocupao excessiva de Dora em relao ingesta


alimentar, associada ansiedade, reflete um quadro de
transtorno dismfico corporal.

Dora apresenta um transtorno de ansiedade de separao,


evidenciado pela ocorrncia de pesadelos, pela ansiedade e
pela relutncia em separar-se da me.

julgue os itens que se seguem.




Uma das estratgias possveis no tratamento da dependncia


qumica, pautada na reduo de danos, a terapia de
substituio, que consiste na troca da droga por outra com a
qual o usurio possa estabelecer um padro de uso menos
danoso.

A sndrome disfrica tardia a primeira fase da sndrome de


abstinncia da cocana e caracteriza-se por drstica reduo do

qumica, o psiclogo clnico o responsvel por estabelecer


uma relao emptica com o paciente, ao mesmo tempo em
que estimula a autonomia, a responsabilidade pessoal e o
desejo de mudana por meio de uma abordagem diretiva e no
confrontativa.

O sofrimento apresentado pela criana no caso clnico citado


significativo, acarretando prejuzos no mbito social e no
escolar.

"

O medo de comer indica que Dora apresenta um transtorno da


alimentao da primeira infncia, associado a um transtorno de
apego reativo.

O diagnstico mais provvel nesse caso de anorexia, j que


Dora apresenta consequncias orgnicas, psicolgicas, sociais
e escolares.

Em uma escuta psicanaltica, o profissional dever focar a


ateno nas vivncias infantis de Dora e nas experincias
transcorridas em sua relao com sua me.

Com base nas teorias de Jacques Lacan, correto afirmar que


Dora apresenta uma distoro do esquema corporal devido
impossibilidade de constituio da imago totalizante.

&

Dada a falta de apetite, Dora deve ser diagnosticada com


transtorno de somatizao.

Com relao psicoterapia individual e clnica infantil e do


adolescente, julgue os itens subsequentes.
"

As entrevistas diagnsticas so empregadas para diagnsticos


psiquitricos

nosogrficos,

fundamentais

no

acompanhamento de adolescentes vtimas de violncia ou


com dificuldades de aprendizagem.
#

Ainda que o adolescente apresente demanda espontnea para


atendimento psicolgico, necessria a realizao de
entrevistas com seus pais ou responsveis, assim como sua
participao e responsabilizao durante o tratamento do
adolescente sob sua responsabilidade.

O tipo de estrutura familiar e a maneira como os membros


da famlia se relacionam desempenham papel essencial nos
quadros patolgicos desenvolvidos por crianas e adolescentes.

Em respeito relao transferencial e ao pacto de sigilo

Com relao abordagem psicanaltica, julgue os itens a seguir.


'

De acordo com a psicanlise, o delrio consiste em uma nova


realidade construda pelo sujeito para suportar os conflitos
advindos da realidade cotidiana.

O desmentido, mecanismo que permite a constituio da


psicose, consiste no reconhecimento e na posterior negao,
pelo sujeito, da castrao.

Conforme a psicanlise, os sintomas apresentados pelo


paciente so suficientes para a realizao do diagnstico
diferencial.

estabelecido entre o psiclogo e o adolescente, a transmisso,


aos pais ou responsveis, da concluso final do caso avaliado
s poder ocorrer na presena do adolescente.
&

Constatando-se, durante o tratamento individual da criana ou


do adolescente, dificuldades no mbito familiar, sugere-se
indicar terapia de casal e(ou) terapia familiar.

'

Qualquer acompanhamento psicoterpico inicia-se pelas

De acordo com as teorias lacanianas, h trs possibilidades


estruturais do sujeito: neurose, psicose e perverso.

entrevistas iniciais.


No atendimento aos adolescentes, o nico objetivo das


entrevistas o diagnstico psicolgico da famlia.

"!!

A recusa o mecanismo de defesa utilizado pelo sujeito diante


da neurose.


||TCDF14_003_05N204203||

A respeito da psicologia institucional e do trabalho do psiclogo


nesse contexto, julgue os itens seguintes.
O psiclogo deve se tornar parte do grupo com o qual ele
trabalha como estratgia de aproximao e interveno
informal, no sentido de criar um ambiente mais descontrado
para oferecer informaes e discutir objetivos e resultados.
 Nas equipes multidisciplinares em hospitais, o psiclogo
institucional atua em parceria com a equipe mdica para obter
subsdios que viabilizem sua interveno junto ao paciente no
que se refere ao processo sade-doena.
! As tarefas do psiclogo so determinadas por seu empregador,
caso se trabalhe com esse tipo de vnculo, ou podem
igualmente ser definidas por suas observaes e estudos
diagnsticos acerca das necessidades locais.
" Os objetivos de interveno do psiclogo podem mudar ao
longo do trabalho, mas devem ser avaliados e respeitados com
base na tica e nas necessidades percebidas pelo prprio
psiclogo.
# Sob o ponto de vista do psiclogo e de seu trabalho, so
instituies: igrejas, escolas, teatros, agncias governamentais,
asilos, prises e outros.

CESPE/UnB TCDF/ANAP Aplicao: 2014


#



Julgue os itens a seguir, referentes aos transtornos de humor e de


ansiedade.
$
%

&

'



Na depresso podem ocorrer sintomas de irritabilidade,


ansiedade, sonolncia, insnia e inapetncia.
Tanto um portador de transtorno de estresse ps-traumtico
quanto um portador de fobia especfica podem apresentar
temor intenso acompanhado de reatividade fisiolgica frente a
um mesmo estmulo ou situao como, por exemplo, uma
viagem de barco.
Portadores de fobia social evitam todo tipo de evento social e
toda atividade realizada em pblico, como, por exemplo,
assistir a uma cerimnia religiosa, comer em restaurantes,
assinar cheques em comrcio ou pedir informaes em um
guich de shopping.
No transtorno obsessivo-compulsivo, o paciente realiza rituais
mentais ou motores com a inteno de reduzir a ansiedade
causada pela possibilidade de concretizao de seus
pensamentos obsessivos.
O paciente que apresenta instabilidade de humor, com variao
frequente e repetida entre elao e depresso muito leves,
podendo ainda haver perodos longos de estabilidade,
apresenta caractersticas de distimia.

Julgue os itens de 111 a 115, acerca dos aspectos da psicologia da


sade.
As doenas agudas, geralmente, tm como caractersticas o
surgimento abrupto, a durao limitada, o diagnstico e o
prognstico acurados e a possibilidade de cura.
 Problemas psicolgicos podem desencadear o adoecimento
fsico. Um exemplo a maior incidncia de enfarto do
miocrdio entre pacientes depressivos do que entre seus pares
com situaes fsicas semelhantes, mas sem depresso.
! A assistncia multidisciplinar em hospitais, se no for bem
planejada, pode ser estressante para o paciente porque implica
a interao dele com um maior nmero de pessoas, o que
demanda recursos psicolgicos que, em geral, j esto
limitados.
" Em caso de doena aguda desejvel e esperado que o
paciente adote uma postura mais proativa no manejo dos
problemas a ela associados quando comparado ao paciente
com doena crnica.


A avaliao da dor crnica facilitada pelo preenchimento de


um dirio de dor pelo paciente, o qual inclui, entre outras
variveis, a localizao da dor, os possveis desencadeadores,
a intensidade da dor e uma varivel psicossocial.

No que se refere ao estresse e s suas consequncias, julgue os


prximos itens.
O estresse aumenta a presso sangunea porque, uma vez
detectado o estmulo estressor, o hipotlamo estimula a
hipfise e ela libera hormnios que, ao cair na corrente
sangunea, contraem as paredes dos vasos.
% O estresse, como sndrome geral de adaptao, implica a
quebra da homeostase interna e tem impacto nos nveis fsico,
que corresponde fase de alerta; emocional, que corresponde
fase de resistncia; e social, que corresponde fase de
exausto.
& De acordo com a teoria do estresse proposta por Selye, o
manejo do estresse pode ser feito pela remoo de estressores
desnecessrios vida e por meio de evitao ou fuga das
condies adversas que o causam.
$

Com relao s substncias psicoativas, seu uso e tratamento, julgue


os itens subsecutivos.
Para usurios de substncias psicoativas que estejam em
tratamento e j em abstinncia adequado que o terapeuta
questione, a cada sesso, se sentiu fissura ou se teve sonho ou
fantasia com o uso da droga, os quais seriam sinais de risco
para recada.
 Para pessoas depressivas, ou propensas depresso, o uso
crnico da maconha produz uma intensa sensao de nimo e
bem-estar.
'

A respeito dos Poderes Executivo e Legislativo, julgue os itens a


seguir.
Cabe ao Congresso Nacional, com a sano do presidente da
Repblica, apreciar os atos de concesso e renovao de
concesso de emissoras de rdio e televiso, sendo essa
atuao conjunta exemplo prtico da aplicao da doutrina dos
freios e contrapesos.

O veto do presidente da Repblica a projeto de lei ser
apreciado em sesso unicameral, somente podendo ser
rejeitado pelo voto da maioria absoluta dos congressistas.
 ! Ao tomarem conhecimento de qualquer irregularidade, os
responsveis pelo controle interno dos trs poderes da Unio
devem comunic-la ao TCU, sob pena de responsabilizao
solidria com o infrator.
 " Dispor sobre a organizao da administrao federal
atribuio privativa do presidente da Repblica, que somente
poder ser exercida pelo prprio ou, durante seus
impedimentos, por quem o substituir na presidncia, vedada a
delegao.
 

Com relao s finanas pblicas e ao sistema tributrio nacional,


julgue os itens subsequentes.
Cabem ao Banco Central a emisso de moeda, a funo de
depositrio das disponibilidades de caixa da Unio e a
atribuio de conceder emprstimos ao Tesouro Nacional.
 $ O princpio da anterioridade tributria clusula ptrea, por
constituir garantia individual de que a lei que criar, aumentar
ou extinguir tributo somente pode ser aplicada no exerccio
financeiro seguinte sua publicao.
 % A imunidade tributria recproca entre as pessoas polticas
abrange apenas os impostos.
 #



||TCDF14_003_05N204203||

Acerca da organizao poltico-administrativa do Estado Federal


brasileiro e da administrao pblica, julgue os seguintes itens.


!"

O presidente da Repblica pode dispor, mediante decreto


autnomo, acerca da organizao e do funcionamento da
administrao federal, vedados o aumento de despesa e a
criao ou extino de rgos pblicos.
A autonomia dos estados-membros caracteriza-se pela sua
capacidade de auto-organizao, autolegislao, autogoverno
e autoadministrao, ao passo que a soberania da Unio
manifesta-se em todos esses elementos e, ainda, no que
concerne personalidade internacional.
vedado LODF definir os crimes de responsabilidade do
governador.

Considere que, durante uma fiscalizao, fiscais do DF tenham


encontrado alimentos com prazo de validade expirado na geladeira
de um restaurante. Diante da ocorrncia, lavraram auto de infrao,
aplicaram multa e apreenderam esses alimentos. Com base na
situao hipottica apresentada, julgue os itens subsecutivos.
!

Se a aplicao da multa for indevida, a administrao tem o


poder de anul-la, de ofcio, independentemente de provocao
do interessado.

!

A aplicao de multa ao estabelecimento comercial decorre do


poder disciplinar da administrao pblica.

!!

Diante do risco sade da populao, as mercadorias com


prazo de validade expirado podero ser imediatamente
apreendidas, mesmo antes da abertura de processo
administrativo e sem prvio contraditrio do proprietrio do
estabelecimento.

Acerca do regime jurdico administrativo, julgue os prximos itens.


!#

Os atos administrativos praticados pelo Poder Legislativo


e pelo Poder Judicirio submetem-se ao regime jurdico
administrativo.

!$

Em razo do princpio da legalidade, a administrao pblica


est impedida de tomar decises fundamentadas nos costumes.

!%

O princpio da supremacia do interesse pblico sobre o


interesse privado um dos pilares do regime jurdico
administrativo e autoriza a administrao pblica a impor,
mesmo sem previso no ordenamento jurdico, restries aos
direitos dos particulares em caso de conflito com os interesses
de toda a coletividade.

Suponha que um servidor pblico fiscal de obras do DF, no intuito


de prejudicar o governo, tenha determinado o embargo de uma obra
de canalizao de guas pluviais, sem que houvesse nenhuma
irregularidade. Em razo da paralisao, houve atraso na concluso
da obra, o que causou muitos prejuzos populao. Com base
nessa situao hipottica, julgue os itens que se seguem.
!&

A ausncia de advogado para auxiliar o servidor em sua defesa


no causa de nulidade do processo administrativo disciplinar.

!

O ato de embargo da obra atenta contra os princpios da


legalidade, da impessoalidade e da moralidade.

!

A autoridade competente do rgo de fiscalizao tem a


prerrogativa discricionria de instaurar processo administrativo
para apurar a infrao cometida pelo servidor.

#"

Uma vez instaurado o processo administrativo disciplinar para


apurao da infrao, o servidor poder ser afastado de suas
funes, por at sessenta dias, sem direito remunerao do
cargo.

CESPE/UnB TCDF/ANAP Aplicao: 2014

Com base nas disposies da Lei n. 8.429/1992 e da Lei


n. 9.784/1999, julgue os itens a seguir.
#

Nos processos administrativos, as intimaes sero nulas


quando feitas sem observncia das prescries legais, no
entanto o comparecimento do administrado supre sua falta ou
sua irregularidade.

#

A legitimidade ativa para propor a ao de improbidade


administrativa sempre da pessoa jurdica que foi vtima do
ato de improbidade, cabendo ao Ministrio Pblico intervir na
demanda apenas na condio de fiscal da lei.

Com relao ao regime diferenciado de contrataes e disciplina


legal sobre o prego, julgue os itens subsequentes.
#!

Entre outras proibies, veda-se, no prego, a exigncia


de garantia de proposta bem como a exigncia da aquisio do
edital pelos licitantes como condio para participao no
certame.

##

Afora a Copa do Mundo de 2014 e os Jogos Olmpicos de


2016, o regime diferenciado de contrataes aplica-se a obras
e a servios voltados construo, ampliao e reforma de
estabelecimentos penais e de unidades de atendimento
socioeducativo, entre outras.

No que se refere ao controle da administrao pblica, julgue os


itens que se seguem.
#$

O Poder Legislativo exerce controle financeiro sobre o Poder


Executivo, sobre o Poder Judicirio e sobre a sua prpria
administrao.

#%

O controle judicial dos atos da administrao ocorre depois


que eles so produzidos e ingressam no mundo jurdico, no
existindo margem, no ordenamento jurdico brasileiro, para
que tal controle se d a priori.

Julgue os itens a seguir, relativos responsabilidade civil do


Estado, aos servios pblicos e s organizaes da sociedade civil
de interesse pblico.
#&

De acordo com o princpio da continuidade, os servios


pblicos, compulsrios ou facultativos, devem ser prestados de
forma contnua, no podendo ser interrompidos mesmo em
casos de inadimplemento do usurio.

#

Tanto o dano moral quanto o dano material so passveis de


gerar a responsabilidade civil do Estado.

#

Nos termos da Lei n. 8.987/1995, que dispe sobre o regime


de concesso e permisso da prestao de servios pblicos,
diferentemente da concesso, a permisso de servios pblicos
tem a natureza de ato administrativo unilateral e precrio, e no
a de negcio bilateral que se formaliza mediante contrato.

$"

Compete ao Ministrio da Justia expedir certificado s


entidades interessadas em obter qualificao como organizao
da sociedade civil de interesse pblico.


PROVA: TCDF
ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: CESPE

GABARITO OFICIAL
# conhecimentos especficos de Psicologia
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90

C
C
E
C
E
E
C
E
E
C
C
C
E
E
E
C
E
C
E
C
E
C
C
E
C
C
E
E
C
C

91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120

E
E
C
E
E
C
E
C
X
E
E
E
E
C
C
C
C
E
C
E
C
C
C
E
C
C
E
E
C
E

121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150

Coletnea de Provas | Concursos de Psicologia

E
E
C
E
E
E
C
C
E
C
C
E
C
C
E
E
C
C
E
E
C
E
C
C
C
E
E
C
E
C

TURNO

N DE INSCRIO

NOME DO CANDIDATO

ESCOLA

SALA

ORDEM

LEIA COM ATENO AS INSTRUES ABAIXO


INSTRUES GERAIS
O candidato receber do fiscal:
Um Caderno de Questes contendo 50 (cinquenta) questes objetivas de mltipla escolha.
Uma Folha de Respostas personalizada para a Prova Objetiva.
Ao ser autorizado o incio da prova, verifique, no Caderno de Questes, se a numerao das questes e a paginao esto
corretas e se no h falhas, manchas ou borres. Se algum desses problemas for detectado, solicite ao fiscal outro caderno
completo. No sero aceitas reclamaes posteriores.
A totalidade da Prova ter a durao de 3h30 (trs horas e trinta minutos), incluindo o tempo para preenchimento da Folha
de Respostas da Prova Objetiva.
i
Iniciada a Prova, nenhum candidato poder retirar-se da sala antes de decorridas 2h30 (duas horas e trinta minutos) de
prova, devendo, ao sair, entregar ao fiscal de sala, obrigatoriamente, o Caderno de Questes e a Folha de Respostas da
Prova Objetiva. A Folha de Respostas da Prova Objetiva ser o nico documento vlido para correo.
i
No sero permitidas consultas a quaisquer materiais, uso de telefone celular ou outros aparelhos eletrnicos.
Caso seja necessria a utilizao do sanitrio, o candidato dever solicitar permisso ao fiscal de sala, que designar um
fiscal volante para acompanh-lo no deslocamento, devendo manter-se em silncio durante o percurso, podendo, antes da
entrada no sanitrio e, depois da utilizao deste, ser submetido revista com detector de metais. Na situao descrita, se for
detectado que o candidato est portando qualquer tipo de equipamento eletrnico, ser eliminado automaticamente do
concurso.
O candidato, ao terminar a prova, dever retirar-se imediatamente do estabelecimento de ensino, no podendo permanecer
nas dependncias deste, bem como no poder utilizar os sanitrios.

INSTRUES PROVA OBJETIVA


Verifique se seus dados esto corretos na Folha de Respostas.
A Folha de Respostas NO pode ser dobrada, amassada, rasurada, manchada ou conter qualquer registro fora dos locais
destinados s respostas.
Use caneta transparente de tinta preta.
Assinale a alternativa que julgar correta para cada questo na Folha de Respostas.
Para cada questo, existe apenas 1 (uma) resposta certa no sero computadas questes no assinaladas ou que
contenham mais de uma resposta, emendas ou rasuras.
O modo correto de assinalar a alternativa cobrindo, completamente, o espao a ela correspondente, conforme modelo
abaixo:
Todas as questes devero ser respondidas.
OS TEXTOS E AS QUESTES FORAM REDIGIDOS CONFORME O NOVO ACORDO ORTOGRFICO
DA LNGUA PORTUGUESA, MAS ESTE NO SER COBRADO NO CONTEDO.
CONCURSOS PBLICOS

11/2014
Espao reservado para anotao das respostas

- O candidato poder destacar e levar para conferncia.

CONCURSOS PBLICOS

NOME DO CANDIDATO

N DE INSCRIO

O gabarito da Prova Objetiva estar disponvel no site da Cetro Concursos (www.cetroconcursos.org.br) a partir do dia 18 de novembro de 2014.

PSICLOGO (CONHECIMENTOS ESPECFICOS)


26.

27.

29.

Segundo a Resoluo do CFP n 007/2003, o Psiclogo,


na elaborao de documentos escritos, basear suas
informaes na observncia

Acerca dos crimes e das infraes administrativas,


tratados no Estatuto da Criana e do Adolescente (ECA),
assinale a alternativa incorreta.
(A)

Os crimes definidos no ECA so de ao pblica


condicionada.

(B)

A hospedagem de criana ou de adolescente


desacompanhado dos pais ou responsvel, ou sem
autorizao escrita desses ou da autoridade
judiciria, em motel ou congnere, implicar pena de
multa.

(A)

dos princpios tcnicos e nos dispositivos que


norteiam a prpria demanda.

(B)

das orientaes do conselho regional ao qual est


inserido.

(C)

dos princpios e dispositivos do Cdigo de tica


Profissional do Psiclogo.

(C)

Aplicam-se aos crimes definidos no ECA as normas


da Parte Geral do Cdigo Penal.

(D)

dos diferentes modelos institucionais j adotados


para atuar de forma padronizada.

(D)

(E)

das atualizaes do CFP, relativas ao Manual de


Elaborao de Documentos Escritos produzidos pelo
Psiclogo, decorrentes de avaliao psicolgica.

A autoridade policial responsvel pela apreenso de


criana ou adolescente que deixar de fazer imediata
comunicao autoridade judiciria competente e
famlia do apreendido ou pessoa por ele indicada
estar sujeito pena de deteno de seis meses a
dois anos.

(E)

Publicaes em revistas destinadas ao pblico


infanto-juvenil contendo ilustraes, fotografias,
legendas, crnicas ou anncios de bebidas
alcolicas, e desrespeitando os valores ticos e
sociais da pessoa e da famlia, configuraro pena de
multa de trs a vinte salrios de referncia,
duplicando-se a pena em caso de reincidncia, sem
prejuzo de apreenso da revista ou publicao.

Sobre o registro de informaes decorrentes da prestao


de servios psicolgicos, marque V para verdadeiro ou F
falso e, em seguida, assinale a alternativa que apresenta a
sequncia correta.
( )

O registro documental material valioso e sigiloso,


devendo ser acessado somente pelo Psiclogo e
pela instituio a qual presta o servio.

( )

A obrigatoriedade do registro documental est


prevista na Resoluo n 001/2009.

( )

O pronturio deve ser mantido atualizado e


organizado pelo Psiclogo que acompanha o
procedimento.

( )

O supervisor tcnico deve solicitar do estagirio


registro de todas as atividades e acontecimentos
que ocorrerem com os usurios do servio
psicolgico prestado.

(A)

V/ F/ V/ V

(B)

F/ V/ V/ V

(C)

V/ F/ F/ V

(D)

F/ F/ V/ F

(E)

F/ V/ V/ F

30.

Avaliar os riscos envolvidos, tanto pelos procedimentos,


como pela divulgao dos resultados, com o objetivo de
proteger pessoas, grupos, organizaes e comunidades
envolvidas, uma conduta que o Psiclogo deve cumprir
e se responsabilizar, segundo o artigo 16 do Cdigo de
tica Profissional do Psiclogo, diante de
I.

situaes em que se configure a utilizao de


registros e observao de criana, adolescente ou
interdito, sem perspectivas de promover medidas em
seu benefcio.

II.

encaminhamentos equipe multiprofissional para


complemento de informaes pronturias.

III.

realizao de estudos, pesquisas e atividades


voltadas para a produo de conhecimento e
desenvolvimento de tecnologias.

correto o que est contido em


28.

A avaliao de demanda e a definio de objetivos do


trabalho so processos que devem contemplar,
obrigatoriamente,

(A)

I, apenas.

(B)

II, apenas.

(A)

(C)

III, apenas.

(D)

I e II, apenas.

(E)

II e III, apenas.

os registros documentais dispostos na Resoluo do


CFP n 005/2010, especialmente quando esses
registros esto em forma de pronturio.

(B)

a estrutura dos registros de um parecer psicolgico.

(C)

todo o processo de mtodos e tcnicas previstos no


diagnstico psicolgico.

(D)

uma das partes dispostas para estabelecer os


critrios de avaliao em formulrios de testes
psicolgicos.

(E)

o detalhamento do construto varivel/ invarivel dos


testes que o profissional pretende aplicar.

31.

Segundo o Cdigo de tica Profissional do Psiclogo,


correto afirmar que prestar servios profissionais em
situaes de calamidade pblica ou de emergncia

34.

Leia o trecho abaixo e, em seguida, assinale a alternativa


que preenche correta e respectivamente as lacunas.
Denominam-se

32.

(A)

uma contribuio, visando


coletividade humana.

dignidade

da

(B)

um princpio fundamental amparado pelo que prev


a Declarao dos Direitos Humanos.

(C)

dever fundamental do Psiclogo, sendo um dos itens


de suas responsabilidades.

(D)

uma opo de trabalho voluntrio do profissional


diante de situaes complexas extremas.

(E)

uma obrigao prevista no cdigo, mas a cumprir


somente se convocado, podendo declinar, salvo por
impedimento de motivo relevante.

justificativa de demanda, finalidade do documento,


exposio de motivos e concluso.

(B)

informao do caso, identificao, anlise,


concluso e encaminhamento, se necessrio.

(C)

nome e sobrenome do solicitante, procedimentos,


descrio de demanda e encaminhamento.

(D)

identificao, descrio da demanda, procedimento,


anlise e concluso.

(E)

________________

aqueles

quadros psicticos causados diretamente pela ao da droga


sobre o crebro, de curta durao, que remitem na medida em
que a substncia desaparece do organismo. J as psicoses
________________ por drogas duram dias ou, no mximo,
semanas, manifestando-se como quadros paranoides ou
polimorfos, por exemplo.

correto afirmar que os itens de identificao do relatrio


psicolgico devem compor registros de
(A)

psicoses

35.

nome e sobrenome do cliente, registro do nome


completo do Psiclogo com sua inscrio no CRP,
finalidade
do
documento,
anlise
e
encaminhamento, se necessrio.

(A)

residuais/ funcionais

(B)

funcionais/ disfuncionais

(C)

afetivas/ prolongadas

(D)

mrbidas/ hiperfgicas

(E)

txicas/ induzidas

Conforme estabelecido no ECA, com relao habilitao


de pretendentes adoo, os postulantes adoo,
domiciliados no Brasil, apresentaro petio inicial na qual
conste, entre outros dados,
I.

qualificao completa e dados familiares.

II.

atestados de sanidade fsica e mental e certido de


antecedentes criminais.

III.

comprovante de renda e domiclio e certido


negativa de distribuio cvel.

correto o que est contido em


33.

So drogas psicoativas: lcool, maconha, cocana, ch,


diazepan, nicotina, herona etc., ou qualquer substncia
qumica que, quando ingerida,

(A)

I, apenas.

(B)

II, apenas.

(C)

I e II, apenas.

(A)

provoque inquietao, nusea e dependncias


diversas.

(D)

II e III, apenas.

(E)

I, II e III.

(B)

cause alucinaes e ideias delirantes, alm de


alteraes motoras.

(C)

provoque e/ou modifique uma ou vrias funes do


sistema nervoso central, produzindo efeitos
psquicos e comportamentais.

(D)

acentue o distanciamento afetivo ou efeito reverso


de volio corporal imposta de fora como busca de
ganho em contato interpessoal e do convvio social.

(E)

provoque um ganho reativo de humor, aumento de


apetite, distimia e aceleramento cardaco.

36.

A utilizao de avaliao psicolgica, psicossocial e


sociocultural, a fim de observar o padro de relaes
interpessoais, relaes objetais, dinmica familiar, bem
como a interao como subgrupo cultural ao qual o
paciente pertence, seus valores, alm de histrico legal de
brigas, roubos, prises, crimes cometidos, dizem respeito
(A)

ao levantamento global para identificao


demanda em indivduos infratores.

de

(B)

a alguns itens a serem avaliados na histria de


pacientes com abuso e/ou dependncia de drogas.

(C)

a alguns itens a serem avaliados na histria de


adolescentes resgatados em situao de risco.

(D)

aos aspectos a serem observados em pacientes


com alteraes nas funes psquicas compostas
relativas personalidade do sujeito.

(E)

anamnese psicopatolgica utilizada em instituies


psiquitricas diversas, com foco em pacientes
esquizofrnicos.
8

37.

Leia o trecho abaixo e, em seguida, assinale a alternativa


que preenche corretamente a lacuna.

(A)

1/ 3/ 2

(B)

2/ 3/ 1

Um fenmeno sempre biolgico em suas razes e social

(C)

3/ 2/ 1

em sua extenso final. Mas, ns no nos devemos esquecer,

(D)

2/ 1/ 3

(E)

3/ 1/ 2

tambm, de que, entre esses dois, ele mental. Assim comea


uma definio da psicopatologia, na viso de Jean Piaget. Ou
seja, a psicopatologia um ramo da cincia que trata da

40.

natureza essencial da sade mental e tem boa parte de suas

Sobre as funes do Ministrio Pblico previstas no ECA,


marque V para verdadeiro ou F para falso e, em seguida,
assinale a alternativa que apresenta a sequncia correta.

razes na tradio _____________, quando estudada nas obras


de grandes alienistas do passado, propiciando a observncia
nos ltimos dois sculos.

38.

39.

1.

2.

3.

( )

A intimao do Ministrio Pblico ser feita por meio


de publicao no Dirio Oficial da Unio.

( )

A falta de interveno do Ministrio Pblico acarreta


a suspenso do feito, que ser declarada de ofcio
pelo juiz.

( )

As manifestaes processuais do representante do


Ministrio Pblico devero ser fundamentadas.

(A)

mdica

(B)

filosfica

(C)

autnoma

(D)

neurolgica

(A)

V/ F/ V

(E)

fisiolgica

(B)

F/ V/ F

(C)

F/ F/ V

Quando se estuda os sintomas psicopatolgicos, costumase observar a estrutura bsica de comportamentos, tais
como ideias obsessivas, labilidade afetiva, delrio etc., e
tambm a forma como se preenche essa alterao
estrutural no indivduo, seja em forma de culpa, cunho
religioso, perseguio etc.. A estes dois enfoques bsicos,
correto afirmar que se trata de aspectos como

41.

(D)

V/ V/ V

(E)

F/ F/ F

Quanto aos aspectos bsicos de interpretao e ao


significado dos aspectos gerais dos desenhos, diante da
anlise de uma produo grfica, pode-se afirmar que ela
pode ser feita por meio de trs processos em
interpenetrao, vinculados

(A)

diagnstico e causa.

(B)

avaliao e screening (rastreamento).

(C)

forma e contedo dos sintomas.

(A)

percepo, situao e expresso.

(D)

descrio e concluso.

(B)

a relato, percepo e projeo.

(E)

manifestao e causa.

(C)

a grafismo, avaliao e concluso.

Sobre as trs regras bsicas a serem seguidas ao fazer


uma entrevista psiquitrica, correlacione as colunas
abaixo e, em seguida, assinale a alternativa que apresenta
a sequncia correta.
Utilizar
entrevista
de forma aberta,
permitindo que fale
de
forma
mais
fluente
e
espontnea.
Utilizar
entrevista
de
forma
mais
estruturada, em que
o estrevistador fala
mais,
fazendo
perguntas simples e
fceis de serem
compreendidas
e
respondidas.
Iniciar
com
perguntas neutras
e, gradativamente,
formular perguntas
mais complexas.

( )

Pacientes organizados
(mentalmente), fora de
um estado psictico.

( )

Pacientes paranoides, ou
com capacidade
cognitiva limitada.

( )

Pacientes
desorganizados ou
travados por um alto
nvel de ansiedade.

42.

(D)

adaptao, expresso e projeo.

(E)

ao, reao e projeo.

Sobre os crimes e infraes administrativas descritos no


Estatuto da Criana e do Adolescente (ECA), previsto,
no artigo 230, que privar a criana ou o adolescente de
sua liberdade, procedendo sua apreenso sem estar em
flagrante de ato infracional incide deteno de seis meses
a dois anos. O presente artigo informa que a pena deve
ainda ser aplicada se
(A)

a privao for feita sem uma ordem escrita da


autoridade judiciria competente.

(B)

a privao for mantida, diante de ordenao de


liberao da criana ou do adolescente, to logo se
tenha conhecimento da ilegalidade da apreenso.

(C)

na privao, ocorrerem episdios de vexame ou


constrangimento.

(D)

a privao for feita sem imediata comunicao


autoridade competente.

(E)

a privao for feita sem imediata comunicao ao


apreendido ou pessoa por ele indicada.

43.

No que concerne ao ECA, sobre o direito convivncia


familiar e comunitria, marque V para verdadeiro ou F
para falso e, em seguida, assinale a alternativa que
apresenta a sequncia correta.
( )

44.

45.

A falta ou a carncia de recursos materiais constitui


motivo suficiente para a perda ou a suspenso do
ptrio poder, devendo, para tal, ser constituda
famlia substituta para prover a criana ou o jovem
adolescente de suas necessidades.

46.

(A)

self

(B)

olhar

(C)

esprito

(D)

comportamento

(E)

corpo

Acerca do regime disciplinar tratado no Ttulo II, Captulo


VII, da Lei n 12.594/2012, que institui o Sistema Nacional
de Atendimento Socioeducativo (SINASE) e regulamenta
a execuo das medidas destinadas a adolescente que
pratique ato infracional, todas as entidades de
atendimento socioeducativo devero, em seus respectivos
regimentos, realizar a previso de regime disciplinar que
obedea, dentre outros, aos seguintes princpios:

( )

O reconhecimento do estado de filiao da criana


ou adolescente direito personalssimo, indisponvel
e imprescritvel, podendo ser aplicado contra os pais
ou seus herdeiros.

( )

Entende-se por famlia natural a comunidade


formada pelos pais ou qualquer deles e seus
descendentes.

( )

Na colocao da famlia substituta, o artigo 28,


pargrafo 1, estabelece que, sempre que possvel,
os responsveis sero notificados para serem
ouvidos e considerados sobre a guarda incumbida
do menor.

I.

(A)

V/ F/ V/ V

correto o que est contido em

(B)

F/ V/ V/ V

(C)

V/ F/ F/ V

(A)

I e II, apenas.

(D)

F/ F/ V/ V

(B)

I e III, apenas.

(E)

F/ V/ V/ F

(C)

I, II e III.

(D)

II e III, apenas.

(E)

II, apenas.

No desenvolvimento das operaes concretas, a criana


j possui autonomia de pensamento, o que significa
pensar de acordo com um conjunto prprio de normas, em
que, antes de aceitar os valores j definidos pelos outros,
o raciocnio os avalia. A essa autonomia relacionada
diretamente a seu desenvolvimento afetivo d-se o nome
de
(A)

abstrao reflexiva.

(B)

independncia cognitiva.

(C)

comunicao pessoal estabelecida.

(D)

autorregulao.

(E)

esquemas.

47.

II.

enumerao explcita das garantias de defesa.

III.

apurao da falta disciplinar por comisso composta


por, no mnimo, trs integrantes, sendo um,
obrigatoriamente, oriundo da equipe tcnica.

De acordo com a Lei n 12.594/2012, assinale a


alternativa incorreta.
(A)

Nenhum socioeducando poder desempenhar


funo ou tarefa de apurao disciplinar ou
aplicao de sano nas entidades de atendimento
socioeducativo.

(B)

O regime disciplinar depende da responsabilidade


civil ou penal que advenha do ato cometido.

(C)

No ser aplicada sano disciplinar sem expressa


e anterior previso legal ou regulamentar e o devido
processo administrativo.

(D)

As escolas do Senai podero ofertar vagas aos


usurios do Sistema Nacional de Atendimento
Socioeducativo (SINASE) nas condies a serem
dispostas em instrumentos de cooperao
celebrados entre os operadores do Senai e os
gestores
dos
Sistemas
de
Atendimento
Socioeducativo locais.

(E)

O regulamento interno estabelecer as hipteses de


proibio da entrada de objetos na unidade de
internao, vedando o acesso aos seus portadores.

Leia o trecho abaixo e, em seguida, assinale a alternativa


que preenche corretamente a lacuna.
Dentre as teorias da personalidade, os estudos de Carl

Rogers apontam para perspectivas em que o indivduo busque


dentro de si a capacidade, ao menos latente, de compreender
os fatores de sua vida que lhe causam infelicidade e dor, e,
ento, encontre a chave para reorganizar-se de forma a

sano de durao determinada.

superar tais fatores. Dessa forma, a pessoa assume um


compromisso de um _____________ separado, compromisso
esse que uma profunda tentativa de descobrir e aceitar a
natureza total de si. dedicar-se remoo das mscaras to
logo elas se formem.
10

48.

Segundo o que prev o regramento do Sistema Nacional


de Atendimento Socioeducativo (SINASE), a avaliao e o
acompanhamento
da
gesto
do
atendimento
socioeducativo objetiva
I.

verificar o cumprimento das metas estabelecidas e


elaborar recomendaes aos gestores e operadores
dos Sistemas.

II.

definir estratgias para a gesto de conflitos, vedada


a previso de isolamento cautelar.

III.

receber o adolescente e seus pais ou responsvel e


orient-los sobre a finalidade da medida e a
organizao e funcionamento do programa.

correto o que est contido em


(A)

49.

I, apenas.

(B)

II, apenas.

(C)

III, apenas.

(D)

I e II, apenas.

(E)

II e III, apenas.

Com base na Lei n 12.594/2012, o adolescente em


cumprimento de medida socioeducativa que apresente
indcios de transtorno mental, de deficincia mental, ou
associadas, dever ser avaliado por equipe tcnica
multidisciplinar e multissetorial. A respeito desse assunto,
analise as assertivas abaixo.
I.

As competncias, a composio e a atuao da


equipe tcnica devero seguir, conjuntamente, as
normas de referncia do SUS e do SINASE, na
forma do regulamento.

II.

A avaliao subsidiar a elaborao e execuo da


teraputica a ser adotada.

III.

As informaes produzidas na avaliao obedecero


plenamente ao princpio da publicidade.

correto o que se afirma em

50.

11

(A)

I, II e III.

(B)

I e III, apenas.

(C)

II e III, apenas.

(D)

I e II, apenas.

(E)

I, apenas.

Conforme o disposto no artigo 67 da Lei n 12.594/2012, a


visita do cnjuge, companheiro, pais ou responsveis,
parentes e amigos a adolescente a quem foi aplicada
medida socioeducativa de internao observar dias e
horrios prprios definidos
(A)

pela Justia da Infncia e da Juventude.

(B)

pelo Psiclogo responsvel pelo caso.

(C)

pela equipe do programa de atendimento.

(D)

pelo educador, em conjunto com o Psiclogo


responsvel.

(E)

pela direo do programa de atendimento.

PROVA: FUNDAO CASA


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: CETRO

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

C
B
A
A
C
C
D
C
E
E
B
A
C

39
40
41
42
43
44
45
46
47
48
49
50

A
C
D
A
E
D
A
C
B
A
D
E

Coletnea de Provas | Concursos de Psicologia

Maro/2014

COMPANHIA DO METROPOLITANO DE SO PAULO - METR


Concurso Pblico para provimento de vagas de

Analista Desenvolvimento Gesto Jnior


Psicologia
No de Inscrio

Nome do Candidato

Caderno de Prova 13, Tipo 001

MODELO

No do Caderno

MODELO1

ASSINATURA DO CANDIDATO

No do Documento

0000000000000000
0000100010001

PROVA

Conhecimentos Bsicos
Conhecimentos Especficos

INSTRUES
- Verifique se este caderno:
- corresponde a sua opo de cargo.
- contm 60 questes, numeradas de 1 a 60.
Caso contrrio, reclame ao fiscal da sala um outro caderno.
No sero aceitas reclamaes posteriores.
- Para cada questo existe apenas UMA resposta certa.
- Voc deve ler cuidadosamente cada uma das questes e escolher a resposta certa.
- Essa resposta deve ser marcada na FOLHA DE RESPOSTAS que voc recebeu.

VOC DEVE
- Procurar, na FOLHA DE RESPOSTAS, o nmero da questo que voc est respondendo.
- Verificar no caderno de prova qual a letra (A,B,C,D,E) da resposta que voc escolheu.
- Marcar essa letra na FOLHA DE RESPOSTAS, conforme o exemplo: A

C D E

ATENO
- Marque as respostas com caneta esferogrfica de material transparente e tinta preta ou azul. No ser permitido o uso
de lpis, lapiseira, marca-texto ou borracha durante a realizao das provas.
- Marque apenas uma letra para cada questo, mais de uma letra assinalada implicar anulao dessa questo.
- Responda a todas as questes.
- No ser permitida qualquer espcie de consulta, nem o uso de mquina calculadora.
- A durao da prova de 3 horas, para responder a todas as questes e preencher a Folha de Respostas.
- Ao trmino da prova, chame o fiscal da sala e devolva todo o material recebido.
- Proibida a divulgao ou impresso parcial ou total da presente prova. Direitos Reservados.

Caderno de Prova 13, Tipo 001


CONHECIMENTOS ESPECFICOS
31.

32.

33.

34.

Na perspectiva da psicologia cognitiva e do interacionismo simblico, a cultura organizacional pode ser concebida como um
padro de suposies bsicas compartilhadas, que foi aprendido por um grupo pioneiro de pessoas por meio do enfrentamento
de problemas referentes adaptao externa e integrao interna. Nessa concepo, a cultura organizacional composta por
trs nveis de anlise: pressupostos bsicos; crenas e valores esperados/racionalizados e artefatos visveis e audveis. No nvel
dos pressupostos bsicos, encontramos
(A)

estruturas e processos organizacionais, difceis de acessar, mesmo que por membros antigos da cultura.

(B)

estratgias; planos de crescimento e filosofias distintas e apartadas do dia a dia da organizao.

(C)

estruturas e processos organizacionais, difceis de decifrar e compreender, de acordo com os preceitos estabelecidos.

(D)

crenas, percepes, pensamentos e sentimentos inconscientes tidos como verdades inquestionveis.

(E)

tipos psicolgicos; instrumentos de medidas de cultura e clima organizacional que identificam as origens das filosofias
estabelecidas.

Uma compreenso multinvel da cultura organizacional pode ser feita por meio da caracterizao de nveis centrais,
intermedirios e perifricos, ou seja, trs nveis denominados endocultura, mesocultura e exocultura. A exocultura ou cultura
potencial caracteriza-se pelo nvel externo da cultura corporativa, formado por
(A)

traos psicolgicos j instalados que se manifestam por meio de comportamentos de aceitao ou resistncia para com os
novos modelos de trabalho.

(B)

valores centrais e expressos de modo recorrente nas interaes humanas que ocorrem por meio dos canais formais de
comunicao.

(C)

representaes e traos fundamentais da cultura que esto centralizados e bem definidos, mas que permanecem no
inconsciente coletivo.

(D)

condutas ainda experimentais com o nvel anterior, mas que ainda no so recorrentes o suficiente para serem claramente
percebidas como incorporadas cultura.

(E)

padres e hbitos j razoavelmente estabelecidos que, no caso do modelo proposto por Schein, correspondem ao nvel
mdio que revela alto grau de racionalizao.

Diagnosticado o clima organizacional, aes subsequentes marcam a credibilidade da pesquisa no mbito organizacional. Por
isso, aes corretivas devem ser aplicadas o mais rapidamente possvel, de modo a minimizar seus efeitos negativos nos
resultados dos indivduos trabalhadores e da organizao. Essas aes envolvem
(A)

correo de polticas de gesto, de dinmica de superviso e outros aspectos apontados pelo instrumento diagnstico
utilizado.

(B)

conscientizao dos gestores, por meio de treinamento de sensitividade, quanto aos pontos positivos e negativos
encontrados no diagnstico e publicao dos resultados da pesquisa para os clientes.

(C)

publicao dos resultados da pesquisa para todos os colaboradores e clientes; frum de dvidas e aes corretivas
imediatas para resoluo dos problemas de produo.

(D)

aplicao de fruns de discusses entre os colaboradores e clientes para validar os resultados quantitativos demonstrados
na pesquisa de clima e aplicao de treinamentos de sensitividade aos getores.

(E)

publicao dos resultados da pesquisa para todos os colaboradores; planos de aes de melhoria a serem aplicadas no
mdio prazo.

O processo de recrutamento e seleo tem seu incio quando h a oferta de um cargo ou funo. A anlise das necessidades
faz com que se desenhe um perfil do que esperado do candidato. Traado o perfil, preciso definir, prioritariamente para o
processo seletivo,
(A)
(B)
(C)
(D)
(E)

35.

a remunerao que ser oferecida aos candidatos.


a descrio genrica das atividades para o exerccio da funo.
se o processo de seleo far uso de testes psicolgicos ou de conhecimentos.
as competncias necessrias para o exerccio da funo.
o pacote de benefcios para atrair candidatos.

Um dos problemas enfrentados atualmente pelas empresas o elevado custo dos processos de recrutamento e seleo. A
prtica das entrevistas grupais tem sido uma alternativa para lidar com esta questo econmica, mas no se pode ignorar que a
complexidade do processo de avaliao aumenta, visto que, nesse caso, preciso estar atento a mais de um candidato ao
mesmo tempo. Parmetros de avaliao necessitam de mais preciso e cuidado em sua elaborao. Passa a ser fundamental
(A)

ter em mos um roteiro objetivo de perguntas abertas e fechadas a serem realizadas para cada candidato.

(B)

a presena de outro avaliador, dada as concretas restries cognitivas a que se v imposto a um nico entrevistador.

(C)

a prtica de dinmica de grupo, para que se possa avaliar mais de uma competncia durante o processo de entrevista.

(D)

que as perguntas elaboradas para os candidatos sejam somente do tipo comportamental.

(E)

rastrear somente competncias emocionais durante a entrevista grupal, a fim de excluir do processo aqueles candidatos
com caractersticas autoritrias.

METRO-ADGJ-Psicologia-13

Caderno de Prova 13, Tipo 001


36.

Os programas de tutorizao organizacional apresentamse como ferramentas teis para auxiliarem nos processos
de socializao e tambm durante os perodos de
(A)

(B)

(C)

(D)

(E)

40.

transio de carreiras, uma vez que o colaborador


em tutoria demonstra maior engajamento com a empresa e com seu prprio desenvolvimento, sentindose mais motivado a empreender esforos para a
manuteno do desempenho em nveis elevados.
instabilidade econmica do mercado, uma vez que o
colaborador em tutoria se sentir totalmente seguro
em manter-se no emprego, por ter um sponsor responsvel por sua carreira na empresa e um profissional mais experiente para orient-lo em relao a
novas atividades.
necessidade de reteno de talentos, posto que o
colaborador em tutoria cria um sistema afiliativo
junto ao seu tutor, no demonstrando interesse por
propostas de trabalho oferecidas pelo mercado.
crise de resultados na empresa, fazendo com que o
colaborador em tutoria perceba o seu valor e importncia para transformar o ambiente de crise em
oportunidade.

41.

mudana na organizao, representando um recurso


valioso como fonte de aprendizagem e de suporte
psicossocial, que auxilia os colaboradores em tutoria
a lidarem de forma mais efetiva com as novas
demandas e com o estresse criado por condies de
ambiguidade e incerteza no ambiente de trabalho.

O programa educacional contnuo que envolve os interesses de indivduos, equipes e organizao, diferente do
conjunto de treinamentos tradicionais que visavam apenas
o desenvolvimento de competncias especficas das pessoas, denominado
(A)
(B)
(C)
(D)
(E)

sistema instrucional e diretivo.


educao aberta e sistmica.
educao corporativa e contnua.
sistema educacional dirigido e diretivo.
treinamento de desenvolvimento e educao.

H seis tipos de aprendizagem organizacional, que variam


em termos de abordagens, resultados e contextos conforme Miller. Os tipos de aprendizagem metdica so: analtico, experimental e estrutural. J os de aprendizagem
emergente so:
(A)

situacional, funcional e processual.

(B)

relacional, comportamental e corporativo.

(C)

concreto, abstrato e intuitivo.

(D)

relacional, abstrato e corporativo.

(E)

sinttico, interativo e institucional.

habilidades para enfrentar situaes de estresse;


moral, satisfao e bem estar; condicionamento fsico e sade fsica; suporte social e integrao na
comunidade.

(B)

competncia interpessoal elevada; competncia intrapsquica equilibrada; sade emocional e espiritual


e potencial intelectual.

(C)

habilidades para enfrentar conflitos; motivao dirigida resultados; felicidade e bem estar geral e sade
psquica.

(D)

resilincia; satisfao para com o trabalho realizado;


felicidade e bem estar geral e sade espiritual.

(E)

resilincia; satisfao no ambiente de trabalho; bem


estar geral; sade psquica e espiritual.

O olhar atento sobre as competncias organizacionais revela uma srie de questionamentos sobre a organizao.
Para tanto, na implantao de um modelo de gesto por
competncias, de forma geral, as empresas classificam
suas competncias em categorias distintas, tais como:
essenciais; distintivas; de unidades de negcios; de suporte e capacidade dinmica. As competncias distintivas
conferem organizao
(A)

a segmentao por unidade de negcios.

(B)

vantagens competitivas.

(C)

condies de adaptao rpida e contnua s exigncias de mercado.

(D)

condies de um melhor processo de aprendizagem.

(E)

foco nas estratgias centrais.

_________________________________________________________

_________________________________________________________

38.

(A)

_________________________________________________________

_________________________________________________________

37.

Segundo Bowling, os indicadores de sade positiva so:

42.

O levantamento de necessidades de treinamento realizado em nveis. Entre eles, temos a anlise da estrutura
de cargos, que se inicia a partir do
(A)

exame acurado dos perfis psicolgicos dos empregados com a inteno de identificar os novos hbitos
que devero ser desenvolvidos para que eles
consigam dar conta das metas estabelecidas para o
novo perodo de trabalho.

(B)

perfil psicolgico das pessoas, determinando quais


comportamentos, atitudes, conhecimentos e valores
sero necessrios para desempenhar os cargos.

(C)

estabelecimento dos objetivos pelos quais cada


cargo dever se responsabilizar, identificando assim
o perfil profissional a ser desenvolvido.

(D)

estabelecimento das metas organizacionais que oferecero subsdios sobre as expectativas dos gestores quanto ao nvel de desempenho a ser exigido de
cada colaborador, dentro de um perodo de produo.

(E)

exame dos requisitos e especificaes dos cargos,


avaliando quais so as habilidades, destrezas e competncias que as pessoas devero desenvolver para
desempenhar os cargos.

_________________________________________________________

39.

10

Os Centros de Avaliao so basicamente uma tcnica


padronizada de avaliao do comportamento com base
(A)

em mltiplos inputs.

(B)

em um nico fator de desempenho.

(C)

na teoria multifatorial de desempenho.

(D)

na investigao detalhada de incidentes crticos.

(E)

no processo de avaliao de desempenho de dois


fatores.

METRO-ADGJ-Psicologia-13

Caderno de Prova 13, Tipo 001


43.

O psiclogo de uma empresa foi abordado por um gestor


que lhe pediu que conversasse com um dos seus colaboradores, o qual nos ltimos meses vem apresentando
comportamentos de evitao de atividades sociais e preocupao excessiva em ser criticado ou rejeitado em pblico. Aps a entrevista com este colaborador, o psiclogo
identificou, alm dos comportamentos mencionados pelo
gestor, os seguintes traos: sentimentos persistentes e invasivos de tenso e apreenso; crena de ser socialmente
inepto, pessoalmente desinteressante ou inferior aos
outros; relutncia em se envolver com pessoas, a no ser
com certeza de ser apreciado e restries no estilo de vida
devido necessidade de segurana fsica. Diante das
caractersticas mencionadas, esse colaborador apresenta
um transtorno de personalidade

47.

A tcnica de treinamento que usada principalmente para


ensinar os trabalhadores como fazerem seu atual trabalho
denominada
(A)

treinamento vestibular.

(B)

formao operacional.

(C)

rotao de cargo.

(D)

desempenho profissional.

(E)

treinamento por instruo no prprio cargo.

_________________________________________________________

48.

(A)

anancstica.

(B)

dependente.

(C)

ansiosa.

O conceito de caminho-objetivo para liderana concentrase em vrios tipos de comportamento do lder e de fatores
situacionais. Os tipos de comportamento do lder, neste
conceito, so os seguintes: liderana incentivadora; liderana diretiva; liderana orientada para realizaes; liderana participativa e liderana com influncia

(D)

compulsiva.

(A)

racional.

(E)

obssessiva.

(B)

descendente.

(C)

lateral.

(D)

multidisciplinar.

(E)

ascendente.

_________________________________________________________

44.

Essencialmente, a anlise transacional, como o nome indica, consiste em enfocar as mltiplas maneiras de como se
processam as transaes do sujeito com os demais
membros de um mesmo grupo familiar ou social, partindo
de como se processam e configuram as relaes do seu
ego com as figuras parentais

_________________________________________________________

49.

(A)

idealizadas.

(B)

projetadas.

Os lderes, que se caracterizam por exibirem um comportamento de recompensas contingenciais e um comportamento dinmico de administrao por exceo, aplicam o
estilo de liderana

(C)

transformadas.

(A)

situacional.

(D)

refletidas.

(B)

transacional.

(E)

internalizadas.

(C)

autocrtico.

(D)

democrtico.

(E)

paternalista.

_________________________________________________________

45.

A formao de reao consiste na adoo de um padro


de comportamento que
(A)

repleto de significados projetados pela pessoa em


suas relaes interpessoais.

(B)

significativo e coerente a uma reao negativa que a


pessoa quer demonstrar.

(C)

diretamente oposto tendncia reativa que a pessoa


est tentando esconder, negar ou refutar.

(D)

direcionado a um objeto percebido numa distncia


exterior aos limites psicolgicos da pessoa.

(E)

caracterstico das pessoas com distrbios cognitivos


que tentam apresentar comportamentos adequados
em suas relaes emocionais.

_________________________________________________________

50.

No ambiente organizacional, as barreiras comunicao


eficaz podem ser classificadas entre organizacionais e
individuais. So exemplos de barreiras organizacionais:
(A)

diferenas semnticas e rudo.

(B)

rudo e questes relacionadas ao interesse prprio.

(C)

percepes divergentes e diferenas semnticas.

(D)

colapsos na rede e presses de prazos.

(E)

diferenas de status e espao pessoal.

_________________________________________________________
_________________________________________________________

51.

46.

O mtodo de avaliao de desempenho aplicado por algumas empresas que tem como pressuposto uma curva
normal de desempenho denominado

Um tipo de equipe funcional muito aplicada no ambiente


corporativo aquela composta por grupos de funcionrios
formados para prestar aconselhamento organizao em
determinadas questes. Este tipo de equipe denominada

(A)

comparao binria.

(A)

projetiva.

(B)

incidentes crticos.

(B)

de processo.

(C)

escala grfica induzida.

(C)

de servios.

(D)

escala grfica objetiva.

(D)

consultiva.

(E)

escolha forada.

(E)

de produo.

METRO-ADGJ-Psicologia-13

11

Caderno de Prova 13, Tipo 001


52.

Na escolha de um instrumento de avaliao psicolgica,


fundamental que o psiclogo consulte o Sistema de
Avaliao de Testes Psicolgicos SATEPSI, com o
intuito de verificar se o teste
(A)

possui manual de aplicao estruturado e atualizado.

(B)

foi aprovado para uso em avaliao psicolgica.

(C)

foi testado na populao brasileira.

(D)

considerado um teste de personalidade ou um


inventrio de preferncias.

(E)

produzir os resultados desejados pelo psiclogo.

56.

(A)
(B)
(C)
(D)
(E)
57.

Durante a entrevista de seleo podem ocorrer tendncias


de julgamento por parte do entrevistador em relao ao
entrevistado. Essas tendncias so denominadas de propenses do entrevistador. Um entrevistador que faz uso
excessivo de perguntas, como: "Voc acredita que tem
condies para ocupar este cargo?"; "Voc quis me dizer
que fazia isto ou aquilo...?", apresenta uma propenso
classificada como
(A)

dominao do entrevistador.

(B)

preconceito pessoal.

(C)

utilizao da projeo como mecanismo de sublimao.

efeito-halo.

(B)

o uso da cor vermelha para uma pele mais densa.

(D)

respostas telegrafadas.

(C)

(E)

efeito da recentividade.

o uso da cor acromtica para uma pele mais lisa e


malhada.

(D)

utilizao da transferncia objetal como mecanismo


de defesa.

(E)

uso da representao de cores vivas para manifestao de comportamentos adaptativos.

Segundo a Anlise Transacional, a personalidade estrutura-se em trs entidades ou estados de ego, denominados
estado do ego Pai; estado do ego Adulto e estado do ego
Criana (P-A-C). Um gestor demonstra um estado de ego
Criana diante da situao de atraso de sua secretria na
empresa quando manifesta o seguinte processo comunicativo:
(A)

"Quisera eu poder chegar mais tarde!"

(B)

"Se ela chega atrasada, os outros colaboradores


ficaro insatisfeitos."

(C)

"Se ela chega atrasada, a equipe poder perder


produtividade."

(D)

(E)

_________________________________________________________

58.

59.

12

devoluo.

(B)

encerramento.

(C)

finalizao.

(D)

fechamento.

(E)

avaliao diagnstica.

Ao adotar uma viso interacionista de conflito, os administradores devem encorajar


(A)
(B)
(C)
(D)
(E)

"Coitada! Pela cara dela, parece que passou a noite


em claro."

(A)

sincronicidade.
distoro.
reciprocidade.
eficcia.
empatia.

_________________________________________________________

"Coitada! Ela mora to distante do trabalho, com


certeza deve ter enfrentado muito trnsito na
cidade."

A avaliao psicodiagnstica um processo que, na maioria das vezes, se prolonga por vrias sesses que compreendem entrevistas com o prprio sujeito, com os seus
familiares, alm daquelas reservadas para a administrao de testes. A sequncia se completa com um ltimo
encontro, denominado entrevista de

No processo comunicativo, quanto maior a complexidade


de um tema, a importncia do tema para as partes envolvidas e os sentimentos despertados pelo tema, maiores
so as possibilidade de
(A)
(B)
(C)
(D)
(E)

_________________________________________________________

55.

Na aplicao do Mtodo de Rorschach, o sujeito pode


falar em cor quando (na impresso que teve, foi de textura
(como na resposta "pele de animal, na Lmina IV ou
VI), ainda que este caso seja menos frequente. Se o
sujeito acompanha suas palavras com um movimento dos
dedos sobre a superfcie da mancha, roando-a de leve,
est concretamente nos comunicando a sua impresso de
textura. Contudo, em sua maioria, os sujeitos preferem
usar apenas a comunicao verbal. O fato de o sujeito
verbalizar que sua resposta pode envolver textura, em lminas densamente sombreadas, aumenta a probabilidade
do uso de tal determinante, mas o inqurito que vai determinar sua utilizao. A resposta "pele de animal" pode
sugerir trs possibilidades: o uso do sombreado como
textura; referncia apenas forma e
(A)

_________________________________________________________

54.

multimodais e trabalho.
autogesto e trabalho.
servios e projetos.
autogesto e modais.
informais e superviso.

_________________________________________________________

_________________________________________________________

53.

As equipes podem ser diferenciadas pelo tipo de trabalho


que realizam, e pelo propsito que buscam. Alguns tipos
de equipes funcionais so:

a barganha distributiva.
os conflitos funcionais.
a viso de tnel.
os conflitos disfuncionais.
as opinies convergentes.

_________________________________________________________

60.

As organizaes possuem mecanismos internos que produzem estabilidade. Por exemplo, as pessoas contratadas
so escolhidas por se ajustarem organizao, e depois
so moldadas e orientadas a se comportar de determinadas maneiras. A essa fonte de resistncia organizacional chamamos de
(A)
(B)
(C)
(D)
(E)

ameaa especializao.
foco limitado de mudana.
inrcia estrutural.
ameaa s relaes de poder.
medo do desconhecido.
METRO-ADGJ-Psicologia-13

PROVA: METR - SP
ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: FCC

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

31
32
33
34
35
36
37
38
39
40
41
42
43
44
45

D
D
A
D
B
E
C
E
A
A
B
E
C
E
C

46
47
48
49
50
51
52
53
54
55
56
57
58
59
60

E
E
E
B
D
D
B
D
A
A
C
C
B
B
C

Coletnea de Provas | Concursos de Psicologia

Govern
nodoEstad
dodaB
Bahia
AsssembleiaaLegislativadoEsstadodaB
BahiaALBA
Pro
ovaEscritaObjetiva





TcnicodeNvvelSup
periorManh
h

P colo
Psic
ogia
a
T
TIPO1
1BR
RANCA
A
Inform
maes Geraiss
1. Vocreceberdofiscaldesaala:
a) uma folha de resposttas destinada  marcao das
respostasdasquesteso
objetivas;
(
questtes
b) esse cadeerno de prova contendo 80 (oitenta)
objetivas, cada qual com
m cinco alternaativas de respo
ostas
(A,B,C,DeE).
2. Verifique se seu
s caderno est completo, sem repetio
o de
questes ou falhas.
f
Caso contrrio, notifique imediatameente
o fiscal de sala para qu
ue sejam tom
madas as devvidas
providncias.
o
so id
dentificadas pelo nmero situ
uado
3. As questes objetivas
acimadoseueenunciado.
4. Aoreceberaffolhaderespostasdaprovaob
bjetivavocdevve:

objetiva,deintteira
6. Opreenchimeentodasresposstasdaprovao
responsabilidaade do candidaato, dever serr feito com can
neta
esferogrficad
detintaindelvveldecorpretaaouazul.Nosser
permitida a troca da folha de resposstas por erro do
candidato.
7. O tempo dissponvel para a realizao da prova  de
5(cinco)horaas,jincludootempoparaamarcaodafo
olha
derespostasd
daprovaobjetivva.
po suficiente para o preencchimento de suas
s
8. Reserve temp
respostas. Paara fins de avaliao, se
ero levadas em
considerao apenas as maarcaes realizzadas na folhaa de
respostasda prova
p
objetivaa, no sendo permitido anotar
informaes relativas
r
s suas respostas em
e qualquer outro
meioquenosejaoprpriocadernodepro
ovas.

a) conferir seus


s
dados peessoais, em esspecial seu no
ome,
nmero de
d inscrio e
e o nmero do
d documento de
identidadee;

d incio da prrova


9. Somente aps decorridas2 (duas) horas do
vocpoderrretirarsedasaladeprova,co
ontudosemlevvaro
cadernodeprrovas.

b) ler atentamente as instrrues para o preenchimento


o da
folhadereespostas;

10.Somente no decorrer dos ltimos sesssenta minutos do


perodo da prrova, voc pod
der retirarse da sala levand
do o
cadernodeprrovas.

c) marcar naa folha de resp


postasda prova objetiva o cam
mpo
relativo confirmaod
dotipo/corde prova,conform
meo
cadernoquevocrecebeeu;
c
d) assinar seeu nome, apenas nos espaos reservados, com
canetaesfferogrficadettintaazuloupreeta.
5. Duranteaapliicaodaprovaanoserperm
mitido:
a) qualquerttipodecomunicaoentreoscandidatos;
b) levantard
dacadeirasem adevidaautorrizaodofiscaalde
sala;
c) portar aparelhos eletrnicos, tais com
mo bipe, teleffone
p
recep
ptor,
celular, aggenda eletrnicca, notebook, palmtop,
gravador, mquina de calcular, mquina fotogrfica
digital, co
ontrole de alarme de carro etc., bem co
omo
relgiodeequalquermod
delo,culosesccurosouquaisq
quer
acessrioss de chapelariaa, tais como ch
hapu, bon, go
orro
etc. e, ainda, lpis, lap
piseira (grafite)), corretor lqu
uido
e/ouborraacha.Talinfraopoderacarrretaraeliminaao
sumriado
ocandidato.

a prova, entreggue a folha de respostasao fiiscal


11.Ao terminar a
da sala e deeixe o local dee prova. Caso voc se negu
ue a
entregar,sereliminadodocconcurso.
12.A FGV realizar a coleta da impresso digiital dos candidaatos
nafolhaderespostas.
13.Oscandidatosspoderosersubmetidosasisstemadedetecco
de metais qu
uando do ingresso e da saada de sanitrios
durante a reaalizao das pro
ovas. Ao sair da sala, ao trm
mino
daprova,ocaandidatonopo
oderusarosanitrio.
14.Os gabaritoss preliminaress das provas objetivas seero
divulgados no dia 13/05//2014, no endereo eletrnico
www.fgv.br/fggvprojetos/concursos/alba.
p
interposio de recu
ursos contra os
15.O prazo para
gabaritos prreliminares seer das 0h
h00min do dia
14/05/2014 at s 23h
h59min do dia 15/05/20
014,
observado o horrio oficial de Salvador, no
endereowww
w.fgv.br/fgvprojjetos/concursoss/alba, por meio
m
doSistemaEleetrnicodeInterposiodeReccurso.

AssembleiaLegislativadoEstadodaBahia2014



ConhecimentosEspecficos
51
Uma funcionria foi encaminhada  psicloga da empresa em
funo de problemas de relacionamento com os colegas e
clientesnosltimosdoismeses.Afuncionriatrabalhavahdez
anosnaempresaenuncaapresentaraproblemasnoambientede
trabalho. Ultimamente, entretanto, parecia desmotivada e com
dificuldadedecumprirastarefassolicitadas.
A situao era complexa, porque a empresa vinha atravessando
umperododemudana,emfunodemodificaesplanejadas
para o final do ano. Como a funcionria era uma pessoa de
confiana, fora responsabilizada por uma parte significativa dos
procedimentoseachefeadmitiaqueelaestavasobrecarregada.
Em conversa com a funcionria, a psicloga soube que
elaapresentava vrios outros sintomas fsicos e mentais como
sentimentodeimpotncia,cansao,insnia,irritao,problemas
deatenoememriaetaquicardia.
Combasenocasodescrito,odiagnsticosugeridopela psicloga
de
(A) DoenadeHuntington.
(B) SndromedeAsperger.
(C) DoenadeTaySachs.
(D) SndromedeBurnout.
(E) DoenadeCreutzfeldtJakob.

52
Um dos problemas que afetam o rendimento no trabalho  o
nveldeansiedadeouestressevivenciado.
Aesserespeito,analiseasafirmativasaseguir.
I. O Inventrio de Sintomas de Stress para adultos de
Lipp(IVSSL)foiconstrudocombasenoconceitodeansiedade
deHansSelye.
II. O Inventrio de Sintomas de Stress para adultos de
Lipp(IVSSL)permiteavaliaraansiedadeemadultos,indicando
a fase de ansiedade em que o indivduo se encontra: alerta,
resistnciaouexausto.
III. O Inventrio de Sintomas de Stress para adultos de
Lipp(IVSSL) avalia sintomasde stress nas ltimas 48 horas
(alerta)enoltimoms(resistnciaeexausto).
Assinale:
(A) sesomenteaafirmativaIestivercorreta.
(B) sesomenteaafirmativaIIestivercorreta.
(C) sesomenteaafirmativaIIIestivercorreta.
(D) sesomenteasafirmativasIeIIIestiveremcorretas.
(E) sesomenteaafirmativaIIeIIIestiveremcorretas.

TcnicodeNvelSuperiorPsicologia

FGV Projetos


53
Um psiclogo soube que uma empresa estava contratando
estagirios de diferentes cursos de graduao para fazer
aplicaes de inventrios de personalidade. Os estagirios
trabalhavamsupervisionadosporumapsicloga,queorganizava
um perodo inicial de treinamento, durante o qual aprendiam a
utilizardiferentestcnicas.
A empresa funcionava terceirizada, prestando servios e
consultoriaparavriasoutrasempresas,combastantesucesso.
Aesserespeito,analiseasafirmativasaseguir.
I. O psiclogo comunicou a situao ao Conselho Federal de
Psicologia.
II. O psiclogo resolveu no tomar nenhuma medida, uma vez
que a psicloga parecia cuidadosa e treinava os estagirios
pararealizarosprocedimentos.
III. O psiclogo enviou uma carta  empresa, explicando quea
psicloga estava ferindo o Cdigo de tica Profissional do
psiclogo.
Assinale:
(A) sesomenteaafirmativaIestivercorreta.
(B) sesomenteaafirmativaIIestivercorreta.
(C) sesomenteaafirmativaIIIestivercorreta.
(D) sesomenteasafirmativasIIeIIIestiveremcorretas.
(E) setodasasafirmativasestiveremcorretas.

54
Naescolhadosinstrumentospsicolgicosaseremaplicados,uma
sriedeaspectosdevemserconsiderados:
I. o coeficiente de fidedignidade diz respeito a duas
mensuraessimilaresdeummesmotrao,comautilizao
desseinstrumentooudeinstrumentosequivalentes.
II. a validade de um teste diz respeito  possibilidade do teste
medirexatamenteoqueotestepretendemedir.
III. afidedignidadepodeserdeconstrutooudeconsistncia.
Assinale:
(A) sesomenteoaspectoIestivercorreto.
(B) sesomenteoaspectoIIestivercorreto.
(C) sesomenteoaspectoIIIestivercorreto.
(D) sesomenteosaspectosIeIIestiveremcorretos.
(E) setodososaspectosestiveremcorretos.

55
O consumo de lcool e drogas  um problema de extrema
importncia,sendoconsideradocomoumadasprincipaiscausas
demortee/oudeabsentesmonotrabalho.
Aesserespeito,assinaleaafirmativacorreta.
(A) O nmero de empresas com programas especficos para
funcionriosusuriosdedrogastmaumentado.
(B) AinternaoreveliaproibidanoBrasil.
(C) Os CAPS so dispositivos especficos para o atendimento de
usuriosdedrogas.
(D) ApolticadereduodedanosnorecomendadanoBrasil.
(E) As famlias que consomem lcool regularmente tm maior
probabilidade de terem adolescentes que consomem lcool
precocemente.

Tipo1CorBrancaPgina11

AssembleiaLegislativadoEstadodaBahia2014


FGV Projetos

56

60

A BaterialFatorial de Personalidade  um instrumento aprovado


pelo CPF que avalia a personalidade, sendo utilizado em
numerososcontextos.
Aesserespeito,assinaleaafirmativacorreta.
(A) A Baterial Fatorial de Personalidade  constituda por
4dimenses.
(B) Um dos pontos importantes da Baterial Fatorialde
PersonalidadeofatodetersidoconstrudanoBrasil.
(C) A dimenso de sociabilidade inclui a amabilidade e a
confiananaspessoas.
(D) A dimenso de realizao inclui a competncia e o
comprometimento.
(E) A dimenso de extroverso inclui a comunicao, o
dinamismoeasinteraessociais.

A respeito do mtodo Zulliger, teste bastante utilizado em


processosseletivos,assinaleaafirmativacorreta.
(A) Nesse mtodo,asdeterminantes de resposta so forma,
movimentoecor.
(B) Nesse mtodo,a aplicao individual inclui as instrues, a
aplicaopropriamenteditaeoinqurito.
(C) Nessemtodo,pessoascommenosdequatrorespostascom
contedos diversificados tendem a ser estereotipadas e
inflexveis.
(D) Nesse mtodo, as respostas de movimento humano esto
associadascriatividade.
(E) Nesse mtodo, as respostas de cor pura(C) indicam
incapacidadedecontroleemocional.

57
Em relao  ateno bsica na sade, assinale a afirmativa
correta.
(A) Os princpios da ateno bsica no Brasil so integralidade,
qualidadeeparticipaosocial.
(B) A atuao das equipes de sade est restrita s aes de
preveno,recuperaoereabilitaodedoenas.
(C) O trabalho com pacientes alcolatras est restrito 
prevenoterciria.
(D) A estratgia de Sade da Famlia acompanha as mudanas
propostas,apartirdasconfernciasdeAlmaAtaeOttawa.
(E) A ateno primria na sade  um conceito similar ao
conceitodeprevenoprimria.

ArespeitodotestedasMatrizesProgressivasdeRaven,aplicado
em diferentes situaes inclusive as de processos seletivos,
analiseasafirmativasaseguir.
I. OtestedeRavenbuscaavaliarofatorg.
II. OtestedeRavenumtesteverbal.
III. O teste de Raven tem base no referencial terico de
Spearman.
Assinale:
(A) sesomenteaafirmativaIestivercorreta.
(B) sesomenteaafirmativaIIestivercorreta.
(C) sesomenteaafirmativaIIIestivercorreta.
(D) sesomenteasafirmativasIeIIIestiveremcorretas.
(E) setodasasafirmativasestiveremcorretas.

