Você está na página 1de 316

ISSN 1806-8944

Cadernos
de Finanas
Pblicas
Nmero 12

Dezembro 2012

A constitucionalidade das contribuies previdencirias do setor rural


Mrio Pereira de Pinho Filho

Dinmica fronteiria no arco norte brasileiro no contexto das reas


de Livre Comrcio
Eloisa Maieski Antunes; Eli Martins Senhoras; Rosaldo Trevisan

Dinmica transfronteiria no arco sul brasileiro no contexto do Regime


de Tributao Unificada
Eloisa Maieski Antunes; Eli Martins Senhoras; Rosaldo Trevisan

Dissoluo irregular e responsabilidade tributria dos gestores de


sociedades empresrias
Alisson Fabiano Estrela Bonfim

Reflexes sobre o gasto pblico e o crescimento econmico no Brasil


e no mundo: contribuies baseadas na reviso integrativa
Valdocu de Queiroz e Johan Hendrik Poker Junior

O aproveitamento das economias de escala pelo Sistema de


Registro de Preos
Felipe Ribeiro Alves Morais

Planejamento tributrio e a norma cogente no tributria


Igaro Jung Martins

Polticas keynesianas anticclicas no Brasil: estabilizao


e desenvolvimento econmico
Danielle Sandi Pinheiro; Carlos Frederico Rubino P. de Alverga; Juliana Sandi Pinheiro

Simplificao e elaborao da legislao tributria infralegal:


notas sobre o acesso ao direito vigente e a gesto da elaborao
legislativa pelo Executivo
Fabiana de Menezes Soares

Transao tributria e interesse pblico


Daniela Figueiredo Oliveira Frana Ferreira

Transparncia na aplicao de recursos em obras pblicas


Carlos Rafael Menin Simes e Romilson Rodrigues Pereira

Ministrio da Fazenda
Escola de Administrao Fazendria Esaf

Cadernos de
Finanas Pblicas
Nmero 12

Cad. Fin. Pbl. Braslia n. 12

Dezembro 2012

ISSN 1806-8944
p. 5-309
dez. 2012

As matrias desta Revista podero ser reproduzidas, total ou parcialmente,


desde que citada a fonte.

GOVERNO FEDERAL
MINISTRIO DA FAZENDA
ESCOLA DE ADMINISTRAO FAZENDRIA

Reviso de texto
Fatima Rejane de Meneses
Yana Maria Palankof
Editorao eletrnica e capa
Luis Henrique Alcntara Tabosa de Castro

%CFGTPQUFGPCPCURDNKECU 'UEQNCFG#FOKPKUVTCQ
Fazendria. n. 12 (dez. 2012). Braslia : Esaf, 2000Anual
ISSN 1806-8944
1. FINANAS PBLICAS Peridicos. I. Escola de
#FOKPKUVTCQ(C\GPFTKC
CDD 336.005

Os conceitos e opinies emitidos pelos autores no refletem necessariamente


o ponto de vista da Escola de Administrao Fazendria Esaf.
ESCOLA DE ADMINISTRAO FAZENDRIA (Esaf)
Rodovia DF-001 km 27,4 CEP: 71.686-900
Fone: (61) 3412-6058/3412-6273
Fax.: (61) 3412-6293
Home page: http://www.esaf.fazenda.gov.br

SUMRIO

A constitucionalidade das contribuies previdencirias do setor rural ... 5


Mrio Pereira de Pinho Filho

Dinmica fronteiria no arco norte brasileiro no contexto


das reas de Livre Comrcio ...................................................................... 39
Eloisa Maieski Antunes
Eli Martins Senhoras
Rosaldo Trevisan

Dinmica transfronteiria no arco sul brasileiro no contexto


do Regime de Tributao Unificada .......................................................... 65
Eloisa Maieski Antunes
Eli Martins Senhoras
Rosaldo Trevisan

Dissoluo irregular e responsabilidade tributria dos gestores


de sociedades empresrias............................................................................ 87

#NKUUQP(CDKCPQ'UVTGNC$QPO


5

Reflexes sobre o gasto pblico e o crescimento econmico no Brasil


e no mundo: contribuies baseadas na reviso integrativa................... 113
Valdocu de Queiroz
Johan Hendrik Poker Junior

O aproveitamento das economias de escala pelo Sistema de


Registro de Preos ..................................................................................... 137
Felipe Ribeiro Alves Morais

Planejamento tributrio e a norma cogente no tributria ................... 163


Igaro Jung Martins

Polticas keynesianas anticclicas no Brasil: estabilizao e


desenvolvimento econmico..................................................................... 197
Danielle Sandi Pinheiro
Carlos Frederico Rubino P. de Alverga
Juliana Sandi Pinheiro

Simplificao e elaborao da legislao tributria infralegal:


notas sobre o acesso ao direito vigente e a gesto da elaborao
legislativa pelo Executivo..................................................................... 219
Fabiana de Menezes Soares

10 Transao tributria e interesse pblico............................................... 255


 
&CPKGNC(KIWGKTGFQ1NKXGKTC(TCPC(GTTGKTC
11 Transparncia na aplicao de recursos em obras pblicas ................... 283
Carlos Rafael Menin Simes
Romilson Rodrigues Pereira

A constitucionalidade das contribuies


previdencirias do setor rural
Mrio Pereira de Pinho Filho

Abstract

Auditor-Fiscal da Receita Federal do Brasil


Licenciatura plena em Matemtica pelo Uniceub e
GURGEKCNK\CQGO&KTGKVQ6TKDWVTKQRGNC
'UEQNCFG#FOKPKUVTCQ(C\GPFTKC
'UCH

This present work contains relevant study of social


security tax constitutionality of the rural sector.
Differently what occurs in most of the majority
urban enterprises, in which social security tax
incides on the remuneration of the workers, in the
rural sector was adopted the gross revenues from
the commercialization production as the basis of
incidence of the tax of individuals employers, legal
entities and agribusiness. Such tax has been the
object of questions as to its constitutionality. In
spite of that, various sectors of the economy have
been adopted the recipe as the calculation basis for
social security tax since 2011, by tax policy of the
federal government known as the releasing taxes of
the payroll. For this reason, it is necessary to check
out the validity of social security tax for the rural
sector, at the constitutional order, to assess the risks
arising from the application of systematic established
for rural area to those other sectors. To achieve this
objective, we will present the main aspects of the tax
to the social security system, the social security tax of
companies in general, and of those incidents on other
bases, not the payroll, as well as the main aspects of
the tax of the insured of the General Scheme of Social
Security. It analyzes the arguments that substantiate
the discussions about the unconstitutionality of the
rural sector tax, and it is concluded that, with the
edition of Constitutional Amendment n. 20 of 1998
and n. 42 of 2003, these extant overcome. Using the
criteria proposed by doctrine, concludes that the tax
of the rural sector not reproach the constitutional
principle of isonomy tax.

Resumo
Este trabalho contm estudo pertinente constitucionalidade das contribuies previdencirias
do setor rural. Diferentemente do que ocorre
com relao maioria das empresas urbanas,
em que as contribuies previdencirias incidem
sobre a remunerao dos trabalhadores, no meio
rural adotou-se a receita bruta proveniente
da comercializao da produo como base de
incidncia da contribuio de empregadores
pessoas fsicas e jurdicas e agroindstrias. Tais
contribuies tm sido objeto de questionamentos
quanto sua constitucionalidade. A despeito disso,
para diversos setores da economia, a partir de 2011
tambm se tem adotado a receita como base de
clculo das contribuies previdencirias por meio
da poltica tributria do governo federal conhecida
como desonerao da folha de pagamento. Por
essa razo, faz-se necessrio verificar a validade das
contribuies previdencirias do setor rural luz da
ordem constitucional vigente para se avaliar os riscos
decorrentes da aplicao da sistemtica estabelecida
para a rea rural a esses outros setores. Para se atingir
esse objetivo, apresentam-se os principais aspectos das
contribuies para o sistema de seguridade social, das
contribuies previdencirias das empresas em geral
e daquelas incidentes sobre outras bases que no a
folha de salrios, bem como os principais aspectos
das contribuies dos segurados do Regime Geral
de Previdncia Social. Analisam-se os argumentos
que fundamentaram as discusses acerca da
inconstitucionalidade das contribuies do setor
rural e conclui-se que, com a edio das Emendas
Constitucionais n. 20, de 1998, e n. 42, de 2003, estes
restaram superados. Utilizando critrios propostos
pela doutrina, conclui-se que as contribuies do
setor rural no afrontam o princpio constitucional
da isonomia tributria.

Palavras-chave
Contribuio previdenciria. Rural. Isonomia.
Constitucionalidade.

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

Keywords
Social security tax. Rural sector. Isonomy.
Constitutionality.

1 INTRODUO
# KPUVKVWKQ FCU EQPVTKDWKGU RTGXK
dencirias do setor rural, incidentes
UQDTGCTGEGKVCFCEQOGTEKCNK\CQFGUGWU
RTQFWVQUFGPQOKPCFCUEQPVTKDWKGU
substitutivas, tem suscitado inmeras
controvrsias no que se refere sua
constitucionalidade.
5

Mrio Pereira de Pinho Filho

#SWGNGU SWG FGHGPFGO C XCNKFCFG FGUUC UKUVGOVKEC FG VTKDWVCQ CTIWOGPVCO


SWGJKUVQTKECOGPVGQVTKDWVQVGOKPEKFKFQUQDTGQTGUWNVCFQFCEQOGTEKCNK\CQ
dos produtos agrcolas, sendo esse um mecanismo que viabiliza o adimplemento
FCU EQPVTKDWKGU PGUUG UGVQT 1U SWG CFXQICO C KPEQPUVKVWEKQPCNKFCFG FGUUCU
EQPVTKDWKGUCNGICOSWG
a) elas foram criadas com base em fonte de custeio (receita) no prevista no art. 195
FC%QPUVKVWKQ(GFGTCNFGUGOCQDUGTXPEKCFQUGWho, o qual determina
UWCKPUVKVWKQRQTNGKEQORNGOGPVCT
b) constituem bis in idemEQOC%QPVTKDWKQRCTCQ(KPCPEKCOGPVQFC5GIWTKFCFG
5QEKCN
%QPU UGOSWGJCLCCWVQTK\CQEQPUVKVWEKQPCNGZRTGUUCRCTCVCN
E QURTQFWVQTGUTWTCKUGUVQUWDOGVKFQUCWOCVTKDWVCQOCKUITCXQUCUGEQORCTCFQU
CQUFGOCKUEQPVTKDWKPVGURQKUUQQDTKICFQUCUCVKUHC\GTCEQPVTKDWKQUQDTGC
HQNJCFGUCNTKQUC%QPUGCEQPVTKDWKQKPEKFGPVGUQDTGCEQOGTEKCNK\CQFC
RTQFWQTWTCNPQCNECPCPFQGUVCUNVKOCUCUFGOCKUGORTGUCUQWGSWKRCTCFQU
restando, desse modo, malferido o princpio da igualdade tributria previsto no
art. 150, II, da CF/1988.
#XGTKECQFCEQPUVKVWEKQPCNKFCFGFCUEQPVTKDWKGURTGXKFGPEKTKCUFQUGVQTTWTCN
sobretudo aps o advento das Emendas Constitucionais n. 20, de 1998, e n. 42, de
QDLGVQFGUVGGUVWFQCRTGUGPVCUGEQOQQRQFGGZVTGOCTGNGXPEKCRQKU
FKCPVGFGWOEGPTKQGOSWGUGRTQOQXGTGKVGTCFCOGPVGCFGUQPGTCQFCHQNJC
FGRCICOGPVQHC\UGPGEGUUTKQKPXGUVKICTUGCFGURGKVQFCUCNVGTCGURTQOQXKFCU
PCQTFGOEQPUVKVWEKQPCNCUWDUVKVWKQFCUEQPVTKDWKGUUQDTGCTGOWPGTCQRQT
EQPVTKDWKGUKPEKFGPVGUUQDTGCTGEGKVCQWQHCVWTCOGPVQCHTQPVCC%QPUVKVWKQ
(GFGTCNKPXKCDKNK\CPFQCQRQRQTGUUCUKUVGOVKECFGVTKDWVCQ
KORQTVCPVGOGPEKQPCTSWGC.GKPFGFGFG\GODTQFGGCNVGTCGU
RQUVGTKQTGUCQGUVCDGNGEGTGOSWGCEQPVTKDWKQRTGXKFGPEKTKCFGFKXGTUQUUGVQTGU
da economia incidir, at 31 de dezembro de 2014, sobre o valor da receita bruta
FGUUCUGORTGUCUHC\GOWOXGTFCFGKTQGPUCKQUQDTGCFGUQPGTCQFCHQNJCFGUCNTKQU
4GUUCNVGUG SWG CU EQPVTKDWKGU RTGXKFGPEKTKCU FGUVKPCFCU CQ 4GIKOG )GTCN FG
2TGXKFPEKC5QEKCNVOEQOQPCNKFCFGCICTCPVKCFGTGEWTUQUCQVTCDCNJCFQTGC
seus dependentes quando, diante da ausncia de capacidade laboral, concede a estes
DGPGHEKQUPGEGUUTKQUUWCOCPWVGPQ
A sustentabilidade desse regime previdencirio, ou seja, a capacidade de
CWVQPCPEKCOGPVQ GXKVCPFQUG C FGRGPFPEKC FG TGEWTUQU GUVCVCKU  EQPFKQ
necessria para se impedir o comprometimento do sistema securitrio.
#UUKO LWUVKECUG C QRQ RGNQ VGOC GO TC\Q FC TGNGXPEKC UQEKCN FQ 4GIKOG
Geral de Previdncia e tendo em vista, por um lado, a atmosfera poltica propcia
FGUQPGTCQFCHQNJCFGRCICOGPVQGRQTQWVTQVQFCUCURQNOKECULWTKURTWFGPEKCKU
e doutrinrias que envolvem a matria.
6

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

2 CONTRIBUIES PARA A SEGURIDADE SOCIAL


#UGIWTKFCFGUQEKCNEQORTGGPFGCGUTGNCEKQPCFCUUTGCUFGUCFGRTGXKFPEKC
G CUUKUVPEKC UQEKCN 0C GUVGKTC FQU CTVU   G  FC %QPUVKVWKQ G GO
consonncia com a doutrina de Ibrahim (2009), tem-se que a obrigatoriedade de
CVWCQGUVCVCNEQOQHQTOCFGICTCPVKTQCEGUUQTGFGRTQVGVKXCTGRTGUGPVCFCRGNC
seguridade social deve, de acordo com a rea a que esteja relacionada, observar os
seguintes requisitos:
a) a sadeFKTGKVQFGVQFQUGFGXGTFQ'UVCFQKPFGRGPFGPVGOGPVGFGEQPVTKDWKQ
b) a assistncia social ser prestada a quem dela necessitar, s pessoas que no possuem
EQPFKGUFGOCPWVGPQRTRTKCKPFGRGPFGPVGOGPVGFGEQPVTKDWKQFKTGVC
FQDGPGEKTKQVGPFQEQOQTGSWKUKVQCPGEGUUKFCFGFQCUUKUVKFQG
c) a previdncia social EQPIWTC UGIWTQ EQNGVKXQ EQPVTKDWVKXQ EQORWNUTKQ FG
QTICPK\CQ GUVCVCN G FGXG QDUGTXCT ETKVTKQU SWG RTGUGTXGO UGW GSWKNDTKQ
PCPEGKTQGCVWCTKCN6GORQTQDLGVQQCORCTQFGUGWUDGPGEKTKQUEQPVTCQU
EJCOCFQUTKUEQUUQEKCKU
FQGPCKPXCNKFG\OQTVGKFCFGCXCPCFCOCVGTPKFCFG
desemprego involuntrio ou recluso).
2CTCHC\GTHTGPVGUFGURGUCUFGEQTTGPVGUFCUCGUGORTGGPFKFCURGNQUGPVGUGUVCVCKU
FGUVKPCFCUCCUUGIWTCTQHWPEKQPCOGPVQFQUKUVGOCFGRTQVGQUQEKCNCUGIWTKFCFG
UQEKCNVGOEQOQHQPVGFGPCPEKCOGPVQCNOFGTGEWTUQUQTCOGPVTKQUFC7PKQ
FQUGUVCFQUFQ&KUVTKVQ(GFGTCNGFQUOWPKERKQUQRTQFWVQFCCTTGECFCQFCU
EQPVTKDWKGU UQEKCKU FG GORTGICFQTGU GORTGUCU G GPVKFCFGU C GNCU GSWKRCTCFCU
EWLCUDCUGUKORQPXGKUSWGGUVQRTGXKUVCUPQCTV%QPUVKVWKQUQ
a) a folha de salrios e demais rendimentos do trabalho pagos ou creditados, a qualSWGTVVWNQRGUUQCHUKECSWGRTGUVGUGTXKQOGUOQUGOXPEWNQGORTGICVEKQ
D CTGEGKVCQWHCVWTCOGPVQ
E QNWETQ
F CTGOWPGTCQFQUVTCDCNJCFQTGU
G QTGUWNVCFQFCEQOGTEKCNK\CQFCRTQFWQTWTCNFGRGSWGPQUCITKEWNVQTGU
H CTGEGKVCFQUEQPEWTUQUFGRTQIPUVKEQUG
I QXCNQTFGRTQFWVQUGUGTXKQUKORQTVCFQUFQGZVGTKQT
#NOFCUHQPVGUCPVGTKQTOGPVGTGHGTKFCUC%QPUVKVWKQRTGXQWVTCUHQPVGUFG
EWUVGKQPQho do art. 195, que se reporta ao inciso I do art. 154 (MARTINS,
 #EQODKPCQFGUUGUFKURQUKVKXQURQUUKDKNKVCEQPENWKTSWGCKPUVKVWKQFG
EQPVTKDWKGU RCTC C OCPWVGPQ QW C GZRCPUQ FC UGIWTKFCFG UQEKCN EQO DCUG
nessa competncia residual, necessita de lei complementar, e seu fato gerador e
DCUGFGENEWNQFGXGOUGTFKXGTUQUFQUFCUEQPVTKDWKGUUQEKCKUFKUETKOKPCFCUPC
%QPUVKVWKQ
Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

Mrio Pereira de Pinho Filho

3 CONTRIBUIES PARA O REGIME GERAL


DE PREVIDNCIA SOCIAL
'UREKG FQ IPGTQ EQPVTKDWKQ RCTC C UGIWTKFCFG UQEKCN CU EQPVTKDWKGU
RTGXKFGPEKTKCURTGXKUVCUPCCNPGCCFQUKPEKUQU+G++FQCTVFC%QPUVKVWKQ
UQCUUKOFGPQOKPCFCUGOTC\QFCFGUVKPCQGZENWUKXCFQUUGWUTGEWTUQURCTCC
TGCNK\CQFQRCICOGPVQFGDGPGHEKQUFQ4GIKOG)GTCNFG2TGXKFPEKC5QEKCN1
 KORQTVCPVG TGIKUVTCT SWG CNO FCU EQPVTKDWKGU KPEKFGPVGU UQDTG C HQNJC FG
UCNTKQUJCKPFCFKXGTUCUEQPVTKDWKGUFGUVKPCFCUCQEWUVGKQFCRTGXKFPEKCUQEKCN
institudas sobre outras bases econmicas.
3.1 FATO GERADOR
%QOQHQTOCFGRQUUKDKNKVCTCEQORCTCQGPVTGCUEQPVTKDWKGURTGXKFGPEKTKCU
sobre a folha de salrios e as incidentes sobre bases diversas, faz-se necessrio analisar
os aspectos relacionados ao fato gerador2FGUUCUEQPVTKDWKGU
%CTXCNJQ
R HCEKNKVQWUQDTGOCPGKTCGUUCVCTGHCEQOCCRTGUGPVCQ
da estrutura lgica da regra matriz de incidncia tributria, cujo modelo genrico
FGHQTOWNCQLWTFKEQFGUETKVKXCCRTGUGPVC
C PCJKRVGUGQUETKVTKQUOCVGTKCNGURCEKCNGVGORQTCNG
b) na consequncia, os critrios pessoal e quantitativo.
De forma sinttica e a ttulo meramente ilustrativo, a despeito de aprofundados
estudos elaborados pela doutrina, os critrios do fato gerador do tributo podem
UGTFGPKFQUFCUGIWKPVGHQTOC
C ETKVTKQOCVGTKCNCQQWUKVWCQ
FGUETKVCRGNQNGIKUNCFQT SWGUGKFGPVKECEQOQ
PENGQQWOCVGTKCNKFCFGFQHCVQIGTCFQT
D ETKVTKQ GURCEKCN GUV TGNCEKQPCFQ CQ CNECPEG IGQITEQ FC PQTOC VTKDWVTKC
no se confundindo com seu campo de validade, apesar de serem frequentes as
EQKPEKFPEKCUPGUUGUGPVKFQ
E ETKVTKQVGORQTCNTGHGTGUGUKPFKECGUEQPVKFCUPCJKRVGUGSWGPQUQHGTGEGO
elementos para saber, com exatido, em que preciso instante acontece o fato
descrito, passando a existir o liame jurdico que amarra devedor e credor, em
HWPQFGWOQDLGVQQRCICOGPVQFGEGTVCRTGUVCQRGEWPKTKC
%#48#.*1
R 
 %QPHQTOGCTVFC%QPUVKVWKQ
2 Apesar das crticas doutrinrias expresso fato gerador, concordamos com a opinio de Amaro no sentido
FGPQJCXGTKPEQPXGPKGPVGUTKQPQGORTGIQCODKXCNGPVGFGUUCGZRTGUUQRCTCFGUKIPCTVCPVQCFGUETKQ
hipottica quanto o acontecimento concreto que lhe corresponda (AMARO, 2006, p. 262).

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

d) critrio pessoal: integra o consequente da regra matriz de incidncia tributria e


RQUUKDKNKVCCKFGPVKECQFCURGUUQCUXKPEWNCFCUTGNCQLWTFKEC
UWLGKVQCVKXQ
e sujeito passivo). O sujeito ativo a pessoa (estatal ou no) que credora da
QDTKICQ VTKDWVTKC sujeito passivo  Q FGXGFQT FGUUC QDTKICQ
#/#41
R 
G ETKVTKQSWCPVKVCVKXQEQPLWPVQFGKPHQTOCGUEQPVKFCUPCPQTOCSWGRGTOKVGO
precisar a exata quantia devida a ttulo de tributo.
#UGIWKTRCUUCUGCPNKUGFGECFCWOFGUUGUETKVTKQUGOTGNCQUEQPVTKDWKGU
previdencirias de empresas e equiparados a empresas.
3.1.1 CRITRIO MATERIAL

1HCVQIGTCFQTFQVTKDWVQWOCUKVWCQOCVGTKCNFGUETKVCRGNQNGIKUNCFQTCFSWKTKT
TGPFCRTGUVCTUGTXKQUKORQTVCTOGTECFQTKCUGUVTCPIGKTCUGVE
#/#41
R %QOTGNCQUEQPVTKDWKGUFGGORTGUCUGGSWKRCTCFQUUQDTGCHQNJCFG
UCNTKQUQCTVFC.GKPFGNKOKVCUGCFKURQTSWGCEQPVTKDWKQ
KPEKFGUQDTGCTGOWPGTCQFGUVKPCFCCTGVTKDWKTQVTCDCNJQFGUGIWTCFQUSWGNJG
RTGUVCOUGTXKQU
FGUGQDUGTXCTSWGRCTCUGHCNCTGOTGOWPGTCQFGUVKPCFCCTGVTKDWKTQVTCDCNJQ
necessrio o estabelecimento de um vnculo contratual entre empregador e
trabalhador. Desse modo, contratar trabalhadores (segurados do Regime Geral
de Previdncia Social) caracteriza-se como o critrio material do fato gerador das
EQPVTKDWKGURTGXKFGPEKTKCUKPEKFGPVGUUQDTGCHQNJCFGUCNTKQU
'OUGVTCVCPFQFGEQPVTKDWKGURTGXKFGPEKTKCUCKPEKFKTUQDTGCTGEGKVCFCUGORTGUCU
QETKVTKQOCVGTKCNECTCEVGTK\CUGEQOCCQFGUGobter essas receitas.
3.1.2 CRITRIO ESPACIAL

Tendo-se em conta que, como se ver adiante, a Unio o ente que detm
EQORGVPEKCRCTCKPUVKVWKTCUEQPVTKDWKGUFGUVKPCFCUCQEWUVGKQFQ4GIKOG)GTCNFG
2TGXKFPEKC5QEKCNRQFGUGCTOCTEQOUGIWTCPCSWGGUUCUEQPVTKDWKGUCNECPCO
QU HCVQU QEQTTKFQU GO VQFQ Q VGTTKVTKQ PCEKQPCN 2QTO PC UKVWCQ GURGEEC
referida na alnea e do inciso I do art. 12 da Lei n. 8.212, de 1991,3 o fato gerador
FCEQPVTKDWKQRCTCCRTGXKFPEKCUQEKCNDTCUKNGKTCRQFGCNECPCTHCVQUQEQTTKFQU
em territrio estrangeiro.
3.1.3 CRITRIO TEMPORAL

1HCVQIGTCFQTFGUUCUEQPVTKDWKGUUWTIG
3 Segundo esse dispositivo, o brasileiro que trabalha para a Unio, no exterior, em organismos oficiais brasileiros
QWKPVGTPCEKQPCKUFQUSWCKUQ$TCUKNUGLCOGODTQGHGVKXQUCNXQUGUGIWTCFQPCHQTOCFCNGIKUNCQXKIGPVGFQ
pas do domiclio, segurado da previdncia brasileira.

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

Mrio Pereira de Pinho Filho

C GOUGVTCVCPFQFCUEQPVTKDWKGUKPEKFGPVGUUQDTGCHQNJCFGUCNTKQULWPVCOGPVG
EQOQFKTGKVQTGOWPGTCQFGEQTTGPVGFCTGNCQFGGORTGIQQWGOTC\QFC
RTGUVCQFGUGTXKQURQTRGUUQCUHUKECUSWCPFQCWUGPVGQXPEWNQGORTGICVEKQ
D GOUGVTCVCPFQFCUEQPVTKDWKGUKPEKFGPVGUUQDTGCTGEGKVCPCOGFKFCGOSWG
as receitas forem auferidas.
3.1.4 CRITRIO PESSOAL
3.1.4.1 SUJEITO ATIVO

#KPUVKVWKQFCUEQPVTKDWKGURCTCUGIWTKFCFGUQEKCNGOGURGEKCNCURTGXKFGPEKTKCU
FGEQORGVPEKCFC7PKQ%QOQPKECGZEGQCGUUCTGITCVGOUGSWGCQUGPVGU
HGFGTCVKXQUEQORGVGKPUVKVWKTCEQPVTKDWKQRCTCQEWUVGKQFQTGIKOGRTRTKQFG
previdncia de seus servidores.4 Assim, a criao de contribuies destinadas ao custeio
do denominado Regime Geral de Previdncia Social compete exclusivamente Unio.
3.1.4.2 SUJEITO PASSIVO (CONTRIBUINTE)

A Lei n. 8.212, de 1991, por meio de seus arts. 12, 14 e 15, estabelece o rol de
contribuintes do Regime Geral de Previdncia Social:
a) as empresas, cujo conceito legal abrange o empresrio individual ou sociedade
GORTGUTKCSWGCUUWOGQTKUEQFGCVKXKFCFGGEQPOKECWTDCPCQWTWTCNEQOPU
NWETCVKXQUQWPQDGOEQOQQUTIQUGCUGPVKFCFGUFCCFOKPKUVTCQRDNKEC
FKTGVCGKPFKTGVC
b) os equiparados empresa, que, nos termos da Lei n. 8.212, de 24 de julho de 1991,
UQQEQPVTKDWKPVGKPFKXKFWCNGOTGNCQCQUUGIWTCFQUSWGNJGRTGUVCOUGTXKQU
C EQQRGTCVKXC C CUUQEKCQ QW GPVKFCFG FG SWCNSWGT PCVWTG\C QW PCNKFCFG
COKUUQFKRNQOVKECGCTGRCTVKQEQPUWNCTFGECTTGKTCUGUVTCPIGKTCU
c) os empregadores domsticos, que compreendem a pessoa ou famlia que admitem
CUGWUGTXKQUGOPCNKFCFGNWETCVKXCGORTGICFQFQOUVKEQG
d) os segurados do Regime Geral de Previdncia.
3.1.5 CRITRIO QUANTITATIVO
3.1.5.1 BASE DE CLCULO

# DCUG FG ENEWNQ FC EQPVTKDWKQ UQDTG C HQNJC FG UCNTKQU IWCTFC CNIWOCU
RGEWNKCTKFCFGUFGCEQTFQEQOCECVGIQTKCFGUGIWTCFQUCUGTXKQFCGORTGUC

 %QPUVKVWKQCTVcaputGho.

10

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

a) com relao a empregados e trabalhadores avulsos: corresponde ao total das


TGOWPGTCGU RCICU FGXKFCU QW ETGFKVCFCU C SWCNSWGT VVWNQ FWTCPVG Q OU
destinadas a retribuir o trabalho, qualquer que seja sua forma, inclusive as gorjetas,
os ganhos habituais sob a forma de utilidades e os adiantamentos decorrentes de
TGCLWUVG UCNCTKCN SWGT RGNQU UGTXKQU GHGVKXCOGPVG RTGUVCFQU SWGT RGNQ VGORQ
FKURQUKQFQGORTGICFQTQWVQOCFQTFGUGTXKQUPQUVGTOQUFCNGKQWFQ
EQPVTCVQQWCKPFCFGEQPXGPQQWCEQTFQEQNGVKXQFGVTCDCNJQQWUGPVGPC
PQTOCVKXCG
b) com relao aos contribuintes individuais:QVQVCNFCUTGOWPGTCGURCICUQW
creditadas a qualquer ttulo, no decorrer do ms, a esses segurados.
'OUGVTCVCPFQFCUEQPVTKDWKGUKPEKFGPVGUUQDTGCTGEGKVCCDCUGFGENEWNQRQT
bvio, ser a receita auferida pelos contribuintes.
#UDCUGUFGENEWNQFCUEQPVTKDWKGURTGXKFGPEKTKCUUQDTGCTGOWPGTCQGUQDTG
CTGEGKVCUGTQGUVWFCFCUFGHQTOCOCKUFGVCNJCFCPCUUGGUG
3.1.5.2 ALQUOTA

'O VGTOQU FKFVKEQU CU EQPVTKDWKGU UQDTG C HQNJC FG UCNTKQU RQFGO UGT
subdivididas em trs espcies:
C EQPVTKDWKQRCTCQRCICOGPVQFGDGPGHEKQUGOIGTCN
D EQPVTKDWKQ RCTC Q PCPEKCOGPVQ FC CRQUGPVCFQTKC GURGEKCN G FQU DGPGHEKQU
concedidos em razo do grau de incidncia de incapacidade laborativa decorrente
FQUTKUEQUCODKGPVCKUFQVTCDCNJQG
E EQPVTKDWKQCFKEKQPCNRCTCQPCPEKCOGPVQFCCRQUGPVCFQTKCGURGEKCNFGUVKPCFC
CQUGIWTCFQUWLGKVQCEQPFKGUGURGEKCKUSWGRTGLWFKSWGOCUCFGQWCKPVGITKFCFG
fsica.
#CNSWQVCFGECFCWOCFGUUCUEQPVTKDWKGUGCFCUEQPVTKDWKGUKPEKFGPVGUUQDTG
CTGEGKVCGPEQPVTCOUGGURGEKECFCUPCUUGGUG

4 CONTRIBUIES DE EMPREGADORES
(EMPRESAS E EQUIPARADOS)
A folha de salrios e demais rendimentos do trabalho pagos ou creditados, a qualquer
VVWNQ  RGUUQC HUKEC SWG NJG RTGUVG UGTXKQ OGUOQ UGO XPEWNQ GORTGICVEKQ
UQCRTKPEKRCNDCUGEQOTGNCQSWCNRQUUXGNCKPUVKVWKQFGEQPVTKDWKGU
previdencirias exigveis dos empregadores. Entretanto, para diversos setores da
GEQPQOKCCUEQPVTKDWKGURQFGOVGTDCUGUFGKPEKFPEKCFKUVKPVCU

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

11

Mrio Pereira de Pinho Filho

4.1 CONTRIBUIES INCIDENTES SOBRE A FOLHA DE SALRIOS


REGRA GERAL
5QDCIKFGFC%QPUVKVWKQFGEQOQTGITCCUEQPVTKDWKGURTGXKFGPEKTKCU
dos empregadores institudas pela Lei n. 8.212, de 1991, tm como base de incidncia
a folha de salrios e demais rendimentos do trabalho, consoante previso contida
na alnea a do inciso I do caput de seu art. 195. Sobre a mesma base incide ainda
CEQPVTKDWKQ
C RCTCQPCPEKCOGPVQFCCRQUGPVCFQTKCGURGEKCNGFQUDGPGHEKQUEQPEGFKFQUGO
razo do grau de incidncia de incapacidade laborativa decorrente dos riscos
ambientais do trabalho, cujas alquotas so de 1%, 2% ou 3%, conforme o risco
de acidente de trabalho na atividade preponderante da empresa seja considerado
NGXGOFKQQWITCXG
D CFKEKQPCN  EQPVTKDWKQ TGHGTKFC PQ KVGO C FGUVKPCFC CQ PCPEKCOGPVQ FC
aposentadoria especial, cuja alquota corresponde a 12%, 9% ou 6%, e incide
GZENWUKXCOGPVGUQDTGCUTGOWPGTCGUFGGORTGICFQUQWVTCDCNJCFQTGUCXWNUQU
cuja atividade exercida permita a concesso de aposentadoria especial aps 15,
QWCPQUFGEQPVTKDWKQTGURGEVKXCOGPVG
E FGUQDTGQVQVCNFCUTGOWPGTCGURCICUQWETGFKVCFCUCSWCNSWGTVVWNQ
no decorrer do ms, aos segurados contribuintes individuais que lhe prestem
UGTXKQUG
F CFKEKQPCNFGTGNCVKXCOGPVGUGORTGUCUFQUGVQTPCPEGKTQ
Com base nesses subsdios, fornecidos pelas Leis ns. 8.212/1991 e 8.213/1991,
VQTPCUG RQUUXGN C KFGPVKECQ FQU GNGOGPVQU SWCPVKVCVKXQU FC EQPVTKDWKQ
RTGXKFGPEKTKCKPEKFGPVGUQDTGCTGOWPGTCQ
4.2 CONTRIBUIES SUBSTITUTIVAS
%QOTGNCQUEQPVTKDWKGURTGXKFGPEKTKCUQNGIKUNCFQTQTFKPTKQVGOQRVCFQ
RQTUWDUVKVWKTCTGOWPGTCQRQTQWVTCUDCUGUFGKPEKFPEKC'UUCVEPKECUGIWPFQ
UG RTQEWTC LWUVKECT XGO UGPFQ CFQVCFC EQOQ HQTOC FG HCEKNKVCT C CTTGECFCQ
G Q EQPVTQNG FC UECNK\CQ FG FCT VTCVCOGPVQ UKORNKECFQ C OKETQ G RGSWGPCU
empresas, de desonerar a folha de pagamento de determinados setores da economia
GHQOGPVCTCETKCQFGPQXQURQUVQUFGVTCDCNJQQWFGVQTPCTOCKUEQORGVKVKXCC
indstria nacional.
'ODQTCOWKVQUGFKUEWVCUQDTGCUEQPVTKDWKGUUWDUVKVWVKXCUFCTGCTWTCNQEGTVQ
SWGKPOGTQUQWVTQUUGIOGPVQULGUVQUWLGKVQUCCNIWOCHQTOCFGUWDUVKVWKQ
FCUEQPVTKDWKGUUQDTGCTGOWPGTCQRQTEQPVTKDWKGUKPEKFGPVGUUQDTGQWVTCU
DCUGUGEQPOKECU#VWCNOGPVGCUUKVWCGUGOSWGUGXGTKECGUUCUWDUVKVWKQUQ
as seguintes:
12

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

C OKETQGORTGUCUGGORTGUCUFGRGSWGPQRQTVGQRVCPVGURGNQ5KORNGU
D GPVKFCFGUFGURQTVKXCUSWGOCPVOGSWKRGFGHWVGDQNRTQUUKQPCN
E GORTGUCUCDTCPIKFCURGNC.GKPG
f) empregadores rurais e agroindstrias.
4.3 CONTRIBUIES DE EMPREGADORES DOMSTICOS
#EQPVTKDWKQFQGORTGICFQTFQOUVKEQFGFQUCNTKQFGEQPVTKDWKQFQ
GORTGICFQFQOUVKEQCUGWUGTXKQ

5 SEGURADOS DO REGIME GERAL DE PREVIDNCIA SOCIAL


%QPUQCPVGLUGXGTKEQWCPVGTKQTOGPVGQUUGIWTCFQUFC2TGXKFPEKC5QEKCN
4)25 
so tambm seus contribuintes, conforme previso contida no art. 201 da Carta,
segundo a qual a Previdncia Social ser organizada sob a forma de regime geral,
FGECTVGTEQPVTKDWVKXQGFGNKCQQDTKICVTKC
V-se que para se valer do RGPS necessrio que a pessoa fsica esteja vinculada
CGUUG4GIKOGGGUUCXKPEWNCQUGFRGNCNKCQFCSWCNRTQXOQFKTGKVQCQU
benefcios previdencirios e o dever de contribuir para a Previdncia. A depender
FCHQTOCFGNKCQQUUGIWTCFQUUQENCUUKECFQUEQOQ
C QDTKICVTKQUQW
b) facultativos.
5.1 SEGURADO OBRIGATRIO
CRGUUQCHUKECOCKQTFGCPQUSWGGZGTCSWCNSWGTVKRQFGCVKXKFCFGTGOWPGTCFC
CDTCPIKFCRGNQ4GIKOG)GTCNFG2TGXKFPEKC5QEKCN2CTCGUUGEQPVTKDWKPVGCNKCQ
automtica e decorre do exerccio da atividade remunerada, ou seja, independe
da vontade do segurado. Os segurados obrigatrios se subdividem nas seguintes
categorias:
C GORTGICFQ
D VTCDCNJCFQTCXWNUQ
E EQPVTKDWKPVGKPFKXKFWCN
F GORTGICFQFQOUVKEQG
e) segurado especial.
Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

13

Mrio Pereira de Pinho Filho

5.1.1 EMPREGADO

A despeito da extensa lista constante do art. 12 da Lei n. 8.212/1991, em linhas gerais


GORTGICFQRQFGUGTFGPKFQEQOQCSWGNGSWGRTGUVCUGTXKQFGPCVWTG\CWTDCPC
QWTWTCNCGORTGUCQWGSWKRCTCFQGOECTVGTPQGXGPVWCNUQDUWCUWDQTFKPCQ
GOGFKCPVGTGOWPGTCQKPENWUKXGEQOQFKTGVQTGORTGICFQ
6GPFQGOXKUVCSWGQUTIQUGCUGPVKFCFGUFCCFOKPKUVTCQRDNKECVCODOUQ
FGPKFQURGNC.GKPEQOQGORTGUCUQEQPEGKVQFGGORTGICFQCDTCPIG
o servidor pblico ocupante de cargo em comisso, sem vnculo efetivo com os
GPVGUHGFGTCVKXQUUWCUCWVCTSWKCUGHWPFCGU5QCKPFCEQPUKFGTCFQUUGIWTCFQU
empregados o exercente de mandato eletivo, desde que no vinculado a regime
prprio de previdncia social.
5.1.2 TRABALHADOR AVULSO

CSWGNGSWGRTGUVCUGTXKQFGPCVWTG\CWTDCPCQWTWTCNCFKXGTUCUGORTGUCUUGO
XPEWNQGORTGICVEKQEQOKPVGTOGFKCQQDTKICVTKCFQTIQIGUVQTFGOQFG
obra, nos termos da Lei n. 8.630, de 25 de fevereiro de 1993, ou do sindicato da
ECVGIQTKC#UKPFKECNK\CQPQTGSWKUKVQRCTCSWGQUGIWTCFQSWGRTGUVCUGTXKQ
por intermdio do sindicato da categoria seja caracterizado como trabalhador avulso.
#KPVGTOGFKCQFQTIQIGUVQTFGOQFGQDTCQEQTTGGOTGNCQCQUVTCDCNJCFQTGU
SWG RTGUVCO UGTXKQU PC TGC RQTVWTKC %QO TGNCQ CQU SWG FGUGORGPJCO
CVKXKFCFGU NKICFCU C KPFUVTKC UGTXKQU QW EQOTEKQ HQTC FQ ODKVQ RQTVWTKQ
CKPVGTOGFKCQHGKVCRGNQUKPFKECVQFCECVGIQTKC
5.1.3 CONTRIBUINTE INDIVIDUAL

'UUCECVGIQTKCCDTCPIGSWGORTGUVCUGTXKQFGPCVWTG\CWTDCPCQWTWTCNGOECTVGT
GXGPVWCNCWOCQWOCKUGORTGUCUUGOTGNCQFGGORTGIQCRGUUQCHUKECSWGGZGTEG
RQTEQPVCRTRTKCCVKXKFCFGGEQPOKECFGPCVWTG\CWTDCPCEQOPUNWETCVKXQUQW
PQQGORTGUTKQFGPVTGQWVTQU
5.1.4 EMPREGADO DOMSTICO