58

62

DeacordocomaDSMIV,odiagnsticopositivodostranstornos
manacosfeitoapartirdosseguintessintomas:
I. presena de cinco ou mais sintomas,dentre o total dos
sintomasdescritos.
II. persistnciadossintomasdurante,aomenos,umasemana.
III. sintomas como autoestima diminuda, acelerao
psicomotora,desinibiosocial/sexual,fugadeideias.
Assinale:
(A) sesomenteosintomaIestivercorreto.
(B) sesomenteosintomaIIestivercorreto.
(C) sesomenteosintomaIIIestivercorreto.
(D) sesomenteossintomasIIeIIIestiveremcorretos.
(E) setodasossintomasestiveremcorretos.

O Inventrio Fatorial de Personalidade (IVPII)  um instrumento


que pode auxiliar nos processos de recrutamento e seleo, a
partirdaavaliaodosmotivosounecessidadesquedeterminam
ocomportamentodosindivduos.
Aesserespeito,assinaleaafirmativacorreta.
(A) O(IVPII)constitudopor10itens.
(B) Os fatores afago e heterossexualidade foram retirados da
relao de itens compreendidos no Inventrio Fatorial de
Personalidade(IVPII).
(C) O fator intracepo diz respeito  tendncia a atuarem
funodesentimentosouinclinaesdifusas.
(D) O Inventrio Fatorial de Personalidade(IVPII) no tem uma
padronizaoparaoBrasil.
(E) Os blocos de apurao de respostas no so diferenciados
segundoosexodosujeito.

59
Sobre as normas para a elaborao de documentos escritos,
segundo o Conselho Federal de Psicologia, assinale a afirmativa
correta.
(A) Os documentos escritos compreendem as declaraes, os
atestadoseoslaudospsicolgicos.
(B) Asdeclaraesdevemincluirdadosrelativosfrequncias
sesses, perodo de atendimento e motivos ou sintomas do
comparecimentodosolicitante.
(C) O laudo psicolgico objetiva responder a uma questo
especfica.
(D) Os termos tcnicos utilizados no laudo psicolgico devem
incluir explicaes retiradas dos fundamentos terico
filosficosqueossustentam.
(E) Os documentos escritos, bem como o material que os
fundamentaram devem ser guardados por um perodo
mnimode10anos.

TcnicodeNvelSuperiorPsicologia

61

63
Com o objetivo de auxiliar em uma deciso, foi solicitada a um
psiclogo especialista em famlias, a elaborao de um
parecerpsicolgico.
Aesserespeito,analiseasafirmativasaseguir.
I. Oparecerdeveresponderaquesitosespecficos.
II. O parecer deve comear por uma ampla avaliao sobre o
problemaquemotivouasolicitao.
III. O parecer deve atender s orientaes do CFP para a
elaboraodelaudospsicolgicos.
Assinale:
(A) sesomenteaafirmativaIestivercorreta.
(B) sesomenteaafirmativaIIestivercorreta.
(C) sesomenteaafirmativaIIIestivercorreta.
(D) sesomenteasafirmativasIeIIIestiveremcorretas.
(E) setodasasafirmativasestiveremcorretas.

Tipo1CorBrancaPgina12

AssembleiaLegislativadoEstadodaBahia2014



FGV Projetos


64

68

Arespeitodosestadosdepressivos,assinaleaafirmativacorreta.
(A) No esturpor depressivo, o paciente pode vir a falecer por
complicaesclnicas,comopneumonias.
(B) Na depresso agitada, o paciente pode apresentar
alucinaescomcontedosdeculpa.
(C) Na depresso psictica aguda, o paciente permanece em
estadodecatalepsia.
(D) Adistimiaumquadrodeintensidadeleveeremissobreve.
(E) Os quadros de depresso secundria costumam estar
associadosasituaesdeluto.

Umpsiclogodeuincioaumprocessoseletivo,determinandoos
conhecimentos, habilidades e aptides necessrias para o cargo
em questo. Posteriormente, selecionou entre os currculos
apresentados, aqueles que atendiam ao perfil desejado,
solicitandoqueoscandidatosfalassemsobreasdiferentesreas
previamenteestabelecidas.
Combasenocasodescrito,assinaleaopoqueindicaomtodo
deentrevistautilizadopelopsiclogonesseprocessoseletivo.
(A) Entrevistaaberta.
(B) Entrevistaporcompetncias.
(C) Entrevistaestruturada.
(D) Entrevistacomportamental.
(E) Entrevistacognitiva.

65
Sobreagestoporcompetncias,abordagemadotadapormuitas
empresas,assinaleaafirmativacorreta.
(A) Agestoporcompetnciapropeseacaptar,desenvolvere
avaliarascompetnciasindividuais.
(B) Ospontosbsicosconsideradosnagestoporcompetncias
soashabilidadeseascompetnciastcnicasdoindivduo.
(C) No modelo de gestes por competncias, cabe ao gestor
identificarascompetnciasdosseuscolaboradores.
(D) A gesto por competncia substitui o levantamento de
necessidadesdetreinamentoporumavisodasnecessidades
da empresa e de como as pessoas podero agregar valor 
empresa.
(E) Aspautasoureferenciaisdedesempenhodizemrespeitoaos
conhecimentos que o profissional precisa ter para
desempenharumafuno.

66
Sobre as diretrizes para a realizao de um trabalho
depsicoterapia cognitivocomportamental, assinale a afirmativa
correta.
(A) A terapia comportamental  uma abordagem ecltica,
baseadanosensocomum.
(B) A terapia cognitivocomportamental determina que
cognies disfuncionais esto envolvidas nos transtornos
psicolgicos.
(C) Aterapiacognitivocomportamentalfocalizaseutrabalhoem
dois nveis de cognio: os pensamentos automticos e as
crenasnucleares.
(D) O foco das terapias cognitivocomportamental so as
mudanascomportamentais.
(E) A adivinhao  um tipo de distoro cognitiva, na qual o
indivduofazumaleituramentaldopensamentodosoutros.

67
Ao considerarmos o delrio,  possvel determinar as seguintes
dimensesimportantes:
(A) os indivduos com retardo mental apresentam delrios mais
organizados.
(B) apreocupaocomodelriomaisencontradaemindivduos
comtranstornodelirante.
(C) o grau de convico do delrio   mais intenso nas psicoses
reativasbreves.
(D) a extenso do delrio  mais ampla nas psicoses reativas
breves.
(E) o comportamento desviante est mais presente em
indivduoscommaniapsictica.

TcnicodeNvelSuperiorPsicologia

69
O sistema de gesto por competncias inclui uma srie de
procedimentos.
Aesserespeito,analiseasafirmativasaseguir.
I. No mapeamento e mensurao por competncias so
identificados os conhecimentos necessrios a uma
determinada funo e determinados os graus ideais em que
essesconhecimentosdevemestarpresentes.
II. Na avaliao por competncias  verificado se o perfil dos
funcionriosatendesnecessidadesdaempresa.
III. No plano de desenvolvimento por competncias procurase
potencializaroperfildecompetnciasdecadafuncionrio.
Assinale:
(A) sesomenteaafirmativaIestivercorreta.
(B) sesomenteaafirmativaIIestivercorreta.
(C) sesomenteaafirmativaIIIestivercorreta.
(D) sesomenteasafirmativasIIeIIIestiveremcorretas.
(E) setodasasafirmativasestiveremcorretas.

70
Em relao ao procedimento de recrutamento e seleo, analise
asafirmativasaseguir.
I. Recrutamento  o processo de escolha dos candidatos que
melhorseadaptamaocargoproposto.
II. Os processos seletivos so compostos por entrevistas
individuais,dinmicadegrupo,aplicaesdetesteseoutros
procedimentos.
III. A organizao de um processo seletivo obedece s
prefernciaspessoaisdosetordepsicologia.
Assinale:
(A) sesomenteaafirmativaIestivercorreta.
(B) sesomenteaafirmativaIIestivercorreta.
(C) sesomenteaafirmativaIIIestivercorreta.
(D) sesomenteasafirmativasIeIIestiveremcorretas.
(E) setodasasafirmativasestiveremcorretas.

Tipo1CorBrancaPgina13

AssembleiaLegislativadoEstadodaBahia2014


FGV Projetos

71

74

Asquestesdesadementaldotrabalhadortmsidoavaliadasa
partir de estudos sobre os efeitos do trabalho no cotidiano das
pessoas. Dentre essesestudos,podemos destacar o trabalhode
ChristopheDejours.
Sobre o trabalho de Christophe Dejours,analise as afirmativas a
seguir.
I. Segundo Dejours, o objetivo do trabalhador  receber
recompensasmateriaisporseutrabalho.
II. Christophe Dejours descobriu que as presses vividas no
ambientedetrabalhodecorremdadesorganizaopessoal.
III. O trabalho de Christophe Dejours introduziu modificaes
nosprogramasdesadedotrabalhadorpropostosnoBrasil.
Assinale:
(A) sesomenteaafirmativaIestivercorreta.
(B) sesomenteaafirmativaIIestivercorreta.
(C) sesomenteaafirmativaIIIestivercorreta.
(D) sesomenteasafirmativasIeIIestiveremcorretas.
(E) sesomenteasafirmativasIIeIIIestiveremcorretas.

AEscaladeAnsiedadedeBeckuminstrumentoaplicadotanto
naclnicaquantoempesquisas.
ArespeitodaescaladeBeck,assinaleaafirmativacorreta.
(A) Nodeveseraplicadacoletivamente.
(B) Osresultadosdessaescalasotransformadosemtrsscores
 a ansiedade leve, a ansiedade moderada e a ansiedade
severa.
(C) EssaescalacontraindicadanahiptesediagnsticadeTOC.
(D) Essaescalauminstrumentodeautoaplicao.
(E) O formulrio dessa escala  um questionrio de mltipla
escolhacom25itens.

72
A respeito dodesenho de cargos nas empresas, avalie as
afirmativasaseguir.
I. Eletemavercomaestruturaoedimensionamentodeum
cargoemumaorganizao.
II. Ele obedece aos modelos clssico, humanstico e
contingencial.
III. O modelo contingencial considera as pessoas, a tarefa e a
estruturaorganizacional.
Assinale:
(A) sesomenteaafirmativaIestivercorreta.
(B) sesomenteaafirmativaIIestivercorreta.
(C) sesomenteaafirmativaIIIestivercorreta.
(D) sesomenteaafirmativaIeIIestiveremcorretas.
(E) setodasasafirmativasestiveremcorretas.

73
Umafuncionriafoiadmitidaemumaempresadepoisdepassar
por um processo de seleo bastante rigoroso. Iniciando seu
trabalho, mostrouse competente e ativa, sugerindo solues
para os problemas que lhe eram apresentados. Entretanto, 
medidaqueotempopassava,comeouaterdificuldadescoma
execuo das tarefas solicitadas, entregandoas sempre no final
doprazo.
Afuncionriatinhaconscinciadoproblemaeaceitouaindicao
de um atendimento psicolgico, uma vez que o problema estava
repercutindo desfavoravelmente no seu trabalho. Durante a
avaliao psicolgica, a funcionria admitiu que esse problema
estavapresenteemvriasreasdesuavida,sendosugeridauma
terapiabreveparadiscutirosintomaapresentado.
Combaseno casodescrito, odiagnsticosugeridopelopsiclogo
de
(A) ansiedade.
(B) angstia.
(C) procrastinao.
(D) depresso.
(E) SndromedeBurnout.

TcnicodeNvelSuperiorPsicologia

75
Em relao ao processo de recrutamento interno, assinale a
afirmativacorreta.
I. Orecrutamentointernonoapresentapontosnegativos.
II. O recrutamento interno  ideal para empresas com
estabilidade.
III. O recrutamento interno incentiva a fidelidade dos
funcionriosempresa.
Assinale:
(A) sesomenteaafirmativaIestivercorreta.
(B) sesomenteaafirmativaIIestivercorreta.
(C) sesomenteaafirmativaIIIestivercorreta.
(D) sesomenteaafirmativaIIeIIIestiveremcorretas.
(E) setodasasafirmativasestiveremcorretas.

76
A respeito daEscala Wesler de Inteligncia para Adultos (WAIS),
umdostestesmaisutilizadosparamedirfatoresdeinteligncia,
assinaleaafirmativacorreta.
(A) OWAISnoestpadronizadoparaoBrasil.
(B) OWAIScomportodeumQIverbaledeumQIdeexecuo.
(C) O QI verbal  composto pelos itens informao,
compreenso,aritmticaesemelhanas.
(D) O QI deexecuo  compostopelos itens completar figuras,
cubosearmarobjetos.
(E) AanlisedoWAISincluiaanlisedasdiscrepnciasentreos
resultadosglobaiseosresultadosdossubtestes.

77
Nos estudos sobre os processos seletivos nas organizaes, 
importante considerar a contribuio dos estudos clssicos. A
esserespeito,assinaleaafirmativacorreta.
(A) Os primeiros procedimentos de seleo foram realizados no
exrcitoamericanoduranteasegundaguerramundial.
(B) O experimento clssico de Elton Mayo concluiu que a
motivaoindividualdostrabalhadorespermiteentenderseu
comportamento.
(C) Segundo Taylor, o trabalhador deveria ser incentivado a
avaliarecontrolarseuprpriotrabalho.
(D) Osistematayloristaincentivavaapesquisadenovosmtodos
detrabalhoparaaumentaraprodutividade.
(E) O taylorismo buscou aperfeioar o processo de diviso
tcnicadotrabalho.

Tipo1CorBrancaPgina14

AssembleiaLegislativadoEstadodaBahia2014



78
O Conselho Federal de Psicologia (CFP) regulamentou o
atendimentoonlinepormeiodaResoluon011/2012.
Aesserespeito,assinaleaafirmativacorreta.
(A) Testespsicolgicosonlinesoproibidos.
(B) O atendimento a crianas e adolescentes online dever
seguiroscritriosdoEstatutodaCrianaedoAdolescente.
(C) O atendimento virtual dever ser realizado em at
30encontrosvirtuais.
(D) Apermissoparaapermanncianoardeumsiteautorizado
peloCFPserdecincoanos,renovveisporigualperodo.
(E) Nocasodoatendimentoonline,autorizadoaremunerao
aoparticipantedepesquisas.

FGV Projetos




79
Um psiclogo foi convocado para trabalhar em uma situao
emergencial,emqueseconfiguravacalamidadepblica.
Aesserespeito,analiseasafirmativasaseguir.
I. Opsiclogocondicionouseucomparecimentoaopagamento
dehorasextra.
II. O psiclogo compareceu ao local solicitado, respondendo 
convocao.
III. O psiclogo condicionou seu comparecimento ao
recebimentodealgumavantagem,comoabonodefriasou
contagemdediasparalicenaprmio.
Assinale:
(A) sesomenteaafirmativaIestivercorreta.
(B) sesomenteaafirmativaIIestivercorreta.
(C) sesomenteaafirmativaIIIestivercorreta.
(D) sesomenteasafirmativasIIeIIIestiveremcorretas.
(E) setodasasafirmativasIIeIIIestiveremcorretas.

80
Em relao aos distrbios de memria, analise as afirmativas a
seguir.
I. O uso prolongado de medicamentos de origem
benzodiazepinos, antidepressivos e antiepilpticos contribui
paraadisfunodosprocessosdememria.
II. O excesso de estimulao contribui para os distrbios de
memria.
III. Programas de ativao de memria retardam processos
degenerativos.
Assinale:
(A) sesomenteaafirmativaIestivercorreta.
(B) sesomenteaafirmativaIIestivercorreta.
(C) sesomenteaafirmativaIIIestivercorreta.
(D) sesomenteasafirmativasIeIIIestiveremcorretas.
(E) setodasasafirmativasestiveremcorretas.



TcnicodeNvelSuperiorPsicologia

Tipo1CorBrancaPgina15

PROVA: AL - BA
ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: FGV

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

51
52
53
54
55
56
57
58
59
60
61
62
63
64
65

D
A
A
D
E
X
D
B
D
D
D
C
A
A
D

66
67
68
69
70
71
72
73
74
75
76
77
78
79
80

B
B
B
D
B
C
E
C
D
D
E
E
B
B
E

Coletnea de Provas | Concursos de Psicologia

Defensoria Pblica do Estado do Rio de Janeiro


Concurso Pblico 2014

Prova Escrita Objetiva Nvel Superior Tcnico Especializado

PSICOLOGIA
TIPO 1 BRANCA
Informaes Gerais
1. Voc receber do fiscal de sala:
a) uma folha de respostas destinada marcao das
respostas das questes objetivas;
b) este caderno de prova contendo 80 (oitenta) questes
objetivas, cada qual com cinco alternativas de respostas
(A, B, C, D e E).
2. Verifique se seu caderno est completo, sem repetio de
questes ou falhas. Caso contrrio, notifique imediatamente
o fiscal de sala para que sejam tomadas as devidas
providncias.
3. As questes objetivas so identificadas pelo nmero situado
acima do seu enunciado.
4. Ao receber as folhas de respostas da prova objetiva, voc
deve:
a) conferir seus dados pessoais, em especial seu nome,
nmero de inscrio e nmero do documento de
identidade;

6. O preenchimento das respostas da prova objetiva, de inteira


responsabilidade do candidato, dever ser feito com caneta
esferogrfica de tinta indelvel de cor preta ou azul. No ser
permitida a troca da folha de respostas por erro do
candidato.
7. O tempo disponvel para a realizao da prova de
4 (quatro) horas, j includo o tempo para a marcao da
folha de respostas da prova objetiva.
8. Reserve tempo suficiente para o preenchimento de suas
respostas. Para fins de avaliao, sero levadas em
considerao apenas as marcaes realizadas nas folhas de
respostas da prova objetiva, no sendo permitido anotar
informaes relativas s suas respostas em qualquer outro
meio que no seja o prprio caderno de provas.
9. Somente aps decorridas duas horas do incio da prova, voc
poder retirar-se da sala de prova, contudo sem levar o
caderno de provas.

b) ler atentamente as instrues para o preenchimento da


folha de respostas;

10. Somente no decorrer dos ltimos sessenta minutos do


perodo da prova, voc poder retirar-se da sala levando o
caderno de provas.

c) marcar nas folhas de respostas da prova objetiva o campo


relativo confirmao do tipo/cor de prova, conforme o
caderno que voc recebeu;

11. Ao terminar a prova, entregue a folha de respostas ao fiscal


da sala e deixe o local de prova. Caso voc se negue a
entregar, ser eliminado do concurso.

d) assinar seu nome, apenas nos espaos reservados, com


caneta esferogrfica de tinta azul ou preta.

12. A FGV realizar a coleta da impresso digital dos candidatos


na folha de respostas.

5. Durante a aplicao da prova no ser permitido:


a) qualquer tipo de comunicao entre os candidatos;
b) levantar da cadeira sem a devida autorizao do fiscal de
sala;
c) portar aparelhos eletrnicos, tais como bipe, telefone
celular, agenda eletrnica, notebook, palmtop, receptor,
gravador, mquina de calcular, mquina fotogrfica
digital, controle de alarme de carro etc., bem como
relgio de qualquer modelo, culos escuros ou quaisquer
acessrios de chapelaria, tais como chapu, bon, gorro
etc. e, ainda, lpis, lapiseira (grafite), corretor lquido
e/ou borracha. Tal infrao poder acarretar a eliminao
sumria do candidato.

13. Os candidatos podero ser submetidos a sistema de deteco


de metais quando do ingresso e da sada de sanitrios
durante a realizao das provas. Ao sair da sala, ao trmino
da prova, o candidato no poder usar o sanitrio.
14. Os gabaritos preliminares das provas objetivas sero
divulgados no dia 08/04/2014, no endereo eletrnico
www.fgv.br/fgvprojetos/concursos/dpge/rj.
15. O prazo para interposio de recursos contra os gabaritos
preliminares ser das 0h00min do dia 09/04/2014 at as
23h59min do dia 10/04/2014, observado o horrio oficial, no
endereo www.fgv.br/fgvprojetos/concursos/dpge/rj, por
meio do Sistema Eletrnico de Interposio de Recurso.

Concurso Pblico para a Defensoria do Estado do Rio de Janeiro 2014

FGV - Projetos

CONHECIMENTOS ESPECFICOS
QUESTO 41
Em outubro de 2013 ganhou repercusso na mdia a deciso do
TJMG de devolver para a famlia biolgica a menina Duda, 5 anos.
Afastada dos genitores por maus tratos aos 2 meses de idade,
Duda ficou em acolhimento institucional at 1 ano e 8 meses. Ela
foi ento encaminhada para uma famlia, que pediu sua adoo e
com a qual j convivia h mais de dois anos quando da deciso do
Tribunal. Considerando os aspectos psicolgicos dessa situao
luz dos desenvolvimentos tericos da Teoria do Apego de John
Bowlby, correta a seguinte considerao:
(A) o apego materno instintivo e natural e permite que a
criana construa vnculos de cuidado permanentes e
protetores de sua higidez emocional.
(B) a adoo medida excepcional e irrevogvel, qual se deve
recorrer apenas quando esgotados os recursos de
manuteno da criana na famlia natural ou extensa.
(C) crianas institucionalizadas em tenra idade desenvolvem
comumente um quadro de depresso anacltica que, nos
casos mais graves, pode evoluir para o bito.
(D) a vivncia de uma relao calorosa, ntima e contnua com a
me ou me substituta permanente essencial sade
mental da criana pequena.
(E) a ruptura na continuidade de cuidados pela famlia adotiva
resultar no desenvolvimento de um falso self como
estratgia de defesa da personalidade.

QUESTO 42
O consumo de crack no Brasil vem crescendo desde a dcada de
90, sobretudo entre crianas, adolescentes e adultos em situao
de rua, motivando presses diversas sobre os atores sociais pela
necessidade de aes que deem aos usurios oportunidades de
viver de forma digna e com sade. Os efeitos psquicos, fsicos e
sociais do consumo de crack mais comumente observados so
(A) o surgimento tardio dos fenmenos da tolerncia e da
abstinncia, provocando nos usurios um comportamento
compulsivo de reutilizao da substncia.
(B) o aumento na incidncia de DSTs e da contaminao por HIV
em adolescentes e mulheres, em decorrncia da prtica de
sexo sem proteo em troca de crack.
(C) a criao de cracolndias como parte da estratgia de reduo
de danos destinada a usurios com comorbidades
psiquitricas e sem referncia de moradia.
(D) o aumento na incidncia de infanticdios de recm-nascidos
por purperas usurias prejudicadas em suas habilidades
cognitivas e na regulagem das emoes.
(E) a necessidade de autorizao judicial ou dos responsveis
legais para o acesso de adolescentes ao atendimento dos
consultrios de rua.

Tcnico Superior Especializado em Psicologia

Tipo 1 Cor Branca Pgina 7

Concurso Pblico para a Defensoria do Estado do Rio de Janeiro 2014

FGV - Projetos

QUESTO 43

QUESTO 45

A interdio de idosos, independentemente do motivo, um


assunto que provoca polmica, divide opinies, gera conflitos
familiares e na maioria das vezes traz sofrimento para os dois
lados. Apesar da deciso no ser fcil, a curatela, que se d por
meio de deciso judicial, serve para proteger o interditado,
preservar seu patrimnio e dar a ele melhor qualidade de vida.
Considerando a percia imprescindvel para a deciso judicial,
ser passvel de interdio o idoso
(A) portador de enfermidade ou deficincia mental que
impossibilite seu discernimento para os atos da vida civil.
(B) sem vnculos de afinidade ou parentesco direto, a saber,
cnjuge, filhos e parentes at o segundo grau.
(C) que, ao exame psquico, apresentar-se hipertenaz e hipervigil,
com orientao alopsquica e curso prolixo do pensamento.
(D) que, ao exame psquico, apresentar um quadro de humor
distmico acompanhado de pensamentos hiperblicos.
(E) com faculdades fsicas e mentais preservadas que manifestar
de forma inequvoca perante o Juzo sua vontade de ser
curatelado.

As aes de adoo postuladas por pessoas homossexuais e por


casais homoafetivos so uma realidade nas Defensorias Pblicas
com atribuio de Infncia e Juventude. Essas configuraes
familiares tm sido objeto de estudos na rea da Psicologia que
apontam que
(A) a ausncia de modelos do gnero masculino e feminino pode,
eventualmente, tornar confusa a prpria identidade sexual,
havendo o risco de a criana tornar-se homossexual.
(B) a criana que vive em um lar homossexual ser socialmente
estigmatizada ou ter prejudicada a sua insero social, o que
lhe acarretar perturbaes psquicas.
(C) a funo parental no est contida no sexo e sim na forma
como os adultos que esto no lugar de cuidadores lidam com
as questes de poder, hierarquia e disciplina no
relacionamento com os filhos.
(D) a habilitao para adoo de pares homoafetivos indicada
para a consecuo de adoes necessrias, a saber, de
crianas mais velhas, doentes e grupos de irmos, para os
quais h poucos pretendentes.
(E) a partir de um vis psicanaltico correto afirmar que funo
materna e funo paterna correspondem necessria e
biunivocamente a uma mulher e a um homem.

QUESTO 44
De acordo com pesquisas acadmicas recentes, o TDAH, o
transtorno desafiador opositivo e o transtorno de conduta
lideram a lista dos transtornos mais diagnosticados por
neuropediatras e psiquiatras infantis na atualidade, sendo a
prevalncia destes estimada em 3% a 6% da populao infantil e,
dependendo do critrio utilizado, podendo chegar a 26% da
mesma populao. Uma anlise crtica desse fenmeno permite
concluir que
(A) as descobertas sobre os mecanismos neuroqumicos e o
desenvolvimento de novos psicofrmacos permitiram
diagnsticos mais acurados e tratamentos mais adequados s
patologias neuropsiquitricas da populao infanto-juvenil.
(B) atualmente, a medicalizao tem sido utilizada no apenas
como a principal forma de tratamento da criana, mas
como dispositivo de vigilncia e controle que as instncias
tutelares realizam sobre a famlia e a criana.
(C) a escola o locus privilegiado para o diagnstico dos
distrbios de aprendizagem e de comportamento das
crianas, suprindo a insuficincia ou deficincia da
interveno parental na percepo e manejo destes
distrbios.
(D) a medicalizao da criana em idade escolar decorre de um
olhar cientfico sobre a doena em seus aspectos genticos e
bioqumicos, livre de desvios ideolgicos sobre sua dimenso
psquica, histrica ou social.
(E) a epidemia de crianas e adolescentes diagnosticados com
TDAH e transtornos de conduta alerta as autoridades
responsveis por programas de epidemiologia e sade
pblica para as deficincias nas aes de preveno primria.

Tcnico Superior Especializado em Psicologia

QUESTO 46
A Sra. M.L. buscou o Ncleo da Defensoria Pblica para ingressar
com ao de Guarda de seus netos de 2 e 5 anos.
Ela relatou que seu genro J.P., pai dos meninos, era alcoolista e
agredia verbal e fisicamente sua filha na presena das crianas.
A av estava cansada de aconselhar a filha e argumentou que
tinha condies de criar melhor os netos. Ouvida, a genitora das
crianas, A. P., mostrou-se preocupada com a iniciativa de sua
me. Ela admitiu que o marido s vezes se excedia na bebida,
mas ela nunca tinha ficado muito machucada (sic). Ele sempre se
arrependia e ela o perdoava porque, sbrio, ele era bom pai e
bom marido e ela no desejava nenhuma providncia que
pusesse em risco seu casamento. Os dados apresentados aqui
permitem considerar que
(A) medo e dependncia concorrem, entre outros fatores, para
que mulheres no se coloquem em posio de litgio contra o
agressor e evitem atitudes que possam resultar diretamente
na priso dele.
(B) a aplicao da Lei Maria da Penha s caber nesta situao
se, aps denncia annima, restarem comprovados por
percia danos permanentes sade mental e fsica da me e
dos filhos menores de idade.
(C) a av extrapola seus direitos e deveres ao interferir na
dinmica do casal e buscar na Justia solues para os netos
sem o consentimento do chefe da famlia.
(D) J.P. inimputvel do ponto de vista penal pelo seu
diagnstico de transtorno de personalidade borderline
agravado pela condio de abuso de substncias psicoativas.
(E) o acolhimento institucional das crianas a soluo que
melhor atende aos seus interesses neste momento,
considerando o comportamento omisso da genitora diante
das agresses do marido.

Tipo 1 Cor Branca Pgina 8

Concurso Pblico para a Defensoria do Estado do Rio de Janeiro 2014

FGV - Projetos

QUESTO 47

QUESTO 49

A garantia dos direitos de crianas e adolescentes e suas famlias


tarefa que impe muitos desafios na prtica cotidiana dos
profissionais envolvidos, entre eles, os psiclogos que integram
as Defensorias Pblicas. A sistemtica estabelecida pela Lei n
8.069/90 - o Estatuto da Criana e do Adolescente - para plena
efetivao dos direitos infanto-juvenis importa na interveno de
diversos rgos e autoridades, que, embora possuam atribuies
especficas a desempenhar, tm igual responsabilidade na
apurao e integral soluo dos problemas existentes, tanto no
plano individual quanto coletivo. Analise os exemplos de
situaes que devem ser abordadas sob a perspectiva do Sistema
de Garantia de Direitos:
I. criana ou adolescente com deficincia, inseridos na famlia,
com necessidade de apoio para atendimento psicolgico e
fonoaudiolgico;
II. criana ou adolescente que trabalham nas ruas,
desacompanhados dos pais ou responsveis;
III. criana recm-nascida abandonada na maternidade/hospital
ou em outros espaos pblicos;
IV. pai suposto que se recusa a reconhecer a paternidade de
criana havida fora do matrimnio;
V. municpio sem programas de acolhimento familiar e
institucional.
Esto corretas as seguintes situaes:
(A) todas, com exceo de I.
(B) apenas III e IV.
(C) todas, com exceo de V.
(D) apenas I, II e V.
(E) todas, sem exceo.

Os conflitos fazem parte do cotidiano da humanidade desde o


incio dos tempos como fenmeno sociolgico, tanto nas relaes
familiares quanto nas relaes sociais. comum que conflitos
sejam levados diretamente Justia sem que outros caminhos
tenham sido tentados. A mediao constitui uma das diversas
formas alternativas de soluo de controvrsias capazes de evitar
a judicializao dos conflitos. Sobre a atuao do mediador,
correto apontar que
(A) o mediador atua como um facilitador do dilogo entre
pessoas a fim de que a negociao direta entre elas possa ser
restabelecida.
(B) a mediao guarda sintonia com o paradigma adversarial do
contraditrio, caracterstico de toda lide consensual.
(C) o acordo sugerido na mediao tem a coautoria do mediador
e das partes, o que evita os interminveis recursos a outras
instncias.
(D) o mediador faz o papel do juiz e escolhido de comum
acordo pelas partes, sendo comumente um tcnico com
grande conhecimento na rea do conflito.
(E) a mediao regida pelo princpio da publicidade, que
autoriza a divulgao e a utilizao no processo das
informaes trazidas.

QUESTO 48
A menina B., de 3 anos, foi atendida no Servio de Pediatria de
um hospital pblico levada por seus pais, com um quadro de
mltiplas verrugas na regio perianal. Aps anamnese e exame
clnico, a pediatra desconfiou de condiloma, causado por
contaminao pelo vrus HPV. Confirmada a doena aps exames
laboratoriais, a mdica acionou o Conselho Tutelar para notificar
a suspeita de violncia sexual. Para a necessria apurao dessa
situao, o psiclogo dever considerar que
(A) uma criana nesta faixa etria se encontra no estgio de
desenvolvimento cognitivo definido por Jean Piaget como
operatrio-concreto, caracterizado pelo pensamento
egocntrico e pela deformao na percepo da realidade.
(B) o complexo centrado na fantasia de castrao, que vem
trazer uma resposta ao enigma decorrente da diferena
anatmica entre os sexos, um sintoma presente em
algumas crianas precocemente expostas a experincias
sexuais.
(C) a presena de sinais fsicos da violncia perpetrada contra a
criana, apurada no exame de corpo de delito, condio
indispensvel para a confirmao da ocorrncia do abuso
sexual infantil.
(D) a palavra da criana pode ser a nica prova possvel ao
processo legal e ser preciso utilizar estratgias adequadas
idade em um ambiente emocionalmente facilitador para
permitir a revelao do abuso.
(E) a inquirio de crianas deve se dar na presena de seus pais,
o que garantir um ambiente psicologicamente seguro e
isento das variveis que sero introduzidas por um
entrevistador desconhecido.

Tcnico Superior Especializado em Psicologia

QUESTO 50
A famlia um fato social, anterior e acima do prprio Direito,
tendo em vista as suas constantes transformaes. Segundo
Maria Berenice Dias, a famlia agora passa por um processo
evolutivo de dissociao, desaparecendo a subordinao,
prevalecendo a igualdade, ganhando o afeto o reconhecimento
como ncleo ensejador da famlia moderna. (DIAS, 2010).
Nesse contexto, passamos a identificar como entidade familiar
a famlia mosaico, que
(A) originada no matrimnio ou na unio de fato de um casal,
em que um ou ambos tm filhos provenientes de um
casamento ou relao prvia.
(B) formada pela convivncia em uma mesma unidade
habitacional de diferentes geraes de ascendentes e
descendentes do casal.
(C) a entidade familiar sem coabitao, formada pela guarda
compartilhada dos filhos havidos na unio conjugal aps a
separao do casal.
(D) a famlia socioafetiva, que no depende da consanguinidade
e formada pela criao do vnculo jurdico de filiao pela
adoo.
(E) a famlia formada por pares homoafetivos que buscam o
reconhecimento legal pelo vnculo do casamento ou
declarao de unio estvel.

Tipo 1 Cor Branca Pgina 9

Concurso Pblico para a Defensoria do Estado do Rio de Janeiro 2014

FGV - Projetos

QUESTO 51

QUESTO 53

Nos anos de 2012 e 2013, a Vara da Infncia de Petrolina - PE


apurou cerca de 300 procedimentos judiciais relativos s escolas
da comarca. Dentre os problemas mais comuns, encontram-se
indisciplina, evaso, violncia fsica, bullying, drogas e ameaa. De
acordo com juiz da Vara da Infncia e da Juventude, Marcos
Bacelar, a violncia no ambiente escolar tem crescido de forma
alarmante, abrangendo de atitudes agressivas at situaes
caracterizadoras do bullying. (Fonte: Dirio de Pernambuco).
Sobre essa forma de violncia, o bullying, pode-se considerar
corretamente que
(A) uma prtica de delito plurissubjetivo, ou seja, que envolve
um grupo de pessoas, com a caracterstica especial de ser de
concurso necessrio de condutas recprocas.
(B) os autores de bullying satisfazem os critrios nosolgicos do
DSM.IV para o diagnstico de Transtorno de Controle dos
Impulsos, sub tipo Explosivo Intermitente.
(C) a intolerncia s diferenas fsicas, sociais ou
comportamentais das vtimas um fato descrito como de
grande importncia no desencadeamento de condutas de
bullying.
(D) o cyberbullying erroneamente classificado como forma de
manifestao de bullying, j que nele est ausente a agresso
fsica que caracteriza o fenmeno.
(E) uma vivncia que contribui para a progresso da
dependncia dos pais (infncia) e dos pares (adolescncia)
para um nvel de autonomia relativa (interdependncia
emocional).

Eduardo procurou a Defensoria Pblica para ingressar com ao


de Adoo de sua enteada Isabela, 13 anos. A adolescente no
tinha registro paterno e contava 09 anos de idade quando sua
me Ana casou-se com Eduardo. No caso apresentado cabe
analisar que
(A) o sub-registro paterno causa do conhecido fenmeno do
abandono afetivo que vem sendo objeto de demandas na
rea de Famlia e Infncia e Juventude.
(B) a presena do pai verdadeiro fundamental para o
estabelecimento
na
adolescncia
de
relaes
interdependentes saudveis sem perda da identidade.
(C) a falta do Nome do Pai, como concebida por Lacan, o
equivalente psquico da falta de reconhecimento judicial da
paternidade.
(D) a elevao do afeto a valor jurdico torna a justia adequada
vida, retirando da famlia o vetor sangue como referencial
jurdico para a constituio desta.
(E) o direito do genitor de Isabela ao reconhecimento da filha s
prescreve na maioridade da jovem e impede a adoo nesse
momento.

QUESTO 52
Em janeiro de 2014, um homem que tentou entrar com maconha
em um presdio foi absolvido pelo juiz da 4 Vara de
Entorpecentes do Distrito Federal, do Tribunal de Justia do DF e
Territrios. Para embasar sua deciso, o juiz substituto Frederico
Ernesto Cardoso Maciel afirmou que falta regulamentao sobre
a venda da substncia e que considera incoerente que o lcool
e o tabaco sejam permitidos e vendidos, ao passo que a
maconha, que ele afirma ser um entorpecente recreativo, seja
proibida. (Fonte: Jornal O Globo). Os estudos sobre essa
substncia psicoativa indicam que
(A) a maconha estimulante da atividade mental e seu uso
prolongado provoca insnia e uma sensao intensa de
euforia e poder.
(B) ao uso continuado da maconha atribudo um prejuzo na
capacidade de aprendizagem e memorizao e um estado de
amotivao.
(C) a ocorrncia de delrios ou alucinaes critrio de excluso
para o diagnstico de intoxicao por canabinoides, como a
maconha e o haxixe.
(D) a ao depressora da maconha sobre o sistema nervoso
central evidenciada pelo aumento na incidncia de
condutas suicidas sob o efeito da droga.
(E) a sndrome de abstinncia de substncias canabinoides
envolve a ocorrncia de tremores, convulses e alucinaes
do tipo visual, ttil e sinestsico.

Tcnico Superior Especializado em Psicologia

QUESTO 54
A teoria psicossocial de Erik Erikson (1902-1994) reside no amplo
quadro das teorias psicodinmicas da personalidade. Erikson
identificou oito estgios psicossociais no ciclo da vida humana,
que compreendem fases desde o nascimento at a velhice,
caracterizadas por crises de identidade. De acordo com a teoria
de Erikson, no ltimo estgio dessa evoluo, correspondente
velhice, pode-se identificar
(A) a crise entre a produtividade ou generatividade e a
estagnao.
(B) a sensao de tranquilidade consequente da inexistncia de
polaridades.
(C) a sensao de isolamento, de estar s, sem ningum com
quem partilhar ou de quem cuidar.
(D) a vergonha decorrente da conscincia da perda da autonomia
e da dependncia dos cuidados de terceiros.
(E) a dimenso psicossocial que polariza integridade em um
extremo e desesperana em outro.

QUESTO 55
Em recente pesquisa, as professoras Ceclia Coimbra e Maria Lvia
do Nascimento identificaram que os profissionais dos Conselhos
Tutelares e Varas de Infncia atuam de forma sobreimplicada. A
sobreimplicao para a Anlise Institucional, segundo Lourau, se
articula
(A) ao superdimensionamento da anlise de implicaes, que
maximiza a oposio entre grupo sujeito e grupo submetido.
(B) a uma dificuldade de anlise de implicaes que, mesmo
quando realizada, pode considerar como referncia apenas
um nico nvel, um s objeto.
(C) naturalizao do funcionamento institucional, fundamental
para o bom atendimento dos usurios que procuram estes
estabelecimentos.
(D) crtica do funcionamento da sociedade neoliberal que no
atende a populao com polticas pblicas eficazes e de
qualidade.
(E) constante necessidade de capacitao profissional, j que a
rea de interveno constantemente atravessada por
inovaes jurdicas e transformaes sociais.

Tipo 1 Cor Branca Pgina 10

Concurso Pblico para a Defensoria do Estado do Rio de Janeiro 2014

FGV - Projetos

QUESTO 56

QUESTO 60

A noo de periculosidade, tal como pensada por Foucault,


expressa
(A) o risco virtual de criminosos delinquirem, o que exige a
construo de mais estabelecimentos prisionais.
(B) o perigo de convivncia com psicopatas e criminosos
impulsivos que devem ser constantemente monitorados.
(C) o perigo virtual de qualquer indivduo adotar
comportamentos transgressores.
(D) o perigo advindo da presena de criminosos no
ressocializados na sociedade.
(E) a necessidade de controle de serial killers em razo do risco
social que representam.

A principal estratgia desenvolvida como soluo para a questo


social da criana e de adolescentes pobres, abandonados ou
infratores no Brasil, desde o sculo XIX,
(A) a escolarizao compulsria.
(B) o confinamento institucional.
(C) a insero no mundo do trabalho.
(D) o encaminhamento aos pais ou responsveis.
(E) a colocao em famlia substituta sob a forma de adoo.

QUESTO 57
O Estatuto da Criana e do Adolescente (Lei 8.069/90) considera
o ato infracional como anlogo a crime ou contraveno penal.
Ao se pensar na formao do adolescente em conflito com a lei,
pode-se asseverar que a sociedade descumpre suas obrigaes
para com a criana que vem a cometer um ato infracional no
futuro. Frente a tais assertivas, correto afirmar que um
elemento determinante da insero no mundo da criminalidade
:
(A) a penalizao.
(B) a ignorncia simblica da lei.
(C) a ideologia do favor.
(D) a convivncia com infratores.
(E) a negligncia familiar.

QUESTO 58
Jurandir Freire Costa, na anlise de importantes transformaes
na subjetividade contempornea, considera que o corpo est se
tornando o referente privilegiado para a construo das
identidades pessoais. Segundo Freire Costa, esse fenmeno se
articula
(A) no superao do dipo na cultura contempornea e
derrocada das instncias educativas tradicionais.
(B) ao capitalismo globalizado que disseminou atributos fsicos
como modelos e ao esvaziamento da poltica partidria.
(C) proliferao do uso de drogas (lcitas e ilcitas) e ao
consumismo sem limites.
(D) ao remapeamento cognitivo do corpo fsico e invaso da
cultura pela moral do espetculo.
(E) educao sentimental e s transformaes no
funcionamento familiar.

QUESTO 59
A insero do psiclogo nas instituies judicirias aconteceu
inicialmente por meio de
(A) avaliaes das polticas pblicas destinadas populao
infanto-juvenil.
(B) avaliaes acerca da fidedignidade do testemunho de uma
pessoa sobre um acontecimento.
(C) anlise das condies sociais para efetivao dos direitos
humanos.
(D) anlises complexas acerca do ser humano, valorizando-se
aspectos relacionais e abordagens qualitativas.
(E) anlise dos comportamentos de uma pessoa, articulando-os
s transformaes no campo social.

Tcnico Superior Especializado em Psicologia

QUESTO 61
Sabe-se que, em muitos processos de Destituio do Poder
Familiar, os argumentos utilizados contra as famlias de origem
consistem em comparaes entre esses ncleos familiares e
pais e mes idealizados, sem que se problematizem as
condies sociais e polticas articuladas s alegadas dinmicas de
negligncia, risco ou abandono da criana. Nesses processos so
usualmente solicitados estudos tcnicos sobre a dinmica
familiar. Na produo desses documentos cabe ao psiclogo
atentar para os seguintes Princpios Fundamentais previstos no
Cdigo de tica Profissional do Psiclogo:
I. Basear o trabalho no respeito, promoo da liberdade, da
dignidade, da igualdade e da integridade do ser humano que
embasam a Declarao Universal dos Direitos Humanos.
II. Trabalhar visando promover a sade e a qualidade de vida
das pessoas e das coletividades, contribuindo para eliminao
de quaisquer formas de negligncia, explorao, violncia,
crueldade e opresso.
III. Atuar com responsabilidade social, analisando crtica e
historicamente a realidade poltica, econmica, social e
cultural.
IV. Assumir responsabilidades profissionais somente por
atividades para as quais esteja capacitado pessoal, poltica,
terica e tecnicamente.
Assinale se:
(A) somente I est correta.
(B) somente I e II esto corretas.
(C) somente II e III esto corretas.
(D) somente I, II e III esto corretas.
(E) somente I, II e IV.

QUESTO 62
No conhecido livro Vigiar e Punir, Foucault reflete sobre a
tcnica do exame, que consistiria em uma tecnologia
(A) do poder soberano que invisibiliza, desterritorializa e
militariza.
(B) do poder disciplinar que visibiliza, individualiza e normaliza.
(C) do poder disciplinar que singulariza, invisibiliza e pune.
(D) do poder fluido que controla, medicaliza e incita.
(E) do poder soberano que normaliza, cerimonializa e pune.

QUESTO 63
Pensando os processos de subjetivao contemporneos, Lus
Cludio Mendona Figueiredo considera que um dos grandes
polos de constituio das subjetividades em culturas
ultraindividualistas seria um processo psicopatolgico
originalmente pensado por Fairbairn como
(A) a histeria.
(B) a esquizofrenia.
(C) a esquizoidia.
(D) o transtorno bipolar.
(E) as toxicomanias.

Tipo 1 Cor Branca Pgina 11

Concurso Pblico para a Defensoria do Estado do Rio de Janeiro 2014

FGV - Projetos

QUESTO 64

QUESTO 67

No ano de 2007, a Secretaria Especial de Polticas para as


Mulheres da Presidncia da Repblica lanou o Pacto Nacional
pelo Enfrentamento Violncia contra a Mulher. Esse tipo de
violncia um fenmeno
(A) multicausal em que a maior parte dos agressores no so
conhecidos pelas vtimas.
(B) que est em franca transformao, pois os homens
representam hoje a maioria das vtimas de violncia
domstica (65,8%).
(C) transcultural que no est associado s estatsticas de
homicdios cometidos contra as mulheres.
(D) que se expressa nas relaes interpessoais na qual
majoritariamente o agressor conhecido pela vtima.
(E) interpessoal que ocorre prioritariamente nas classes
pauperizadas.

Pensando a histria das prticas cientficas, Ian Hacking considera


que as classificaes da cincia produzem maneiras de ver e
habitar o mundo. Especificamente traando um percurso sobre a
epidemiologia da violncia contra a criana, Hacking discute
como a questo emergiu nos discursos mdicos, mas foi
disseminada por meio de outros especialismos desde a metade
do sculo XIX. No Brasil, o artigo 5 do ECA determina que
nenhuma criana ou adolescente ser objeto de qualquer forma
de negligncia, discriminao, violncia, crueldade e opresso.
Com relao violncia contra a criana, correto afirmar que
(A) um fenmeno no qual h uma relao unvoca entre causas
e consequncias, o que permite a interveno precoce em
ncleos familiares detentores do mesmo padro de
relacionamento.
(B) no Brasil considera-se como violncia fsica a prtica de atos
violentos intencionais ou acidentais praticadas em uma
relao de assimetria por pais, responsveis, familiares ou
pessoas prximas.
(C) qualquer nvel de dano criana independe do contexto
social e cultural, articulando-se apenas ao ato violento, donde
decorre a importncia da produo de leis severas contra
quaisquer prticas de disciplinamento fsico.
(D) na violncia psicolgica quaisquer danos criana so
independentes da repetio e persistncia da conduta,
gerando transtornos no desenvolvimento biopsicossocial da
criana e do adolescente.
(E) a privao decorrente da pobreza confunde-se muitas vezes
com a privao relacionada negligncia, j que as
desigualdades na distribuio de renda podem dificultar que
famlias pobres atendam adequadamente as necessidades
das crianas.

QUESTO 65
A Lei 4.504/05 alterou o Cdigo de Organizao e Diviso
Judiciria do Estado do Rio de Janeiro, definindo nova
nomenclatura para a 1 Vara da Infncia e da Juventude da
Capital, que passou a ser denominada Vara da Infncia, da
Juventude e do Idoso. Com relao s intervenes em Varas de
Idosos, correto afirmar que
(A) o papel dos psiclogos nos processos envolvendo idosos deve
se restringir elaborao de laudos periciais.
(B) a mediao atribuio prevista no Cdigo de Processo Civil
Brasileiro e a interveno mais adequada nestes casos.
(C) o idoso flagrado em delito tipificado pelas leis penais ser
assemelhado ao adolescente autor de ato infracional para
efeito de aplicao de penas.
(D) a deciso judicial est adstrita ao laudo pericial, ratificando o
parecer do especialista, pois esta avaliao construda na
observncia das prerrogativas ticas da profisso.
(E) as dinmicas geralmente apontam para a necessidade de
articulao de uma rede de proteo ampliada que no deve
restringir-se ao sistema judicial.

QUESTO 66
Ao pensar a ferramenta anlise de implicaes, Lourau se
refere
(A) a um princpio equivalente contratransferncia freudiana,
que permite conhecer o funcionamento dos grupos sujeitos e
dos grupos submetidos frente aos confrontos e alianas
institucionais.
(B) ao engajamento e participao poltico-institucional,
ferramentas fundamentais emergncia da transversalidade.
(C) ao reconhecimento da objetividade e neutralidade tcnicas
do pesquisador, atravessadas pela dimenso da enunciao
coletiva.
(D) s anlises transferenciais dos que fazem parte da
interveno,
dos
atravessamentos
e
produes
socioculturais, polticas e econmicas dos estabelecimentos e
sujeitos que deles participam.
(E) valorizao do sobretrabalho e do ativismo da prtica que
buscam beneficiar os indivduos atendidos nas instituies.

Tcnico Superior Especializado em Psicologia

QUESTO 68
No conhecido texto O Mal Estar na Civilizao (1930 [1929]),
Freud afirma que a cultura se v obrigada a livrar-se de uma
hostilidade primria e independente que se ope aos objetivos
de Eros. Para tanto, a cultura tem em seu favor um poderoso
aliado, a saber:
(A) a moral sexual civilizada que recalca as pulses sexuais.
(B) o embate imprevisvel entre pulso de vida e pulso de
morte.
(C) as leis jurdicas que organizam as fontes de sofrimento
humano.
(D) aquele que numa vertente ontogentica corresponde ao
herdeiro do complexo de dipo.
(E) o narcisismo das pequenas diferenas que caracteriza os
grupamentos humanos.

QUESTO 69
Em seus diversos livros que retratam a contemporaneidade,
Bauman destaca uma economia prpria das sociedades em geral
que se distingue da chamada sociedade de produtores, cujas
condies necessrias vida eram a segurana, o planejamento a
longo prazo, a acumulao, entre outras. A economia das
sociedades contemporneas est centrada fundamentalmente
(A) no narcisismo.
(B) na satisfao sem limites.
(C) no capitalismo.
(D) no consumismo.
(E) na sexualidade.

Tipo 1 Cor Branca Pgina 12

Concurso Pblico para a Defensoria do Estado do Rio de Janeiro 2014

FGV - Projetos

QUESTO 70

QUESTO 73

Em considerando uma situao hipottica na qual o paciente diz


em atendimento clnico que costuma agredir o seu filho como
forma de educ-lo, o psiclogo, de acordo com o cdigo de tica
e as leis jurdicas,
(A) deve quebrar o sigilo somente mediante determinao
judicial.
(B) deve manter o sigilo, podendo quebr-lo somente em
situao de violncia fsica ou sexual.
(C) pode quebrar o sigilo baseando sua deciso na busca do
menor prejuzo.
(D) deve quebrar o sigilo em qualquer situao que envolva
maus-tratos criana e ao adolescente.
(E) no pode quebrar o sigilo em nenhuma hiptese.

Jos procurou a Defensoria Pblica para regulamentar a visita em


relao filha, de cinco anos de idade, apesar de incidir sobre ele
a denncia feita pela me de manipul-la sexualmente. A me
passou a impedir o acesso do pai filha desde que esta fez um
relato que sugeria cenas de abuso sexual. Angustiada, a me
levou a menina ao conselheiro tutelar, para o qual repetiu o
mesmo relato. Assim, o conselheiro sugeriu o impedimento do
contato paterno at que judicialmente fosse averiguada a
veracidade do abuso. Desde ento, passaram-se oito meses sem
que Jos conseguisse qualquer contato com a filha. Em relao a
esse caso em especial, o psiclogo deve atentar que
(A) a criana enquanto sujeito de direitos deve ser valorizada em
sua fala, sendo isso o suficiente para mant-la afastada do
pai.
(B) possvel que se trate de uma falsa denncia decorrente de
alienao parental, e o tempo de afastamento paterno pode
aprofundar ainda mais esse quadro.
(C) em situaes de abuso sexual infantil, no necessrio
escutar o suposto abusador e sim obter uma interveno
imediata da lei.
(D) caberia realizar um trabalho teraputico com a famlia antes
de dar prosseguimento a quaisquer processos judiciais.
(E) Jos est sofrendo com acusaes infundadas e por isso deve
ser concedido a ele o acesso filha o mais breve possvel.

QUESTO 71
De modo geral, o Judicirio vem buscando meios de evitar os
danos decorrentes dos numerosos depoimentos a que a criana
supostamente vtima de abuso sexual submetida. Para tanto,
lana mo de expedientes, como, por exemplo, o depoimento
sem dano ou depoimento especial que, por sua vez, criticado
pelo Conselho Federal de Psicologia. A posio do Conselho
apoia-se reconhecidamente nos argumentos abaixo, exceto
(A) tal proposta de inquirio no foi objeto de discusso e
deliberao do Conselho Nacional dos Direitos da Criana e
do Adolescente (CONANDA), rgo mximo do Sistema de
Garantia de Direitos (SGD).
(B) h dvidas de que a inquirio nos moldes propostos no se
configure como violncia ou violadora de direitos.
(C) no cabe ao psiclogo realizar inquirio judicial e sim o
trabalho de escuta, que se caracteriza, sobretudo, como uma
relao de cuidado.
(D) o dilogo entre os saberes no deve se sustentar numa lgica
vertical e hierrquica e sim interdisciplinar.
(E) importante preservar o uso de tcnicas especficas de
revelao do abuso sexual, como, por exemplo, as bonecas
anatomicamente corretas.

QUESTO 72
Sabemos desde Foucault que a psiquiatria se transformou, a
partir da segunda metade do sculo XIX, numa pea estratgica
do biopoder, ampliando o seu escopo de ao para a gesto da
populao e, assim, promovendo a higiene das raas e o controle
das anomalias consideradas perigosas ordem social. Para tanto,
exigiu-se do saber psiquitrico o privilgio de teorias baseadas
(A) no isolamento manicomial como estratgia teraputica
inaugurada por Pinel.
(B) no Panopticon de Bentham, cujo olhar vigilante tornou-se
crucial nas sociedades disciplinares.
(C) na diviso binria entre a loucura manaco-depressiva e a
demncia precoce feita por Kraepelin.
(D) no enquadramento da mo de obra proletria junto aos
aparelhos de produo capitalista.
(E) no conceito de degenerao, que atribui transmisso
hereditria a causalidade de desvios diversos.

Tcnico Superior Especializado em Psicologia

QUESTO 74
A atuao do psiclogo, tanto como perito quanto como
assistente tcnico no judicirio, tornou-se objeto de
regulamentao por parte do Conselho Federal, sendo
importante observar que
(A) convm ao assistente tcnico estar presente durante a
realizao dos atendimentos do perito e vice-versa, desde
que no haja interferncia na dinmica e na qualidade do
servio realizado.
(B) em seu relatrio, o psiclogo perito apresentar indicativos
pertinentes sua investigao que subsidiam o juiz, sem
adentrar as decises, que so exclusivas das atribuies dos
magistrados.
(C) a relao entre os profissionais deve pautar-se no respeito
autonomia e na colaborao, sendo vedado ao assistente
tcnico formular quesitos ao psiclogo perito.
(D) o psiclogo perito pode lanar mo de entrevistas, aplicao
de testes psicolgicos, recursos ldicos e de outros
instrumentos reconhecidas pelo Conselho, com exceo de
visitas domiciliares e institucionais, que so tcnicas
pertinentes ao Servio Social.
(E) vedado ao psiclogo que seja terapeuta das partes
envolvidas em um litgio atuar como perito de pessoas
atendidas por ele e/ou de terceiros envolvidos na mesma
situao litigiosa, no havendo tal restrio ao assistente
tcnico.

Tipo 1 Cor Branca Pgina 13

Concurso Pblico para a Defensoria do Estado do Rio de Janeiro 2014

FGV - Projetos

QUESTO 75

QUESTO 78

Existe consenso de que, nos litgios familiares, a criana tomada


geralmente como objeto de disputa entre seus pais, que,
movidos por sentimento de vingana e ressentimento,
confundem os problemas pretritos da conjugalidade com as
fronteiras da parentalidade. Segundo a teoria de Pierre Legendre,
a funo primordial da interveno do Direito :
(A) organizar as leis da genealogia, cuja combinatria deve ser
pautada no interdito entre as geraes.
(B) acolher as novas formas de sociabilidade e o avano das
cincias humanas.
(C) promover a capacidade do ser humano em se autofundar por
conta prpria.
(D) pr em ao os micropoderes que incitam as formas de
subjetivao.
(E) compreender as motivaes inconscientes que fazem da
criana o sintoma dos pais.

Um laudo realizado pelo psiclogo a pedido do defensor foi


contestado e corre risco de ser impugnado pelo fato de no estar
de acordo com a Resoluo 08/2010 nem com o manual de
elaborao de documentos (Resoluo 07/2003), estabelecido
pelo Conselho Federal de Psicologia. O trecho abaixo que serviu
de justificativa para o pedido de impugnao foi
(A) a me v-se obrigada a terceirizar os cuidados em relao
criana por causa do trabalho, fazendo a ressalva de que, em
breve, mudar de emprego, exigindo-lhe mais tempo longe do
lar. Contudo, ela garante que a av coabitar com ela, de
maneira que ficar disponvel para ajud-la nos cuidados,
embora a criana no esteja habituada a conviver com ela.
(B) notrio o sofrimento da criana ao criticar o pai. Sem expor
uma razo plausvel para tanto, ela demonstra certa confuso
ao dizer que seu pai o padrasto. Da se supe a existncia de
conflito de lealdade exclusiva, sendo conveniente a retomada
da convivncia com o pai o mais breve possvel.
(C) importante frisar que, apesar de seu relato inicial, a
criana possui relao de afeto com a me e com o pai. Em
contrapartida, no possui boa relao com o padrasto, nem
tampouco parece sentir-se segura em sua companhia.
(D) a criana ficar exposta situao delicada caso permanea
sob a guarda da me. Por sua vez, o pai tem tempo disponvel
e conta com o apoio familiar, alm de se mostrar zeloso por
sua filha. Desse modo, o mais indicado que a filha fique sob
a guarda do pai, devendo ser regulamentada a visita com a
me.
(E) igualmente indicado a ambas as partes que a criana deixe
de ser envolvida no presente processo e nos diversos conflitos
que compem o litgio.

QUESTO 76
O sentimento moderno de infncia iniciado por reformadores
catlicos e protestantes corresponde a uma representao de
que a criana possui particularidades especficas, devendo ser
afastada da convivncia direta com os adultos para ser
escolarizada e preparada para a vida adulta. Assim se produziu
historicamente a viso desenvolvimentista da infncia que
marcou o campo da pedagogia e da psicologia, com nfase
especial em sua vertente conhecida por psicologia de
desenvolvimento. Por sua vez, e apesar das controvrsias do
campo da psicanlise, a noo de infantil em Freud difere dessa
perspectiva desenvolvimentista, na medida em que
(A) Freud considera a sexualidade perverso-polimorfa como
fenmeno cronologicamente exclusivo da infncia.
(B) a pulso sexual tem objeto e alvo definidos, sendo desviada
nos sujeitos de estrutura perversa.
(C) a sexualidade de carter infantil perverso-polimorfo,
obedecendo a uma temporalidade inconsciente que se
atualiza na vida amorosa adulta.
(D) Freud se ope pedagogia moral da escola em detrimento da
autoridade paterna.
(E) a psiconeurose desencadeada por uma experincia
traumtica de seduo por parte do adulto, cujos efeitos
surgem aps a puberdade.

QUESTO 77
Certas prticas jurdicas parecem perigosamente identificar o
sujeito psicolgico com o sujeito de direitos, reduzindo o
primeiro ao segundo e transformando certas atividades que
envolvem o psiclogo em meras sanes. Com a finalidade de
refletir sobre essa questo, convm citar uma das formas com
que Foucault pensava a relao entre direito e norma, a saber:
(A) h uma colonizao recproca entre as normas disciplinares e
o direito, servindo este ltimo como veculo para as
primeiras.
(B) o direito se ope norma, tendo o primeiro cedido lugar s
disciplinas a partir das sociedades monrquicas.
(C) a economia industrial foi crucial para o desenvolvimento das
disciplinas, deslocando o direito de sua antiga funo de
ordenador social.
(D) a represso o elemento central da dinmica do poder
agenciado pela norma e pelo direito.
(E) o direito aquele que organiza os corpos no tempo e no
espao, mantendo a vigilncia contnua sobre cada
individualidade.

Tcnico Superior Especializado em Psicologia

QUESTO 79
Sabe-se que a Era Moderna corresponde quebra de uma viso
de mundo totalizante e hierrquica baseada na religio. Contudo,
o ideal de igualdade nas sociedades democrticas modernas fez
com que as diferenas individuais e sociais passassem a ser
justificadas pela natureza biolgica. Da o surgimento da
criminologia positivista como meio de controle social a partir de
uma suposta natureza biolgica do indivduo que rompe o
contrato social, cujo principal expoente foi
(A) Breuler.
(B) Kraepelin.
(C) Lombroso.
(D) Jaspers.
(E) Buffon.

QUESTO 80
Franoise Dolto adverte que a criana pode ter dificuldades de
amar ambos os pais, porque acha que um deles mais infeliz do
que o outro e que foi esse outro que o tornou mais infeliz. A
emoo de ver o genitor que no encontra habitualmente pode
faz-la vomitar, e essa reao pode ser compreendida como
(A) sinal de recusa da criana de ver esse outro genitor.
(B) sinal de maus-tratos cometidos pelo genitor.
(C) um sintoma decorrente do desejo inconsciente recalcado.
(D) um reflexo patolgico da sndrome de alienao parental.
(E) uma reao psicossomtica que indica algo que ela no sabe
verbalizar.

Tipo 1 Cor Branca Pgina 14

PROVA: DP - RJ
ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: FGV

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60

D
B
A
B
C
A
E
D
A
A
C
B
D
E
B
C
A
D
B
B

61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80

D
B
C
D
E
D
E
D
D
C
E
E
B
B
A
C
A
D
C
E

Coletnea de Provas | Concursos de Psicologia

ConcursoPblico2014





ProvaEscritaObjetivaNvelSuperior

PTS II - Psiclogo
TIPO1BRANCA
Informaes Gerais
1. Vocreceberdofiscaldesala:
a) uma folha de respostas destinada  marcao das
respostasdasquestesobjetivas;
b) esse caderno de prova contendo 70 (setenta) questes
objetivas, cada qual com cinco alternativas de respostas
(A,B,C,DeE).
2. Verifique se seu caderno est completo, sem repetio de
questes ou falhas. Caso contrrio, notifique imediatamente
o fiscal de sala para que sejam tomadas as devidas
providncias.
3. As questes objetivas so identificadas pelo nmero situado
acimadoseuenunciado.
4. Aoreceberafolhaderespostasdaprovaobjetivavocdeve:

6. Opreenchimentodasrespostasdaprovaobjetiva,deinteira
responsabilidade do candidato, dever ser feito com caneta
esferogrficadetintaindelveldecorpretaouazul.Noser
permitida a troca da folha de respostas por erro do
candidato.
7. O tempo disponvel para a realizao da prova  de
4 (quatro) horas, j includo o tempo para a marcao da
folhaderespostasdaprovaobjetiva.
8. Reserve tempo suficiente para o preenchimento de suas
respostas. Para fins de avaliao, sero levadas em
considerao apenas as marcaes realizadas na folha de
respostas da prova objetiva, no sendo permitido anotar
informaes relativas s suas respostas em qualquer outro
meioquenosejaoprpriocadernodeprovas.

a) conferir seus dados pessoais, em especial seu nome,


nmero de inscrio e o nmero do documento de
identidade;

9. Somente aps decorridas 2 (duas) horas do incio da prova
vocpoderretirarsedasaladeprova,contudosemlevaro
cadernodeprovas.

b) ler atentamente as instrues para o preenchimento da


folhaderespostas;

10.Somente no decorrer dos ltimos 60 (sessenta) minutos do


perodo da prova, voc poder retirarse da sala levando o
cadernodeprovas.

c) marcarnafolhaderespostasdaprovaobjetivaocampo
relativoconfirmaodotipo/cordeprova,conformeo
cadernoquevocrecebeu;
d) assinar seu nome, apenas nos espaos reservados, com
canetaesferogrficadetintaazuloupreta.
5. Duranteaaplicaodaprovanoserpermitido:
a) qualquertipodecomunicaoentreoscandidatos;
b) levantardacadeirasemadevidaautorizaodofiscalde
sala;
c) portar aparelhos eletrnicos, tais como bipe, telefone
celular, agenda eletrnica, notebook, palmtop, receptor,
gravador, mquina de calcular, mquina fotogrfica
digital, controle de alarme de carro etc., bem como
relgiodequalquermodelo,culosescurosouquaisquer
acessrios de chapelaria, tais como chapu, bon, gorro
etc. e, ainda, lpis, lapiseira (grafite), corretor lquido
e/ouborracha.Talinfraopoderacarretaraeliminao
sumriadocandidato.

11.Aoterminara prova, entreguea folha de respostas ao fiscal


da sala e deixe o local de prova. Caso voc se negue a
entregar,sereliminadodoconcurso.
12.A FGV realizar a coleta da impressodigital dos candidatos
nafolhaderespostas.
13.Oscandidatospoderosersubmetidosasistemadedeteco
de metais quando do ingresso e da sada de sanitrios
durante a realizao das provas. Ao sair da sala, ao trmino
daprova,ocandidatonopoderusarosanitrio.
14.Os gabaritos preliminares das provas objetivas sero
divulgados no dia 13/05/2014, no endereo eletrnico
www.fgv.br/fgvprojetos/concursos/funarte.
15.O prazo para interposio de recursos contra os
gabaritos preliminares ser das 0h00min do dia
14/05/2014 at s 23h59min do dia 15/05/2014,
observado o horrio oficial de Salvador, no endereo
www.fgv.br/fgvprojetos/concursos/funarte, por meio do
SistemaEletrnicodeInterposiodeRecurso.

Funarte - Concurso Pblico 2014

FGV-Projetos

Conhecimentos Especficos
QUESTO 41
O psiclogo americano Abraham Maslow (1908-1970) um
expoente da chamada Psicologia Humanista e se notabilizou por
seus estudos sobre a motivao. Maslow descreveu a motivao
em termos de uma diviso hierrquica das necessidades
humanas, que ele nomeou Hierarquia das Necessidades. De
acordo com a teoria de Maslow, analise as afirmativas a seguir:
I. Na base da pirmide, encontra-se o grupo de necessidades
consideradas por Maslow o mais bsico e reflexivo, o dos
interesses fisiolgicos e de sobrevivncia.
II. As necessidades de segurana aparecem aps o suprimento
das necessidades fisiolgicas, e so representadas como
proteo contra a violncia, proteo para sade, recursos
financeiros e outros.
III. A terceira camada da pirmide de Maslow fala das
necessidades de associao, que se referem s necessidades
do indivduo em termos sociais, como amizades e
socializao.
IV. As necessidades de status e de estima ocorrem depois que as
necessidades sociais so supridas e so: a autoconfiana e a
conquista do reconhecimento, a confiana e o respeito aos
outros.
V. A ltima necessidade refere-se motivao para realizar o
potencial mximo do ser, que a necessidade de
autorrealizao.
Assinale se:
(A) somente I, II e IV esto corretas;
(B) somente I, IV e V esto corretas;
(C) somente II, III e IV esto corretas;
(D) somente II, III e V esto corretas;
(E) todas esto corretas.

Pgina 8 - Tpo 1 - Branca

Nvel Superior - PTS II - Psiclogo

Funarte - Concurso Pblico 2014

FGV-Projetos

QUESTO 42

QUESTO 45

O uso de esteroides tem indicao teraputica para reposio


hormonal; porm, essas substncias so utilizadas principalmente
pelos competidores esportivos e jovens que, em busca de um
corpo mais forte e musculoso, podem desenvolver um padro de
consumo que se assemelha ao de dependncia. Entre as
manifestaes psiquitricas decorrentes do abuso de esteroides,
pode(m)-se identificar:
(A) transtornos de humor e de comportamento;
(B) compulso alimentar peridica;
(C) ginecomastia e atrofia testicular;
(D) psicastenia e episdios histricos;
(E) tricotilomania e onicofagia.

Daniel Dias um importante atleta paraolmpico da natao


brasileira na atualidade. O atleta, que nasceu com m formao
congnita dos membros superiores e da perna direita, descobriu
o esporte aos dezesseis anos, tendo como grande influncia a
boa performance do tambm atleta Clodoaldo Silva nas
Paraolimpadas de 2004, em Atenas. Daniel ministra palestras
motivacionais nas quais define que Deficiente uma palavra
limitante e que classifica a pessoa. Deficincias e limites todos
ns temos. Portanto, no sou um atleta deficiente, sou um atleta
paraolmpico.
A capacidade de enfrentamento das dificuldades e de superao
dos obstculos apresentada por esse atleta conhecida em
psicologia como:
(A) autoeficcia;
(B) empatia;
(C) resilincia;
(D) liderana autocrtica;
(E) ergonomia.

QUESTO 43
Na abordagem preventiva do crack, identificam-se fatores de
proteo ao incio do uso, como rede familiar, educao e prtica
esportiva, entre outros, e fatores de risco, sobre os quais
correto apontar que:
(A) o convvio com usurios de crack costuma ser um incentivo
para iniciar, manter e/ou aumentar o consumo da droga. O
ambiente de transgresso e a necessidade de fazer parte do
grupo so um forte apelo para o consumo;
(B) questes
psicolgicas
e
sociais,
como
analfabetismo, insegurana, baixa autoestima, internaes
compulsrias, violncia domstica, depresso e esquizofrenia
promovem a iniciao ao uso do crack;
(C) o baixo poder aquisitivo, a disponibilidade nas ruas e a
facilidade de uso fazem com que o crack seja a droga de
eleio e de uso exclusivo da camada socioeconmica
desfavorecida da populao;
(D) a represso ao uso de outras drogas lcitas, como lcool e
tabaco, e de drogas ilcitas mais leves empurra o usurio para
um ambiente de marginalidade e, consequentemente, para o
uso do crack;
(E) a oferta continuada de informaes e de recomendaes
sobre os perigos do uso do crack acaba paradoxalmente
despertando a curiosidade para o uso da droga entre a
populao mais jovem.

QUESTO 44
A Resoluo n 02/01 do Conselho Federal de Psicologia, que
trata da Concesso e Registro do Ttulo Profissional de
Especialista em Psicologia nos Conselhos Regionais de Psicologia,
definiu, entre as especialidades que podero receber esse ttulo,
a do psiclogo especialista em psicologia do esporte. De acordo
com a resoluo, atribuio desse profissional:
(A) o treinamento esportivo de pacientes psiquitricos e de
pessoas com necessidades especiais fsicas e cognitivas,
incluindo idosos;
(B) o assessoramento de atletas nas questes contratuais
atinentes ao desenvolvimento de uma carreira profissional;
(C) a produo de pareceres psicolgicos que subsidiem decises
de tcnicos e dirigentes no desligamento de atletas inaptos;
(D) a orientao da efetivao do esporte no competitivo de
carter profiltico e recreacional, para o bem-estar e a
qualidade de vida dos indivduos;
(E) o uso das atividades esportivas de equipe como tcnica de
terapia grupal em programas de reabilitao de dependncia
qumica de adolescentes e adultos jovens.

Nvel Superior - PTS II - Psiclogo

QUESTO 46
O psiquiatra Enrique Pichon-Rivire (1907 1977) desenvolveu,
com base em suas experincias profissionais com pacientes
psiquitricos, o conceito de Grupos Operativos, que se definem
como grupos centrados na tarefa. O autor teorizou sobre os
diferentes papis que os participantes dos grupos podem
assumir, entre os quais NO se encontra o papel de:
(A) sabotador, membro que o lder da resistncia mudana;
(B) louco, membro que concentra os aspectos psicopatolgicos
do grupo ou da tarefa;
(C) porta-voz, aquele que traduz atravs de sua fala e aes os
sentimentos e as ideias que circulam no grupo;
(D) lder, o depositrio de aspectos positivos do grupo, que leva o
grupo a buscar a mudana;
(E) bode expiatrio, membro que se faz depositrio dos aspectos
negativos e atemorizantes do grupo ou da tarefa.