CSWGNGSWGRTGUVCUGTXKQFGPCVWTG\CEQPVPWCCRGUUQCQWHCONKCPQODKVQ
TGUKFGPEKCNFGUVCGOCVKXKFCFGUUGOPUNWETCVKXQU
5.1.5 SEGURADO ESPECIAL

a pessoa fsica residente no imvel rural ou em aglomerado urbano ou rural


prximo a ele que, individualmente ou em regime de economia familiar, ainda
SWGEQOQCWZNKQGXGPVWCNFGVGTEGKTQUCVVWNQFGOVWCEQNCDQTCQFGUGPXQNXC
CVKXKFCFGPCEQPFKQFG
14

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

a) produtor, seja proprietrio, usufruturio, possuidor, assentado, parceiro ou


meeiro outorgado, comodatrio ou arrendatrio rurais, que explore atividade
CITQRGEWTKCGOTGCFGCVSWCVTQOFWNQUUECKUFGUGTKPIWGKTQQWGZVTCVKXKUVC
XGIGVCNGHCCFGUUCUCVKXKFCFGUQRTKPEKRCNOGKQFGXKFCG
D RGUECFQTCTVGUCPCNQWCGUVGCUUGOGNJCFQSWGHCCFCRGUECRTQUUQJCDKVWCNQW
principal meio de vida.
Tambm se enquadram como segurados especiais, desde que no possuam outra
HQPVG FG TGPFKOGPVQ Q EPLWIG QW EQORCPJGKTQ DGO EQOQ NJQ OCKQT FG
16 anos de idade ou a este equiparado que, comprovadamente, trabalhem com
o grupo familiar respectivo.
5.2 SEGURADO FACULTATIVO5
UGIWTCFQHCEWNVCVKXQQOCKQTFGCPQUFGKFCFGSWGRQTCVQFGXQPVCFGUGNKG
CQ4GIKOG)GTCNFG2TGXKFPEKC0QRQFGTQNKCTUGPCEQPFKQFGUGIWTCFQ
HCEWNVCVKXQCRGUUQCLNKCFCGOQWVTCECVGIQTKCQWQUGTXKFQTEKXKNQEWRCPVGFGECTIQ
efetivo ou o militar da Unio, dos estados, do Distrito Federal ou dos municpios,
DGOEQOQQFCUTGURGEVKXCUCWVCTSWKCUGHWPFCGU
5.3 CONTRIBUIES DOS SEGURADOS
5.3.1 CONTRIBUINTE INDIVIDUAL, EMPREGADO DOMSTICO
E SEGURADO FACULTATIVO

#DCUGFGENEWNQFCEQPVTKDWKQFQUUGIWTCFQUGORTGICFQVTCDCNJCFQTCXWNUQ
contribuinte individual, empregado domstico e segurado facultativo o salrio de
contribuio. Para cada uma dessas categorias de segurados o salrio de contribuio
RQFGUGTFGPKFQPQUUGIWKPVGUVGTOQU
a) empregado e trabalhador avulsoCTGOWPGTCQCWHGTKFCGOWOCQWOCKUGORTGUCU
assim entendida a totalidade dos rendimentos pagos, devidos ou creditados a
qualquer ttulo durante o ms destinados a retribuir o trabalho, qualquer que seja
sua forma, inclusive as gorjetas, os ganhos habituais sob a forma de utilidades e os
CFKCPVCOGPVQUFGEQTTGPVGUFGTGCLWUVGUCNCTKCNSWGTRGNQUUGTXKQUGHGVKXCOGPVG
RTGUVCFQUSWGTRGNQVGORQFKURQUKQFQGORTGICFQTQWVQOCFQTFGUGTXKQU
PQUVGTOQUFCNGK QWFQEQPVTCVQQWCKPFC FGEQPXGPQQWCEQTFQEQNGVKXQ
FGVTCDCNJQQWUGPVGPCPQTOCVKXC

5 Segundo Ibrahim (2009, p. 215): A regra bsica a compulsoriedadeFGHKNKCQGEQPUGSWGPVGEQPVTKDWKQ


'PVTGVCPVQQDGFGEGPFQCQRTKPERKQFCWPKXGTUCNKFCFGFGRCTVKEKRCQPQ4)25ETKQWUGHKIWTCCVRKECEWLC
HKNKCQCQ4)25FGEQTTGGZENWUKXCOGPVGFGCVQFGXQPVCFGFQKPVGTGUUCFQ

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

15

Mrio Pereira de Pinho Filho

b) contribuinte individual:
D CTGOWPGTCQCWHGTKFCGOWOCQWOCKUGORTGUCUQWRGNQGZGTEEKQFGUWC
CVKXKFCFGRQTEQPVCRTRTKCFWTCPVGQOUQW
D Q UCNTKQ OPKOQ OGPUCN PQ ECUQ FG QRQ RGNC GZENWUQ FQ FKTGKVQ CQ
DGPGHEKQFGCRQUGPVCFQTKCRQTVGORQFGEQPVTKDWKQ
c) empregado domstico C TGOWPGTCQ TGIKUVTCFC GO UWC %CTVGKTC FG 6TCDCNJQ
G2TGXKFPEKC5QEKCNQWEQORTQXCFCOGFKCPVGTGEKDQUFGRCICOGPVQ
d) segurado facultativo: corresponde ao valor por ele declarado.
1 UCNTKQ FG EQPVTKDWKQOWKVQUGCUUGOGNJC DCUGFG ENEWNQFC EQPVTKDWKQ
FCU GORTGUCU
TGOWPGTCQ  C PKEC FKHGTGPC  SWG Q UCNTKQ FG EQPVTKDWKQ
EQORQTVCNKOKVGUOPKOQGOZKOQGCTGOWPGTCQGOTGNCQGORTGUCPQ
UQHTGNKOKVCGUPCKPEKFPEKCFGEQPVTKDWKQ
5.3.1.1 LIMITE MNIMO

Para os segurados empregado, trabalhador avulso e empregado domstico, o limite


OPKOQQRKUQUCNCTKCNNGICNQWPQTOCVKXQFCECVGIQTKCUGKPGZKUVGPVGGUVGUQ
UCNTKQOPKOQ1UCNTKQFGEQPVTKDWKQFGUUGUUGIWTCFQURQFGUGTHTCEKQPCFQ
sendo que tanto um quanto outro limite devem ser considerados no seu valor
mensal, dirio ou horrio, conforme o ajustado no contrato de trabalho e calculado
de acordo com o nmero de dias ou horas, no ms, efetivamente trabalhados.
Para os segurados facultativo e contribuinte individual, o limite mnimo do salrio
FGEQPVTKDWKQQUCNTKQOPKOQRQKUPQJFGUGHCNCTGORKUQUCNCTKCNRCTCVCKU
categorias de segurados.
5.3.1.2 LIMITE MXIMO

comum a todas as categorias de segurados e corresponde ao maior benefcio da


tabela de benefcios pagos pelo Instituto Nacional do Seguro Social.
5.3.2 SEGURADO ESPECIAL

#DCUGFGENEWNQFCEQPVTKDWKQRTGXKFGPEKTKCFQUGIWTCFQGURGEKCNCTGEGKVC
DTWVCRTQXGPKGPVGFCEQOGTEKCNK\CQFGUWCRTQFWQTWTCN+UUQFGEQTTGEQOQL
foi dito, do prprio texto constitucional e tem por objeto o custeio dos benefcios
desses segurados.

16

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

5.4 ALQUOTAS
5.4.1 SEGURADOS EMPREGADOS, EMPREGADOS DOMSTICOS
E TRABALHADORES AVULSOS

#CNSWQVCFCEQPVTKDWKQFGUUGUUGIWTCFQUXCTKCGPVTGGFGCEQTFQEQO
a faixa salarial. Esses valores so reajustados anualmente com os mesmos ndices
WVKNK\CFQURCTCQTGCLWUVCOGPVQFQUDGPGHEKQUFGRTGUVCQEQPVKPWCFCFQ4GIKOG
Geral de Previdncia Social. Ressalva-se que as alquotas no so progressivas, e que
CEKOCFQNKOKVGOZKOQFQUCNTKQFGEQPVTKDWKQPQJKPEKFPEKCFCEQPVTKDWKQ
5.4.2 CONTRIBUINTES INDIVIDUAIS E SEGURADOS FACULTATIVOS

%QOQ TGITC C CNSWQVC FG EQPVTKDWKQ FQU UGIWTCFQU EQPVTKDWKPVG KPFKXKFWCN


GHCEWNVCVKXQFGUQDTGQTGURGEVKXQUCNTKQFGEQPVTKDWKQ
4GEGPVGOGPVGHQTCOETKCFCUPQXCUCNSWQVCUFGEQPVTKDWKQRCTCGUUGUUGIWTCFQU
PQECUQFGQRQRGNCGZENWUQFQFKTGKVQCQDGPGHEKQFGCRQUGPVCFQTKCRQTVGORQ
FGEQPVTKDWKQ0GUUGECUQFGCEQTFQEQOQho do art. 21 da Lei n. 8.212/1991,6
CCNSWQVCFCEQPVTKDWKQKPEKFGPVGUQDTGQNKOKVGOPKOQOGPUCNFQUCNTKQFG
EQPVTKDWKQFG
a) 11% no caso do segurado contribuinte individual que trabalhe por conta prpria,
UGOTGNCQFGVTCDCNJQEQOGORTGUCQWGSWKRCTCFQGFQUGIWTCFQHCEWNVCVKXQG
b) 5% no caso de contribuinte individual enquadrado como microempreendedor
KPFKXKFWCNPQUVGTOQUFC.GK%QORNGOGPVCTPFGFGFG\GODTQFG
ou segurado facultativo sem renda prpria que se dedique exclusivamente ao
trabalho domstico no mbito de sua residncia, desde que pertencente a famlia
de baixa renda.
5.4.3 SEGURADOS ESPECIAiS

2CTCQUUGIWTCFQUGURGEKCKUCCNSWQVCFCEQPVTKDWKQFG
C GOTGNCQCQUDGPGHEKQUGOIGTCNG
D  FGUVKPCFC CQ PCPEKCOGPVQ FC CRQUGPVCFQTKC GURGEKCN G FQU DGPGHEKQU
concedidos em razo do grau de incidncia de incapacidade laborativa decorrente
dos riscos ambientais do trabalho.

 0CTGFCQFCFCRGNC.GKP

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

17

Mrio Pereira de Pinho Filho

6 CONTRIBUIES DE PRODUTORES RURAIS EVOLUO


HISTRICA DA LEGISLAO
A despeito de normas anteriores que j versavam sobre direitos previdencirios no
Brasil, o Decreto n. 4.682, de 24 de janeiro de 1923, conhecido como Lei Eli Chaves

CWVQTFQRTQLGVQTGURGEVKXQ EQPUKFGTCFQQOCTEQQEKCNFGETKCQFCRTGXKFPEKC
UQEKCNDTCUKNGKTC#.GK'NK%JCXGURGTOKVKWCETKCQFCU%CKZCUFG#RQUGPVCFQTKCU
e Penses (CAPs), as quais foram reestruturadas ao longo dos anos 1930, formando
os Institutos de Aposentadorias e Penses (IAPs) (SCHWARZER, 2000, p. 127).
1U+#2UFGUVKPCXCOUGCQUVTCDCNJCFQTGUWTDCPQUGUWCEQDGTVWTCGTCFGPKFCRQT
setores de atividade. Assim, foram criados os Institutos de Aposentadoria e Penso
para ferrovirios, bancrios, industririos, etc.
Apesar de a CF de 1934 j estabelecer o direito previdncia social a todo trabalhador
brasileiro, para obreiros do setor rural essa cobertura surge somente em 1963 com a
.GKPFGFGOCTQFG'UVCVWVQFQ6TCDCNJCFQT4WTCN'UUGGUVCVWVQ
instituiu o Fundo de Assistncia e Previdncia ao Trabalhador Rural. Com as
CNVGTCGUFQ&GETGVQ.GKPQ(WPFQRCUUQWCUGTEQPJGEKFQRQT(WPTWTCN
sigla que lhe foi atribuda pelo citado decreto-lei.
2CTCCEQPUVKVWKQFQ(WPTWTCNC.GKPETKQWCEQPVTKDWKQFGFQ
XCNQTFQURTQFWVQUCITQRGEWTKQU1OGUOQPFKEGHQKCFQVCFQRCTCCEQPVTKDWKQ
de estabelecimentos fabris que utilizassem matria-prima proveniente de sua
RTQFWQCITQRGEWTKCKPEKFGPVGUQDTGQXCNQTFCOCVTKCRTKOCRTRTKCWVKNK\CFC
PQRTQEGUUQFGKPFWUVTKCNK\CQ
'UUC OGUOC NGK FGPKW Q GORTGICFQT TWTCN EQOQ C RGUUQC HUKEC QW LWTFKEC
proprietria ou no, que explore atividades agrcolas, pastoris ou na indstria
rural, em carter temporrio ou permanente, diretamente ou por intermdio de
RTGRQUVQU#NGKHG\VCODOOGPQKPFUVTKCTWTCNCSWCNUGIWPFQUGWCTVo,
exerce atividade industrial em estabelecimento rural no compreendida na
%QPUQNKFCQFCU.GKUFQ6TCDCNJQ
#CTTGECFCQFQ(WPTWTCNDGOEQOQCRTGUVCQFQUDGPGHEKQUGUVCDGNGEKFQUPC
NGKCQVTCDCNJCFQTTWTCNGUGWUFGRGPFGPVGUEQWKPKEKCNOGPVGUQDCTGURQPUCDKNKFCFG
do Instituto de Aposentadoria e Penses dos Industririos (IAPL).
Com o advento da Lei Complementar n. 11, de 25 de maio de 1971, foi institudo
o Programa de Assistncia ao Trabalhador Rural (Prorural), cujo objeto, a exemplo
do que ocorria com o Funrural, era predominantemente a concesso de benefcios
previdencirios.
#Q (WPTWTCN  CVTKDWFC RGTUQPCNKFCFG LWTFKEC FG PCVWTG\C CWVTSWKEC ECPFQ
diretamente subordinado ao ministro do Trabalho e Previdncia Social. Essa
CWVCTSWKC CUUWOG CU TGURQPUCDKNKFCFGU CV GPVQ FQ +CRK SWCPVQ  GZGEWQ FQ
Programa de Assistncia ao Trabalhador Rural (Prorural).
18

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

%QPTOCPFQ Q GPVGPFKOGPVQ UGIWPFQ Q SWCN Q RNCPQ FG EWUVGKQ


KPUVKVWFQ
RGNC .GK P   DCUGCFQ RTKPEKRCNOGPVG GO WOC EQPVTKDWKQ FG 

WO RQT EGPVQ  UQDTG Q XCNQT FC RTKOGKTC EQOGTEKCNK\CQ FQ RTQFWVQ TWTCN G
EQOTGEQNJKOGPVQFGQDTKICQNGICNFQRTRTKQRTQFWVQTCITEQNCPQHQTPGEGW
WOC DCUG PCPEGKTC UWEKGPVG  GZGEWQ FQ RTQITCOC
5%*9#4<'4 
p. 127-128), para o custeio do Prorural foram criadas as seguintes fontes:
C EQPVTKDWKQFGFGXKFCRGNQRTQFWVQTUQDTGQXCNQTEQOGTEKCNFQURTQFWVQU
TWTCKUG
b) 2,4% sobre a folha de salrios das empresas em geral.
1WVTCRTQXKFPEKCCFQVCFCRGNC.GK%QORNGOGPVCTPHQKCCVTKDWKQFC
TGURQPUCDKNKFCFGRGNQTGEQNJKOGPVQFCEQPVTKDWKQUQDTGQXCNQTEQOGTEKCNFQU
produtos rurais ao adquirente, consignatrio ou cooperativa. Esse recolhimento
UQOGPVGEQWUQDCTGURQPUCDKNKFCFGFQRTQFWVQTPQECUQFGKPFWUVTKCNK\CQFC
RTQFWQRQTGNGRTRTKQQWFGXGPFCCQEQPUWOKFQTPQXCTGLQQWCCFSWKTGPVG
domiciliado no exterior.
A partir da Lei n. 6.260, de 6 de novembro de 1975, foi a vez de se criar um sistema
FGRTGXKFPEKCGURGEEQRCTCGORTGICFQTGUTWTCKUGUGWUFGRGPFGPVGUOGFKCPVG
EQPVTKDWKQFG
C FGWOFEKOQFQXCNQTFCRTQFWQTWTCNFQCPQCPVGTKQTLXGPFKFCQWCXCNKCFC
UGIWPFQCUEQVCGUFQOGTECFQG
b) de um vigsimo do valor da parte da propriedade rural porventura mantida
UGO EWNVKXQ UGIWPFQ C NVKOC CXCNKCQ GHGVWCFC RGNQ +PUVKVWVQ 0CEKQPCN FG
%QNQPK\CQG4GHQTOC#ITTKC
+PETC 
%QOCGFKQFC.GKPGCETKCQFQ5KUVGOC0CEKQPCNFG2TGXKFPEKC
G #UUKUVPEKC 5QEKCN
5KPRCU  C CTTGECFCQ FCU EQPVTKDWKGU FG VTCDCNJCFQTGU
urbanos e rurais e a concesso de benefcios previdencirios a estes passaram a
VGT CFOKPKUVTCGU GO EQOWO 'UUC NGK VTCPUHGTKW RCTC Q +PUVKVWVQ 0CEKQPCN FG
2TGXKFPEKC 5QEKCN
+025  C TGURQPUCDKNKFCFG RGNC EQPEGUUQ G RGNC OCPWVGPQ
dos benefcios dos trabalhadores e dos empregadores do setor rural. Ao Instituto
FG#FOKPKUVTCQ(KPCPEGKTCFC2TGXKFPEKCG#UUKUVPEKC5QEKCN
+CRCU EQWDGC
CVTKDWKQFGCTTGECFCTUECNK\CTGEQDTCTCUEQPVTKDWKGUFGUVKPCFCURTGXKFPEKC
%QPENWFCCKORNCPVCQFQ5KPRCUQ(WPTWTCNTGUVQWGZVKPVQ
1WVTCRTQHWPFCOQFKECQPQUKUVGOCRTGXKFGPEKTKQDTCUKNGKTQXGKQEQOC.GK
PFGFGLWNJQFG#RCTVKTFGUWCGFKQCEQPVTKDWKQFCUGORTGUCU
em geral e das entidades ou rgos a ela equiparados, destinada previdncia social,
KPEKFGPVGUQDTGCHQNJCFGUCNTKQUHQKZCFCGO

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

19

Mrio Pereira de Pinho Filho

C  UQDTG Q VQVCN FCU TGOWPGTCGU FQU UGIWTCFQU GORTGICFQU CXWNUQU


CWVPQOQUGCFOKPKUVTCFQTGU7
D UQDTGQVQVCNFCUTGOWPGTCGURCICUQWETGFKVCFCUPQFGEQTTGTFQOUCQU
UGIWTCFQUGORTGICFQUGCXWNUQURCTCQPCPEKCOGPVQFCEQORNGOGPVCQFCU
RTGUVCGURQTCEKFGPVGFQVTCDCNJQ
c) 0,9% a 1,8% para empresas cujo ndice de acidentes de trabalho seja superior
OFKCFQTGURGEVKXQUGVQTCVVWNQFGCFKEKQPCNFCEQPVTKDWKQRCTCPCPEKCOGPVQ
FCURTGUVCGURQTCEKFGPVGFQVTCDCNJQG
F RCTCGORTGUCUFQUGVQTPCPEGKTQRCICUCVVWNQFGCFKEKQPCNFCEQPVTKDWKQ
UQDTGCTGOWPGTCQ
# EQPVTKDWKQ CDTCPIGW CU EQPVTKDWKGU RCTC Q UCNTKQ HCONKC RCTC Q UCNTKQ
OCVGTPKFCFGRCTCQCDQPQCPWCNGVCODOCFGUQDTGCTGOWPGTCQFGUVKPCFC
CQ 2TQTWTCN # EQPVTKDWKQ UQDTG RTQFWVQU CITEQNCU FC .GK %QORNGOGPVCT
n. 11, de 25 de maio de 1971, contudo, permaneceu, a despeito da supresso da
EQPVTKDWKQKPEKFGPVGUQDTGCHQNJCFGUCNTKQU'UUGHQKQGPVGPFKOGPVQRCEKECFQ
PCLWTKURTWFPEKCFQ5WRGTKQT6TKDWPCNFG,WUVKC8
# CFOKPKUVTCQ FCU TGCU FG EWUVGKQ G FG DGPGHEKQU  VTCPUHGTKFC RCTC Q +055
EQOCETKCQFCCWVCTSWKCRGNQ&GETGVQPOGFKCPVGCWVQTK\CQFC
Lei n. 8.029, de 12 de abril de 1990.
#RCTVKTFCRWDNKECQFC.GKPQ2TQTWTCNGQUKUVGOCRTGXKFGPEKTKQFQU
GORTGICFQTGUTWTCKUHQKGZVKPVQFCPFQNWICTCWOUKUVGOCFGRTGXKFPEKCWPKECFQ
para trabalhadores urbanos e rurais. A Lei n. 8.212/1991 trouxe o plano de custeio
da previdncia social, e Lei n. 8.213/1991 coube a disciplina do plano de benefcios.
'OEQPHQTOKFCFGEQOCTGFCQQTKIKPCNFC.GKPCEQPVTKDWKQUQDTG
a folha de pagamento das empresas passou a ser de:
C UQDTGQVQVCNFCUTGOWPGTCGURCICUFGXKFCUQWETGFKVCFCUCSWCNSWGTVVWNQ
durante o ms, aos segurados empregados e trabalhadores avulsos e contribuintes
KPFKXKFWCKUSWGNJGRTGUVGOUGTXKQU
D RCTCQPCPEKCOGPVQFCEQORNGOGPVCQFCURTGUVCGURQTCEKFGPVGFQVTCDCNJQ
FQUUGIWKPVGURGTEGPVWCKUKPEKFGPVGUUQDTGQVQVCNFCUTGOWPGTCGUFGUGIWTCFQU
empregados e trabalhadores avulsos:
 &G CEQTFQ EQO Q VGZVQ NGICN C EQPVTKDWKQ KPEKFKTKC UQDTG C TGOWPGTCQ FG UGIWTCFQU GORTGICFQU
trabalhadores avulsos, trabalhadores autnomos e empresrios, porm a expresso avulsos, autnomos
G CFOKPKUVTCFQTGU HQK UWURGPUC GO TC\Q FC 4GUQNWQ FQ 5GPCFQ (GFGTCN P  &KURQPXGN GO
<http://www.senado.gov.br/publicacoes/anais/pdf/Resolucoes/1995.pdf>.
 #EQPVTKDWKQRCTCQ(WPTWTCNKPEKFGPVGUQDTGQXCNQTEQOGTEKCNFQURTQFWVQUTWTCKU
CTVKIQ+FC.GK
Complementar 11/1971) permaneceu vigente at o advento da Lei n. 8.213/1991, que passou a viger em
PQXGODTQFG2TGEGFGPVGU4'UR'54GN/KP%CUVTQ/GKTC5GIWPFC6WTOC&,G
REsp 871.852/RJ, Rel. Min. Luiz Fux, Primeira Turma, DJe 12.5.2008. Disponvel em: <http://www.stj.jus.
br/SCON/jurisprudencia/doc.jsp?livre=871.852%2FRJ&&b=ACOR&p=true&t=&l=10&i=2>.

20

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

b.1) 1% para as empresas em cuja atividade preponderante o risco de acidentes do


VTCDCNJQUGLCEQPUKFGTCFQNGXG
b.2) 2% para as empresas em cuja atividade preponderante esse risco seja considerado
OFKQ
b.3) 3% para as empresas em cuja atividade preponderante esse risco seja considerado
ITCXG
E RCTCGORTGUCUFQUGVQTPCPEGKTQRCICCVVWNQFGCFKEKQPCNFCEQPVTKDWKQ
UQDTGCTGOWPGTCQ
#KPFCFGCEQTFQEQOCTGFCQQTKIKPCNFGUUCNGKUQOGPVGCEQPVTKDWKQFQRTQFWVQT
do parceiro, do meeiro e do arrendatrio rurais, do garimpeiro, do pescador artesanal
e o assemelhado, que exerciam essas atividades, individualmente ou em regime de
GEQPQOKCHCOKNKCT
UGIWTCFQGURGEKCN VKPJCCTGEGKVCFCEQOGTEKCNK\CQFCRTQFWQ
TWTCNEQOQDCUGFGKPEKFPEKCFCEQPVTKDWKQ0QECUQFQUGORTGICFQTGUTWTCKU
CEQPVTKDWKQRCTCQEWUVGKQFQUDGPGHEKQUFQUUGIWTCFQUCUGWUGTXKQVCODO
RCUUQWCKPEKFKTGZENWUKXCOGPVGUQDTGCTGOWPGTCQFGUUGUUGIWTCFQU
*QWXGVCODOCNVGTCGUPCEQPVTKDWKQFQURTQFWVQTGUTWTCKURGUUQCUPCVWTCKU
para o custeio dos benefcios prprios e destinados a seus dependentes. Estes passaram
CUGTGPSWCFTCFQUEQOQVTCDCNJCFQTGUCWVPQOQUGCEQPVTKDWKQRCUUQWCKPEKFKT
UQDTGQTGURGEVKXQUCNTKQFGEQPVTKDWKQEQOCNSWQVCXCTKXGNFGC
Atualmente, esses produtores esto enquadrados na categoria de contribuintes
KPFKXKFWCKUGEQPVTKDWGOPCHQTOCFGPKFCPQKVGO
%QOTGNCQEQVCRCVTQPCNC.GKPFGFGFG\GODTQFGTGUVCDGNGEGW
CEQPVTKDWKQUQDTGCTGEGKVCDTWVCFCEQOGTEKCNK\CQFCRTQFWQTWTCNRCTCQU
GORTGICFQTGUTWTCKURGUUQCUHUKECUUQOGPVGEQOTGNCQCUGIWTCFQUGORTGICFQUG
VTCDCNJCFQTGUCXWNUQU4GNCVKXCOGPVGCQUEQPVTKDWKPVGUKPFKXKFWCKUCTGOWPGTCQ
RGTOCPGEGWUGPFQWVKNK\CFCEQOQDCUGFGENEWNQFCEQPVTKDWKQ
/CKUVCTFGC.GKPFGFGOCTQFGC/GFKFC2TQXKUTKCPFG
de outubro de 1996, a Lei n. 9.528, de 10 de dezembro de 1997, e a Lei n. 10.256, de
FGLWNJQFGRTQOQXGTCOCNVGTCGURQPVWCKUPCTGFCQVTC\KFCKPKEKCNOGPVG
RGNC.GKP#VWCNOGPVGCUCNSWQVCUFCEQPVTKDWKQGUVQZCFCUGO
C FCTGEGKVCDTWVCRTQXGPKGPVGFCEQOGTEKCNK\CQFCUWCRTQFWQG
D  FC TGEGKVC DTWVC RTQXGPKGPVG FC EQOGTEKCNK\CQ FC UWC RTQFWQ RCTC
PCPEKCOGPVQFCURTGUVCGURQTCEKFGPVGFQVTCDCNJQ
Para os empregadores rurais pessoas jurdicas e para as agroindstrias (indstrias
TWTCKU HQKC.GKPFGFGCDTKNFGSWGVTQWZGFGXQNVCCEQPVTKDWKQ
KPEKFGPVGUQDTGCRTQFWQEQOCUUGIWKPVGUCNSWQVCU
Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

21

Mrio Pereira de Pinho Filho

C RCTCQRCICOGPVQFGDGPGHEKQURTGXKFGPEKTKQUGOIGTCNG
D RCTCQPCPEKCOGPVQFCEQORNGOGPVCQFCURTGUVCGURQTCEKFGPVGFG
trabalho.
Inicialmente a base de clculo estabelecida para empregadores rurais pessoas
jurdicas e para as agroindstrias era sensivelmente distinta. Enquanto os produtores
TWTCKUUQHTKCOCKPEKFPEKCUQDTGCTGEGKVCDTWVCRTQXGPKGPVGFCEQOGTEKCNK\CQ
FG UWC RTQFWQ RCTC CU CITQKPFUVTKCU C DCUG WVKNK\CFC HQK Q XCNQT GUVKOCFQ FC
RTQFWQCITEQNCRTRTKCEQPUKFGTCFQUGWRTGQFGOGTECFQ#EQPVTKDWKQFCU
agroindstrias, entretanto, foi declarada inconstitucional pelo Supremo Tribunal
Federal (BRASIL, ADI n. 1.103-1/DF).
#.GKPTGFGPKWCDCUGFGENEWNQFCUEQPVTKDWKGURTGXKFGPEKTKCUFCU
GORTGUCUCITQKPFWUVTKCKU#RCTVKTFCGFKQFGUUGFKRNQOCNGICNCEQPVTKDWKQFCU
empresas agroindustriais passou a incidir sobre o valor da receita bruta proveniente
FCEQOGTEKCNK\CQFCRTQFWQCGZGORNQFQSWGQEQTTGEQOGORTGICFQTGUTWTCKU
pessoas fsica e jurdica.

7 FUNDAMENTOS ERIGIDOS EM DEFESA DA


INCONSTITUCIONALIDADE DAS CONTRIBUIES DO
SETOR RURAL A PARTIR DA CONSTITUIO DE 1988
0CUGQCPVGTKQTFGOQPUVTQWUGSWGFGUFGLWPJQFGSWCPFQHQKKPUVKVWFC
no Brasil a previdncia dos trabalhadores do campo, o valor dos produtos rurais
QWCTGEGKVCTGHGTGPVGEQOGTEKCNK\CQFGUUGURTQFWVQUVOUKFQWVKNK\CFQUEQOQ
DCUGUFGENEWNQFCUEQPVTKDWKGUFGGORTGICFQTGUTWTCKUKPENWUKXGCITQKPFUVTKCU
5QOGPVGRQTWOEWTVQRGTQFQRQUVGTKQTGFKQFC%QPUVKVWKQFGGFC
EQPUGSWGPVGWPKECQFQUUKUVGOCUFGRTGXKFPEKCTWTCNGWTDCPQUGWVKNK\QWC
TGOWPGTCQEQOQDCUGRCTCCKPEKFPEKCFCUEQPVTKDWKGUFGUUGUGVQT
#GZRGTKPEKC
FGUGWVKNK\CTCTGOWPGTCQEQOQDCUGFGKPEKFPEKCFCUEQPVTKDWKGU
de empregadores rurais) foi rapidamente abandonada, porm o que se sucedeu
HQTCOKPPFXGKUFKUEWUUGUSWCPVQEQPUVKVWEKQPCNKFCFGFCEQPVTKDWKQUQDTGQ
XCNQTFCRTQFWQQWUQDTGCTGEGKVCFGRTQFWVQUTWTCKUKPUVKVWFCRCTCUWDUVKVWKT
CEQPVTKDWKQUQDTGCHQNJCFGUCNTKQU
7.1 CONTRIBUIO DAS AGROINDSTRIAS
Com a Lei n. 8.870/1994 houve uma tentativa de se imputar s pessoas jurdicas
FGFKECFCU  RTQFWQ CITQKPFWUVTKCN WOC EQPVTKDWKQ ECNEWNCFC UQDTG Q XCNQT
GUVKOCFQ FC RTQFWQ CITEQNC RTRTKC EQPUKFGTCFQ UGW RTGQ FG OGTECFQ GO
UWDUVKVWKQEQPVTKDWKQUQDTGHQNJCFGUCNTKQUFQUVTCDCNJCFQTGUFQUGVQTTWTCN
'UUCEQPVTKDWKQGPVTGVCPVQHQKHWNOKPCFCRGNQ5WRTGOQ6TKDWPCN(GFGTCNRQT
22

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

OGKQFC#Q&KTGVCFG+PEQPUVKVWEKQPCNKFCFGP&(FG
$4#5+.#&+
n. 1.103-1/DF).
&GCEQTFQEQOQGPVGPFKOGPVQFC5WRTGOC%QTVGSWCPFQQho do art. 25 da Lei
PETKCEQPVTKDWKQUQEKCNUQDTGQvalor estimado da produo agrcola
RTRTKCEQPUKFGTCFQUGWRTGQFGOGTECFQGNGKPEQPUVKVWEKQPCNRQTSWGWUCDCUG
de clculo no prevista na Lei Maior. Ainda segundo esse entendimento:
1hoFQCTVFC%QPUVKVWKQRTGXSWGNGKEQORNGOGPVCTRQFGKPUVKVWKT
QWVTCUHQPVGUFGTGEGKVCRCTCCUGIWTKFCFGUQEKCNFGUVCHQTOCSWCPFQC.GK
no  UGTXGUG FG QWVTCU HQPVGU ETKCPFQ EQPVTKDWKQ PQXC CNO
das expressamente previstas, ela inconstitucional, porque lei ordinria,
insuscetvel de veicular tal matria.

&GUUC HQTOC C EQPVTKDWKQ FCU GORTGUCU CITQKPFWUVTKCKU RGTOCPGEGW UQDTG


a folha de salrios at outubro de 2001, quando a Lei n. 10.256/2001 alterou a
.GKPFGOQFQSWGCEQPVTKDWKQFCITCPFGOCKQTKCFGUUCUGORTGUCU
RCUUQWCKPEKFKTUQDTGQXCNQTFCTGEGKVCDTWVCRTQXGPKGPVGFCEQOGTEKCNK\CQFC
RTQFWQGOUWDUVKVWKQUEQPVTKDWKGUUQDTGCTGOWPGTCQCGZGORNQFQSWG
LQEQTTKCEQOTGNCQCQUGORTGICFQTGUTWTCKURGUUQCULWTFKECU
7.2 EMPREGADORES RURAIS PESSOAS JURDICAS
#RGUCTFGPQJCXGTFGEKUQPQODKVQFQ56(CEGTECFCUEQPVTKDWKGUUWDUVKVWVKXCU
FQU GORTGICFQTGU TWTCKU RGUUQCU LWTFKECU GUVCU PC FKEQ FQ CTV  FC .GK
PVCODOVOUKFQQDLGVQFGEQPVGUVCGUVCPVQRGNCFQWVTKPCSWCPVQ
pela jurisprudncia.
&GPVTG QU CTIWOGPVQU GO HCXQT FC KORQUUKDKNKFCFG FG UG FGPKT C TGEGKVC DTWVC
RTQXGPKGPVGFCEQOGTEKCNK\CQFCRTQFWQEQOQDCUGFGKPEKFPEKCFCEQPVTKDWKQ
social dos produtores rurais pessoas jurdicas, nos termos do referido art. 25,
FGUVCECOUGKPKEKCNOGPVGQUEQPVKFQUPCFGEKUQRTQHGTKFCPQ/CPFCFQFG5GIWTCPC
n. 1999.71.00.021280-5/RS (BRASIL, TRIBUNAL REGIONAL FEDERAL DA
4a REGIO), que reconheceu a inconstitucionalidade do dispositivo, uma vez que:
Ao estabelecer para o empregador rural pessoa jurdica nova forma de
RCICOGPVQFGEQPVTKDWKQGZKOKPFQQFCSWGNCKPEKFGPVGUQDTGCHQNJCFG
UCNTKQUGGZKIKPFQQWVTCKPEKFGPVGUQDTGCRTQFWQTWTCNo legislador criou
nova contribuio+UUQRQTSWGCEQPVTKDWKQKPUVKVWFCPQUGUWDUWOGU
JKRVGUGURTGXKUVCUPQKPEKUQFQCTVKIQFC%QPUVKVWKQ(GFGTCNLSWG
PQUGVTCVCFGEQPVTKDWKQUQDTGCHQNJCFGUCNTKQUe no se mostra possvel a
incidncia sobre o faturamento, uma vez que sobre tal base j incide contribuio

%QPU .
#KPUVKVWKQFCPQXCEQPVTKDWKQUQOGPVGRQFGTKCVGTQEQTTKFQOGFKCPVG
.GK%QORNGOGPVCTGCFGOCKUFGXGTKCQDUGTXCTCTGITCSWGRTQDGCCFQQ
FGHCVQIGTCFQTQWDCUGFGENEWNQRTRTKQUFGEQPVTKDWKQLFKUETKOKPCFC
Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

23

Mrio Pereira de Pinho Filho

PC%QPUVKVWKQ(GFGTCNVGPFQGOXKUVCQFKURQUVQPQho do artigo 195, c.c


artigo 154, inciso I, ambos do referido Diploma. (Grifei)

de se notar que os argumentos apontados pelo Tribunal Regional Federal da


4a 4GIKQ RCTC CHCUVCT C CRNKECQ FQ caput e incisos I e II do art. 25 da Lei
n. 8.870/1994 so, em determinados aspectos, semelhantes aos apontados pelo STF
PC#&+P&(RCTCFGENCTCTCKPEQPUVKVWEKQPCNKFCFGFCEQPVTKDWKQFCU
CITQKPFUVTKCUUQDTGQXCNQTGUVKOCFQFCRTQFWQCITEQNCRTRTKCEQPUKFGTCFQUGW
RTGQFGOGTECFQQWUGLCPQGUVCPFQQXCNQTDTWVQFGEQTTGPVGFCEQOGTEKCNK\CQ
FC RTQFWQ GPVTG CU JKRVGUGU RTGXKUVCU PQ CTV  FC %CTVC FC 4GRDNKEC C
KPUVKVWKQ FC PQXC EQPVTKDWKQ UQOGPVG RQFGTKC VGT QEQTTKFQ OGFKCPVG NGK
EQORNGOGPVCTGOEQPUQPPEKCEQOQFKURQUVQPQho do mesmo artigo.
*CKPFCUGIWPFQCFGEKUQFGUGQDUGTXCTCTGITCSWGRTQDGCCFQQFGHCVQ
IGTCFQTQWDCUGFGENEWNQRTRTKQUFGEQPVTKDWKQLFKUETKOKPCFCPC%QPUVKVWKQ
Federal (bis in idem QSWGKORQUUKDKNKVCCKPEKFPEKCFGEQPVTKDWKQPQXCUQDTG
QHCVWTCOGPVQWOCXG\SWGUQDTGGUUCDCUGLKPEKFGC%QPU
Para Machado e Machado Segundo (2001, p. 103), alm dos argumentos utilizados
pelo Poder Judicirio:
'UUCHQTOCFKHGTGPEKCFCFGVTKDWVCQRCTCWPUEQPVTKDWKPVGUCVXCPVCLQUC
OCURCTCQWVTQUTGRTGUGPVCPWUKPUWRQTVCXGNOGPVGOCKQTSWGWOCVTKDWVCQ
sobre a folha de salrios. Basta que a empresa possua elevada receita bruta,
GTGFW\KFCHQNJCFGUCNTKQURCTCSWGQPWUTGRTGUGPVCFQRGNCFWRNCVTKDWVCQ
da receita se torne muito maior que o arcado pelos contribuintes em geral.

Esses autores (idem, p. 105) concluem que:


=?UGCEQPVTKDWKQETKCFCRGNC.GKPo 8.870/94 for vista como um adicional
FC%QPUQWWOCGNGXCQKPFKTGVCFGUWCCNSWQVCUWCKPXCNKFCFGUWDUKUVG
RQT XKQNCQ CQU RTKPERKQU FC KUQPQOKC FC ECRCEKFCFG EQPVTKDWVKXC FC
GSWKFCFGPQEWUVGKQFCUGIWTKFCFGUQEKCNFQPQEQPUEQGRTKPEKRCNOGPVG
do princpio da proporcionalidade.

4GUUCNVGUGSWGCUUKOEQOQPQECUQFCUCITQKPFUVTKCUCUEQPVTKDWKGUUWDUVKVWVKXCU
FGRTQFWVQTGUTWTCKURGUUQCULWTFKECUVCODOUQHTGTCOOQFKECGUEQOCGFKQ
da Lei n. 10.256/2001.
7.3 EMPREGADORES RURAIS PESSOAS FSICAS
&Q OGUOQ OQFQ SWG CU EQPVTKDWKGU FG CITQKPFUVTKCU G GORTGICFQTGU TWTCKU
RGUUQCULWTFKECUCEQPVTKDWKQUWDUVKVWVKXCFQUGORTGICFQTGUTWTCKURGUUQCUHUKECU
tambm foi alvo de incontveis questionamentos.