QUESTO 47
Falar em pblico, interagir com outras pessoas, realizar
desempenhos sob observao ou participar de atividades sociais
podem ser fonte de extremo desconforto emocional para
algumas pessoas e comprometer de maneira importante a vida
profissional, social e escolar. Sobre esse quadro, pode-se afirmar
que:
(A) se trata de transtorno inserido no espectro dos transtornos
afetivos de humor do tipo depressivo;
(B) a ansiedade antecipatria e o comportamento de evitao
podem levar ao total isolamento social;
(C) a fobia social ou agorafobia pode se manifestar por ataques
de pnico ao se estar em meio a uma multido;
(D) se trata de timidez, uma reao normal a fatores estressores,
como novos ambientes e pessoas estranhas;
(E) o uso do lcool comum como um ansioltico para minimizar
o desconforto do transtorno de estresse ps-traumtico.

Tpo 1 - Branca - Pgina 9

Funarte - Concurso Pblico 2014

FGV-Projetos

QUESTO 48

QUESTO 51

O excesso de informaes, derivado, em parte, do fcil acesso


tecnologia, est associado a uma possvel diminuio de
produtividade e da aprendizagem, dada sua relao com a
capacidade de ateno. Sobre a ateno e seus transtornos,
pode-se afirmar que:
(A) a distraibilidade a propriedade de manter a ateno
orientada de modo permanente em determinado sentido do
mundo interior;
(B) a tenacidade a possibilidade de desviar a atenopara um
novo objeto, especialmente para um estmulo do meio
exterior;
(C) nos perodos de euforia do transtorno afetivo bipolar, a
ateno se caracteriza pela combinao de supertenacidade e
subvigilncia;
(D) o elemento afetivo tem significao determinante no
processo da ateno, uma vez que a pessoa dirige a ateno
aos estmulos que lhe despertam interesse;
(E) a ateno criada pela conscincia e pode ser entendida
como uma atitude psicolgica atravs da qual a atividade
psquica se foca em diversos estmulos.

Leon Festinger, um dos mais importantes tericos da psicologia


social, cunhou, em 1957, o termo dissonncia cognitiva, que
pode ser definido como:
(A) o sentimento de ansiedade e tenso interna provocado pela
percepo da inconsistncia lgica entre duas cognies
diferentes, incluindo atitudes, crenas e comportamentos;
(B) o conjunto de manifestaes comportamentais suscitadas
pela interao de uma pessoa com outras pessoas ou pela
mera expectativa de tal interao;
(C) a substituio do paradigma vigente na cincia normal por
um novo paradigma, resultado de uma espcie de revoluo
cientfica;
(D) a modificao do modo de pensar e agir de cada indivduo em
relao a crenas e valores, criando assim novas informaes
ou cognies sobre alguns dos seus conceitos pessoais;
(E) o aprendizado de cada indivduo na relao com os outros
indivduos pela apropriao da realidade criada pelas
geraes anteriores.

QUESTO 49
A maconha uma substncia proibida e, uma vez detectada,
causa de suspenso, punio e at perda de patrocnios de
atletas. Sobre os efeitos do uso da maconha, correto afirmar
que:
(A) proporciona uma sensao intensa de euforia e poder;
(B) o THC induz a inapetncia e a sonolncia exagerada;
(C) verifica-se o aumento da concentrao e da ateno no uso
moderado;
(D) a dependncia severa se desenvolve rapidamente;
(E) o uso continuado pode levar sndrome amotivacional.

QUESTO 50
O culto ao corpo tornou-se um fenmeno social e cultural e vem
chamando ateno por produzir uma obsesso pela forma, pela
sade e pela busca de um ideal de beleza de acordo com padres
predeterminados. Assim, o corpo passou a ser objeto de grande
investimento, possibilitado por novas tecnologias, exerccios,
dietas, tratamentos, cosmticos, cirurgias plsticas, entre outros.
Sobre os transtornos mentais associados insatisfao com a
imagem corporal, pode-se afirmar que:
(A) na bulimia nervosa verifica-se uma perturbao significativa
na percepo do esquema corporal
que tem como
consequncia a recusa alimentar;
(B) a anorexia nervosa se manifesta por excessos alimentares
seguidos de culpa e comportamentos compensatrios, como
jejum, induo de vmitos, exerccios fsicos intensos ou
abuso de medicamentos laxativos e diurticos;
(C) no transtorno dismrfico muscular, um subtipo do transtorno
dismrfico corporal, a autoimagem distorcida leva os
pacientes a se verem franzinos e a se dedicarem prtica
exagerada de exerccios fsicos e ao consumo de suplementos
alimentares e anabolizantes;
(D) a obesidade mrbida decorre de compulso alimentar
associada a sedentarismo, baixa autoestima, autoindulgncia
e baixa capacidade de persistncia;
(E) o transtorno dismrfico corporal simples se inicia na primeira
infncia e caracteriza-se por perturbao na alimentao com
fracasso significativo em ganhar peso ou perda significativa
de peso em curto prazo.

Pgina 10 - Tpo 1 - Branca

QUESTO 52
O psiclogo comete infrao ao Cdigo de tica na seguinte
situao:
(A) prestar servio profissional em situao de calamidade
pblica ou emergncia, sem visar benefcio pessoal;
(B) levar ao conhecimento das instncias competentes o
exerccio ilegal ou irregular da profisso, transgresses a
princpios e diretrizes do Cdigo de tica ou da legislao
profissional;
(C) pleitear ou receber comisses, emprstimos, doaes ou
vantagens outras de qualquer espcie, alm dos honorrios
contratados, assim como intermediar transaes financeiras;
(D) estipular o valor da remunerao de acordo com as
caractersticas de sua atividade e comunic-lo ao usurio ou
beneficirio antes do incio do trabalho a ser realizado;
(E) intervir na prestao de servios psicolgicos que estejam
sendo efetuados por outro profissional, numa situao de
trabalho multiprofissional em que a interveno faz parte da
metodologia adotada.

QUESTO 53
O estudo da psicologia das massas leva Freud a opor a
identificao, que constitui uma instncia da personalidade, e o
processo em que o objeto posto no lugar de uma instncia; por
exemplo, no caso de um lder que se substitui:
(A) ao id;
(B) ao inconsciente;
(C) pulso;
(D) sublimao;
(E) ao ideal do ego.

QUESTO 54
Freud considerava um destino bem-sucedido da pulso aquele
em que esta ltima modifica o seu prprio objeto, encontrando
satisfao num alvo no sexual e predominantemente ligado a
atividades artsticas e intelectuais. Tal destino chamado por ele
de:
(A) sublimao;
(B) recalque;
(C) transformao em seu contrrio;
(D) retorno prpria pessoa;
(E) inverso de contedo.

Nvel Superior - PTS II - Psiclogo

Funarte - Concurso Pblico 2014

FGV-Projetos

QUESTO 55

QUESTO 59

Em meio ao trabalho de grupo com jovens artistas, um deles


procurou o psiclogo para falar, em particular, que j revendeu
pequena quantidade de drogas para o sustento prprio e de sua
famlia. Acrescentou que, apesar de no continuar com essa
prtica, alguns membros de seu grupo tomaram conhecimento e
agora o pressionam a vender maconha para eles. Mesmo sem
saber o que fazer por ora, o jovem pediu ao psiclogo que
mantenha o sigilo e no abra o assunto para os demais
envolvidos. Diante dessa situao e com base no Cdigo de tica,
o psiclogo:
(A) deve quebrar o sigilo, haja vista a presena do consumo e do
comrcio ilegal de maconha;
(B) pode quebrar o sigilo, baseando sua deciso na busca do
menor prejuzo;
(C) deve quebrar o sigilo, porm, somente para os membros que
pressionam o jovem que confidenciou ao psiclogo;
(D) deve quebrar o sigilo para os familiares e responsveis do
jovem;
(E) no pode quebrar o sigilo em nenhuma hiptese.

Walter Benjamin foi um conhecido autor que refletiu sobre as


articulaes entre subjetividade e cidade. Em seus estudos, ele
indica a indissociabilidade entre os modos de produo
capitalista e as formas de existncia do citadino. Tal anlise pode
ser de profundo interesse, especialmente se considerarmos as
grandes capitais brasileiras, projetadas para a circulao de
carros e transportes, sem promoverem formas alternativas de
territorializao e experincias singulares. Numa perspectiva de
resistncia a essa lgica capitalista, a psicologia, associada a
manifestaes artsticas, pode ser de grande importncia para:
(A) dar sentido existncia na cidade e fazer frente ao
assentamento humano;
(B) incentivar o citadino a encontrar o conforto em seu lar;
(C) adaptar o corpo citadino ao movimento das metrpoles;
(D) promover a cura atravs da travessia do fantasma;
(E) estimular o retorno vida campestre.

QUESTO 56
sabido que existe a segregao e a criminalizao de uma
significativa parcela da populao brasileira, a saber, a juventude
pobre e negra. Tal discriminao remonta a perodos histricos,
entre os quais, a preocupao do Estado em controlar os
escravos recm-libertos pela lei do Ventre Livre e, assim, a tutela
sobre os menores em situao irregular.
A partir dos movimentos sociais em favor dos direitos humanos
que marcaram os anos 80-90, surgiram leis que procuraram
abolir a discriminao em relao a jovens e crianas de camadas
sociais e econmicas distintas, entre as quais destaca-se:
(A) o Cdigo de Menores;
(B) o Cdigo Criminal;
(C) o Cdigo Penal;
(D) o Estatuto da Criana e do Adolescente;
(E) a Lei Paulo Delgado.

QUESTO 57
Embora se reconhea a falncia de um paradigma focado na
mera represso, o problema das drogas continua a ser um tema
altamente complexo. Esse paradigma vem sendo substitudo por
outro, que privilegia a preveno e os direitos humanos, do ponto
de vista da sade pblica, devendo fazer parte de uma poltica
de:
(A) centralizao das comunidades teraputicas;
(B) moralizao do consumo;
(C) democratizao de medicamentos;
(D) reduo de danos;
(E) incentivo s internaes voluntrias.

QUESTO 58
Segundo Michel Foucault, a proteo e o evitamento da
depredao das novas formas de acmulo de riqueza na
modernidade fizeram proliferar uma tecnologia de vigilncia e
controle, que se instalou no sculo XVIII e caracteriza nossa
sociedade at os dias de hoje. Tal tecnologia corresponde:
(A) represso social;
(B) excluso da pobreza;
(C) ao grande enclausuramento;
(D) luta de classes;
(E) ao panoptismo.

Nvel Superior - PTS II - Psiclogo

QUESTO 60
Segundo Samulski, as percepes so processos presentes em
todas as fases da ao esportiva, contribuindo para determinar as
mudanas de velocidade, de espao e de movimentos do corpo
inteiro ou de parte dele, da posio do adversrio, da forma de
controle do equipamento, etc. O mesmo autor, baseando-se em
Neumaier, afirma que a percepo (particularmente a visual) nos
esportes deve cumprir quatro tarefas:
(A) controle da expectativa; assimilao das informaes
provenientes do meio ambiente; antecipao do movimento
externo; avaliao do movimento;
(B) percepo do estado psquico do adversrio direto;
percepo dos pontos fracos do sistema defensivo;
percepo da forma de apitar dos rbitros; percepo dos
movimentos de superioridade ou inferioridade numrica de
defesa;
(C) percepo do comportamento dos colegas; percepo do
comportamento do adversrio direto; percepo do
comportamento do defensor prximo; percepo do
comportamento da defesa perante a movimentao do
ataque;
(D) formao de uma base para orientao; controle visual do
prprio movimento; antecipao do movimento externo;
avaliao do movimento;
(E) controle da expectativa; percepo de informaes
relevantes; antecipao da execuo do movimento;
percepo do estado psquico do adversrio direto.

QUESTO 61
Dietmar Samulski considera que, no esporte de rendimento,
atletas que no dispem de uma ateno suficientemente flexvel
no alcanam, de forma geral, um alto ndice de rendimento
esportivo, sendo, por isso, muito importante desenvolver neles a
capacidade de concentrao. So diretrizes utilizadas para
melhorar a capacidade de ateno:
(A) simular as condies de competio no treinamento; praticar
o controle visual; permanecer concentrado em situaes
presentes;
(B) usar palavras-chave; estabelecer rotinas de comportamento;
permanecer concentrado em situaes futuras;
(C) desenvolver planos de competio; manter inalterados os
estmulos e desafios; evitar e bloquear estmulos relevantes;
(D) pensar no sentido de suas aes; concentrar-se no objetivo
futuro; praticar o controle auditivo;
(E) simular as condies de competitividade no treinamento;
desenvolver planos de competio; compreender e integrar
os pensamentos negativos.

Tpo 1 - Branca - Pgina 11

Funarte - Concurso Pblico 2014

FGV-Projetos

QUESTO 62

QUESTO 65

Recentes pesquisas indicam que a qualidade de vida resultado


das condies subjetivas de um indivduo nos vrios aspectos que
compem a sua vida, como o trabalho, a vida social, a sade
fsica, o humor, entre outros. Com relao prtica de atividades
fsicas por pessoas idosas, correto afirmar que:
(A) devem-se diminuir progressivamente as atividades fsicas na
terceira idade, pois h risco de elevao de ataques cardacos
ou agravamento de problemas de sade;
(B) a depresso, principal problema de sade mental entre os
idosos, no significativamente alterada por meio da prtica
de atividades fsicas;
(C) a prtica de atividades fsicas reduz e/ou atrasa a diminuio
das capacidades fsicas e a fragilidade orgnica;
(D) a prtica de atividades fsicas por idosos parece estar
relacionada ao aumento da incidncia de morbidez e
mortalidade por leses musculares;
(E) pesquisas indicam que a taxa de mortalidade entre idosos se
revela diretamente proporcional ao nvel de atividades fsicas
praticadas por eles.

Georges Canguilhem, no clssico texto O que a psicologia?,


considera que:
(A) o psiclogo contemporneo exercita um saber cientfico que
se ancora em larga tradio filosfica e que tambm est
articulado ascenso do mtodo experimental, constituindose prtica relevante e fundamental para compreenso da
dimenso psquica dos indivduos.
(B) o psiclogo o profissional competente para investigar a
personalidade e maturidade individuais, os modos de
relacionamento familiar, a adaptao laborativa, a capacidade
de constituio do vnculo e o desenvolvimento de atitudes
tolerantes e disciplinadas em atividades comunitrias.
(C) o psiclogo , na maioria das vezes, um prtico profissional
cuja cincia totalmente inspirada nas leis de adaptao a
um meio sociotcnico, o que confere s [suas] operaes de
medida uma significao de apreciao e um alcance de
percia.
(D) o psiclogo um estudioso das causas e consequncias da
violncia familiar, relacionando o fenmeno da violncia
domstica violncia estrutural (que incide sobre a vida das
crianas e adolescentes) e delinquncia, entendida como
forma de violncia cometida por crianas e jovens
transgressores.
(E) o psiclogo o profissional indicado a motivar, treinar e
desenvolver habilidades esportivas tanto em atletas que
visem aumentar seu rendimento esportivo quanto em
crianas e jovens em processo de iniciao desportiva, bem
como em atletas com burnout.

QUESTO 63
Desde o incio dos jogos olmpicos na era moderna, o nvel do
desempenho esportivo vem crescendo continuamente, e o
sistema de treinamento um dos fatores responsveis por isso.
Associado sndrome de supertreinamento, oburnout consiste:
(A) na primeira fase da sndrome por supertreinamento, que se
caracteriza por condutas de elevada competitividade,
aumento significativo das atividades fsicas e insensibilidade
fadiga;
(B) numa resposta psicofisiolgica exaustiva, que envolve uma
fuga psquica, emocional e, s vezes, fsica, em resposta a um
excessivo nvel de estresse ou insatisfao;
(C) numa etapa do processo de recuperao, que consiste na
reduo progressiva dos fatores estressantes por meio de
prticas de relaxamento e visualizao positiva;
(D) em sintomas fsicos e psicolgicos objetivos que podem ser
detectados antecipadamente no sistema de treinamento;
(E) em sintomas derivados de fatores emocionais, como
proximidade de competies, desejo de vencer, temores de
fracasso, etc.

QUESTO 64
A utilizao da Psicologia do Esporte pode se revelar til tanto na
preveno quanto na cura de leses esportivas, auxiliando no
processo de reabilitao do atleta. Nesse contexto, o uso de
tcnicas psicolgicas do controle da dor (pain coping strategies)
vem se revelando eficaz na reduo e controle da dor. Em relao
ao controle da dor, as tcnicas mais utilizadas so:
I. tcnicas psicodramticas, teis na formao de vnculos
deconfiana com a equipe que acompanha a reabilitao,
fundamentais no controle da dor;
II. tcnicas psicanalticas, que visam reconhecer fatores
inconscientes relacionados s dificuldades no processo de
reabilitao e de persistncia da dor;
III. tcnicas cognitivas que redirecionam a ateno para longe do
foco da dor, ou, inversamente, que a focalizam, para
reinterpret-la;
IV. tcnicas comportamentais que se baseiam na modificao de
comportamentos, na tentativa de controlar ou minimizar a dor.
Assinale se apenas:
(A) I est correta;
(B) II est correta;
(C) I e II esto corretas;
(D) II e III esto corretas;
(E) III e IV esto corretas.
Pgina 12 - Tpo 1 - Branca

QUESTO 66
As pesquisas na rea de psicologia do esporte deram maior
nfase ao esporte de rendimento no perodo de 1965 a 1990. Nos
ltimos anos, entretanto, o foco de interesse da Psicologia do
Esporte se ampliou. A Psicologia do Esporte voltada para crianas
e adolescentes:
(A) deve ter objetivos e formas de atuao muito especficas, de
acordo com o nvel de desenvolvimento dos alunos,
respeitando suas capacidades maturacionais dentre aspectos
biolgicos e sociais;
(B) deve se orientar para o alcance do alto rendimento nas
competies, pois a expertise no esporte depende do precoce
desenvolvimento do talento na rea esportiva;
(C) tem como objetivo a anlise e modificao de fatores
psquicos determinantes do desempenho no esporte;
(D) objetiva a melhoria planejada e sistemtica das capacidades
psquicas individuais do rendimento, estabilizao e
otimizao do comportamento na competio;
(E) pretende acelerar e otimizar os processos de recuperao
psicolgica e a otimizao dos processos de comunicao social.

QUESTO 67
Em eco s mais recentes transformaes subjetivas da cultura
miditica, a celebrada revista Time escolheu, como personalidade
do ano de 2006: VOC! Naquela edio, um espelho cintilava na
capa da publicao como um convite autocontemplao por
cada leitor da revista. Em consonncia com o processo de
espetacularizao do eu, empresas on-line esto aproveitando
esse fenmeno para:
(A) proteger a intimidade e preservar as narrativas pessoais;
(B) vender produtos atravs da publicidade tradicional, sem
qualquer mediao dos usurios;
(C) ajudar pessoas a criar e compartilhar ideias e informaes;
(D) condenar acidamente a hiperexposio miditica e difundir
textos crticos ao sistema;
(E) desincentivar a criatividade de cada um, valorizando as
narrativas oficiais.
Nvel Superior - PTS II - Psiclogo

Funarte - Concurso Pblico 2014

FGV-Projetos

QUESTO 68

QUESTO 70

Para a Psicologia do Esporte, a performance de excelncia


definida como um desempenho atltico e consistente dentro de
um perodo de tempo estendido. Para obter tal performance, os
atletas precisam adquirir capacidades e habilidades nos campos
de domnio fisiolgico, tcnico, cognitivo-ttico e emocional.
Como domnio emocional considerado:
(A) o controle emocional que envolve a capacidade do atleta de
monitorar e exercer controle sobre suas prprias emoes
por meio de tcnicas de superao + a submisso ao
acompanhamento psicoterpico profundo;
(B) o controle emocional + as habilidades psicolgicas de
motivao, estabelecimento de metas, controle da ativao,
autoconfiana, atitude positiva, habilidades interpessoais,
imaginao e treinamento mental;
(C) a submisso ao acompanhamento psicoterpico profundo,
que poder permitir a elaborao de temores e traumas que
dificultem a vitria + o desenvolvimento de habilidades
psicolgicas como motivao, imaginao e controle mental;
(D) a submisso ao acompanhamento psicoterpico profundo + a
participao em terapia de grupo, que propiciar a formao
de vnculos de confiana com os demais membros da equipe;
(E) o controle emocional que envolve a capacidade do atleta de
monitorar e exercer controle sobre suas prprias emoes
por meio de tcnicas de superao + a participao em
terapia de grupo que propiciar a formao de vnculos de
confiana com os demais membros da equipe.

Michel Foucault, no difundido livro Microf sicadoPoder, analisa,


entre outras questes, o surgimento da medicina social,
refletindo sobre processos que ocorreram na Inglaterra do sculo
XIX, e conclui que a medicina inglesa:
(A) consistia no questionamento crtico da prtica e do saber
mdicos, incumbindo s universidades e corporao dos
mdicos o encargo da formao mdica e a distribuio dos
diplomas;
(B) constituiu-se atravs da imposio da quarentena, que
pressupunha a permanncia de cada pessoa em sua casa para
imediata localizao, alm de vigilncia constante para
verificao do contgio, ou no, da doena;
(C) preocupou-se com o controle da circulao da gua e do ar,
opinando na construo de largas avenidas no espao urbano
e na demolio de casas edificadas em pontes;
(D) constituiu essencialmente um controle da sade e do corpo
das classes mais pobres para torn-las mais aptas ao trabalho
e menos perigosas s classes mais ricas;
(E) estatizou-se desde o sculo XVII atravs da criao de
administradores mdicos nomeados pelo governo para
atender a todos os moradores de uma determinada regio.

QUESTO 69
Michel Foucault, no conhecido livro Microfsica do Poder, analisa
que o hospital e a medicina permaneceram independentes at
meados do sculo XVIII. Segundo Foucault, com relao a essa
situao, correto afirmar que:
(A) a medicina se tornou hospitalar atravs das necessidades
sanitrias advindas com o grande internamento no Hospital
Geral, local onde se justapunham e se misturavam doentes,
loucos, devassos, prostitutas, etc;
(B) a hospitalizao dos discursos mdicos se originou do
reconhecimento da erudio do saber clnico, que implicou a
constituio de um espao privilegiado de exerccio de poder;
(C) a medicalizao do hospital est relacionada colonizao do
discurso religioso pelo conhecimento mdico, submetendo o
espao hospitalar, antes administrado por religiosos, ao
discurso clnico;
(D) a medicina se hospitalizou a partir da disseminao do olhar
como estratgia de vigilncia e controle individuais, o que
permitiu uma nova tcnica de condicionamento dos corpos e
mentes;
(E) o primeiro fator de medicalizao do hospital foi
simplesmente a anulao de seus efeitos negativos,
purificando-o das doenas que ele podia suscitar nas pessoas
internadas, espalhando-as pela cidade.

Nvel Superior - PTS II - Psiclogo

Tpo 1 - Branca - Pgina 13

PROVA: FUNARTE
ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: FGV

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

41
42
43
44
45
46
47
48
49
50
51
52
53
54
55

E
A
A
D
C
B
B
D
E
C
A
C
E
A
B

56
57
58
59
60
61
62
63
64
65
66
67
68
69
70

D
D
E
A
D
A
C
B
E
C
A
C
B
E
D

Coletnea de Provas | Concursos de Psicologia

Prefeitura do Municpio de Osasco


Concurso Pblico 2014
Prova escrita objetiva Nvel Superior

Psiclogo
TIPO 1 BRANCA
Informaes Gerais
1. Voc receber do fiscal de sala:
a) este caderno de prova contendo 60 questes objetivas,
cada qual com 5 (cinco) alternativas de respostas
(A, B, C, D e E);
b) uma folha de respostas destinada marcao das respostas
das questes objetivas.
2. Verifique se seu caderno est completo, sem repetio de
questes ou falhas. Caso contrrio, notifique imediatamente o
fiscal de sala para que sejam tomadas as devidas providncias.
3. As questes objetivas so identificadas pelo nmero situado
acima do seu enunciado.
4. Ao receber a folha de respostas da prova objetiva voc deve:

6. O preenchimento das respostas da prova objetiva, de inteira


responsabilidade do candidato, dever ser feito com caneta
esferogrfica de tinta indelvel de cor preta ou azul. No ser
permitida a troca da folha de respostas por erro do candidato.
7. O tempo disponvel para a realizao da prova de
4 (quatro) horas, j includo o tempo para a marcao da folha
de respostas da prova objetiva.
8. Reserve tempo suficiente para o preenchimento de suas
respostas. Para fins de avaliao, sero levadas em
considerao apenas as marcaes realizadas na folha de
respostas da prova objetiva, no sendo permitido anotar
informaes relativas s suas respostas em qualquer outro
meio que no seja o prprio caderno de prova.

a) conferir seus dados pessoais, em especial seu nome,


nmero de inscrio e o nmero do documento de
identidade;

9. Somente aps decorrida uma hora e trinta minutos do incio da


prova voc poder retirar-se da sala de prova sem, contudo,
levar o caderno de prova.

b) ler atentamente as instrues para o preenchimento da


folha de respostas;

10. Somente no decorrer dos ltimos sessenta minutos do perodo


da prova, voc poder retirar-se da sala levando o caderno de
prova.

c) marcar na folha de respostas da prova objetiva o campo


relativo confirmao do tipo/cor de prova, conforme o
caderno que voc recebeu;
d) assinar seu nome, apenas nos espaos reservados, com
caneta esferogrfica de tinta azul ou preta.
5. Durante a aplicao da prova no ser permitido:
a) qualquer tipo de comunicao entre os candidatos;
b) levantar da cadeira sem a devida autorizao do fiscal de
sala;
c) portar aparelhos eletrnicos, tais como bipe, telefone
celular, agenda eletrnica, notebook, palmtop, receptor,
gravador, mquina de calcular, mquina fotogrfica digital,
controle de alarme de carro etc., bem como relgio de
qualquer modelo, culos escuros ou quaisquer acessrios
de chapelaria, tais como chapu, bon, gorro etc. e, ainda,
lpis, lapiseira (grafite), corretor lquido e/ou borracha. Tal
infrao poder acarretar a eliminao sumria do
candidato.

11. Ao terminar a prova, entregue a folha de respostas ao fiscal da


sala e deixe o local de prova. Caso voc se negue a entregar,
ser eliminado do concurso.
12. A FGV realizar a coleta da impresso digital dos candidatos na
folha de respostas.
13. Os candidatos podero ser submetidos a sistema de deteco
de metais quando do ingresso e da sada de sanitrios durante
a realizao das provas. Ao sair da sala, ao trmino da prova, o
candidato no poder usar o sanitrio.
14. Os gabaritos preliminares das provas objetivas sero
divulgados no dia 16/09/2014, no endereo eletrnico
http://fgvprojetos.fgv.br/concursos/prefeituradeosasco.
15. O prazo para interposio de recursos contra os gabaritos
preliminares ser das 0h do dia 17/09/2014 at as 23h59 do dia
18/09/2014, observado o horrio oficial, no endereo
http://fgvprojetos.fgv.br/concursos/prefeituradeosasco, por meio
do Sistema Eletrnico de Interposio de Recurso.

Concurso Pblico para a Prefeitura Municipal de Osasco

Conhecimentos especficos
31
O Artigo 57 do Estatuto do Idoso classifica como infrao
administrativa passvel de aplicao de multa Deixar o
profissional de sade ou o responsvel por estabelecimento de
sade ou instituio de longa permanncia de comunicar
autoridade competente os casos de crime contra idoso de que
tiver conhecimento. Analise as situaes a seguir:
I Apropriar-se de ou desviar bens, proventos, penso ou
qualquer rendimento do idoso, dando-lhes aplicao diversa
de sua finalidade.
II Lavrar qualquer ato notarial que envolva pessoa idosa sem a
devida representao legal.
III Submeter o idoso a condies desumanas ou degradantes
privando-o de alimentos e cuidados indispensveis quando
obrigado a faz-lo.
IV Obstar o acesso de algum a qualquer cargo pblico por
motivo de idade.
So crimes contra o idoso previstos nessa Lei:
(A) apenas I e II esto corretas;
(B) apenas III e IV esto corretas;
(C) apenas I, II e III esto corretas;
(D) apenas I, III e IV esto corretas;
(E) I, II, III e IV esto corretas.

32
Os Centros de Ateno Psicossocial (CAPS), entre todos os
dispositivos de ateno sade mental, tm valor estratgico
para a Reforma Psiquitrica Brasileira.
Os CAPS so os
articuladores estratgicos da rede de ateno s pessoas com
transtornos mentais e da poltica de sade mental num
determinado territrio, por meio da seguinte linha de ao:
(A) prestao de atendimento clnico em regime de ateno
mensal, evitando assim as internaes em hospitais
psiquitricos;
(B) promoo da insero social das pessoas com transtornos
mentais atravs de aes intersetoriais;
(C) regulao da porta de entrada da rede manicomial de sade
mental na sua rea de atuao;
(D) fornecimento de suporte ateno sade mental na rede
bsica e hospitalar;
(E) implementao e gesto dos servios residenciais
teraputicos destinados a egressos do sistema asilar.

Psiclogo

FGV Projetos

33
No atendimento paciente X, o psiclogo observou o seguinte
quadro: esforos frenticos para evitar um abandono real ou
imaginado; recorrncia de ameaas suicidas e de comportamento
automutilante; sentimentos crnicos de vazio; instabilidade
afetiva devido a uma acentuada reatividade do humor e padro
de relacionamentos interpessoais instveis e intensos,
caracterizado pela alternncia entre extremos de idealizao e
desvalorizao. Este padro de vivncias e comportamentos
caracterstico do transtorno de personalidade:
(A) borderline;
(B) esquizoide;
(C) paranoide;
(D) narcisista;
(E) bipolar.

34
A Resoluo CFP 001/99 estabelece normas de atuao para os
psiclogos em relao questo da orientao sexual. De acordo
com essa Resoluo, o psiclogo procurado por um paciente
homossexual dever:
(A) recusar o paciente j que a homossexualidade no constitui
doena, nem distrbio e nem perverso;
(B) recomendar o tratamento se confirmada a ocorrncia de
comportamentos ou prticas de homossexualismo;
(C) aceitar o paciente sem abordar na terapia suas prticas
sexuais
desviantes
da
norma
estabelecida
socioculturalmente;
(D) aceitar o paciente, considerando que a forma como cada um
vive sua sexualidade faz parte da identidade do sujeito, que
deve ser compreendida na sua totalidade;
(E) sugerir a insero do paciente em terapia de grupo para uma
reflexo sobre o preconceito e a superao de discriminaes
e estigmatizaes.

35
A Sra. V. R., 30 anos, procurou o CRAS de seu bairro para relatar
que havia descoberto estar grvida de 3 meses. Ela j tinha 2
filhos de seu primeiro casamento e a gravidez era fruto de um
relacionamento afetivo eventual ocorrido aps sua separao. V.
R. afirmou que no desejava cuidar do beb aps o nascimento e
queria saber como proceder para entregar a criana em adoo.
De acordo com o disposto no Estatuto da Criana e do
Adolescente, dever o profissional que atendeu a gestante V. R.:
(A) localizar o suposto genitor da criana para o reconhecimento
da paternidade;
(B) indicar famlia substituta para a colocao da criana em
adoo;
(C) encaminhar a gestante obrigatoriamente Justia da Infncia
e da Juventude;
(D) providenciar assistncia psicolgica e social para dissuadi-la
da entrega;
(E) advertir a gestante de que ela estar incorrendo em crime de
abandono de incapaz.

Tipo 1 Cor BRANCA Pgina 9

Concurso Pblico para a Prefeitura Municipal de Osasco

FGV Projetos

36

39

O psicanalista ingls Donald Winnicott (1896-1971) notabilizou-se


por seu trabalho terico e clnico em Psicanlise Infantil. Ao tratar
do desenvolvimento emocional saudvel do beb, esse autor
descreveu o conceito de me suficientemente boa, que pode
ser definida como a me que no processo de amadurecimento do
beb:
(A) se torna um objeto transicional para seu beb;
(B) no desilude seu beb, j que as falhas so um obstculo
para sua independncia;
(C) persiste no estado de preocupao materna primria,
incentivando o amadurecimento psicolgico da criana;
(D) comete falhas que abriro espao ao desenvolvimento do
beb recm nascido;
(E) na fase de dependncia extrema do beb, adapta-se
ativamente s suas necessidades.

Com a finalidade de obter informaes sobre o desenvolvimento


cognitivo de seus alunos, a professora Maria props a eles um
jogo que consistia em apresentar duas bolas iguais de massa de
modelar, fazer uma forma de salsicha com uma delas e perguntar
onde havia mais massa. Jos respondeu que a salsicha tinha mais
massa porque era maior e Joo respondeu que a quantidade de
massa era igual e que apenas o formato de uma delas havia sido
modificado. Considerando a teoria de Jean Piaget sobre os
estgios do desenvolvimento cognitivo, possvel concluir que
Jos e Joo esto respectivamente nos estgios:
(A) sensrio-motor e pr-operatrio;
(B) operatrio-concreto e pr-operatrio;
(C) pr-operatrio e operatrio-concreto;
(D) operatrio-formal e operatrio-concreto;
(E) sensrio-motor e operatrio-formal.

37

40

A partir da experincia original dos Alcolicos Annimos,


surgiram inmeros grupos de autoajuda voltados para a
abordagem de comportamentos compulsivos, como os
Narcticos Annimos, os Comedores Compulsivos Annimos e os
Dependentes de Amor e Sexo, entre outros. caracterstica
encontrada nesses grupos teraputicos:
(A) a coordenao por um terapeuta profissional;
(B) a excluso de outros tratamentos paralelos;
(C) a fixao de prazos de tratamento;
(D) a participao compulsria;
(E) a centralidade em uma condio comum aos membros.

A doena de Alzheimer a forma mais comum de demncia na


velhice. Ela pode ter incio ao redor dos 50 anos, mas mais
frequente em idades mais avanadas. Ocorre entre homens e
mulheres na mesma proporo, sendo que incide em 8% da
populao de idosos uma doena neurodegenerativa, cujos
sintomas mais caractersticos so:

38
A me de Pedro, um menino de 6 anos com transtorno do
espectro autista, solicitou ao psiclogo da unidade de sade
pblica orientao quanto insero escolar do filho. De acordo
com o disposto na legislao, a orientao correta :
(A) Pedro poder ser includo em uma classe comum do ensino
regular tendo, se necessrio, acompanhante especializado;
(B) Pedro dever ser matriculado em escola especializada no
atendimento de deficientes mentais;
(C) Pedro tem direito ao ensino domiciliar individual
considerando sua excessiva aderncia a rotinas e os padres
de comportamento ritualizados;
(D) a matrcula escolar facultativa para crianas com transtorno
do espectro autista dadas as dificuldades na interao social e
na comunicao verbal;
(E) a matrcula de aluno com transtorno do espectro autista ser
condicionada aprovao do gestor escolar.

Psiclogo

(A) comprometimento da memria antiga e dificuldade de


compreenso de palavras;
(B) incio lento e insidioso e piora progressiva na capacidade de
raciocnio e julgamento;
(C) perda sbita da memria recente e da capacidade de
reconhecer faces familiares;
(D) movimentos espasmdicos e rgidos e dificuldade de
coordenao motora;
(E) predominncia de alucinaes visuais e de trocas de palavras
na comunicao verbal.

41
Nos primrdios da psicologia, o movimento funcionalista teve
forte presena, especialmente no contexto norte-americano,
destacando-se do elementarismo associacionista alemo do
sculo XIX. Dentre os grandes expoentes desse movimento
funcionalista, cabe destacar:
(A) Max Wertheimer;
(B) William James;
(C) Abraham Maslow;
(D) Fritz Perls;
(E) Wolfgang Kohler.

Tipo 1 Cor BRANCA Pgina 10

Concurso Pblico para a Prefeitura Municipal de Osasco

FGV Projetos

42

45

Frederic Skinner foi uma figura de importncia no campo da


psicologia, particularmente no behaviorismo, propondo um
sistema no qual as explicaes do comportamento humano no
se restringem ao comportamento reflexo. Para esse autor,
grande parte do comportamento seria influenciada por suas
consequncias, para o qual ele emprega o conceito de
condicionamento:
(A) operante;
(B) respondente;
(C) cognitivo;
(D) primrio;
(E) clssico.

A Reforma Psiquitrica Brasileira (RFB) consolidou-se ao longo


das duas ltimas dcadas depois de um movimento amplo e
organizado de luta antimanicomial, consolidando marcos legais e
normativos de suma importncia. Ultimamente a incluso do
usurio de drogas, em particular do Crack, vem suscitando novos
debates no contexto da assistncia em sade mental. A
alternativa que NO pertence s diretrizes defendidas pela RFB :
(A) fomentar um modelo de ateno psiquitrica baseado na
comunidade e no centrado no hospital;
(B) instituir os servios residenciais teraputicos a fim de
viabilizar a reabilitao psicossocial assistida de pacientes
institucionalizados;
(C) defender aes em rede na Ateno Bsica, nos Ambulatrios
Especializados, nos CAPS AD, nas Unidades Residenciais
Transitrias, nos Servios Residenciais Teraputicos, nos
leitos em Hospitais Gerais e nas pequenas enfermarias
especializadas;
(D) enfatizar os Pontos de Encontro, os Centros de Convivncia e
as Oficinas de Gerao de Renda e Trabalho;
(E) fortalecer a criao e ampliao das comunidades
teraputicas para o tratamento especfico de usurios de
drogas, com nfase na abstinncia.

43
Considera-se "A Interpretao dos Sonhos" como o momento
inaugural da psicanlise, em que Freud apresenta a sua primeira
tpica, formada por trs sistemas, inconsciente, pr-consciente e
consciente, cada um com sua funo, o seu tipo de processo e
sua energia de investimento. Nesse contexto, ele formula as
regras prprias que regulam o inconsciente, ou seja:
(A) princpio de realidade e clivagem do ego;
(B) energia ligada e processo secundrio;
(C) deslocamento e condensao;
(D) clivagem do ego e recalcamento originrio;
(E) condensao e energia ligada.

44
Em 2013 foi concluda a ltima verso do manual diagnstico e
estatstico, conhecido por DSM-V, dando continuidade
expanso das categorias diagnsticas existentes nos sistemas
classificatrios anteriores, numa clara tendncia de patologizao
do normal. Pequenos desvios de conduta transformaram-se em
objeto de interveno psiquitrica a ponto de abranger a quase
totalidade dos assuntos humanos. Consolida-se, assim, o lugar da
psiquiatria como estratgia biopoltica que, desde a
modernidade, refere-se s populaes com a tarefa principal de
antecipar e administrar as manifestaes que possam afetar a
ordem social. Ao contrrio da psiquiatria clssica, representada
por Pinel e Esquirol, essa psiquiatria ampliada, representada por
Morel, Magnan, etc., tem como destaque o conceito de:
(A) alienao;
(B) psicose;
(C) neurose;
(D) degenerao;
(E) esquizofrenia.

Psiclogo

46
Na conhecida obra O Mal Estar na Civilizao (1930 [1929]),
Freud aponta para um paradoxo da conscincia moral, ou seja, de
que so precisamente as pessoas que levaram mais longe a
santidade as que se censuram da pior pecaminosidade (Freud,
1990 [1930]: 149). A presena do sentimento de culpa
inconsciente est na raiz desse paradoxo moral, haja vista:
(A) a tenso entre o eu e o supereu que faz retornar sobre ele a
pulso agressiva de cuja satisfao renunciou;
(B) a substituio do supereu pelo eu ideal, cuja instncia obriga
o eu a agir de acordo com a moral sexual civilizada;
(C) a dissoluo do complexo de dipo e a consequente
introjeo no ego da severidade educativa dos pais;
(D) a represso do supereu em relao s aes moralmente
condenveis praticadas pelo sujeito;
(E) a dessexualizao da libido que modifica o objeto da pulso
para algo socialmente valorizado.

47
De acordo com o Estatuto da Criana e do Adolescente (Lei n
8.069/90), a equipe interprofissional, da qual o psiclogo faz
parte em geral, possui ampla atuao, que vai desde as situaes
de destituio de poder familiar, colocao em famlia substituta,
acolhimento familiar ou institucional, at as de definio de
guarda ou de medida socioeducativa ao adolescente em ato
infracional. Portanto, a lei prev equipe interprofissional
algumas atribuies, EXCETO:
(A) fornecer subsdios por escrito mediante laudos;
(B) proporcionar subsdios verbalmente na audincia;
(C) desenvolver trabalhos de aconselhamento e orientao;
(D) promover aes de encaminhamento e preveno;
(E) fiscalizar locais de realizao de eventos infantis.

Tipo 1 Cor BRANCA Pgina 11

Concurso Pblico para a Prefeitura Municipal de Osasco

FGV Projetos

48

52

A Doutrina jurdica dos antigos cdigos de menores elegia


sobremaneira os mais pobres como alvo do Estado, cuja
consequncia no era seno a criminalizao da juventude. O
advento do Estatuto da Criana e do Adolescente (lei 8.069/90)
revogou o Cdigo de Menores de 1979 e inaugurou uma nova
doutrina, qual seja:
(A) da situao irregular;
(B) do interesse do menor de idade;
(C) do direito de tratamento digno na aplicao de sanes
penais;
(D) da proteo integral de seus direitos;
(E) do direito de opinar sobre questes de guarda, tutela e
adoo.

Kurt Lewin considerava sua proposta como uma teoria de campo,


desenvolvendo uma perspectiva terico-empirista. Esse autor
compreendia o espao vital como:
(A) um campo psicolgico que inclui a totalidade de fatos que
determinam o comportamento (C) de um indivduo em dado
momento, incluindo a pessoa (P) e o ambiente (A);
(B) um campo psicolgico dirigido ao aprendizado
comportamental associado ao condicionamento operante;
(C) um campo psicolgico articulado a estruturas filogenticas
que visa ao desenvolvimento sexual de um indivduo(I),
incluindo as variveis ambientais (A) que incidem nesse
processo;
(D) um campo psicolgico e lingustico fundamental para a
aquisio e desenvolvimento de habilidades cognitivas;
(E) um campo psicolgico previsvel e controlado envolvendo
estmulos e reaes em processos comportamentais e
mentais.

49
De acordo com o Cdigo de tica Profissional do Psiclogo, seu
dever fundamental:
(A) prestar servios psicolgicos de qualidade, devendo
comunicar ao seu conselho, num prazo mximo de um ms,
caso se utilize de tcnicas ainda no reconhecidas na
legislao profissional;
(B) prestar servios profissionais em situao de calamidade
pblica ou de emergncia, sem visar benefcio pessoal;
(C) fornecer, a quem de direito, na prestao de servios
psicolgicos, informaes concernentes ao trabalho a ser
realizado, mediante pagamento por seus servios;
(D) informar os resultados decorrentes da prestao de servios
psicolgicos, transmitindo todas as informaes neles obtidas
para a tomada de decises que afetam o usurio ou
beneficirio;
(E) preservar uma relao colaborativa com outro profissional
psiclogo, levando ao conhecimento das instncias
competentes somente os casos de exerccio ilegal ou irregular
da profisso.

53
Jean Piaget um dos principais tericos que pensam o
desenvolvimento infantil. Com relao aos esquemas piagetianos
analise as afirmativas a seguir:
I As crianas compreendem o mundo atravs da utilizao de
esquemas, estruturas psicolgicas que organizam a experincia.
II A assimilao ocorre quando novas experincias so
incorporadas de imediato aos esquemas existentes.
III A acomodao ocorre quando os esquemas so modificados
em funo da experincia.
Com base nas consideraes acima, a(s) afirmativa(s) correta(s)
/so:
(A) apenas I;
(B) apenas II;
(C) apenas I e II;
(D) apenas II e III;
(E) I, II e III.

50
H situaes em que o psiclogo pode se deparar com o conflito
entre o sigilo profissional e os valores que embasam a declarao
universal dos direitos humanos. Em casos assim, de acordo com o
Cdigo de tica Profissional, ele poder decidir pela quebra de
sigilo, baseando sua deciso na busca:
(A) da liberdade;
(B) da dignidade;
(C) do bem-estar;
(D) de seu benefcio;
(E) do menor prejuzo.

51
A psicologia da Gestalt realizou, dentre outros estudos, pesquisas
sobre a percepo humana. Essa escola considera como
princpios da organizao perceptual:
(A) segregao de figura e fundo, unidade monotemtica,
proximidade;
(B) proximidade, similaridade, boa continuao;
(C) segregao de figura e fundo, boa continuao, unidade
monotemtica;
(D) similaridade, unidade monotemtica, boa continuao;
(E) proximidade, similaridade, unidade monotemtica.

Psiclogo

54
Wolfgang Khler, um dos cofundadores da Psicologia da Gestalt,
desenvolveu importantes pesquisas sobre a inteligncia. Para
esse autor, insight :
(A) o processo de maturao das experincias espaciais em
funo do desenvolvimento cognitivo de um indivduo em um
campo interacional especfico;
(B) o processo de replicao da experincia de resoluo de um
dado problema por um indivduo;
(C) o processo de resoluo de um dado problema a partir da
percepo global do campo pela reorientao dos elementos
em nova configurao;
(D) a reconfigurao do campo emocional em funo da
alterao dos componentes ambientais;
(E) a reconfigurao do campo ambiental pelo surgimento de
foras vetoriais emocionais.

Tipo 1 Cor BRANCA Pgina 12

Concurso Pblico para a Prefeitura Municipal de Osasco

FGV Projetos

55

58

Vygotsky considerava que o processo de desenvolvimento


humano ocorria a partir das interaes sociais. Para esse autor, a
zona de desenvolvimento proximal corresponde:
(A) ao processo de aquisio das habilidades cognitivas
desenvolvidas espontaneamente por crianas na fase prescolar;
(B) ao conjunto de ideias, crenas e comportamentos noreflexivos de uma pessoa;
(C) diferena entre o nvel de desempenho que uma criana
alcana sozinha e o nvel mais elevado quando est sob
assistncia;
(D) ao desenvolvimento das habilidades de comunicao e
interao social de crianas em fase escolar;
(E) ao monitoramento do progresso no aprendizado motor fino
das crianas ao longo dos anos escolares.

O Estatuto da Criana e do Adolescente (Lei 8.069/90) disciplina


que a medida socioeducativa de internao poder ser aplicada:
I quando se tratar de ato infracional cometido mediante grave
ameaa ou violncia pessoa;
II a critrio do juiz, na anlise das circunstncias determinantes
do ato infracional e da personalidade do adolescente;
III por descumprimento reiterado e injustificvel da medida
anteriormente imposta.
A(s) afirmativa(s) correta(s) (so):
(A) apenas I;
(B) apenas II;
(C) apenas I e II;
(D) apenas I e III;
(E) I, II e III.

56
As pesquisas desenvolvidas por psiclogos sociais em meados do
sculo XX iluminaram aspectos at ento pouco explorados sobre
o comportamento humano quando em interao com outros
indivduos ou em grupo. Os estudos desenvolvidos pelo psiclogo
Stanley Milgram em Yale so ainda muito atuais frente s
questes ticas vivenciadas na contemporaneidade. Sua pesquisa
mais conhecida sobre:
(A) tica organizacional;
(B) conflitos inter-geracionais;
(C) relaes conjugais;
(D) aprendizado escolar;
(E) obedincia autoridade.

59
De acordo com o Estatuto do Idoso (Lei 10.741/03), considera-se
idosa a pessoa com idade:
(A) igual ou superior a 60 (sessenta) anos;
(B) igual ou superior a 65 (sessenta e cinco) anos;
(C) igual ou superior a 70 (setenta) anos;
(D) superior a 60 (sessenta) anos;
(E) superior a 65 (sessenta e cinco) anos.

60
57
De acordo com o preceituado no Estatuto da Criana e do
Adolescente (lei 8.069/90), o Conselho Tutelar :
(A) rgo permanente e vinculado, com competncia
jurisdicional, encarregado pela sociedade de zelar pelo
cumprimento dos direitos da criana e do adolescente;
(B) rgo permanente e autnomo, no jurisdicional,
encarregado pela sociedade de zelar pelo cumprimento dos
direitos da criana e do adolescente;
(C) rgo provisrio e vinculado, com competncia jurisdicional,
encarregado pela sociedade de zelar pelo cumprimento dos
direitos da criana e do adolescente;
(D) rgo provisrio e autnomo, no jurisdicional, encarregado
pela sociedade de zelar pelo cumprimento dos direitos da
criana e do adolescente;
(E) rgo permanente e autnomo, com competncia
jurisdicional, encarregado pela sociedade de zelar pelo
cumprimento dos direitos da criana e do adolescente.

Psiclogo

O Estatuto do Idoso (Lei 10.741/03) assegura o benefcio de 1


(um) salrio-mnimo mensal, nos termos da LOAS, ao idoso a
partir de:
(A) 60 (sessenta) anos;
(B) 60 (sessenta) anos que no possua meios para prover a sua
subsistncia;
(C) 60 (sessenta) anos cuja subsistncia no possa ser provida
por sua famlia;
(D) 70 (setenta) anos cuja subsistncia no possa ser provida por
sua famlia;
(E) 65 (sessenta e cinco) anos que no possua meios para
prover a sua subsistncia, nem t-la provida por sua famlia.

Tipo 1 Cor BRANCA Pgina 13

PROVA: PREFEITURA DE OSASCO


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: FGV

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

31
32
33
34
35
36
37
38
39
40
41
42
43
44
45

D
A
A
D
E
X
D
B
D
D
D
C
A
A
D

46
47
48
49
50
51
52
53
54
55
56
57
58
59
60

B
B
B
D
B
C
E
C
D
D
E
E
B
B
E

Coletnea de Provas | Concursos de Psicologia

Tribunal de Justia do Estado de Gois


Concurso Pblico 2014
Prova escrita objetiva e discursiva Nvel Superior

Analista Judicirio - rea


Especializada - Psiclogo
TIPO 1 BRANCA
Informaes Gerais
1. Voc receber do fiscal de sala:
a) uma folha de respostas destinada marcao das respostas
das questes objetivas e a folha de texto definitivo da
redao;
b) esse caderno de prova contendo 50 questes objetivas,
cada qual com 5 (cinco) alternativas de respostas (A, B, C, D
e E) e o tema da redao;
2. Verifique se seu caderno est completo, sem repetio de
questes ou falhas. Caso contrrio, notifique imediatamente o
fiscal de sala para que sejam tomadas as devidas providncias.
3. As questes objetivas so identificadas pelo nmero situado
acima do seu enunciado.
4. Ao receber a folha de respostas da prova objetiva voc deve:
a) conferir seus dados pessoais, em especial seu nome,
nmero de inscrio e o nmero do documento de
identidade;
b) ler atentamente as instrues para o preenchimento da
folha de respostas;
c) marcar na folha de respostas da prova objetiva o campo
relativo confirmao do tipo/cor de prova, conforme o
caderno que voc recebeu;
d) assinar seu nome, apenas nos espaos reservados, com
caneta esferogrfica de tinta azul ou preta.
5. Durante a aplicao da prova no ser permitido:
a) qualquer tipo de comunicao entre os candidatos;
b) levantar da cadeira sem a devida autorizao do fiscal de
sala;
c) portar aparelhos eletrnicos, tais como bipe, telefone
celular, agenda eletrnica, notebook, palmtop, receptor,
gravador, mquina de calcular, mquina fotogrfica digital,
controle de alarme de carro etc., bem como relgio de
qualquer modelo, culos escuros ou quaisquer acessrios
de chapelaria, tais como chapu, bon, gorro etc. e, ainda,
lpis, lapiseira (grafite), corretor lquido e/ou borracha. Tal
infrao poder acarretar a eliminao sumria do
candidato.

6. O preenchimento das respostas da prova objetiva, de inteira


responsabilidade do candidato, dever ser feito com caneta
esferogrfica de tinta indelvel de cor preta ou azul. No ser
permitida a troca da folha de respostas por erro do candidato.
7. O tempo disponvel para a realizao da prova de
4 (quatro) horas, j includo o tempo para a marcao da folha
de respostas da prova objetiva e de elaborao do texto
definitivo da redao.
8. Reserve tempo suficiente para o preenchimento de suas
respostas. Para fins de avaliao, sero levadas em
considerao apenas as marcaes realizadas na folha de
respostas da prova objetiva, no sendo permitido anotar
informaes relativas s suas respostas em qualquer outro
meio que no seja o prprio caderno de provas.
9. Somente aps decorrida uma hora do incio da prova voc
poder retirar-se da sala de prova sem, contudo, levar o
caderno de provas.
10. Somente no decorrer dos ltimos sessenta minutos do perodo
da prova, voc poder retirar-se da sala levando o caderno de
provas.
11. Ao terminar a prova, entregue a folha de respostas ao fiscal da
sala, a folha de texto definitivo da redao e deixe o local de
prova. Caso voc se negue a entregar, ser eliminado do
concurso.
12. A FGV realizar a coleta da impresso digital dos candidatos na
folha de respostas.
13. Os candidatos podero ser submetidos a sistema de deteco
de metais quando do ingresso e da sada de sanitrios durante
a realizao das provas. Ao sair da sala, ao trmino da prova, o
candidato no poder usar o sanitrio.
14. Os gabaritos preliminares das provas objetivas sero
divulgados no dia 20/10/2014, no endereo eletrnico
www.fgv.br/fgvprojetos/concursos/tjgo14.
15. O prazo para interposio de recursos contra os gabaritos
preliminares ser de 0h do dia 21/10/2014 at as 23h59 do dia
22/10/2014, observado o horrio oficial, no endereo
www.fgv.br/fgvprojetos/concursos/tjgo14, por meio do Sistema
Eletrnico de Interposio de Recurso.

Tribunal de Justia do Estado de Gois

FGV Projetos

Conhecimentos Especficos
26
Durante dcadas, as leis brasileiras partiram da pressuposio de
que os cuidados infantis eram atributos naturais da mulher,
relegando ao pai o papel de visitante em caso de divrcio ou
separao do casal. Tal concepo modificou-se em vista do
interesse crescente dos homens em participar dos cuidados
infantis, e do direito da criana e do adolescente convivncia
familiar. A Lei n 11.698, de 2008, celebra essa transformao,
sendo conhecida tambm como:
(A) lei do divrcio;
(B) lei da paternidade;
(C) carta magna;
(D) estatuto da criana e do adolescente;
(E) lei da guarda compartilhada.

27
Richard Gardner conhecido por nomear uma sndrome na qual
a criana programada a odiar o genitor sem qualquer
justificativa, sofrendo com a campanha difamatria dirigida por
algum que exerce forte influncia sobre ela. O termo criado por
ele chama-se sndrome de:
(A) burnout;
(B) alienao parental;
(C) transtorno desafiador de oposio;
(D) mnchausen;
(E) estocolmo.

28
Franoise Dolto, conhecida psicanalista francesa, ressalta em
diversos livros a importncia de dirigir a palavra criana
enquanto sujeito de desejo, marcado pela linguagem e, logo, pela
lei da castrao. No contexto de separao dos pais, ela
recomenda escutar a criana na perspectiva de:
(A) consider-la membro da famlia, logo, possuidora de deveres
filiais;
(B) sugerir que ela decida com quem deseja ficar, logo,
atendendo a sua condio de sujeito de direitos;
(C) obter subsdios para a deciso judicial, logo, orientando a
concluso das avaliaes psicolgicas;
(D) induzi-la a expressar seus sentimentos, logo, considerando a
separao entre lei e desejo;
(E) consider-la objeto das leis menoristas, logo, subordinada ao
Estado.

29
Segundo a psicanlise, podemos conceber a constituio do eu
(moi) como unidade psquica, correlativamente constituio do
esquema
corporal
na
qual
a
criana
se
identifica com a imagem do semelhante. J. Lacan relacionou esse
primeiro momento da formao do eu com a experincia
narcsica fundamental designada como:
(A) complexo fraterno;
(B) estdio do espelho;
(C) metfora paterna;
(D) complexo do desmame;
(E) dialtica flica.

Analista Judicirio - rea Especializada - Psiclogo

Tipo 1 Cor BRANCA Pgina 6

Tribunal de Justia do Estado de Gois

FGV Projetos

30

33

Com o advento das sociedades disciplinares, a priso desponta


como sendo a punio por excelncia. Contudo, o projeto da
tcnica corretiva que acompanhou a lgica da deteno punitiva
simultneo crtica da priso e de seus mtodos. Assim,
segundo Foucault, a promessa de regenerar o apenado atravs
do encarceramento corresponde a uma utopia fracassada, haja
vista a priso:
(A) reduzir a criminalidade sem modificar a desigualdade social;
(B) ficar subordinada autoridade da figura do juiz penal;
(C) objetivar a delinquncia e consolid-la no fluxo das
ilegalidades;
(D) combater o trfico de drogas e reduzir a prostituio;
(E) atender aos anseios da classe burguesa frente ao
proletariado.

A Resoluo CFP N 007/2003 institui o Manual de Elaborao de


Documentos Escritos produzidos pelo psiclogo, decorrentes de
avaliao psicolgica, tendo como objetivo orientar o profissional
na confeco de documentos e fornecer os subsdios ticos e
tcnicos necessrios para a elaborao qualificada da
comunicao escrita. Nela, encontram-se as finalidades distintas
entre relatrio e parecer, sendo que:
(A) o primeiro visa a informar a ocorrncia de fatos ou situaes
objetivas relacionados ao atendimento psicolgico, e o
segundo visa a relatar sobre o encaminhamento, as
intervenes, o diagnstico, o prognstico e a evoluo do
caso;
(B) o primeiro visa a apresentar os procedimentos e concluses
gerados pelo processo da avaliao psicolgica, e o segundo
visa a declarar o acompanhamento psicolgico do atendido e
as informaes sobre as condies do atendimento;
(C) o primeiro visa a fundamentar sobre uma questo focal do
campo psicolgico cujo resultado pode ser indicativo ou
conclusivo, e o segundo visa a fornecer as informaes
necessrias relacionadas demanda, solicitao ou petio;
(D) o primeiro visa a relatar sobre o encaminhamento, as
intervenes, o diagnstico, o prognstico e a evoluo do
caso, e o segundo, fornecer esclarecimento, de forma focal,
sobre orientao e sugesto de projeto teraputico;
(E) o primeiro visa a apresentar os procedimentos e concluses
gerados pelo processo da avaliao psicolgica, e o segundo
visa a apresentar resposta esclarecedora de uma questo
problema, visando a dirimir dvidas que esto interferindo na
deciso.

31
Ao receber as pessoas encaminhadas para serem avaliadas, por
determinao judicial, o psiclogo percebeu que uma delas foi
seu chefe na instituio onde trabalhou antes de ingressar no
tribunal. O psiclogo:
(A) poder realizar a avaliao psicolgica, j que no existe mais
vnculo com tal pessoa;
(B) poder realizar a avaliao psicolgica, caso no possua
vnculos pessoais com tal pessoa;
(C) dever realizar a avaliao psicolgica, sob risco de
descumprir a determinao judicial;
(D) no poder realizar a avaliao psicolgica, haja vista os
vnculos pessoais ou profissionais poderem afetar o trabalho;
(E) no poder realizar a avaliao psicolgica, tendo em vista a
relao hierrquica anterior entre ele e a pessoa.

32
A Resoluo CFP n 008/2010 foi criada com o objetivo de dispor
sobre a atuao do psiclogo como perito e assistente tcnico no
Poder Judicirio. Segundo tal documento:
(A) o psiclogo assistente tcnico pode estar presente durante a
realizao dos procedimentos metodolgicos que norteiam o
atendimento do psiclogo perito, sendo vedado o contrrio;
(B) a relao entre os profissionais deve se pautar no respeito e
colaborao, cada qual exercendo suas competncias, sendo
vedado ao assistente tcnico formular quesitos ao psiclogo
perito;
(C) o trabalho pericial poder contemplar observaes,
entrevistas, aplicao de testes psicolgicos, utilizao de
recursos ldicos e outros instrumentos, excetuando-se visitas
domiciliares e institucionais, devendo estas serem feitas de
forma interdisciplinar;
(D) em seu relatrio, o psiclogo perito apresentar indicativos
pertinentes sua investigao que possam diretamente
subsidiar o Juiz na solicitao realizada, reconhecendo os
limites legais de sua atuao profissional, sem adentrar as
decises, atribuio exclusiva dos magistrados;
(E) vedado ao psiclogo que esteja atuando como
psicoterapeuta das partes envolvidas em um litgio atuar
como perito, no havendo impedimento para o assistente
tcnico, desde que no interfira na qualidade e na dinmica
do servio realizado.

Analista Judicirio - rea Especializada - Psiclogo

34
Michel Foucault identificou, pela anlise genealgica, as prticas
jurdicas como uma das mais importantes na emergncia das
formas modernas de subjetividade. Esse autor prope o
reconhecimento das identidades como:
(A) essncias subjetivas que se articulam introspeco e
complexidades internas;
(B) produes histricas que se constituem pela imbricao e
agenciamento de prticas mltiplas;
(C) expresso do funcionamento cerebral e herana gentica que
definiro o eu;
(D) expresso comportamental do aprendizado interativo com os
meios ambientes interno e externo;
(E) instrumento para ao cognitiva dos indivduos inseridos em
grupos familiares, escolares e sociais.

Tipo 1 Cor BRANCA Pgina 7

Tribunal de Justia do Estado de Gois

FGV Projetos

35

38

Apesar de crticas, no universo das Varas de Famlia, a percia


psicolgica ainda uma das estratgias mais utilizadas pelos
juzes nos casos de separao litigiosa com disputa pela guarda
dos filhos. Nesses processos a solicitao da percia define-se
primordialmente por:
(A) mediar os conflitos intra-familiares, buscando estabelecer
estratgias de comunicao mais positivas entre os membros
do crculo familiar;
(B) avaliar o nvel de conflito e suas consequncias para as
crianas, encaminhando os componentes do processo para a
rede teraputica;
(C) atribuir a responsabilidade de cada parte na dissoluo da
relao conjugal, considerando favoravelmente a concesso
da guarda ao cnjuge no culpado pelo trmino da unio;
(D) formular laudos que expressem a verdade sobre os sujeitos
envolvidos, sancionando as condutas imorais e/ou perigosas
que possam vir a ser cometidas contra as crianas;
(E) fornecer subsdios para a deciso judicial, por meio da
resposta aos quesitos formulados no processo, o que pode
caracterizar um dos genitores como o melhor para o exerccio
da guarda.

De acordo com o Relatrio Mundial sobre Violncia e Sade, em


48 pesquisas realizadas com populaes de todo o mundo, de
10% a 69% das mulheres relataram ter sofrido agresso fsica por
um parceiro ntimo em alguma ocasio de sua vida.
(Organizao Mundial de Sade. Relatrio mundial sobre
violncia e sade apud MORGADO, Rosana. Mulheres em
situao de violncia domstica In Brando, Eduardo &
Gonalves, Hebe. Psicologia Jurdica no Brasil. Rio de Janeiro:
Nau, 2011).

36
Recentes mudanas no Estatuto da Criana e do Adolescente
modificaram a sistemtica de adoo no Brasil, como a necessria
participao dos postulantes adoo em grupos reflexivos ou a
criao do Cadastro Nacional de Adoo. Com relao ao papel
das equipes tcnicas nesse processo, correto afirmar que:
(A) auxiliam os pais a compreender a importncia da revelao,
trabalhando elementos que facilitem esse momento;
(B) agenciam a chegada das crianas para os habilitados,
considerando a disponibilidade em viajar para outros estados;
(C) orientam mensalmente a rede de apoio escolar sobre a
chegada dos filhos adotivos;
(D) classificam os atributos desejveis nas crianas acolhidas,
incentivando condutas na interao com os postulantes;
(E) informam sobre os direitos do adotante, inclusive sobre o
direito de conhecer a famlia biolgica e de manter contato.

37
A negligncia significa a omisso de cuidados bsicos, como a
privao de medicamentos, a falta de atendimento aos cuidados
necessrios com a sade, a ausncia de proteo contra as
inclemncias do meio como o frio e o calor e o no provimento
de estmulos e condies de frequncia escola. (Notificao de
maus tratos contra crianas e adolescentes pelos profissionais de
sade. BRASIL: Ministrio da Sade, 2002).
A definio de negligncia proposta pelo Ministrio da Sade faz
com que se possa questionar a diferena entre pobreza e
negligncia, sendo considerado pobreza quando o grau de
privao incide:
(A) sobre um dos filhos;
(B) sobre todos os filhos no genticos;
(C) apenas sobre os filhos adolescentes;
(D) sobre toda a famlia;
(E) sobre alguns membros da famlia.

Analista Judicirio - rea Especializada - Psiclogo

So fatores que se articulam ao fenmeno da violncia contra a


mulher:
(A) a responsabilidade da mulher que no rompe o
relacionamento com o agressor, a baixa autoestima das
mulheres e a banalizao da violncia domstica;
(B) a dependncia econmica das mulheres, a existncia de filhos
que necessitam do pai e a falta de assistncia de uma rede de
assistncia s vtimas;
(C) a convivncia prolongada com relaes de violncia, a
legitimao social para sua perpetuao e a formao de uma
identidade de gnero subordinada;
(D) a ausncia de polticas pblicas articuladas sobre o tema, o
temor pelo perigo real de morte na ruptura e a conivncia
das prprias vtimas;
(E) a complacncia social com o fenmeno, os baixos ndices de
punio dos acusados e o empoderamento das vtimas pela
proteo recebida de suas famlias consanguneas.

39
conhecido que, antes da promulgao do Estatuto da Criana e
do Adolescente, ainda sob a gide do ltimo Cdigo de Menores,
os laudos psicolgicos eram atravessados pela busca de
patologias individuais que justificassem as medidas a serem
aplicadas. Atualmente, entretanto, as intervenes psicolgicas
buscam se pautar na garantia dos direitos das crianas e
adolescentes, tal como preconizado pelo ECA e pela prpria
Constituio vigente.
Com base nesses argumentos, as intervenes psicolgicas que
se buscam construir eticamente em Varas de Infncia e
Juventude nesse momento so:
(A) laudos periciais da personalidade de casais ou solteiros
postulantes adoo;
(B) diagnsticos de periculosidade e reincidncia de adolescentes
infratores;
(C) avaliaes psicopatolgicas de crianas e adolescentes
acolhidos;
(D) grupos reflexivos com os pais de adolescentes infratores e
com os prprios jovens;
(E) laudos avaliativos das famlias desestruturadas que tiverem
filhos acolhidos.

40
Jacob Lvy Moreno terico bastante conhecido por seus
estudos em psicologia social e por ser o criador:
(A) da psicologia dos jogos;
(B) da psicologia analtica;
(C) do psicodrama;
(D) da psicologia simblica;
(E) do gestaltismo.

Tipo 1 Cor BRANCA Pgina 8

Tribunal de Justia do Estado de Gois

FGV Projetos

41

44

O economista R. V., 38 anos, chamou a polcia aps flagrar uma


me batendo no filho na ltima quarta-feira (21). O menino nem
viu de onde veio a palmada, ficou assustado e parecia muito
humilhado. Ficou um bom tempo com a mo no rosto, lamentou
o economista que denunciou o caso. O barulho do tapa foi
escutado do outro lado da rua pelo vigia que fazia a segurana do
restaurante.
De acordo com a chamada Lei da Palmada:
(A) o uso do castigo corporal vedado aos pais, salvo como
forma de disciplina e correo de seus filhos;
(B) indicado o acolhimento institucional da criana para
proteg-la da violncia intrafamiliar;
(C) o conselho tutelar poder aplicar me a medida de
encaminhamento a tratamento psicolgico ou psiquitrico;
(D) ningum est autorizado a interferir nos mtodos educativos
dos genitores ou responsveis pela criana;
(E) s cabe sano me da criana se do castigo resultarem
marcas fsicas ou leso incapacitante.

O Sr. Joo Silva, 66 anos, foi denunciado por fazer uma ligao
clandestina de gua no condomnio em que sndico.
Considerando a legislao no que concerne s pessoas com idade
igual ou superior a 60 (sessenta) anos, o Sr. Joo Silva ser:
(A) inimputvel em funo de sua idade;
(B) semi-imputvel em funo de sua idade;
(C) passvel de interdio judicial;
(D) capaz de responder por seus atos;
(E) sentenciado a medida socioeducativa.

42
Crianas criadas na primeira infncia em instituies onde so
totalmente privadas da me e onde os cuidados so dispensados
de forma annima e sem o estabelecimento de um lao afetivo
desenvolvem distrbios graves denominados pelo psicanalista
Ren Spitz de Hospitalismo, cujas caractersticas so:
(A) depresso anacltica e atraso no desenvolvimento corporal;
(B) atraso na linguagem e precoce adaptao ao meio;
(C) apatia e menor resistncia s doenas;
(D) desenvolvimento de um falso self e psicose;
(E) splitting do ego e deficincia mental.

43
Aps sofrer um assalto mo armada dentro de um nibus, a
professora Mariana passou a apresentar sintomas que
perduraram por meses seguidos, impedindo seu retorno para a
escola onde lecionava. Considerando o quadro apresentado por
Mariana, correto afirmar que:
(A) alucinaes auditivas de contedo persecutrio so sintomas
caractersticos do transtorno de estresse ps-traumtico;
(B) a reatividade fisiolgica na exposio a indcios externos que
lembram algum aspecto do evento traumtico uma forma
de reviver o trauma;
(C) acontecimentos estressores especialmente traumticos so
condies necessrias e suficientes para o desenvolvimento
da sndrome do pnico;
(D) a ansiedade antecipatria com relao s lembranas do
evento traumtico conhecida como flashback;
(E) Mariana desenvolveu um quadro disfuncional de fobia social
que pode se tornar incapacitante do ponto de vista
profissional.

Analista Judicirio - rea Especializada - Psiclogo

45
O consumo inadequado do lcool um importante problema de
sade pblica, acarretando custos para a sociedade e envolvendo
questes mdicas, psicolgicas, profissionais e familiares, com
significativas repercusses judiciais.
Considerando os vrios aspectos envolvidos nesse problema,
pode-se afirmar que:
(A) a preveno terciria tem como objetivo retardar o incio do
uso de lcool ou evitar que ele se instale na populao de
terceira idade;
(B) a venda de bebidas alcolicas a crianas expressamente
proibida pela legislao, sendo a venda a adolescentes
condicionada autorizao e superviso dos pais ou
responsvel;
(C) a dependncia de lcool na gravidez pode resultar no
nascimento de bebs afetados pela sndrome do alcoolismo
fetal, com sequelas no desenvolvimento fsico e mental;
(D) a sndrome de abstinncia do lcool faz parte das estratgias
de reduo de danos, que preconizam a oferta de incentivos
aos usurios que adotam os Doze Passos do AA;
(E) os efeitos estimulantes da ingesto de lcool, como euforia,
desinibio e loquacidade, so benficos no tratamento de
quadros mais benignos de depresso e ansiedade.

46
H oito anos, em 07 de agosto de 2006, era aprovada a Lei n
11.340, conhecida nacionalmente como Lei Maria da Penha. O
instrumento legal foi um passo importante para o enfrentamento
da violncia contra a mulher, alterando o Cdigo Penal em favor
daquelas vtimas de violncia.
Quanto s formas de violncia contra a mulher de acordo com a
lei, analise os itens a seguir:
I a difamao por mdia virtual;
II a proibio de usar mtodos contraceptivos;
III a destruio de documentos pessoais;
IV o crcere privado;
V a agresso fsica por companheira em relao homoafetiva.
O(s) item(ns) correto(s) /so:
(A) somente II;
(B) somente I, II e IV;
(C) somente I, III e V;
(D) somente IV e V;
(E) I, II, III, IV e V.

Tipo 1 Cor BRANCA Pgina 9

Tribunal de Justia do Estado de Gois

47
Sobre o dever dos filhos maiores com relao aos pais, o
entendimento legal de que:
(A) os filhos maiores tm o dever de ajudar e amparar os pais na
velhice, carncia ou enfermidade;
(B) a maioridade extingue o dever familiar, sendo deciso
pessoal a assistncia aos pais;
(C) apenas nas hipteses de curatela e tutela ficam os filhos
obrigados a garantir o sustento dos pais;
(D) a obrigao dos pais com relao aos filhos legalmente
reconhecidos imprescritvel, no cabendo obrigao
inversa;
(E) apenas idosos sem laos familiares so objeto da proteo
legal e devero ser amparados pelo Estado.

48
O ecstasy uma substncia alucingena ilcita cujo uso
frequentemente associado a certos grupos, como os jovens
frequentadores de raves. Os usurios relatam sensao de bem
estar, alerta e euforia, porm h relatos de mortes pelo uso
abusivo dessa substncia causadas por:
(A) distores perceptivas;
(B) hipopirexia maligna;
(C) bradicardia;
(D) delrios persecutrios;
(E) hipertermia maligna.

FGV Projetos

Tema da redao:
Uma caracterstica evidente dos cartuns com psiclogos a
absoluta vinculao com a psicanlise. O div onipresente e no
so raras referncias diretas a Freud e teoria psicanaltica. E
mais: a despeito de grande parte dos profissionais, pelo menos
no Brasil, serem mulheres, os homens dominam os cartuns,
sendo normalmente caracterizados com barba e culos,
imagem e semelhana do "Pai" Freud. Comumente retratados
como seres frios e distantes, quando no sonolentos ou
displicentes, os psiclogos se limitam a escutar o sofrimento dos
pacientes, permanecendo sentados, de pernas cruzadas,
estticos e impassveis, com suas canetas e blocos de anotao
na mo - ou ento com placas do teste Rorschach. Quando falam,
limitam-se a fazer perguntas bvias, dar diagnsticos ("Voc
bipolar") ou, ento, algum conselho ou prescrio do tipo "faa
isso, faa aquilo" para os pacientes. Sua autoridade evidenciada
pelos onipresentes diplomas, sempre pendurados na parede do
consultrio. No entanto, apesar de posarem de sabe-tudo so,
algumas vezes, representados como inseguros, mal-resolvidos e
at mesmo "loucos", tal qual seus prprios pacientes.

49
A literatura mdica registra uma forma grave, rara e de difcil
deteco de abuso infantil, em que o responsvel, normalmente
a me, de modo persistente ou intermitente simula de forma
intencional sintomas em seu filho ou provoca ativamente
doenas, colocando-o em risco e numa situao que requer
constante investigao e tratamento. Essa condio
reconhecida como um transtorno psiquitrico denominado:
(A) hipocondria;
(B) transtorno somatoforme;
(C) histeria de converso;
(D) sndrome de munchausen por procurao;
(E) transtorno de personalidade histrinica.

50
Aps o falecimento de Cassia Eller, o pai da cantora e a
companheira dela, Maria Eugnia, travaram uma batalha judicial
pela tutela do filho de Cassia, o menino Chico, que era criado
pela me e pela companheira. A deciso final favorvel a Maria
Eugnia pode ser analisada como:
(A) um desdobramento do reconhecimento pelo Superior
Tribunal de Justia da unio estvel entre pessoas do mesmo
sexo;
(B) a legitimao de relaes informalmente construdas sob o
paradigma do arranjo familiar conhecido por famlia mosaico;
(C) uma violao ao direito da criana de, na falta de seus
genitores, ficar aos cuidados de sua famlia extensa;
(D) uma comprovao de que a guarda compartilhada o arranjo
que melhor atende s necessidades afetivas e materiais da
criana;
(E) uma confirmao da valorizao do afeto como bem jurdico
e elemento constitutivo de relaes familiares.

Analista Judicirio - rea Especializada - Psiclogo

Que viso tem a sociedade brasileira dos profissionais da


Psicologia?
Explique qual essa viso, identificando os fatores que a
produzem, por meio de um texto dissertativo-argumentativo,
com nmero mnimo de 20 (vinte) e mximo de 30 (trinta) linhas,
redigido em linguagem culta.

Tipo 1 Cor BRANCA Pgina 10

PROVA: TJ - GO
ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: FGV

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

E
B
A
B
C
D
D
E
B
E
A
D
C

39
40
41
42
43
44
45
46
47
48
49
50

D
C
C
C
B
D
C
E
A
E
D
E

Coletnea de Provas | Concursos de Psicologia

ESTADO DO ACRE
SECRETARIA DE ESTADO DA GESTO ADMINISTRATIVA
SECRETARIA DE ESTADO DE SADE

CONCURSO PBLICO para o cargos de

Psiclogo

P
Verifique se esta
LETRA a mesma
do seu Carto
de Respostas.

PROVA

S16

DE ACORDO COM O EDITAL, O


CANDIDATO QUE FIZER PROVA
DE LETRA DIFERENTE SER
ELIMINADO.

MANH

TRANSCREVA, EM ESPAO DETERMINADO NO SEU CARTO DE RESPOSTAS, A FRASE


DO ESCRITOR JOS SARAMAGO PARA EXAME GRAFOTCNICO.
O homem deixou de respeitar a si mesmo quando perdeu o respeito por seu semelhante.

ATENO
DURAO DA PROVA: 5 horas.
ESTE CADERNO CONTM 80 (OITENTA) QUESTES
DE MLTIPLA ESCOLHA, CADA UMA COM 5 ALTERNATIVAS DE
RESPOSTA A, B, C, D e E CONFORME DISPOSIO ABAIXO.

Quantidade de
questes

Valor de cada
questo

Lngua Portuguesa

tica e Legislao na Administrao Pblica

10

Histria e Geografia do Acre

Conhecimentos de Sade Pblica

20

Conhecimentos Especficos

40

Disciplinas

VERIFIQUE SE ESTE MATERIAL EST EM ORDEM, CASO


CONTRRIO, NOTIFIQUE IMEDIATAMENTE O FISCAL.

RESERVE OS 30 (TRINTA) MINUTOS FINAIS


PARA MARCAR SEU CARTO DE RESPOSTAS.

BOA PROVA!
www.funcab.org

CONHECIMENTOS ESPECFICOS
Questo 41
A classe trabalhadora compreendida,
corretamente, como a totalidade dos assalariados
que vivem da venda:
A)
B)
C)
D)
E)

da autonomia.
do capital.
da fora de trabalho.
dos meios de produo.
do proletariado.

Questo 42
Uma das consequncias da reestruturao produtiva
do capital :
A)
B)
C)
D)
E)

reduo do setor de servios.


aumento da oferta de trabalho aos idosos.
aumento da oferta de trabalho aos jovens.
reduo do trabalho feminino.
reduo do conjunto de trabalhadores estveis.

Questo 43
Atualmente, percebe-se uma expanso do trabalho
chamado terceiro setor. Quais so suas
caractersticas principais?
A) Empresas assistenciais, sem fins lucrativos que
se desenvolvem margem do mercado.
B) Empresas pblicas, sem fins lucrativos, voltadas
ao mercado.
C) Empresas de economia mista, com fins lucrativos
que se desenvolvem margem do mercado.
D) Empresas privadas, sem fins lucrativos, internas
ao mercado.
E) Empresas assistenciais, com fins lucrativos,
alternativas ao mercado.

Questo 44
[...] a constatao de que os indivduos desenvolvem
mecanismos de defesa individuais e coletivos para
fazer frente ao sofrimento e aos constrangimentos
ligados ao trabalho (LANCMAN, S. & UCHIDA, S., 2003,
p. 88), uma importante descoberta de qual autor?
A)
B)
C)
D)
E)

08

Sigmund Freud
Abraham H. Maslow
Elton Mayo
Christophe Dejours
Frederick Herzberg

FUNCAB - Fundao Professor Carlos Augusto Bittencourt

Questo 45

Questo 48

De acordo com o modelo geral de interveno para


lidar com o estresse no trabalho, as aes podem ser
primrias, secundrias e tercirias, conforme
apresentadas na coluna I. Estabelea a correta
correspondncia com suas respectivas definies
indicadas na coluna II.

A elaborao de um projeto de Qualidade de Vida no


Trabalho (QVT) deve levar em conta um enfoque:
A)
B)
C)
D)
E)

Coluna I
1. Primria
2. Secundria
3. Terciria

Questo 49
No Brasil, a insero do psiclogo na sade pblica
se deu atravs de qual campo?

Coluna II

A)
B)
C)
D)
E)

( ) Reduo das consequncias de longo prazo do


estresse
( ) Reduo dos estressores no trabalho
( ) Reduo de estresse, burnout, etc
A sequncia correta :
A)
B)
C)
D)
E)

1, 3, 2.
3, 1, 2.
2, 1, 3.
2, 3, 1.
3, 2, 1.

[...] arranjos organizativos de aes e servios de


sade, de diferentes densidades tecnolgicas, que
integradas por meio de sistemas de apoio tcnico,
logstico e de gesto, buscam garantir a integralidade
do cuidado. (Ministrio da Sade, 2010 portaria n 4.279, de
30/12/2010). O fragmento apresenta a definio de:
A)
B)
C)
D)
E)

A corrente franco-belga da Ergonomia da Atividade,


props uma inverso no paradigma taylorista.
Marque a alternativa que apresenta corretamente o
princpio geral da Ergonomia da Atividade.
Adaptar o trabalho a quem trabalha.
Estudar o clima organizacional.
Implementar a Gesto de Pessoas.
Ajustar o homem ao trabalho.
Organizar as rotinas de trabalho.

Comisso Intergestores Tripartite.


Redes de Ateno Sade.
Centro de Ateno Psicossocial.
Estratgia Sade da Famlia.
Programa de Agentes Comunitrios de Sade.

Questo 51
Qual o objetivo da Poltica de Humanizao do SUS?
A)
B)
C)
D)
E)

Questo 47
O clima organizacional percebido dentro de uma
organizao atravs do comportamento do(s):
A)
B)
C)
D)
E)

Clnica privada
Laboratrios de Psicologia
Sade mental
Assistncia social
Servios de Psicologia Aplicada

Questo 50

Questo 46

A)
B)
C)
D)
E)

psicossocial.
racionalista.
patolgico.
hierarquizado.
disciplinar.

Hierarquizar a gesto da rede de servios.


Ampliar o Programa Sade da Famlia.
Organizar a vigilncia em sade.
Reestruturar a rede de sade mental.
Descentralizar a gesto da rede de servios.

Questo 52

cliente externo.
gestores.
colaboradores de diferentes empresas.
gestores frente aos desafios do trabalho.
colaboradores.

A..Ateno Primria em Sade tem papel de


destaque na organizao do SUS. No entanto, alguns
desafios se interpem. Marque a alternativa que
indica corretamente quais so esses desafios.
A)
B)
C)
D)
E)
09

Equidade e integralidade
Universalidade e verticalidade
Centralizao e equidade
Verticalidade e centralizao
Universalidade e centralizao
FUNCAB - Fundao Professor Carlos Augusto Bittencourt

Questo 53

Questo 56

Os estudos e prticas da Psicologia no campo do


trabalho emergiram a partir do(a):
A)
B)
C)
D)
E)

As alternativas abaixo apresentam o que vedado ao


psiclogo no exerccio profissional, de acordo com o
artigo 2 do Cdigo de tica Profissional do
Psiclogo, EXCETO:

surgimento da ps-modernidade.
surgimento da sociedade de consumo.
crise mundial do petrleo.
Segunda Guerra Mundial.
surgimento da sociedade industrial.

A) Induzir qualquer pessoa ou organizao a


recorrer a seus servios.
B) Emitir documentos sem fundamentao e
qualidade tcnico-cientfica.
C) Induzir a convices polticas, filosficas, morais,
ideolgicas, religiosas, de orientao sexual,
quando do exerccio de suas funes
profissionais.
D) Prestar servios profissionais em situaes de
calamidade pblica ou de emergncia.
E) Prestar servios ou vincular o ttulo de psiclogo a
servios de atendimento cujos procedimentos no
estejam reconhecidos pela profisso.

Questo 54
A Declarao um dos documentos produzidos por
psiclogos. Marque a alternativa que indica o que
NO pode ser registrado no referido documento.
A)
B)
C)
D)

O acompanhamento psicolgico do atendido.


Sintomas, situaes ou estados psicolgicos.
Informaes sobre as condies do atendimento.
Comparecimento do atendido e/ou
acompanhante.
E) Ocorrncia de fatos ou situaes objetivas
relacionados ao atendimento psicolgico.

Questo 57
[...] implica o emprego de mtodos oriundos das
cincias fsicas e naturais, das matemticas e dos
mais diversos ramos do conhecimento humano.
(CARVALHO, A. M., p. 165, 2010). Essa a definio de:

Questo 55
Em relao aos testes psicolgicos, o parecer
favorvel do SATEPSI indica que o teste:

A)
B)
C)
D)
E)

A) no poder ser utilizado no processo de avaliao


psicolgica.
B) s poder ser utilizado para o ensino do
instrumento.
C) possui um conjunto mnimo de estudos que atesta
sua qualidade.
D) no possui pesquisa com populao brasileira.
E) s poder ser utilizado para o aprimoramento da
pesquisa.

Tecnologia.
Diviso social do trabalho.
autogesto.
Cho-de-fbrica.
Diviso sexual do trabalho.

Questo 58
Qual o objetivo das aes de vigilncia em sade do
trabalhador?
A) Levantar os nveis de absentesmo e desligar os
funcionrios com ndices elevados.
B) Identificar os funcionrios portadores de
sofrimento mental e encaminh-los para a
internao.
C) Controlar as epidemias de doenas no ambiente
de trabalho.
D) Avaliar a capacidade mental dos funcionrios no
desempenho de suas funes.
E) Identificar os riscos sade nos contextos do
trabalho e indicar modificaes visando
preveno.

10

FUNCAB - Fundao Professor Carlos Augusto Bittencourt

Questo 59

Questo 62

As principais teorias sobre motivao no trabalho


esto listadas na coluna I. Estabelea a correta
correspondncia com seus respectivos idealizadores
indicados na coluna II.

Qual a primeira etapa da seleo de pessoal?


A) Realizar a triagem dos candidatos
B) Divulgar o processo seletivo
C) Obteno de informaes relativas ao cargo a ser
preenchido
D) Obteno de informaes sobre os candidatos
E) Elaborar parecer psicolgico sobre os candidatos

Coluna I
1.
2.
3.
4.

Teoria de Hierarquia de Necessidades


Teorias X e Y
Teoria Bifatorial de Motivao-Higiene
Teoria sobre Poder, Aflio e Realizao

Questo 63

Coluna II
(
(
(
(

O processo de recrutamento pode ser dividido em


trs formas. Marque a alternativa que indica
corretamente as trs.

) David McClelland
) Frederik Herzberg
) Abraham H. Maslow
) Douglas McGregor

A)
B)
C)
D)
E)

A sequncia correta :
A)
B)
C)
D)
E)

3, 4, 2, 1.
4, 3, 1, 2.
2, 4, 3, 1.
4, 3, 2, 1.
1, 4, 3, 2.

Questo 64
Misso, viso e valores so elementos que
constituem qual dimenso das organizaes?

Questo 60

A)
B)
C)
D)
E)

Os agravos sade decorrentes de acidentes de


trabalho representam um problema social,
econmico e de sade pblica. No entanto,
pesquisadores da rea apontam um fator que
subdimensiona o problema. Esse fator a:
A)
B)
C)
D)
E)

Espao organizacional
Clima organizacional
Adaptao organizacional
Controle organizacional
Cultura organizacional

Questo 65

psicologizao.
medicalizao.
aposentadoria.
subnotificao.
notificao.

No momento da demisso de um funcionrio,


importante realizar a entrevista de desligamento.
Marque a alternativa que indica a funo desta
entrevista.
A) Oferecer ao funcionrio uma segunda chance.
B) Avaliar mentalmente o funcionrio.
C) Avaliar as competncias do funcionrio para
reaproveit-lo em outra funo.
D) Conhecer as opinies do funcionrio para que a
empresa no tenha prejuzos futuros.
E) Oferecer ao funcionrio a possibilidade de
expressar suas verdadeiras opinies (crticas,
elogios) empresa.

Questo 61
O replanejamento do trabalho uma maneira de
prevenir os agravos sade do trabalhador. O
replanejamento est associado a qual noo?
A)
B)
C)
D)
E)

Interno, externo e global


Interno, externo e misto
Global, 360 e misto
Subjetivo, objetivo e misto
Interno, externo e 360

Negociao
Universalizao
Disciplinarizao
Hierarquizao
Associao

11

FUNCAB - Fundao Professor Carlos Augusto Bittencourt

Questo 66

Questo 71

[...] apreciao sistemtica do desempenho de cada


pessoa no cargo e o seu potencial de
desenvolvimento futuro. (CHIAVENATO, 2009, p. 247).
Essa a definio de:
A)
B)
C)
D)
E)

No que diz respeito ao poder nas organizaes,


pode-se afirmar, de modo geral, que:
A) conflito e cooperao so elementos integrantes
da vida nas organizaes.
B) a cooperao significa a existncia de ideias que
podem chocar-se.
C) a soluo de conflitos impossvel dentro dos
grupos.
D) as empresas devem impedir a organizao
sindical.
E) a avaliao psicolgica tem por funo localizar
os pontos de conflito dentro das
organizaes.

recrutamento de pessoal.
seleo de pessoal.
desenho de cargos.
avaliao de desempenho.
treinamento e desenvolvimento de pessoal.

Questo 67
O treinamento de pessoal pode envolver algumas
mudanas de comportamento. Marque a alternativa
que indica corretamente uma dessas mudanas.
A)
B)
C)
D)
E)

Questo 72
Em que se baseia o clculo do ndice de rotatividade
de pessoal?

Montagem de escala de pontos.


Mudana tecnolgica.
Desenvolvimento de carreiras.
Acompanhamento do mercado.
Desenvolvimento de habilidades.

A) No volume de entrada e sada de pessoal


B) Na conjuntura econmica
C) No volume de candidatos em um processo de
seleo
D) No volume de desligamentos
E) Na poltica salarial da organizao

Questo 68
AAnlise Organizacional envolve o estudo:
A)
B)
C)
D)
E)

dos indivduos dentro da empresa.


da reestruturao produtiva.
da empresa como um todo.
do setor de RH.
das estratgias de marketing de uma empresa.

Questo 73
A rotatividade de pessoal envolve custos primrios,
secundrios e tercirios. Marque a alternativa que
NO indica um custo primrio.
A)
B)
C)
D)
E)

Questo 69
So muitos os meios de realizar o levantamento de
necessidades de treinamento. Marque a alternativa
que indica corretamente um deles.
A)
B)
C)
D)
E)

Custo de recrutamento de seleo.


Custo de integrao.
Custo extraoperacional.
Custo de registro e documentao.
Custo de desligamento.

Modificao do trabalho.
Contribuies dos grupos de trabalho.
Recompensas salariais.
Hierarquia das necessidades.
Satisfao pessoal.

Questo 70
Qual o nome do procedimento no qual a organizao
estimula os empregados a pedir por sua prpria
iniciativa o desligamento?
A)
B)
C)
D)
E)

Poltica de demisso seletiva.


Plano de demisso voluntria.
Outplacement.
Reestruturao produtiva.
Plano de aposentadoria.
12

FUNCAB - Fundao Professor Carlos Augusto Bittencourt

Questo 77

Questo 74
O trabalho das pessoas nas organizaes
influenciado por trs grupos de condies, conforme
apresentados na coluna I. Estabelea a correta
correspondncia com suas respectivas definies
indicadas na coluna II.

De acordo com o Cdigo de tica Profissional do


Psiclogo, a suspenso temporria do exerccio
profissional pode ser aplicada como penalidade. O
Conselho Profissional pode manter essa pena por
at:

Coluna I

A)
B)
C)
D)
E)

1. Condies ambientais de trabalho


2. Condies de tempo
3. Condies sociais
Coluna II

15 dias.
45 dias.
60 dias.
30 dias.
25 dias.

Questo 78

( ) Durao da jornada, horas extras, perodos de


descanso, etc.
( ) Iluminao, temperatura, rudo, etc.
( ) Organizao informal, relacionamentos, status,
etc.

De acordo com o Cdigo de tica do Psiclogo, o


psiclogo, na realizao de estudos, pesquisas e
atividades voltadas para a produo de
conhecimento, dever: Marque a alternativa
INCORRETA.

A sequncia correta :

A) Avaliar os riscos envolvidos.


B) Garantir o carter voluntrio da participao dos
envolvidos.
C) Garantir o anonimato das pessoas.
D) Garantir o acesso dos envolvidos aos resultados
da pesquisa.
E) Prestar servios a organizaes concorrentes.

A)
B)
C)
D)
E)

1, 2, 3.
3, 2, 1.
2, 1, 3.
2, 3, 1.
1, 3, 2.

Questo 75

Questo 79

Uma das causas dos acidentes de trabalho o ato


inseguro. Marque a alternativa que o define
corretamente.

Qual a funo dos programas de bem-estar nas


organizaes?
A) So voltados para os clientes.
B) Tm como objetivo as aes curativas.
C) Servem para mapear os riscos de acidentes no
trabalho.
D) Provocam problemas de sade nos funcionrios.
E) Tm como objetivo avaliar o desenvolvimento dos
funcionrios.

A) a forma de contato entre o agente do acidente e


o acidentado.
B) o objeto ou substncia relacionados leso
como a prensa, a ferramenta, etc.
C) a violao de procedimento aceito como seguro.
D) a condio fsica ou mecnica existente no
local.
E) o custo direto do acidente de trabalho.

Questo 80
So vrios os processos de avaliao do
desempenho, marque a alternativa que indica
corretamente a principal caracterstica dos
processos de aplicar pessoas.

Questo 76
Um plano de segurana no trabalho deve envolver a
preveno de roubos. Marque a alternativa que NO
indica uma ao de preveno de roubos.
A)
B)
C)
D)
E)

A) base para o inventrio de habilidades para a


construo de um banco de talentos.
B) Indica o desempenho e os resultados alcanados
por cada um.
C) Indica os pontos fortes e fracos de cada pessoa.
D) Proporciona informao sobre como as pessoas
esto identificadas com seus cargos e tarefas.
E) Indica se as pessoas esto sendo motivadas e
recompensadas pela organizao.

Controle de entrada e sada de pessoal


Seguro contra riscos fortuitos
Controle de entrada e sada de veculos
Controles contbeis
Registro de mquinas e equipamentos

13

FUNCAB - Fundao Professor Carlos Augusto Bittencourt

PROVA: SESACRE
ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: FUNCAB

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60

C
E
A
D
B
A
E
A
C
B
E
D
E
B
C
D
A
E
B
D

61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80

A
C
B
E
E
D
E
C
A
B
A
A
C
C
C
B
D
E
X
D

Coletnea de Provas | Concursos de Psicologia

Empresa Brasileira de Servios Hospitalares


Edital no 03, rea Assistencial, de 20/2/2014
Maternidade Climrio de Oliveira da Universidade Federal da Bahia
Concurso Pblico para Provimento de Vagas e Formao de Cadastro de
Reserva em Empregos Pblicos Efetivos de Nvel Superior e Mdio

Cargo 116
Psiclogo rea Hospitalar
Data e horrio da prova: Domingo, 4/5/2014, s 8h30
INSTRUES

Voc receber do fiscal:


o um caderno de questes da prova objetiva contendo 50 (cinquenta) questes de mltipla escolha, com 5 (cinco) alternativas
de resposta cada uma, e apenas uma alternativa correta;
o um carto de respostas tico personalizado.
Verifique se a numerao das questes, a paginao do caderno de questes e a codificao do carto de respostas tico esto
corretas.
Quando autorizado pelo fiscal do IADES, no momento da identificao, escreva no espao apropriado do carto de respostas,
com a sua caligrafia usual, a seguinte frase:

A persistncia o caminho do xito.

Voc dispe de 4 (quatro) horas para fazer a prova objetiva, devendo controlar o tempo, pois no haver prorrogao desse prazo.
Esse tempo inclui a marcao do carto de respostas tico.
Somente ser permitido levar o caderno de questes da prova objetiva aps 3 (trs) horas e 30 (trinta) minutos do incio da prova.
Somente aps decorrida 1 (uma) hora do incio da prova, voc poder entregar seu carto de respostas tico e retirar-se da sala.
Aps o trmino da prova, entregue ao fiscal do IADES o carto de respostas devidamente assinado.
Deixe sobre a carteira apenas o documento de identidade e a caneta esferogrfica de tinta preta ou azul, fabricada de material
transparente.
No permitida a utilizao de qualquer aparelho eletrnico de comunicao. Desligue e guarde em embalagem fornecida pelo
fiscal do IADES: mquina fotogrfica; telefone celular; relgio; gravador; bip; receptor; pager; notebook; tablet eletrnico; walkman;
aparelho porttil de armazenamento e de reproduo de msicas, vdeos e outros arquivos digitais; agenda eletrnica; palmtop;
rgua de clculo; mquina de calcular e (ou) qualquer outro equipamento similar.
No permitida a consulta a livros, dicionrios, apontamentos e apostilas.
Voc somente poder sair e retornar sala de aplicao de provas na companhia de um fiscal do IADES.
No ser permitida a utilizao de lpis em nenhuma etapa da prova.

INSTRUES PARA A PROVA OBJETIVA

Verifique se os seus dados esto corretos no carto de respostas. Caso haja algum dado incorreto, escreva apenas no(s) campo(s)
a ser(em) corrigido(s), conforme instrues no carto de respostas.
Leia atentamente cada questo e assinale, no carto de respostas tico, uma nica alternativa.
O carto de respostas tico no pode ser dobrado, amassado, rasurado ou manchado nem pode conter nenhum registro fora dos
locais destinados s respostas.
A maneira correta de assinalar a alternativa no carto de respostas cobrir, fortemente, com caneta esferogrfica preta ou azul,
o espao a ela correspondente.
Marque as respostas assim:

CONHECIMENTOS ESPECFICOS
Questes de 26 a 50

QUESTO 26_______________________
Uma equipe de sade multiprofissional um grupo formado
por profissionais de sade, de mesma ou diferentes profisses
e reas de atuao, responsveis pela assistncia sade de
um ou mais pacientes. A respeito do trabalho em equipe,
assinale a alternativa correta.
(A)

(B)

(C)

(D)

(E)

Diante de problemas triviais na equipe de sade, as


pessoas devem adotar comportamentos mais
assertivos e de colaborao.
O fato de dois colegas de trabalho, sendo um mdico
e outro psiclogo, procurarem chegar a uma soluo
comum para um problema interpessoal na equipe
constitui exemplo de evitao de conflitos
interpessoais.
As situaes em que as pessoas simplesmente no
colaboram entre si ou intencionalmente discordam
sobre alguma questo em particular constituem
exemplos de quebra de comunicao na equipe de
trabalho.
Um membro da equipe cuja personalidade
possibilita caracteriz-lo como observador no
apresenta dificuldade em se relacionar com o grupo
e manter um contato mais estreito com as pessoas.
A utilizao do trabalho em equipe no se
caracteriza como um advento recente nas
organizaes.

QUESTO 27_______________________
As instituies, como um hospital, podem ser definidas como
as normas (culturais, histricas, sociais) que formam a trama
social que une os indivduos. Uma dimenso fundamental que
une e atravessa todos os nveis da rede social. Nesse sentido,
correto afirmar que a anlise institucional tem como objetivo
(A)
(B)
(C)

(D)

(E)

CONCURSO PBLICO REA ASSISTENCIAL EBSERH

analisar os fenmenos humanos em situao no


curso da vida profissional, exclusivamente.
transformar as instituies a partir das prticas e
discursos dos seus gestores.
verificar empiricamente as formas como os valores,
representaes e sentimentos so utilizados pelos
diversos atores sociais e protagonistas em cada
situao institucional, com que finalidades e com
que efeitos.
propiciar que determinado grupo de uma instituio
se torne capaz de controlar o outro grupo e de
promover regulao para gerenciar as suas questes.
transformar as instituies a partir das prticas e dos
discursos dos seus donos.

116 Psiclogo rea Hospitalar

PGINA 6/11

QUESTO 28 ______________________

QUESTO 31_______________________

As necessidades demandadas de sade e o crescente


desenvolvimento cientfico e tecnolgico produziram
estratgias e mecanismos para efetivar o trabalho em equipe,
com qualidade e eficincia. Em relao ao trabalho em equipe,
assinale a alternativa correta.

So modalidades de documentos utilizados pelo psiclogo


hospitalar: declarao, atestado psicolgico, relatrio/laudo
psicolgico e parecer psicolgico. Acerca dos documentos
oficiais elaborados pelo psiclogo hospitalar, assinale a
alternativa correta.

(A)

(B)

(C)

(D)

(E)

A eficcia no comportamento interpessoal, em uma


equipe de sade, pouco se relaciona habilidade
para resolver os problemas sem retrocessos.
Na fase inicial de formao de equipes de sade, as
relaes entre os membros raramente so
conflituosas e divergentes.
Pessoas motivadas e convencidas a permanecerem
em uma equipe de sade constituem exemplo de
falta de coeso das equipes de trabalho.
Em uma equipe de sade, o papel socioemocional
evidenciado quando um indivduo proporciona
apoio para as necessidades emocionais de seus
colegas de trabalho.
So caractersticas do trabalho em equipe de sade:
a superviso identificada com controle, o
desenvolvimento de controle coletivo do grupo e o
envolvimento seletivo das pessoas nas tarefas.

(A)

(B)

(C)

(D)

(E)

QUESTO 29 ______________________
Assinale a alternativa que aponta uma possvel desvantagem
do trabalho em equipe multifuncional.
(A)
(B)
(C)
(D)
(E)

Aumento da rotatividade dos profissionais,


resultando na reduo de custos.
Estabelecimento de prioridades.
Reduo da duplicao dos servios.
Gerao de intervenes mais criativas.
Reduo de intervenes desnecessrias pela falta
de comunicao entre os profissionais.

QUESTO 32_______________________
De acordo com a Resoluo no 007/2003, do Manual de
Elaborao de Documentos Escritos, produzidos por
psiclogos, decorrentes de avaliao psicolgica, assinale a
alternativa correta.
(A)

QUESTO 30 ______________________
O psiclogo hospitalar que atua em uma enfermaria de
neurologia ou neurocirurgia utiliza-se dos conhecimentos da
neuropsicologia para avaliar muitos pacientes com leses
cerebrais ou outras doenas que atingem o sistema nervoso
central. A avaliao neuropsicolgica uma importante
ferramenta de trabalho que consiste em uma avaliao que
(A)
(B)

(C)

(D)

(E)

padronizada e inclui a anamnese e testes de


funes cognitivas superiores.
inclui orientao temporal, pessoal e espacial;
linguagem, nomeao e compreenso verbal; leitura
e escrita.
exclui ateno e memria; ateno auditiva e visual;
percepo; gnosias; praxias; pensamento; raciocnio
lgico e clculo.
deve ser realizada para verificar no s as
disfunes, mas tambm as potencialidades do
paciente de um ponto de vista cognitivo e
emocional.
no adequada para avaliar as funes cognitivas
superiores e nem os aspectos emocionais do
paciente.

CONCURSO PBLICO REA ASSISTENCIAL EBSERH

Entre as atribuies do psiclogo hospitalar, inclui-se


a de emitir parecer confirmativo sobre afastamentos
para tratamento de doenas ocupacionais relacionadas
s alteraes das funes psquicas apresentadas por
membros da equipe de sade.
Um parecer um documento fundamentado e
resumido sobre uma questo focal do campo
psicolgico, cujo resultado pode ser indicativo ou
conclusivo.
Um parecer um tipo de documento muito pouco
demandado nos servios de sade e raramente est
presente na tarefa da maioria dos psiclogos
hospitalares.
O parecer tem como finalidade apresentar resposta
esclarecedora, exclusivamente utilizado pelo campo
do conhecimento psicolgico.
O psiclogo, em um parecer, pode fazer afirmaes
sem sustentao em fatos e (ou) teorias, devendo ter
linguagem imprecisa, especialmente quando se referir
a dados de natureza subjetiva, expressando-se de
maneira objetiva.

(B)

(C)

(D)

(E)

O relatrio ou laudo psicolgico fundamenta-se em


uma interpretao inferencial acerca de situaes e
(ou) condies psicolgicas e suas determinaes
histricas, sociais, polticas e culturais, pesquisadas
no processo de avaliao psicolgica.
O relatrio ou laudo psicolgico uma apresentao
descritiva acerca de situaes e (ou) condies
psicolgicas e suas determinaes histricas,
sociais, polticas e culturais, pesquisadas no
processo de avaliao psicolgica.
O relatrio psicolgico no sinnimo de laudo
psicolgico, pois o primeiro deve ser subjetivo,
composto por interpretao inferencial, e o segundo
deve ser descritivo e conter linguagem objetiva.
Apenas na elaborao de laudos psicolgicos, e no
na de relatrios psicolgicos, o psiclogo
fundamentar suas informaes na observncia aos
princpios e dispositivos do Cdigo de tica
Profissional do Psiclogo.
O relatrio ou laudo psicolgico deve ser subsidiado
em dados colhidos e analisados, luz de um
instrumental tcnico proveniente exclusivamente de
testes psicolgicos, para que seu referencial tcnicofilosfico e cientfico seja resguardado.

116 Psiclogo rea Hospitalar

PGINA 7/11

QUESTO 33 ______________________
A teoria da anlise institucional teve incio no perodo da
Segunda Guerra Mundial. Naquela poca, comearam a ser
proferidos seminrios sobre higiene mental com o objetivo de:
desenvolver a psicologia e a profisso do psiclogo; criar
inquietao no que se refere s novas promoes do psiclogo,
buscando algo que lhe permitisse uma melhor situao social,
um cumprimento mais eficaz de seu papel, voltando-se mais
ao trabalho e s atividades sociais (Bleger, 1984). Embora seja
muito prxima da psicologia, a anlise institucional tambm
lhe tece algumas crticas. Quanto a esse tema, correto afirmar
que a principal crtica se refere (ao)
(A)

(B)
(C)
(D)
(E)

adoo
pela
psicossociologia
de
ideias
psicanalticas e lewinianas, redundando em
ecletismo terico.
desvalorizao das relaes informais nas
organizaes pela perspectiva psicossociolgica.
estgio pr-paradigmtico da psicossociologia,
ainda presa a conceitos pr-cientficos.
exclusividade dada pelo enfoque psicossociolgico
problemtica das relaes humanas.
modelo dominantemente mstico presente nas
prticas dos psicossocilogos.

QUESTO 34 ______________________
No mundo cientfico, sempre houve um movimento por
buscar, analisar, descrever e categorizar os fenmenos. Assim,
o pediatra Corradine (1998) lista uma srie de caractersticas
das gestantes usurias de drogas. Em relao a esse assunto,
correto afirmar que, entre os achados, esto
(A)
(B)

(C)
(D)
(E)

mulheres de nvel socioeconmico mais alto, que


fazem uso de mais de um tipo de droga.
mulheres de nvel socioeconmico mais baixo com
histrico de infraes, como, por exemplo, roubo e
prostituio.
mulheres provenientes de famlias sem histrico de
abuso de substncias qumicas.
mulheres sem quadros de transtornos mentais.
mulheres provenientes de famlias com histrico de
abuso de substncias qumicas, mas sem quadros de
transtornos mentais.

QUESTO 35 ______________________
Em seu livro Manual de Psicologia Hospitalar, Simonetti
(2004) apresenta trs tcnicas para que o psiclogo consiga
promover a fala do paciente: a entrevista, a associao livre e
o silncio. No que se refere a essas tcnicas, assinale a
alternativa correta.
(A)

(B)

O silncio permite ao paciente uma fala sem


roteiros, em que ele tem a oportunidade de um
espao para falar o que vier mente, assim o
psiclogo tambm exerce a funo de uma escuta
livre.
Em ambas as tcnicas, associao livre e entrevista,
as perguntas buscam s a obteno de dados, sem
privilegiar o vnculo paciente-psiclogo.

CONCURSO PBLICO REA ASSISTENCIAL EBSERH

(C)

(D)

(E)

No silncio, no se deve valorizar, em um primeiro


momento, temas relacionados doena, pois, se
apenas a doena for valorizada, o psiclogo nada
mais far que repetir o discurso mdico.
A associao livre uma estratgia utilizada pelo
psiclogo para alcanar assuntos mais acessveis,
como, por exemplo, a doena ou o motivo da
internao, o uso dos remdios, onde mora, a
profisso, o estado civil.
O silncio essencial e deve ser respeitado pelo
psiclogo, pois ele estimula a fala do paciente ao
funcionar como um vcuo, que puxa as palavras e
pede para ser preenchido.

QUESTO 36_______________________
Assinale a alternativa que no apresentada uma funo da
entrevista psicolgica realizada pelos psiclogos nas
instituies hospitalares.
(A)

(B)
(C)
(D)

(E)

Conhecer os recursos internos e externos do


paciente para lidar com a situao de doena e
hospitalizao.
Conhecer a histria da doena e da pessoa.
Fornecer dados sobre a estrutura psicodinmica da
personalidade da pessoa.
Fornecer dados sobre a estrutura psicodinmica da
personalidade dos membros da famlia e da equipe
de sade.
Classificar o paciente em uma escala de urgncia
emocional.

QUESTO 37_______________________
Segundo Chiatonne (2000), consenso que o psiclogo
hospitalar deve seguir requisitos mnimos - tericos e prticos
para a atuao, orientao, superviso, formao especfica
nas reas clnica e hospitalar na graduao, especializao e
ps-graduao e experincia pertinente na rea. Quanto
formao do psiclogo para atuar no hospital, essa autora
alerta que
(A)

(B)

(C)

(D)

(E)

a formao acadmica pouco interfere na insero e


no desempenho tcnico do psiclogo hospitalar,
apesar de possuir caractersticas prprias, adequadas
e especficas ao hospital.
90% dos psiclogos formados assegura que a
formao universitria os preparou suficientemente
para atuar em hospitais, pois h muito contato com
a rea ainda na graduao.
pode ocorrer uma crise de identidade, pois os
psiclogos hospitalares chegam a duvidar da
eficincia e cientificidade de sua tarefa,
desqualificando-a por no se enquadrar em qualquer
das atividades aprendidas nos cursos de formao
acadmica.
no desejvel uma especializao em psicologia
hospitalar nem ao final do curso, nem depois da
graduao.
requer uma formao socialmente desarticulada das
instituies de sade, e descomprometida com as
realidades sociais e inserida em um contexto maior
institucional.

116 Psiclogo rea Hospitalar

PGINA 8/11

QUESTO 38 ______________________

QUESTO 41_______________________

O trabalho de psiclogos hospitalares se revela to intenso que


j se pode falar em consolidao da rea da psicologia
hospitalar no Brasil, que inclusive j consegue realizar
congressos ou encontros de mbito nacional. Em relao
atuao do psiclogo nessa rea, correto afirmar que cabe ao
psiclogo hospitalar

Na maternidade, a psicloga chamada a atender uma


paciente de 55 anos de idade, que foi hospitalizada ao procurar
atendimento mdico com vrios sinais de incio de trabalho de
parto. Ao exame, a ginecologista no constatou batimentos
cardacos fetais e suspeitou de bito fetal. Aps ultrassom de
urgncia, verificou-se que a paciente no tinha tero, pois
tinha se submetido a uma histerectomia total h dois anos. A
psicloga tentou abordar a paciente, mas ela parecia no ver
ningum, estava gemendo e falando repetidamente que seu
filho estava para nascer. Considerando essa situao
hipottica, correta afirmar que o psiclogo hospitalar, para
atender bem paciente, deve ter conhecimento de que se trata
de um quadro de

(A)

(B)

(C)

(D)
(E)

trabalhar dificuldades conjugais e familiares


geradas antes da doena em si, para poder promover
a cura psquica, considerando a condio clnica do
paciente.
promover qualidade de vida dos membros da
equipe, tratando a condio psicodinmica de cada
um.
psicologizar a equipe para que sejam
psicoterapeutizados quanto aos seus aspectos
emocionais, e assim haja uma troca simultnea de
experincias entre ela e os pacientes.
ser o nico
responsvel pela verdadeira
humanizao do hospital.
trabalhar a aceitao e adaptao dos limites do
processo de adoecimento e do tratamento, o manejo
da dor e do estresse, a tomada de decises e o
preparo para procedimentos invasivos, entre outros.

QUESTO 39 ______________________
Considere o relato de uma me diagnosticada com depresso
ps-parto no estudo de Arrais (2005): Gostaria de saber, por
que, mesmo que eu tenha realizado o meu sonho de ser me,
mesmo tendo a pessoa amada do meu lado, eu continuo a ter
essas angstias e tristezas. Ser que sou mesmo esse fracasso
de me e de esposa como penso?. De acordo com essa autora,
e acerca da temtica da depresso ps-parto (DPP), assinale a
alternativa correta.
(A)

(B)

(C)

(D)

(E)

A DPP um quadro delirante, frequentemente


alucinatrio, grave e agudo que se instala depois do
parto e por isso h um srio risco de suicdio.
Na DPP, h forte presena de sentimentos de culpa
relacionados sensao de ser incapaz de lidar com
novas solicitaes da maternidade.
Na DPP, ocorre um repdio total ao beb: a paciente
no o quer ver, aterroriza-se com ele, maltrata-o e
comum chegar ao infanticdio do prprio filho.
A etiologia est relacionada apenas queda
hormonal abrupta com o nascimento e a sada da
placenta.
Apesar da DPP, as mes deprimidas no apresentam
reduo do contato afetivo e nem dificuldade para
expressar sentimentos positivos pelo beb.

(A)
(B)
(C)
(D)
(E)

QUESTO 42_______________________
Sra. Isabel me de Bruno, que nasceu com
mielomeningocele e hidrocefalia e apresentou o seguinte
relato: No queria me separar de meu filho nas cirurgias e na
internao na UTIN. Fui para o grupo de pais com a psicloga,
mdicos, assistentes sociais e enfermeiras, que acontece toda
semana na UTI neonatal, e vi que no estava sozinha... Outras
mes tambm estavam passando por dificuldades com seus
bebs e isso me ajudou muito. No que se refere ao
atendimento em grupo descrito por Sra. Isabel correto
afirmar que se trata de uma ferramenta privilegiada pelos
psiclogos hospitalares que trabalham em hospitais e
normalmente denominado de grupo
(A)
(B)
(C)
(D)
(E)

No exerccio profissional, o psiclogo hospitalar sempre


vivencia situaes que so permeadas de questes de cunho
tico. Quanto ao cuidado psicolgico ao paciente, assinale a
alternativa que indica os princpios ticos que devem estar
presentes.
(A)
(B)

Em relao ao conceito de educao em sade, correto


afirmar que ela est ancorada na concepo de

(C)

preveno da sade.
sade complementar.
promoo da sade.
preveno de doenas.
recuperao da sade.

CONCURSO PBLICO REA ASSISTENCIAL EBSERH

Balint.
de orientao e apoio.
social.
de controle.
psicanaltico.

QUESTO 43_______________________

QUESTO 40 ______________________

(A)
(B)
(C)
(D)
(E)

pseudociese.
esquizofrenia.
depresso ps-parto.
simulao.
psicose puerperal.

(D)
(E)

Respeito, liberdade, dignidade, igualdade e


integridade.
Veracidade, maternidade, duplo efeito e
confiabilidade.
Dignidade, negligncia, respeito s pessoas e
veracidade.
Liberdade, confiabilidade, duplo efeito, justia e
dependncia.
Justia, dependncia, integridade, respeito s
pessoas e veracidade.

116 Psiclogo rea Hospitalar

PGINA 9/11

QUESTO 44 ______________________
Para Vasconcelos (2001), medida que a educao em sade
deixa de ser um complemento da ateno, assumindo a
responsabilidade de reorganizar e reorientar as prticas
assistenciais, correto afirmar que ela passa a ser um
instrumento
(A)
(B)
(C)

(D)

(E)

de construo da participao da gesto nos servios


de sade.
que permite o aprofundamento da religio na vida
dos indivduos, famlias e sociedade.
que refora a verticalidade da relao entre o
profissional e o usurio, valorizando trocas
interpessoais iniciativas da comunidade.
que favorece o dilogo e a compreenso do saber
popular, contrapondo-se passividade das prticas
educativas tradicionais.
que permite ao usurio no ser reconhecido como
sujeito portador de um saber sobre o processo de
sade-doena-cuidado.

QUESTO 45 ______________________
de responsabilidade do psiclogo, ao ingressar em uma
organizao, como um hospital, considerar se a misso, a
filosofia, as polticas, as normas e as prticas nela vigentes so
compatveis com os princpios e regras do Cdigo de tica
Profissional do Psiclogo. De acordo com esse cdigo,
existindo incompatibilidade, correto afirmar que cabe ao
psiclogo
(A)

(B)

(C)

(D)

(E)

recusar-se a prestar servios e, se pertinente,


apresentar denncia ao rgo competente
(Pargrafo nico do art. 3 do Cdigo de tica
Profissional do Psiclogo).
decidir se deve ou no ingressar, associar-se ou
permanecer no hospital, pois essa uma deciso de
foro ntimo (Pargrafo nico do art. 3 do Cdigo de
tica Profissional do Psiclogo).
propor antes do ingresso, mudanas para alterar a
misso, a filosofia, as polticas, as normas e as
prticas vigentes no hospital para criar a
compatibilidade com os princpios e regras desse
cdigo (Pargrafo nico do art. 4 do Cdigo de
tica Profissional do Psiclogo).
ingressar no hospital ou organizao com
autorizao por escrito do Conselho Federal de
Psicologia (Pargrafo nico do art. 4 do Cdigo de
tica Profissional do Psiclogo).
apresentar denncia ao rgo competente
(Pargrafo nico do art. 4 do Cdigo de tica
Profissional do Psiclogo).

(B)

(C)
(D)

(E)

QUESTO 47_______________________
O SisPreNatal o software que foi desenvolvido pelo Datasus,
com a finalidade de permitir o acompanhamento adequado das
gestantes inseridas no Programa de Humanizao no PrNatal e Nascimento (PHPN), do Sistema nico de Sade.
Acerca do SisPreNatal, correto afirmar que
(A)

(B)
(C)
(D)

(E)

Ao se pensar no beb internado na UTIN, deve-se lembrar de


que ele, assim como a criana que nasceu saudvel, precisa ter
seu desenvolvimento afetivo preservado e, para que isso
ocorra, ser preciso da presena dos pais (Brasil, 2002). Cunha
(2002) mostra que o beb prematuro, mesmo doente, tem sua
capacidade de seduo muito desenvolvida para conquistar o
cuidador. Deve-se ento ajudar os pais a serem conquistados
por seu beb. Em relao a esse assunto, assinale a alternativa
que apresenta uma atuao caracterstica do psiclogo na
UTIN.
(A)

(B)

(C)

Em relao Rede Cegonha, correto afirmar que se trata de


uma estratgia inovadora do Ministrio da Sade que visa
organizar uma rede de cuidados que assegure

(D)
(E)

s mulheres o direito ao nascimento seguro, ao


crescimento e ao desenvolvimento saudveis.

CONCURSO PBLICO REA ASSISTENCIAL EBSERH

se fundamenta nas anlises das necessidades de


ateno especfica gestante, ao recm-nascido e
mulher no perodo ps-parto.
define o elenco mximo de procedimentos para uma
assistncia pr-natal adequada.
permite o acompanhamento das gestantes, desde o
incio da gravidez at a consulta de puerprio.
garante que toda gestante tenha o direito ao acesso a
atendimento psicolgico e de qualidade no decorrer
da gestao, parto e puerprio.
foi institudo pelo Ministrio da Sade, por meio da
Portaria/GM n 560, de 01/06/2001, a mesma que
instituiu o Programa de Humanizao no Pr-natal e
Nascimento.

QUESTO 48_______________________

QUESTO 46 ______________________

(A)

s crianas o direito ao planejamento reprodutivo e


ateno humanizada gravidez, ao parto e ao
puerprio.
a reduo da mortalidade materna e infantil com
nfase no componente materno.
a organizao da Rede de Ateno Sade Materna
e Infantil para que esta garanta acesso, acolhimento
e resolutividade.
a promoo do vnculo entre a assistncia
ambulatorial e o parto.

Apresentar o beb aos pais, mostrar a eles as


competncias j existentes no beb deles, tais como
virar-se na direo de suas vozes.
Mostrar a diferena nos valores de saturao de
oxignio na presena deles e a sensibilidade ao
toque.
Ajudar a equipe e a famlia na busca da segurana
do beb, minimizando ao mximo esse sofrimento.
Estar atento comunicao do beb.
Lembrar a todos que, mesmo sendo beb, esse deve
ser considerado como sujeito dotado de emoes,
que sente dor e possui sua prpria individualidade,
que deve ser respeitada.

116 Psiclogo rea Hospitalar

PGINA 10/11

QUESTO 49 ______________________
Raramente as mes so preparadas psicologicamente pelas
equipes de sade durante a gestao para enfrentar uma UTI
Neonatal (UTIN). O psiclogo hospitalar, nesse ambiente,
muito importante para dar assistncia s mes no sentido de
ampar-las nesse momento difcil, marcado por sentimentos
de medo, angstia, ansiedade e culpa. Com relao ao trabalho
do psiclogo na UTIN, assinale a alternativa que se afasta dos
propsitos da atuao dele.
(A)
(B)

(C)

(D)
(E)

Orientar as mes acerca de como lidar com o beb,


da importncia do contato pele a pele e da conversa.
Acompanhar a me nas visitas ao seu filho,
favorecendo a relao me filho para que esta no
fique prejudicada.
Controlar o ndice de infeces hospitalares, a
mortalidade dos bebs hospitalizados e a regulao
de leitos da UTIN.
Mediar a relao entre a equipe e a me.
Estimular as mes a se integrarem e serem ativas no
papel de me durante a internao do filho.

QUESTO 50 ______________________
O espao para o psiclogo atuar na obstetrcia extremamente
vasto, porm a realidade mostra que so poucos profissionais
que abrangem todas as atuaes que a literatura aponta.
Assinale a alternativa que caracteriza corretamente o papel do
psiclogo na obstetrcia.
(A)
(B)

(C)

(D)
(E)

Auxiliar a equipe no diagnstico diferencial do


Blues, depresso ps-parto e na psicose puerperal.
Realizar manobras relacionadas proteo ao
perneo e ao manejo do polo ceflico no momento
do parto.
Atuar apenas no ps-parto, auxiliando na
amamentao e na insero do pai. Evitar a atuao
durante o parto, pois um momento exclusivo dos
mdicos e dos enfermeiros obstetras.
Estimular o luto patolgico em situao de bebe
natimorto, beb malformado.
Acompanhar as gestantes em maternidades somente
se elas forem encaminhadas por seus mdicos
obstetras.
rea Livre

CONCURSO PBLICO REA ASSISTENCIAL EBSERH

116 Psiclogo rea Hospitalar

PGINA 11/11

PROVA: EBSERH - MCO - UFBA


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: IADES

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

E
C
D
A
D
B
B
D
B
E
E
C
E

39
40
41
42
43
44
45
46
47
48
49
50

B
X
A
B
A
D
A
D
X
X
C
A

Coletnea de Provas | Concursos de Psicologia

Empresa Brasileira de Servios Hospitalares


Edital no 03 rea Assistencial, de 20/2/2014.
Hospital Universitrio Professor Edgard Santos da Universidade Federal da
Bahia
Concurso Pblico para Provimento de Vagas e Formao de Cadastro de
Reserva em Empregos Pblicos Efetivos de Nvel Superior e Mdio

Cargo 123
Psiclogo rea Hospitalar
Data e horrio da prova: Domingo, 11/5/2014, s 8h30
INSTRUES

Voc receber do fiscal:


o um caderno de questes da prova objetiva contendo 50 (cinquenta) questes de mltipla escolha, com 5 (cinco) alternativas
de resposta cada uma, e apenas uma alternativa correta;
o um carto de respostas tico personalizado.
Verifique se a numerao das questes, a paginao do caderno de questes e a codificao do carto de respostas tico esto
corretas.
Quando autorizado pelo fiscal do IADES, no momento da identificao, escreva no espao apropriado do carto de respostas,
com a sua caligrafia usual, a seguinte frase:

A vida um palco que no admite ensaios.

Voc dispe de 4 (quatro) horas para fazer a prova objetiva, devendo controlar o tempo, pois no haver prorrogao desse prazo.
Esse tempo inclui a marcao do carto de respostas tico.
Somente ser permitido levar o caderno de questes da prova objetiva aps 3 (trs) horas e 30 (trinta) minutos do incio da prova.
Somente aps decorrida 1 (uma) hora do incio da prova, voc poder entregar seu carto de respostas tico e retirar-se da sala.
Aps o trmino da prova, entregue ao fiscal do IADES o carto de respostas devidamente assinado.
Deixe sobre a carteira apenas o documento de identidade e a caneta esferogrfica de tinta preta ou azul, fabricada de material
transparente.
No permitida a utilizao de qualquer aparelho eletrnico de comunicao. Desligue e guarde em embalagem fornecida pelo
fiscal do IADES: mquina fotogrfica; telefone celular; relgio; gravador; bip; receptor; pager; notebook; tablet eletrnico; walkman;
aparelho porttil de armazenamento e de reproduo de msicas, vdeos e outros arquivos digitais; agenda eletrnica; palmtop;
rgua de clculo; mquina de calcular e (ou) qualquer outro equipamento similar.
No permitida a consulta a livros, dicionrios, apontamentos e apostilas.
Voc somente poder sair e retornar sala de aplicao de provas na companhia de um fiscal do IADES.
No ser permitida a utilizao de lpis em nenhuma etapa da prova.

INSTRUES PARA A PROVA OBJETIVA

Verifique se os seus dados esto corretos no carto de respostas. Caso haja algum dado incorreto, escreva apenas no(s) campo(s)
a ser(em) corrigido(s), conforme instrues no carto de respostas.
Leia atentamente cada questo e assinale, no carto de respostas tico, uma nica alternativa.
O carto de respostas tico no pode ser dobrado, amassado, rasurado ou manchado nem pode conter nenhum registro fora dos
locais destinados s respostas.
A maneira correta de assinalar a alternativa no carto de respostas cobrir, fortemente, com caneta esferogrfica preta ou azul,
o espao a ela correspondente.
Marque as respostas assim:

QUESTO 24_______________________

CONHECIMENTOS ESPECFICOS
Questes de 21 a 50
LEGISLAO APLICADA AO
SISTEMA NICO DE SADE (SUS)
Questes de 21 a 25

QUESTO 21 ______________________
A 8a Conferncia Nacional de Sade (1986) foi um marco do
processo de formulao de um novo modelo de sade pblica
universal. Acerca do tema, assinale a alternativa que indica um
dos principais encaminhamentos dessa conferncia.
(A)

(B)
(C)

(D)
(E)

A ruptura com a ciso estrutural entre sade pblica


e medicina curativa individual e com a intensa
privatizao que, ento, caracterizava o sistema de
sade brasileiro.
A socializao do sistema de sade brasileiro e a
privatizao da medicina privada.
A fomentao das instituies superiores de ensino
em sade e a viabilizao de estudos em
especializaes mdicas pouco exploradas at
ento.
A criao de uma indstria nacional farmacutica e
de equipamentos mdico-hospitalares.
A criao de um modelo previdencirio com
financiamento obrigatrio da Unio e garantia de
uso de percentual elevado do produto interno bruto
(PIB) brasileiro nas aes de sade pblica.

Quando ocorre a participao complementar dos servios


privados, nas situaes em que as disponibilidades do SUS
forem insuficientes para garantir a cobertura assistencial
populao de determinada rea, os critrios e os valores para
a remunerao de servios e os parmetros de cobertura
assistencial sero estabelecidos
(A)
(B)
(C)
(D)
(E)

QUESTO 25_______________________
Quanto ao VERSIA, assinale a alternativa correta.
(A)
(B)

(C)
(D)

QUESTO 22 ______________________
No mbito do SUS, a participao, na perspectiva do controle
social, possibilita populao
(A)
(B)
(C)
(D)
(E)

contrapor-se s aes de sade promovidas pela


Administrao Pblica.
agir sem a ajuda de equipes mdicas e de apoio s
aes em sade.
interferir na gesto da sade, colocando as aes do
Estado na direo dos interesses da coletividade.
definir que o que pblico deve estar sob o controle
dos governantes, apenas.
no interferir no controle social, que deve ser
traduzido apenas em mecanismos formais.

QUESTO 23 ______________________
Com base na Resoluo no 453/2012, do Conselho Nacional
de Sade, correto afirmar que as funes, como membro do
Conselho de Sade,
(A)
(B)
(C)
(D)
(E)

no sero remuneradas.
sero remuneradas por meio de jetons.
devem ser exclusivas, no podendo o conselheiro
acumular outra atividade profissional.
devem ser exercidas por outro membro da famlia,
em caso de ausncia do titular.
no garantem a dispensa do trabalho sem prejuzo
para o conselheiro.

CONCURSO PBLICO REA ASSISTENCIAL EBSERH

pelos Ministrios da Sade e do Planejamento,


conjuntamente.
levando-se em conta a mdia dos preos praticados
pelo segmento privado na regio.
necessariamente em edital de licitao para fins de
contratao da instituio particular de sade.
pela direo nacional do SUS, aprovados no
Conselho Nacional de Sade.
pelo Conselho de Sade correspondente regio
atendida.

(E)

o sistema de verificao do SIASUS.


um sistema centralizado e responsvel pela
gerao das informaes processadas pelo
SIASUS.
utilizado e atualizado diariamente pelo
DATASUS.
Esto, entre os benefcios do VERSIA, a
integridade
das
informaes
sobre
os
estabelecimentos de sade e o intercmbio
eletrnico de dados com rgos internacionais de
sade.
Tem abrangncia exclusivamente municipal.
CONHECIMENTOS ESPECFICOS
Questes de 26 a 50

QUESTO 26 ______________________
Para realizar educao em sade, imprescindvel que o
psiclogo faa uso de determinados princpios educativos.
Acerca desse assunto, assinale a alternativa correta.
(A)
(B)
(C)

(D)

(E)

A prtica educativa em sade dinmica, ativa,


propicia participao e conhecimentos.
As pessoas no devem ser consideradas dentro da
cultura em que vivem.
A participao das pessoas no planejamento do
programa de educao em sade causa desinteresse,
pois demonstra a insegurana do psiclogo para
realiz-lo.
O trabalho educativo deve ser finalizado com o
estudo dos problemas ou das necessidades do
grupo.
Todas as atividades educativas devem visar ao
ajustamento psicolgico e padronizao dos
comportamentos sociais.

123 Psiclogo rea Hospitalar

PGINA 6/12

QUESTO 27 ______________________

QUESTO 29 ______________________

O processo de interao humana um dos aspectos mais


importantes na definio de atividades voltadas para a
obteno dos resultados de qualquer organizao como um
hospital. Com relao a esse assunto, assinale a alternativa
correta.

Nas relaes humanas, a partir de divergncias de


percepes e ideias que as pessoas se colocam em posies
antagnicas, caracterizando uma situao conflitiva, desde as
mais leves, at as mais profundas. Com base nessas
informaes, correto afirmar que, as situaes de conflito

(A)

(B)

(C)

(D)

(E)

As caractersticas cognitivas de cada indivduo so


fatores que tornam complexo o processo de relaes
humanas.
A comunicao interpessoal transmite pensamentos
e sentimentos, mas no tem como objetivo
influenciar para obter reaes especficas da pessoa
com quem se fala.
Os processos interpessoais existentes nas
organizaes dependem tanto da qualificao
tcnica de seus membros quanto de habilidades de
comunicao.
A discriminao de certos aspectos do prprio
comportamento dificulta a convivncia com os
colegas no trabalho e contribui para promover
influncias recprocas que prejudicam a autonomia
de cada um.
Ser inteligente no trato com as pessoas significa,
entre outros aspectos, saber transmitir sua
mensagem com clareza. Expressar-se com clareza
importante
para
qualquer
relacionamento,
profissional ou pessoal.

QUESTO 28 ______________________
A competncia interpessoal a habilidade de lidar
eficazmente com relaes interpessoais, de lidar com outras
pessoas de forma adequada necessidade de cada uma delas e
s exigncias da situao. Segundo Argyris, essa habilidade
de lidar eficazmente com relaes interpessoais est
relacionada (s)
(A)

(B)
(C)

(D)

(E)

percepo padronizada da situao interpessoal, de


suas variveis relevantes ao ajustamento pessoal ao
outro e respectiva inter-relao.
habilidade de resolver parcialmente os problemas
de tal modo que haja regresses.
solues alcanadas de tal forma que as pessoas
envolvidas continuem trabalhando juntas to
eficientemente, pelo menos, como quando
comearam a resolver seus problemas.
percepo diversificada da situao interpessoal, de
modo que as pessoas tenham percepes e opinies
semelhantes de uma mesma situao, que propicie
uma situao de conflito.
solues alcanadas de tal forma que as pessoas
envolvidas rompam suas relaes, e cada um deve
buscar resolver seus problemas.

CONCURSO PBLICO REA ASSISTENCIAL EBSERH

(A)
(B)

(C)

(D)

(E)

so componentes evitveis e desnecessrios da vida


grupal.
podem ter consequncias positivas e funcionais,
mas o conflito em si sempre patolgico e
destrutivo.
raramente podem ter consequncias disfuncionais,
ou seja, negativas, a depender de sua intensidade,
estgio de evoluo, contexto e forma como
tratado.
tm muitas funes positivas, de um ponto de vista
amplo. Elas previnem a estagnao decorrente do
equilbrio constante da concordncia, estimulam o
interesse e a curiosidade pelo desafio da oposio,
descobrem os problemas e demandam a sua
resoluo.
funcionam como a raiz da estagnao pessoal,
grupal e social.

QUESTO 30 ______________________
Quando uma pessoa comea a participar de um grupo, como
uma equipe multiprofissional de sade, h uma base interna
de diferenas que englobam valores, atitudes, conhecimentos,
informaes, preconceitos, experincia anterior, gostos,
crenas e estilo comportamental, o que traz inevitveis
diferenas de percepes, opinies, sentimentos em relao a
cada situao compartilhada. Com base nessas informaes,
correto que essas diferenas passam a constituir um (uma)
(A)
(B)

(C)

(D)

(E)

repertrio nocivo: o daquela pessoa nova e estranha


naquele grupo.
desafio, pois a maneira de lidar com diferenas
individuais cria certo clima, positivo ou negativo,
entre as pessoas e tem forte influncia sobre toda a
vida em grupo, principalmente nos processos de
comunicao, no relacionamento interpessoal, no
comportamento organizacional e na produtividade.
obstculo intransponvel, pois as diferenas na
equipe sempre so nocivas e levam falta de
respeito pela opinio do outro e falta de troca de
informaes.
ameaa, pois as diferenas no devem ser encaradas
e tratadas como positivas. Elas vo determinar a
modalidade de relacionamento negativa entre
membros do grupo, colegas de trabalho, superiores
e subordinados.
conflito, pois, a partir de divergncias de
percepes e ideias, as pessoas se colocam em
posies antagnicas, caracterizando uma situao
harmoniosa na equipe.

123 Psiclogo rea Hospitalar

PGINA 7/12

QUESTO 31 ______________________

QUESTO 33 ______________________

As relaes interpessoais desenvolvem-se em decorrncia do


processo de interao. Em situao de trabalho,
compartilhadas por duas ou mais pessoas, como nas equipes
multiprofissionais de sade, h atividades predeterminadas a
serem executadas, bem como interaes e sentimentos
recomendados, tais como comunicao, cooperao, respeito,
amizade. medida que as atividades e as interaes
prosseguem, correto afirmar que os sentimentos despertados
podem ser

No trabalho do psiclogo hospitalar, o exame do estado


psquico muito importante para a avaliao da situao de
crise. A respeito desse assunto, assinale a alternativa que
apresenta objetivo desse tipo de exame.

(A)

(B)

(C)

(D)

(E)

diferentes dos indicados inicialmente e ento


inevitavelmente os sentimentos no influenciaro
as interaes e as prprias atividades.
negativos de simpatia e atrao e provocaro
aumento de interao e cooperao, repercutindo
favoravelmente nas atividades e ensejando maior
produtividade.
positivos de antipatia e rejeio e tendero
diminuio das interaes, ao afastamento nas
atividades, com provvel queda de produtividade.
contraditrios, tanto positivos e negativos, que
faro com que o trabalho em equipe
multiprofissional seja impossvel de se concretizar
na prtica, em funo dos conflitos profissionais,
provocados por sentimentos ambivalentes.
cclicos, pois o ciclo atividade-interaosentimentos no se relaciona diretamente com a
competncia tcnica de cada pessoa. Profissionais
competentes individualmente podem render muito
abaixo de sua capacidade por influncia do grupo e
da situao de trabalho.

QUESTO 32 ______________________
Acerca da avaliao psicolgica no contexto hospitalar e
ambulatorial, assinale a alternativa correta.
(A)

(B)

(C)

(D)

(E)

A avaliao psicolgica de um paciente deve ter um


enfoque biomdico, que envolve os domnios
biolgico-fisiolgico, psicolgico-comportamental
e social-ambiental.
Para avaliao psicolgica no contexto mdicohospitalar, necessrio que o psiclogo conhea o
curso da doena, suas peculiaridades, tratamentos
disponveis e procedimentos e nus posteriores ao
tratamento.
A avaliao psicolgica no hospital deve ser
realizada nos moldes do psicodiagnstico
tradicional.
Para ter validade, a avaliao psicolgica deve
utilizar-se sempre de testes psicomtricos, como,
por exemplo, o inventrio de Beck, com fins de
avaliao de quadros de depresso e ansiedade.
Na avaliao psicolgica, o uso de testes
psicolgicos foi delimitado no contexto hospitalar
como o de maior coerncia e eficcia.

CONCURSO PBLICO REA ASSISTENCIAL EBSERH

(A)
(B)
(C)
(D)
(E)

Avaliar tanto os aspectos sadios quanto as


disfunes e psicopatologias do paciente.
Avaliar a conduta do familiar do paciente.
Avaliar o funcionamento dos afetos da equipe.
Avaliar a interao familiar.
Avaliar as experincias prvias.

QUESTO 34 ______________________
A anlise institucional uma abordagem que busca a
transformao das instituies a partir das prticas e dos
discursos dos seus sujeitos. A instituio constitui tambm o
objeto, ou o conceito posto em anlise. Para Lourau, correto
afirmar que a noo de instituio
(A)

(B)

(C)

(D)

(E)

no se modifica na medida em que os indivduos


vo se tornando sujeitos da histria e da construo
social.
distinguida em cinco nveis, sendo que um deles
o institudo, que se refere fora que tende a
transformar as instituies ou que tende a fund-las,
e que so as foras produtivas de cdigos
institucionais.
distinguida em trs nveis, sendo que um deles o
instituinte, que se refere s leis, s normas
constitudas e aos padres para regular as atividades
sociais.
distinguida em trs nveis, sendo que um deles a
institucionalizao, que o reconhecimento das
novas normas criadas pelo processo instituinte.
distinguida em quatro nveis, a saber: o institudo,
o instituinte, a institucionalizao e a prpria
instituio.

QUESTO 35 ______________________
Bebidas alcolicas, apesar de lcitas, do origem a graves
problemas na rea da sade mental. Esses casos geralmente
vo parar nas emergncias dos hospitais gerais. A respeito
desse assunto, assinale a alternativa correta.
(A)

(B)
(C)

(D)
(E)

O comportamento, em relao ao lcool,


caracterizado pelo aumento progressivo da
quantidade da substncia consumida, com o fim de
se obter determinado efeito psicoativo, chama-se
abstinncia.
Na sndrome de dependncia ao lcool, a evidncia
mais direta presena da sndrome de abstinncia.
A apresentao clnica est determinada por fatores
externos, como o acesso facilitado aquisio da
bebida alcolica, que pouco se relaciona com a
personalidade do alcoolista e com o seu meio
familiar.
O meio ambiente pouco interfere no surgimento de
dependncia ao lcool.
No se pode estabelecer qualquer relao entre o
abuso de lcool e o ambiente familiar.

123 Psiclogo rea Hospitalar

PGINA 8/12

QUESTO 36 ______________________
Considere hipoteticamente que paciente de 23 anos de idade,
solteiro, chega ao ponto-socorro de um hospital geral, cuja
equipe interdisciplinar conta com o trabalho de experiente
psiclogo. O paciente trazido por dois irmos mais velhos,
fora, pois tentou agredir, de forma grave, seu pai e sua me.
Os irmos informam que ele usurio de crack e lcool h
alguns anos. Sua expresso facial de alerta, est
hipervigilante e muito agitado. Fala aos gritos com a equipe e
no consegue prestar ateno s perguntas feitas, s repete
incessantemente: bando de merdas. O psiclogo experiente
convocado a dar seu parecer sobre o caso para que a equipe
estabelea as condutas imediatas em mdio prazo. No caso
apresentado, a respeito do papel do psiclogo e da temtica da
dependncia qumica, assinale a alternativa correta.
(A)

(B)

(C)

(D)

(E)

Em geral, no pronto-socorro, alm de receber os


cuidados mdicos, o paciente ir passar por uma
entrevista de anamnese e participar da psicoterapia
de grupo e da terapia ocupacional, conduzidas pelo
psiclogo.
O psiclogo, ainda no pronto-socorro, deve
proceder a uma entrevista completa junto ao
paciente para levantamento da histria do uso de
crack e lcool, incluindo esclarecimentos dos
sintomas atuais com sua descrio objetiva e
detalhada, as circunstncias em que surgiram, se
houve ou no algum estressor que desencadeou ou
agravou o quadro, o grau de interferncia na vida
social, nas atividades profissionais dirias, nas
relaes interpessoais e a intensidade do sofrimento
psquico; breve histrico do desenvolvimento
pessoal e de como ocorreu a ultrapassagem das
diferentes etapas evolutivas.
O psiclogo deve fazer uso de conteno mecnica
para facilitar a avaliao psicolgica e promover
culpabilizao da famlia no momento do
tratamento.
Proporcionar ao paciente, ainda no pronto-socorro,
situaes que levem a reflexes e reorganizao de
padres de abuso do crack e do lcool e repreendlo e puni-lo toda vez que sair desses padres, para
poder modelar o comportamento saudvel.
Prosseguir atendimento ao paciente e suporte aos
familiares, alm de aconselhar e encaminhar o
paciente a buscar tratamento aps a alta do hospital,
nos CAPS AD.

(B)

(C)

(D)

(E)

QUESTO 38 ______________________
A entrevista psicolgica um recurso tcnico utilizado nas
diversas reas do campo profissional e que ganha destaque no
contexto hospitalar. uma das principais tcnicas utilizadas
pela sua importncia investigativa e recebe novas
configuraes e adaptaes, considerando as contingncias do
ambiente institucional e as particularidades da populao
usuria. Quanto entrevista psicolgica utilizada no espao
hospitalar, assinale a alternativa correta.
(A)

(B)

(C)

(D)

QUESTO 37 ______________________
Com relao ao paciente alcoolista e ao
farmacodependente, assinale a alternativa correta.
(A)

paciente

Frequentemente, tanto o paciente alcoolista como o


paciente
farmacodependente
procuram
espontaneamente os servios de atendimento em
sade, como um hospital geral ou um CAPS AD.