24

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

Recentemente, por meio do Recurso Extraordinrio n. 363.852/MG (BRASIL,


Supremo Tribunal Federal), o STF declarou a inconstitucionalidade do art. 1o
FC.GKPFGFGFG\GODTQFGSWGFGWPQXCTGFCQCQUCTVKIQU
incisos V e VII, 25, incisos I e II, e 30, inciso IV, da Lei n. 8.212, de 24 de julho
FGFGUQDTKICPFQQ(TKIQTEQ/CVCDQK5#FCTGVGPQGFQTGEQNJKOGPVQ
RQTUWDTQICQFCEQPVTKDWKQKPEKFGPVGUQDTGCTGEGKVCDTWVCFGGORTGICFQTGU
pessoas naturais.
Os trechos do voto do ministro Marco Aurlio, relator do recurso extraordinrio,
trazem uma sntese dos elementos apontados no julgamento para fundamentar essa
KORQTVCPVGFGEKUQSWGNGXQWFGENCTCQFGKPEQPUVKVWEKQPCNKFCFGFCEQPVTKDWKQ
dos empregadores rurais pessoas naturais:
0CTGFCQRTKOKVKXCCPVGTKQT'OGPFC%QPUVKVWEKQPCNPo 20/98, tratando-se
FGGORTGICFQTCEQPVTKDWKQFGEQTTGTKCFCHQNJCFGUCNTKQUFQHCVWTCOGPVQ
QWFQNWETQPQUWTIKPFQCRQUUKDKNKFCFGFGUGVGTEWOWNCQGOXKTVWFGFG
CVQPQTOCVKXQQTFKPTKQ5QOGPVGC%QPUVKVWKQ(GFGTCNSWGEQPUKFGTCFQ
QOGUOQHGPOGPQLWTFKEQRQFGCDTKTGZEGQWPKEKFCFGFGKPEKFPEKC
FGEQPVTKDWKQ
[...]
QRTQFWVQTTWTCNRGUUQCPCVWTCNECEQORGNKFQCUCVKUHC\GTFGWONCFQC
EQPVTKDWKQUQDTGCHQNJCFGUCNTKQUGFGQWVTQC%QPUPQJCXGPFQNWICT
RCTCVGTUGPQXQPWUTGNCVKXCOGPVGCQPCPEKCOGPVQFCUGIWTKFCFGUQEKCN
isso a partir de valor alusivo venda de bovinos. Cumpre ter presente, at
OGUOQCTGITCFQKPEKUQ++FQCTVKIQFC%QPUVKVWKQ(GFGTCNPQSWG
veda instituir tratamento desigual entre contribuintes que se encontrem em
UKVWCQGSWKXCNGPVG&GCEQTFQEQOQCTVKIQho, do Diploma Maior,
UGQRTQFWVQTPQRQUUWKGORTGICFQUECEQORGNKFQKPGZKUVGPVGCDCUGFG
KPEKFPEKCFCEQPVTKDWKQCHQNJCFGUCNTKQUCTGEQNJGTRGTEGPVWCNUQDTG
Q TGUWNVCFQ FC EQOGTEKCNK\CQ FC RTQFWQ 5G CQ EQPVTTKQ EQPVC EQO
empregados, estar obrigado no s ao recolhimento sobre a folha de salrios,
EQOQVCODONGXCPFQGOEQPVCQHCVWTCOGPVQFC%QPVTKDWKQ5QEKCNRCTC
(KPCPEKCOGPVQFC5GIWTKFCFG5QEKCN%QPUGFCRTGXKUVCVQOCFCCOGUOC
base de incidncia, o valor comercializado no artigo 25 da Lei no 8.212/91.
#UUKOPQHQUUGUWEKGPVGCFWRNKEKFCFGEQPUKFGTCFQQHCVWTCOGPVQVGOUG
ainda, a quebra da isonomia.
#UUGPVQWQ2NGPTKQSWGQho do artigo 25 da Lei no 8.870/94 fulminado
GPUGLCTCHQPVGFGEWUVGKQUGOQDUGTXPEKCFQhoFQCTVKIQFC%QPUVKVWKQ
Federal, ou seja, sem a vinda balha de Lei complementar. O enfoque serve,
UQDQPIWNQFCGZKIPEKCFGUVCNVKOCPQVQECPVGFKURQUKQFQCTVKIQ
da Lei no 8.212/91. que, mediante lei ordinria, versou-se a incidncia da
EQPVTKDWKQUQDTGCRTQXGPKGPVGFCEQOGTEKCNK\CQRGNQGORTGICFQTTWTCN
RGUUQCPCVWTCN=?GPVGPFGPFQUGSWGEQOGTEKCNK\CQFCRTQFWQCNIQ
diverso de faturamento e este no se confunde com receita, tanto assim que a
Emenda Constitucional no 20/98 inseriu, ao lado do vocbulo faturamento,
no inciso I do artigo 195, o vocbulo receita. Ento, no h como deixar
de assentar que a nova fonte deveria estar estabelecida em lei complementar.
Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

25

Mrio Pereira de Pinho Filho

No mesmo sentido o voto do ministro Cezar Peluso, cujos trechos mais relevantes
para este estudo reproduz-se a seguir:
[...] no obstante a Lei no 8.212/91 tenha empregado, eufemisticamente,
Q XQEDWNQ TGEGKVC DTWVC CQ KPUVKVWKT C GZCQ PQ CTV  KPEKUQU + G ++
Impecvel, ainda, o argumento de S. Exa. de que, antes da EC no 20/98, no se
RQFGTKCKPUVKVWKTEQPVTKDWKQUQDTGCTGEGKVCHCNVCFGRTGXKUQEQPUVKVWEKQPCN
[...] Alm disso, sob tal base de clculo, o empregador rural pessoa fsica recebe
VTCVCOGPVQVTKDWVTKQFGUHCXQTXGNGOTGNCQCQUEQPVTKDWKPVGUPQTWTCKU
que contribuem apenas sobre as fontes previstas nas alneas do art. 195, inc. I,
o que evidencia ofensa ao princpio da isonomia. Assim, o art. 150, inc. II. Da
%QPUVKVWKQFC4GRDNKECCVKPIKFQITCXGOGPVGEQOQQCTVKPEKUQ8
SWGGUVCDGNGEGCGSWKFCFGPCHQTOCFGRCTVKEKRCQPQEWUVGKQ

Em que pesem os argumentos contrrios deciso, esta foi reafirmada por


unanimidade no julgamento do Recurso Extraordinrio n. 596177/RS (BRASIL,
Supremo Tribunal Federal), com repercusso geral reconhecida pelo STF,
cujos fundamentos em nada se diferenciaram daqueles j arrolados no Recurso
Extraordinrio n. 363.852/MG.
7.4 FUNDAMENTOS COMUNS QUANTO
INCONSTITUCIONALIDADE DAS CONTRIBUIES
SUBSTITUTIVAS DOS PRODUTORES RURAIS
Conforme se pode observar, os argumentos que tm balizado a discusso quanto
 KPEQPUVKVWEKQPCNKFCFG FCU EQPVTKDWKGU UWDUVKVWVKXCU FG GORTGICFQTGU TWTCKU
RGUUQCUHUKECULWTFKECU GFGCITQKPFUVTKCUIWCTFCOOWKVC UGOGNJCPCGPVTG UK
4GUWOKFCOGPVGCTOCUGSWG
a) essas foram criadas com base em fonte de custeio (receita) no prevista no art. 195
FC%QPUVKVWKQUGOCQDUGTXPEKCFQUGWhoQSWCNFGVGTOKPCUWCKPUVKVWKQ
RQTNGKEQORNGOGPVCT
b) constituem bis in idemEQOC%QPUUGOSWGJCLCCWVQTK\CQEQPUVKVWEKQPCN
GZRTGUUCRCTCVCNUGPFQSWGUQOGPVGC%QPUVKVWKQ(GFGTCNRQFGCDTKTGZEGQ
WPKEKFCFGFGKPEKFPEKCFGEQPVTKDWKQ
E QURTQFWVQTGUTWTCKUGUVQUWDOGVKFQUCWOCVTKDWVCQOCKUITCXQUCUGEQORCTCFQU
CQUFGOCKUEQPVTKDWKPVGURQKUUQQDTKICFQUCUCVKUHC\GTCEQPVTKDWKQUQDTGC
HQNJCFGUCNTKQUC%QPUGCEQPVTKDWKQKPEKFGPVGUQDTGCEQOGTEKCNK\CQFC
RTQFWQTWTCNPQCNECPCPFQGUVCUNVKOCUCUFGOCKUGORTGUCUQWGSWKRCTCFQU
restando, desse modo, malferido o princpio da igualdade tributria previsto no
art. 150, II da CF/1988.
2GTEGDGUGCSWKWOCEQPVTCFKQ2TKOGKTCOGPVGUGCTOCEQODCUGGOGPVGPFKOGPVQ
assentado no STF, que receita no se confunde com faturamento e que, por essa
26

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

TC\QCUEQPVTKDWKGUFQURTQFWVQTGUTWTCKUVGTKCOUKFQETKCFCUUGOCQDUGTXPEKC
FQ h o FQ CTV  FC %QPUVKVWKQ Q SWCN FGVGTOKPC UWC KPUVKVWKQ RQT NGK
complementar.
#NGICUGCKPFCUGTCEQPVTKDWKQKPEQPUVKVWEKQPCNRQTHC\GTWUQFGDCUGFGKPEKFPEKC
UGOGNJCPVGFC%QPUSWGQHCVWTCOGPVQ1TCGUUGUCTIWOGPVQUPQRQFGO
coexistir, pois se receita e faturamento tm conceitos distintos, no se pode, como
EQPUGSWPEKCNIKECCTOCTSWGCEQPVTKDWKQGZKIKFCFQUGVQTTWTCNHQKKPUVKVWFC
em bis in idemEQOC%QPU
&GVQFQOQFQCVWCNOGPVGCUEQPVTKDWKGUUWDUVKVWVKXCUFQUGVQTTWTCNVOEQOQ
base legal a Lei n. 10.256/2001, de forma que muitos dos argumentos alegados
na discusso acerca de sua inconstitucionalidade j foram relevados em razo
da nova ordem estabelecida pela Emenda Constitucional n. 20/1998. Porm,
RGTUKUVGO FXKFCU PQ SWG UG TGHGTG  RQUUKDKNKFCFG FG CU EQPVTKDWKGU FQ UGVQT
rural representarem afronta ao princpio da isonomia, o que ser analisado mais
detalhadamente em captulo parte.
7.5 ADEQUAO DAS CONTRIBUIES SUBSTITUTIVAS
EM GERAL CONSTITUIO DE 1988
,UGXKWPQKVGOSWGHQTCOKPUVKVWFCUQWVTCUEQPVTKDWKGUGOUWDUVKVWKQ
SWGNCUKPEKFGPVGUUQDTGCHQNJCFGUCNTKQUPQUQOGPVGEQOTGNCQCQUGVQTTWTCN
# CWVQTK\CQ RCTC C UWDUVKVWKQ FCU EQPVTKDWKGU FCU OKETQGORTGUCU G FCU
empresas de pequeno porte decorre do disposto na alnea d do inciso III do art.
FC%QPUVKVWKQ%QOTGNCQUGORTGUCUFQUUGVQTGUKPFWUVTKCNFGUGTXKQUG
FQEQOTEKQXCTGLKUVCCUEQPVTKDWKGUUWDUVKVWVKXCUETKCFCURGNC.GKP
GCNVGTCGURQUVGTKQTGUVOCORCTQPQVGZVQEQPUVKVWEKQPCNCNVGTCFQRGNCU'OGPFCU
%QPUVKVWEKQPCKUPGP+UUQKORNKECEQPHQTOGUGCTOQWSWG
PQUGRQFGOCKUCNGICTCKPEQPUVKVWEKQPCNKFCFGFGUUCUEQPVTKDWKGUUGLCGOTC\Q
FGUWCKPUVKVWKQRQTNGKQTFKPTKCUGLCUQDQCTIWOGPVQFGSWGJCXGTKCbis in idem
EQOC%QPUUGOCWVQTK\CQEQPUVKVWEKQPCN
2CTC CU CUUQEKCGU FGURQTVKXCU SWG OCPVO GSWKRG FG HWVGDQN RTQUUKQPCN EWLC
EQPVTKDWKQKPEKFGUQDTGCTGEGKVCDTWVCFGEQTTGPVGFQUGURGVEWNQUFGURQTVKXQU
patrocnio, licenciamento de uso de marcas e smbolos, publicidade, propaganda
e de transmisso de espetculos desportivos, institudas pela Lei n. 9.528, de 10 de
FG\GODTQFGXCNGOCUOGUOCUTGITCUCRNKEXGKUUEQPVTKDWKGUFQURTQFWVQTGU
rurais criadas antes das Emendas Constitucionais n. 20/1998 e n. 42/2003.
 FG UG EQPENWKT RQTVCPVQ SWG CU EQPVTKDWKGU FGUUCU GPVKFCFGU VCODO UQ
inconstitucionais. Ademais, nesse sentido a concluso de Martins (2005, p. 210):
A base de clculo estabelecida para clubes de futebol inconstitucional, pois
PQVGORTGXKUQPC%QPUVKVWKQ'UVCFKURGSWGCEQPVTKDWKQFCUGORTGUCU
Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

27

Mrio Pereira de Pinho Filho

ECNEWNCFCUQDTGCHQNJCFGUCNTKQU
CTV+ #EQPVTKDWKQFGVGTOKPCFC
PQhho a 9oFQCTVFC.GKPUWDUVKVWKCEQPVTKDWKQFCGORTGUC
UGOSWGJCLCRGTOKUUQEQPUVKVWEKQPCNRCTCGUUGO.QIQUQOGPVGRQTNGK
EQORNGOGPVCTSWGUGRQFGTKCKPUVKVWKTVCNEQPVTKDWKQ
ho do art. 195 da
%QPUVKVWKQ 

 FG UG QDUGTXCT SWG Q OGUOQ CTIWOGPVQ  XNKFQ RCTC CU EQPVTKDWKGU FG
empregadores rurais pessoas jurdicas, institudas pela Lei n. 8.870/1994.
7.6 AS CONTRIBUIES DO SETOR RURAL ANTE AS ALTERAES
TRAZIDAS PELAS EMENDAS CONSTITUCIONAIS N. 20/1998 E
N. 42/2003
0QCETFQTGNCVKXQCQ4GEWTUQ'ZVTCQTFKPTKQP/)CFGENCTCQFG
KPEQPUVKVWEKQPCNKFCFG FC EQPVTKDWKQ FG GORTGICFQTGU TWTCKU RGUUQCU PCVWTCKU
RTGXKUVCPQCTVFC.GKPTGUVTKPIGUGTGFCQFCFCRGNQCTVo da
.GKPGUCVWCNK\CGUQEQTTKFCUCVC.GKP6CPVQSWG
UG HCNC GO KPEQPUVKVWEKQPCNKFCFG CV SWG NGIKUNCQ PQXC CTTKOCFC PC 'OGPFC
%QPUVKVWEKQPCNPXGPJCKPUVKVWKTCEQPVTKDWKQ
Com o advento da Emenda Constitucional n. 20/1998, o vocbulo receita passou
C EQPUVCT GZRTGUUCOGPVG FC TGFCQ FC CNPGC D FQ KPEKUQ + FQ CTV  FC
%QPUVKVWKQTGUVCPFQGUXC\KCFQQCTIWOGPVQFGSWGCGZKIPEKCFGEQPVTKDWKQ
UQDTGGUUCDCUGGPUGLCTKCHQPVGFGEWUVGKQUGOQDUGTXPEKCFQho do artigo 195 da
%QPUVKVWKQ(GFGTCNQWUGLCUGOCXKPFCDCKNCFGNGKEQORNGOGPVCT
Consoante j se destacou no item 7.4, considerando-se que o Supremo Tribunal
Federal j se posicionou no sentido de que receita e faturamento so conceitos
FKUVKPVQU UGTKC CDUWTFC C EQPENWUQ FG SWG CU EQPVTKDWKGU FQ UGVQT TWTCN
SWG
incidem sobre a receita) teriam sido institudas em bis in idem EQO C %QPU
(que incide sobre o faturamento). Entretanto, como esse tem sido um elemento
TGKVGTCFCOGPVGCRQPVCFQRCTCLWUVKECTCKPEQPUVKVWEKQPCNKFCFGFGUUCUEQPVTKDWKGU
cabe aqui destacar que, com a Emenda Constitucional n. 42/2003, foi facultado
CQNGIKUNCFQTUWDUVKVWKTCUEQPVTKDWKGUUQDTGCHQNJCFGUCNTKQUFCUGORTGUCURQT
outras, cuja base pode ser tanto a receita quanto o faturamento.
&GUUCHQTOCCRCTVKTFCUEKVCFCUGOGPFCUGUVQNGIKUNCFQTCWVQTK\CFQCNCPCTOQ
desse permissivo constitucional para substituir o tributo sobre a folha de salrios
VCODORQTEQPVTKDWKQUQDTGQHCVWTCOGPVQOGUOQSWGGObis in idem com a
%QPUPGUUGUGPVKFQSWGUGVGORQUKEKQPCFQQ6TKDWPCN(GFGTCNFCa Regio
(BRASIL, AC n. 2007.70.03.004958-9/PR):
%QPHQTOGLCUUGPVQWQ56(
44''G CUEQPVTKDWKGURCTCC
seguridade social podem ser institudas por lei ordinria, quando compreendidas
nas hipteses do art. 195, I, CF, s se exigindo lei complementar, quando se
28

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

EWKFCFGETKCTPQXCUHQPVGUFGPCPEKCOGPVQFQUKUVGOC
%(CTVRCT 
(RE 150755-PE, DJ 20-08-93).

Vale referir que, na concluso do voto proferido no RE no 363.852/MG, o relator


/KPKUVTQ/CTEQ#WTNKQTGUUCNXQWCFGENCTCQFGKPEQPUVKVWEKQPCNKFCFGCVSWG
NGIKUNCQPQXCCTTKOCFCPC'OGPFC%QPUVKVWEKQPCNPo 20/98, viesse a instituir
CEQPVTKDWKQ
[...]
%QOQ EQPUGSWPEKC EQO C GFKQ FC .GK Po 10.256/2001, que deu nova
TGFCQCQCTVKIQFC.GKPo 8.212/91, resta superada a inconstitucionalidade
FCEQPVTKDWKQQTCGOFGDCVG
[...]
Logo, no h falar em inconstitucionalidade do artigo 25 da Lei no 8.212/91,
PCTGFCQFCFCRGNC.GKPo 10.256/01, conforme postulado na inicial, uma
vez que em conformidade com os preceitos da Lei Maior.
[...]
#UUKOUGPFQFGXKFCUCUEQPVTKDWKGUUQEKCKUKPEKFGPVGUUQDTGCTGEGKVCDTWVCFC
EQOGTEKCNK\CQFGRTQFWVQURGNQGORTGICFQTTWTCNRGUUQCHUKECapenas a partir
da entrada em vigor da Lei no 10.256/01, em 10.07.2001, a empresa recorrente
TGURQPUXGN RQT UWDUVKVWKQ VTKDWVTKC RGNC TGVGPQ G TGEQNJKOGPVQ FCU
mesmas somente a partir desta data, quando em vigor referida lei.
[...]

#RGUCTFCUCUUGTVKXCUFGSWGCUEQPVTKDWKGUFQURTQFWVQTGUTWTCKUUQOGPVGUGTKCO
KPEQPUVKVWEKQPCKU CV SWG NGIKUNCQ PQXC VTC\KFC RGNC 'OGPFC %QPUVKVWEKQPCN
P  XKGUUG C KPUVKVWKT Q VTKDWVQ G FQ HCVQ FG SWG VQFC C CVWCN NGIKUNCQ
TGNCEKQPCFC C GUUCU EQPVTKDWKGU HQK GFKVCFC GO FCVC RQUVGTKQT  TGHGTKFC
GOGPFCPQUGRQFGQNXKFCTSWGFGPVTGCUTC\GUCRQPVCFCURCTCCFGENCTCQFG
KPEQPUVKVWEKQPCNKFCFG FC EQPVTKDWKQ FQU GORTGICFQTGU TWTCKU RGUUQCU PCVWTCKU
estaria a ofensa ao princpio da isonomia ou igualdade tributria.
#UUKOEQPUKFGTCPFQUGSWGCPQXCNGIKUNCQPQVTQWZGSWCNSWGTCNVGTCQPGUUG
UGPVKFQHC\UGPGEGUUTKQXGTKECTUGUQXNKFQUQURTGUUWRQUVQUCRQPVCFQURCTC
LWUVKENCQSWGHCTUGPCUGQUGIWKPVG

8 A CONTRIBUIO DOS PRODUTORES RURAIS E O


PRINCPIO DA ISONOMIA OU IGUALDADE TRIBUTRIA
8.1 O PRINCPIO DA ISONOMIA
O princpio da isonomia , sem sombra de dvidas, o principal pilar do Estado
democrtico de direito. A isonomia serve de sustentculo para os demais princpios
FGFKTGKVQGFGXGUGTXKTVCODOUQDRGPCFGPWNKFCFGFGKPURKTCQRCTCSWCNSWGT
regra que se queira estabelecer.
Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

29

Mrio Pereira de Pinho Filho

Para Borges (2011, p. 45):


# KUQPQOKC  C RTRTKC %QPUVKVWKQ %QPHWPFGUG EQO GNC CQ RGTOGCT
VQFQUQUFKTGKVQUGFGXGTGUSWGC%QPUVKVWKQKPUVKVWKW5GOKUQPQOKCGUVCTKC
simplesmente supressa a CF de 1988 como um todo. No ela portanto uma
palavra que possa ser extirpada do texto constitucional e substituda, sem
maiores delongas, por outra, como se fora uma intil quinquilharia.

Na CF/1988, o princpio da isonomia encontra-se insculpido no art. 5o:


Art. 5o6QFQUUQKIWCKURGTCPVGCNGKUGOFKUVKPQFGSWCNSWGTPCVWTG\C
garantindo-se aos brasileiros e aos estrangeiros residentes no Pas
CKPXKQNCDKNKFCFGFQFKTGKVQXKFCNKDGTFCFGKIWCNFCFGUGIWTCPCG
propriedade, nos termos seguintes:
+JQOGPUGOWNJGTGUUQKIWCKUGOFKTGKVQUGQDTKICGUPQUVGTOQUFGUVC
%QPUVKVWKQ

Da leitura do dispositivo constitucional possvel se extrair que este tem o legislador


como principal destinatrio, pois se ele pudesse criar normas distintivas de
pessoas, coisas ou fatos, que devessem ser tratados com igualdade, o mandamento
constitucional se tornaria inteiramente intil (SILVA, 2006, p. 216). Por bvio, a
NGKRQFGKPUVKVWKTVTCVCOGPVQFGUKIWCNGOTGNCQCFGUVKPCVTKQUSWGUGGPEQPVTGO
GOUKVWCGUFKUVKPVCU8CNGFK\GTSWGCCRNKECQFQRTKPERKQFCKIWCNFCFGFGRGPFG
FGWOETKVTKQFKHGTGPEKCFQTGFGWOOCUGTCNECPCFQ
8+.#R 
2CTCTGEQPJGEKOGPVQFCUFKHGTGPEKCGUSWGRQFGOUGTHGKVCUUGOQHGPUCCQRTKPERKQ
da isonomia:
[...] tem-se que investigar, de um lado, aquilo que adotado como critrio
FKUETKOKPCVTKQFGQWVTQNCFQEWORTGXGTKECTUGJLWUVKECVKXCTCEKQPCN
KUVQHWPFCOGPVQNIKEQRCTCXKUVCFQVTCQFGUKIWCNCFQTCEQNJKFQCVTKDWKT
Q GURGEEQ VTCVCOGPVQ LWTFKEQ EQPUVTWFQ GO HWPQ FC FGUKIWCNFCFG
RTQENCOCFC (KPCNOGPVG KORGPFG CPCNKUCT UG C EQTTGNCQ QW HWPFCOGPVQ
TCEKQPCN CDUVTCVCOGPVG GZKUVGPVG  KP EQPETGVQ CPCFQ EQO QU XCNQTGU
prestigiados no sistema constitucional. A dizer: se guarda ou no harmonia
com eles (MELLO, 2005, p. 21-22).

8.2 O PRINCPIO DA IGUALDADE TRIBUTRIA E SUA


APLICAO EM RELAO S CONTRIBUIES PARA
A SEGURIDADE SOCIAL
1 RTKPERKQ FC KIWCNFCFG VTKDWVTKC  OGTC TGRTQFWQ FQ RTKPERKQ IGTCN
da isonomia, segundo o qual todos so iguais perante a lei. Apresenta-se aqui
como garantia de tratamento uniforme, pela entidade tributante, de quantos se
GPEQPVTCTGO GO KIWCKU EQPFKGU
/#%*#&1  R   0QU VGTOQU FQ
CTVFC%QPUVKVWKQ
30

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

Art. 150. Sem prejuzo de outras garantias asseguradas ao contribuinte,


vedado Unio, aos Estados, ao Distrito Federal e aos Municpios:
II instituir tratamento desigual entre contribuintes que se encontrem em
UKVWCQ GSWKXCNGPVG RTQKDKFC SWCNSWGT FKUVKPQ GO TC\Q FG QEWRCQ
RTQUUKQPCNQWHWPQRQTGNGUGZGTEKFCKPFGRGPFGPVGOGPVGFCFGPQOKPCQ
jurdica dos rendimentos, ttulos ou direitos.

%QOQ HQTOC FG ICTCPVKT GEEKC PC CRNKECQ FGUUG RTKPERKQ EQO TGNCQ U
EQPVTKDWKGURCTCCUGIWTKFCFGUQEKCNQEQPUVKVWKPVGTGHQTOCFQTKPUGTKWQho no
CTVFC%CTVCRCTCFKURQTSWG#UEQPVTKDWKGUUQEKCKURTGXKUVCUPQKPEKUQ+
deste artigo podero ter alquotas ou bases de clculo diferenciadas, em razo da
CVKXKFCFGGEQPOKECQWFCWVKNK\CQKPVGPUKXCFGOQFGQDTC
KPENWFQRGNC'OGPFC
Constitucional n. 20/1998).
A Emenda Constitucional n. 47/2005 alterou o dispositivo trazido pela Emenda
%QPUVKVWEKQPCNPCOFGRTGXGTVCODOCRQUUKDKNKFCFGFGFKHGTGPEKCQ
FGVTCVCOGPVQGOTC\QFQRQTVGFCGORTGUCQWFCEQPFKQGUVTWVWTCNFQOGTECFQ
FGVTCDCNJQ%QPTCUG
h o #U EQPVTKDWKGU UQEKCKU RTGXKUVCU PQ KPEKUQ + FQ caput deste artigo
podero ter alquotas ou bases de clculo diferenciadas, em razo da atividade
GEQPOKECFCWVKNK\CQKPVGPUKXCFGOQFGQDTCFQRQTVGFCGORTGUCQW
FCEQPFKQGUVTWVWTCNFQOGTECFQFGVTCDCNJQ
4GFCQFCFCRGNC'OGPFC
Constitucional n. 47/2005.)

%QOCKPUGTQFGUUGFKURQUKVKXQTGUVQWGUENCTGEKFQSWGQNGIKUNCFQTRQFGTTGEQTTGT
a critrios diferenciados no estabelecimento de regras tributrias, tornando mais
GSWPKOGQVTCVCOGPVQGPVTGQUEQPVTKDWKPVGUPCHQTOCFGRCTVKEKRCQPQEWUVGKQ
do sistema de seguridade social.
'UUC FKHGTGPEKCQ RQFG UG VTCFW\KT PC CFQQ FG CNSWQVCU FKHGTGPEKCFCU QW PC
UWDUVKVWKQ FC HQNJC FG UCNTKQU TGEGKVC HCVWTCOGPVQ QW NWETQ EQOQ DCUG FG
KPEKFPEKCFCUEQPVTKDWKGUOCUJFGUGEQPUKFGTCT
C CCVKXKFCFGGEQPOKEC
D CEQPFKQGUVTWVWTCNFQOGTECFQFGVTCDCNJQ
E QRQTVGFCGORTGUCQW
F CKPVGPUKXCWVKNK\CQFGOQFGQDTC
2QFGUGRQTVCPVQCFGRGPFGTFCCVKXKFCFGGEQPOKECQWFCEQPFKQGUVTWVWTCNFQ
OGTECFQFGVTCDCNJQTGFW\KTCNSWQVCUFGEQPVTKDWKGURCTCUGIWTKFCFGQWCKPFC
alterar suas bases de incidncia como forma de garantir o direito social de acesso ao
VTCDCNJQGFGRTGXGPKTCRTGECTK\CQFCUTGNCGUNCDQTCKU#NKUGUUCUHQTCOCNIWOCU
FCUGZRNKECGUCRTGUGPVCFCURCTCCUFGUQPGTCGUFCHQNJCFGUCNTKQURTQOQXKFCU
pela Lei n. 12.546/2011.
Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

31

Mrio Pereira de Pinho Filho

Do mesmo modo, a depender do porte da empresa, esta pode ter suas alquotas
aumentadas ou diminudas ou ainda a base de clculo alterada, tendo em vista
que, geralmente, quanto maior a empresa maior sua lucratividade e melhores
UWCURQUUKDKNKFCFGUFGHC\GTHCEGCQEWUVGKQFQUKUVGOCFGUGIWTKFCFGCQEQPVTTKQ
GORTGUCUFGOGPQTRQTVGRQFGOGPHTGPVCTFKEWNFCFGUPQEWORTKOGPVQFGUWCU
QDTKICGU#SWKTGUKFGOCKUWOCLWUVKECVKXCRCTCQVTCVCOGPVQFKHGTGPEKCFQSWG
se dispensa s micro e pequenas empresas.
Tem-se ainda que as alquotas e as bases de clculo tambm podem ser distintas
GO TC\Q FC KPVGPUKXC WVKNK\CQ FG OQ FG QDTC 'UUG  WO EQOCPFQ XQNVCFQ
GURGEKECOGPVGRCTCCUEQPVTKDWKGURTGXKFGPEKTKCUVGPFQGOXKUVCSWGCHQNJC
FGUCNTKQUCRTKPEKRCNDCUGFGKPEKFPEKCFGUUCUEQPVTKDWKGU
#FGOCKU C HKO FG CHCUVCT SWCKUSWGT FXKFCU EQO TGNCQ U DCUGU UQDTG CU
SWCKU RQFGTKCO KPEKFKT CU EQPVTKDWKGU RTGXKFGPEKTKCU RQT OGKQ FC 'OGPFC
%QPUVKVWEKQPCNPHQKKPENWFQQhPQCTVFQVGZVQEQPUVKVWEKQPCN
EQOTGHGTPEKCGZRTGUUCUQDTGCRQUUKDKNKFCFGFGUWDUVKVWKQFCEQPVTKDWKQUQDTGC
HQNJCRQTEQPVTKDWKGUKPEKFGPVGUUQDTGCTGEGKVCQWQHCVWTCOGPVQh#RNKECUG
QFKURQUVQPQhKPENWUKXGPCJKRVGUGFGUWDUVKVWKQITCFWCNVQVCNQWRCTEKCNFC
EQPVTKDWKQKPEKFGPVGPCHQTOCFQKPEKUQ+CRGNCKPEKFGPVGUQDTGCTGEGKVCQWQ
faturamento (Includo pela Emenda Constitucional n. 42, de 19.12.2003.).
#QKPENWKTQUhho e 13 do art. 195 da Carta da Repblica, o constituinte reformador
reconhece no ser razovel que as empresas que mais se utilizam de mo de obra,
KUVQ  SWG OCKU EQPVTKDWGO EQO C IGTCQ FG GORTGIQU PQ RCU UGLCO CU OCKU
RGPCNK\CFCUEQOQRCICOGPVQFGEQPVTKDWKGURTGXKFGPEKTKCUGPSWCPVQCSWGNCU
SWGSWGTGOTC\QFCPCVWTG\CFCCVKXKFCFGSWGTGOTC\QFQWUQFGCXCPCFC
tecnologia, mesmo tendo igual ou maior rentabilidade, participem com parcelas de
TGEWTUQUOWKVQKPHGTKQTGURCTCCOCPWVGPQFCRTGXKFPEKCRDNKEC
8.3 A CONTRIBUIO DOS PRODUTORES RURAIS EM FACE
DO PRINCPIO DA IGUALDADE TRIBUTRIA
#CPNKUGSWGCSWKUGHCTUQDTGCEQPVTKDWKQFQURTQFWVQTGUTWTCKUGOHCEGFQ
RTKPERKQFCKIWCNFCFGVTKDWVTKCNGXCTGOEQPUKFGTCQQUGNGOGPVQUCRQPVCFQU
RGNC FQWVTKPC G RGNC LWTKURTWFPEKC RCTC LWUVKECT C KPEQPUVKVWEKQPCNKFCFG FGUUCU
EQPVTKDWKGU5GIWPFQUGCTIWOGPVC
C QURTQFWVQTGUTWTCKUGUVQUWDOGVKFQUCWOCVTKDWVCQOCKUITCXQUCUGEQORCTCFQU
CQUFGOCKUEQPVTKDWKPVGURQKUGUVQQDTKICFQUCUCVKUHC\GTCEQPVTKDWKQUQDTG
CHQNJCFGUCNTKQUC%QPUGCEQPVTKDWKQKPEKFGPVGUQDTGCEQOGTEKCNK\CQ
FC RTQFWQ TWTCN PQ CNECPCPFQ GUVCU NVKOCU CU FGOCKU GORTGUCU QW
GSWKRCTCFQU

32

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

D GUUCHQTOCFKHGTGPEKCFCFGVTKDWVCQRCTCWPUEQPVTKDWKPVGUCVXCPVCLQUCOCU
RCTCQWVTQUTGRTGUGPVCPWUOCKQTSWGWOCVTKDWVCQUQDTGCHQNJCFGUCNTKQU
Basta que a empresa possua elevada receita bruta e reduzida folha de salrios.
Primeiramente, quanto ao argumento segundo o qual, diferentemente das empresas
GO IGTCN QU RTQFWVQTGU TWTCKU GUVQ QDTKICFQU  EQPVTKDWKQ UQDTG C HQNJC FG
UCNTKQU%QPUGEQPVTKDWKQKPEKFGPVGUQDTGCEQOGTEKCNK\CQFCRTQFWQ
TWTCNRTGEKUQGUENCTGEGTSWGFGCEQTFQEQOCNGIKUNCQSWGKPUVKVWKCEQPVTKDWKQ
FQURTQFWVQTGUTWTCKUPQJEWOWNCQGPVTGCEQPVTKDWKQKPEKFGPVGUQDTGQ
TGUWNVCFQFCEQOGTEKCNK\CQFGRTQFWVQUTWTCKUGCKPEKFGPVGUQDTGCHQNJCFGUCNTKQU
FGGORTGICFQUGVTCDCNJCFQTGUCXWNUQUOCUUKOOGTCUWDUVKVWKQFGWOCDCUGFG
incidncia (folha de salrios de segurados empregados e trabalhadores avulsos) por
QWVTC
TGEGKVCDTWVCFCEQOGTEKCNK\CQFCRTQFWQ QWUGLCCQEQPVTKDWKPVGUWLGKVQ
EQPVTKDWKQUWDUVKVWVKXCUWDUKUVGVQUQOGPVGCEQPVTKDWKQFGKPEKFGPVG
UQDTGCTGOWPGTCQFQUUGIWTCFQUEQPVTKDWKPVGUKPFKXKFWCKU
'URGEKECOGPVG EQO TGNCQ CQU GORTGICFQTGU TWTCKU RGUUQCU PCVWTCKU OGTGEG
TGRCTQVCODOCKPHQTOCQFGSWGGUVGECEQORGNKFQCUCVKUHC\GTFGWONCFQ
CEQPVTKDWKQUQDTGCHQNJCFGUCNTKQUGFGQWVTQCEQPVTKDWKQUQDTGTGUWNVCFQ
FCEQOGTEKCNK\CQFCRTQFWQTWTCNGObis in idemEQOC%QPURQKUEQPHQTOG
LUGGUENCTGEGWCEQPVTKDWKQKPEKFGPVGUQDTGQTGUWNVCFQFCEQOGTEKCNK\CQFG
RTQFWVQUTWTCKUUWDUVKVWKCEQPVTKDWKQUQDTGCHQNJCFGGORTGICFQUGVTCDCNJCFQTGU
avulsos, e mais, esses produtores, por se tratar de pessoas naturais, no se sujeitam
%QPU2QTGUUCUTC\GUHCNUQQRTKOGKTQHWPFCOGPVQVKFQEQOQJDKNCLWUVKECT
CKPEQPUVKVWEKQPCNKFCFGFGUUCUEQPVTKDWKGU
Quanto ao malferimento do princpio da igualdade tributria em razo do fato de
SWGCVTKDWVCQFGRCTEGNCFQUGORTGICFQTGUTWTCKURQUUCXKTCTGRTGUGPVCTPWU
OCKQTSWGCVTKDWVCQFCUFGOCKUGORTGUCUDCUVCPFQRCTCKUUQSWGGUUGURTQFWVQTGU
possuam elevada receita bruta e reduzida folha de salrios, recorrer-se- metodologia
proposta por Celso Antnio Bandeira de Mello9RCTCUGHC\GTVCNXGTKECQ5GIWPFQ
GUUGCWVQTRCTCUGTGEQPJGEGTCUFKHGTGPEKCGUSWGRQFGOUGTHGKVCUUGOQHGPUCCQ
princpio da isonomia, impende investigar:
C CSWKNQSWGCFQVCFQEQOQETKVTKQFKUETKOKPCVTKQ
D UG J LWUVKHKECVKXC TCEKQPCN
HWPFCOGPVQ NIKEQ  RCTC C CFQQ FQ ETKVTKQ
FGUKIWCNCFQTG
E UGCEQTTGNCQQWHWPFCOGPVQTCEKQPCNCDUVTCVCOGPVGGZKUVGPVGin concreto,
CPCFQEQOQUXCNQTGURTGUVKIKCFQUPQUKUVGOCEQPUVKVWEKQPCN#FK\GTUGIWCTFC
ou no harmonia com eles.

9 A metodologia proposta pelo autor encontra-se reproduzida no item 8.1.

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

33

Mrio Pereira de Pinho Filho

8.3.1 CRITRIO DISCRIMINATRIO

1ETKVTKQWVKNK\CFQRCTCFKHGTGPEKCTCVTKDWVCQFCUGORTGUCUGOIGTCNGCVTKDWVCQ
FQUGORTGICFQTGUFQUGVQTTWTCNEQOQLUGXGTKEQWCCFQQFGDCUGFGENEWNQ
FKUVKPVCFCSWGNCUCRNKEXGKUUFGOCKUGORTGUCUKUVQCUWDUVKVWKQFCHQNJCFG
UCNTKQUFGGORTGICFQUGVTCDCNJCFQTGUCXWNUQURGNCTGEGKVCDTWVCFCEQOGTEKCNK\CQ
de produtos rurais.
8.3.2 JUSTIFICATIVA PARA A ADOO RACIONAL
DO CRITRIO DISCRIMINATRIO

%QOQHWPFCOGPVQUNIKEQUGTKIKFQURCTCCCFQQFQETKVTKQFGUKIWCNCFQTCRQPVCO
se os seguintes:
C RTGXGPKTCRTGECTK\CQFCUTGNCGUFGVTCDCNJQGICTCPVKTQCEGUUQCQUFKTGKVQU
UQEKCKUGRTGXKFGPEKTKQUFGEQTTGPVGUFGUUCUTGNCGUG
D ICTCPVKTCGSWKFCFGPCHQTOCFGRCTVKEKRCQPQEWUVGKQRTGXKFGPEKTKQ
8.3.2.1 PRECARIZAO DAS RELAES DE TRABALHO

Dentre todos os setores da economia, um dos que apresentam os mais altos ndices
de informalidade o setor rural. Essa elevada taxa de informalidade potencializada
pela presso exercida pelos encargos sociais e previdencirios, que tm como base
os salrios pagos aos trabalhadores.
Uma vez submetidos ao labor informal, os trabalhadores do setor rural acabam por
VGTITCPFGUFKEWNFCFGUFGCEGUUQCQUFKTGKVQUSWGEQORGOQRCVTKOPKQUQEKCN
CUUQEKCFQUTGNCGUFGVTCDCNJQ
+2'#R 1WVTCEQPUGSWPEKCFKUUQ
SWGGODQTCUGGPSWCFTGOPQEQPEGKVQFGUGIWTCFQUQDTKICVTKQUECOGZENWFQU
do Regime Geral de Previdncia Social.
2QTGUUGUOQVKXQUCFGUQPGTCQFCHQNJCFGUCNTKQUOGFKCPVGCUWDUVKVWKQFC
DCUGFGENEWNQFCUEQPVTKDWKGURTGXKFGPEKTKCUFQUGORTGICFQTGUTWTCKUVGOUKFQ
CRTGUGPVCFCEQOQCNVGTPCVKXCRCTCCOGPK\CTCRTGECTKGFCFGFCUTGNCGUVTCDCNJKUVCU
no campo.
8.3.2.2 EQUIDADE NA FORMA DE PARTICIPAO NO CUSTEIO

7OCFKUVQTQFGEQTTGPVGFCWVKNK\CQFCHQNJCFGUCNTKQUEQOQDCUGFGKPEKFPEKC
FCU EQPVTKDWKGU RTGXKFGPEKTKCU  SWG CU GORTGUCU SWG WVKNK\CO OQ FG QDTC
KPVGPUKXC CECDCO RQT UGT OCKU RGPCNK\CFCU EQO Q RCICOGPVQ FG EQPVTKDWKGU
previdencirias, enquanto outras, em razo da natureza da atividade ou do uso de
CXCPCFCVGEPQNQIKCOGUOQVGPFQKIWCNQWOCKQTTGPVCDKNKFCFGRCTVKEKRCOEQO
RCTEGNCUFGTGEWTUQUOWKVQKPHGTKQTGURCTCCOCPWVGPQFCRTGXKFPEKCRDNKEC
6QOGUGRQTOQFGNQCUKVWCQFQUETKCFQTGUFGDQXKPQUEWLCWVKNK\CQFGOQFG
QDTCTGFW\KFUUKOC%CUQCUEQPVTKDWKGURTGXKFGPEKTKCUFCTGCTWTCNKPEKFKUUGO
34