CONCURSO PBLICO REA ASSISTENCIAL EBSERH

A primeira conduta a ser feita pelo profissional de


sade, quando pacientes com essa problemtica
chegam ao pronto-socorro com sndrome de
abstinncia ou de intoxicao, fazer uma censura
sobre o comportamento ilcito e encaminhar para o
servio policial proceder aos enquadres legais.
H difundida entre os membros da equipe de sade
e a populao em geral uma imagem negativa
desses pacientes, associando-os sempre
marginalidade e ao crime. Essa noo muitas vezes
leva a equipe a assumir uma atitude hostil que
provoca uma situao de desconfiana e
distanciamento.
Por mais difcil que possa parecer, a interveno da
equipe deve proporcionar ambiente hostil,
mantendo-se os pacientes contidos fisicamente,
para evitar que eles impeam o estabelecimento de
um bom vnculo teraputico, essencial nessa
abordagem.
Entre as emergncias psiquitricas, aquelas
relacionadas ao uso de lcool e farmacodependentes
esto entre as menos importantes, pois so as menos
frequentes e de menor gravidade.

(E)

Na maioria das vezes, a entrevista psicolgica


realizada ao lado do leito do paciente, em um
ambiente pouco privativo e compartilhado por
demais integrantes da equipe de sade e (ou) por
familiar e acompanhante do paciente.
Apesar de importante, no permite conhecer a
relao que a pessoa faz com sua doena e o
significado que atribui internao.
Permite a aproximao, a investigao e a
interveno para com o paciente de forma
imprecisa, o que dificulta compreender e auxiliar na
minimizao do sofrimento e no enfrentamento da
situao em que se encontra.
Os dados colhidos na entrevista psicolgica no
ajudam a complementar o diagnstico mdico, pois
permitem apenas a explorao do contexto
vivencial do sujeito, de cunho muito subjetivo, que
no contribui para o esclarecimento da doena.
Os dados colhidos na entrevista, a partir dos relatos
dos pacientes, no ajudam a revelar informaes
sobre o estilo de vida e os comportamentos que
comprometeram ou colaboraram com o
desencadeamento, o desenvolvimento ou a
evoluo da doena.

123 Psiclogo rea Hospitalar

PGINA 9/12

QUESTO 39 ______________________
Quando o psiclogo inicia uma investigao diagnstica, pelo
levantamento detalhado da histria clnica do paciente, que
inclua o esclarecimento dos sintomas atuais com sua descrio
objetiva e detalhada, as circunstncias em que surgiram, se
houve ou no algum estressor que desencadeou ou agravou o
quadro, o grau de interferncia na vida social, nas atividades
profissionais dirias, nas relaes interpessoais e a intensidade
do sofrimento psquico; breve histrico do desenvolvimento
pessoal e de como ocorreu a ultrapassagem das diferentes
etapas evolutivas. Com base nas informaes apresentadas,
correto afirmar que esse procedimento usualmente recebe o
nome de
(A)
(B)
(C)
(D)
(E)

entrevista prvia.
anamnese.
biografia.
entrevista aberta.
histrico social.

A entrevista psicolgica um recurso tcnico utilizado nas


diversas reas do campo profissional e que ganha destaque no
contexto hospitalar. Acerca da entrevista no hospital, assinale
a alternativa correta.

(B)

(C)

(D)

(E)

importante focar a entrevista em seus objetivos,


no qual est incluso um tratamento humanizado ao
paciente, chamando-o pelo nome, respeitando-o
como pessoa, e fazer com que a entrevista seja ao
mesmo tempo emptica e til.
O psiclogo deve compartilhar com o entrevistado
o seu estado psquico, criando, assim, uma relao
de empatia.
Por meio da entrevista psicolgica, no possvel
perceber a relao que a pessoa faz com sua
doena e o significado que atribui internao.
No hospital, na maioria das vezes, a entrevista
psicolgica realizada em uma sala exclusiva, em
um ambiente privativo e isolado dos demais
pacientes, acompanhantes e integrantes da equipe
de sade.
Por meio da entrevista, no possvel levantar
dados sobre estilo de vida e comportamentos do
paciente que comprometeram ou colaboraram
com o desencadeamento, o desenvolvimento ou a
evoluo da doena.

QUESTO 41 ______________________
Os modelos de estratgias esto diretamente relacionados ao
sentido que a doena traz para cada doente. Na teoria do
Coping, esse sentido funciona como um ncleo cognitivo que
influencia as respostas afetivas e de motivao para enfrentar
a doena. Quanto aos sentidos mais comuns da doena na
nossa cultura, com suas respectivas caractersticas, assinale a
alternativa correta.
(A)

A doena como adversria pode ter o sentido de


uma falta que jamais poder ser substituda.
Observam-se depresso, agressividade, resistncia
aos meios de adaptao, podendo conduzir ao
suicdio.

CONCURSO PBLICO REA ASSISTENCIAL EBSERH

(C)

(D)

(E)

A doena, vista como uma estratgia provocada


pelo paciente, um sinal de perda de controle, tendo
implicaes morais negativas. Tentativa de escapar
da doena, que lhe traz sentimentos de vergonha.
Na doena, como uma perda ou um dano, e o
paciente se serve da doena como mediadora nas
suas relaes interpessoais. uma tcnica utilizada
para assegurar ateno, suporte, dependncia e
submisso da parte do outro.
Na doena, como fraqueza, pode ser uma soluo
de conflitos interiores e exteriores. O paciente tem
uma tendncia a prolongar a sua enfermidade.
Quando percebida como um desafio, a doena
considerada como qualquer outro acontecimento da
vida que impe exigncias e tarefas especficas, as
quais devem ser cumpridas por todos os meios
possveis. Inspira estratgias ativas e geralmente
adaptadas.

QUESTO 42 ______________________

QUESTO 40 ______________________

(A)

(B)

No contexto hospitalar, o delirium uma sndrome com


caractersticas muito especficas e muito encontrada em
pacientes internados nas UTIs. Com relao caracterizao
dessa sndrome, assinale a alternativa correta.
(A)
(B)
(C)
(D)
(E)

Tem um curso crnico.


causada por uma disfuno psicolgica.
Observa-se a diminuio da ateno voluntria.
H um aumento do nvel de conscincia.
H necessidade exclusiva de manejo psicolgico.

QUESTO 43 ______________________
A respeito da alucinao, correto afirmar que ela designa
uma alterao de
(A)
(B)
(C)
(D)
(E)

pensamento.
senso-percepo.
conscincia-vigilncia.
memria.
volio.

QUESTO 44 ______________________
O transtorno obsessivo-compulsivo tem como sintomatologia
importante a ansiedade. Trata-se de uma patologia psquica
que, quando grave, incapacitante. Quanto a esse transtorno,
assinale a alternativa correta.
(A)
(B)
(C)

(D)

(E)

Esse transtorno deve ser acompanhado apenas pela


psicologia, com uso da psicanlise.
O paciente no costuma ter conscincia do absurdo
de suas ideias.
A combinao de tratamento farmacolgico com
psicoterapia cognitivo-comportamental costuma
ser mais efetiva do que essas mesmas terapias
empregadas separadamente.
No que tange farmacoterapia, os inibidores
seletivos da recaptao da serotonina costumam ser
os mais efetivos.
Esse transtorno deve ser acompanhado apenas pela
psiquiatria, com uso de farmacoterapia, j que o
paciente no responde psicoterapia.

123 Psiclogo rea Hospitalar

PGINA 10/12

QUESTO 45 ______________________

QUESTO 47 ______________________

Levando-se em considerao o Cdigo de tica Profissional


do Psiclogo, assinale a alternativa correta quanto atuao
do psiclogo hospitalar.

A educao em sade est voltada para a melhoria da


qualidade de vida do indivduo e da coletividade. A respeito
desse assunto, assinale a alternativa que no corresponde aos
objetivos da educao em sade.

(A)

(B)

(C)

(D)

(E)

O psiclogo hospitalar deve compartilhar


informaes sigilosas com outros profissionais,
desde que eles faam parte de uma mesma equipe
de trabalho.
de responsabilidade do psiclogo, ao ingressar
em um hospital, considerar se h compatibilidade
entre as normas e prticas nele vigentes e o Cdigo
de tica Profissional do Psiclogo. Caso haja
conflito, dever seguir as normas e as regras do
hospital.
No caso de atendimento a idosos na geriatria, o
psiclogo hospitalar tem a obrigao de comunicar
aos responsveis quaisquer informaes solicitadas
por esses.
Quando requisitado a depor em juzo, o psiclogo
hospitalar no necessitar mais manter o sigilo
profissional,
podendo
prestar
quaisquer
informaes referentes ao caso.
O Cdigo de tica Profissional do Psiclogo prev
que o psiclogo poder decidir pela quebra de
sigilo, baseando sua deciso na busca do menor
prejuzo, como, por exemplo, preservar a vida do
paciente.

QUESTO 46 ______________________
A biotica surgiu para atender s questes ticas para as quais,
no estado atual do conhecimento, no existe resposta
satisfatria. Com relao a essa nova cincia, assinale a
alternativa correta.
(A)

(B)

(C)

(D)

(E)

A tica um campo de atuao e reflexo em


interface com as vrias reas da sade e do direito
que tratam das questes ligadas vida e morte.
O feto uma pessoa? A partir de quando? Qual a
nossa atitude diante do aborto. Quando a vida
termina? O ser humano em desenvolvimento
humano desde o momento da concepo? Esses so
exemplos de questes tratadas pela tica, mas no
pela biotica.
A biotica prope como princpios bsicos a justia,
a autonomia, a beneficncia, ou seja, fazer o bem,
no causar dano, e a no maleficncia.
A biotica surgiu no meio de pesquisas, nos
laboratrios, com os cientistas se questionando
sobre a tica envolvida em determinados
procedimentos cientficos de diversos campos do
conhecimento, tais como direito, medicina, religio,
filosofia, antropologia, teologia, psicologia, entre
outros.
tica e biotica so conceitos sinnimos.

CONCURSO PBLICO REA ASSISTENCIAL EBSERH

(A)
(B)
(C)
(D)

(E)

Conscientizar o indivduo para que considere a


sade como um valor.
Estimular a utilizao dos servios de sade.
Orientar o indivduo sobre o fato de que a sua sade
depende somente do Estado.
Incentivar o indivduo a cuidar de sua sade por
meio dos prprios esforos e aes, exercendo a
cidadania almejada.
Fornecer conhecimento com a finalidade de
estimular pacientes para efetivar mudanas em seu
comportamento.

QUESTO 48 ______________________
O tabagismo classificado pela Organizao Mundial de
Sade (OMS) como a principal causa evitvel de doena e
morte no mundo ocidental. Cerca de 90% dos fumadores
fumam todos os dias, podendo ser considerados dependentes
do tabaco. Nesses casos, a desabituao tabgica muito
difcil cerca de 70% dos fumadores declaram que gostariam
de deixar de fumar, mas apenas alguns conseguem. A
educao em sade tem contribudo significativamente para
preveno e controle desse tipo de doena nos ltimos 20
anos, principalmente quando se relaciona com os custos para
a sade, os quais podem ser reduzidos por meio desta
estratgia, pois ela busca
(A)
(B)
(C)
(D)

incrementar os riscos do tabagismo ativo.


promover a iniciao do tabagismo.
retardar a cessao do uso pelos fumantes.
capacitar os profissionais de sade e educao
para o gerenciamento e o desenvolvimento de
aes de controle do tabaco em suas redes de
atuao, governamentais ou no.
informar e mobilizar a populao sobre os
benefcios do tabagismo passivo.

(E)

QUESTO 49 ______________________
A Estratgia Sade da Famlia teve seu incio no Brasil no ano
de 1994, sendo um modelo de organizao dos servios de
ateno primria sade e mantm coerncia com os
princpios organizativos do Sistema nico de Sade (SUS).
Entre as caractersticas da organizao do Programa de Sade
da Famlia (PSF), encontra-se
(A)
(B)
(C)
(D)
(E)

cadastramento de famlias com adscrio de


clientela.
ampliao da necessidade de leitos hospitalares.
ampliao de agendas e encaminhamento para
consultas emergenciais.
priorizao de aes curativas.
funcionamento com base demanda espontnea.

123 Psiclogo rea Hospitalar

PGINA 11/12

QUESTO 50 ______________________
A reforma psiquitrica brasileira, entre outros aspectos,
consiste no progressivo deslocamento do centro do cuidado
para fora do hospital, em direo comunidade e aos Centros
de Ateno Psicossocial (CAPS). Com relao aos CAPS,
assinale a alternativa correta quanto constituio deles.
(A)

(B)

(C)

(D)

(E)

Velhos dispositivos de ateno sade mental


foram aproveitados estrategicamente para viabilizar
esse movimento.
Locais anexos e (ou) dentro dos hospitais
psiquitricos, que funcionam como pronto
atendimento, admitindo os usurios de determinado
territrio para recebimento de medicao
psiquitrica e realizao de consultas e internao a
longo prazo.
funo por excelncia dos CAPS desorganizar a
rede de ateno s pessoas com transtornos mentais
e usurios de lcool e outras drogas e encaminhar os
pacientes para hospitais psiquitricos.
Servios abertos e comunitrios do Sistema nico
de Sade (SUS) so referncia para o atendimento
de pessoas com transtornos mentais severos e (ou)
persistentes.
Servios que funcionam 24 horas por dia e atendem
s emergncias psiquitricas, que necessitam de
internao.
rea livre

CONCURSO PBLICO REA ASSISTENCIAL EBSERH

123 Psiclogo rea Hospitalar

PGINA 12/12

PROVA: EBSERH - UFBA


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: IADES

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

A
E
C
D
B
E
B
A
D
B
E
C
A

39
40
41
42
43
44
45
46
47
48
49
50

B
A
E
C
B
X
E
X
C
D
A
D

Coletnea de Provas | Concursos de Psicologia

Empresa Brasileira de Servios Hospitalares


Edital no 03, rea Assistencial, de 11/12/2013
Hospital Universitrio Maternidade Escola Janurio Cicco da Universidade
Federal do Rio Grande do Norte MEJC
Concurso Pblico para Provimento de Vagas e Formao de Cadastro de
Reserva em Empregos Pblicos Efetivos de Nvel Superior e Mdio

Data e horrio da
prova:

Realizao

Cargo 117

Psiclogo

rea Hospitalar

INSTRUES
caderno de questes
carto de respostas
caderno de questes

carto de respostas

fiscal do IADES

carto de respostas

A histria escrita pelos vencedores.


carto de respostas
caderno de questes
carto de respostas
IADES

carto de respostas
caneta esferogrfica de tinta preta

azul fabricada de

material transparente
IADES

bip

pager notebook tablet

walkman
palmtop;
fiscal do IADES

INSTRUES PARA A PROVA OBJETIVA


carto de respostas
carto de respostas
carto de respostas
carto de respostas
carto de respostas
azul

caneta esferogrfica preta

CONHECIMENTOS ESPECFICOS
Questes de 26 a 50

QUESTO 26 ______________________
Maria uma enfermeira de uma maternidade pblica. Acha
que somente suas ideias so importantes e desconsidera a
opinio dos outros membros da equipe de sade. A equipe
adota a postura de evitar se comunicar com ela.
Considerando a temtica das relaes humanas nessa
situao hipottica, assinale a alternativa correta.
As relaes humanas se caracterizam por uma atitude
de respeito, compreenso e valorizao do ser
humano, como a adotada pela enfermeira Maria.
A comunicao, embora importante, no
indispensvel para que os membros da equipe
interajam com o objetivo de alcanar objetivos
comuns.
Uma mudana no comportamento e na forma de
Maria se comunicar pode lev-la a uma melhoria na
eficcia de suas aes e no relacionamento
interpessoal com a equipe.
Dificuldades de comunicao tm pouca relevncia
nos desentendimentos entre membros de um grupo,
visto que tais problemas esto mais relacionados a
caractersticas individuais.
A comunicao envolve apenas aspectos no verbais.

QUESTO 27_______________________
Um bom relacionamento interpessoal vai contribuir para a
melhoria do trabalho em equipe. Para que possa existir um
bom relacionamento humano entre os integrantes de uma
equipe de sade, necessrio que exista entre seus membros
capacidade comunicativa.
Simpatia.
habilidade redacional.
rapidez de raciocnio.
alta rotatividade da equipe.

QUESTO 28_______________________
Considerando os fatores que facilitam o trabalho da equipe
multidisciplinar, assinale a alternativa correta.
Ausncia de reunies de equipe.
Humildade.
Baixa remunerao associada alta rotatividade de
profissionais.
Alta competitividade.
Individualismo.

QUESTO 29_______________________
Alguns conceitos so fundamentais para os psiclogos e
equipe de sade compreenderem as reaes emocionais do
paciente diante da doena e da hospitalizao. Assinale a
alternativa que correlaciona corretamente os conceitos com
as afirmativas que expressam sua definio.
Mecanismos de defesa so os sentimentos que o
profissional de sade deposita no paciente em
resposta ao lugar que o paciente o coloca.
Contratransferncia diz respeito a qualquer situao,
boa ou ruim, que exige do indivduo esforos
adaptativos. De modo geral, a doena grave ou
hospitalizao pode produzir essa reao medida
que so exigidos do indivduo esforos adaptativos a
nvel fsico, emocional e social.
Transferncia uma tendncia universal do paciente
trazer para a relao atual com o profissional de
sade sentimentos e conflitos originrios de
relacionamentos com pessoas importantes no incio
da vida.
A negao um mecanismo usado apenas pelos
profissionais de sade para lidar com os prprios
sentimentos na sua prtica.
A negao um mecanismo de defesa comum, por
meio do qual o profissional de sade evita o medo,
mas aumenta muito a ansiedade.

QUESTO 30_______________________
No contexto da sade mental na UTI, o delirium uma
sndrome com caractersticas muito especficas. Com relao
sua caracterizao, assinale a alternativa correta.
Tem um curso crnico.
causado por uma disfuno psicolgica.
Necessidade exclusiva de manejo psicolgico.
H um aumento do nvel de conscincia.
Observa-se a diminuio da ateno voluntria.
6

QUESTO 31 ______________________

QUESTO 33_______________________

Joo tinha 8 anos de idade quando recebeu o diagnstico de


portador de osteossarcoma (cncer sseo). Apresentava uma
tumorao aparente em fmur distal esquerdo. J na reunio
de admisso em equipe, foi colocado pelo mdico, que, aps
trs ciclos de quimioterapia, seria realizada uma amputao
do membro, em funo da idade do paciente. O relato da me

Em relao ao uso da psicoterapia no hospital geral, assinale


a alternativa correta.

gente ficou preocupado, s de saber que ele ia que sofrer com


o tratamento, em perder a perna e ficar um aleijado...
Inclusive eu e o pai dele falamos que a gente no ia deixar
ele fazer o tratamento... o pai dele, a famlia, o av dele, no
queriam de jeito nenhum deixar cortar a perna e nem fazer o
O
paciente acabou falecendo dez meses aps o diagnstico,
sem realizar qualquer tipo de tratamento. Agora, assinale a
alternativa correta quanto atuao da equipe de sade, nas
proposies a seguir.
Avisar a famlia sobre a amputao, trs meses antes
da cirurgia, uma forma inadequada de preparao
psicolgica para a mesma, pois uma estratgia que
aumenta a ansiedade.
Pode-se supor que a qualidade da relao mdicofamlia no deve ter contribudo para o desfecho
negativo do caso acima.
A atitude do mdico foi inadequada, pois provocou
comportamentos de esquiva por parte da famlia. No
deveria ter comunicado o diagnstico de cncer e a
perspectiva da amputao, sobretudo em se tratando
do caso de uma criana.
O caso de Joo tpico e mostra que, para pessoas
com cncer serem ajudadas, necessrio, alm de
orientao, uma escuta qualificada, oferecida pela
psicologia, para compreender o que est por trs da
dificuldade de adeso.
A famlia afeta o processo de adeso ao tratamento
oncolgico, pois parte integrante dele, mas no
por esta razo que devemos ver a famlia tambm

QUESTO 32 ______________________
A avaliao psicolgica realizada no contexto hospitalar
utiliza-se de recursos semelhantes ao usados no contexto de
consultrio clnico, entre eles a anamnese. A respeito desse
recurso, Cunha (2000) afirma que a anamnese pressupe
um levantamento da histria psiquitrica pregressa e
das condies de vida do paciente.
a histria clnica, ou seja, a histria da doena atual.
a caracterizao da emergncia de sintomas ou de
mudanas comportamentais, em determinada poca e
a sua evoluo at o momento atual.
a entrevista com diversos familiares, para uma
compreenso da dinmica individual do paciente.
uma reconstituio global da vida do paciente, como
um marco referencial em que a problemtica atual,
como a doena, se enquadra e ganha significao.

A interveno psicolgica deve ser norteada pela


psicoterapia breve e de apoio na maioria dos casos.
Ao adotar a psicoterapia de longo prazo no hospital,
o psiclogo reala o aspecto preventivo de sua
interveno, pois, ao focar nas questes relativas ao
adoecimento, internao e ao tratamento, evita a
progresso do desequilbrio psicolgico do paciente.
As psicoterapias de apoio so indicadas para
pacientes em situaes de crise, no devendo jamais
ser utilizada com pacientes de patologia crnica, com
processos irreversveis ou incurveis.
As tcnicas de psicoterapia individual foram
delimitadas no contexto hospitalar como as de maior
coerncia e eficcia.
Para os casos ambulatoriais, dever ser adotada a
psicoterapia por tempo prolongado, duas vezes por
semana.

QUESTO 34_______________________
As instituies, como um hospital, podem ser definidas como
as normas (culturais, histricas, sociais) que formam a trama
social que une os indivduos uma dimenso fundamental
que une e atravessa todos os nveis da rede social. A anlise
institucional tem como objetivo
analisar os fenmenos arquitetnicos e ambientais
dos hospitais.
transformar as instituies de acordo com as prticas
e os discursos dos seus gestores.
denunciar os casos de assdio moral.
propiciar que determinado grupo de uma instituio
se torne capaz de autoanalisar-se e de gerenciar suas
prprias questes.
identificar dificuldades econmicas das instituies e
indicar profissionais a serem demitidos.

QUESTO 35_______________________
Em um hospital pblico, um grupo de pacientes invade a
reunio de equipe e, aos gritos, protesta contra a morosidade
do atendimento as longas filas, a ausncia de material, a falta
de mdicos e enfermeiros, a curta durao das consultas. Em
uma tica de anlise institucional socioanaltica, tal
acontecimento deveria ser
levado a direo do hospital, a fim de que a
instituio volte a funcionar harmoniosamente e sem
conflitos.
contornado com cuidado e discutido internamente na
equipe tcnica, com a presena de um analista ou
supervisor institucional.
acolhido como reivindicao e encaminhado aos
rgos representativos das categorias, visando a
solues posteriores.
interpretado em uma reunio posterior da equipe
tcnica, pois se trata de um sintoma institucional.
enfatizado como um possvel provocador de uma
anlise coletiva e generalizada das contradies
institucional.
7

QUESTO 36 ______________________
A escola promotora de sade torna-se importante e poderosa
estratgia para o desenvolvimento de aes e de reflexo. Por
essa razo, tem sido um espao privilegiado para aes de
educao em sade. O Programa Sade na Escola (PSE)
estabelece a parceria entre as polticas de educao e sade,
institudo em 2007, por meio do Decreto no 6.286/2007
(Brasil, 2007). Pensando na relao escola e sade correto
afirmar:
Escola promotora de sade aquela na qual alunos,
professores, funcionrios, pais e familiares atuam
isoladamente para melhorar a qualidade de vida, a
educao, a sade e o ambiente em que vivem.
A educao em sade, em seus primrdios no Brasil,
surgiu associada ideia de se usar o espao escolar
para promoo da sade com a criao de um peloto
de sade em uma escola de So Paulo.
A associao entre promoo de sade e escola traz,
em si, a percepo de que a sade muito mais
produto da educao do que da biologia ou da
gentica.
O PSE tem como propsito contribuir para a
formao integral dos pais, e no dos estudantes da
rede pblica de educao bsica, por meio de aes
de preveno, promoo e ateno sade.
O PSE tem como objetivo principal que os gestores
escolares aprendam e se desenvolvam com vistas
melhoria da qualidade de vida das pessoas de toda a
comunidade.

QUESTO 37 ______________________
A dcada de 1990 testemunhou, nas democracias ocidentais,

QUESTO 38_______________________
por que, no comeo da gravidez, eu no queria ele, pelas
vezes que fui impaciente com seu choro. Acho que todas
mes sentem-se fracassadas como eu ... para mim at
mesmo um pecado continuar vivendo depois que se perde um
vida h trs anos). Considerando a situao hipottica,
assinale a alternativa que mais se adequa posio do
psiclogo diante dessa situao.
Desestimular a expresso de sentimentos e procurar
desculpabiliz-la.
Suspeitar do desenvolvimento de luto patolgico e
atentar para o risco de suicdio da me e
encaminh-la para acompanhamento psiquitrico.
O relato apresentado, no d indcios de
rebaixamento de autoestima e empobrecimento do
ego que marcam a diferena entre luto e melancolia,
por isso no necessrio fazer um diagnstico
diferencial entre eles.
Promover um processo de elaborao do luto, em
que o afeto (libido) que havia sido destinado para o
objeto amado (me), que deixou de existir, possa
continuar nele e no retornar para o prprio sujeito
(filho).
Suspeitar que se trata de um caso de stress
ps-traumtico.

QUESTO 39_______________________
A entrevista psicolgica um recurso tcnico utilizado nas
diversas reas do campo profissional e que ganha destaque
no contexto hospitalar. A respeito da entrevista no hospital,
assinale a alternativa correta.

busca
implementados, em diversos pases da Amrica Latina,
inclusive no Brasil, sistemas de avaliao das polticas
pblicas de escopo varivel. A respeito dessa temtica
correto afirmar que
a poltica de avaliao no Brasil segue, ainda hoje,
uma tendncia inversa da adotada pelos pases
desenvolvidos.
no Brasil o movimento de constituio de uma
poltica de avaliao articulada gesto muito
antiga.
reforou-se, no Brasil, a ideia de que uma poltica de
avaliao para subsidiar os sistemas de gesto e
controle do Estado era desnecessria.
a poltica de avaliao no Brasil foi introduzida com
diretrizes que acabaram por reforar abordagens
fragmentrias e conservadoras, com a dissociao
dos processos avaliativos j em curso, uma tendncia
inversa da adotada pelos pases desenvolvidos.
ocorreu uma desvalorizao da avaliao como algo
capaz de instrumentar os pases nos seus processos
decisrios.

Por meio da entrevista psicolgica, no possvel


perceber a relao que a pessoa faz com sua doena e
o significado que atribui internao. Por isso, o
psiclogo deve utilizar apenas testes psicomtricos
em suas avaliaes.
No cabe entrevista a funo teraputica medida
que esta, apesar de propiciar a verbalizao,
manifestao, reflexo, no promove a elaborao e
adaptao condio de Ser ou Estar doente.
Os dados colhidos na entrevista psicolgica so de
fundamental importncia para nortear o trabalho do
mdico e complementam o diagnstico da doena.
A entrevista psicolgica no adequada para
explorao do contexto vivencial do paciente sobre
estilo de vida e comportamentos que comprometeram
ou colaboraram com o desencadeamento, o
desenvolvimento ou a evoluo da doena.
No hospital, na maioria das vezes, a entrevista
psicolgica realizada ao lado do leito do paciente,
em um ambiente adaptado e compartilhado por
demais integrantes da equipe de sade e (ou) por
familiar e acompanhante do paciente. Por isso, a
privacidade relativa.

QUESTO 40 ______________________

QUESTO 43_______________________

A realizao de entrevista clnica considerada uma das


principais competncias do psiclogo, independentemente de
sua abordagem terica. Com relao ao procedimento de
entrevista clnica, assinale a alternativa correta.

Maria, me de Francisca, portadora de uma fissura

A entrevista clnica define-se pelo seu carter


fechado, em que o entrevistado conduz os contedos
tratados.
Existem diferentes fases da entrevista, e os autores
concordam com a existncia de uma fase de
introduo, uma de explorao, uma de teste de
hiptese e, finalmente, uma fase de feedback
(devoluo da informao).
O silncio deve ser evitado durante as primeiras
entrevistas, uma vez que ele indicador da
resistncia do cliente interveno.
Refere-se ao processo de empatia estabelecido pelo
entrevistado para com o entrevistador, que
favorecer a troca de informaes e a ajuda mtua
para que o processo psicoteraputico obtenha
sucesso.
A relao deve ser hierarquizada, em que o
entrevistador detm poder sobre o entrevistado,
criando situaes de presso para observar
comportamentos que se manifestem inadequados.

QUESTO 41 ______________________
Entre os servios de sade, os de ateno bsica apresentam
contexto privilegiado para desenvolvimento de prticas
educativas em sade por
serem caracterizados pela maior proximidade com a
populao e pela nfase nas aes preventivas e
promocionais.
ser necessrio conhecer os indivduos para os quais
se destinam as aes de sade, incluindo suas
crenas, hbitos e papis, e as condies objetivas
em que vivem.
por ser preciso envolver os indivduos nas aes,
para, s depois de identificar suas crendices e
preconceitos, reeduc-los, introduzindo-os nas
prticas normalizadoras da educao em sade.
ser objetivo atual da educao em sade transformar
saberes existentes e, no, de informar para sade.
ser o espao onde normalmente ocorrem as
campanhas de vacinao.

QUESTO 42 ______________________
Dentro da temtica da sade mental, o suicdio , sem
dvida, a manifestao mais evidente de ruptura de equilbrio
que requer uma interveno em crise. Em se tratando de uma
paciente suicida, qual dos desejos preponderantes aumenta a
resistncia a uma interveno psicolgica?
Desejo de apelo.
Desejo de cesura.
Desejo de morrer.
Desejo de ateno.
Desejo de ajuda.

separar de minha filha na cirurgia e na internao. Fui para o


grupo de pais com as psiclogas, ortodentistas, mdicos,
assistentes sociais e enfermeiras, que acontece toda semana
na enfermaria e lutamos muito, at que conseguimos
atendimento em grupo descrito por Maria uma ferramenta
privilegiada pelos psiclogos hospitalares e so normalmente
denominados de
grupos Balint.
grupos sociais.
grupos de orientao e apoio.
grupos de controle.
grupos psicanaltico.

QUESTO 44_______________________
Em equipes multiprofissionais, a participao do psiclogo
requer alguns cuidados para se manter uma postura tica. O
atual Cdigo de tica Profissional do Psiclogo recomenda
o arquivamento dos documentos elaborados por um
perodo de, pelo menos cinco, anos.
o registro integral e detalhado de relatos dos
atendimentos no pronturio do paciente, para que a
equipe possa ter acesso a todas as informaes.
quando o psiclogo participar de greves, deve
paralisar todos os seus atendimentos, inclusive os
servios emergenciais.
quando o paciente encaminhado por profissionais
ou instituies externas, o psiclogo de instituies
pblicas pode receber o pagamento de um percentual
da remunerao inicial do tratamento.
o emprstimo de instrumentos da psicologia para
aplicao por outros profissionais da equipe.

QUESTO 45_______________________
Relacionando uma crise teoria de Coping, utilizada pelos
psiclogos da sade, correto afirmar que
um evento estressor sempre percebido como
negativo, por isso torna-se uma ameaa quando h
uma falncia dos modos de enfrentamento e
adaptao, podendo levar a uma crise.
as pessoas esto merc dos estressores. Por isso,
so passivas e reagem de modo pouco adaptativo s
situaes de estresse.
o modo de enfrentamento de uma crise pode ser
determinado por histria passada, seus valores e
crenas pessoais, mas tem pouco a ver com a
avaliao da situao e com seus recursos pessoais e
sociais disponveis para serem usados na situao.
o conceito de Coping se aproxima do conceito de
crise, pois trata-se de um processo de manejo de
demandas (internas ou externas) que so avaliadas
como sobrecarregando ou excedendo os recursos do
indivduo.
o conceito de Coping diz respeito a qualquer
situao, boa ou ruim, que exige do indivduo
esforos adaptativos.
9

QUESTO 46 ______________________
Considerando o Cdigo de tica Profissional do Psiclogo,
para atuao do psiclogo hospitalar, correto afirmar que
o
psiclogo
hospitalar
deve
compartilhar
informaes sigilosas com outros profissionais no
psiclogos, desde que eles faam parte de uma
mesma equipe de trabalho.
de responsabilidade do psiclogo, ao ingressar em
um hospital, considerar se a misso, a filosofia, as
polticas, as normas e as prticas nela vigentes so
compatveis com princpios e regras do Cdigo de
tica Profissional do Psiclogo.
os psiclogos regidos pelos princpios da biotica e
no pelo cdigo de tica profissional que vlido
para os demais psiclogos na rea da sade.
o psiclogo hospitalar no poder mais manter o
sigilo profissional, devendo prestar quaisquer
informaes referentes ao caso, quando requisitado a
depor em juzo.
o psiclogo hospitalar tem a obrigao de comunicar
aos responsveis quaisquer informaes solicitadas
por esses, no caso de atendimento a crianas na
pediatria.

QUESTO 47 ______________________
O tabagismo classificado pela Organizao Mundial de
Sade (OMS) como a principal causa evitvel de doena e
morte no mundo ocidental. Cerca de 90% dos fumadores
fuma todos os dias, podendo ser considerados dependentes
do tabaco. Nesses casos, a desabituao tabgica muito
difcil cerca de 70% dos fumadores declara que gostaria de
deixar de fumar, mas apenas alguns conseguem. No Brasil, o
Programa Nacional de Controle do Tabagismo, por meio de
suas aes educativas, busca
capacitar os profissionais de sade e educao para
gerenciamento e desenvolvimento de aes de
controle do tabaco em suas redes de atuao,
governamentais ou no.
promover a iniciao do tabagismo.
retardar a cessao do uso pelos fumantes.
incrementar os riscos do tabagismo ativo.
informar e mobilizar a populao sobre os benefcios
do tabagismo passivo.

QUESTO 48 ______________________
Com relao ao paciente alcoolista e ao
farmacodependente, assinale a alternativa correta.

paciente

Entre as emergncias psiquitricas, aquelas


relacionadas ao uso de lcool e farmacodependentes
esto entre as menos importantes, pois so as menos
frequentes e de menor gravidade.
Pacientes alcoolizados e farmacodependentes,
geralmente, chegam ao pronto-socorro dos hospitais
gerais devido a comportamentos auto ou
heteroagressivos, trazidos por policiais ou parentes.
Raramente necessria a conteno mecnica para
realizar a avaliao clnica, psiquitrica e
psicolgica.

Em geral, tanto o paciente alcoolista como os


farmacodependente
procuram
pacientes
espontaneamente os servios de atendimento em
sade.
A primeira conduta a ser feita pelo profissional de
sade quando pacientes com essa problemtica
chegam ao pronto-socorro, com sndrome de
abstinncia ou de intoxicao, fazer uma censura
sobre o comportamento ilcito e encaminhar para o
servio policial proceder aos enquadres legais.

QUESTO 49_______________________
O Programa de Humanizao ao Pr-natal e Nascimento PHPN (Brasil, 2000) possui alguns objetivos, entre eles
encontra-se:
Reduzir as altas taxas de mortalidade materna e
perinatal, ampliar o acesso ao pr-natal
exclusivamente para gestantes usurias de crack e
outras drogas.
Promover os vnculo entre a assistncia e o parto
domiciliar.
Realizar um trabalho preventivo gestante usuria
de crack e outras drogas, estando ela em tratamento
de desintoxicao ou no, como forma de fortalecer
os vnculos familiares e a reinsero social.
Estabelecer os critrios para qualificar a assistncia e
um sistema de informaes SISPRENATAL para
fiscalizar o cumprimento deles.
Definir os pais como os nicos acompanhantes
possveis no momento do parto.

QUESTO 50 ______________________
A despeito da insero dos psiclogos nas equipes
interdisciplinares, apenas em 1997 que a American
Psychological Association (APA) oficializou a especialidade
da psicologia no contexto da sade. De acordo com a APA,
assinale a alternativa correta.
O nome conferido a essa nova rea, por essa
associao, foi psicologia hospitalar.
A atuao do psiclogo da sade independe do
contexto, podendo ocorrer em hospitais, centros de
sade comunitrios, PSF, organizaes no
governamentais, domiclios, empresas, escolas, entre
outros.
Essa nova especialidade aplica seus princpios,
tcnicas e conhecimentos nos problemas inerentes ao
processo sade-doena, tendo por base o modelo
psicossomtico.
Foi a partir do questionamento a respeito do modelo
biopsicossocial que novos modelos de interveno,
incluindo outras disciplinas da sade, como a
psicologia.
Ainda nos anos de 1970, surgem duas reas de
atuao: a psicologia da sade e a medicina
que,
por
causa
da
comportamental,
contemporaneidade, so consideradas como termos
sinnimos pelos autores.

10

PROVA: EBSERH - UFRN


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: IADES

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

C
A
B
C
E
D
E
A
D
E
C
D
B

39
40
41
42
43
44
45
46
47
48
49
50

E
B
A
C
C
A
D
B
A
B
X
B

Coletnea de Provas | Concursos de Psicologia

Governo do Distrito Federal


Edital no 1, Metr-DF, de 12/12/2013
Secretaria de Estado de Administrao Pblica do Distrito Federal
Concurso Pblico para Provimento de Vagas e Formao de Cadastro Reserva
para o Metr-DF

Cargo 111
Psiclogo
Data e horrio da prova: Domingo, 20/4/2014, s 8h30
INSTRUES

Voc receber do fiscal:


o um caderno de questes da prova objetiva contendo 50 (cinquenta) questes de mltipla escolha, com 5 (cinco) alternativas
de resposta cada uma, e apenas uma alternativa correta;
o um carto de respostas tico personalizado.
Verifique se a numerao das questes, a paginao do caderno de questes e a codificao do carto de respostas tico esto
corretas.
Quando autorizado pelo fiscal do IADES, no momento da identificao, escreva no espao apropriado do carto de respostas,
com a sua caligrafia usual, a seguinte frase:

Amigos distantes, abrace-os.

Voc dispe de 4 (quatro) horas para fazer a prova objetiva, devendo controlar o tempo, pois no haver prorrogao desse prazo.
Esse tempo inclui a marcao do carto de respostas tico.
Somente ser permitido levar o caderno de questes da prova objetiva aps 3 (trs) horas do incio da prova.
Somente aps decorrida 1 (uma) hora do incio da prova, voc poder entregar seu carto de respostas tico e retirar-se da sala.
Aps o trmino da prova, entregue ao fiscal do IADES o carto de respostas devidamente assinado.
Deixe sobre a carteira apenas o documento de identidade e a caneta esferogrfica de tinta preta ou azul, fabricada de material
transparente.
No permitida a utilizao de qualquer aparelho eletrnico de comunicao. Desligue e guarde em embalagem fornecida pelo
fiscal do IADES: mquina fotogrfica; telefone celular; relgio; gravador; bip; receptor; pager; notebook; tablet eletrnico; walkman;
aparelho porttil de armazenamento e de reproduo de msicas, vdeos e outros arquivos digitais; agenda eletrnica; palmtop;
rgua de clculo; mquina de calcular e (ou) qualquer outro equipamento similar.
No permitida a consulta a livros, dicionrios, apontamentos e apostilas.
Voc somente poder sair e retornar sala de aplicao de provas na companhia de um fiscal do IADES.
No ser permitida a utilizao de lpis em nenhuma etapa da prova.

INSTRUES PARA AS PROVAS OBJETIVA E DISCURSIVA

Verifique se os seus dados esto corretos no carto de respostas da prova objetiva e na folha de respostas da prova
discursiva. Caso haja algum dado incorreto, escreva apenas no(s) campo(s) a ser(em) corrigido(s), conforme instrues no carto
de respostas.
Leia atentamente cada questo e assinale, no carto de respostas tico, uma nica alternativa.
O carto de respostas tico e a folha de respostas da prova discursiva no podem ser dobrados, amassados, rasurados ou
manchados e nem podem conter nenhum registro fora dos locais destinados s respostas.
A maneira correta de assinalar a alternativa no carto de respostas cobrir, fortemente, com caneta esferogrfica preta ou azul,
o espao a ela correspondente.
Marque as respostas assim:

(E)

CONHECIMENTOS ESPECFICOS
Questes de 26 a 50

Os projetos no podem ser analisados segundo sua


localizao.

QUESTO 26 _____________________

QUESTO 29 _____________________

No que diz respeito atrao e reteno de talentos nas


organizaes, assinale a alternativa correta.

Quanto avaliao do desempenho, assinale a alternativa


correta.

(A)
(B)

(C)

(D)
(E)

O recrutamento integra o processo de agregar pessoas


e funciona logo aps a seleo.
Enquanto o objetivo da seleo abastecer o processo
seletivo de candidatos, o objetivo do recrutamento
escolher e classificar os candidatos mais adequados s
necessidades do cargo e da organizao.
O processo seletivo pode estar fundamentado no cargo
a ser preenchido ou nas competncias a serem
capturadas.
A seleo de pessoal no um sistema de comparao,
mas sim de escolha (tomada de deciso).
A entrevista de seleo considerada uma tcnica
altamente objetiva, com baixa margem de erro e
variao.

QUESTO 27 _____________________

(A)

(B)

(C)

(D)

(E)

Com relao aos aspectos relacionados gesto do


conhecimento, assinale a alternativa correta.
(A)
(B)

(C)

(D)

(E)

O conhecimento explcito altamente pessoal,


subjetivo, informal e experimental.
As organizaes so as grandes interessadas em obter
vantagem competitiva, logo no existem barreiras
organizacionais criao do conhecimento, e sim
individuais.
O capital intelectual representa o inventrio de
conhecimentos gerados pela organizao, e que no
podem ser expressos como tecnologia.
Os administradores precisam controlar a criao do
conhecimento, o que se chama promoo do
conhecimento, ou seja, o conjunto geral de atividades
organizacionais que afetam positivamente o controle
do conhecimento em seus cinco subprocessos.
Quando o conhecimento para de evoluir, transformase em uma opinio ou dogma.

QUESTO 28 _____________________
Uma das alternativas gerenciais que, nos ltimos anos, tem-se
mostrado bastante atraente, como opo para os executivos
das empresas, o gerenciamento de projetos. A esse respeito,
assinale a alternativa correta.
(A)
(B)

(C)

(D)

Temporalidade significa curta durao, pois projetos


no podem durar anos.
A incerteza e a complexidade so dimenses
raramente utilizadas em tipologias de projetos para
caracteriz-los.
Um dos mtodos mais utilizados na maioria dos
softwares disponveis para gesto de projetos o
diagrama de precedncia (Preceeding Diagramming
Method PDM).
O grfico ou diagrama de Gantt uma tcnica
raramente utilizada para elaborao de cronogramas
de projeto.

CONCURSO PBLICO METR-DF

A avaliao do desempenho pode ser feita pelo


gerente, pela equipe de trabalho, pelo rgo de
recursos humanos ou pela comisso de avaliao, mas
jamais pela prpria pessoa.
A avaliao do desempenho no tem aplicaes em
todos os processos de gesto de pessoas, ou seja, sua
aplicao limita-se aos processos de aplicar e de
monitorar indivduos.
A avaliao do desempenho um processo esttico,
fundamentado em mtodos especficos que servem,
exclusivamente, para avaliar e medir o potencial de
desenvolvimento de um indivduo.
Na avaliao para cima, o comando democrtico e
participativo do superior passa a ser substitudo por
um comando burocrtico e centralizador do poder.
A comisso de avaliao do desempenho costuma ser
bastante criticada por seu aspecto fortemente
centralizador e pelo seu esprito de julgamento quanto
ao passado.

QUESTO 30 _____________________
Considerando os prs e os contras da avaliao do
desempenho por escolha forada, correto afirmar que esse
mtodo
(A)
(B)
(C)
(D)
(E)

tira a influncia pessoal do avaliador, isto , a


subjetividade.
requer treinamento dos avaliadores para sua
aplicao.
proporciona uma viso global dos resultados da
avaliao.
provoca retroao de dados.
bastante conclusivo a respeito dos resultados.

QUESTO 31 _____________________
A respeito de cultura organizacional, assinale a alternativa
correta.
(A)

(B)

(C)

(D)
(E)

111 Psiclogo

A cultura organizacional percebida ou observada em


si mesma, e no por meio de seus efeitos e suas
consequncias.
A sobrevivncia e o crescimento de uma organizao
existem na medida em que tanto a estabilidade como
a adaptabilidade e a mudana so possveis.
Uma organizao pouco estvel e altamente mutvel
tem muito menos probabilidade de desaparecer do
mapa do que uma organizao pouco adaptativa,
rgida e imutvel.
A cultura de uma organizao sempre ajuda a
melhorar o desempenho do indivduo.
Valores compartilhados constituem o primeiro nvel
da cultura, o mais visvel, perceptvel e difundido.

PGINA 7/13

QUESTO 32 _____________________

QUESTO 35 _____________________

A cultura organizacional apresenta algumas caractersticas


bsicas. De acordo com Chiavenato (2010), assinale a
alternativa que melhor caracteriza as polticas que afirmam as
crenas acerca de como os empregados ou clientes devem ser
tratados.

Considerando as ideias de Herzberg para enriquecer tarefas e


estimular os fatores motivacionais, assinale a alternativa
correta.

(A)
(B)
(C)
(D)
(E)

Regularidade nos comportamentos observados.


Normas.
Valores dominantes.
Filosofia.
Regras.

(A)

(B)

QUESTO 33 _____________________

(C)

No que se refere cultura e socializao organizacional,


assinale a alternativa correta.
(A)

(B)

(C)

(D)

(E)

O grau em que o novo membro da organizao deve


aprender os valores, as normas e os padres de
comportamento independe do nvel de socializao
exigido pela organizao.
Diferentemente da seleo de candidatos e da
integrao no cargo, o reconhecimento e a promoo
de pessoas no so considerados meios de
socializao nas organizaes.
Algumas vezes, a socializao organizacional exige
uma fase destrutiva ou descongeladora dos valores
e dos padres de comportamento previamente
aprendidos pelo novo membro em outras
organizaes.
A socializao funciona como o esquema de recepo
e de boas-vindas aos novos participantes, e no como
elemento de manuteno da cultura organizacional.
A cultura de uma organizao est relacionada
aceitao implcita de seus membros, e jamais pode
ser reforada pelo processo de seleo.

QUESTO 34 _____________________
Quanto motivao, satisfao e ao envolvimento no
trabalho, incluindo as teorias a respeito do tema, assinale a
alternativa correta.
(A)

(B)

(C)

(D)

(E)

A satisfao no trabalho se refere unicamente ao nvel


de contentamento com o sistema de recompensas e
remunerao.
O envolvimento no trabalho diz respeito aos afetos
dirigidos organizao, ao trabalho ou carreira, e
no ao nvel de identificao ou de afinidade com o
trabalho realizado.
Assim como Maslow, Alderfer afirmou que a
motivao da conduta humana obedeceria a um
sentido apenas progressivo, ou seja, ascendente.
Motivao pode ser definida como uma ao dirigida
a objetivos, sendo autorregulada, biolgica ou
cognitivamente, persistente no tempo e ativada por um
conjunto de necessidades, emoes, valores, metas e
expectativas.
A Teoria Y, de McGregor, trouxe tona a ideia de que
o desempenho do homem no trabalho um problema
mais de natureza motivacional do que gerencial.

CONCURSO PBLICO METR-DF

(D)

(E)

A pessoa no deve programar o respectivo trabalho,


pois essa preocupao deve ser do seu chefe ou
superior imediato. Ela deve se preocupar com o
prprio desempenho, j que assim se sentir motivada
ao ver sua produo.
A pessoa deve ter o controle sobre o que faz, e no do
que precisa para faz-lo.
A tarefa deve proporcionar pessoa a informao
direta de retorno a respeito de seu bom desempenho e
a informao indireta de retorno acerca de seu mau
desempenho, ou seja, a retroinformao nem sempre
essencial.
Todo trabalho deve ter qualidades ou caractersticas
nicas, e a pessoa deve ter oportunidade de responder
pelo que faz e pelos resultados que consegue alcanar.
Toda pessoa deve ter oportunidade de aprender novas
tarefas, e no novas habilidades.

QUESTO 36 _____________________
Assinale a alternativa correta quanto tcnica cognitiva em
que, usualmente, os pacientes constroem uma hierarquia das
situaes temidas e se imaginam, nas diversas circunstncias,
sob um estado de relaxamento, incompatvel com o estado de
ansiedade.
(A)
(B)
(C)
(D)
(E)

Comprovao da realidade.
Dessensibilizao sistemtica.
Soluo de problemas.
Distrao.
Modificao do componente afetivo.

QUESTO 37 _____________________
Em relao s tcnicas utilizadas na terapia cognitiva, assinale
a alternativa correta.
(A)

(B)

(C)

(D)
(E)

111 Psiclogo

A representao de papis deve ser aplicada apenas a


situaes que requerem uma resposta assertiva, ou
seja, essa tcnica no cabe em situaes que requerem
outras habilidades sociais, como educar os filhos.
No treinamento assertivo, o paciente inicialmente
desencorajado a identificar situaes-problemas que
lhe causam significativa ansiedade, a fim de conseguir
um nvel de relaxamento mais apropriado para,
posteriormente, poder modelar seu comportamento.
Comprovao da realidade uma tcnica que tenta
provocar uma descrio imprecisa de uma situao, ao
considerar a informao dos fatos reais.
Nas tcnicas de reatribuio, o paciente deve explorar
e considerar todos os fracassos a uma nica causa.
Tanto o relaxamento muscular progressivo quanto o
relaxamento autgeno so aconselhveis como parte
da dessensibilizao sistemtica.
PGINA 8/13

QUESTO 38 _____________________

(E)

Quanto ao absentesmo nas organizaes de trabalho, assinale


a alternativa correta.
(A)
(B)

(C)

(D)

(E)

O absentesmo tambm chamado de ausentismo,


turnover ou desligamento.
Considera-se que ausncias so faltas ao trabalho por
motivos evitveis, e no faltas ou atrasos por motivo
de doena.
O absentesmo refere-se ao desligamento das pessoas
das organizaes, o que corresponde admisso de
um substituto.
Existem dois tipos de absentesmo: o que se refere ao
desligamento por iniciativa do funcionrio e o que se
relaciona ao desligamento por iniciativa do
colaborador.
O ndice de absentesmo pode tanto ser mensal como
anual e pode ser calculado por meio de uma frmula
matemtica.

QUESTO 39 _____________________

QUESTO 41 _____________________
Com base no DSM-IV, assinale a alternativa correta.
(A)

(B)

(C)

(D)

(E)

Considerando os transtornos somatoformes descritos no


DSM-IV, assinale a alternativa correta.
(A)

(B)

(C)

(D)
(E)

O transtorno de somatizao (historicamente chamado


de histeria ou sndrome de Briquet) um transtorno
polissintomtico que se inicia antes dos 30 anos de
idade.
A hipocondria (tambm conhecida como transtorno
conversivo) a preocupao com o medo ou a ideia
de ter uma doena grave, com base em uma
interpretao errnea de sintomas ou funes
corporais.
A caracterstica essencial do transtorno dismrfico
corporal uma preocupao acentuadamente
excessiva com um defeito imaginado na aparncia,
ou seja, tal preocupao no pode estar relacionada a
uma anomalia fsica real.
No transtorno dismrfico corporal, a preocupao no
est limitada aparncia fsica.
No transtorno conversivo, os sintomas so
intencionalmente produzidos ou simulados, como no
transtorno factcio ou na simulao.

QUESTO 40 _____________________

(B)

(C)
(D)

O nvel de satisfao no trabalho pode afetar a


rotatividade, mas no o absentesmo, uma vez que este
afetado por barreiras externas ao trabalho, tais como
doenas ou responsabilidades particulares.
O termo absentesmo relaciona-se a estar ausente do
local de trabalho (seja por faltas ou atrasos), bem
como a permanecer presente fisicamente, mas sem
ao e comprometimento (presena fsica e ausncia
mental).
A gesto do problema de ausncia ainda no capaz
de trazer retornos favorveis.
No se pode afirmar que o absentesmo afetado pela
capacidade profissional das pessoas.

CONCURSO PBLICO METR-DF

Em se tratando de episdio depressivo maior em


crianas e adolescentes, o humor no pode ser irritvel
em vez de triste.
Os indivduos com um episdio manaco
frequentemente reconhecem que esto doentes, porm
resistem s tentativas de tratamento.
O transtorno de dficit de ateno/hiperatividade e um
episdio manaco so ambos caracterizados por
atividade excessiva, comportamento impulsivo, fraco
julgamento e negao dos problemas.
As compulses so comportamentos repetitivos (e no
atos mentais), cujo objetivo prevenir ou reduzir a
ansiedade ou o sofrimento.
A ansiedade ou esquiva a locais ou a situaes, das
quais poderia ser difcil escapar ou nas quais o auxlio
poderia no estar disponvel, denominada de
agarofobia.

QUESTO 42 _____________________
Considerando as ideias propostas por Alfred Adler, assinale a
alternativa correta.
(A)

(B)

(C)
(D)

(E)

No que se refere ao tema do absentesmo, assinale a alternativa


correta.
(A)

A motivao para a assiduidade afetada por prticas


organizacionais, bem como por atitudes, valores e
objetivos dos empregados.

Alfred Adler criou uma imagem da natureza humana


que mostra as pessoas como vitimadas pelos instintos
e conflitos, e condenadas por foras biolgicas e
experincias da infncia.
Segundo Adler, a personalidade no moldada pelo
ambiente e interaes sociais peculiares, mas sim
pelos esforos para satisfazer as necessidades
biolgicas.
Para Adler, assim como para Freud, o inconsciente
o centro da personalidade.
Adler achava que os sentimentos de inferioridade
estavam sempre presentes como fora motivadora no
comportamento.
Adler acreditava que a pessoa no podia criar um
estilo de vida apropriado.

QUESTO 43 _____________________
De acordo com Hackman e Oldham, a dimenso do cargo em
que a pessoa deve ter uma clara percepo de como o seu
trabalho produz consequncias e impactos sobre o trabalho das
outras denominada
(A)
(B)
(C)
(D)
(E)

111 Psiclogo

significado da tarefa.
retroao do prprio trabalho.
retroao extrnseca.
inter-relacionamento.
identidade da tarefa.

PGINA 9/13

QUESTO 44 _____________________

(E)

Com relao entrevista clnica no contexto diagnstico,


assinale a alternativa correta.
(A)

(B)

(C)

(D)
(E)

Quanto ao aspecto formal, as entrevistas podem ser


divididas em estruturadas ou semiestruturadas, sendo
estas tambm conhecidas como entrevistas de livre
estruturao.
A finalidade maior de uma entrevista sempre a de
descrever e avaliar para oferecer alguma forma de
retorno.
Na entrevista psicodinmica, a investigao do
desenvolvimento psicossexual algo irrelevante ou de
pouca importncia.
A entrevista de triagem tem como objetivo nico
avaliar a demanda do sujeito.
A entrevista diagnstica sempre prioriza aspectos
sindrmicos
em
detrimento
de
aspectos
psicodinmicos.

QUESTO 45 _____________________

QUESTO 47 _____________________
Acerca de condies de trabalho, segurana no trabalho e
sade ocupacional, assinale a alternativa correta.
(A)

(B)

(C)

(D)

Considerando aspectos relacionados prtica clnica do


psiclogo, incluindo as modalidades de documentos
decorrentes de avaliaes psicolgicas, assinale a alternativa
correta.
(E)
(A)

(B)

(C)

(D)

(E)

Uma entrevista, na prtica, antes de poder ser


considerada uma tcnica, deve ser vista como um
contato social entre duas ou mais pessoas.
A declarao um documento que visa informar a
ocorrncia de fatos ou situaes subjetivas
relacionadas ao atendimento psicolgico.
O relatrio deve ser subsidiado em dados colhidos e
analisados, no necessariamente luz de um
instrumental tcnico.
Diferentemente do relatrio, a finalidade do laudo
deve ser a de apresentar os procedimentos e as
concluses gerados pelo processo da avaliao
psicolgica.
Na exposio de motivos em um parecer, deve-se
apresentar a questo em tese, sendo necessria a
descrio detalhada dos procedimentos, como os
dados colhidos ou o nome dos envolvidos.

QUESTO 46 _____________________

(B)

(C)

(D)

O levantamento quantitativo e qualitativo dos dados,


incluindo a integrao deles, constitui a ltima etapa
de um processo psicodiagnstico.
O psicodiagnstico um processo que tem incio em
uma consulta, a partir da qual se delineiam os passos
do exame, que constitui uma das rotinas do psiclogo
clnico.
Na prtica, considera-se que os sintomas esto
presentes quando os limites da variabilidade normal
no so ultrapassados.
Um problema identificado quando so reconhecidas
alteraes ou mudanas nos padres de
comportamento normal, que so percebidas como
sendo de natureza exclusivamente qualitativa.

CONCURSO PBLICO METR-DF

Para a psicologia organizacional, o bem-estar est


associado qualidade de vida, ao nvel de estresse e
satisfao, mas no sade mental, uma vez que seus
conceitos so bastante distintos.
A sade ocupacional est relacionada apenas com a
assistncia mdica aps acidentes de trabalho ou
instalao de doenas.
Os principais itens do programa de higiene do trabalho
no esto relacionados com o ambiente psicolgico de
trabalho, mas sim com o ambiente fsico e com a
ergonomia.
A incluso de estratgias destinadas no somente a
tornar ou manter as pessoas saudveis, mas
principalmente a faz-las mais felizes e satisfeitas
com o prprio ambiente de trabalho, pode constituirse em um investimento com grandes possibilidades de
retorno organizacional.
Remoo de fumaa, ferramentas que reduzam a
necessidade de esforo humano e tipo de atividade
agradvel e motivadora esto relacionados,
respectivamente, com aplicao de princpios de
ergonomia, ambiente fsico de trabalho e ambiente
psicolgico de trabalho.

QUESTO 48 _____________________
Com base na Lei no 24/1994, que instituiu o Programa de
Controle Mdico de Sade Ocupacional, correto afirmar que
esse programa exige
(A)

(B)

No que se refere ao psicodiagnstico, assinale a alternativa


correta.
(A)

No necessrio que o paciente apresente certo


nmero de caractersticas sintomatolgicas, durante
determinado perodo de tempo, para ser possvel
chegar a uma deciso/concluso diagnstica.

(C)

(D)

(E)

111 Psiclogo

exame mdico pr-admissional, exame mdico


peridico, exame de retorno ao trabalho (no caso de
afastamento superior a 30 dias), exame de mudana de
funo, antes da transferncia, e exame mdico
demissional nos 15 dias que antecedem o
desligamento definitivo do funcionrio.
apenas exame mdico pr-admissional e exame
mdico demissional, sendo que este deve ser realizado
nos 15 dias que antecedem o desligamento definitivo
do funcionrio.
exame mdico pr-admissional, exame mdico
peridico e exame mdico demissional at 15 dias
aps o desligamento definitivo do funcionrio.
exame mdico pr-admissional, exame mdico
peridico e exame mdico demissional. Exame de
retorno ao trabalho ou de mudana de funo so
opcionais, no sendo exigncias da referida lei, em
condio alguma.
apenas exame mdico pr-admissional, exame de
retorno ao trabalho (no caso de afastamento superior
a 60 dias) e exame mdico demissional nos 15 dias
que antecedem o desligamento definitivo do
funcionrio.

PGINA 10/13

QUESTO 49 _____________________
Com relao a assdio moral e sexual no ambiente de trabalho,
assinale a alternativa correta.
(A)

(B)

(C)

(D)

(E)

Diferentemente de quando existe um desequilbrio de


poder entre chefe e subordinado, os colegas de
trabalho que no ocupam posies de poder no
podem ter influncia e usar de certo poder para
assediar sexualmente os respectivos colegas.
Um funcionrio pode se envolver em prticas de
assdio sexual a mulheres; no para obter poder sobre
a mulher que ocupa posio hierrquica superior
dele ou para minimizar as diferenas de poder entre
eles, mas sempre por uma questo de falta de tica ou
carter.
Os atos de violncia moral visam humilhar,
desqualificar e desestabilizar emocionalmente a
relao da vtima com a organizao e o ambiente de
trabalho, o que pe em risco a sade, a prpria vida da
vtima e o seu emprego.
O assdio moral e sexual no trabalho caracterizam-se
pela exposio dos trabalhadores a situaes
humilhantes e constrangedoras, repetitivas e
prolongadas fora da jornada de trabalho, no
necessariamente relativas ao exerccio das respectivas
funes.
No ajudam a combater o assdio moral, no ambiente
de trabalho, analisar o assediador e entender as
atitudes dele.

QUESTO 50 _____________________
Quanto a desgastes ou fatores estressantes presentes em
organizaes de trabalho, assinale a alternativa correta.
(A)

(B)

(C)

(D)

(E)

Considera-se que a percepo em si de um fator


estressante suficiente para levar a um desgaste
psicolgico, independentemente da avaliao ou da
interpretao dos funcionrios a respeito desse fator.
Pesquisas a respeito da carga de trabalho descobriram
que ela tem relao com trs tipos de desgastes:
psicolgico, fsico e comportamental.
No existem estudos capazes de demonstrar que as
percepes da poltica organizacional esto
associadas com desgastes psicolgicos e fsicos.
Altos nveis de controle (autonomia) costumam estar
associados com altos nveis de desgaste emocional,
inteno de abandonar o emprego, sintomas na sade,
ausncia e rotatividade.
A ambiguidade e o conflito de papis so os fatores
menos estudados nas pesquisas a respeito de estresse
ocupacional.
rea Livre

CONCURSO PBLICO METR-DF

111 Psiclogo

PGINA 11/13

PROVA: METR - DF
ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: IADES

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

C
E
C
E
A
B
D
C
D
D
B
E
E

39
40
41
42
43
44
45
46
47
48
49
50

A
E
C
D
A
B
A
B
D
A
C
B

Coletnea de Provas | Concursos de Psicologia

GOVERNO DO DISTRITO FEDERAL


SECRETARIA DE ESTADO DE ADMINISTRAO PBLICA DO DISTRITO FEDERAL
CONCURSO PBLICO PARA PROVIMENTO DE VAGAS E FORMAO DE
CADASTRO RESERVA PARA CARGOS DE NVEL SUPERIOR
EDITAL NO 01 SEAP/SES-NS, DE 28 DE MAIO DE 2014.

Cargo 111
PSICLOGO

Data e horrio da prova:


Domingo, 7/9/2014, s 8h30

INSTRUES

Voc receber do fiscal:


o um caderno de questes da prova objetiva contendo 50 (cinquenta) questes de mltipla escolha, com 5 (cinco) alternativas
de resposta cada uma, e apenas uma alternativa correta;
o um carto de respostas tico personalizado.
Verifique se a numerao das questes, a paginao do caderno de questes e a codificao do carto de respostas tico esto
corretas.
Quando autorizado pelo fiscal do IADES, no momento da identificao, escreva no espao apropriado do carto de respostas,
com a sua caligrafia usual, a seguinte frase:

O som aniquila a beleza do silncio.

Voc dispe de 3 (trs) horas e 30 (trinta) minutos para fazer a prova objetiva, devendo controlar o tempo, pois no haver
prorrogao desse prazo. Esse tempo inclui a marcao do carto de respostas tico.
Somente ser permitido levar o caderno de questes da prova objetiva aps 2 (duas) horas e 37 (trinta e sete) minutos do incio da prova.
Somente aps decorrida 1 (uma) hora do incio da prova, voc poder entregar seu carto de respostas tico e
retirar-se da sala.
Aps o trmino da prova, entregue ao fiscal do IADES o carto de respostas devidamente assinado.
Deixe sobre a carteira apenas o documento de identidade e a caneta esferogrfica de tinta preta ou azul, fabricada de material
transparente.
No permitida a utilizao de qualquer aparelho eletrnico de comunicao. Desligue e guarde em embalagem fornecida pelo
fiscal do IADES: mquina fotogrfica; telefone celular; relgio; gravador; bip; receptor; pager; notebook; tablet eletrnico;
walkman; aparelho porttil de armazenamento e de reproduo de msicas, vdeos e outros arquivos digitais; agenda eletrnica;
palmtop; rgua de clculo; mquina de calcular e (ou) qualquer outro equipamento similar.
No permitida a consulta a livros, dicionrios, apontamentos e apostilas.
Voc somente poder sair e retornar sala de aplicao de provas na companhia de um fiscal do IADES.
No ser permitida a utilizao de lpis em nenhuma etapa da prova.

INSTRUES PARA A PROVA OBJETIVA

Verifique se os seus dados esto corretos no carto de respostas. Caso haja algum dado incorreto, escreva apenas no(s) campo(s)
a ser(em) corrigido(s), conforme instrues no carto de respostas.
Leia atentamente cada questo e assinale, no carto de respostas tico, uma nica alternativa.
O carto de respostas tico no pode ser dobrado, amassado, rasurado ou manchado nem pode conter nenhum registro fora dos
locais destinados s respostas.
A maneira correta de assinalar a alternativa no carto de respostas cobrir, fortemente, com caneta esferogrfica preta ou azul,
o espao a ela correspondente.
Marque as respostas assim:

(C)

A pneumonia, a asma e a bronquite esto entre as


doenas respiratrias mais comuns no DF,
influenciadas pelo clima seco do meio do ano, pelo
tabagismo e pela baixa qualidade do ar em algumas
regies.
A utilizao intensiva de transporte individual, em
detrimento do transporte coletivo, melhora
sensivelmente a qualidade do ar nas cidades. Os
nibus so mais poluentes que os carros, portanto,
devem ser evitados.
O excesso de rvores no ambiente urbano central
de Braslia reduz a oferta de oxignio no ar,
especialmente nos perodos de seca, e agrava a
situao de quem tem doena respiratria.

(D)

ATUALIDADES

(E)

Questes de 23 a 25

QUESTO 23 ______________________
O livro 20 anos de construo do sistema de sade no Brasil:
Uma avaliao do Sistema nico de Sade, publicado pelo
Banco Mundial em 2013, conclui que, no perodo avaliado, o
Brasil observou melhorias impressionantes nos resultados da
sade, com redues drsticas nos indicadores de mortalidade
infantil e aumentos na expectativa de vida. Considerando
essa informao, assinale a alternativa incorreta a respeito do
quadro atual dos servios de sade pblica no Brasil.
(A)

(B)

(C)

(D)

(E)

A reduo da rede de unidades de sade, nas duas


ltimas dcadas, foi acompanhada por igual
inibio na oferta de servios pelo sistema pblico
de sade brasileiro.
A gradual equiparao da disponibilidade de
servios entre os estados, atingida por meio da
reestruturao do sistema hospitalar e da
implementao da Estratgia de Sade da Famlia
com foco nos estados mais pobres, contribuiu para
uma reduo das disparidades geogrficas na
utilizao de servios de sade.
A cobertura de vacinao no Brasil tem
permanecido prximo aos 100% desde o incio dos
anos 2000.
H muitos anos que a proporo de cesreas no
Brasil tem estado entre as mais altas do mundo. O
nmero de cesreas vem crescendo em todas as
regies do Pas.
Entre 1990 e 2009, o volume de consultas mdicas
e de procedimentos de ateno bsica aumentou
significativamente, uma das consequncias do
fortalecimento da Estratgia de Sade da Famlia.

QUESTO 25_______________________
Estudo divulgado pela Codeplan, em 2013, prev que a
populao do Distrito Federal (DF) chegar a 3,7 milhes de
habitantes em 2030. Com relao ao perfil populacional do
DF, assinale a alternativa correta.
(A)

Os telefones celulares esto presentes em quase


todos os domiclios do DF, assim como quase
todos tm fogo, televiso e geladeira.
O percentual de pessoas no naturais do DF
expressivo em comparao ao restante do Pas,
porm apresenta uma tendncia de reduo, o que
sugere tanto uma predisposio de queda no fluxo
migratrio quanto um crescimento proporcional do
nmero de pessoas nascidas na cidade.
No DF, a formalizao do emprego com carteira
assinada superior do Brasil, em termos
percentuais.
Comparativamente com os demais estados da
Federao, o DF apresenta a populao
economicamente ativa com o maior rendimento
mdio mensal, superior a R$ 2.500,00.
Devido ao forte crescimento demogrfico ocorrido
nos ltimos 20 anos, apenas 65% da populao do
DF tm acesso a abastecimento de gua pela rede
geral e domiclio com rede de esgoto ou fossa
sptica.

(B)

(C)

(D)

(E)

CONHECIMENTOS ESPECFICOS
Questes de 26 a 50

QUESTO 24 ______________________
Nos ltimos anos, as doenas respiratrias tm ocupado
posio de destaque no ranking das enfermidades mais
comuns no Distrito Federal (DF), juntamente com os
problemas cardiovasculares e o cncer. Alm dos maus
hbitos e do envelhecimento da populao, essas
enfermidades esto relacionadas poluio do ar. A esse
respeito, assinale a alternativa correta.
(A)

(B)

A implantao do sistema de rodzios de veculos


no DF, que comeou no incio deste ano, tem
propiciado uma melhoria da qualidade do ar nas
regies do Plano Piloto e no centro de Taguatinga.
A ocorrncia de doenas respiratrias tem sido rara
no DF, uma consequncia direta da Lei Antifumo,
sancionada em 2012, que probe o uso de cigarros
em locais pblicos.

CONCURSO PBLICO SEAP/SES-NS

QUESTO 26_______________________
Acerca da crise hipomanaca, assinale a alternativa correta.
(A)
(B)

(C)
(D)

(E)

Pessoas com mania disfrica tendem a no ser


agressivas nem hostis aos outros.
Quando acometida por crise hipomanaca, a pessoa
precisa ser hospitalizada, uma vez que sua
segurana est seriamente ameaada.
Uma pessoa que sofre de crise hipomanaca tem a vida
profissional e a social seriamente comprometidas.
A pessoa acometida de crise hipomanaca
geralmente no precisa ser hospitalizada, pois seu
quadro patolgico no compromete sua vida
profissional nem social.
A sndrome de elao caracterizada pelo alto nvel
de humildade que o transtorno provoca na pessoa.

111 PSICLOGO TIPO A

PGINA 6/11

QUESTO 27 ______________________

(E)

Quanto ao processo de psicodiagnstico, assinale a alternativa


correta.
(A)

(B)

(C)

(D)

(E)

Deve-se seguir um modelo bsico de trabalho,


utilizando uma nica estratgia, de acordo com um
roteiro preestabelecido, independentemente do tipo
de paciente ou de solicitao feita pelo profissional.
Deve-se formular uma estratgia diagnstica para
ser testada e mantida durante todo o processo de
psicodiagnstico. Dessa forma, o psiclogo dever
insistir em um modelo rgido, capaz de orientar a
formulao de hipteses.
Recomenda-se no fornecer entrevista de devoluo
ao trmino do processo, pois, muitas vezes, o
paciente no est preparado para obter tais
informaes que, normalmente, causam intensa
mobilizao emocional.
Considera-se, no incio de qualquer avaliao
psicodiagnstica, o motivo da solicitao, de modo
a selecionar a bateria de testes mais adequada.
Outros aspectos a serem considerados so a idade do
examinando e o momento evolutivo no qual se
encontra o sujeito.
Realizar o psicodiagnstico quando o sujeito est
em uso de medicao psiquitrica ou vivenciando
uma sria crise evolutiva contraindicado, mesmo
quando se trata de estabelecer um diagnstico
diferencial ou escolher o devido processo
teraputico.