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

UQDTGCHQNJCFGUCNTKQUPCFCLWUVKECTKCQHCVQFGGUUGURGEWCTKUVCUCTECTGOEQO
EQPVTKDWKGU RTQRQTEKQPCNOGPVG OWKVQ KPHGTKQTGU U UWRQTVCFCU RQT GZGORNQ
RGNQUCITKEWNVQTGUFGFKECFQUCQEWNVKXQFGJQTVCNKCUSWGUGWVKNK\COOWKVQOCKU
intensamente de mo de obra e geralmente contam com receitas bem mais modestas.
8.3.3 AFINAO ENTRE A CORRELAO OU O
FUNDAMENTO RACIONAL E OS VALORES
PRESTIGIADOS NO SISTEMA CONSTITUCIONAL

# %QPUVKVWKQ FG  GNGXQW UQDTGOCPGKTC C KORQTVPEKC FQU FKTGKVQU UQEKCKU


GRTGXKFGPEKTKQUFQUVTCDCNJCFQTGUDTCUKNGKTQURTQXCFKUUQSWGJOGPQCGUUGU
direitos ao longo de todo o texto da Carta.
#NCFQEQPFKQFGXGTFCFGKTCENWUWNCRVTGCQFKTGKVQCQVTCDCNJQGRTGXKFPEKC
encontra-se impassvel de supresso a qualquer pretexto, sob pena de transgresso aos
alicerces do Estado democrtico de direito. Nesse sentido, o art. 6oFC%QPUVKVWKQ
estabelece: Art. 6o5QFKTGKVQUUQEKCKUCGFWECQCUCFGCCNKOGPVCQo trabalho,
COQTCFKCQNC\GTCUGIWTCPCCRTGXKFPEKCUQEKCNCRTQVGQOCVGTPKFCFGG
KPHPEKCCCUUKUVPEKCCQUFGUCORCTCFQUPCHQTOCFGUVC%QPUVKVWKQ
Desse modo, estando os direitos sociais decorrentes do trabalho (BRASIL,
CONSTITUIO, art. 7o), a universalidade da cobertura e do atendimento

KFGOCTV+ GCGSWKFCFGPCHQTOCFGRCTVKEKRCQPQEWUVGKQFCUGIWTKFCFG
social (idem, art. 194, V), em harmonia com os valores prestigiados no sistema
EQPUVKVWEKQPCNDTCUKNGKTQVGOUGSWGCUWDUVKVWKQFCHQNJCFGUCNTKQURGNCTGEGKVC
DTWVCFCEQOGTEKCNK\CQFGRTQFWVQUTWTCKUETKVTKQXNKFQRCTCQdiscrmen entre
empresas rurais e urbanas, apto a ser utilizado sem ofensa ao princpio da isonomia.

9 CONCLUSO
A seguridade social constitui-se de um conjunto de princpios e regras voltado para o
estabelecimento de um sistema protetivo destinado ao provimento das necessidades
DUKECU FQ KPFKXFWQ G FG UWC HCONKC  PCPEKCFC RQT TGEWTUQU RTQXGPKGPVGU
FQUQTCOGPVQUFC7PKQFQUGUVCFQUFQUOWPKERKQUFQ&KUVTKVQ(GFGTCNGFG
EQPVTKDWKGUUQEKCKU5WCUCGUXKUCOICTCPVKCFGFKTGKVQUTGNCEKQPCFQUUTGCU
de sade, assistncia e previdncia social.
#UEQPVTKDWKGURTGXKFGPEKTKCUGUREKGFQIPGTQEQPVTKDWKGURCTCCUGIWTKFCFG
social, destinam-se exclusivamente ao pagamento de benefcios previdencirios
e tm como contribuintes os empregadores e os trabalhadores.
'OTGITCCUEQPVTKDWKGUFCUGORTGUCUKPEKFGOUQDTGCHQNJCFGUCNTKQUGPVTGVCPVQ
JKUVQTKECOGPVG Q NGIKUNCFQT QTFKPTKQ VGO QRVCFQ RQT KPUVKVWKT EQPVTKDWKGU
RTGXKFGPEKTKCUFGGORTGICFQTGUFQUGVQTTWTCNUQDTGCTGEGKVCFCEQOGTEKCNK\CQ
FGRTQFWVQUCITEQNCU6QFCXKCFGCEQTFQEQOQVGZVQQTKIKPTKQFC%QPUVKVWKQ
Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

35

Mrio Pereira de Pinho Filho

a folha de salrios, o faturamento ou o lucro eram as nicas bases sobre as quais


RQFGTKCOKPEKFKTEQPVTKDWKGURCTCUGIWTKFCFGUQEKCN
'UUC RQUKQ HQK RCEKECFC PC LWTKURTWFPEKC FQ 5WRTGOQ 6TKDWPCN (GFGTCN
UGIWPFQ C SWCN CU EQPVTKDWKGU UQEKCKU KPENWUKXG CU RTGXKFGPEKTKCU VO
natureza tributria e se submetem ao regime jurdico-tributrio previsto na
%QPUVKVWKQ
$4#5+.5WRTGOQ6TKDWPCN(GFGTCN4'45  QWUGLC
RCTCCKPUVKVWKQFGEQPVTKDWKGUUQEKCKUJFGUGQDUGTXCTVQFQUQURTKPERKQUG
regras constitucionalmente aplicveis aos demais tributos, a menos que a prpria
%QPUVKVWKQGUVCDGNGCCNIWOCFKHGTGPEKCQPGUUGUGPVKFQ
&GCEQTFQEQOGUUGGPVGPFKOGPVQCUEQPVTKDWKGUKPUVKVWFCUUQDTGCTGEGKVCUQD
CIKFGFQVGZVQFC%QPUVKVWKQGOUWCXGTUQQTKIKPCNUQKPEQPUVKVWEKQPCKUC
menos que observem as regras relativas ao exerccio da competncia residual para
CKPUVKVWKQFGEQPVTKDWKGUUQEKCKURTGXKUVCPQhoFQCTVFC%QPUVKVWKQ
A partir da Emenda Constitucional n. 20/1998, porm, a receita passou a integrar
C TGNCQ EQPUVKVWEKQPCN FG JKRVGUGU CRVCU C CDTKICT EQPVTKDWKGU FGUVKPCFCU 
OCPWVGPQFQUKUVGOCFGUGIWTKFCFGUQEKCN1WVTCRTQXKFPEKCCFQVCFCRQTGUUC
GOGPFCNHQKCFGRQUUKDKNKVCTSWGCUEQPVTKDWKGURTGXKFGPEKTKCUVKXGUUGOCNSWQVCU
QWDCUGUFGENEWNQFKHGTGPEKCFCUGOTC\QFCCVKXKFCFGGEQPOKECQWFCWVKNK\CQ
intensiva de mo de obra.
A Emenda Constitucional n. 42/2003, por seu turno, inseriu dispositivo no art. 195
FC%QPUVKVWKQEQOQKPVWKVQFGGUVKOWNCTCUWDUVKVWKQFCEQPVTKDWKQUQDTGC
HQNJCFGUCNTKQURQTEQPVTKDWKQKPEKFGPVGVCPVQUQDTGCTGEGKVCSWCPVQUQDTGQ
faturamento.
2QTVCPVQCUEQPVTKDWKGUFGGORTGICFQTGUTWTCKUKPEKFGPVGUUQDTGCTGEGKVCKPUVK
tudas de acordo com o texto constitucional alterado pela Emenda Constitucional
n. 20/1998, no mais necessitam observar as regras relativas ao exerccio da
EQORGVPEKCTGUKFWCNRCTCCKPUVKVWKQFGEQPVTKDWKGUUQEKCKU
Porm, a despeito das Emendas Constitucionais n. 20/1998 e n. 42/2003, ainda
UWDUKUVKTCOKPEGTVG\CUSWCPVQEQPHQTOCQFGUUCUEQPVTKDWKGUCPVGQRTKPERKQ
da igualdade tributria.
'UUCUKVWCQHQKCXGTKIWCFCEQOCWVKNK\CQFGOGVQFQNQIKCRTQRQUVCRGNCFQWVTKPC
EQOQKPVWKVQFGXGTKECTK QSWGHQKCFQVCFQEQOQETKVTKQFKUETKOKPCVTKQKK UG
JLWUVKECVKXCTCEKQPCN
HWPFCOGPVQNIKEQ RCTCCCFQQFQETKVTKQFGUKIWCNCFQTG
KKK UGCEQTTGNCQQWQHWPFCOGPVQTCEKQPCNCDUVTCVCOGPVGGZKUVGPVGin concreto,
CPCFQEQOQUXCNQTGURTGUVKIKCFQUPQUKUVGOCEQPUVKVWEKQPCN
%QODCUGPGUUCXGTKECQEQPENWKWUGSWGCUEQPVTKDWKGURTGXKFGPEKTKCUKPEKFGPtes sobre a receita de produtores rurais, institudas aps a Emenda Constitucional
n. 20/1998, esto em consonncia com o ordenamento constitucional vigente.
36

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

A constitucionalidade das contribuies previdencirias do setor rural

REFERNCIAS
AMARO, Luciano. Direito tributrio brasileiro. 12. ed. So Paulo: Saraiva, 2006.
VILA, Humberto, Teoria dos princpiosFCFGPKQCRNKECQFQURTKPERKQU
jurdicos. 11. ed. So Paulo: Malheiros, 2010.
$14)'55QWVQ/CKQT5QDTGCCVWCNK\CQFGETFKVQUFQUWLGKVQRCUUKXQEQPVTC
o Fisco. Revista Dialtica, So Paulo, n. 32, p. 44-51, maio 2011.
$4#5+.%QPUVKVWKQ. Disponvel em: <http://www.planalto.gov.br/ccivil_03/
Constituicao/Constitui%C3%A7ao.htm>.
______. Supremo Tribunal Federal, ADI n. 1.103-1/DF, publicada no DJs em
25 de abril de 1997. Disponvel em: <http://www.stf.jus.br/portal/geral/
verPdfPaginado.asp?id=185458&tipo=TP&descricao=ADI%2F1103>.
______ Tribunal Regional Federal da 4a Regio, MS n. 1999.71.00.021280-5/RS.
Disponvel em: <http://jurisprudencia.trf4.jus.br/pesquisa/resultado_pesquisa.
php>.
______. Supremo Tribunal Federal, RE n. 363.852/MG, publicado no DJe n. 71,
em 23 de abril de 2010. Disponvel em: <http://www.stf.jus.br/arquivo/cms/
noticiaNoticiaStf/anexo/RE363852_relatorio.pdf>.
______. Supremo Tribunal Federal, RE 596177/RS, DJe n. 165, publicado em 29 de
agosto de 2011. Disponvel em: <http://redir.stf.jus.br/paginadorpub/paginador.
jsp?docTP=AC&docID=626799>.
______. Tribunal Regional Federal da 4a Regio, AC n.o 2007.70.03.004958-9/PR.
Disponvel em: <http://jurisprudencia.trf4.jus.br/pesquisa/resultado_pesquisa.
php>.
______. Supremo Tribunal Federal, RE 560.626-1/RS, DJe n. 232, publicado em 5 de
dezembro de 2008. Disponvel em http://redir.stf.jus.br/paginadorpub/paginador.
jsp?docTP=AC&docID=56793>.
CARVALHO, Paulo de Barros. Curso de direito tributrio. 12. ed. So Paulo:
Saraiva, 1999.
FUNDAO ANFIP. Previdncia socialTGIKOGIGTCNNGIKUNCQCVWCNK\CFC
remisses e notas: Leis ns. 8.212 e 8213/1991.Coordenador Pedro Dettrich Jnior.
GF$TCUNKC#PR
IBRAHIM, Fbio Zambitte. Curso de direito previdencirio. 14. ed. Rio de
Janeiro: Impetus, 2009.
+056+6761 0#%+10#. &1 5')741 51%+#.
+055 5GTXKQ 0CEKQPCN
de Aprendizagem Rural. Manual de orientao na rea rural. 6. ed. Braslia:
INSS, 2009.

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

37

Mrio Pereira de Pinho Filho

INSTITUTO DE PESQUISA E ECONOMIA APLICADA (IPEA). Comunicado


Ipea n. 42, PNAD 2008: Primeiras anlises, o setor rural, 2010, p. 18. Disponvel
em: <http://www.ipea.gov.br/sites/000/2/comunicado_presidencia/100401_
ComunicaIpea_42_PNAD_SetorRural.pdf>.
/#%*#&1 *WIQ FG $TKVQ /#%*#&1 5')70&1 *WIQ FG $TKVQ
+PEQPUVKVWEKQPCNKFCFG FC EQPVTKDWKQ RTGXKFGPEKTKC KPUVKVWFC RGNC .GK
n. 8.870/1994. Revista Dialtica de Direito Tributrio, So Paulo, n. 72, set. 2001.
______. Curso de direito tributrio. 31. ed. So Paulo: Malheiros, 2010.
MARTINEZ, Wladimir Novaes. Comentrios lei bsica da previdncia social.
Tomo I: Plano de custeios. 5. ed. So Paulo: LTR, 2006.
MARTINS, Srgio Pinto. Direito da seguridade social. 22. Ed. So Paulo: Atlas, 2005.
______. Direito do trabalho. 23. ed. So Paulo: Atlas, 2007.
MELLO, Celso Antnio Bandeira de. Contedo jurdico do princpio da
igualdade. 3. ed., 13a tiragem. So Paulo: Malheiros, 2005.
MELLO, Eduardo Soares de. Contribuies sociais no sistema tributrio. 5. ed.
So Paulo: Malheiros, 2006.
NASCIMENTO, Amauri Mascaro. Curso de direito do trabalho. 21. ed. So Paulo:
Saraiva, 2006.
OLIVEIRA, Mrcia Henrique Ribeiro. Do Funrural ao STF: aspectos da
EQPVTKDWKQRCVTQPCNFQTWTCNRGUUQCHUKECRevista Dialtica, So Paulo, n. 188,
p. 43-58, maio 2011.
PAULSEN, Leandro. Contribuies: custeio da seguridade social. 1. ed. Porto
Alegre: Livraria do Advogado Editora, 2007.
SCHWARZER, Helmut. Impactos socioeconmicos do sistema de aposentadorias
rurais na Amaznia. Rio de Janeiro: Ipea, 2000. Disponvel em: <http://www.
periodicos.ufpa.br/index.php/ncn/article/viewFile/23/20>.
SILVA, Jos Afonso da. Curso de direito constitucional positivo. 27. ed. So Paulo:
Malheiros, 2006.

38

Cad. Fin. Pbl., Braslia, n. 12, p. 5-38, dez. 2012

Dinmica fronteiria no arco norte brasileiro


no contexto das reas de Livre Comrcio
Eloisa Maieski Antunes

Abstract

Servidora da UTFPR. Pesquisadora convidada


da Universit Paris 1 Panthon/Sorbonne
Pesquisadora na Univille e na Unipampa

GO+PVGITCGU'EQPOKECU$KPCEKQPCKUG
Desenvolvimento Social em Regies de Fronteiras)
&QWVQTCPFCGO)GQITCC'EQPOKEC
7(24 
Mestre em Engenharia Urbana

Professor e pesquisador do Departamento


FG4GNCGU+PVGTPCEKQPCKU
&4+ DGOEQOQFQU
2TQITCOCUFG/GUVTCFQGO)GQITCC
22))'1 
e em Sociedade e Fronteiras (PPG-SOF) da
Universidade Federal de Roraima (UFRR)
Graduado, especialista, mestre, doutor e
ps-doutorando em Cincias Jurdicas

This paper discusses the border dynamics in the


#OC\QPVJTQWIJVJGUVWF[QH(TGG6TCFG#TGCU
(6# 
established in seven cities due to the importance of
this micro-scale in promoting regional integration
and development. Structured in eight sections, the
article discusses the policies of spatial planning and
development that impacted in the emergence of FTA
on the border zone and on the borderline as well, and
presents a systematic case study in depth about the
seven existing FTA. Based on these discussions this
text provides subsidies for a theoretical and empirical
understanding about the FTA in order to show their
successes and limits taking for granted there has been
no other studies about this regime with customs and
taxes implications.

Rosaldo Trevisan

Keywords

Auditor-Fiscal da Receita Federal do Brasil


Consultor do FMI nas reas tributria/aduaneira
%QPUGNJGKTQFQ%CTH/(#UUGUUQTFG/QFGTPK\CQ
#FWCPGKTCFC1TICPK\CQ/WPFKCNFG#FWCPCU
Doutorando (UFPR) e Mestre (PUC-PR) em Direito
Pesquisador em matria tributria (UFPR e UCB)
e aduaneira (Unicamp)

Amazon. Free Trade Area. Border. Customs and


Tax Regime.

Eli Martins Senhoras

Resumo
O presente texto discute a dinmica fronteiria
na Amaznia, tomando como referncia o estudo
FCUTGCUFG.KXTG%QOTEKQ
#.% GUVCDGNGEKFCU
em sete municpios, pois estas representam uma
importante microescala de promoo da integrao
e do desenvolvimento regional. Estruturado em oito
sees, o artigo discute as polticas de ordenamento
e desenvolvimento territorial que repercutiram
no surgimento das ALC na faixa e na linha de
fronteira, bem como apresenta um estudo de caso
sistemtico e em profundidade sobre as sete ALC
existentes. Com base em tais discusses, este texto
fornece subsdios para a compreenso terica e
emprica das ALC com a finalidade de mostrar os
sucessos e os limites, uma vez que inexistem estudos
com esse objetivo sobre o regime, com repercusses
aduaneiras e tributrias.

Palavras-chave
Amaznia. rea de Livre Comrcio. Fronteira.
Regimes aduaneiros-tributrios.