QUESTO 28 ______________________
Em relao testagem no processo de psicodiagnstico,
assinale a alternativa correta.
(A)

(B)

(C)

(D)

O teste palogrfico pode ser considerado um teste


expressivo de personalidade, assim como o
psicodiagnstico miocintico (PMK). Estudos
acerca do comportamento expressivo indicam que
existe uma congruncia entre os movimentos
expressivos e as atitudes, os traos, os valores e
outras disposies da personalidade.
O teste mais importante da bateria de testes deve ser
aplicado logo na primeira sesso. Assim o psiclogo
j garante informaes suficientes para responder
aos quesitos que eliciaram a avaliao, alm de obter
elementos para um diagnstico diferencial.
Para o laudo ou relatrio final, o psiclogo dever
indicar, de forma isolada, os resultados obtidos em
cada teste utilizado, assim como os resultados das
entrevistas e os dados acerca da histria clnica.
O exame do estado mental do paciente dever
contemplar as principais alteraes nas reas de
ateno, sensopercepo, memria, orientao,
pensamento, linguagem, conscincia e afetividade,
entre outros. O miniexame do estado mental um
dos instrumentos mais completos de avaliao. No
entanto, por ser bastante extenso e necessitar de
capacitao especfica para a aplicao, o teste ainda
pouco utilizado.

CONCURSO PBLICO SEAP/SES-NS

A administrao de teste psicolgico apenas um


dos instrumentos utilizados no processo de
avaliao psicolgica. Entretanto, em razo de sua
importncia, no pode ser dispensado, mesmo que
haja alguma limitao fsica ou cognitiva por parte
do examinando.

QUESTO 29_______________________
As observaes de Freud a respeito de seus pacientes
revelaram uma srie interminvel de conflitos e acordos
psquicos. Ele tentou ordenar esse caos aparente propondo trs
componentes bsicos estruturais da psique: o id, o ego e o
superego (Fadiman & Frager, 1979).
Com base nessa teoria, assinale a alternativa correta.
(A)
(B)

(C)

(D)
(E)

O id guarda tudo o que a pessoa herdou desde o


nascimento at a adolescncia.
O
superego
se
caracteriza
por
estar
permanentemente em contato com a realidade
exterior ou o mundo exterior da pessoa, e se
comporta como um espectador imparcial diante de
situaes de julgamento.
O ego se desenvolve a partir do id, mas precisa
controlar as pulses desse, a fim de que a pessoa se
capacite a construir solues motivadas menos pelas
emoes e mais pela realidade dos fatos.
O id possui mais contedos conscientes do que
inconscientes.
A funo do superego no se coaduna com
contedos que necessitam de julgamentos.

QUESTO 30_______________________
No que se refere esquizofrenia, assinale a alternativa correta.
(A)

(B)

(C)

(D)

(E)

Para a psicanlise, a esquizofrenia no ,


propriamente, uma patologia, mas o sintoma de
relaes entre pessoas em um sistema social
marcado pela competio entre elas.
Para a teoria psicanaltica, a esquizofrenia o
transtorno esquizoide adquirido pela pessoa que
teve pais rgidos quando criana e, por isso, precisa
ser tratada em clnicas especiais, que no permitem
a presena dos genitores durante o tratamento.
A esquizofrenia uma neurose caracterizada pelo
vazio existencial da pessoa doente, e, por isso, ela
procura, por todos os meios, aumentar a prpria
autoestima buscando constantemente o contato com
pessoas otimistas.
Devido s suas alucinaes, a pessoa esquizofrnica
confere maior perigo para os indivduos ao seu redor
do que para ela mesma, sendo, por isso,
aconselhvel mant-la afastada de pessoas idosas
e (ou) crianas.
O maior perigo que a pessoa com transtorno de
esquizofrenia causa para ela mesma.

111 PSICLOGO TIPO A

PGINA 7/11

QUESTO 31 ______________________

QUESTO 34_______________________

A psicopatologia, em acepo mais ampla, pode ser definida


como o conjunto de conhecimentos referentes ao adoecimento
mental do ser humano. O campo da psicopatologia inclui um
grande nmero de fenmenos humanos especiais, associados
ao que se denominou historicamente de doena mental
(Dalgalarrondo, 2008).

Assinale a alternativa que apresenta o comportamento que


melhor se enquadra no transtorno obsessivo-compulsivo
(TOC).

A fim de tratar alguns tipos de patologia, existem vrias


abordagens tericas, cada uma com linha de conduta
teraputica prpria. Uma das correntes adota, entre outros
recursos, os estmulos pavlovianos. Assinale a alternativa que
apresenta o nome dessa corrente.
(A)
(B)
(C)
(D)
(E)

(A)

(B)
(C)

(D)

Individuao adleriana.
Logoterapia frankliniana.
Anlise junguiana.
A. T. berniana.
E.R ou S.R skinneriana.

(E)

Enxugar o cho da casa vrias vezes ao dia, posto


que ele est sempre sujo em funo da grande
quantidade de poeira trazida pelos ventos
constantes.
No comer antes de lavar as mos, mesmo que elas
no paream sujas.
Levantar vrias vezes da cama, antes de dormir, para
verificar se as portas esto bem trancadas, uma vez
que houve assalto na vizinhana na noite anterior.
Somente ligar o carro depois de se certificar de que
a chave da ignio est adequadamente posicionada.
No sentar no restaurante antes de olhar, com
extrema ateno, para as mesas e verificar qual delas
est mais limpa e (ou) mais adequada.

QUESTO 35_______________________
QUESTO 32 ______________________
A respeito da esquizofrenia, assinale a alternativa correta.

No que se refere depresso ps-parto, assinale a alternativa


correta.
(A)

(A)

(B)

(C)

(D)

(E)

A esquizofrenia uma neurose nogena que leva o


indivduo a escutar vozes que produzem nele um
padro de comportamento fbico, inclusive medo de
enlouquecer.
A pessoa esquizofrnica apresenta vrios sintomas
patolgicos e, entre eles, destacam-se alucinaes,
desorganizao mental, catatonia e delrio.
A esquizofrenia uma patologia de carter exgeno,
que nada tem a ver com questes genticas ou
componentes endgenos.
No h como uma pessoa esquizofrnica ter uma
vida social e de trabalho adequadas, visto que suas
crises so incontrolveis.
No atendimento do paciente esquizoide, no h
necessidade de conhecer a construo subjetiva
dele, uma vez que se trata de patologia puramente
biolgica.

(B)

(C)

(D)

(E)

QUESTO 33 ______________________
Considerando as psicoses funcionais, assinale a alternativa
correta.
(A)

(B)

(C)

(D)
(E)

As
psicoses
funcionais
so
transtornos
caractersticos de pessoas viciadas em trabalho,
devido importncia das funes que exercem na
sociedade. Por isso, so chamadas de workaholics.
As psicoses funcionais so aquelas adquiridas pelas
pessoas que, desde a infncia, foram solicitadas a
exercerem funes inadequadas para seu
temperamento e sua idade.
As psicoses funcionais baseiam-se nas distores
funcionais inconscientes causadas por traumas na
infncia.
S as pessoas que passaram por fortes traumas na
vida podem adquirir um transtorno funcional.
As psicoses funcionais so caracterizadas pelo
abuso de substncias psicoativas.

CONCURSO PBLICO SEAP/SES-NS

A depresso ps-parto s atinge mulheres que


sofrem de tenso pr-menstrual.
pouco provvel que componentes exgenos
contribuam para a depresso puerperal, uma vez que
suas causas se encontram apenas na diminuio dos
hormnios progesterona e estrognio.
Pelo fato de todas as purperas terem quedas
acentuadas dos mesmos hormnios depois do parto
e nem todas terem depresso ps-parto, fica
evidente que no h causas endgenas que
provoquem a depresso puerperal.
Uma das causas da depresso ps-parto a queda
importante dos hormnios progesterona e
estrognio. Entretanto, tambm pode haver causas
externas, e geralmente h, que contribuem para que
a depresso se instale na purpera.
Alm dos sintomas desagradveis da depresso
ps-parto, a purpera apresenta quadro de piora
quando sabe que esse tipo de depresso geralmente
dura em torno de seis meses.

QUESTO 36_______________________
Acerca da bipolaridade, assinale a alternativa correta.
(A)

(B)

(C)

(D)
(E)

Pessoas com transtorno bipolar grave podem


tornar-se reconhecidos artistas e cientistas com
grande potencial de produzirem trabalhos muito
importantes
para
o
desenvolvimento
da
humanidade.
Ainda que pessoas bipolares possam contribuir com
o desenvolvimento do conhecimento, apenas de
forma limitada elas podem faz-lo.
No existe forte correlao entre a bipolaridade e a
instabilidade de humor, a no ser que a pessoa com
tal transtorno seja provocada por outrem.
O quadro de delrium no implica dficit cognitivo,
mas modificao na conscincia.
O neurtico quase sempre vive em um mundo
imaginrio, o que o faz perder, aos poucos, o senso
de realidade.

111 PSICLOGO TIPO A

PGINA 8/11

QUESTO 37 ______________________

(C)

O humor e as emoes so, ao mesmo tempo, experincias


psquicas e somticas, e revelam sempre a unidade
psicossomtica bsica do ser humano (Dalgalarrondo, 2008).
Nesse contexto, existe o sintoma distimia que pode ser
caracterizado como
(A)
(B)
(C)
(D)
(E)

incapacidade de sentir prazer, seja pelo que for.


transtorno depressivo leve e crnico.
distanciamento psictico afetivo.
apatia.
modificao bsica do humor, tanto no que concerne
inibio quanto exaltao.

(D)

(E)

QUESTO 38 ______________________
Que tipo de impulso mais se aproxima daquele de uma pessoa
que est sempre se vangloriando diante dos outros?
(A)
(B)
(C)
(D)
(E)

QUESTO 41_______________________
Quanto aos transtornos alimentares, assinale a alternativa
correta.

Histrico.
Bipolar.
Autoafirmativo.
Nervoso.
Disfrico.

(A)

(B)

QUESTO 39 ______________________
(C)
As sndromes ansiosas so ordenadas inicialmente em dois
grupos: quadros em que a ansiedade constante e permanente
(ansiedade generalizada, livre e flutuante) e quadros em que
h crises de ansiedade abruptas e mais ou menos intensas
(Dalgalarrondo, 2008).

(D)

(E)
A respeito desse tema, assinale a alternativa que corresponde
a quadros de crise abrupta.
(A)
(B)
(C)
(D)
(E)

Em relao aos sonhos, assinale a alternativa correta.


(A)

(B)

Segundo R. Debray, as noites so um reflexo dos dias. Com


base nessa informao e considerando os transtornos do sono,
assinale a alternativa correta.

(C)

(B)

Os medicamentos indutores do sono so bastante


utilizados no tratamento das mais diversas formas de
insnia. Tais substncias agem sobre a causa da falta
de sono, porm no exercem nenhuma influncia
sobre os problemas psicolgicos que normalmente a
acompanham.
Os transtornos do sono ocorrem isoladamente. A
insnia pode ser um dos sintomas da depresso e de
transtornos como o de ansiedade, o bipolar e o de
estresse ps-traumtico.

CONCURSO PBLICO SEAP/SES-NS

Por ser um distrbio de insatisfao pessoal, a


anorexia melhor tratada com a psicoterapia, sendo,
na
maioria
das
vezes,
dispensado
o
acompanhamento mdico.
Apesar de serem distrbios alimentares, a anorexia
e a bulimia no tm relao entre si.
Os transtornos alimentares caracterizam-se, em
geral, por estados de ansiedade difceis de serem
abordados em funo da sua complexa origem.
pouco provvel que as condies culturais e
familiares exeram influncia no desenvolvimento
dos transtornos alimentares.
Fatores biolgicos no se incluem nas
manifestaes de distrbios alimentares.

QUESTO 42_______________________

Pnico.
Medo de altura.
Medo de falar em pblico.
Medo de escuro.
Medo de si mesmo.

QUESTO 40 ______________________

(A)

A higiene do sono compreende as condies e


atitudes que favorecem o sono de qualidade, como,
por exemplo, ser prudente no uso de alimentos
e (ou) bebidas estimulantes e evitar trabalho
intelectual at o momento de se deitar. No entanto,
essas aes no do resultado nos casos de
distrbios do sono.
Os indivduos deprimidos esto propensos a
apresentar um padro de sono conturbado,
caracterizado pelo despertar muito cedo, mas
possuem a capacidade de voltar a dormir
preservada.
A presena de transtornos do sono pode auxiliar a
identificao de indivduos mais vulnerveis ao
desenvolvimento do transtorno depressivo. Em
muitos casos, a insnia e a hipersonia constituem o
nico sintoma aparente do quadro depressivo. Nesse
caso, h a possibilidade de o tratamento da insnia
reduzir o risco de um novo episdio.

(D)

(E)

Os sonhos pouco tm a ver com as contingncias


experienciadas pelos pacientes no dia a dia; eles so
apenas contedos inconscientes que no se
coadunam com a vivncia diria.
A interpretao dos sonhos, apesar da sua
importncia, no se enquadra entre as maiores
contribuies da psicanlise para a compreenso e o
tratamento das neuroses.
S devem ser levados em considerao, para o
tratamento das neuroses, os sonhos a que os
pacientes atribuem importncia para suas vidas, os
quais so mais recorrentes, segundo eles.
Os pesadelos so sonhos aterradores que ocorrem,
geralmente, no sono REM (Rapid Eye Movement) e
relacionam-se a conflitos inconscientes e (ou)
conscientes antigos e (ou) atuais.
Os contedos dos sonhos recorrentes preconizam
acontecimentos futuros nas vidas das pessoas, a fim
de que essas se previnam, porque tais sonhos tm
grande probabilidade de se realizarem.

111 PSICLOGO TIPO A

PGINA 9/11

QUESTO 43 ______________________

QUESTO 46_______________________

Acerca de aspectos relativos a no adeso ao tratamento


psicolgico, considerando a maioria das teorias psicolgicas,
assinale a alternativa correta.

Em relao ao transtorno de personalidade, assinale a


alternativa correta.
(A)

(A)
(B)
(C)
(D)
(E)

Medo do tratamento.
Benefcio marginal ou secundrio que a doena
propicia pessoa.
Crena de que no h cura.
A prpria patologia causadora, compulsoriamente,
da resistncia adeso ao tratamento.
Somente as patologias psicticas provocam na
pessoa resistncia adeso ao tratamento.

(B)

(C)

QUESTO 44 ______________________
A teoria do estresse um dos paradigmas centrais da
psicologia do sculo 20. Os primeiros estudos a respeito do
estresse mostram que as demandas excessivas sobre o
organismo (sejam elas somticas ou psicolgicas) produzem
uma sequncia tpica de respostas fisiolgicas, o que envolve
ativao simptica e do eixo adreno-hipofisrio e
hipotalmico. necessrio o desenvolvimento de formas de
apoio s vtimas, visando ajud-las a readquirir o controle das
prprias vidas (Corioli, 1998).
Considerando essas informaes, correto afirmar que,
enquanto vivencia o transtorno de estresse ps-traumtico
(TEPT), a pessoa desenvolve vrios sintomas, entre eles, o (a)
(A)
(B)
(C)
(D)
(E)

sentimento subjetivo de anestesia dissociativa e a


ausncia de resposta emocional.
reduo da conscincia e a resilincia.
desrealizao e a resilincia.
amnsia dissociativa e a clarividncia.
assertividade e o catatonismo.

QUESTO 45 ______________________
A posio da maioria dos terapeutas que lida com o transtorno
de estresse ps-traumtico (TEPT) de que, depois de uma
experincia traumtica que fora o indivduo a se defrontar
com a prpria vulnerabilidade e o desamparo, a vida jamais
ser a mesma, e o trauma, de alguma forma, far parte do seu
cotidiano (Cordioli, 1998).

(D)

(E)

impossvel que uma pessoa criada em um


ambiente favorvel desenvolva algum tipo de
transtorno de personalidade na vida adulta.
O transtorno de personalidade causado por
condies exclusivamente endgenas, estando
pouco relacionado com as condies do meio
ambiente em que foi criada a pessoa.
Em geral, o transtorno de personalidade est muito
relacionado com a construo subjetiva da pessoa.
Por isso, se uma pessoa est esgotada pelo excesso
de trabalho, mais pertinente, sob o ponto de vista
teraputico, descobrir por que ela trabalha tanto em
vez de lhe sugerir um ms de descanso.
Embora a pessoa com transtorno de personalidade
ansiosa sofra muito, no sensvel rejeio e
mostra-se mais atenta aos outros do que a si prpria.
O indivduo sociopata, apesar de ser frio e
insensvel, no se aproveita dos outros nem mente
de forma recorrente.

QUESTO 47_______________________
A partir de 2003, passa a fazer parte da estrutura do
Ministrio da Sade uma rea tcnica que torna os
princpios tericos, polticos e metodolgicos acumulados e
ainda a construo no campo da Educao Popular em Sade,
como orientadores de suas aes e de seu projeto poltico.
Ministrio da Sade. Caderno de Educao Popular e Sade.
Braslia-DF: MS, 2007.

A respeito da Educao Popular em Sade, preconizada pelo


Ministrio da Sade por meio do Sistema nico de Sade,
assinale a alternativa correta.
(A)

(B)

A respeito desse tema, assinale a alternativa correta.


(A)
(B)

(C)

(D)

(E)

A fim de auxiliar o paciente, o psiclogo deve


ajud-lo a desconstruir o passado traumtico.
Ajudar o paciente a encontrar um sentido ou
significado para o seu trauma deve constituir-se no
ponto principal da terapia.
O psiclogo no deve nomear os sintomas para o
paciente, e deve evitar que este os traga para o
processo teraputico.
O terapeuta no precisa se esforar para que ele e o
paciente construam um vnculo forte entre si, uma
vez que o trauma sofrido por este impede que isso
acontea.
Somente o fato de o paciente verbalizar seus
sentimentos relacionados ao trauma, sem que seja
necessrio vivenci-los no processo teraputico, j
suficiente para que a cura seja alcanada.

CONCURSO PBLICO SEAP/SES-NS

(C)

(D)

(E)

111 PSICLOGO TIPO A

Baseia-se na concepo positivista, de modo que a


educao em sade vista de forma reducionista,
cujas prticas so impositivas.
Ao problematizar a realidade tomada como
referncia, a Educao Popular em Sade
mostra-se como um dispositivo de crtica social e
das situaes vivenciadas por indivduos, grupos e
movimentos.
A Educao Popular em Sade evita atos
pedaggicos que fazem com que as informaes
acerca da sade dos grupos sociais contribuam
para aumentar a visibilidade quanto sua insero
histrica, social e poltica.
Apesar de trabalhar com atores sociais, a Educao
Popular em Sade pouco contribui para a
construo de cenrios nos quais os movimentos
populares possam se fazer presentes, por falta de
referencial terico consistente.
Por estar fora do ambiente acadmico, a Educao
Popular em Sade no desperta o interesse
cientfico e, por isso, h produo acadmica a
respeito do tema.
PGINA 10/11

QUESTO 48 ______________________
Uma pessoa com sintomas de esquecimento de si mesma
geralmente se encontra em estado de transtorno
(A)
(B)
(C)
(D)
(E)

associativo.
ciclotmico.
de negao.
dissociativo.
compulsivo.

QUESTO 49 ______________________
O caminho da constituio do Sistema nico de Sade como
principal poltica pblica de sade no Brasil foi longo e
marcado por eventos que definiram claramente as polticas
governamentais. Em 1977, por exemplo, foi criado um rgo,
grande ente governamental prestador da assistncia mdica,
basicamente custa da compra de servios mdicos
hospitalares e especializados do setor privado.
Essas informaes se referem
(A)
(B)
(C)
(D)
(E)

ao Instituto Nacional de Previdncia Social


(INPS).
ao Instituto Nacional de Assistncia Mdica da
Previdncia Social (INAMPS).
ao Programa de Aes Integradas de Sade
(PAIS).
aos Sistemas Unificados e Descentralizados de
Sade (SUDS).
s Caixas de Aposentadorias e Penses (CAPs).

QUESTO 50 ______________________
No que se refere ao transtorno de personalidade, correto
afirmar que
(A)

(B)

(C)
(D)

(E)

esse transtorno corrobora para um desempenho


deficitrio tanto pessoal como comunitrio, porm
tal dficit de desempenho no compulsrio.
esses transtornos, em geral, so facilmente
superados com as experincias de vida da pessoa,
sejam eles dolorosos ou no.
somente as experincias dolorosas so capazes de
ajudar as pessoas com esse transtorno a se curarem.
a pessoa com esse transtorno sofre de incapacidade
bastante acentuada para manter relaes com os
outros, exceto quando se tratar de transtorno da
personalidade esquizoide.
um fator importante da personalidade paranoide o
fato de a pessoa com esse transtorno dificilmente
guardar rancores dos outros, alm de no se
preocupar em pedir explicaes acerca de
conspiraes, a no ser com base em dados reais.
rea livre

CONCURSO PBLICO SEAP/SES-NS

111 PSICLOGO TIPO A

PGINA 11/11

PROVA: SES - DF
ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: IADES

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

D
D
A
C
E
E
B
E
X
D
A
B
C

39
40
41
42
43
44
45
46
47
48
49
50

A
X
C
D
B
A
B
C
B
D
B
A

Coletnea de Provas | Concursos de Psicologia

'

<

<

<

>

>

M
o

'

'

e
N

"

&

>

>

>

"

"

"

"

'

"

"

"

"

"

&

'

'

"

"

"

"

"

"

"

"

"

"

"

"

"

"

'

"

"

"

'

"

'

'

'

<

"

&


*

'

'

"

"

"

'

"

"

"

"

"

"

"

"

"

&

'

'

"

"




"


=

"

"

"

"

<

"

"

"

"

"

"

"

"

"

"

"

"

"

"

"

"

"

"

>

>

>

'

'

"

<

"

"

>

"

"

"

>

>

"

'

'

"

"

"

"

"

"

"

'

'

"

"

'

'

'

'

"

"

"

"

"

"

"

"

"

"

&

"

'

"

"

&

"

"

"

&

"

"

>

"

'

"

"

&

>

>

>

"

"

"

"

"

"

"

"

"

"

"

"

<

"

"

<

"

"

"

"

"

"

"

"

>

>

<

"

"


=

"

,
,

"

"




>

"

"




<

"

"

"

"

"

"

"

"

"

>

"

"

"

"

"

&

"

"

"

"

"

"

"

"

"

,


"

"

"

"

"

"

&

"

"

"

"

"

"

"

<

"

"

"

"

"

"

"

&

"

"

"

"

"

"

"

"

&

'

&

'

&

&

'

&

&

'

'

"

'

&

'

&

&

'

&

&

&

"

&

'

&

&

"

&

'

&

&

'

"

&

&

'

"

'

'

&

&

&

'

/
*

"

'

'

'

'

"

&

"

&

&

'

'

&

'

'

&

'

"

<

"

>

"

&

'

'

&

&

&

&

&

'

'

'

&

&

&

&

&

'

'

'

'

&

&

'

&

&

'

&

&

"

"

'

"

>

&

'

&

&

&

&

&

&

&

&

'

&

&

>

&

'

&

&

'

&

'

'

'

"

&

&

'

&

&

&

&

&

"

'

'

&

&

'

'

&

'

&

&

'

&

&

&

&

'

&

'

'

"

&

'

'

&

&

'

'

&

&

'

'

"

&

&

&

&

&

'

'

'

'

&

&

'

&

&

&

&

'

"

&

'

&

&

'

'

&

&

'

'

'

&

'

&

&

&

'

'

&

&

&

&

&

'

'

'

&

&

&

&

&

&

&

&

'

'

'

&

'

&

'

&

'

'

&

'

'

'

'

&

'

'

&

'

&

&

'

&

&

'

"

"

&

'

"

'

&

&

'

&

&

&

'

&

'

&

'

&

'

&

'

'

'

&

&

&

&

&

'

&

'

&

"

"

"

'

"

'

"


'

"

"

&

"

'

&

&

'

'

'

'

'

'

&

'

'

&

'

"

'

&

&

&

&

'

'

'

&

'

'

&

'

'

&

'

'

&

'

'

&

&

'

&

&

&

'

'

'

&

&

'

&

'

"

'

'

&

'

&

'

'

&

&

&

'

'

'

P
'

"

'

&

&

&

'

&

'

&

'

&

'

.
+

&

'

&

'

&

'

L
/

&

'

&

&

'

$
$

'

&

&

'

&

'

"

'

&

'

'

'

'

&

'

&

'

&

&

&

P
*

'

'

'

'

'

'

&

'

&

&

&

&

&

"

"

&

&

&

"

"

&

&

&

'

"

"

"

&

&

&

&

"

'

"

"

&

&

&

&

&

&

&

PROVA: EBSERH - UNIVASF


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: IBFC

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

C
D
E
D
E
A
B
A
B
D
C
B
D

39
40
41
42
43
44
45
46
47
48
49
50

B
C
E
A
E
C
D
A
E
B
C
A

Coletnea de Provas | Concursos de Psicologia

HOSPITAL ESTADUAL DR. ODILO ANTUNES DE SIQUEIRA DE


PRESIDENTE PRUDENTE
EDITAL N 15/2014

NVEL SUPERIOR

AGENTE TCNICO DE ASSISTNCIA SADE (PSICLOGO)


NOME DO CANDIDATO

ASSINATURA DO CANDIDATO

RG DO CANDIDATO

LEIA COM ATENO AS INSTRUES ABAIXO


INSTRUES GERAIS
I. Nesta prova, voc encontrar 08 (oito) pginas numeradas sequencialmente, contendo 50 (cinquenta) questes
correspondentes seguinte disciplina: Conhecimentos Especficos (50 questes).
II. Verifique se seu nome e nmero de inscrio esto corretos no carto de respostas. Se houver erro, notifique o fiscal.
III. Assine e preencha o carto de respostas nos locais indicados, com caneta azul ou preta.
IV. Verifique se a impresso, a paginao e a numerao das questes esto corretas. Caso observe qualquer erro, notifique
o fiscal.
V. Voc dispe de 3 (trs) horas para fazer esta prova. Reserve os 20 (vinte) minutos finais para marcar o carto de
respostas.
VI. O candidato s poder retirar-se do setor de prova 1 (uma) hora aps seu incio.
VII. O candidato no poder levar o caderno de questes. O Caderno de Questes das provas objetivas ser divulgado no
endereo eletrnico do IBFC (www.ibfc.org.br), durante o perodo recursal.
VIII. Marque o carto de respostas cobrindo fortemente o espao correspondente letra a ser assinalada, conforme o exemplo
no prprio carto de respostas.
IX. A leitora ptica no registrar as respostas em que houver falta de nitidez e/ou marcao de mais de uma alternativa.
X. O carto de respostas no pode ser dobrado, amassado, rasurado ou manchado. Exceto sua assinatura, nada deve ser
escrito ou registrado fora dos locais destinados s respostas.
XI. Ao terminar a prova, entregue ao fiscal o carto de respostas e este caderno. As observaes ou marcaes registradas
no caderno no sero levadas em considerao.
XII. terminantemente proibido o uso de telefone celular, pager ou similares.

Boa Prova!

DESTAQUE AQUI

GABARITO DO CANDIDATO - RASCUNHO


Assinatura do Candidato:

Nome:

Inscrio:

10

11

12

13

14

15

16

17

18

19

20

21

22

23

24

25

26

27

28

29

30

31

32

33

34

35

36

37

38

39

40

41

42

43

44

45

46

47

48

49

50

IBFC_05

CONHECIMENTOS ESPECFICOS
1) Cdigos de tica profissionais so fundamentais para
o estabelecimento de padres esperados quanto s
prticas referendadas por uma respectiva categoria
profissional e pela sociedade. Assinale a alternativa
incorreta a respeito do atual Cdigo de tica do
Psiclogo
a) foi aprovado em 2005.
b) o terceiro da categoria profissional no Brasil.
c) seu processo de construo ocorreu num perodo
inferior a seis meses, e contou com a participao de
alguns profissionais da categoria de psiclogos, que
puderam representar os demais e a sociedade.
d)
conta com os princpios fundamentais, as
responsabilidades do psiclogo, e as disposies
gerais.
2) Tendo em vista o atual Cdigo de tica do Psiclogo,
pode-se considerar que em sua construo, buscou-se
aproximar-se de um:
a) instrumento de reflexo do profissional.
b) conjunto de normas a serem seguidas pelo psiclogo.
c) conjunto de padres de conduta especficos, para
cada prtica particular do psiclogo, uma vez que
os principais dilemas ticos se restringem a prticas
especficas.
d) instrumento que possa ser utilizado como modelo para
aes especficas, principalmente na rea de atuao
clnica, escolar, organizacional, e hospitalar.
3) O atual Cdigo de tica do Psiclogo traz como dever
do psiclogo respeitar o sigilo profissional a fim de
proteger, por meio da confidencialidade, a intimidade
das pessoas, grupos ou organizaes. De acordo com
este Cdigo, considere a afirmativa correta quanto ao
sigilo profissional:
a) quando requisitado a depor em juzo o psiclogo dever
informar todos os aspectos da confidencialidade das
pessoas atendidas, independente da relevncia de tais
informaes.
b) no atendimento da criana deve ser comunicado aos
pais ou responsveis o essencial para se promoverem
medidas em seu benefcio.
c) em nenhuma hiptese o psiclogo pode decidir pela
quebra do sigilo, uma vez que tem compromisso com a
tica.
d) no caso de quebra do sigilo, cabe ao psiclogo o dever
de prestar todas as informaes relacionadas ao caso.
4) Na prtica do trabalho do psiclogo, eventualmente
podem ocorrer situaes em que exista a necessidade
de interveno na prestao de servios psicolgicos
que estejam sendo efetuados por outro profissional
tambm da rea da psicologia. Situaes como estas
so permitidas, de acordo com o atual Cdigo de tica
da categoria, nas seguintes condies:
I. quando se tratar de trabalho multiprofissional e a
interveno fizer parte da metodologia adotada.
II. quando informado expressamente, obrigatoriamente
por ambas as partes, da interrupo voluntria e
definitiva do servio.
III. a pedido do profissional responsvel pelo servio.
IV. em caso de emergncia ou risco pessoa atendida,
neste caso no necessitando dar imediata cincia ao
profissional responsvel pelo acompanhamento do
caso.
Esto corretas as afirmativas:
a) I e III so corretas.
b) somente I correta.
c) II, III e IV so corretas.
d) todas so corretas.

5) Alm da atuao na assistncia, como profissional


da sade, o Cdigo de tica do Psiclogo prev a
atuao do profissional na rea da pesquisa cientfica.
Os aspectos ticos relacionados s pesquisas que
envolvem seres humanos preconizam a necessidade
de que todo estudo se processe com o consentimento
livre e esclarecido dos participantes, que aceitem
livremente participar. Com relao ao processo de
consentimento livre e esclarecido, assinale a alternativa
correta:
a) este dever assegurar a manuteno do sigilo e
privacidade dos participantes somente durante as fases
finais da pesquisa, que o momento da divulgao dos
resultados.
b) dever apresentar a justificativa, os objetivos, e os
procedimentos que sero utilizados, sem necessitar
a incluso de detalhamento dos mtodos a serem
utilizados.
c) dever garantir plena liberdade do participante se
recusar a participar do estudo, porm assegurado
que uma vez aceito, sua participao no poder ser
interrompida em fases posteriores do estudo.
d) este dever explicitar os possveis desconfortos e
riscos decorrentes da participao na pesquisa, alm
dos benefcios esperados dessa participao.
6) A biotica, cincia que estuda de forma transdiciplinar
as questes ticas, principalmente nas relaes de
conflitos e controvrsias morais implicados pelas
prticas das cincias da vida e da sade, conta com
alguns princpios. So considerados princpios da
biotica:
a) universalidade, beneficncia, integralidade.
b) no maleficncia, integralidade, justia.
c) autonomia, beneficncia, justia.
d) universalidade, autonomia, no maleficncia.
7) Discusses acerca de questes bioticas relacionadas
ao fim de vida permeiam tanto os espaos de sade,
quanto esto constantemente presentes na mdia
nacional e internacional. Abaixo so apresentados
conceitos relacionados ao processo de terminalidade,
bem como suas definies:
I. distansia
II. eutansia
III. ortotansia

IBFC_05

A processo pelo qual se opta por no submeter um


paciente terminal a procedimentos invasivos que vo
adiar sua morte, nem a processos que vo adiantla, focando o tratamento do doente em estado de
terminalidade na adoo de procedimentos paliativos,
buscando o controle da dor e de outros sintomas.
B prtica pela qual se abrevia a vida de um enfermo
incurvel de maneira controlada e assistida, com
consentimento deste ou de um representante.
C conjunto de aes, tambm chamada de obstinao
teraputica, que tem o objetivo de atrasar o processo
de morte de um doente incurvel em estado de
terminalidade, usando todos os meios, proporcionados
ou no, para atingir tal fim, que muitas vezes infligem ao
paciente sofrimentos adicionais que no sero capazes
de reverter o quadro.
Assinale a alternativa que associa corretamente o
conceito sua definio:
a) I-C, II-B, III-A.
b) I-B, II-A, III-C.
c) I-A, II-C, III-B.
d) I-A, II-B, III-C.

8) Enquanto membro de uma equipe de sade, o psiclogo


deve estar atualizado e engajado em discusses que
permeiam o campo da biotica. No caso da prtica da
eutansia no ambiente hospitalar brasileiro, assinale a
alternativa correta.
a) cabe ao psiclogo, aps avaliao psicolgica do
paciente, autorizar a realizao da eutansia em casos
especficos.
b) a prtica da eutansia permitida quando realizada uma
avaliao conjunta da equipe de sade que acompanha
o paciente, em que seja comprovado que este esteja
vivenciando um grau de sofrimento insuportvel
causado pela enfermidade, e venha a decidir de forma
consciente pela sua realizao.
c) o paciente pode optar por este procedimento, e tal
deciso necessita ser autorizada por uma comisso de
biotica hospitalar.
d) a eutansia proibida sob quaisquer circunstncias.

12) Os cuidados paliativos, segundo a Organizao


Mundial de Sade (OMS), caracteriza-se por ser
uma abordagem que promove qualidade de vida de
pacientes e seus familiares diante de doenas que
ameaam a continuidade da vida, atravs da preveno
e alvio do sofrimento. Assinale a alternativa que no
pode ser considerada uma caracterstica dos cuidados
paliativos nesta abordagem.
a) ajudar a famlia a lidar com a doena do paciente e com
o luto.
b) o trabalho deve acontecer numa abordagem
multiprofissional, com equipes de profissionais em
equidade de poder e importncia.
c) deve ser oferecido ao paciente somente quando as
terapias curativas no tiverem mais eficcia e o paciente
estiver fora de possibilidade teraputica.
d) requer avaliao e tratamento da dor e de outros
problemas de natureza fsica, psicossocial e espiritual.

9) A Resoluo do Conselho Federal de Medicina


1.995/2012 relacionada s questes bioticas da
atualidade, que dispe sobre o conjunto de desejos,
prvia e expressamente manifestados pelo paciente,
sobre cuidados e tratamentos que ele quer ou no
receber no momento em que estiver incapacitado
de expressar livre e autonomamente sua vontade
conhecida como:
a) diretivas antecipadas de vontade.
b) termo de consentimento livre e esclarecido.
c) princpio de justia biotica.
d) ortotansia.

13) A comunicao de diagnsticos e prognsticos


na rea da sade pode se tornar uma tarefa difcil
ao profissional, principalmente quando trata-se da
comunicao de ms notcias, como a de possibilidade
de morte. Dessa forma, frequente a interveno do
psiclogo tanto junto aos pacientes e familiares que
recebem tais notcias, quanto junto equipe de sade
responsvel por esta comunicao. A comunicao de
ms notcias, de acordo com a literatura que orienta
esta prtica, sugere que esta deva acontecer:
a) sempre avaliando o que o paciente j sabe sobre sua
situao de sade antes de comunicar a m notcia.
b) sempre em um nico encontro, no qual devem ser
comunicadas todas as questes relativas ao diagnstico
10) A atuao do psiclogo na rea da sade, principalmente
e prognstico.
nos ambientes hospitalares, coloca-o constantemente
c) obrigatoriamente na presena de seus familiares,
em contato com o tema da morte. Dessa forma se faz
uma vez que estes vo ser o suporte que o paciente
necessrio que o profissional tenha conhecimento
necessita neste momento.
sobre os principais mecanismos que so comumente
d)
utilizando-se
da linguagem tcnica relacionada ao caso
utilizados pelos pacientes ante a ameaa de morte.
a fim de que o paciente possa ter a total dimenso da
Elisabeth Kbler-Ross, renomada psiquiatra sua,
situao na linguagem mdica.
props cinco estgios pelos quais pode passar o doente
em seu processo de morte, e sugere em sua obra,
que estes aconteam didaticamente numa sequencia, 14) As famlias que acompanham seus parentes em
apesar de no se caracterizar uma sequencia rgida. Tal
situao de terminalidade geralmente sofrem com
sequencia proposta :
as situaes de perda, em maior ou menor grau, e
vivenciam o luto. Muitas vezes, a vivncia do luto
a) raiva, negao, depresso, negociao, aceitao.
considerada depresso. Assinale a alternativa que
b) negao, raiva, negociao, depresso, aceitao.
apresenta a correta relao do luto com a depresso:
c) negociao, raiva, negao, aceitao, depresso.
a)
todo processo de luto, patolgico ou no, permeado
d) raiva, depresso, negociao, aceitao, negao.
pela manifestao de depresso clnica.
b) luto e depresso podem ter sintomas parecidos,
11) Ao se deparar com uma situao de terminalidade na
porm no luto considerado no patolgico no existe a
rea da sade, cabe equipe de profissionais objetivar
perda da auto-estima, ou se o tem, no acontece por
a qualidade de vida do paciente para que este possa
longos perodos de tempo, sintoma que comumente
vivenciar a morte de forma digna. Julgue as afirmaes
encontrado na maioria das depresses clnicas.
abaixo como V (verdadeiras) ou F (falsas) em relao
c) no existe relao entre luto e depresso, j que ambas
ao atendimento do psiclogo ao paciente considerado
as situaes no apresentam nenhuma caracterstica
terminal.
ou padres em comum.
( ) evitar falar sobre o prognstico com o paciente nas
d) um transtorno de depresso no pode ser sido iniciado
intervenes, mesmo quando o tema for iniciado pelo
durante o processo de luto, aps uma perda.
paciente, j que este fato pode acarretar um quadro
depressivo de difcil manejo, e piorar sua situao de
15) A terapia do luto, comumente utilizada no
sade.
acompanhamento de pessoas enlutadas em situaes
( ) facilitar a expresso de pensamentos, sentimentos e
especficas. Tal abordagem compreende o processo
emoes associadas ao processo de adoecimento.
de luto como composto por quatro tarefas bsicas,
( ) ajudar o paciente a manter a esperana.
que se realizadas com sucesso, podem favorecer o
( ) determinar as prioridade do paciente e acatar suas
desenvolvimento saudvel da pessoa que perdeu um
definies de qualidade de vida.
ente querido. O momento em que a pessoa enlutada
( ) deve-se obrigatoriamente trazer o tema da morte e do
pode redefinir a perda de modo que ela possa
morrer para os atendimentos, uma vez que esta a
redundar em algum benefcio para a pessoa que fica,
maior questo vivenciada pelo paciente.
frequentemente faz parte de uma execuo completa
A ordem correta de afirmaes verdadeira e falsas, de
da tarefa do luto chamada de:
cima para baixo :
a) Tarefa II - elaborar a dor da perda.
a) F, V, V, V, F.
b) Tarefa IV - reposicionar em termos emocionais a pessoa
b) V, V, F, F, F.
que faleceu.
c) V, F, V, F, V.
c) Tarefa I - aceitar a realidade da perda.
d) F, V, F, V, V.
d) Tarefa III - ajustar-se a um ambiente onde est faltando
a pessoa que faleceu.
2

IBFC_05

16) Com
relao
ao
conceito
de
normalidade,
constantemente discutido na rea de sade mental e
psicopatologia, d valores verdadeiro (V) ou falso (F).
( ) uma definio de normalidade que costuma ser usada
em estudos normativos do comportamento baseia-se no
princpio da curva de distribuio normal, que considera
a faixa intermediria como normal, e os extremos como
anormais, numa abordagem amparada pelo princpio
estatstico.
( ) sua definio dependente da abordagem terica do
profissional, suas opes filosficas e ideolgicas.
( ) o conceito conhecido como normalidade como processo
baseado em aspectos funcionais, sendo que o
fenmeno considerado patolgico quando produz
sofrimento para o individuo ou para o seu grupo social.
A ordem correta de afirmaes verdadeiras e falsas, de
cima para baixo :
a) V, V, F.
b) F, F, V.
c) F, V, F.
d) V, V, V.
17) Um transtorno com incio frequentemente na infncia,
que caracterizado por dificuldade em prestar ateno
a detalhes, podendo causar erros por descuido em
atividades escolares ou de trabalho, dificuldade
frequente para manter a ateno em tarefas ou
atividades ldicas, dificuldade para seguir instrues
e no cumprimento de deveres ou tarefas domsticas
ou profissionais, no devido a comportamento de
oposio ou incapacidade de compreender instrues,
dificuldade para organizar tarefas e atividades, e
esquecimento de atividades dirias chamado de:
a) Transtorno de comportamento disruptivo.
b) Transtorno de dficit de ateno e hiperatividade.
c) Transtorno de tique.
d) Transtorno autista.
18) A depresso atualmente um grave problema de
sade, sendo responsvel por ser a psicopatologia que
mais incapacita pessoas ao redor do mundo. Assinale
a alternativa incorreta em relao ao transtorno
depressivo maior:
a) duas vezes mais frequente no sexo feminino que no
masculino.
b) pode aumentar o tempo de internao dos pacientes
hospitalizados, e a morbidade em casos de ps
operatrios.
c) est associado com alta mortalidade.
d) seu incio considerado somente a partir da idade
adulta.

19) Transtornos de personalidade so caracterizados


por um padro persistente de vivncia ntima ou
comportamento que se desvia acentuadamente das
expectativas da cultura do indivduo, sendo invasivo e
inflexvel, tem seu incio na adolescncia ou comeo
da idade adulta, estvel ao longo do tempo e provoca
sofrimento ou prejuzo. Assinale a alternativa que
corresponda s caractersticas do transtorno de
personalidade borderline:
a) padro invasivo de desrespeito e violao dos direitos
dos outros, que ocorre desde a adolescncia, com
fracasso em conformar-se s normas sociais em relao
a comportamentos legais, propenso para enganar e
manipular os outros a fim de obter vantagens pessoais
ou prazer, fracasso em planejar o futuro, irritabilidade e
agressividade, e indiferena por ter causado prejuzo a
algum.
b) padro invasivo de excessiva emocionalidade e
busca de ateno, permeado por um sentimento de
desconforto em situaes nas quais no o centro das
atenes, sua interao com os outros frequentemente
se caracteriza por um comportamento inadequado,
sexualmente provocante ou sedutor, exibe mudana
rpida e superficialidade na expresso das emoes,
e exibe autodramatizao, teatralidade e expresso
emocional exagerada.
c) padro invasivo de instabilidade dos relacionamentos
interpessoais, auto-imagem, afetos, e acentuada
impulsividade, incluindo realizao de esforos
frenticos para evitar um abandono real ou imaginado,
um padro de relacionamentos interpessoais instveis
e intensos, caracterizado pela alternncia entre
extremos de idealizao e desvalorizao, perturbao
da identidade, impulsividade em reas potencialmente
prejudiciais prpria pessoa, e recorrncia de
comportamento, gestos ou ameaas suicidas ou de
comportamento automutilante.
d) padro invasivo de distanciamento das relaes
sociais e uma faixa restrita de expresso emocional em
contextos interpessoais, no desejando nem gostando
de relacionamentos ntimos, incluindo fazer parte de
uma famlia, quase sempre opta por atividades solitrias,
manifesta pouco interesse em ter experincias sexuais
com outra pessoa, e tem prazer em poucas atividades,
alm de no ter amigos ntimos ou confidentes,
demonstrando distanciamento ou afetividade embotada.
20) A ansiedade est presente ao longo do ciclo da
vida, aparecendo como uma resposta a situaes
especficas. Quando ultrapassa os nveis da
normalidade, passa a ser considerada um transtorno
de acordo com a psicopatologia. Assinale a alternativa
cujas psicopatologias apresentadas no correspondem
a um transtorno de ansiedade.
a) fobia especfica, transtorno de pnico com agorafobia.
b) transtorno do estresse ps traumtico, transtorno
obsessivo compulsivo.
c) transtorno de pnico, fobia social.
d) transtorno bipolar, transtorno distmico.
21) Com a Resoluo n02/2001 do Conselho Federal
de Psicologia, a Psicologia Hospitalar passou a ser
considerada uma especialidade na rea da Psicologia.
Assinale a alternativa que no corresponde a um dos
objetivos da psicologia hospitalar:
a) favorecer a expresso da subjetividade presente no
processo de adoecimento e tratamento, restituindo ao
paciente o lugar de sujeito neste processo.
b) auxiliar pacientes e familiares em sofrimento
psquico decorrente de suas patologias, internaes
e tratamentos, a fim de que possam atravessar a
experincia do adoecimento.
c) realizar a escuta do paciente e seus familiares
hospitalizados, contribuindo para que estes simbolizem
seu sofrimento atravs das palavras.
d) trabalhar com pacientes hospitalizados, de todas as
faixas etrias no ambiente hospitalar, tendo como meta
principal sua cura tanto fsica quanto mental.

IBFC_05

22) No ambiente hospitalar, o psiclogo est inserido numa


equipe com profissionais de formaes variadas. Para
que ocorra um atendimento integrado do paciente,
esta equipe precisa estar em constante comunicao
a respeito de aspectos relacionados ao paciente. Uma
forma de manter a equipe informada a respeito de
aspectos dos atendimentos realizados no ambiente
hospitalar o pronturio. Com relao ao registro em
pronturios compartilhados, cabe ao psiclogo:
a)
registrar todas as informaes relacionadas ao
atendimento psicolgico realizado nos pronturios, j
que estes que embasam atividades em equipe.
b) registrar, nos documentos que embasam as atividades
em equipe multiprofissional, apenas as informaes
necessrias para o cumprimento dos objetivos do
trabalho, podendo manter um arquivo confidencial no
qual registrar todas as informaes relacionadas ao
caso.
c) fazer esta comunicao de forma exclusivamente verbal
equipe, a fim de diminuir interpretaes errneas por
quem tem acesso a estas informaes.
d) no utilizar este recurso como forma de transmitir
informaes relacionadas ao caso em nenhuma
circunstncia, a fim de no expor a confidencialidade.
23) Num hospital geral, a interconsulta psicolgica
comumente solicitada nas mais diversas situaes,
garantindo assim um atendimento integrado aos
pacientes.
Caracteriza-se
como
interconsulta
psicolgica:
a) o atendimento simultneo de dois psiclogos abordando
o caso de diferentes perspectivas.
b) a discusso do caso entre os membros de uma equipe.
c) a presena de um psiclogo, que foi requisitado para
atender solicitao de um outro profissional no
psiclogo, em relao ao atendimento de um paciente.
d) o atendimento conjunto e simultneo de uma mdico
e um psiclogo, que avaliam durante o atendimento,
aspectos fsicos e mentais de determinado paciente.
24) No ambiente hospitalar, a prxis do psiclogo precisou
superar os modelos tradicionais de atuao, e o seu
trabalho, a partir de sua entrada neste ambiente,
necessitou sofrer uma srie de adaptaes a fim de
fazer parte deste ambiente to peculiar. Dessa forma,
quanto durao dos atendimentos psicolgicos para
pacientes internados, consenso na literatura da rea
que:
a) o tempo de durao de cada atendimento definido
pelas condies clnicas do paciente, bem como pela
rotina do ambiente hospitalar, sendo que este tempo
pode ser bastante varivel a cada atendimento.
b) o tempo de atendimento sempre regular, na medida
em que se estabelece junto ao paciente um contrato de
trabalho.
c) o tempo ideal de atendimento psicolgico no hospital
uniformemente definido como sendo o de 30 minutos,
tendo em vista a rotina deste ambiente.
d) o psiclogo nunca deve exceder o tempo de 50 minutos
em cada consulta, levando-se em conta a fragilidade do
paciente na situao de hospitalizao.

25) Julgue as afirmaes a seguir de acordo o setting


teraputico do psiclogo hospitalar, e assinale a
alternativa correta:
I. O modelo de psicologia clnica ideal para embasar a
atividades do psiclogo hospitalar, na medida em que
o setting teraputico equivalente nas duas reas de
atuao.
II. O local de atendimento em psicologia hospitalar onde
o paciente est.
III. Os atendimentos ocorrem principalmente nos leitos
das enfermarias, no caso dos pacientes internados, e a
falta de privacidade, barulhos e interrupes devem ser
tratados com flexibilidade.
Esto corretas as afirmativas:
a) todas esto corretas.
b) somente I e II.
c) somente II e III.
d) somente I e III.
26) O trabalho na rea da sade, principalmente em
ambientes hospitalares, capaz de afetar a sade
mental do trabalhador, que est exposto a uma grande
carga emocional no contato dirio com o sofrimento
humano. A sndrome de burnout, to comum entre
os profissionais da rea da sade, caracteriza-se por
apresentar:
a) humor deprimido, acentuada diminuio do interesse
ou prazer nas atividades, perda ou ganho significativo
de peso, bem como diminuio ou aumento do apetite,
insnia ou hipersonia, agitao ou retardo psicomotor,
fadiga ou perda de energia, e sentimento de inutilidade
ou culpa excessiva, bem como capacidade diminuda
de pensar ou concentrar-se, indeciso, e pensamentos
de morte recorrentes, no necessariamente associados
ao ambiente de trabalho.
b) tenso emocional crnica, afetando principalmente o
campo profissional, e que envolve os componentes da
exausto emocional, despersonalizao e a diminuio
do envolvimento pessoal no trabalho devido ao
esgotamento.
c) ansiedade e preocupao excessivas, ocorrendo na
maioria dos dias, sendo muito difcil alcanar o controle
da preocupao, caracterizada por inquietao,
dificuldade em concentrar-se, irritabilidade, tenso
muscular e perturbao do sono, causando sofrimento
clinicamente significativo.
d) estado de tenso que causa uma ruptura no equilbrio
interno do organismo, ou seja um estado de tenso
patognico do organismo. O desequilbrio ocorre quando
a pessoa necessita responder a alguma demanda que
ultrapassa sua capacidade adaptativa, sendo que a fonte
de tenso pode ser externa ao prprio organismo, ou
interna, como uma autocobrana, no necessariamente
relacionada s relaes de trabalho.

IBFC_05

27) Independentemente de cultura ou classe social, a


criana tem sido vtima de violncia. A violncia contra
a criana e o adolescente pode se caracterizar como
violncia fsica, psicolgica, sexual e negligncia.
Relacione a seguir, o tipo de violncia com sua correta
definio:
A violncia fsica
B violncia psicolgica
C violncia sexual
D negligncia

1. Manifesta-se pela depreciao da criana ou do


adolescente pelo adulto, por humilhaes, ameaas,
impedimentos, ridicularizaes, que minam a sua
auto-estima, fazendo com que acredite ser inferior aos
demais, sem valor, causando-lhe grande sofrimento
afetivo, gerando profundos sentimentos de culpa e
mgoa, insegurana, alm de uma representao
negativa de si mesmo, que podem acompanh-lo por
toda a vida.
2. Este tipo de violncia manifesta-se pela ausncia dos
cuidados fsicos, emocionais e sociais, expressando um
desleixo propositadamente infligido em que a criana
ou o adolescente so mal cuidados, ou mesmo, no
recebem os cuidados necessrios s boas condies
de seu desenvolvimento fsico, moral, cognitivo,
psicolgico, afetivo e educacional.
3. Nesse tipo de violncia, o abusador pode utilizar-se
da seduo ou da ameaa para atingir seus objetivos,
praticando atos libidinosos como toques, carcias,
exibicionismo, que podem no deixar marcas fsicas,
mas que nem por isso deixam de ser abuso grave
devido s consequncias emocionais para suas vtimas.
4. So atos de agresso contra a criana ou o
adolescente pelo uso da fora fsica, utilizada
para machucar a criana ou adolescente de forma
intencional,
no acidental, que podem ir de uma
palmada at ao espancamento, ou outros atos cruis
que podem ou no deixar marcas fsicas evidentes.
Tais agresses podem provocar fraturas, hematomas,
queimaduras, esganaduras,hemorragias e, inclusive,
causar at a morte.
A associao correta :
a) A-4; B-1; C-3, D2.
b) A-3; B-2; C-4; D-1.
c) A-2; B-3; C-1; D-4.
d) A-1; B-4; C-2; D-3.

28) Na rea da sade, principalmente no ambiente


hospitalar, existe certa dificuldade em identificar
quadros relacionados a maus tratos e violncia
domstica intrafamiliar, uma vez que estes chegam
pouco at os servios de sade, e aparecem de forma
mascarada. importante que o profissional da sade
esteja atento aos indcios que mais frequentemente
podem caracterizar maus-tratos. Assinale a alternativa
que no deve ser considerada, num primeiro momento,
como caracterstica de maus tratos:
a) indiferena, por parte dos genitores diante da gravidade
dos ferimentos, e demora em procurar atendimento.
b) leses que no se justificam pelo tipo de acidente
relatado, e incompatveis com a idade da criana ou
adolescente.
c) poucas leses, localizadas em reas expostas, sem
padro definido.
d) leses em vrios estgios de cicatrizao ou cura, em
reas cobertas, como genitlia e ndegas.

29) Um tipo de violncia contra a criana e o adolescente,


caracterizada como um tipo de violncia psicolgica
provocada por um dos pais, na qual este a treina para
romper laos afetivos com o outro cnjuge, criando
fortes sentimentos de ansiedade e temor em relao
ao outro genitor, e trazendo importante repercusso
psquica para essas crianas e adolescentes
conhecida como:
a) sndrome da alienao parental.
b) sndrome do estresse ps traumtico.
c) sndrome do cativeiro.
d) negligncia ao menor.
30) A legislao brasileira prev o aborto legal para
mulheres grvidas em decorrncia de estupro. No
caso de adolescentes que sofreram abuso sexual que
resultaram em gravidez, a legislao brasileira prev
que:
a) no permitida a realizao legal do aborto em nenhuma
circunstncia no caso de adolescentes.
b) permitida a realizao legal do aborto mesmo sem o
consentimento da gestante ou seus responsveis.
c) permitida a realizao legal do aborto desde que com
consentimento prvio, sendo necessria a autorizao
de responsveis ou tutores para a solicitao do
procedimento.
d) no existe legislao especfica para tal questo, e
cada caso analisado individualmente pelos rgos
competentes.
31) No Brasil, o Sistema nico de Sade (SUS), funciona
de acordo com princpios e diretrizes que lhe garantem
suas caractersticas peculiares e funcionamento em
todo territrio nacional. Assinale a alternativa que
corresponde a diretriz organizativa do SUS, conhecida
como descentralizao:
a) exigncia de que quando um indivduo busca o
atendimento ou quando surge um problema de impacto
coletivo sobre a sade, o servio correspondente esteja
capacitado para enfrent-lo e solucion-lo at o nvel de
sua competncia.
b) diviso das responsabilidades pela gesto da sade no
Brasil entre as trs esferas do governo, federal, estadual
e municipal, a partir da ideia de que quanto mais perto
do fato a deciso for tomada, mais chance haver de
ser eficaz.
c) conjunto contnuo e articulado de aes e servios,
preventivos e curativos, individuais e coletivos, em
todos os nveis de complexidade.
d) assegura aes e servios de todos os nveis, de acordo
com a complexidade que cada caso requeira, more o
cidado onde morar, sem privilgios e sem barreiras.
32) No Brasil, aproximadamente 12% da populao
necessita de algum atendimento em sade mental, seja
de forma contnua ou eventual. Julgue os objetivos
do governo brasileiro apresentados abaixo como
verdadeiros (V) ou falsos (F) em relao ao modelo
atual de ateno sade mental:
( ) qualificar, expandir e fortalecer a rede hospitalar formada
pelos Centros de Ateno Psicossocial, Servios
Residenciais Teraputicos, e Unidades Psiquitricas em
Hospitais Gerais.
( ) incluir as aes da sade mental na ateno bsica.
( ) aumentar, de forma pactuada e programada os leitos
psiquitricos nos hospitais.
( ) avaliar continuamente todos os hospitais psiquitricos
por meio do Programa Nacional de Avaliao dos
Servios Hospitalares.
A ordem correta de afirmaes verdadeiras e falsas, de
cima para baixo :
a) V, F, V, F.
b) V, V, F, V.
c) F, F, V, V.
d) F, V, F, V.

IBFC_05

33) Um dos Programas da Poltica Nacional de Sade


Mental brasileira o Programa De Volta Pra Casa,
que assiste pessoas acometidas por transtornos
mentais, com histria de longa internao psiquitrica.
Assinale a alternativa que no corresponde a uma das
caractersticas do programa:
a) abriga os beneficirios, que esto impossibilitados
de retornar s suas famlias de origem, em casas
localizadas no espao urbano, garantindo-lhes o direito
moradia.
b) estimula o exerccio pleno dos direitos civis, polticos e
de cidadania.
c) realiza o pagamento do auxlio-reabilitao ao
beneficirio do programa atravs de um carto
magntico com o qual este pode sacar e movimentar
mensalmente estes recursos.
d) deve
estar
presente
numa
estratgia
de
acompanhamento na rede de ateno sade mental,
capaz de dar uma resposta efetiva s demandas do
beneficirio.
34) De acordo com a atual Poltica Nacional de Ateno
Bsica (PNAB), assinale a alternativa incorreta em
relao aos seus princpios gerais:
a) caracteriza-se por um conjunto de aes de sade, no
mbito individual e coletivo, que abrange a promoo
e a proteo da sade, a preveno de agravos, o
diagnstico, o tratamento, a reabilitao e a manuteno
da sade.
b) desenvolvida por meio do exerccio de prticas
gerenciais e sanitrias democrticas e participativas,
sob forma de trabalho em equipe, dirigidas a populaes
de territrios bem delimitados, pelas quais assume a
responsabilidade sanitria.
c) deve ser o contato preferencial dos usurios com os
sistemas de sade.
d) utiliza tecnologias de baixa complexidade e elevada
densidade, que devem resolver os problemas de sade
de maior frequncia e relevncia em seu territrio.
35) Nas ltimas dcadas observam-se conquistas
importantes em termos de polticas pblicas que
garantiram direitos pessoa idosa no Brasil. Entre elas,
em 2003, foi aprovado o Estatuto do Idoso, destinado a
regular os direitos assegurados s pessoas com idade
igual ou superior a 60 anos. Em relao ao Estatuto do
Idoso, assinale a alternativa incorreta.
a) ao idoso que esteja no domnio de suas faculdades
mentais assegurado o direito de optar pelo tratamento
de sade que lhe for reputado mais favorvel.
b) dever do poder pblico o fornecimento gratuito de
medicamentos, especialmente de uso continuado, com
exceo de prteses e rteses para reabilitao, que
ainda ficam a cargo da iniciativa privada ou organizaes
no governamentais.
c) assegurado ao idoso internado ou em observao
o direito a acompanhante, devendo o rgo de sade
proporcionar as condies adequadas para a sua
permanncia em tempo integral.
d) vedada a discriminao do idoso nos planos de sade
pela cobrana de valores diferenciados em razo da
idade.

36) Assinale a alternativa correta em relao ao que dispe/


regulamenta a Lei Federal n 12.527, de 18 de novembro
de 2011:
a) dispe sobre a proteo e os direitos das pessoas
portadoras de transtornos mentais, e redireciona o
modelo assistencial em sade mental.
b) dispe sobre o Estatuto do Idoso e d outras
providncias.
c) regulamenta o acesso a informaes, sendo que
subordinam-se ao regime desta Lei os rgos pblicos
integrantes da administrao direta dos Poderes
Executivo, Legislativo, e Judicirio e do Ministrio
Pblico, bem como as autarquias, as fundaes
pblicas, as empresas pblicas, as sociedades de
economia mista e demais entidades controladas direta
ou indiretamente pela Unio, Estados, Distrito Federal e
Municpios.
d) regulamenta o benefcio de prestao continuada da
assistncia social pessoa com deficincia e ao idoso.
37) A lei que dispe sobre os procedimentos a serem
observados com o fim de garantir o acesso a
informaes na administrao pblica faz distino
entre os termos conceituais a que se refere. Assinale a
alternativa que apresenta a associao correta entre os
termos com suas definies, de acordo com tal lei:
1. informao
2. documento
3. informao sigilosa
4. informao pessoal
A aquela submetida temporariamente restrio de
acesso pblico em razo de sua imprescindibilidade
para a segurana da sociedade e do Estado.
B unidade de registro de informaes, qualquer que seja
o suporte ou formato.
C aquela relacionada pessoa natural identificada ou
identificvel.
D dados, processados ou no, que podem ser utilizados
para produo e transmisso de conhecimento, contidos
em qualquer meio, suporte ou formato.
a) 1-B; 2-A; 3-C; 4-D.
b) 1-A; 2-C; 3-D; 4-B.
c) 1-C; 2-D; 3-B; 4-A.
d) 1-D; 2-B; 3-A; 4-C.
38) De acordo com o Decreto n 58.052, de 16/05/2012,
dever dos rgos e entidades da Administrao Pblica
Estadual:
I. promover a gesto transparente de documentos, dados
e informaes, assegurando sua disponibilidade,
autenticidade e integridade, para garantir o pleno direito
de acesso.
II. divulgar documentos, dados e informaes de interesse
coletivo ou geral, sob sua custdia, independentemente
de solicitaes.
III. proteger os documentos, dados e informaes sigilosas
e pessoais, por meio de critrios tcnicos e objetivos, o
menos restritivo possvel.
Esto corretas:
a) apenas I.
b) todas as afirmaes.
c) apenas II e III.
d) apenas I e III.

IBFC_05

39) A Psicossomtica um tema relativamente recente na


rea da sade, embora seus princpios estejam contidos
na doutrina mdica h muitos sculos. Um importante
autor da chamada medicina psicossomtica conhecido
por conduzir estudos que associavam certas doenas
caractersticas de personalidade, e por liderar o grupo
conhecido como Escola de Chicago :
a) Franz Alexander.
b) Alfred Adler.
c) Theodor Adorno.
d) Wilfred Bion.
40) Um grande nmero de doenas, segundo a abordagem
psicossomtica, revela a forma de uma pessoa
viver a sua interao com o mundo. No paciente
psicossomtico, uma caracterstica comumente
observada a dificuldade em falar sobre, e para
identificar seus sentimentos, conhecida como:
a) distimia.
b) alexitimia.
c) ciclotimia.
d) hipomania.
41) Durante o desenvolvimento da Psicossomtica,
muitas Escolas tiveram influncia e contriburam
para o desenvolvimento de tal rea. Atravs de seus
estudos tericos e prticos, apresentaram correlaes
importantes para a compreenso do fenmeno
psicossomtico. Assinale a alternativa cujos conceitos
citados no apresentam correlao dentro desta
abordagem terica:
a) afeto e sintoma.
b) doena somtica e situao de perda e ou separao.
c) pensamento operatrio e pacientes somatizadores.
d) atividades fantasmtica aumentada e pacientes com
doenas somticas.
42) A Psicoterapia Breve considerada uma forma de
interveno teraputica frequentemente utilizada
em instituies de sade. A Psicoterapia Breve de
abordagem psicodinmica tem algumas caractersticas
particulares, com exceo de:
a) permite a dinamizao do processo teraputico,
colocando em ao mais rapidamente um processo de
mudana a partir do foco de trabalho.
b) favorece a neutralidade absoluta do terapeuta, que
obedece a regra da abstinncia, mantendo a ateno
flutuante.
c) favorece maior flexibilidade de ao, possibilitando ao
terapeuta lidar com a realidade externa do paciente,
bem como com aspectos transferenciais.
d) permite a formulao de um plano teraputico a ser
atingido, uma vez feita a avaliao psicodinmica e a
escolha de um foco de atuao, para onde convergiro
a interpretao, ateno, e negligncia seletiva do
terapeuta.
43) A seguir so apresentadas situaes em que fazse necessrio algum tipo de acompanhamento
psicolgico. Assinale a alternativa em que h indicao
para a psicoterapia breve de orientao psicodinmica:
I. Nos casos de transtornos psiquitricos crnicos e
graves.
II. Pacientes em situao de crise.
III. Pacientes em situao de mudana ou transio de
etapas evolutivas.
IV. Pacientes com transtornos reativos que possuam um
nvel de adaptao aceitvel anteriormente.
Esto corretas as afirmativas:
a) I e IV.
b) I, III, IV.
c) II, III, IV.
d) I, II, III, IV.

44) O diagnstico de AIDS, mesmo com o advento dos


mais modernos tratamentos, ainda modifica drstica
e negativamente a viso do paciente sobre o seu
futuro. Dessa forma, comum o desenvolvimento pelo
paciente, aps receber tal diagnstico, de um transtorno
caracterizado por estado de angstia subjetiva e
perturbao emocional, usualmente interferindo no
funcionamento e no desempenho social, sendo que
o incio do quadro se d usualmente aps algumas
semanas do diagnstico, e cessa em geral, aps os
seis primeiros meses. Tal acometimento conhecido
como:
a) transtorno de ajustamento.
b) transtorno de ansiedade generalizada.
c) transtorno obsessivo compulsivo.
d) transtorno de pnico.
45) Apesar da constante evoluo da cincia na pesquisa
da cura da AIDS, no foi descoberto, at o momento,
um tratamento que promova a erradicao total do
vrus causador no organismo humano. Entretanto, o
tratamento utilizado tem propiciado grande mudana
no curso clnico da infeco, possibilitando controle
da doena e aumento da qualidade de vida, e a maior
causa de falncia teraputica deste tratamento a m
adeso. Assinale a alternativa que no corresponde, de
acordo com a literatura da rea, a um fator de risco para
m adeso do paciente ao tratamento:
a) uso/abuso de lcool.
b) uso/abuso de drogas ilcitas.
c) depresso.
d) uso/abuso de tabaco.
46) A gestao e o nascimento de uma criana modificam
o contexto familiar, e podem estar permeadas de
sentimentos ambivalentes geradores de dvidas e
insegurana. De acordo com a teoria psicanaltica,
a dificuldade para engravidar pode estar ligada s
questes inconscientes como:
I. o medo de gerar filhos, que pode estar presente em
casos de infertilidade e de transtornos de fecundao.
II. denegrir seu prprio corpo, no caso da mulher, na
construo da auto imagem, gerando baixa estima.
III. a criao da imagem de um beb aterrorizador, que vai
trazer mais perdas e riscos do que ganhos.
Esto corretas as afirmativas:
a) nenhuma est correta.
b) todas esto corretas.
c) somente II est correta.
d) somente I e III esto corretas.
47) O puerprio um perodo de intensas adaptaes
tanto para a mulher quanto para a famlia. A depresso
associada ao nascimento de um beb, chamada de
depresso ps-parto se refere a um conjunto de
sintomas que est descrito de forma incorreta em:
a) est associada exclusivamente a mecanismos
biolgicos.
b) o DSM IV sugere que os sintomas devem estar presentes
por pelo menos trs semanas para a realizao do
diagnstico.
c) sua apresentao clnica semelhante dos quadros
depressivos que se do em outros momentos do ciclo
reprodutivo feminino.
d) uma combinao de fatores biolgicos, obsttricos,
sociais e psicolgicos pode significar risco para a
depresso ps-parto.

IBFC_05

48) A possibilidade de um diagnstico de malformao fetal


durante a gravidez uma das principais preocupaes
vivenciadas pelos pais durante a gestao. Nos casos
de confirmao deste diagnstico, assinale a alternativa
que no corresponde a uma possvel vivncia dos pais
de bebs diagnosticados com malformao, de acordo
com a literatura da rea:
a) ao gerar um filho malformado, os pais podem sentir
que o que eles tem de pior foi passado ao filho, e agora
esto expostos para a sociedade todos os seus erros,
todos os seus defeitos.
b) casais que tm muitos filhos sofrem menos do que os
casais que esto esperando o primeiro filho.
c) os pais podem sentir-se ameaados diante da
possibilidade de serem vistos como pessoas defeituosas,
imperfeitas ou anormais.
d) a capacidade de lidar com a notcia de um diagnstico
de malformao fetal multifatorial.

50) O aborto espontneo durante a gestao, situao de


etiologia multifatorial, acomete muitas mulheres no
mundo todo e pode ser considerada uma emergncia
obsttrica em hospitais maternidade. Tal perda, que
pode ser minimizada por alguns membros da famlia,
exige dos pais um trabalho de luto. Assinale a alternativa
que facilita a passagem pela tarefa do luto denominada
elaborao da dor da perda:
a) evitar lembrar-se de aspectos relacionados gestao.
b) a expresso das emoes relativas ao aborto.
c) a tentativa de evitar o sofrimento.
d) no entrar em contato com a situao vivenciada.

49) A insero do psiclogo na assistncia ao contexto


gestacional de alto risco est preconizada pela Portaria
N 3.477, de agosto de 1998. Assim, leia as afirmaes
sobre a atuao do psiclogo com familiares de
bebs diagnosticados com malformao, cabe a este
profissional; d valores verdadeiros (V) ou falsos (F).
( ) derrubar as defesas psicolgicas dos pais em todas
as situaes, uma vez que favorecer a vivncia da
situao real.
( ) oferecer a esses pais um trabalho de escuta
especializada.
( ) favorece a resignificao, por parte dos pais, da dor que
previamente consideravam insuportvel.
A ordem correta de afirmaes V (verdadeiras) e F
(falsas), de cima para baixo :
a) F, V, V.
b) V, F, F.
c) V, V, V.
d) F, F, V.

IBFC_05

PROVA: HEPP
ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: IBFC

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25

C
A
B
A
D
C
A
D
A
B
A
C
A
B
D
A
B
D
C
D
D
B
C
A
C

26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50

B
A
C
A
C
B
D
A
D
B
C
D
B
A
B
D
B
C
A
D
B
A
B
A
B

Coletnea de Provas | Concursos de Psicologia

    

   






 

Psiclogo rea Hospitalar

 

(M
"29+! 2
>(&&FB;
-8 * G2 + H " = * .
9. K 9; " +! 9. K ; " 9 * * .L + * " #". ! G
2 * O"# "*. ! *W ! * # * ! " * * H " * ! * 3" * G2 1
"+. +. ; "*." < . +8 ! *. +
*
2 !"
!"I9 9# . 3 = #" = U +*. .9 -8 = * .
1 "*." *"+. ! ; < <" . 9# ." !"
-8 * G2 I9"
9!"**" . K" ! ! * !
"+." !" < # 3C".
* G 2 " U "I9 " !" * D!"1 "
!
#
9. #"+
+ ! ; *8
+* !" ! * <9+-R"* !
." !"
-8 * G2 ; V
5
9 =
$
Q
(
$
/
/
N /
#
(
3
4 $
'B
'%
+
$
(
* F
8 '%
8
8
'%
'
(
4 A
'%
8
0
!
'%
%
8
$
!
% #
% 8 $ (

(?
?9

;
P O( 7 $.

'

12
;

1
!
' (@

!
8

'%
3

# 3 *" + * *93 3C". * "* " ,< * !


1 F
!
1
1
;
#
1
8
; (
1
8
' (
*.8
". * * ." + . *
9 F! FF! FFF FA(
3 FF FFF!
(
FFF FA!
(

% 4556

2 ! * D!"; + *"1
' (
;

* F! FF FFF!
4 F! FFF FA!

(
(

(N
?4

'%

&

%
+* !" +!
* < * *1
> B9
> BT
8,
> B 4+

8
$
.
* ." # * "*. "**" " * D!" "
1

$
'B

B2

; !
(@
" !

/
!
$

>

BT

'B
+

$
!
*"I9Q+ "*.H
9 A! =! =! =! A(

.
D

!
3

2 ! * D!"; # I9"

* < # .

'%

* " ! !"

;
/

% 4556

*"

;
(

$ $
K

/
'

8
$ 'B

5
8 #8

8 5

4 2

+
/

8
>

; !

'%

8
!

/ 5
$

#8
8

(
!
!

0
%

5
'%

(
". "#
3 =! A! A! =! A(

! "# $$%&'%(&$)

+, " + "+!" "- " ". /+

A! A! A! A! =(

0001 !" +1 213

* A! A! =! A! =(

. ! ! $(%&'%(&$)1

4 =! =! =! =! A(

'%

(P
"29+! 2
3
7 % 4555% 689 ;
* G 2 ;
+
9# . . #"+.
#
"+." !" "+!"+." I9,# ;
# ;
"7"# ; 9#
*. ; + # #"+. ! + #+"*" !" " H +* !"
! " * * * " . *; ** # #
"*"+- " 2
! !" !" # 3 ! !"* ,+ * 9 * I9 H.
* I9" ** # ! < 9 .
. . #"+. 1 3 "
* * " . * *" "# 3 ! ! * "# 9# + #+"*" # !" "+!"+."* I9,# *; + *"1
1
'
8
8
(
1 *
;
!
/
1
$ 5
(
1
$
!
(
1A
!
8 $ $
(
*.H>8 B
". >*B "+ * >*B < # . >*B
9 FF(
3 F FFF(
FF FFF(
* F! FF FFF(
4 F! FFF FA(

F&
?T

! KE
8
!
(
!
!

1 !8
0 1

$
1%

!/

D
/

!
#

!
% ,

$ 1

'%
/

(4
!

(:
%
0

LK
LL

(9

"*.9! !"

(
(@

* #"+ + ! ; ** + "
8
'
+ '% !

'%

# " -8
9
#
3

/ 0
1

." + .

688

8 !

'

% 4558%

". 1

'%

(
+ '%
!
0

'%

! ,

8 B (
!
0 '%

0 '%

8#

'B
!

$ 8 !
#

'%
$

(
*

% !
+

'% !

8 B

8 !

#
+

8
'%

(
$

'%

8#

'%

F$
?2

8 '%
"**"* .

9 9
3 A
4
* )

$
* !" . . #"+. ; !"*.
8 '%
# !$
'%
/
B

/ #

/
# *" * *"29 +."* 3 ! 2"+*; V
'B

/
/

%
/

+ F(@

% 4558

5
(

8
4

! ,

&

#8
8 (

,
! 0

8 'B

$ Q
8#

+
/

$ (

8
(

F(
O "29+! 2
:
; <
/ % =>>6 ; 9#
+. * 2+ < . + * ."
! 9*9H !" *93*.:+ *; L !"
I9" " "* 39* # XXXXXXXXXXXXXXXXXXXXX; "# "K !" XXXXXXXXXXXXXXXXXXXXX !" *"9* *"+. #"+. *
#" ! 9* !"
XXXXXXXXXXXXXXXXXXXXX1W ** + "
." + . I9" # ".
". " *"I9"+ #"+." < # .
+." 1
9
0 N
N $ Q
*
N
'% N $ Q
3
N
0 N
4
'% N #8 N $ $
#8 N
'% N

! "# $$%&'%(&$)

+, " + "+!" "- " ". /+

0001 !" +1 213

. ! ! $(%&'%(&$)1

FF
?

! EK
1

!$
!,
(9

'%

(M

'%

!
(:
/

&
'

+."

; ** + "
B

/
5

/
(
$

!
'%

(@

'%

! +
'%
(

'%

'%

!
8Q

!/

$
.

$ 1

'B !
%

1
8

8'

(9

+! -R"*
"*"+. ! * "
.
(
% (
0 '% (

/ 5
0 '% !

'%
!

% 4558

%!

'%

D
$ 1 !
0
!
8
(
(4
% (

9
3

4 9

!
!
% !

'%

! KL

'%
+

." + .

!
!

* 2

/
8

U,

# 3 *" + "*.9! !" *


9 2
!
B
(
3
!
+

F)
?"

.
8

'% !

8 /
/

'% !
'B
+

!
&
B

(@

&

(
8 !

/
2

"+." " < K"# 9# ! 2+G*.


*
4

% 4558

!" . +*. + !"


% + FF(
+ F(

F'
< ** + ; !"*"+
" 9# . . #"+. 9 " "+-8 ! !" "+!Q+ I9,# ; !" " H *" "* ! + *8 !"
>(&&NB; I9" < # "7 *. 9#
9. "* "+ # ! * +"*." **9+. 1 "+. " "*."*; !"*.
*"
9.
< # 2 " !" *,+! #" !" 3*. +Q+
H
; "# I9"
"#; L# ! * * +. # * H** * !
; +."+* *
# + <"*. -R"* 9. +/# *; 9*R"* " 9 + -R"* *9 * " .H." * #
+."*; +
#"+." # +*". * " "I9"+ *
+ # *1 < # 2 " ! *,+! #" !" 3*. +Q+
H
!"* . +." #"+." L
9
(
*
'%
(
3
(
4
$
0
(
(

FM
+."7. ! *
2
# !" "+."+! #"+.
1 7 $. 8
1 9
19
,
17
*.H>8 B
". >*B >*B <
9 FA!
(
3 F! FF! FFF FA(
FF FFF!
(

! "# $$%&'%(&$)

! * D!"; "+ +. *" *


2 = * .
I9"; ! +." ! *8 ! 9. 3
>(&&)B; L
" . . #"+. ! * * " . * * G2 * "# . + ! ! " #"+. 1 3 " ."# ; + *"1
1
,
$. 8
(
1
,
/
#8 ! 8 /
(
1
,
$
(
1
,
1
(M %
!
(
# . >*B
* F! FF FFF!
(
4 F! FFF FA!
(

+, " + "+!" "- " ". /+

0001 !" +1 213

. ! ! $(%&'%(&$)1

F?
?9

8 '%
1
8Q
!
8 $ 0 '%
8 *93 ."+* I9" # R"# "7 #" *,I9 ; V
9
% (
3 (
9 8
(

#/

8
(@

'%

% 455@

5
*
4

(
8 '% (

8 '%

FN
?5

6
( V6
: 4 9
8

&
!=
#8

/
%

78
#
!
8 (;

."7. ; L
%

>
%

< #

D
'% (
/
(

#
#

'

(
#

! OJS

* 7

A@>

1
8 !
$
4

% 4556%

I9"

$
D

#
#
D

4 -

( ;<

:@
# " -8
9 $
#
3 9

(;

98:

D
(

1%

FP
" .G
9 9! * G2 L 9#
"*"+. -8 !"* .
" !" * .9 -R"* "% 9 +! -R"* * G2 * " *9 *
!"." # + -R"* = *.G
*; *
*;
,. * " 9 .9 *; "*I9 * ! * +
"** !"
-8 * G2 1 "
+" *
."+* ! " .G % 9! * G2 U* "* " . * !"< + -R"*1
$1 F
'% (
> B
!
(
(1 *
'%
(
> B
/
,
0
'B ! & 0
/
$ (
F1
(
> B
&
'%
'B
&
$
8 ! 0B
+
8 /
0
(
)1 9
(
> B 4+
'%
N
'B
8
'%
5
/
$
$ 1 (
'1
% (
> B
/
0
+
'%
8
! $. 8
1
'B 8 8
&
+
(
*"I9Q+ "*.H
". "#
9 ! ! E! K! L(
3 ! E! ! K! L(
E! K! L! ! (
* ! L! E! K! (
4 L! ! ! E! K(

)&
"

* "* 9-R"* !
; "+ +. *" .
+ ! *
."+! #"+. * G2

! 9#"+. I9"
1 *." ! 9#"+.
-

+< #
Q+
!" < . * 9 * .9 -R"* 3C".
"*"+. * *"29 +."* < + ! !"*5

?
%,
* ! ! * #"+
9
3

%,
+ ! * "<" "# *"
(
(
(

! "# $$%&'%(&$)

'

@
! 9#"+. !"+ # + !

+, " + "+!" "- " ". /+

'
*
4

0001 !" +1 213

(
'%

. ! ! $(%&'%(&$)1

)$
O # " -8
* +*. 9#"+. * !"
-8 * G2 ; +
"** ! * ! 2+G*. ; > B XXXXXXXXXXXXXXXXXXX;
!" *" XXXXXXXXXXXXXXXXXX 9 XXXXXXXXXXXXXXXXXX; # *; +* !" +!
"*. 9.9 ! > B XXXXXXXXXXXXXXXXXXX;
L 9# 9+ ! !" "**"+
"; +
"** ; 9# ** 3 2 .G " < + ! * ! 2+G*. I9"; "# 29+* * *; !"
2
% 4555
". +
+. . ; # * !" + .9 "K ." Q9. 1W
** + "
." + . I9" # ".
". " *"I9"+ #"+." < # .
+." 1
9
N
8 N
8 N
5
3
N
8 N
N
N
N
N
*
N
N
N
4
'%
N
8 N
8 N
5

)(
"
!
# B / >(&&); 1 $$)B;
" *9 " " -8
; *9
+* !" +!
. -8
# "
" ! !" * "
* < * *1
> B2
$
(
> B9
5
,
8 8
> BT
!
!
*"I9Q+ "*.H
". "#
9 A! A! =(
3 =! A! A(

O * " -R"* =9# + *; * "** * # +=" #"+. !" * #"*# *" !"*. #
" -8 " ! * " + #"+. ! +." ! *
+." #"+. * !
! "** " *
W1
! " + +!
+=" #"+. U " * + ! !"; # I9"
* < # . *
8 8

!
'% !

,!

(
#
8

/ 5

'%
(

A! =! =(

* A! A! A(

4 =! =! A(

)F
O # 9# "+. " *. * G2 ;
. !" "* +!" 9 +"2
9+.
#"+."
"*"+- !" * + * " * +. # *
*
. G2 * !"+ # + *" XXXXXXXXXXXXXXXXXX1 YH XXXXXXXXXXXXXXXXXX L ."+. .
!
"+." !"
;
"*"+. ; #
<
9# . ; 9+.
#"+."; 9# * +. # ; * + 9 Q+ I9" !" < . +8 ."#1W
C

** + "
." + .
9 / 8 N 8 8
3 / 8 N
'% N

I9"

# ".

". " *"I9"+

#"+."

'%

< # .
+."
*
8
N
4
'% N

% =>>9

1
'%
'%

'%

))
"

+ ! * *
2 # * "# * D!" #"+. "+ +. # *" H * + " . *Z "# #"
"*."*;
9.
< # I9" O
+ " . !" + # ! !" "# *
. 2 . #3L# #
G
!"< + -8 ! I9" L * D!" "
"+- #"+. 1 **"* ."# *
"*"+. # !"*! 3 #"+. * "# H * H " * ! * D!" #"+. W1 8
+* !" ! * H " *
* D!" #"+. ; V
5
#
(
* 7
'%
'%
(
2
#
(
4
.
;
#
; (
/
/
(

>(&&NB;

!
!
9
3

)'
?9

+
9 $
3 1

#
'B
#
< # !" *

/
!
*";

!,
(*
." K !

(
(
0 '% (

! "# $$%&'%(&$)

+, " + "+!" "- " ". /+

!/
0
*9 < "I9Q+

" # .:+
* / 0
4 /

0001 !" +1 213

,+
(

0
$0
;L
8 (

. ! ! $(%&'%(&$)1

(@

8
#
% 4558

)M
?2

8
# "
1
?
1
12
/
*.H>8
9 F! FF

!
8 8
/ !
+
;
!
'%
'
'
'%
#8
-8 U* "2 * 9 * ! "+. " *. "# * D!" #"+. ; + *"1
0
5
!
@! 8
8
$
!
Q (
0
!
#8
$ + !
! 8
8
(
#
!
! 8
!
8 !
/
$
/ 8 5
W
B
". >*B >*B < # . >*B
FFF(
3 F!
(
FFF!
(
* F FF!

(@

% 4558

0 8 !

+
!?

!
WU

@!

#8

0
/

4 FF FFF!

)?
.9 -8 "#
2 # * !" " "+-8 " . . #"+. +
+."7. ! * D!" #"+. #
"+. "# +. .
#
! " * ! !" !"*." #
# " +=" " * "*.9! * "# . + ! * +
*
3 "# * " 9* *
.H * !
>(&&NB < # I9" O * *,+! #"* !" "** * *8
.9 #"+." " +=" ! * #
* D!"1 "*." *"+. ! ;
9#
3 "#
.H
!" * D!" D3 1 "29+! " +. #"+. * !
2 + K -8 #9+! ! * D!" >
B;
!" "**8 #
9+
L +* !" !
#"
9* !" +
! !" "+. " . ! * *
3 "# * ! * D!"1W
"
+" !"I9 ! #"+." * *93. * !" *,+! #"* " . +*. + * !" "** * * "* " . * * +. # *1
8
$1 *
%
#
(
> BM $
% /
8
8 !
$
(
> B M#
8
'
(1 4
8 (
/
#
! .
$
5
(
> B*
%
/
'% ( 2
8 1 ,
# !
/ +
;
8 (
F1 *
%
(
> B4
8
8 !
/
!
!
8
/
+
5
&
'B
$
(
)1 *
%
(
> B*
%
8
/
!
8 !
!
#
#
!
#
1
#
'%
%
'B
'1 *
%
Q
(
;
8 (
*"I9Q+ "*.H
". "#
9 L! ! K! E! (
3 ! K! E! ! L(
! K! L! ! E(
* E! K! ! L! (
4 ! L! E! ! K(

)N
# G! 2 !" [.
< ** + ;
"*. 3" " "
! R"* "* " ! * I9 +. U* H. * "<" "+! ! * " "* " .
."2
< ** + " " * "! !";
9 < #"+.
9. "< "78 "7 2 ! !" ! +! ,!9
"
! *9
H
7 *; !" # !
"* +* 3 KH ; "** " ". #"+.";
-R"* " *9 * +*"I9Q+ * + "7" ,
< ** + 1 #
3 *" + G! 2 !" [.
< ** + ! * G 2 ;
! + "* 9-8 +@ &$&%&' " + * "* " . * "* +* 3 ! !"*
!"*."; ** + " < # .
1
9
8'
'B
;$
5
!
8
$
#
(
3 9
$
8
/
.
!
(
=
! /
!
'%
8'
!
'B
$ 1
0
$. 8
(
* F
! /
'%
8'
!
'B
B /
$
(
4 7
! /
! $
1
!
'B
8'
!
!
/
!
$
$ 1 (

! "# $$%&'%(&$)

+, " + "+!" "- " ". /+

0001 !" +1 213

. ! ! $(%&'%(&$)1

)P
"* 9-8 +@ &$&%&'
G! 2 !" [.
L . +* . I9"
* G 2
!" H +."
+
9.
< ** + "# !"." # + ! * * .9 -R"*1
* G 2 ! V
5
9 X
8
8'
3 C
$ 1
C
+
!
/ /
* 4
5
$
4
0
% 8
'% 8
(

< ** + ! * G 2 1
.1 ?@ !"*." G! 2 !" [.
< ** +
"*. -8 !" *" - * * G2 * I9" "*."C # *"+! "<".9 ! *
* *"29 +."* +." "+-R"* *8 " # . ! *
"*. -8 !" *" - !
(
8

'%

0
!
8' !/

(
'% 8

8' (

' !

! $

'B

'&
"
!
#
.1 $M ! G! 2 !" [.
"*.9! *; "*I9 * * " . ! !"*
. ! *
!" " "* ! * G 2 ; V
5
9 <
!
3 *8
/
'B ! 8
% (
<
!
!
/
.
* 98
8 8
!
!
!
0 'B
4 <
8
'%
'B
8
'%
#

! "# $$%&'%(&$)

+, " + "+!" "- " ". /+

< ** + ! * G 2
! "# "* 9-8 +@ &$&%&';
!9-8 !" +=" #"+. " !"*"+
#"+. !" ." +
0 'B !

" K
2 *; *8

0 'B

(
/

8
8 8
!

8 8

'%
8

0001 !" +1 213

$.

. ! ! $(%&'%(&$)1

PROVA: EBSERH - HC - UFPE


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: IDECAN

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

E
A
C
B
D
E
D
E
C
A
B
A
D

39
40
41
42
43
44
45
46
47
48
49
50

B
E
D
A
C
B
D
D
C
D
E
B

Coletnea de Provas | Concursos de Psicologia

UNIVERSIDADE DE PERNAMBUCO - UPE


FACULDADE DE CINCIAS MDICAS - FCM
RESIDNCIA MULTIPROFISSIONAL INTEGRADA EM SADE DA FAMLIA, EM SADE
MENTAL E EM ATENO CLNICA ESPECIALIZADA
PROCESSO SELETIVO PBLICO

PSICOLOGIA

PSICOLOGIA

19. Sobre Reduo de Danos sociais e sade, decorrentes do uso de produtos, substncias ou drogas que causem
dependncia, assinale a alternativa INCORRETA.
A) A reduo de danos no implica o estabelecimento de vnculo com os profissionais, pois o usurio passa a ser o
responsvel pelos caminhos a serem construdos em sua vida.
B) A reduo de danos uma estratgia de sade pblica, dirigida a usurios ou a dependentes qumicos, que no conseguem
ou no querem interromper o uso de drogas, tendo como objetivo reduzir os riscos associados sem, necessariamente,
intervir na oferta ou no consumo.
C) As aes de reduo de danos devem ser desenvolvidas em todos os espaos de interesse pblico em que ocorra ou possa
ocorrer o consumo de produtos, substncias ou drogas que causem dependncia ou para onde se reportem os seus
usurios.
D) Nas aes de reduo de danos, devem ser preservadas a identidade e a liberdade da deciso do usurio ou dependente
sobre qualquer procedimento relacionado preveno, ao diagnstico e ao tratamento.
E) As aes de informao, educao e aconselhamento devem ser acompanhadas da distribuio dos insumos destinados a
minimizar os riscos decorrentes do consumo de produtos, substncias e drogas que causem dependncia.
20. Os Centros de Ateno Psicossocial (CAPS) so servios substitutivos ao hospital psiquitrico, que tm valor
estratgico para a Reforma Psiquitrica Brasileira. Sobre esses servios, analise as afirmativas abaixo:
I.

Os CAPS atendem s pessoas com transtornos mentais graves e persistentes e s com necessidades decorrentes do
uso de crack, lcool e outras drogas, admitindo-as independentemente de sua rea territorial.
II. O trabalho no CAPS realizado, prioritariamente, em espaos coletivos, de forma articulada com os outros pontos
de ateno da rede de sade e das demais redes.
III. O cuidado desenvolvido atravs de Projeto Teraputico Singular, construdo pela equipe multiprofissional a
partir do acolhimento do usurio.
IV. A ordenao do cuidado est sob a responsabilidade do CAPS ou da Ateno Bsica, garantindo permanente
processo de cogesto e acompanhamento longitudinal do caso.
Est CORRETO o que se afirma em
A) I, II, III e IV.
B) II, apenas.
C) II e IV, apenas.
D) I, III e IV, apenas.
E) I e IV, apenas.

CONHECIMENTOS ESPECFICOS

Nos Cadernos de Ateno Bsica de N 34, do Ministrio da Sade, so abordados vrios pontos essenciais para a
prtica do cuidado em Sade Mental, incluindo as pessoas que fazem uso de lcool e de outras drogas. Sobre o
referido cuidado, responda as questes de 21 a 30.

21. Quanto s diretrizes gerais para identificao de problemas de sade mental em criana e adolescente, correto
afirmar, EXCETO, que
A) a avaliao das crianas e adolescentes deve focar no conhecimento da subjetividade dos seus pais, uma vez que esta
espelhar as dos filhos.
B) a demanda de cuidado na faixa etria em foco, em geral, parte dos adultos, os quais devem reconhecer as dificuldades da
criana ou do adolescente, acreditar que h necessidade de cuidados e, ainda, que os servios de sade podem ajud-los.
C) aes que fortaleam os fatores protetores e o desenvolvimento da resilincia devem fazer parte do cuidado das famlias em
situaes de vulnerabilidade.
D) um dos objetivos da avaliao inicial a formulao de hiptese diagnstica, devendo haver cautela para que ela foque na
pessoa da interveno e no, apenas, na sua doena.
E) o genograma e o ecomapa podem ser ferramentas para uma melhor compreenso do contexto da criana e do adolescente,
sua famlia, a escola e a comunidade.

PSICOLOGIA

22. Considerando-se os principais grupos de problemas das crianas e adolescentes, assinale a alternativa CORRETA.
A) Os sintomas emocionais mais comuns so os comportamentos antissociais e o uso de drogas.
B) Os sintomas emocionais mais comuns so problemas de conduta e atrasos no desenvolvimento.
C) Os sintomas emocionais mais comuns so os comportamentos antissociais e a agitao.
D) Os sintomas emocionais mais comuns so ansiedades, medos, tristezas, alterao de apetite e sono.
E) Os sintomas emocionais mais comuns so os comportamentos antissociais e as dificuldades de relacionamento.
23. Os principais fatores de proteo e de risco para os transtornos mentais podem ser classificados nos seguintes
domnios:
A) sexual, psicolgico e social.
B) social, psicolgico, biolgico.
C) cultural, espiritual e psicolgico.
D) sexual, espiritual e psicolgico.
E) social, psicolgico, comportamental.
24. As trs razes para priorizar a compreenso dos transtornos mentais, observando as pessoas que sofrem, so:
A) As pessoas procuram ajuda porque sofrem e no porque tm uma doena; nem todo sofrimento doena, mas a interao
de fatores de vulnerabilidades deve ser conhecida no processo de cuidado e o estigma quanto expresso doena mental
se coloca como um sofrimento a mais para quem o carrega.
B) As pessoas procuram ajuda porque no sabem a sua doena, cabendo aos profissionais inform-las. Todo sofrimento
esconde uma doena latente, e o estigma quanto expresso doena mental se coloca como um sofrimento a mais para
quem o carrega. Por esse motivo, o profissional deve trabalhar as resistncias da pessoa ao tratamento.
C) As pessoas procuram ajuda porque sofrem e no porque tm uma doena; todo sofrimento doena latente; o estigma
quanto expresso doena mental se coloca como um sofrimento a mais para quem o carrega, e o profissional pode
trabalhar as resistncias da pessoa ao tratamento.
D) As pessoas procuram ajuda porque no sabem a sua doena, e cabe aos profissionais inform-las; todo sofrimento esconde
uma doena latente a ser identificada e tratada pelo profissional, e o estigma quanto expresso doena mental se coloca
como um sofrimento a mais para quem o carrega.
E) As alternativas A, B, C e D esto erradas.
25. Segundo o conceito de territrio de Guattari, todas as afirmativas esto corretas, EXCETO:
A) Apresenta uma conotao subjetiva.
B) Baseia-se na concepo de territrios existenciais.
C) Subsidia o cuidado quando o profissional capaz de focar, prioritariamente, no seu conhecimento tcnico sobre as pessoas.
D) So espaos e processos de circulao das subjetividades das pessoas.
E) So territrios que se configuram/desconfiguram/reconfiguram a partir das possibilidades, agenciamentos e relaes que as
pessoas e os grupos estabelecem entre si.
26. Visando superar os conceitos fechados, lineares e prontos, que produzem uma concepo reducionista de famlia,
falar em famlia significa, EXCETO:
A) considerar prioritariamente os laos consanguneos existentes.
B) visualizar a vivncia de processos de cuidado, estabelecimentos de vnculos afetivos, de convivncia e de parentesco.
C) considerar que os vnculos estabelecidos so condicionados pelos valores socioeconmicos e culturais predominantes em
um dado contexto geogrfico, histrico e cultural.
D) que ela pode ser considerada como tal na medida em que cria seus prprios problemas e estrutura as suas formas de relao,
tendo suas percepes, seus vnculos e suas especificidades.
E) compreender que ela o meio relacional bsico para as demais relaes com o mundo, da norma transgresso, da sade
aos transtornos, do amor ao dio.
27. O profissional na ateno bsica pode lanar mo de diversas alternativas para atuao com a famlia. Todas abaixo
so estratgias possveis, EXCETO
A) acolhimento, escutas regulares e peridicas.
B) grupos de orientao.
C) grupos de cuidado aos cuidadores.
D) intervenes domiciliares.
E) grupos de psicoterapia familiar.
8

PSICOLOGIA

28. Nos itens abaixo, assinale V (Verdadeiro) para os transtornos classificados como transtornos mentais comuns e F
(falso) para os que no se enquadram nessa classificao.
(
(
(
(
(

)
)
)
)
)

Tristeza/sensao de depresso
Fobia e perturbao compulsiva
Reao aguda ao estresse e estresse ps-traumtico
Somatizao
Sensao de ansiedade, nervosismo e/ou tenso

Assinale a alternativa que apresenta a sequncia CORRETA.


A) V-F-F-V-V
B) F-F-F-F-F
C) F-V-F-V-F
D) V-F-V-V-F
E) V-V-V-V-V
29. Quanto deteco e interveno breve ao usurio de lcool, CORRETO afirmar que
A) a avaliao do padro de uso do usurio deve fazer parte da rotina a partir da idade adulta.
B) os sintomas de ansiedade ou depresso podem estar associados ao abuso ou dependncia do lcool.
C) testes, como o AUDIT, devem ser aplicados em todos os usurios adultos da Ateno Bsica como forma de detectar,
precocemente, casos de alcoolismo.
D) Para maior clareza no diagnstico do abuso ou da dependncia ao lcool, necessrio discutir com os familiares sobre o
contexto do usurio, uma vez que o prprio usurio no consegue fazer uma autocrtica quanto ao seu padro de uso.
E) a frequncia com que a pessoa consome lcool no traduz o risco para o alcoolismo e, sim, a quantidade consumida.
30. Quanto interveno baseada na mediao de conflitos, correto afirmar, EXCETO, que
A) prope a utilizao e o desenvolvimento de habilidades comunicativas, cognitivas, sociais e emocionais imbricadas com
crenas e atitudes que levam elaborao de um modelo mental.
B) a tarefa comum une as pessoas em busca da soluo de seus conflitos.
C) o conflito um fenmeno social decorrente do confronto de interesses entre dois ou mais atores.
D) o conflito pode despertar sentimentos e energia que causam coeso grupal.
E) o mediador deve ser muito cauteloso, ao realizar perguntas exploratrias para no precipitar novas tenses.
31. Segundo o Manual de Preveno de Suicdio dirigido a profissionais de sade mental, so considerados fatores de
risco para o suicdio
A) transtornos mentais e psicolgicos.
B) psicolgicos e sociodemogrficos.
C) hereditrios e psicolgicos.
D) transtornos mentais, sociodemogrficos, psicolgicos e condies clnicas incapacitantes.
E) hereditrios, psicolgicos e sociais.
32. Quanto aos fatores de risco psicolgicos para o suicdio, assinale a alternativa INCORRETA.
A) Perdas recentes
B) Perdas de figuras parentais na infncia
C) Dinmica familiar conturbada
D) Epilepsia
E) Personalidade com traos significativos de agressividade e humor lbil
33. Existem caractersticas psicolgicas prprias ao estado em que se encontra a maioria das pessoas sob risco de
suicdio. Sobre elas, todas as alternativas esto corretas, EXCETO:
A) a pessoa apresenta ambivalncia em decorrncia dos problemas de suas vidas, o que desencadeia uma luta interna entre o
desejo de vida e de morte.
B) o impulso de cometer suicdio pode ser transitrio e ser controlado e, assim, evitar o suicdio.
C) rigidez/constrio leva a pessoa a pensar em termos de tudo ou nada.
D) a associao dos 4D (depresso, desesperana, desamparo e desespero) serve de alerta para a necessidade de cuidado.
E) as caractersticas psicolgicas devem ser observadas, uma vez que as pessoas em risco de suicdio no costumam expressar
seus pensamentos e intenes suicidas.
9

PSICOLOGIA

34. Sobre os dispositivos e as tcnicas disposio do(a) psiclogo(a) para o diagnstico e interveno na ateno bsica
e especializada, analise os itens abaixo:
I. Entrevista psicolgica/anamnese e descrio nosolgica
II. Diagnstico interventivo, mediao de conflitos e grupos operativos
III. Projeto Teraputico Singular, matriciamento e consulta compartilhada
Est(o) CORRETO(S)
A) I, apenas.
B) II, apenas.
C) I e III, apenas.
D) II e III, apenas.
E) I, II e III.
35. O conceito de grupo e sua organizao com objetivos teraputicos deve considerar, EXCETO:
A) A viabilidade do processo comunicativo verbal e no verbal em suas vrias possibilidades, ou seja, visual, auditiva e verbal
deve ser contemplada na determinao do tamanho do grupo.
B) As pessoas compem um grupo independente de realizarem aes com objetivos comuns, podendo ser grupo serial.
C) No grupo, vivel identificar dois nveis de identidade, ou seja, aquela prpria ao grupo e outra caracterstica a cada um de
seus membros.
D) No grupo, existe um campo dinmico no qual as interaes afetivas dos seus membros gravitam em torno de fantasias,
ansiedades, papis etc.
E) Coabitam na dinmica grupal duas foras antagnicas, ou seja, uma fora de fortalecimento e uma de desintegrao da
coeso grupal.
36. Com base na seguinte afirmao, assinale a alternativa que identifica a linha terica a qual ela est associada: O
desenvolvimento no orientado apenas pela reduo de tenses, mas, principalmente, pelo pleno crescimento e mudana
pessoal. A tendncia atualizadora, funo a ser exercida pelo organismo em sua totalidade, a principal fora motivadora
do ser humano. Essa necessidade deve ser vivenciada em acordo com a percepo que o organismo tem de sua realidade.
A) Psicanaltica
B) Corporal
C) Comportamental

D) Fenomenolgica
E) Psicodramtica

37. Quanto qualidade de vida do idoso, so identificados quatro domnios: o fsico, o social, o ambiental e o
psicolgico. Quanto a esse ltimo domnio, correto afirmar, EXCETO, que
A) a qualidade de vida subjetiva nessa faixa etria no se expressa diferentemente entre homens e mulheres.
B) para as mulheres, a percepo do esquecimento e da perda da atratividade so fatores que as levam a perceber o
envelhecimento de forma negativa.
C) a atividade fsica, o estresse, a percepo e a aceitao em relao ao envelhecimento esto associados qualidade de vida.
D) a capacidade funcional e a autonomia so importantes fatores para a percepo da qualidade de vida entre idosos.
E) perdas psicolgicas, frustraes e aspiraes devem ser consideradas pelos profissionais que acompanham idosos, seja na
ateno bsica ou especializada.
38. A abordagem ao usurio de drogas com base na Reduo de Danos contempla o entendimento de que o sofrimento
envolvido na drogadio est associado
I. prioritariamente aos aspectos psicofsicos causados pelas drogas.
II. aos aspectos sociais, como misria, esfacelamento de laos, incapacidade de dilogo.
III. desestruturao familiar.
Est(o) CORRETO(S)
A) I, apenas.
B) II, apenas.
C) I e III, apenas.
D) II e III, apenas.
E) I, II e III.
10

PSICOLOGIA

39. Lancetti trabalha com o conceito da clnica peripattica, em que prope que o profissional estabelea o processo de
cuidado de forma dinmica, negociada e no andar da vida dos usurios de tal modo a ampliar sua autonomia e
qualidade de vida. Baseando-se nessa abordagem, CORRETO afirmar que
A) no existe um perfil de usurio a ser atendido e, sim, a construo de projetos teraputicos e estratgias para contemplar as
necessidades de tais usurios.
B) no existe um setting a priori; as equipes e seus profissionais devem ser capazes de chegar onde os usurios mais
vulnerveis estejam e necessitem.
C) o diagnstico nosogrfico deve nortear a construo do Projeto Teraputico Singular.
D) em situaes-limites, todos os recursos teraputicos das redes produtivas, sociais e familiares devem ser articulados.
E) o acolhimento em situaes-limites tem sido apontado como potente para a adeso ao projeto de cuidado.
40. O processo de trabalho do psiclogo no CAPS vem sendo estruturado dentro de uma dinmica interdisciplinar.
Dentre outras aes, esperado que esse profissional assuma:
I.

A referncia de cuidado de alguns usurios, inclusive para as abordagens familiares necessrias e consulta
compartilhada.
II. Triagem, avaliao e elaborao de projeto teraputico singular.
III. Visita domiciliar, abordagens territoriais e matriciamento.

Est(o) CORRETO(S)
A) I, apenas.
B) II, apenas.
C) I e III, apenas.
D) II e III, apenas.
E) I, II e III.

11

PROVA: RESIDNCIA EM SADE DA FAMLIA


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: UPE

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

21
22
23
24
25
26
27
28
29
30

A
D
B
A
C
A
E
A
B
E

31
32
33
34
35
36
37
38
39
40

D
D
E
E
B
D
A
B
E
E

Coletnea de Provas | Concursos de Psicologia

UNIVERSIDADE DE PERNAMBUCO - UPE


FACULDADE DE CINCIAS MDICAS - FCM
RESIDNCIA MULTIPROFISSIONAL INTEGRADA EM SADE DA FAMLIA E
MULTIPROFISSIONAL EM SADE MENTAL
PROCESSO SELETIVO PBLICO

No deixe de preencher as informaes a seguir:


Prdio

Sala

Nome

N de Identidade

rgo Expedidor

UF

N de Inscrio

PSICOLOGIA
ATENO
q

Abra este Caderno, quando o Fiscal de Sala autorizar o incio da Prova.

Observe se o Caderno est completo. Ele est dividido em duas partes, assim constitudas:
1 Parte Conhecimentos Gerais: 20(vinte) questes objetivas de mltipla escolha com 05 (cinco)
alternativas cada;
2 Parte Conhecimentos Especficos: 20 (vinte) questes objetivas de mltipla escolha com 05
(cinco) alternativas cada, envolvendo assuntos especficos de cada categoria profissional.

Se o Caderno estiver incompleto ou com algum defeito grfico que lhe cause dvidas, informe,
imediatamente, ao Fiscal.

Uma vez dada a ordem de incio da Prova, preencha, nos espaos apropriados, o seu Nome completo, o
Nmero do seu Documento de Identidade, a Unidade da Federao e o Nmero de Inscrio.

Para registrar as alternativas escolhidas nas questes objetivas de mltipla escolha, voc receber um
Carto-Resposta de Leitura tica. Verifique se o Nmero de Inscrio impresso no Carto coincide
com o seu Nmero de Inscrio.

As bolhas constantes do Carto-Resposta devem ser preenchidas totalmente com caneta esferogrfica
azul ou preta.

Preenchido o Carto-Resposta, entregue-o ao Fiscal e deixe a sala em silncio.

BOA SORTE!

18. As propostas da Reforma Psiquitrica demandam dinmicas de trabalho inovadoras e provocam novos
agenciamentos entre os saberes no campo da Sade Mental.
Assinale a alternativa INCORRETA sobre o Movimento de Reforma Psiquitrica no Brasil.
A) O Movimento de Reforma Psiquitrica no Brasil (MRPB) buscou no somente a superao das condies dos muitos
internos cronificados em hospitais pblicos e conveniados mas tambm a transformao dos modelos assistenciais, dos
paradigmas e das aes corporativas centradas no manicmio e em suas prticas.
B) O MRPB incorporou a necessidade de qualificao da assistncia psiquitrica, alm da transformao das relaes sociais e
a reviso das formas de segregao presentes na sociedade.
C) O MRPB surgiu no contexto das lutas pela redemocratizao do pas a partir do Movimento dos Trabalhadores de Sade
Mental (MTSM), no final dos anos 1970.
D) A principal bandeira de luta do MRPB at meados dos anos 1990 foi o fechamento dos manicmios, que se constituam
nica resposta doena e ao doente mental.
E) A necessidade de prover um sistema de sade mental inserido no SUS, alternativo ao modelo hospitalocntrico, garantindo
uma nova resposta ao portador de transtornos mentais, estabeleceu um ponto de contato entre a Reforma Psiquitrica e a
Reforma Sanitria.
19. A Clnica Ampliada busca integrar vrias abordagens para possibilitar um manejo eficaz da complexidade do
trabalho em sade. So eixos fundamentais englobados na proposta da Clnica Ampliada, EXCETO:
A) a transformao dos meios ou instrumentos de trabalho, pois so necessrios arranjos e dispositivos de gesto que
privilegiem uma comunicao transversal na equipe e entre equipes.
B) a compreenso ampliada do processo sade-doena, buscando evitar uma abordagem que privilegie excessivamente algum
conhecimento especfico.
C) suporte para os profissionais de sade. necessrio criar instrumentos de suporte para que eles possam lidar com as
prprias dificuldades.
D) ampliao do objeto de trabalho, com a valorizao da dimenso biolgica e da sintomatologia, na anlise de cada caso.
E) construo compartilhada dos diagnsticos e teraputicas, como uma forma mais potente do que uma abordagem pontual e
individual.
20. Sobre apoio matricial de Sade Mental, assinale a alternativa que NO se refere a instrumentos de matriciamento.
A) Consulta compartilhada ou interconsulta.
B) Projeto Teraputico Singular (PTS).
C) Encaminhamento ao especialista.
D) Visita domiciliar conjunta.
E) Contato a distncia: uso do telefone e outras tecnologias de comunicao.

2 PARTE - CONHECIMENTOS ESPECFICOS

Texto para as questes de 21 a 35.


Ao ser acionado (a) pela equipe da Estratgia de Sade da Famlia (ESF), o (a) psiclogo (a) realizou uma
visita casa de dona Lcia (60 anos) que vinha apresentando alterao no seu comportamento habitual aps a morte
do marido em decorrncia de um acidente domstico h um ano e meio. Seu Mrio (na poca com 68) foi subir no p
de manga e caiu de um galho alto, tendo fraturado o fmur.
Desde ento, dona Lcia deixou de frequentar a Igreja; no realiza mais suas atividades dirias, no se
anima pra nada; s dorme sob efeito da medicao prescrita pelo mdico da Estratgia de Sade da Famlia(ESF),
no se alimenta espontaneamente, necessitando muito do estmulo de sua filha Ana (25 anos) e, ainda assim, de
forma irregular. Durante a visita, ao abordar dona Lcia, ela fala lentamente e em tom baixo, sente muita culpa por
no ter feito mais pelo marido e, nesse momento, por dar trabalho filha e por no sentir mais prazer em nada,
inclusive viver, pois a dor que sente no peito quando lembra tudo que perdeu na vida insuportvel.
Ana, por sua vez, se sente sobrecarregada com os cuidados da me e do irmo Jnior (19 anos) que h dois
anos abandonou a escola e comeou a usar crack, mesmo tendo o pai no p dele. Para completar, trouxe a
namorada pirada que no se trata e que tem uma filha, coitada, uma mocinha. Ao investigar o contexto de Jlia
(25anos), companheira de Jnior, o (a) psiclogo (a) identificou que ela era conhecida na vizinhana por ser
esquisita, de poucos amigos, mas mantinha uma vida aparentemente saudvel; estudou, casou, teve a filha Lara
(6 anos), mas, aps ter sido trada e se separar de forma bastante turbulenta, descuidou-se da higiene pessoal,
passou a catar lixo e fazer de sua casa uma fortaleza contra os inimigos. O nico apoio que tinha era de Lara que
precisou que amadurecer para cuidar da me, coisa que faz at hoje e, diga-se de passagem, que a menina no
tem contato nenhum com o pai e s frequenta a escola por influncia de Ana, porque Lara no relaxa, parece
me de Jlia agora que ela anda meio estranha novamente.
6

Na poca que Jnior conheceu Jlia, ele ainda tinha juzo e, em acordo com os pais, trouxe as duas para
morar com a famlia, quando ela estava um pouco melhor, por ter iniciado um tratamento com o psiquiatra.
Esse caso corriqueiro na comunidade nos suscita vrias questes clnicas quanto s possveis intervenes e
questes ticas.
Com base no caso descrito anteriormente, responda as questes a seguir:
21. No Guia Prtico de Matriciamento em Sade Mental do Ministrio da Sade, quanto abordagem sobre a visita
domiciliar na Ateno Bsica, CORRETO afirmar que
A) como a realidade a ser identificada no domiclio ser sempre dinmica, o planejamento da visita domiciliar se torna
desnecessrio.
B) a equipe de sade da famlia deve fazer o encaminhamento escrito do caso a ser acompanhado pelo(a) psiclogo(a).
C) cabe ao () psiclogo (a) obter as informaes clnicas relevantes dos casos a serem acompanhados do ponto de vista
psicolgico.
D) a responsabilidade de acompanhamento direto do(a) psiclogo(a) s deve ser voltada a, apenas, um membro da famlia para
evitar interferncias na conduo do caso.
E) a ausncia do ACS e/ou de outro membro da equipe bsica na visita domiciliar s deve acontecer, se houver uma
justificativa muito importante.
22. Todos abaixo so sinais e sintomas vivenciados por dona Lcia, EXCETO:
A) Anedonia

B) Algofobia

C) Apatia

D) Anorexia

E) Insnia

23. O conjunto de sinais e sintomas apresentados por dona Lcia, considerando o contexto de seu adoecimento, suscita
as seguintes hipteses diagnsticas a serem consideradas no diagnstico diferencial:
A) Luto patolgico/depresso maior/insnia primria.
B) Luto normal/ansiedade generalizada/ depresso menor.
C) Luto patolgico/depresso menor/demncia.
D) Luto normal/insnia primria/depresso menor.
E) Luto normal/ depresso maior/ ansiedade generalizada.
24. Minkowski (1966) afirma que por si mesmo, o sofrimento no tem sentido como poderia ter algum? mas, por
meio dele, coloca-se o problema do sentido da vida. Quando o autor faz tal afirmao, ele subsidia uma srie de
questes a serem consideradas no caso apresentado, EXCETO:
A) Como a escuta pode favorecer o entendimento da historicidade do sofrimento?
B) possvel ultrapassar a abordagem apenas voltada para a demanda explcita apresentada?
C) realmente papel do (a) psiclogo (a) atuar em casos assim que exigem mais que psicoterapia?
D) A formao profissional contempla a atuao em contextos complexos?
E) Qual o alcance e os limites da atuao interdisciplinar?
25. Considerando o ponto de vista de Bguier (2004) em relao parentalidade de pacientes com diagnstico de
psicose, a hipermaturidade de Lara pode ser considerada
A) um mecanismo de defesa saudvel que deve ser reforado e que exerce um fator de proteo para transtornos mentais
futuros.
B) um suporte social indispensvel para a me e que deve ser reforado, uma vez que os vnculos familiares funcionam como
fator de proteo para a recorrncia de novas crises.
C) um problema srio a ser resolvido e que no est sendo considerado pela famlia na qual Lara est inserida.
D) Lara dever ser entregue ao pai legtimo para o acompanhamento de seu desenvolvimento, tendo em vista que a me
necessita voltar-se para o seu prprio cuidado.
E) um elemento entre outros, a ser considerado na abordagem famlia, visando facilitar o processo de vivncia e o
reconhecimento dos papis de cada sujeito enquanto pai ou me e na identificao e elaborao das implicaes dessa
vivncia enquanto pais e filhos.
26. Ao declarar que os profissionais necessitam abandonar algumas concepes de famlia, Antnio Lancetti (2000) nos
subsidia a afirmar que a famlia de Dona Lcia
A) merece uma interveno tcnica para que, de fato, possa ser considerada como tal, uma vez que no momento est em crise.
B) tem sua forma singular de organizao a qual dever ser considerada na proposta de cuidado.
C) se encontra no limiar entre a famlia saudvel e famlia adoecida.
D) tem em dona Lcia o foco dos seus problemas e como tal a interveno dever priorizar a sua melhora.
E) tem como ncleo saudvel Ana que deve assumir suas responsabilidades no cuidado de todos.
7

27. Na perspectiva da clnica ampliada na Ateno Bsica, quais os elementos tcnicos que devem ser prioritariamente
contemplados pelo(a) psiclogo(a) na abordagem Dona Ana?
A) Escuta da histria familiar/compreenso das vivncias e estratgias do grupo familiar/construo do projeto teraputico
singular, considerando a ESF enquanto coordenadora do cuidado.
B) Escuta qualificada dos sinais e sintomas psquicos/ sigilo profissional em relao equipe da ESF/ locais da rede para
encaminhamento de cada membro da famlia.
C) Avaliao psicolgica de cada membro/ plano de interveno clnico/plano de interveno social.
D) Avaliao psicossocial/ intervenes educativas/ psicoterapia.
E) Intervenes grupais/plano de interveno clnico/contrarreferncia para a ESF.
28. Pensando na famlia de Dona Lcia e considerando as possibilidades de interveno do (a) psiclogo (a), alguns
aspectos podem ser elucidados pelo seu ncleo de conhecimento em uma avaliao clnica. Sobre isso, assinale V
para os Verdadeiros e F para os Falsos.
(
(
(
(
(

)
)
)
)
)

Compreenso dos aspectos simblicos e psicodinmicos do grupo familiar.


Estrutura de personalidade de seus membros.
Identificao das principais defesas psquicas presentes entre seus membros.
Resgate do curso do desenvolvimento psicossocial dos seus membros.
Identificao de possveis transtornos mentais.

Assinale a alternativa que apresenta a sequncia CORRETA.


A) V, F, F, V, V

B) V, V, V, V, V

C) F, F, F, F, F

D) F, V, F, V, F

E) V, F, V, V, F

29. A formulao diagnstica multiaxial proposta no Guia Prtico de Matriciamento em Sade Mental tenta superar a
lgica do diagnstico nosolgico e envolve a avaliao de vrias questes. Sobre isso, assinale V para os Verdadeiros
e F para os Falsos.
(
(
(
(
(

)
)
)
)
)

Sintomas mentais e transtornos mentais


Estilo de personalidade e transtornos de personalidade e do desenvolvimento
Problemas de sade em geral
Avaliao de incapacidade
Problemas sociais

Assinale a alternativa que apresenta a sequncia CORRETA.


A) V, F, F, V, V

B) V, V, V, V, V

C) F, F, F, F, F

D) F, V, F, V, F

E) V, F, V, V, V

30. O Ministrio da Sade incentiva aes de promoo ao desenvolvimento da criana com afeto, havendo, inclusive,
orientaes na Caderneta de Sade da Criana. Considerando Lara (6 anos), qual medida seria a mais apropriada
para a sua fase de desenvolvimento?
A) Conversar buscando o contato olho a olho e usando linguagem infantil.
B) Conversar com a criana utilizando livros com figuras.
C) Estimular a criana a brincar com outras crianas.
D) Estimular a formao saudvel de sua autoimagem e autoestima.
E) Estimular brincadeiras de faz de conta.
31. Como sinais de alerta de alterao patolgica no desenvolvimento e na necessidade de cuidado, podemos considerar,
EXCETO:
A) Alteraes no sono variveis e inespecficas.
B) Indiferena aos cuidadores e ausncia de sorriso social.
C) Comportamentos esteriotipados.
D) Averso ao contato fsico.
E) Indiferena a certos sons na ausncia de deficincia auditiva.
32. Pensando na peculiaridade de cada membro da famlia de Dona Lcia, diversas intervenes poderiam ser
propostas pelo(a) psiclogo(a), EXCETO:
A) Abordagem psicanaltica voltada Dona Lcia que foi quem gerou a visita.
B) Abordagem focal famlia e articulao de possveis acompanhamentos especficos, voltados aos membros da famlia de
acordo com suas necessidades.
C) Discusso do caso com as equipes envolvidas e definio de um projeto teraputico singular e familiar.
8

D) Estimular a participao de Jnior no grupo de adolescente e/ou de atividades fsicas existentes na unidade, incentivo ao
retorno aos estudos e avaliao de Jlia por parte da equipe da ateno bsica.
E) Propor aes de promoo da sade mental especialmente para Ana e Lara em articulao com a rede territorial.
33. Supondo que Jlia tenha um quadro de esquizofrenia e as possibilidades de cuidados na rede psicossocial, assinale a
alternativa INCORRETA.
A) A abordagem a Jlia dever ser definida, considerando os elementos utilizados anteriormente e que tenham apresentado
resultados positivos.
B) O prognstico para a usuria sombrio, tendo em vista o seu transtorno, sendo um caso indicado para os cuidados
paliativos.
C) Dentre os elementos para o seu tratamento, ser importante garantir o que Sarraceno denomina de habitat.
D) O lcus do tratamento de Jlia dever ser construdo no curso do cuidado da famlia na qual ela est inserida e no
necessariamente a partir do seu diagnstico.
E) A gesto do cuidado de Jlia deve contemplar graus mximos de autonomia da usuria e cuidado longitudinal na rede.
34. Correlacione as aes abaixo quanto sua natureza de campo e ncleo de atuao do(a) psiclogo(a) na ateno
bsica e/ou no CAPS.
(
(
(
(
(

)
)
)
)
)

Avaliao da personalidade, aconselhamento, interpretao


Facilitao de grupos psicoterpicos, avaliao do desenvolvimento psquico
Visita domiciliar, abordagem famlia, construo de Projeto Teraputico Singular
Evoluo no pronturio, facilitao de grupos educativos, mediao de conflitos
Diagnstico interventivo, planto psicolgico, anlise do funcionamento psquico

Assinale a alternativa que contm a sequncia CORRETA


A) Ncleo, ncleo, campo, campo, ncleo
B) Ncleo, ncleo, campo, ncleo, campo
C) Campo, campo, ncleo, ncleo, ncleo

D) Campo, campo, campo, campo, ncleo


E) Ncleo, ncleo, ncleo, campo, campo

35. Seu Mrio confirma os dados sobre a vulnerabilidade dos idosos quando vtimas de acidentes domsticos. Enquanto
profissional da rede de cuidado de sade mental, qual o papel do psiclogo na promoo da sade do idoso?
I.
II.

Na ateno bsica, estimular a participao em atividades que garantam a convivncia e ampliao de autonomia.
Na abordagem especializada, intervir precocemente em situaes que representem perdas significativas e
diminuio da autonomia.
III. Em qualquer nvel de interveno, promover a transmisso de conhecimento e habilidades para o estmulo
elaborao de conflitos prprios a essa fase do desenvolvimento humano.
Est CORRETO o que se afirma em
A) I, apenas.

B) II, apenas.

C) I e III, apenas.

D) II e III, apenas.

E) I, II e III.

A Reduo de Danos trouxe baila da assistncia aos usurios de drogas a urgncia de promoo de cidadania como
prtica promotora de sade e se tornou a principal estratgia poltica oficial do Ministrio da Sade, no mbito da Sade
Mental dos usurios de lcool e outras drogas.
Nesse contexto, os casos abaixo so recorrentes Brasil afora, de norte a sul, de leste a oeste:
Janana 19 anos, classe mdia alta, estudou em um intercmbio no Canad. L, conheceu um grupo de jovens usurios
de drogas que a introduziu no consumo de crack nas raves que costumavam ir. Ao voltar ao Brasil, Janana buscou manter
um consumo recreativo de drogas, mas no conseguiu, pois elegeu o crack como droga de preferncia, envolveu-se em
brigas e na venda de drogas para garantir seu prprio consumo. Um dia, foi pega pela polcia que a encaminhou ao
Ministrio Pblico. Este, em seguida, a encaminhou para o Programa Liberdade Assistida, recebendo, ento, uma
medida scio-educativa para seu tratamento;
Pedro 15 anos, classe pobre, sem pais, morador de rua. Acostumado a fazer bicos para sobreviver e para suportar a vida
nas ruas, usa drogas, em especial a cola, principalmente para espantar a fome. Foi apresentado ao crack ainda com dez
anos de idade. Faz uso dessa droga h cinco anos. Apresentou uma srie de problemas comportamentais e j alguma
sequela pelo uso intenso que faz da substncia, tais como inquietao, irritabilidade, ansiedade, alm de alguns cacoetes.
Conheceu os redutores de danos por meio de um projeto social que estava sendo desenvolvido na praa onde geralmente
dorme. Por meio desses agentes de sade, resolveu participar de um grupo de ex-usurios de drogas de um servio
especializado;
9

Marcicleide 27 anos, grvida de quatro meses, bebe lcool desde criana. Aos 15 anos, foi diagnosticada com transtorno
bipolar do humor. Fez tratamento psiquitrico durante quatro anos. Comeou a usar o crack h dois anos, quando ainda
trabalhava como feirante. Perdeu a vaga no emprego, desde que comeou a fazer uso intenso da droga. Preocupada com o
futuro do seu filho, resolveu procurar ajuda e ficou sabendo da existncia de locais de internamento. Foi encaminhada a
um desses servios, mas fugiu do tratamento e colocou em risco sua gravidez.

Considerando os princpios da Reforma Sanitria, da Reforma Psiquitrica e da Reduo de Danos, responda as


questes abaixo, considerando a atuao do psiclogo nesse contexto.

36. De que modo, nossas intervenes teraputicas aos usurios de lcool e outras drogas devem ser pautadas a partir
dos modelos de ateno propostos no contexto do Sistema nico de Sade?
A) De nenhuma forma, visto que, como psiclogos, somos autnomos na escolha da abordagem e/ou no modelo que queremos
seguir.
B) De modo parcial, visto que, como psiclogos, somos relativamente autnomos na escolha da abordagem e/ou no modelo
que queremos seguir.
C) De forma total, visto que, como psiclogos, somos totalmente influenciados pelos modelos que estejam na moda.
D) De forma total, visto que, como tcnicos de sade mental, somos influenciados e influenciamos na perspectiva de um
trabalho em equipe multiprofissional e de modo interdisciplinar bem como na consolidao dos modelos de ateno
propostos.
E) De nenhuma forma, visto que, como tcnicos de sade mental, mesmo compondo uma equipe multiprofissional e de modo
interdisciplinar, nossa interveno especfica da psicologia.
37. Considerando o Programa Liberdade Assistida como uma alternativa para Janana, INCORRETO afirmar que
A) devemos conceituar de jovens que cometeram atos infracionais durante a adolescncia, visto que alguns deles j no so
mais adolescentes, segundo a legislao vigente, pois possuem idades de 18 anos completos a 21 anos incompletos e
segundo o ECA Estatuto da Criana e do Adolescente (Lei 8.069/90), criana o sujeito que possui at 12 anos de idade
incompleto e adolescente aquele que possui de 12 anos a 18 anos de idade incompletos.
B) devemos evitar a utilizao de expresses como delinquente, jovem infrator e jovem em conflito com a lei, pois se
entende que insinuam a existncia de uma carreira criminal, que muitas vezes inexiste, o que acaba legitimando a excluso
e a violncia contra esses sujeitos.
C) se deve compreender que a re-insero social e o resgate da cidadania uma tarefa v, uma vez que no se pode pensar as
medidas socioeducativas sob o foco da educao voltada para o trabalho mas para uma educao voltada aos interesses
desses jovens, de modo a apresentar-lhes o real significado da palavra cidadania.
D) quando se discute sobre a melhor forma de se aplicarem as medidas socioeducativas privativas de liberdade, sempre se
questiona o seu cunho pedaggico e geralmente se advogam posies referentes a uma educao voltada para o mercado de
trabalho.
E) grande parte das propostas de medidas socioeducativas, alm de no ser do interesse dos jovens, voltada para uma
formao que possibilite inseri-los em empregos que geralmente possuem salrios baixssimos, tais como carpintaria,
panificao, agricultura, pecuria, dentre outros.
38. Em relao aos sinais e sintomas apresentados por Pedro, assinale a alternativa CORRETA.
A) De nada adiantar a Reduo de Danos, visto que ele precisa de uma internao para que se livre do uso de drogas.
B) Esses sinais e sintomas s desaparecero no momento em que Pedro seja internado para desintoxicao.
C) H indicao de que ele precisa de um tratamento especfico, devendo ser encaminhado para a rede do Sistema nico de
Sade.
D) No h indicao de que ele precisa de um tratamento especfico, visto que os sinais e sintomas que apresenta decorrem,
apenas, de sua condio social.
E) O grupo de ex-usurios no beneficiar Pedro, visto que ele ainda um dependente.
39. A partir do que se sabe sobre o caso de Marcicleide, segundo Grant (1997), CORRETO afirmar que
A) o transtorno bipolar e o uso indevido de substncias psicoativas so considerados doenas com alto potencial de limitao
de autonomia, tornando-se ainda mais srios quando associados.
B) a comorbidade psiquitrica em dependentes qumicos impede a procura desses por tratamento, fazendo com que as
comorbidades sejam negligenciadas nos ambulatrios e nas enfermarias especializados.
C) com a prevalncia bem demonstrada, entre o transtorno bipolar e o uso indevido de drogas, no h justificativa para a
grande quantidade de lacunas teraputicas existentes, tais como a ausncia de parmetros diagnsticos confiveis e a falta
de metas teraputicas apropriadas, que colocam o psiclogo em situaes de dvida e indeciso.

10

D) no existem evidncias cientficas acerca da etiologia e da evoluo clnica dessa comorbidade (transtorno bipolar e o uso
indevido de drogas), o que impede que o psiclogo compreenda seus critrios diagnsticos bem como as estratgias
farmacolgicas e psicossociais disponveis.
E) apesar de ser extremamente comum o uso indevido de substncias psicoativas pelo paciente bipolar, tal associao incapaz
de alterar a expresso, o curso e o prognstico de ambas as patologias.
40. Nos trs casos apresentados acima, podemos afirmar que a Reduo de Danos seria um excelente aliado no cuidado
a essas pessoas. Quanto s afirmativas a serem avaliadas, assinale V para as Verdadeiras e F para as Falsas.
( ) uma forma de garantir a acessibilidade aos servios de sade e, consequentemente, aos tratamentos possveis.
( ) um modo de cuidar das pessoas que usam drogas na prpria rua, descartando, desse modo, a necessidade de
internao.
( ) Reconhece a necessidade de busca de estratgias adequadas e de desenvolvimento de propostas de interveno
para o enfrentamento das diversas questes envolvidas, considerando o sujeito e sua histria.
( ) Pode-se cham-la de Clnica Peripattica e/ou de novos settings teraputicos, ou seja, de uma clnica em
movimento.
( ) Radicaliza o cuidado do sujeito, indo ao seu encontro muitas vezes, de forma interdisciplinar e intersetorial.
Assinale a alternativa que apresenta a sequncia CORRETA.
A) V, F, F, V e V.
B) V, V, V, V e V.
C) F, F, F, F e F.

D) F, V, F, V e F.
E) V, F, V, V e V.

11

PROVA: RESIDNCIA EM SADE MENTAL


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: UPE

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

21
22
23
24
25
26
27
28
29
30

E
B
C
C
E
B
A
B
B
D

31
32
33
34
35
36
37
38
39
40

E
A
B
A
E
D
C
C
A
E

Coletnea de Provas | Concursos de Psicologia

SECRETARIA DE SADE DE PERNAMBUCO


PROCESSO SELETIVO RESIDNCIA MULTIPROFISSIONAL E EM REA PROFISSIONAL DA
SADE

DADOS DE IDENTIFICAO DO CANDIDATO

No deixe de preencher as informaes a seguir:

Prdio

Sala

Nome

N de Identidade

rgo Expedidor

UF

N de Inscrio

RESIDNCIA MULTIPROFISSIONAL DE INTERIORIZAO DE


ATENO SADE DO HOSPITAL DOM MOURA DE
GARANHUNS (ESPPE/HDM-GARANHUNS)
PSICOLOGIA

PSICOLOGIA - (ESPPE/HDM-GARANHUNS)

24. Cabe ao mdico, como membro da equipe da ateno Bsica de Sade, as seguintes atribuies:
I. Realizar ateno sade aos indivduos sob sua responsabilidade.
II. Realizar consultas clnicas e pequenos procedimentos cirrgicos.
III. Participar do gerenciamento dos insumos necessrios para o adequado funcionamento da Unidade Bsica de
Sade.
IV. Realizar busca ativa e notificar doenas e agravos de notificao compulsria.
V. Participar das atividades de educao permanente.
Assinale a alternativa que contm uma verdade.
A) Apenas as afirmativas I e II esto corretas.
B) A afirmativa III est incorreta.
C) As afirmativas I e V esto corretas.
D) Apenas as afirmativas I e V esto corretas.
E) Apenas as afirmativas I e III esto corretas.
25. Sobre os Ncleos de Apoio Sade da Famlia (NASF), leia as sentenas abaixo:
I.
II.

Podem atuar apoiando as atividades da Academia da Cidade e os Consultrios na Rua.


So organizados em duas modalidades, sendo a carga horria dos profissionais envolvidos a principal
caracterstica que diferencia uma modalidade da outra.
III. Os profissionais podem ser cadastrados em at duas unidades de sade.
IV. Os sanitaristas no compem a lista de ocupaes autorizadas para participar dos NASF.
V. Devem funcionar em horrio de trabalho coincidente com os da equipe de Sade da Famlia.
Assinale a alternativa que contm uma verdade.
A) Existe, apenas, uma afirmativa correta.
B) Existem, apenas, duas afirmativas corretas.
C) Existem, apenas, trs afirmativas corretas.
D) Existem, apenas, quatro afirmativas corretas.
E) Existem cinco afirmativas corretas.

CONHECIMENTOS ESPECFICOS
26. Sobre os CAPS (Centros de Ateno Psicossocial), analise as seguintes afirmaes:
I.

Assumem um papel estratgico na articulao das redes de ateno, limitando-se, para tanto, assistncia
teraputica direta aos portadores de transtorno mental.
II. Entre suas modalidades de atendimento, temos aquelas direcionadas famlia, ao paciente individualizado e aos
pacientes em grupo.
III. Dentre os seus objetivos, tem-se a adequao do modelo hospitalocntrico, para, assim, aprimorar os mecanismos
e as estratgias de internao e asilo hospitalar.
Est INCORRETO o que se afirma em
A) I e II, apenas.

B) I e III, apenas.

C) II e III, apenas.

D) II, apenas.

E) III, apenas.

27. Considerando as atividades diretamente desenvolvidas pelos CAPS junto com a populao, assinale a alternativa
INCORRETA.
A) Tratamento medicamentoso
B) Orientao
C) Cursos de capacitao

D) Atendimento psicoterpico
E) Atividades comunitrias

28. Considerando a insero do Psiclogo na ateno bsica, considere a ao INCORRETAMENTE relacionada a esse
nvel de assistncia.
A) Promoo e proteo da sade
B) Preveno de agravos
C) Diagnstico

D) Reabilitao e manuteno da sade


E) Cuidados paliativos hospitalares
7

PSICOLOGIA - (ESPPE/HDM-GARANHUNS)

29. Sobre o Complexo de dipo e a sua importncia no desenvolvimento psicossexual, analise as seguintes afirmaes:
I. o momento, no qual se d a estruturao psquica, seja esta neurtica, perversa ou psictica.
II. Tanto para o menino como para a menina, observa-se a inveja flica como o seu fator organizador.
III. So quatro os elementos constitutivos do dipo: a Criana, a Me, o Pai e o Falo.
Est INCORRETO o que se afirma em
A) I, apenas.

B) II, apenas.

C) III, apenas.

D) II e III, apenas.

E) I, II e III.

30. Para Erick Erikson, o estgio da adolescncia tipificado por uma(um)


A) crise de identidade.
B) autonomia do eu.
C) posicionamento altrusta.

D) elaborao de lutos.
E) sndrome normal.

31. Ainda segundo Erikson, quando o adolescente se mostra experimentando papis, est realizando um trabalho de
elaborao interna, denominado de
A) Identificao difusa.
B) Resoluo positiva.
C) Plano de vida.

D) Moratria psicossocial.
E) Isolamento vital.

32. Em relao gravidez e ao processo gestacional, analise as seguintes afirmaes:


I.

O carter instintivo da maternidade e, portanto, da gravidez, determina o padro comportamental emocional que a
mulher vivencia durante a gestao, mostrando que suas experincias subjetivas da infncia tm uma interferncia
secundria na relao me-beb.
II. Para a gestante, a gravidez acarreta uma variedade de transformaes que ocorrem tanto no seu prprio corpo
como face s expectativas de novos papis, o que implica a reestruturao na rede de relaes conjugais, familiares
e sociais.
III. Irritabilidade, mudanas bruscas de humor, tristeza, insegurana, baixa autoestima e sensao de incapacidade de
cuidar do beb so alguns sintomas vividos na maternidade cuja elaborao depende, fundamentalmente, das
condies econmicas da gestante.
Est INCORRETO o que se afirma, apenas, em
A) I e II.

B) I e III.

C) II e III.

D) II.

E) III.

33. Sobre o puerprio, assinale a alternativa INCORRETA.


A) No puerprio, a mulher vivencia uma srie de adaptaes fsicas e emocionais em funo das expectativas construdas
durante a gestao e a realidade trazida com a chegada do beb.
B) No caso de mulheres primparas, pela inexperincia face maternidade, pode-se observar uma maior instabilidade
emocional, sendo a ansiedade uma condio psquica bastante frequente.
C) O perfil psicolgico da mulher no puerprio pode comportar sentimentos ambivalentes em relao ao beb, ou seja, que
reflitam tanto sua aproximao como averso dele.
D) A ideao de suicdio e de infanticdio so sintomas relacionados ao diagnstico do estresse ps-traumtico no ps-parto,
podendo ocorrer sua efetivao.
E) Corresponde ao perodo que se inicia aps o parto e se estende at, aproximadamente, sexta semana, compreendendo o
perodo imediato, tardio e remoto.
34. Sobre o idoso, considere os seguintes itens:
I.
II.
III.
IV.
V.

Competncia funcional
Humor
Percepo
Orientao
Memria

Os itens CORRETAMENTE relacionados avaliao mental do idoso so


A) I, II e III, apenas.

B) III, IV e V, apenas.

C) II, III e IV, apenas.


8

D) I, IV e V, apenas.

E) I, II, III, IV e V.

PSICOLOGIA - (ESPPE/HDM-GARANHUNS)

35. Sobre a demncia do tipo Alzheimer, que acomete muitos idosos, INCORRETO afirmar que
A) o tipo mais comum de demncia, embora haja outros, como a demncia vascular.
B) sua causa desconhecida, no havendo, ainda, preveno ou cura.
C) uma condio caracterizada pelo incio gradual e declnio progressivo das funes cognitivas.
D) resulta, frequentemente, na produo de um contedo delirante do tipo persecutrio.
E) se observa o comprometimento da memria, o qual pode estar associado afasia.
36. Considerando os pensamentos tpicos do Transtorno Obsessivo Compulsivo (TOC), assinale a alternativa cuja
descrio est INCORRETAMENTE relacionada sua ocorrncia.
A) So percebidos como intrusivos e inadequados, alm de gerarem sofrimento.
B) No esto relacionados s preocupaes usuais com os problemas da vida real e cotidiana.
C) Como na insero de pensamentos, so percebidos como impostos por algo ou algum externo.
D) Ocorre a tentativa de ignorar ou suprimir tais pensamentos com outros pensamentos.
E) Em algum momento, so percebidos ou reconhecidos como excessivos ou irracionais.
37. Em relao ao Transtorno de Ansiedade Generalizada (TAG), assinale o sintoma INCORRETAMENTE associado
ao seu diagnstico.
A) Irritabilidade
B) Inquietao
C) Tenso muscular

D) Dificuldade de concentrao
E) Despersonalizao

38. Considere a seguinte enunciao de um paciente: No sou solteiro nem casado, sou sindor, e o meu prazer um
orgasmaravilha. Considerando as alteraes de linguagem associadas s psicopatologias, assinale a alternativa que
identifica, CORRETAMENTE, o sintoma descrito.
A) Esquizofasia

B) Neologismo

C) Ecolalia

D) Bradilalia

E) Logorreia

39. Uma paciente fez a seguinte afirmao: Encaminhei ao coronel H. coisas muito importantes, to importantes como o
Penhasco de Gibraltar. No meu dirio, tambm constam documentos relevantes que iro mudar o curso da histria:
nada ser como antes. CORRETO afirmar que o paciente apresenta um(a)
A) Delrio.

B) Alucinao.

C) Reificao.

D) Perseverao.

E) Hiperprosexia.

40. Analise a seguinte descrio: i desvio gradual ou repentino do fluxo de pensamento, ii ideias que, por si mesmas,
adquirem o poder de realizao e iii processo ideativo desconexo e desordenado.
Considerando os transtornos que acometem a forma ou o processo de pensamento, assinale a alternativa que
identifica, CORRETA e SEQUENCIALMENTE, os sintomas descritos.
A) Neologismo Delrio Descarrilhamento
B) Descarrilhamento Pensamento mgico Pensamento ilgico
C) Distrao Pensamento ilgico Afasia
D) Pensamento ilgico Desorientao Pensamento mgico
E) Pensamento altrusta Hiperatividade Catatonia
41. Considerando o processo de subjetivao, segundo Vygotsky, CORRETO afirmar que
A) ocorre uma relao de influncia mtua entre o indivduo e a sociedade.
B) se observa uma prevalncia da modelagem do sujeito pelo ambiente.
C) prepondera o domnio dos processos inconscientes face aos conscientes.
D) se constata a independncia do sujeito face aos processos socioculturais.
E) enfatiza a dominncia da cultura sobre a subjetividade/individualidade.
42. Suponha que um Psiclogo, em oposio ao cogito cartesiano Penso, logo sou, faa a seguinte afirmao: Penso
onde no sou, sou onde no penso. Assinale a alternativa que identifica, CORRETAMENTE, a perspectiva de
subjetivao implcita na afirmao do Psiclogo.
A) O desejo inconsciente
B) A vontade consciente
C) O desejo consciente e/ou pr-consciente
D) A vontade consciente e/ou pr-consciente
E) O instinto e sua indeterminao hereditria
9

PSICOLOGIA - (ESPPE/HDM-GARANHUNS)

43. Analise a seguinte afirmao: O paciente no recorda coisa alguma do que esqueceu e recalcou, mas expressa-o, por
exemplo, pela atuao (acts it out). Ele o reproduz no como lembrana, mas, como ao (adaptado de Freud, vol.
XII, p.196).
O mecanismo descrito, que um referencial clnico para a escuta psicanaltica, a
A) Associao livre.

B) Condensao.

C) Repetio.

D) Catarse.

E) Rememorao.

44. Ainda sobre a clnica psicanaltica, analise as seguintes afirmaes:


I.

O perodo de tratamento depende, em certa medida, da vontade do analista, pois, por sua ao diretiva, pode
favorecer que o analisante negue suas resistncias.
II. Na transferncia, temos a expresso da resistncia do analisante, a qual se opera mediante a atualizao de suas
fantasias inconscientes no analista.
III. O analista deve se preocupar com aspectos do contrato teraputico, por exemplo, pagamento e atrasos, uma vez
que podem servir expresso da resistncia do analisante.
IV. O reforamento do ego, pelo analista, deve visar, sempre, modelagem de atitudes que permitam a expresso e
elaborao dos conflitos psquicos inconscientes do analisante.
Esto CORRETAS, apenas,
A) I e II.

B) II e IV.

C) I e IV.

D) II e III.

E) III e IV.

45. Considerando-se o papel do terapeuta na Terapia Centrada no Cliente, analise as seguintes afirmaes:
I.

Deve estar em contato com o cliente, o qual se mostra num estado de incongruncia, portanto, vulnervel e
ansioso.
II. Deve comunicar, pelo menos, num grau mnimo, sua considerao positiva incondicional pelo cliente.
III. Deve se apresentar congruente e integrado na relao com o cliente e, ao mesmo tempo, elaborar sua atitude
transferencial por ele.
Est INCORRETO, apenas, o que se afirma em
A) I.

B) II.

C) III.

D) I e II.

E) II e III.

46. Em relao ao processo psicoterpico com crianas, segundo o embasamento psicanaltico, assinale a alternativa
INCORRETA.
A) O brincar, enquanto mecanismo de expresso associativo, emerge como um espao de simbolizao entre a criana e o
terapeuta.
B) O sintoma da criana pode ser a expresso de um conflito relacional com os pais, da a necessidade de tambm escut-los.
C) Os elementos do contrato teraputico, por exemplo o pagamento, permitem evidenciar possveis resistncias dos pais.
D) A transferncia um deslocamento de fantasias inconscientes que se opera entre o terapeuta e a criana/pais.
E) Na anamnese, organizada, fundamentalmente, com o uso de inventrios e entrevistas estruturadas, buscam-se tanto
informaes objetivas como aquelas sobre a dinmica familiar.
47. Sobre a parentalidade, assinale a alternativa INCORRETA.
A) No mbito da parentalidade, a funo paterna, enquanto funo de mediao entre a me e o beb, auxilia a me a
reconhecer o beb em sua dimenso de sujeito e alteridade, j que para o pai o beb se constitui como objeto externo desde
a concepo.
B) A diversidade dos arranjos familiares, inclusive aqueles associados homossexualidade, mostram que o parentesco e a
filiao, enquanto fenmenos sociais, no so apenas derivados da procriao. Assim, as regras adotadas para seu
funcionamento so mais que uma rplica exata da "natureza".
C) A parentalidade, por sua origem sociocultural, independe das fantasias e dos fantasmas vivenciados com os pais, no
estando articulada a formaes sintomticas de convvio, ou seja, a histria transgeracional na qual perpassam para as
geraes futuras os segredos e conflitos familiares antecedentes.
D) Os desajustes conjugais na transio para a parentalidade podero estar associados com problemas no desenvolvimento da
criana. Quando o casal projeta suas ansiedades na criana, interferir negativamente no desenvolvimento desta.
E) Os pais assumem a funo parental, que um conjunto de elementos biolgicos, psicolgicos, jurdicos, ticos, econmicos
e culturais a partir de seus modelos parentais. Para tanto, tm que se organizar, criar e negociar novos papis e novas
funes, segundo os contextos em que esto inseridos.

10

PSICOLOGIA - (ESPPE/HDM-GARANHUNS)

48. Considere a seguinte afirmao feita por um religioso numa palestra: Na parentalidade homossexual, temos uma
configurao familiar, que poder ser prejudicial ao desenvolvimento psicossocial normal das crianas, pois, pode induzila a adquirir essa identidade sexual.
Considerando as atuais concepes da compreenso do processo de desenvolvimento psicolgico e sua vinculao
com a parentalidade, diramos que essa afirmao teoricamente ERRADA, porque
A) pressupe, equivocadamente, que a homossexualidade seja um transtorno ou doena psquica.
B) assevera que a identidade sexual uma caracterstica biologicamente determinada e imutvel.
C) restringe o processo de filiao sua dimenso sociocultural, desconsiderando a biolgica.
D) supe que a parentalidade no est contida no sexo, mas, numa construo scio-subjetiva.
E) relega o carter instintivo, portanto, hereditrio, da identidade sexual masculina e feminina.
49. Analise a seguinte afirmao sobre a organizao e o funcionamento familiar: Regula a si mesma, de acordo com
regras externas e internas, criadas em um perodo de tempo. Estabiliza-se e equilibra-se por meio dessas regras. Muitas
vezes, regida pela circularidade, oferece resistncia mudana, mantendo, sempre que possvel, sua homeostase.
O tipo de abordagem preconizada nessa perspectiva terica a
A) Psicanaltica.
B) Construtivista.
C) Modeladora.
D) Focal.
E) Sistmica.
50. Em relao ao atendimento psicoterpico da famlia, analise as seguintes afirmaes:
I.

Entre os objetivos da abordagem familiar, tem-se o restabelecimento da negociao entre os membros da famlia,
evitando, assim, alianas transgeneracionais (pai com filho, me com filho, av com neto).
II. O comportamento sintomtico dos familiares pode tender manuteno das regras de interao que controlam o
estabelecimento de fronteiras e hierarquias, e, assim, reforam a patologia familiar.
III. O sintoma do filho pode cumprir a funo de, ao mesmo tempo, manter os pais unidos em relao preocupao
com ele, e, tambm, mant-los afastados de uma relao mais prxima entre si.
Est CORRETO o que se afirma em
A) I e II, apenas.
B) I e III, apenas.
C) II, apenas.
D) III, apenas.
E) I, II e III.

11

PROVA: RESIDNCIA EM SADE


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: UPE

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

26
27
28
29
30
31
32
33
34
35
36
37
38

B
C
E
B
A
D
B
D
E
D
C
E
B

39
40
41
42
43
44
45
46
47
48
49
50

A
B
A
A
C
D
C
E
C
A
E
E

Coletnea de Provas | Concursos de Psicologia

SECRETARIA DE ADMINISTRAO
SECRETRIA DE SADE
CONCURSO PBLICO

MANH
DADOS DE IDENTIFICAO DO CANDIDATO

No deixe de preencher as informaes a seguir:


PRDIO

SALA

NOME

N DE IDENTIDADE

RG. EXPED.

UF

N DE INSCRIO

CADERNO DE PROVA 13
ANALISTA EM SADE
PSICLOGO

PSICLOGO

CONHECIMENTOS ESPECFICOS

21. Sobre a Reforma Psiquitrica em curso no Brasil, cujo marco significativo de reflexo est compreendido entre as
dcadas de 1980 e 1990, assinale a alternativa que INCORRETAMENTE relaciona os seus objetivos.
A) Reestruturao da assistncia psiquitrica mediante a reforma e humanizao da rede manicomial.
B) Salvaguarda dos direitos civis, da dignidade pessoal e dos direitos humanos dos usurios.
C) Desenvolvimento de aes para a permanncia do usurio em seu meio comunitrio.
D) Reviso crtica do papel hegemnico e centralizador do hospital psiquitrico.
E) Criao de servios substitutivos como as residncias teraputicas.
22. Considerando o processo de desinstitucionalizao veiculado Reforma Psiquitrica, analise os itens abaixo:
I.

Pressupe a realizao de aes que, concretamente, desloquem o centro do cuidado ao paciente da comunidade,
distrito e territrio para a instituio, permitindo, com a regulao do seu contato com o corpo social, o controle,
quando necessrio, do processo segregativo.
II. Caracteriza-se como uma crtica epistemolgica ao saber mdico-positivista que fundamenta a prtica psiquitrica,
favorecendo, a partir de uma abordagem histrica da realidade do sujeito e do seu processo de adoecimento, a
transformao qualitativa do modelo de sade.
III. A mudana dos servios de um modelo esttico para outro dinmico e em transformao, o qual, no mbito de sua
concepo e operacionalizao, abarque, inclusive, a reflexo crtica sobre as relaes de poder entre a instituio,
os profissionais e os usurios.
Est(o) CORRETO(S)
A) I, apenas.

B) I e II, apenas.

C) II e III, apenas.

D) III, apenas.

E) I, II e III.

23. A Lei n 11.064, de 16 de maio de 1994, dentre outros aspectos, dispe sobre a internao psiquitrica involuntria.
No artigo 7, para proteger os direitos do usurio, especifica que o mdico responsvel pela internao faa, por meio
da instituio, sua comunicao a determinado rgo pblico e num determinado prazo.
Assinale a alternativa que identifica, CORRETAMENTE, um e outro.
A) Ministrio Pblico, no prazo de 48 horas, contadas a partir do procedimento de internao.
B) Secretaria de Sade, no prazo de 24 horas, contadas a partir do procedimento de internao.
C) Defensoria Pblica, no prazo de 36 horas, contadas a partir do procedimento de internao.
D) Conselho Tutelar, no prazo de 24 horas, contadas a partir do procedimento de internao.
E) Conselho Nacional de Justia, no prazo de 72 horas, contadas a partir do procedimento de internao.
24. Observe a seguinte descrio: Designa um momento individual especfico, no qual efervescem questes, afetos, gestos e
comportamentos variveis e singulares, que afetam em graus variveis a vida cotidiana da prpria pessoa e daqueles de
seu convvio, e costumam ser determinantes das demandas e intervenes em servios de Sade Mental.
Assinale a alternativa que identifica, CORRETAMENTE, o conceito descrito.
A) Sndrome

B) Surto

C) Transtorno

D) Cronicidade

E) Crise

PSICLOGO

25. Em seu relato, um paciente diz: Lembra o tsunami no Japo? Aconteceu porque fui praia nadar. L, vi uma onda e
imaginei-a gigantesca, com todos se afogando. Imaginei um tsunami. Ao chegar a minha casa, vi a notcia no jornal da
TV. Toda aquela desgraceira aconteceu e muitos morreram.
Nesse relato, considerando os sintomas associados ao pensamento, identifica-se a ocorrncia de um(a)
A) neologismo
B) verbigerao
C) glossolalia

D) pensamento mgico
E) afrouxamento associativo

26. O Ataque de Pnico, que, alm do Transtorno de Pnico, tambm ocorre em transtornos como a Fobia e o Estresse
Ps-Traumtico, compreende um conjunto de sintomas bem definidos. Analisando as alternativas abaixo, assinale
aquela cujo sintoma est INCORRETAMENTE relacionado sua ocorrncia.
A) Palpitaes
B) Sensao de asfixia
C) Medo de perder o controle

D) Nusea
E) Ideao delirante de morte

27. Sobre o processo de avaliao em Psicologia, assinale a alterativa INCORRETA.


A) A escolha das estratgias e dos instrumentos avaliativos feita sempre de acordo com uma abordagem terica
(psicanaltica, fenomenolgico-existencial, sistmicas etc.), um objetivo (clnico, profissional, educacional, forense etc.) e
uma finalidade (diagnstico, tratamento, preveno etc.).
B) A avaliao, enquanto procedimento clnico, envolve um corpo organizado de princpios tericos, mtodos e tcnicas de
investigao tanto da personalidade como das funes cognitivas (memria, linguagem etc.).
C) A entrevista, como abordagem terica da avaliao psicolgica, pressupe uma relao simtrica Psiclogo-Cliente, a qual
pode ser caracterizada como emptica ou transferencial.
D) O processo avaliativo atravs do jogo e do brincar pressupe que o significado psicolgico da atividade ldica comporta,
alm do prazer, a expresso simblica das fantasias, desejos e experincias.
E) As etapas do psicodiagnstico so, sinteticamente, as seguintes: 1 contato inicial e entrevistas; 2 planejamento e
aplicao dos testes e tcnicas projetivas, 3 anlise e interpretao dos resultados e 4 devoluo dos resultados ao
examinando e elaborao/encaminhamento do laudo para o solicitante.
28. Considerando os fundamentos que orientam a definio e aplicabilidade de um Projeto Teraputico Singular,
assinale a alternativa INCORRETA.
A) Realiza-se tanto com indivduos como com grupos, valorizando-se, para um e outro, as diferenas que os singularizam.
B) Pressupe-se que seja elaborado, implantado e desenvolvido por um determinado profissional e ou uma equipe
multiprofissional.
C) Organiza-se em quatro etapas: diagnstico, definio de metas, diviso de responsabilidade e reavaliao.
D) Estimula-se a posio ativa do usurio para que modifique sua forma de se relacionar com a vida e a doena.
E) Orienta-se segundo a recusa de uma prtica que reduza o usurio a um diagnstico/protocolo de tratamento.
29. Senhor P, um profissional de sade que trabalha num hospital geral, fornece o seguinte depoimento: A dor e a
morte so fatos tristes, mas naturais. Para mim, normal. Vivencio desta maneira. Procuro no envolver o lado emocional
de forma a no atrapalhar o meu trabalho. Fao tudo pelo paciente, mas se ele vier a morrer, sinto muito, sei que fiz o que
pude fazer. No sou eu quem deve chorar ou sofrer. O choro algo dos familiares ou amigos..
Esse tipo de reao emocional, apresentada pelo Sr. P em relao ao sofrimento e morte dos seus pacientes, bem
como dos familiares e amigos do paciente, CORRETAMENTE denominado de
A) Transferncia negativa.
B) Empatia genuna.
C) Realimentao negativa.

D) Calosidade profissional.
E) Distanciamento crtico negativo.

30. Sobre a organizao edpica, tal qual descrita por Freud, assinale a alternativa INCORRETA.
A) Tanto para o menino como para a menina, no princpio, o primeiro objeto de amor a me, sendo o pai, tambm para
ambos, a figura intrusiva que lhes impede a relao exclusiva.
B) Na fase flica, o pnis e seu anlogo, o clitris, tornam-se as zonas ergenas predominantes, sendo que do pnis, enquanto
presente ou ausente, o nico atributo sexual reconhecido.
C) A castrao indica renncia me enquanto objeto do desejo, sendo que, no menino, impe a angstia face perda do
pnis, e, na menina, a decepo pela constatao da impossibilidade de t-lo.
D) O menino e a menina, ao vivenciarem a castrao, interiorizam um complexo de proibies que lhes permitem constituir o
ego e sua funo de resoluo dos conflitos, inclusive o edpico.
E) Com a resoluo da crise edipiana, a relao da criana com os pais dessexualizada, sendo os sentimentos de afeio e
ternura colocados em substituio queles de carter ertico.
7

PSICLOGO

31. Leia a seguinte afirmao: Trata-se de um processo que se fundamenta, essencialmente, no(a) __________ da
realidade, ou melhor, na existncia de uma percepo angustiante e traumatizante: a ausncia de pnis na me e na
mulher. Quando essa estratgia de defesa associada a um mecanismo correlativo, ou seja, a elaborao de uma
formao substitutiva, tem-se o (a) _______________________, e, portanto, uma perverso.
Assinale a alternativa cujo item complementa, CORRETAMENTE, as lacunas da descrio.
A) recalque - exibicionismo
B) recusa - fetiche
C) recusa - homossexualidade

D) foracluso - fetiche
E) foracluso - homossexualidade

32. Considerando os fundamentos tericos da Abordagem Centrada na Pessoa (ACP), particularmente aqueles
relacionados organizao e funcionamento da personalidade, analise as afirmativas abaixo:
I.

Na medida em que as experincias ocorrem, vo sendo simbolizadas, organizadas e apreendidas, quando so


percebidas como compatveis com o autoconceito. Essas vivncias tambm podem ser ignoradas, por no se
relacionarem ao eu; ou recusadas simbolizao; ou, ainda, terem uma simbolizao distorcida, tendo em vista a
sua incoerncia com a estrutura do eu.
II. O posicionamento do sujeito no mundo pode se dar por uma condio de ajustamento ou desajustamento. O
ajustamento ocorre quando as experincias vividas so ou podem ser simbolicamente assimiladas numa relao
coerente com o autoconceito. O desajustamento, por sua vez, se desenvolve quando as experincias so percebidas
como incompatveis e em desacordo com o autoconceito, sendo, ento, distorcidas.
III. No processo de construo do autoconceito, importante ressaltar a influncia de dois processos: a congruncia e
a incongruncia. O primeiro diz respeito a um estado de consistncia ou harmonia entre o que experienciado e a
conscincia dessa experincia; o segundo, a um estado de discrepncia ou desarmonia entre a experincia e a sua
simbolizao.
Est(o) CORRETA(S)
A) I, apenas.

B) I e II, apenas.

C) II e III, apenas.

D) I e III, apenas.

E) I, II e III.

33. Na teoria de Jung, concebem-se, no mbito do inconsciente coletivo, determinados componentes estruturais que
correspondem a uma forma de pensamento universal, os quais so denominados de
A) Arqutipos.

B) Atitudes.

C) Complexos.

D) Smbolos.

E) Tipos psicolgicos.

34. Considere a definio de determinada tcnica utilizada nas terapias cognitivas e comportamentais: O terapeuta ou
o grupo de clientes, durante as sesses, pode participar de dramatizaes, ora servindo como modelo para ser discutido ou
imitado pelo cliente, ora fazendo o papel de pessoas do cotidiano do cliente. Os participantes so incentivados a trocarem
informao sobre o desempenho de cada um depois do ensaio (Beker, 2012).
Assinale a alternativa que identifica, CORRETAMENTE, a tcnica descrita.
A) Reestruturao cognitiva
B) Exposio
C) Ensaio comportamental (Role-Play)

D) Treino de habilidades sociais


E) Biofeedback

35. Em relao aos fundamentos tericos e empricos que subsidiam a compreenso das condies de assistncia
mulher vtima de violncia, assinale a alternativa INCORRETA.
A) Quando a violncia contra a mulher cometida pelo parceiro, no contexto de uma relao afetivo-sexual,
independentemente de ser uma relao estvel legalizada, temos a violncia conjugal.
B) Distores cognitivas, como a minimizao e negao da violncia, mais do que a passividade, podem demonstrar uma
estratgia defensiva para a sobrevivncia face ameaa vivenciada com o parceiro.
C) Para a mulher, os fatores que dificultam o rompimento do relacionamento podem ser subjetivos (autoconceito negativo),
econmicos (dificuldade financeira) e socioculturais (estigma da separao).
D) As mulheres vitimadas esto, geralmente, isoladas da famlia e da comunidade, o que facilita o controle do agressor; assim,
necessrio que a assistncia se organize numa rede articulada de apoio.
E) A introjeo de um sentimento de nulidade pela mulher decorre, em geral, de seu assujeitamento passivo diante do homem,
oriundo de uma tendncia masoquista, satisfeita na agressividade do parceiro.

PSICLOGO

36. Para o autismo e sua condio epidemiolgica, temos os seguintes dados: i apresenta uma taxa que varia de 2 a 20
casos por 10 mil, ii o incio frequentemente ocorre nos 3 primeiros anos de idade e iii a incidncia mostra uma
frequncia de 4 homens para 1 mulher.
Admitindo tais informaes, e somente estas, para uma criana qualquer nascida, agora, na cidade do Recife, seria
CORRETO afirmar que
A) sendo oriunda de classe econmica C ou D, alta a possibilidade de ser uma criana autista.
B) depois dos 3 anos, ultrapassado o perodo crtico do desenvolvimento, no ser uma criana autista.
C) sendo uma menina, ter maior possibilidade de ser uma criana autista.
D) independentemente do sexo, baixa a possibilidade de ser uma criana autista.
E) sendo um menino, ter menor possibilidade de ser uma criana autista.
37. Sobre a deficincia mental e seu portador, assinale a alternativa INCORRETA.
A) O grau de retardo , geralmente, classificado em 4 nveis: profundo, grave, moderado e leve.
B) A taxa de prevalncia de cerca de 1% da populao, sendo mais comum entre os homens.
C) A etiologia est, necessariamente, veiculada hereditariedade, como na Sndrome de Down e Rett.
D) O tratamento melhora o grau de adaptao, mas, geralmente, o prejuzo intelectual no regride.
E) O diagnstico compreende, necessariamente, a anamnese e o exame fsico (clnicos e laboratoriais).
38. Um ex-usurio de cocana fez o seguinte relato ao Psiclogo: No sei o que aconteceu comigo, mas parece que a
cocana foi se apossando de meu corpo. Como se fosse um demnio, uma coisa ruim: muito era sempre pouco. Quando
usava, o corao disparava e eu ficava animado, ou, como diziam os amigos, ficava ligado. Uma vez, parei de usar
durante dois dias, a senti uma coisa estranha: dormia e comia muito.
Considerando a situao descrita, CORRETO afirmar que o usurio apresentou um quadro de
A) dependncia e tolerncia ao uso da cocana.
B) dependncia, sem tolerncia ao uso da cocana.
C) dependncia, sendo impossvel avaliar a tolerncia cocana.
D) tolerncia, sendo impossvel avaliar a dependncia cocana.
E) intoxicao, com dependncia, mas sem tolerncia cocana.
39. Ainda sobre o relato, assinale a alternativa que identifica um sintoma associado abstinncia de cocana.
A) Sudorese

B) Hipersonia

C) Taquicardia

D) Bulimia

E) Apatia

40. Assinale a alternativa cujo sintoma est associado abstinncia do lcool.


A) Fala arrastada

B) Estupor ou coma

C) Logorreia

D) Lacrimejamento

E) Alucinaes transitrias

41. Considere a seguinte definio sobre um dos fundamentos tericos dos testes psicolgicos: Costuma-se dizer que um
teste apresenta __________ quando ele mede o que supostamente deve medir, sendo este um aspecto fundamental para sua
construo e anlise, pois revela o quanto a evidncia e o suporte terico esto absorvidos na proposta apresentada
(Adaptado de Noronha, 2002).
Assinale a alternativa cujo item completa, CORRETAMENTE, a designao do conceito descrito.
A) Padronizao

B) Validade

C) Fidedignidade

D) Aferio

E) Sistematizao

42. Sobre o teste do Rorschach, assinale a alternativa INCORRETA.


A) As instrues formais devem ressaltar o carter objetivo das respostas a serem dadas s lminas.
B) um teste projetivo que compreende tanto uma validao como uma padronizao
C) Avalia o uso da inteligncia, particularmente no que se refere capacidade de anlise e sntese.
D) As respostas determinadas pelo movimento so associadas ao grau de maturidade e criatividade.
E) bastante utilizado para a definio de diagnsticos diferenciais e o planejamento de tratamento.
43. Considerando a definio dada pela Organizao Mundial de Sade (OMS), assinale a alternativa cuja formulao
est incorretamente relacionada perspectiva clnica dos cuidados paliativos.
A) Fornece um sistema de apoio e ajuda para que os pacientes vivam ativamente at a morte.
B) Focaliza a vida e a morte como etapas naturais e integradas ao ciclo existencial.
C) Admite teraputicas cientficas que, para minimizar o sofrimento, aceleram o processo de morte.
D) Visa realizao de procedimentos que aliviem a dor e outros sintomas desconfortveis.
E) Integra, no cuidado ao paciente e seus familiares, os aspectos psicossociais e os espirituais.
9

PSICLOGO

44. Considere as seguintes definies:


I.

Morte dolorosa e miservel de enfermos por causas sociais e polticas, ou seja, dos excludos que no tm acesso
aos sistemas pblicos ou privados de sade, ou que, mesmo conseguindo ingressar no sistema, no tm um
tratamento adequado e qualificado.
II. Prtica pela qual se busca abreviar, sem dor e sofrimento, a vida de um doente reconhecidamente incurvel.
III. Manuteno da vida por meio de procedimentos desproporcionais - obstinao teraputica - que conduzem a um
processo de morte prolongado e repleto de sofrimento.
IV. Ocorrncia da morte natural, sem interferncia da tecnologia ou da Medicina, possibilitando a morte digna, de
acordo com a evoluo da doena.
Assinale a alternativa que relaciona, CORRETAMENTE, as definies com sua designao conceitual.
A) I Distansia II
B) I Mistansia II
C) I Ortotansia II
D) I Mistansia II
E) I Distansia II

Eutansia III
Eutansia III
Distansia III
Eutansia III
Mistansia III

Ortotansia e IV
Distansia e IV
Eutansia e IV
Ortotansia e IV
Eutansia e IV

Mistansia
Ortotansia
Mistansia
Distansia
Ortotansia

45. Considerando as caractersticas que definem um grupo operativo, analise os itens abaixo:
I.
II.
III.
IV.

Pressupe uma organizao interdisciplinar, centrada na realizao de uma tarefa.


Focaliza a superao e a resoluo de situaes fixas e estereotipadas.
Compreende um grau de resistncia associado ao medo de mudana.
O processo grupal compreende trs etapas: pr-tarefa, tarefa e projeto.

Esto CORRETO(S)
A) I, II e III, apenas.
B) I, III e IV, apenas.
C) I, II e IV, apenas.

D) II, III e IV, apenas.


E) I, II, III e IV.

46. Em relao Sndrome de Burnout, assinale a alternativa INCORRETA.


A) Existe a predominncia de sintomas relacionados exausto mental e emocional, fadiga e depresso.
B) Observa-se uma nfase nos sintomas comportamentais e mentais e no, nos sintomas fsicos.
C) Os sintomas so relacionados ao trabalho, e, tambm, s condies sociofamiliares cotidianas.
D) A manifestao da sndrome deve estar dissociada de distrbios psquicos que a antecedam.
E) Diminuio da efetividade e do desempenho no trabalho por atitudes e comportamentos negativos.
47. Um profissional de sade, que trabalha num hospital, presta o seguinte depoimento sobre o setor de atendimento a
pacientes em hemodilise: Somos Enfermeiros, Mdicos, Assistentes Sociais, Psiclogos etc. que desenvolvem um
trabalho em conjunto. Discutimos cada um dos casos e planejamos a interveno que realizamos, e, com isso, trocamos e
integramos, permanentemente, nossos conhecimentos. Digo mais: nosso compromisso tico no s com o cliente, mas,
com a sade.
Considerando a situao descrita, assinale a alternativa que identifica, CORRETAMENTE, esse tipo de equipe.
A) Multiprofissional
B) Interdisciplinar
C) Transdisciplinar

D) Interprofissional
E) Cooperativa

48. Diante da angstia face ao diagnstico ou tratamento das doenas, o paciente hospitalizado pode apresentar as
seguintes reaes defensivas: i conversar, s vezes, at animadamente, sobre os aspectos tcnicos de seu diagnstico e
tratamento, ii postergar ou abandonar o tratamento e, s vezes, desacreditar nos resultados do exame e iii expressar
raiva contra os mdicos ou seus familiares, e, tambm, culp-los por sua condio de adoecimento.
Assinale a alternativa que identifica, CORRETAMENTE, os mecanismos defensivos descritos.
A) i racionalizao
B) i negao
C) i deslocamento
D) i negao
E) i racionalizao

ii
ii
ii
ii
ii

deslocamento e
racionalizao e
racionalizao e
deslocamento e
negao
e

iii
iii
iii
iii
iii

negao
deslocamento
negao
racionalizao
deslocamento
10

PSICLOGO

49. Considere as seguintes definies observadas na Resoluo CFP N. 007/2003, que institui o Manual de Elaborao
de Documentos Escritos:
I.

Uma apresentao descritiva acerca de situaes e ou condies psicolgicas e suas determinaes histricas,
sociais, polticas e culturais, pesquisadas no processo de avaliao psicolgica.
II. Um documento fundamentado e resumido sobre uma questo focal do campo psicolgico, cujo resultado pode ser
indicativo ou conclusivo.
III. Um documento expedido pelo psiclogo, que certifica uma determinada situao ou estado psicolgico, tendo
como finalidade afirmar sobre as condies psicolgicas de quem, por requerimento, o solicita.

Assinale a alternativa que relaciona, CORRETAMENTE, as definies com sua designao conceitual.
A) I Laudo II
B) I Laudo II
C) I Atestado II
D) I Parecer II
E) I Parecer II

Parecer e III
Atestado e III
Laudo e III
Laudo e III
Atestado e III

Atestado
Parecer
Parecer
Atestado
Laudo

50. Em relao s caractersticas do processo de educao em sade, assinale a alternativa INCORRETA.


A) um instrumento para a promoo da qualidade de vida de indivduos, famlias e comunidades.
B) Fundamenta-se na articulao interdisciplinar dos saberes cientficos, tcnicos e populares.
C) Utiliza recursos institucionais, oriundos tanto da iniciativa pblica como da privada.
D) Fortalece o paradigma biomdico enquanto norteadora da assistncia sade.
E) Abrange a anlise e interveno no processo sade-enfermidade enquanto multideterminada.

11

PROVA: SES - PE
ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: UPE

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

21
22
23
24
25
26
27
28
29
30
31
32
33
34
35

A
C
A
E
D
E
C
B
D
D
B
E
A
C
E

36
37
38
39
40
41
42
43
44
45
46
47
48
49
50

D
C
A
B
E
B
A
C
B
D
C
B
E
A
D

Coletnea de Provas | Concursos de Psicologia

Concurso Pblico

050. PROVA OBJETIVA


Psiclogo ou Psicanalista
Voc recebeu sua folha de respostas e este caderno contendo 60 questes objetivas.

&RQUDVHXQRPHHQ~PHURGHLQVFULomRLPSUHVVRVQDFDSDGHVWHFDGHUQRHQDIROKDGHUHVSRVWDV

4XDQGRIRUSHUPLWLGRDEULURFDGHUQRYHULTXHVHHVWiFRPSOHWRRXVHDSUHVHQWDLPSHUIHLo}HV&DVRKDMDDOJXP
SUREOHPDLQIRUPHDRVFDOGDVDOD
/HLDFXLGDGRVDPHQWHWRGDVDVTXHVW}HVHHVFROKDDUHVSRVWDTXHYRFrFRQVLGHUDFRUUHWD

0DUTXHQDIROKDGHUHVSRVWDVFRPFDQHWDGHWLQWDD]XORXSUHWDDOHWUDFRUUHVSRQGHQWHjDOWHUQDWLYDTXHYRFr
escolheu.
$GXUDomRGDSURYDpGHKRUDVHPLQXWRVMiLQFOXtGRRWHPSRSDUDRSUHHQFKLPHQWRGDIROKDGHUHVSRVWDV

6yVHUiSHUPLWLGDDVDtGDGHQLWLYDGDVDODHGRSUpGLRDSyVWUDQVFRUULGRVGRWHPSRGHGXUDomRGDSURYD

$RVDLUYRFrHQWUHJDUiDRVFDODIROKDGHUHVSRVWDVHHVWHFDGHUQRSRGHQGROHYDUDSHQDVRUDVFXQKRGHJDEDULWR
ORFDOL]DGRHPVXDFDUWHLUDSDUDIXWXUDFRQIHUrQFLD
$WpTXHYRFrVDLDGRSUpGLRWRGDVDVSURLELo}HVHRULHQWDo}HVFRQWLQXDPYiOLGDV

AGUARDE A ORDEM DO FISCAL PARA ABRIR ESTE CADERNO DE QUESTES.

_PDQKm

CONHECIMENTOS ESPECFICOS

34. Na construo do caso clnico, conforme defendida por


Carlo Vigan, psiquiatra e psicanalista de orientao
lacaniana, deve-se encontrar, nas narrativas dos participantes da rede social do paciente (os operadores, os
familiares, as instituies),

31. Ampliar as possibilidades de realizao da clnica ampliada um dos objetivos do apoio matricial e da equipe de
referncia, entendidos como arranjos organizacionais e,
ao mesmo tempo, como metodologia para a gesto do
trabalho em sade. Por equipe de referncia entende-se

(A) roteiros transgeracionais que, a cada gerao, configuram a posio de ovelha negra na rede social do
paciente.

(A) o conjunto de profissionais responsveis pela elaborao de diretrizes gerais de atendimento aos usurios.

(B) o ponto cego dessas narrativas, que corresponde ao


lugar do sujeito e da doena que o acometeu.

(B) o grupo de especialistas que presta servios de consultoria s equipes de atendimento aos usurios.

(C) a funo do sujeito como catalizador dos conflitos inconscientes da rede social e mantenedor da homeostase desses grupos.

(C) o profissional ou equipe de profissionais que tm a responsabilidade pela conduo de um caso individual,
familiar ou comunitrio.

(D) a convergncia de expectativas dos participantes da


rede social em relao ao sujeito que excedem a capacidade que ele tem de atend-las.

(D) o conjunto de protocolos a ser seguido no atendimento


a usurios portadores de categorias de doenas especficas.

(E) a coexistncia de expectativas conflitantes dos participantes da rede social em relao ao sujeito.

(E) a equipe de profissionais de sade mental que oferece


retaguarda psicolgica para profissionais de sade em
geral.

35. Na viso de Jacques Lacan, a condio essencial para a


formao da conscincia de si do sujeito

32. Para Donald D. Winnicott, a psicose uma doena de


deficincia do ambiente. Para o autor, isso significa que
esse transtorno decorre

(A) o predomnio de experincias positivas nos primeiros


meses de vida, que favoream a consolidao do ego
da criana.

(A) da falta de proviso bsica inicial pelo ambiente, cuja


principal consequncia a falha do processo de maturao e integrao da criana.

(B) a presena de condies satisfatrias de manejo do


corpo do beb pela me, de modo a despertar as
diferentes zonas ergenas da criana.

(B) de experincias traumticas recorrentes na infncia,


que acabam por estabelecer a associao entre ambiente e sentimentos de vulnerabilidade.

(C) a instaurao do princpio da realidade em oposio


primazia absoluta do princpio do prazer na psique
da criana.

(C) do desaparecimento de pessoas com as quais o


beb estabeleceu relaes objetais, provocando
sentimentos de perda de si e do outro.

(D) a presena de uma conscincia reflexiva, uma figura


adulta, que reconhea a criana como algum.
(E) a discriminao de um eu-pele pelo beb que favorea a discriminao entre realidade externa e realidade interna.

(D) da ausncia de uma figura que possibilite a vivncia


do conflito edpico, o que impede a consolidao da
identidade da criana.

36. Pode-se dizer que a Sndrome de Asperger

(E) de expectativas, por parte do ambiente, que excedem


as reais possibilidades da criana, promovendo uma
ciso (splitting) insupervel entre self real e self ideal.

(A) faz parte dos transtornos do espectro autista devido


ao comprometimento do teste de realidade.
(B) tende a ser confundida com quadros de retardo mental
devido ao prejuzo precoce das habilidades verbais.

33. caracterstica de crianas e adolescentes diagnosticados


com transtorno de conduta a presena de

(C) compromete as relaes interpessoais principalmente


em decorrncia da falta de reciprocidade emocional.

(A) intenso sofrimento psquico associado a sentimentos


de inadequao.

(D) costuma estar associada a dficit de ateno decorrente


do amplo leque de interesses desses indivduos.

(B) capacidade de aprender com as consequncias


nefastas dos prprios atos.

(E) responde bem a ambientes flexveis que favoream o


desenvolvimento da criatividade de seus portadores.

(C) atitudes de extrema lealdade em relao aos companheiros ou parceiros.


(D) comorbidades de natureza orgnica, como epilepsia
e hiperatividade.
(E) baixa tolerncia frustrao, que favorece a ocorrncia de crises de irritabilidade.

PEAT1301/050-Psiclogo-Psicanalista-Manh

10

37. Assinale a alternativa compatvel com o conceito e com


o desenvolvimento de um Projeto Teraputico Singular
(PTS).

40. No Brasil e em outros pases, reduo de danos uma


poltica de sade pblica que
(A) estimula usurios de drogas de alto risco biopsicossocial a consumirem drogas de risco menor.

(A) O PTS ignora possveis diagnsticos, a fim de evitar


rtulos e abordagens mdico-psiquitricas doena
mental.

(B) procura reduzir o preconceito da sociedade frente ao


consumo de drogas ilcitas para promover a incluso
social dos usurios.

(B) O PTS pode ser entendido como um instrumento de


organizao e sistematizao do cuidado construdo
entre equipe de sade e usurio.

(C) oferece atendimento mdico e psicolgico a indivduos


envolvidos em atividades de risco de modo geral.

(C) O PTS tem como principal objetivo a implementao


de atendimento individual do paciente, de modo a
promover o vnculo com o profissional em sua singularidade.

(D) prope atividades recreativas e de apoio psicolgico


a crianas oriundas de lares desfeitos ou violentos.
(E) visa proteger o usurio de danos decorrentes do uso de
drogas sem necessariamente reduzir esse consumo.

(D) O PTS visa propor procedimentos tcnicos aos profissionais de sade, de modo a assegurar o manejo
adequado de questes de sade mental regionais e
locais.

41. Assinale a alternativa compatvel com a proposta de consultas teraputicas, conforme o estabelecido por Donald
D. Winnicott.

(E) O PTS defende a diviso de responsabilidades, entendida como a responsabilizao de profissionais e


familiares pelo sucesso do projeto.

(A) As consultas teraputicas so particularmente teis


quando o ambiente imediato da criana apresenta de
modo sistemtico ausncia de cuidado pessoal ou
se mostra habitualmente adverso.

38. Um fator imprescindvel para a indicao teraputica de


Psicoterapia Breve

(B) Durante a realizao de consultas teraputicas, o


analista dever usar exclusivamente a comunicao
verbal, de modo a assegurar que ocorra uma comunicao significativa nesses encontros.

(A) a motivao do paciente para a interveno.


(B) a viabilidade da neurose transferencial.

(C) Os objetivos ltimos das consultas teraputicas so


favorecer, no paciente, uma integrao de seus aspectos dissociados ou no vividos e a realizao
concomitante do diagnstico, para a compreenso,
pelo analista, do melhor procedimento a ser adotado.

(C) a presena de dificuldades crnicas.


(D) a existncia de risco de desorganizao psquica.
(E) a precariedade dos recursos egoicos.

(D) O trabalho psicolgico realizado nas consultas teraputicas reserva ao analista um posicionamento semelhante ao do pai, como polo parental que estimula
a autonomia e o amadurecimento da criana.

39. O conceito de espontaneidade central no pensamento


de Jacob Moreno, criador do Psicodrama. Para o autor,
um dos efeitos do trabalho com a espontaneidade (aquecimento) pode ser a catarse de integrao, que significa

(E) Nas consultas teraputicas o analista deve se ater


realidade compartilhada, de modo a preservar, na
criana, a lucidez e os recursos necessrios para lidar
com os limites e desafios impostos por tal realidade.

(A) liberar uma descarga emocional associada recordao de um acontecimento traumtico, que deixa
de ser patognico.

42. consenso, entre os psicanalistas, que ao longo do


processo de crescimento a pessoa, inicialmente limitada a fazer uso de defesas primitivas, torna-se capaz
de usar defesas mais amadurecidas e diferenciadas.
Entre os processos defensivos mais primitivos e indiferenciados, conhecidos tambm como defesas primrias, destacam-se

(B) interagir de maneira mais solta e pessoal com as


pessoas dos diferentes grupos sociais de que o indivduo participa.
(C) tornar o indivduo mais criativo, de modo que opte
por conservas culturais j estabelecidas.
(D) libertar-se de algo que limitava e aprisionava, abrindo
a possibilidade de vislumbrar novas perspectivas de
realizao.

(A) represso, regresso, isolamento.


(B) simbolizao, intelectualizao, moralizao.

(E) atingir um nvel de compreenso das causas que


levaram cristalizao de um papel e inibio da
espontaneidade na trajetria pessoal.

(C) idealizao, racionalizao, compartimentalizao.


(D) ciso, introjeo, identificao projetiva.
(E) formao reativa, negao, deslocamento.

11

PEAT1301/050-Psiclogo-Psicanalista-Manh

43. Nos grupos operativos, conforme propostos por Henri


Pichon-Rivire, o coordenador

46. Segundo as polticas nacionais de sade atuais, para as


quais o olhar sobre o paciente, na sade pblica, tende
sempre a inclu-lo como sujeito social, correto afirmar:

(A) deve ser um papel assumido por diferentes membros


do grupo, em momentos distintos de sua existncia,
de modo a demarcar as etapas de amadurecimento
superadas pelo coletivo.

(A) A Psicologia Social deve ser a orientao terica


preferencial no trato do paciente e na interface com
outros saberes que, via de regra, devero ser-lhe subordinados.

(B) procura provocar novas perspectivas e descobertas


por parte dos participantes, ao escutar e devolver
suas prprias falas, tentando dessa forma surpreend-los e desestabiliz-los.

(B) A interveno psicolgica deve seguir estritamente o


modelo psicoterpico tradicional no nvel da ateno
bsica sade.

(C) tem como funo propor temas especficos para discusso no grupo e direcionar as falas dos diferentes
participantes de modo a manter o foco e maximizar a
produtividade do grupo.

(C) O sintoma deve ser inicialmente considerado a partir


do territrio do paciente, isto , do bairro, da famlia,
das relaes imediatas do campo da particularidade
na sua vida cotidiana.

(D) tem como funo desempenhar o papel da me suficientemente boa que acolhe as necessidades do
grupo e assegura um clima de segurana que restabelecer a confiana no ambiente.

(D) O paciente receber atendimento psicolgico de grupo


em todos os nveis de ateno sade, conforme dispe o princpio de universalidade do SUS.

(E) desempenha o papel de lder da mudana, a partir


do momento em que explicita o que implicitamente
se mostrava inaceitvel e descortina possibilidades
mltiplas de ao.

(E) Os aspectos psicolgicos, em seu sentido estrito,


devem ser examinados apenas nos nveis de ateno sade de maior complexidade.

47. A reabilitao psicossocial entendida como

44. Na viso de Jean Piaget, o desenvolvimento cognitivo se


d por meio

(A) a oferta de qualificao profissional para egressos


do sistema penitencirio ou para instituies de abrigamento de menores em conflito com a lei.

(A) da aplicao de categorias lgicas inatas s interaes


com o ambiente, de modo a adapt-las ao mundo e
cultura especfica em que a criana se insere.

(B) o processo pelo qual se facilita, ao indivduo com limitaes, a restaurao da autonomia de suas funes na comunidade, no melhor nvel possvel.

(B) de um conjunto de sequncias de aes da criana,


prprias de faixas etrias bem definidas, que se consolidam em esquemas mentais no estgio do pensamento formal.

(C) o encaminhamento a locais de convvio social de


pessoas que tendem ao isolamento por questes
psicolgicas diversas.

(C) da ruptura de cada estgio com os esquemas mentais e com as aes que os explicitam utilizados nos
estgios precedentes.

(D) a realizao de grupos operativos que esclarecem


como as limitaes do indivduo comprometem sua
adaptao social.

(D) dos primeiros esquemas mentais postos em ao


particularmente a partir do oitavo ms de vida da
criana.

(E) a modelagem de comportamentos compatveis com


as limitaes fsicas e mentais do indivduo e que
promovam sua vida social.

(E) de sucessivas mudanas quantitativas e qualitativas


das estruturas cognitivas, derivando, cada estrutura,
das estruturas precedentes.

45. Na posio esquizoparanoide, conforme entendida por


Melanie Klein,

48. O CAPSi um servio de ateno diria destinado ao


atendimento de crianas e adolescentes que

(A) as relaes objetais positivas so mantidas separadas


das relaes objetais negativas.

(A) apresentam grave comprometimento psquico.

(B) o predomnio do instinto de morte sobre o instinto de


vida conduz a sentimentos de culpa e desamparo.

(C) apresentam quadros de abuso de substncia.

(B) se encontram em situao de rua.

(D) esto envolvidos com o trfico de drogas.

(C) so desenvolvidas tendncias reparadoras para restaurar objetos amados internos e externos.

(E) vivem em situao de risco devido prostituio.

(D) a pulso de morte ainda pouco investida, o que favorece o uso do recalcamento dos impulsos agressivos.
(E) tendem a ocorrer os estgios iniciais do complexo de
dipo com a consequente incluso do nome do pai.

PEAT1301/050-Psiclogo-Psicanalista-Manh

12

49. O atendimento de casos de transtornos mentais graves


nos CAPs envolve, necessariamente,

53. Para Donald D. Winnicott, na base do transtorno de conduta encontra-se

(A) atividades comunitrias de modo a levar a comunidade em particular e a sociedade em geral a se responsabilizar pelo doente.

(A) um conflito intrapsquico, decorrente do constrangimento da criana ou jovem por no controlar atos
antissociais.

(B) o acolhimento diurno em carter excepcional, para


pacientes que apresentam claramente surto psictico
ou delrio por abstinncia de substncia.

(B) um elemento orgnico associado principalmente a


problemas de hiperatividade e dficit de ateno.

(C) atendimentos familiares e em grupo exclusivamente,


reforando uma abordagem social para o tratamento
de transtornos psquicos graves.

(C) uma opo pela imaturidade que impede o enfrentamento das questes do crescimento e da responsabilidade pelos prprios atos.

(D) a elaborao de um projeto teraputico personalizado,


que leve em conta as dificuldades e possibilidades do
paciente em questo.

(D) uma atitude de rebeldia contra a ordem patriarcal


estabelecida, decorrente de relaes inadequadas
com o pai.

(E) uma etapa de permanncia intensiva no servio,


para tratamento dos sintomas agudos, seguida de
uma etapa de atividades comunitrias.

(E) a esperana no ambiente, do qual a criana ou jovem


espera obter algo bom que foi perdido.

50. A teoria da entrevista psicolgica, conforme defendida


por Jos Bleger, determina que, de acordo com a regra
bsica dessa tcnica, o entrevistador deve procurar, em
uma entrevista psicolgica,

54. As primeiras relaes objetais constituem a base do relacionamento afetivo da criana. Para Ren Spitz, pode-se
considerar que foi estabelecida uma relao objetal com
a me quando o beb

(A) tomar conhecimento do mximo de dados possvel


sobre o histrico e a vida atual do entrevistado.

(A) aceita o seio materno pela primeira vez e recebe o


leite que dele jorra e o alimenta.

(B) aplacar ao mximo a ansiedade do entrevistado para


que ele possa se expressar com clareza.

(B) reage aos rudos do organismo materno ainda durante


o perodo de gestao.

(C) obter o mximo de dados sobre o comportamento


total do entrevistado durante a entrevista.

(C) emite a resposta sorriso, como reao ao rosto e s


feies da me.

(D) manter uma postura neutra de modo a assegurar


que apenas o entrevistado seja participante da entrevista como um todo.

(D) apresenta a reao da angstia do oitavo ms diante


de estranhos.

(E) manter um enquadramento flexvel que contemple


as caractersticas especficas da personalidade e da
queixa do entrevistado.

(E) emite a resposta no, indicando a percepo do


limite entre de si e o Outro.

51. A trade autista, referente s trs reas afetadas pelo


autismo, inclui:

55. Um autor de contribuio expressiva ao estudo do desenvolvimento infantil Lev Vygotsky. Para o autor,

(A) abstrao; memria; comunicao.

(A) a criana nasce em um mundo social e, desde o nascimento, vai formando uma viso do mundo atravs da
interao com adultos ou crianas mais experientes.

(B) verbalizao; socializao; identidade.


(C) interao; cognio; comportamentos focalizados e
repetitivos.

(B) o pensamento aparece antes da linguagem, que por


sua vez apenas uma das formas de expresso da
linguagem.

(D) cognio; afeto; socializao.


(E) socializao; comunicao; comportamentos focalizados e repetitivos.

(C) todas as culturas compartilham o mesmo perfil psicolgico bsico que em ltima instncia possibilita o
convvio social.

52. Segundo Michel Foucault, a captura da loucura pela interpretao cientfica e institucional produzida pela medicina
mental se deu com o conceito de

(D) o conhecimento dialtico na medida em que no


processo de aquisio de informaes, assimilao
e acomodao se alternam.

(A) possesso.

(E) os conhecimentos so elaborados espontaneamente


pela criana, de acordo com o estgio de desenvolvimento em que esta se encontra.

(B) alienao mental.


(C) teste de realidade.
(D) esquizofrenia.
(E) delrio.
13

PEAT1301/050-Psiclogo-Psicanalista-Manh

56. Na puberdade, o hipotlamo produz hormnios que,


alm de influenciar diretamente o comportamento dos
pberes, desencadeiam transformaes corporais, por
meio das quais o corpo infantil gradualmente se transforma em corpo adulto. Os principais hormnios responsveis por essas mudanas so

59. Pode-se dizer que o rpido processo de mudanas ocorridas nas relaes e nos valores familiares nas ltimas
dcadas
(A) alterou o modo como o desenvolvimento psicossexual
ocorre nos diferentes estgios do ciclo vital.
(B) reforou a hierarquia tradicional de papis e as funes
desempenhadas pelos diferentes membros do grupo
familiar.

(A) adrenalina nos meninos; cortisol nas meninas.


(B) adrenalina e cortisol em ambos os gneros.

(C) favoreceu o desenvolvimento de princpios de educao coerentes e alinhados s demandas sociais atuais.

(C) testosterona nos meninos; estrgeno nas meninas.


(D) serotonina nos meninos; dopamina nas meninas.

(D) manteve a funo de continncia, da famlia, para as


ansiedades existenciais de seus membros durante o
desenvolvimento.

(E) ocitocina nos meninos; melatonina nas meninas.

(E) limitou a importncia da famlia ao desempenho de


funes biolgicas em relao aos seus membros.
57. coerente com o pensamento de Jean Piaget afirmar
que
(A) aes morais podem ser observadas nas atividades
ldicas de crianas na faixa de 3 a 4 anos de idade.

60. Assinale a alternativa compatvel com o princpio do equilbrio quase-estacionrio aplicado terapia familiar.

(B) noes de moralidade se desenvolvem a partir de


virtudes indispensveis vida coletiva.

(A) Os membros de um grupo familiar s estaro preparados para aceitar mudanas depois que algo abalar
suas crenas.

(C) o desenvolvimento moral da criana est intimamente


relacionado com a cultura religiosa de cada famlia.

(B) As interaes familiares sempre se mantm ativas,


mesmo durante perodos de isolamento aparente de
um de seus membros.

(D) a compreenso da existncia de regras tem incio


quando a noo de justia se separa da noo de
recompensa.

(C) Deve-se buscar, na terapia, a configurao ideal que


assegure o aproveitamento mximo do potencial de
cada membro do grupo familiar.

(E) as relaes afetivas que se estabelecem entre os seres


humanos esto na origem da ao moral.

(D) De modo geral o funcionamento de uma famlia tende


a sustentar a configurao mais saudvel para todos
os membros.
(E) H sempre uma disposio potencial para a mudana,
inerente famlia, voltada para a obteno de mais bem-estar de seus membros.

58. Um psiclogo, analisando os dados de histrico e entrevistas realizadas com um indivduo, identifica um padro
invasivo de grandiosidade e necessidade de admirao
associado s seguintes caractersticas: senso relativamente estvel de identidade; falta de empatia; certo desdm pelos outros e crena de que especial e singular;
acentuada vulnerabilidade autoestima. Dado que as
funes de controle do pensamento e teste de realidade
esto preservadas no indivduo, as caractersticas identificadas pelo psiclogo sugerem, como hiptese diagnstica mais provvel, o transtorno de personalidade
(A) passivo-dependente.
(B) narcisista.
(C) borderline.
(D) antissocial.
(E) histrinico.

PEAT1301/050-Psiclogo-Psicanalista-Manh

14

PROVA: PREFEITURA DE ATIBAIA


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: VUNESP

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

31
32
33
34
35
36
37
38
39
40
41
42
43
44
45

C
A
E
B
D
C
B
A
D
E
C
D
B
E
A

46
47
48
49
50
51
52
53
54
55
56
57
58
59
60

C
B
A
D
C
E
B
E
D
A
C
E
B
D
A

Coletnea de Provas | Concursos de Psicologia

SECRETARIA MUNICIPAL DA SADE

CONCURSO PBLICO

044. PROVA OBJETIVA

ESPECIALISTA

EM

SADE PSICLOGO

Voc recebeu sua folha de respostas e este caderno contendo 50 questes objetivas.

 &RQUDVHXQRPHHQ~PHURGHLQVFULomRLPSUHVVRVQDFDSDGHVWHFDGHUQRHQDIROKDGHUHVSRVWDV

 4XDQGR IRU SHUPLWLGR DEULU R FDGHUQR YHULTXH VH HVWi FRPSOHWR RX VH DSUHVHQWD LPSHUIHLo}HV &DVR KDMD DOJXP
SUREOHPDLQIRUPHDRVFDOGDVDOD

 /HLDFXLGDGRVDPHQWHWRGDVDVTXHVW}HVHHVFROKDDUHVSRVWDTXHYRFrFRQVLGHUDFRUUHWD

 0DUTXHQDIROKDGHUHVSRVWDVFRPFDQHWDGHWLQWDD]XORXSUHWDDOHWUDFRUUHVSRQGHQWHjDOWHUQDWLYDTXHYRFrHVFROKHX
 $GXUDomRGDSURYDpGHKRUDVMiLQFOXtGRRWHPSRSDUDRSUHHQFKLPHQWRGDIROKDGHUHVSRVWDV
 6yVHUiSHUPLWLGDDVDtGDGHQLWLYDGDVDODHGRSUpGLRDSyVWUDQVFRUULGDVKGRLQtFLRGDSURYD

 'HYHUmRSHUPDQHFHUHPFDGDXPDGDVVDODVGHSURYDRV~OWLPRVFDQGLGDWRVDWpTXHR~OWLPRGHOHVHQWUHJXHVXD
SURYDDVVLQDQGRWHUPRUHVSHFWLYR
 $RVDLUYRFrHQWUHJDUiDRVFDODIROKDGHUHVSRVWDVHHVWHFDGHUQRSRGHQGROHYDUDSHQDVRUDVFXQKRGHJDEDULWR
ORFDOL]DGRHPVXDFDUWHLUDSDUDIXWXUDFRQIHUrQFLD
 $WpTXHYRFrVDLDGRSUpGLRWRGDVDVSURLELo}HVHRULHQWDo}HVFRQWLQXDPYiOLGDV

AGUARDE

A ORDEM DO FISCAL PARA ABRIR ESTE CADERNO DE QUESTES.



CONHECIMENTOS ESPECFICOS

19. Estudos relevantes do pirmeiro ano de vida asseguram que


no desenvolvimento do beb ocorre um fenmeno conhecido como o medo de estranhos, chamado de angstia do
8. ms. Considerado como sinalizador de um organizador
psquico importante, essa angstia do 8. ms revela

16. Alguns autores referem-se ao nascimento psicolgico do


indivduo como um processo intrapsquico, que se constitui
de modo lento. Isso se d pelo estabelecimento do sentido
de desligamento (ser destacado) do mundo real e da relao com esse mundo, particularmente no que diz respeito
s experincias do prprio corpo do sujeito e ao principal
representante do mundo, como a criana o experimenta, o
objeto primrio de amor. Esse processo a(o)

(A) um sinal patolgico no desenvolvimento emocional do


beb.
(B) uma carncia afetiva por falta de cuidados maternos.
(C) um funcionamento inadequado do princpio do prazer.
(D) o estabelecimento de uma verdadeira relao de objeto:
a me j se encontra interiorizada e transformou-se no
objeto libidinal.

(A) prazer-desprazer.
(B) separao-individuao.

(E) um prejuzo no estabelecimento da relao me-beb.

(C) simbiose-ambiguidade.
20. O conceito de funes egoicas abarca um conjunto no qual
necessrio fazer diferenciaes hierrquicas em trs ordens
de funes: funes egoicas bsicas, funes defensivas e
funes integradoras, sintticas e organizadoras. De acordo
com esse conceito, as funes egoicas bsicas, so voltadas
para o mundo exterior, para os outros e para aspectos de si
mesmo. Assinale a alternativa com quatro dessas funes
egoicas bsicas.

(D) fuso-ambiguidade.
(E) incubao-identidade.

17. No desenvolvimento emocional do beb, um papel vital


desempenhado pelo meio ambiente. De forma simplificada,
afirma-se que a funo ambiental envolve, sucintamente,
trs aspectos. Se esses aspectos acontecem de forma satisfatria, de tal modo que a experincia legtima de onipotncia
do beb no seja violada, o resultado pode ser que o beb
seja capaz de usar o objeto e sentir como se esse objeto fosse
um objeto subjetivo, criado por ele.

(A) Libido; julgamento; extroverso; introverso.


(B) Razo; egocentrismo; autonomia; projeo.
(C) Percepo; ateno; pensamento; previso.
(D) Projeo; introjeo; afeto; coordenao.

De acordo com o enunciado, assinale a alternativa correta


desses trs aspectos da funo ambiental.

(E) Considerao; memria; afeto; libido.

(A) A aprovao; o desagrado; o reforo negativo.

21. A falta ou perturbao da sade sentida e sofrida de maneira pessoal, varivel de acordo com as vivncias anteriores
prprias do indivduo, de enfermidade na famlia ou no grupo de relaes. As experincias individuais do adoecer pem
em jogo mecanismos inconscientes de adaptao e defesa.
Os principais mecanismos de defesa que ocorrem frente ao
adoecer so:

(B) O reagir; o desagradar; o frustrar.


(C) O prazer; o desprazer; o corrigir.
(D) O reforo positivo; o reforo negativo; o condicionamento do comportamento.
(E) O segurar; o manejar; a apresentao de objetos.

(A) regresso; negao; racionalizao.


(B) ansiedade; converso; castrao.
(C) medo; fantasia; vivncia afetiva.

18. Uma contribuio importante no desenvolvimento emocional


individual so as ideias que abarcam os primrdios da vida
imaginativa e da experincia cultural. Entre outras contribuies, se encontram aquelas que chamam a ateno para o fato
de que, entre o beb e a me, aparece o brincar criativo, que
se funda na confiana experimentada, por um perodo suficientemente longo. Se a criana utilizar essa rea para iniciar
seu relacionamento com o mundo, por meio do brincar e das
brincadeiras compartilhadas, ento a vida cultural e a fruio
de sua herana cultural podero estar ao seu alcance.

(D) identificao; amnsia; recusa.


(E) cooperao; impulsividade; culpa.
22. Na teoria psicanaltica, dois estados so aproximados: o
luto e a melancolia. Suas circunstncias deflagradoras so
semelhantes, isto , a perda. Os quadros clnicos tambm se
assemelham quando comparamos o afeto normal do luto e a
melancolia, entretanto, eles apresentam diferenas significativas. Uma caracterstica importante que, diferentemente
do luto, a melancolia se faz acompanhar

De acordo com esse pensamento, essa rea da experincia


denominada

(A) da reao de tristeza frente perda do objeto de amor.

(A) rea de transmutao pessoal.

(B) da perda temporria de interesse pelo mundo exterior.

(B) realidade externa.

(C) da reao de tristeza, em que a pessoa descreve o mundo


externo como pobre e sem valor.

(C) mundo real.

(D) de um desprendimento progressivo do objeto perdido e


transformaes psquicas que podem permitir o apego a
novos objetos de amor.

(D) espao potencial.


(E) realizao alucinatria de desejo.

(E) de uma perda aparentemente injustificada da autoestima,


a pessoa se descreve como pobre e sem valor.
PMSP1302/044-EspSade-Psiclogo

23. Nas internaes de crianas, muitas vezes ocorrem prejuzos


graves para a sade delas, devido separao (sbita ou por
perodo prolongado) da me, da famlia e do ambiente domstico. Dentre esses prejuzos graves esto as

27. De acordo com estudiosos da psicoterapia breve, a primeira


entrevista com o paciente:
(A) desempenha um papel crucial, onde o terapeuta, ao
promover uma ressonncia emptica, pode ter uma influncia decisiva na continuidade ou no abandono do
tratamento, assim como na eficcia que o processo teraputico possa vir a alcanar.

(A) epilepsias generalizadas.


(B) sndromes de Korsakov.
(C) sndromes de Down.

(B) eficaz na medida em que o terapeuta deve fazer interpretaes precoces que operem na etiologia da neurose
infantil e nos fenmenos ligados situao edpica.

(D) depresses anaclticas.


(E) vivncias motoras.

(C) responsvel pelo desempenho do terapeuta com o paciente no sentido de criar uma aliana onde exista a supremacia do terapeuta, como sujeito do saber, para pr
em marcha o processo teraputico.

24. O termo Transtorno do Espectro Autista (TEA) engloba:


(A) Autismo, Sndrome de Asperger, Transtorno Global do
Desenvolvimento Sem Outra Especificao.

(D) o terapeuta deve apenas obter a histria clnica do paciente, fixar um contrato, isto , a entrevista deve ser
fonte de informao, sem a necessidade do estabelecimento de uma aliana teraputica.

(B) Afasias, Transtornos da Linguagem, Psicose Infantil.


(C) Sndrome de Down, Autismo propriamente dito, Afasias.

(E) deve ser considerada uma anamnese aprofundada apenas


dos sintomas relacionados queixa bsica da consulta.

(D) Depresso Reativa, Sndrome Narcsica, Transtorno do


Desenvolvimento Intelectual.
(E) Autismo Infantil de Kanner, Transtornos Psicossomticos, Anorexias.

28. Uma das aes teraputicas conhecidas o Psicodrama. No


Psicodrama, o conceito usado para expressar a capacidade
do indivduo de dar respostas adequadas a situaes novas
ou respostas novas e adequadas a situaes antigas a(o)

25. A criana no seu desenvolvimento passa por vrios processos de socializao. Ela submetida a fatores socialmente
determinados por um grupo, capazes de influir na sua conduta. Esses processos habilitam a criana a se tornar um ser
social, embora observa-se que distrbios da socializao podem ocorrer. Dois distrbios da socializao da criana mais
frequentes so:

(A) role-playing.
(B) ncleo do eu.
(C) espontaneidade.
(D) conserva cultural.

(A) hiperatividade; afasia.


(E) matriz de identidade.
(B) timidez; agressividade.
(C) apatia; gagueira.
29. O termo aliana teraputica diz respeito a uma relao de
trabalho que se estabelece entre paciente e psicoterapeuta
em prol do processo teraputico. Tal relao se assenta

(D) rejeio; dislexia.


(E) exibicionismo; sincinesias.

(A) nas relaes onde prevalece a aliana no emptica entre


psicoterapeuta e os familiares do paciente.

26. No processo psicoteraputico, as funes egoicas do indivduo desempenham um papel importante, de acordo com alguns autores. Assinale a alternativa com algumas qualidades
dessas funes egoicas.

(B) no estabelecimento da recproca fascinao narcisista


que se estabelece na transferncia positiva.
(C) no conluio transferencial-contratransferencial que ocorre
na transferncia negativa.

(A) Intolerncia frustrao; sentimento de culpa; homeostase.

(D) nas funes autnomas do ego do paciente, mas remete


s suas relaes objetais infantis.

(B) Integrao; racionalizao; desajuste social.


(C) Diferenciao; restrio social; adaptao.

(E) no julgamento e nas crticas precoces do terapeuta que


favorecem a dissociao regressiva do ego.

(D) Prazer; dependncia; imaginao.


(E) Autonomia; fora; plasticidade.

PMSP1302/044-EspSade-Psiclogo

30. A qualidade da aliana teraputica com pacientes borderline


afetada pela manifestao da tendncia ciso dos objetos internos que esses pacientes apresentam. Na perspectiva
psicanaltica, o modelo conflitual se ope ao modelo deficitrio, quanto ao manejo clnico. Porm, pode-se identificar
em ambos um ponto de convergncia: os dois modelos reconhecem que o principal desafio tcnico a ser superado pelo
terapeuta com pacientes borderline :

33. Do ponto de vista psicanaltico, correto afirmar que os


mecanismos primitivos da mente

(A) o terapeuta poder provocar o acting-out e fomentar as


defesas do paciente.

(C) so mecanismos que surgem durante o primeiro ano de


vida do beb e deixam totalmente de existir e de se expressar na conduta humana.

(A) referem-se aos movimentos psquicos que so inerentes


ao incio da vida psquica e que aparecem reeditados
com grande intensidade durante a adolescncia.
(B) surgem pela primeira vez no perodo da adolescncia,
devido busca de identidade do jovem.

(B) inibir as manifestaes hostis do paciente em relao


ao terapeuta, procurando uma abordagem de aconselhamento.

(D) so mecanismos que se referem, apenas, queles processos patolgicos caractersticos dos assim chamados
fenmenos autistas.

(C) o terapeuta ser capaz de persuadir os pacientes.

(E) referem-se aos movimentos psquicos do perodo de latncia, quando a personalidade da criana j se encontra
mais integrada.

(D) o vnculo ertico que esses pacientes frequentemente


apresentam em relao ao terapeuta.
(E) o desenvolvimento de respostas adequadas s perturbadoras emoes desencadeadas a partir da interao com
esses pacientes.

34. No seu conceito mais estrito, pode-se dizer que Reduo de


Danos (RD) uma
(A) poltica de sade que considera as drogas lcitas e ilcitas algo que deve ser condenado.

31. Os grupos operativos caracterizam-se por


(A) serem formados por grupos de pessoas que se renem
para discutir e trabalhar numa tarefa determinada, e no
tm um objetivo psicoterpico direto.

(B) portaria do Ministrio da Sade para reduzir o risco de


danos associados a certos comportamentos de adio a
drogas com a considervel reduo desses comportamentos.

(B) agruparem pessoas com o objetivo primeiro de desenvolver uma psicoterapia de orientao psicodinmica.

(C) poltica de sade feita por meio de leis e decretos que


foram pensados pelos mdicos e pesquisadores da sade para erradicar os prejuzos do uso de drogas pautada
na ateno ao indivduo.

(C) agruparem pessoas que buscam alvio para suas angstias e conflitos interpessoal.
(D) anlise das configuraes vinculares tendo um olhar
para o plano intrasubjetivo (mundo inconsciente).

(D) poltica de sade que trabalha com o critrio de que o


sucesso de uma interveno fazer com que o usurio
deixe de consumir a droga completamente.

(E) serem grupos fechados, no diretivos, que visam o autoconhecimento em que o conhecimento dos comportamentos e aes de um dos membros influencia o comportamento dos outros.

(E) poltica de sade que se prope a reduzir os prejuzos


de ordem biolgica, social e econmica do uso de drogas pautada no respeito do indivduo e no seu direito de
consumir a droga.

32. A nfase na comunicao livre entre equipe e grupo de pacientes e nas atitudes permissivas que encorajam a expresso de sentimentos so possveis numa organizao do tipo

35. Para todas as drogas fumadas, valem os princpios gerais de


Reduo de Danos (RD). Em se tratando do crack, vrias
estratgias de RD surgiram nos ltimos anos. Uma delas foi
o uso de

(A) religiosa e autoritria.


(B) democrtica e igualitria.

(A) inalantes especiais com filtros adaptados para erradicar


a inalao da droga, e o uso de pastilhas de placebo.

(C) anrquica e anacrnica.


(D) retrgrada e conservadora.

(B) internao compulsria.


(E) hierrquica e tradicional.
(C) cachimbo e a substituio do crack por drogas que causem comparativamente menor dano, como o mesclado,
o freebase e a maconha.
(D) agentes de sade que acompanham e explicam os efeitos nocivos da ingesto das drogas fumadas com o objetivo de punir para coibir o consumo do usurio.
(E) cachimbo coletivo para a preveno de contaminao e
substituio do crack por placebo.

PMSP1302/044-EspSade-Psiclogo

41. Na agitao manaca, o paciente apresenta um humor

36. Uma das categorias importantes no trabalho do campo da


sade a noo de territrio. Territrio o(a)

(A) aptico.

(A) estabelecimento de espao das redes de apoio.

(B) dissimulado.

(B) espao geogrfico do sujeito.

(C) deprimido.

(C) delimitao da rede de servios interligados.

(D) eufrico.

(D) lugar psicossocial do sujeito.

(E) distrfico.

(E) espao regional do sujeito.


42. A descoberta de uma substncia psicoativa nos anos 40
e com larga utilizao nos anos 50, que revolucionou a
Psiquiatria, auxiliando a controlar sintomas como alucinao, agitao psicomotora e delrios foi a(o)

37. As drogas depressoras do SNC (Sistema Nervosos Central) so


as(os)
(A) metiforminas.
(B) anticolinrgicos.

(A) anfetamina.

(C) LSD.

(B) carbonato de ltio.

(D) anfetaminas.

(C) clorpromazina.

(E) barbitricos.

(D) fluoxetina.
(E) efedrina.

38. A adio a drogas acontece apenas quando


43. As Comunidades Teraputicas resultam de processos de
reformas institucionais e consolidaram a(o)

(A) a lembrana do prazer do uso da droga por si faz o indivduo tornar-se viciado.

(A) hierarquizao tradicional dos papis sociais.

(B) o experimentar uma droga passa a ser um hbito e se


transforma em um padro de consumo compulsivo e
destrutivo.

(B) consolidao da Psiquiatria Psicofarmacolgica na


prioridade do uso de medicamentos no tratamento do
enfermo mental.

(C) um padro aleatrio da falta da atividade do prazer


instalado.

(C) organizao das instituies teraputicas com carter


educativo e centralizado na atuao dos psiquiatras.

(D) o uso irregular de uma droga passa a ser consumida ocasionalmente.

(D) tratamento institucional da dependncia ao lcool e


drogas em fazendas com doutrinao religiosa.

(E) um estado aversivo provoca um padro de comportamento impulsivo cuja ao postergada.

(E) promoo da democratizao e horizontalidade das


relaes e papis sociais.

39. Um conjunto de fatores psicolgicos conscientes ou inconscientes, de ordem fisiolgica, intelectual ou afetiva os quais
agem entre si e determinam a conduta de um indivduo, no
sentido de uma condio que energiza o comportamento e o
orienta denominado

44. De acordo com a teoria psicanaltica, a neurose o resultado


de um conflito entre o
(A) Superego e o mundo externo.

(A) motivao.

(B) Ego ideal e os mecanismos de defesa.

(B) esteretipo.

(C) Id e a realidade externa.

(C) ausncia de iniciativa.

(D) Ego e o Id.

(D) estase.

(E) Ego e o mundo externo.

(E) apatia.
45. Um projeto de reforma eficaz no cuidado com pacientes
crnicos, principalmente aos desprovidos de vnculos sociais e familiares slidos, deve contar com uma ampla rede
de dispositivos

40. Assinale a alternativa que apresenta corretamente alguns dos


sintomas da abstinncia de grau leve e moderado do alcoolismo.
(A) Mistela, confuso, tremores, ansiedade.

(A) de enfermagem.

(B) Insnia, febre, mitacismo, confuso.

(B) escolares.

(C) Insnia, confuso, tremores, nusea-vmito.

(C) hospitalares.

(D) Diplopia, tremores, delrios, higiologia.

(D) residenciais.

(E) Iamologia, confuso, nusea, agitao.

(E) manicomiais.
9

PMSP1302/044-EspSade-Psiclogo

50. Em 6 de abril de 2001 entrou em vigor a Lei n. 10.216 que


dispe sobre a proteo e os direitos das pessoas portadoras
de transtornos mentais e redireciona o modelo assistencial
em sade mental. Essa lei dispe sobre os direitos da pessoa
portadora de doena mental e regulamenta trs tipos de internao psiquitrica. So elas:

46. Um dos objetivos da clnica ampliada


(A) criar um contexto favorvel para que se encontre o melhor especialista para o problema.
(B) buscar integrar vrias abordagens para possibilitar um
manejo eficaz da complexidade do trabalho em sade.

(A) internao teraputica, internao diria e internao


assistencial.

(C) ampliar a compreenso dos manejos eficazes na manifestao da doena mental a partir do diagnstico psiquitrico.

(B) internao assistencialista, internao psiquitrica e


internao ocupacional.

(D) colocar em discusso a necessidade de restrio aos


temas relativos doena.

(C) internao voluntria, internao involuntria e internao compulsria.

(E) buscar uma abordagem que privilegie um contedo


especfico na manifestao da doena.

(D) internao presencial, internao hospitalar e internao institucional.

47. As psicoses da infncia e o autismo infantil so condies


clnicas para as quais no se conhece uma causa isolada que
possa ser responsabilizada por sua ocorrncia. Apesar disso,
a experincia permite indicar algumas situaes que favorecem as possibilidades de melhora, principalmente quando o
atendimento tem incio o mais cedo possvel, observando-se
algumas condies. Uma dessas condies :

(E) internao em estabelecimento de sade mental, internao domiciliar e internao em centros de assistncia
diria.

(A) o tratamento tem maior probabilidade de sucesso quando


a criana ou o adolescente mantido em seu ambiente
familiar.
(B) a criana ou o adolescente deve ser tratado separadamente, pois observa-se uma melhora nas suas condies
psquicas.
(C) a atividade de incluso social e escolar no deve ser
considerada parte integrante dos processos teraputicos.
(D) as famlias devem ficar parte do tratamento.
(E) somente a remisso total dos problemas significa uma
melhora importante nas condies de vida para a criana
ou o adolescente e sua famlia.
48. As prticas profissionais nos servios de reabilitao psicossocial so orientadas pelos princpios, objetivos e pressupostos da(do)
(A) Comunidade Teraputica.
(B) Psicopatologia Psicanaltica.
(C) Psiquiatria Biolgica.
(D) Mtodo Psicanaltico Individual.
(E) Reforma Psiquitrica.
49. Alguns representantes do modelo psicodinmico associam
a insuficincia representacional de certos pacientes psicossomticos a
(A) conflitos das funes egoicas.
(B) um distrbio afetivo descrito originalmente como a
desafetao.
(C) uma exacerbao da atividade imaginativa.
(D) um uso excessivo do processo simblico.
(E) um distrbio da agressividade.
PMSP1302/044-EspSade-Psiclogo



PROVA: PREFEITURA DE SO PAULO


ANO: 2014
CARGO: Psiclogo
BANCA ORGANIZADORA: VUNESP

GABARITO OFICIAL
# conhecimentos especficos de Psicologia

16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33

B
E
D
D
C
A
E
D
A
B
E
A
C
D
E
A
B
A

34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50

E
C
D
E
B
A
C
D
C
E
D
D
B
A
E
B
C

Coletnea de Provas | Concursos de Psicologia