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

1 INTRODUO
#U FKUEWUUGU UQDTG VGOCU HTQPVGKTKQU
VOUKFQHQTCURTQHWPFCUGFGITCPFG
RQNOKEC PC GXQNWQ FQ RGPUCOGPVQ
EKGPVEQ RQKU VO IGTCFQ J UEWNQU
FKHGTGPVGU KPVGTRTGVCGU G OCTEQU
PQTOCVKXQUSWGKPWGPEKCOQURTQEGUUQU
FGVGTTKVQTKCNK\CQQWCKPFCTGRGTEWVGO
GOCGUFKRNQOVKECUGRCTCFKRNQOVKECU
que transcendem os territrios nacionais.
Embora a origem etimolgica do
termo fronteira estivesse associada a um
fenmeno espontneo da vida social que
designava a margem do mundo habitado,
EQOQRCUUCTFQVGORQGCUKUVGOCVK\CQ
FG GUVWFQU PQ ODKVQ FC IGQITCC FQ
direito, da economia e da poltica houve
WOCOWFCPCEQIPKVKXCTGNCEKQPCFCCQ
limite ou ao contato do ponto de vista
dos Estados Nacionais.
0Q ECUQ FCU RTKPEKRCKU VGQTK\CGU G
RGUSWKUCUIGQITECUSWGHQTCOCUNKPJCU
39

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

mais frutferas para compreender as fronteirasJQWXGCGUVTWVWTCQFGWORCFTQ


bipartite de tendncias, tanto com discusses sobre limites internacionais ou zonas
de seguranaRTGUGPVGUGOCWVQTGUENUUKEQUFCIGQITCCRQNVKECGFCIGQRQNVKEC
quanto com discusses voltadas s zonas de contato internacionais ou s linhas de
povoamento e ocupao de territrios (PEITER, 2005).
A fratura interpretativa sobre as fronteiras demonstra que elas so dinamizadas
VCPVQRQTHQTCUEGPVTRGVCUFGKPVTQXGTUQNKOKVCQGUGRCTCQSWGUGQTKGPVCO
RGNQU OCTEQU CDUVTCVQU FQ VGTTKVTKQ PCEKQPCN SWCPVQ RQT HQTCU EGPVTHWICU FG
GZVTQXGTUQ EQPVCVQ G CRTQZKOCQ SWG UG QTKGPVCO RGNC EQQRGTCQ G RGNC
KPVGITCQPCKPVGTPCEKQPCNK\CQ
/CTECFCRQTWOCFWCNKFCFGKPVTPUGECFGEQPVCVQGUGRCTCQSWGCVTCKGTGRGNGC
HTQPVGKTCVTCVCUGFGWOC\QPCJDTKFCFGHQTCUEGPVTRGVCUGEGPVTHWICUSWGRQFG
UGTOCKURTGEKUCOGPVGQDUGTXCFCPCSWGNGURQPVQUZQUFGKPVGTCQOCKUKPVGPUC
como as cidades gmeasSWGVCPVQTGRTGUGPVCOQUNKOKVGUFCVGTTKVQTKCNK\CQPCEKQPCN
SWCPVQQURQPVQUFGTGVGTTKVQTKCNK\CQKPVGTPCEKQPCNRQKUUQEKFCFGURTGUGPVGUPQ
limite internacional ou prximas do limite com homlogas no pas lindeiro.
As cidades gmeas so reas singulares construdas em cada lado das fronteiras que
FGOQPUVTCODGOCJKDTKFG\HTQPVGKTKCOCTECFCRQTobjetos tcnicos caractersticos,
EQOQQUHQTVGUQUSWCTVKUCUCFWCPCUQURQUVQUFGUECNK\CQGRQTaes humanas
FGKPUVTWOGPVCNK\CQdiplomtica, efetuadas por diplomatas e pelos presidentes,
como agentes da poltica externa, e paradiplomtica, efetivada pelos representantes
UWDPCEKQPCKUEQOQRTGHGKVQUGRGNCUCGUKPFKXKFWCKUGEQNGVKXCUFCURGUUQCURQT
OGKQFGWOCUTKGFGWZQUEQPXGTIGPVGUQWEQPKVKXQUNGICKUQWKNGICKU
0CUGQUQFKUEWVKFCURQNVKECUFGQTFGPCOGPVQGFGUGPXQNXKOGPVQVGTTKVQTKCN
EQPVGZVWCNK\CPFQCU PC HCKZC FG HTQPVGKTC DTCUKNGKTC EQO TGNCQ CQU UGWU RCUGU
vizinhos na Amrica do Sul, culminando no tratamento, em linhas gerais, dos
TGEQTVGUGURCEKCKUFGCPNKUGFGUFGCOCETQGUECNC
CTEQUHTQPVGKTKQU RCUUCPFQRQT
uma mesoescala (sub-regies), at chegar microescala (cidades gmeas).
0CVGTEGKTCUGQGORTGGPFGUGCPNKUGUQDTGCEGPVTCNKFCFGFCUEKFCFGUFGHTQPVGKTC
como lociIGQGUVTCVIKEQUGHWPEKQPCKUPCFKPCOK\CQFGTGNCGUKPVGTPCEKQPCKU
FGOCPGKTCSWGUGTGIKUVTGOCUVTCPUHQTOCGUPCNIKECFCU\QPCUFGHTQPVGKTCSWG
VOTGRGTEWUUQPCUEKFCFGUIOGCUEQOCRCUUCIGOFGGURCQUZQURCTCGURCQU
FGWZQUCDGTVQU
0CUGQQEQPEGKVQFGEKFCFGUIOGCUCRTGUGPVCFQRQTOGKQFGWOCFKUEWUUQ
terica que objetiva demonstrar a fundamental importncia de cidades vizinhas
pertencentes a diferentes faixas de fronteira nos processos de regionalizao
internacional (usualmente conhecidos pelo termo integrao regional), representando
WOGURCQFGWZQUQTKWPFQUFGFKHGTGPVGUECPVQUPCEKQPCKUECTCEVGTK\CFQRGNQCNVQ
ITCWFGKPVGTCQGKPVGTFGRGPFPEKC
40

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

Dinmica fronteiria no arco norte brasileiro no contexto das reas de Livre Comrcio

0CSWKPVCUGQQUTGIKOGUCFWCPGKTQUCRNKECFQUGOTGCUGURGEKCKUKFGPVKECFQU
como reas de Livre Comrcio (ALC) so apresentados como um fenmeno
genuinamente amaznico, nas faixas de fronteira, que objetiva tanto integrar e
desenvolver os territrios no contexto intranacional quanto quebrar a lgica de
vazamento de renda brasileira no cenrio internacional, em razo das cidades gmeas
FQQWVTQNCFQFCHTQPVGKTCSWGGOTGITCCRTGUGPVCOWOOGPQTEWUVQPCNFQ
RTQFWVQXGPFKFQGOHWPQFGGNGOGPVQUCFWCPGKTQUECODKCKUGVTKDWVTKQU
0C UGQ  VTCXCUG FKUEWUUQ VGTKEC RCTC GZRNKECT UKUVGOCVKECOGPVG CU NIKECU
GEQPOKECUGRQNVKECUSWGLWUVKECTCOCETKCQFCU#.%PCHCKZCGPCNKPJCFG
fronteira amaznica, caracterizando os fundamentos teleolgicos dos objetivos
IGTCKUGGURGEEQUDGOEQOQCUFKOGPUGUPQTOCVKXCUFQTGIKOGSWGKPENWGOCU
JKRVGUGUFGFGUQPGTCQVTKDWVTKC
0C UVKOC UGQ FGUGPXQNXGUG KOGTUQ PC TGCNKFCFG FCU #.% RGTOKVKPFQ
caracterizar o funcionamento do regime nos municpios brasileiros cidades
gmeas de linha de fronteira (Guajar-Mirim/RO, Tabatinga/AM, Brasileia/AC,
Epitaciolndia/AC e Pacaraima/RR) e nos municpios interioranos da faixa de
fronteira (Boa Vista/RR, Macap/AP, Santana/AP e Cruzeiro do Sul/AC).
2QTOUQVGEKFCUEQPUKFGTCGUPCKUCOFGTGEWRGTCTCNIWOCUGCXCPCTGO
outras discusses apresentadas no artigo, com o intuito de sintetizar argumentos que
XGPJCOCEQPVTKDWKTRCTCRQUVGTKQTGUTGGZGUGCIGPFCUFGRGUSWKUCTGNCEKQPCFCU
s cidades gmeas e sobre planejamento territorial em zonas de fronteira.

2 AS FRONTEIRAS INTERNACIONAIS NO ORDENAMENTO E


NO DESENVOLVIMENTO TERRITORIAL
#FKPOKECVGTTKVQTKCNPQOGKQVEPKEQEKGPVEQKPHQTOCEKQPCNVGOUKFQRGTOGCFC
crescentemente por uma lgica de poder baseada em GURCQUFGWZQU, que tendem
CUGECTCEVGTK\CTRQTHQTCUEGPVTHWICUGOEQPVTCRQUKQCQUespaos de lugares, que
ETGUEGOCWOTKVOQOGPQTGUQECTCEVGTK\CFQURQTHQTCUEGPVTRGVCU
0CHQTOCQVGTTKVQTKCNJETGUEGPVGURQNCTK\CGUSWGFQQTKIGOCQUWTIKOGPVQ
FG GURCQU ICPJCFQTGU G RGTFGFQTGU GO TC\Q FG TGFGU FG WZQU SWG FGPGO
TGVGTTKVQTKCNK\CGUCQCDTKTGOFGVGTOKPCFQUGURCQUFGWZQUGGXGPVWCNOGPVG
HGEJCTGOQWVTQUGURCQUOCTIKPCKUFGNWICTGU
$'0-1.+2+'6< 
0GUUGEQPVGZVQCKPUVTWOGPVCNK\CQFCURQNVKECUFGRNCPGLCOGPVQVGTTKVQTKCNVGO
passado por ordenamentos e iniciativas de desenvolvimento que procuram estimular
C HQTOCQ FG XGTVKECNKFCFGU G JQTK\QPVCNKFCFGU DWUECPFQ OQNFCT QU VGTTKVTKQU
EQODCUGPCCDGTVWTCFQUGURCQUFGNWICTGUCWOCUTKGFGWZQUSWGRQUUKDKNKVGO
KPVGITCGUKPVTCPCEKQPCKUGKPVGTPCEKQPCKU

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

41

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

5GIWPFQ4WEMGTV
 CQUGRGPUCTCPQTOCNK\CQFCGNCDQTCQFGFKTGVTK\GU
para uma poltica de ordenamento e desenvolvimento territorial, deve-se contribuir
tanto para o desenvolvimento regional intranacional quanto para o desenvolvimento
regional internacional, tendo destaque os temas de desenvolvimento regional
G VTCPUHTQPVGKTKQ SWG ECTGEGO FG CFGSWCFCU RQNVKECU RDNKECU GO TGNCQ CQ
atendimento de necessidades infraestruturais.
Nesse cenrio de macroviso territorial observa-se que prioritrio trabalhar o
FGUGPXQNXKOGPVQHTQPVGKTKQDWUECPFQWOCKPVGITCQTGIKQPCNKPVTCPCEKQPCNFCU
HCKZCUFGHTQPVGKTCGFCUNQECNKFCFGUPGNCURTGUGPVGUFGOCPGKTCCVTGNCFCKPVGITCQ
regional internacional, quebrando a lgica dos grandes vazios espaciais recortados,
KFGPVKECFQUCRGPCUEQOQEQTTGFQTGUFGRCUUCIGO
A faixa de fronteira brasileira, com uma extenso de 15.719 km, uma rea de
2.300.000 km2 e um total de 588 municpios, adquire maior relevncia pela dimenso
EQPVKPGPVCNSWGTGRTGUGPVCSWCUGFQVGTTKVTKQPCEKQPCNGWOCCORNCXK\KPJCPC
junto aos pases sul-americanos, duas vezes maior que as fronteiras litorneas do
#VNPVKEQ
/#66152'+6'4 
No Brasil, o ordenamento territorial das zonas de fronteira passou a ser incorporado
FQRQPVQFGXKUVCPQTOCVKXQCRCTVKTFCEQPUVTWQFGVTURQUUXGKUTGEQTVGUGURCEKCKU
FGCVWCQFCURQNVKECURDNKECUPQGUVWFQProposta de Reestruturao do Programa
de Desenvolvimento da Faixa de Fronteira (MINISTRIO DA INTEGRAO
NACIONAL, 2005).
0CHCKZCFGHTQPVGKTCDTCUKNGKTCJQWXGCKFGPVKECQFGWOCOCETQGUECNCFGNKOKVCFC
RQT CTEQU HTQPVGKTKQU RQT UWC XG\ UWDFKXKFKFQU GO OGUQGUECNCU CPCNVKECU
correspondentes a 19 sub-regies, sendo seis no arco norte, oito no arco central
e cinco no arco sul, conforme se detalha na Figura 1.
'OECFCUWDTGIKQRQUUXGNKFGPVKECTOKETQGUECNCUSWGKPVGITCOWOCEQORTGGPUQ
FGHTQPVGKTCXKXCCRCTVKTFCXCNQTK\CQFCGUECNCUWDPCEKQPCNFCUEKFCFGUXK\KPJCU
em cada lado das faixas de fronteira, correspondentes s cidades gmeas, que revelam
CUGURGEKEKFCFGUFQURTKPEKRCKURQPVQUZQUSWGCDTGORCUUCIGOCWOCFKPOKEC
FGWZQ
Embora haja um reduzido nmero de cidades gmeas na fronteira brasileira com os
pases sul-americanos, o que evidencia a marginalidade propiciada por um relativo
XC\KQRQRWNCEKQPCNGDCKZCCEGUUKDKNKFCFGFGEQPVCVQSWCPFQUGCPCNKUCCFKUVTKDWKQ
IGQITECFCUEKFCFGUIOGCURQUUXGNTGIKUVTCTWOCCUUKOGVTKCPWOTKECGPVTGQU
diferentes arcos territoriais.
Essa heterogeneidade presente nas faixas de fronteira demonstra existir uma
correspondncia clara entre o nmero de cidades de fronteira e o grau de acordos
FG EQQRGTCQ DKNCVGTCN QW TGIKQPCN GPVTG QU 'UVCFQU 0CEKQPCKU UWNCOGTKECPQU
42

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

Dinmica fronteiria no arco norte brasileiro no contexto das reas de Livre Comrcio

uma vez que praticamente metade das cidades gmeas brasileiras se encontra no
arco sul, envolvendo locais de fronteira com os pases do Mercosul (inclusive
COCKQTFGNCU(Q\FQ+IWCW1).
Figura 1 Faixa de fronteira, arcos e sub-regies fronteirias

Fonte: Grupo Retis (2004). Disponvel em: <http://acd.ufrj.br/gruporetis>

%QOQ CU EKFCFGU IOGCU RQUUWGO GZRTGUUKXCU TGRGTEWUUGU EQOQ RQPVQU ZQU
GURGEKCKUFCU\QPCUFGHTQPVGKTCRQTEQORQTVCTGOCEQPXGTIPEKCFGWZQUPCEKQPCKU
e transnacionais, muitas delas apresentam problemas e carncias infraestruturais que
 0Q CTVKIQ KPVKVWNCFQ &KPOKEC HTQPVGKTKC PQ CTEQ UWN DTCUKNGKTQ PQ EQPVGZVQ FQ 4GIKOG FG 6TKDWVCQ
Unificada, de nossa autoria, publicado nesta mesma obra, trata-se de regime especificamente criado para a
HTQPVGKTC(Q\FQ+IWCW$TCUKN%KWFCFFGN'UVG2CTCIWCK

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

43

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

EWOWNCVKXCOGPVGUQCORNKCFQUCQNQPIQFQVGORQGSWGOGTGEGOCVGPQENCTC
FQRNCPGLCOGPVQRDNKEQGOHWPQFGUWCUEGPVTCNKFCFGUIGQGURCEKCKUPQVTPUKVQ
GPCEQOWPKECQPQODKVQFQURTQEGUUQUFGKPVGITCQTGIKQPCN

3 A CENTRALIDADE DAS CIDADES DE FRONTEIRA


NA DEFINIO GEOGRFICA DAS RELAES
INTERNACIONAIS
Em todo o mundo, as cidades foram, ao longo de distintos ciclos hegemnicos,
FGUGORGPJCPFQFKHGTGPVGURCRKUPCEGPVTCNK\CQQWPCFGUEGPVTCNK\CQFQRQFGT
OQVKXQU RGNQU SWCKU UG VQTPCTCO GUUGPEKCKU RCTC GZRNKECT CU TGNCGU PCEKQPCKU G
KPVGTPCEKQPCKUFGEQPKVQGEQQRGTCQ
0CJKUVTKCCPVKICCHQTOCQFQUITWRCOGPVQUWTDCPQURCUUQWCUGTWOOGKQ
TGNGXCPVGFGWUQQEWRCQGEQPSWKUVCFQUVGTTKVTKQUQSWGRTQRKEKQWCHQTOCQ
FGTGFGUFGEQPVCVQUGPVTGFKUVKPVQURQPVQUZQUGOWOEQPVGZVQECTCEVGTK\CFQRQT
WOOQXKOGPVQGZRCPUKXQFGEKXKNK\CGUGKORTKQU
&WTCPVGQRGTQFQHGWFCNCFGPKQFQUVGTTKVTKQURCUUQWCUGCUUGPVCTGOWOC
NIKECFGEWTVCGURCEKCNK\CQSWGHQTCECTCEVGTK\CFCRQTTGNCGUFGUWUGTCPKCG
XCUUCNCIGOSWGFGPKCOCHQTOCQFGECORQUFGRQFGTTGUVTKVQUCNQECNKFCFGU
FGUEGPVTCNK\CFCUQSWGQECUKQPQWOKVKICQFCPQQFQPCEKQPCNGFQKPVGTPCEKQPCN
GOHWPQFCUTGNCGUGUUGPEKCNOGPVGNQECKU
%QOCHQTOCQGODTKQPTKCFQURTKOGKTQUPENGQUWTDCPQUGQUWTIKOGPVQFGWOC
lgica mercantilista, os burgos e as cidades passaram a desempenhar um relevante
RCRGNPQCFGPUCOGPVQFCEGPVTCNK\CQFQUECORQUFGRQFGTOQVKXQRGNQSWCN
HQTCOHWPEKQPCKUPCFGPKQFQUOCRCUFGEQQRGTCQGEQPKVQSWGFGPKTCOC
HQTOCQFQU'UVCFQU0CEKQPCKUGTGURGEVKXCOGPVGCUHTQPVGKTCUNKOKVCPVGUGPVTGQ
nacional e o internacional.
No mbito das polticas pblicas instrumentalizadas pelos Estados Nacionais
modernos, as cidades presentes em zonas de fronteira passaram a adquirir, ao longo
do tempo, um statusFGTGNGXQHWPEKQPCNUGLCEQOQRQPVQUZQUSWGFGPGONKOKVGU
PCUGEWTKVK\CQHTQPVGKTKCUGLCEQOQPENGQUGURCEKCKUSWGFGPGO\QPCUFGEQPVCVQ
HTQPVGKTKQEQORCUGUXK\KPJQU
/#46+0&+'6< 
Normalmente, registra-se em um primeiro momento a difuso sistmica de uma
NIKEC IGQRQNVKEC DCUGCFC GO TGIKOGU FG EQPVGPQ HTQPVGKTKC RQT OGKQ FG
\QPCUQWHCKZCUFGUGIWTCPCDWUECPFQPQUQOGPVGKPUVTWOGPVCNK\CTCNKOKVCQ
entre o interno e o externo, mas principalmente territorializar as fronteiras por
OGKQ FC EQPUVKVWKQ FG EKFCFGU 'O OQOGPVQ RQUVGTKQT C NIKEC FGUGPXQNXKFC
essencialmente geoeconmica, embora tambm fundamentada em estmulos
IGQRQNVKEQUGIGQEWNVWTCKURCUUCPFQCHQOGPVCTCHQTOCQUQEKQGURCEKCNFGEKFCFGU
IOGCUHTQPVGKTKCUGCPQTOCVK\CQFGTGIKOGUCFWCPGKTQUGOTGCUGURGEKCKUEQOQ
44

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

Dinmica fronteiria no arco norte brasileiro no contexto das reas de Livre Comrcio

o caso das reas de Livre Comrcio, na Amaznia, dos Portos Livres e das Zonas
FG2TQEGUUCOGPVQFG'ZRQTVCQ
<2' 
Em ambos os momentos h uma compreenso estratgica das cidades presentes
nas fronteiras (inter)nacionais como atores funcionais na poltica externa de seus
TGURGEVKXQURCUGUGOHWPQVCPVQFGUWCUNQECNK\CGUSWCPVQFGCGUXQNWPVTKCU
QWKPXQNWPVTKCUEQOTGRGTEWUUQRCTCFKRNQOVKECPCEQPVGPQQWPQEQPVCVQ
FQUWZQUKPVGTPCEKQPCKU
Na Amrica do Sul, as cidades em zonas de fronteira passaram por uma
VTCPUHQTOCQ GXQNWVKXC PQ OQFQ FG KPUVTWOGPVCNK\CQ IQXGTPCOGPVCN WOC
XG\SWGCVGTTKVQTKCNK\CQHTQPVGKTKCRCUUQWRQTGUVOWNQUKPKEKCKUPCFGPKQFG
RQPVQUZQUFGNKOKVCQGEQPVGPQFGWOEQPVGZVQDCUGCFQGOWOCIGQRQNVKEC
EQPKVKXCCVCPCVWTCNK\CQFGGUVOWNQUFGEQPVCVQGKPVGITCQHWPFCFCGOWOC
geopoltica cooperativa.

4 FORMAO SOCIOTERRITORIAL DE CIDADES GMEAS


FRONTEIRIAS E SEU PAPEL NA INTEGRAO REGIONAL
A valorizCQFCGUECNCUWDTGIKQPCNPQGUVWFQVTCPUHTQPVGKTKQCFSWKTGTGNGXPEKCCQ
RGTOKVKTCCPNKUGOCKURTGEKUCFGSWGCKPVGTCQGZKUVGPVGGPVTGRCUGUCEQPVGEGPQ
CRGPCUCRCTVKTFQUOCETQGURCQUFCU\QPCUFGHTQPVGKTCOCUVCODOPCUEKFCFGU
IOGCUSWG UG ECTCEVGTK\CO RQT RQPVQUZQU NQECKU GO ECFC HTQPVGKTC PCEKQPCN
EQPEGPVTCPFQCFGPUCOGPVQURQRWNCEKQPCKUGWZQUFKPOKEQU
5GIWPFQQ/KPKUVTKQFC+PVGITCQ0CEKQPCN
 CUEKFCFGUIOGCUUQPENGQU
urbanos relativamente interdependentes localizados de um lado e de outro dos
NKOKVGU VTCPUHTQPVGKTKQU SWG CRTGUGPVCO XGVQTGU VCPVQ EQPXGTIGPVGU FGTKXCFQU
FQGNGXCFQRQVGPEKCNFGKPVGITCQVTCPUPCEKQPCNSWCPVQFKXGTIGPVGUQTKWPFQUFCU
PQXCUCOGCCUGFQUEQPVGPEKQUQUECTCEVGTUVKEQUFCUHTQPVGKTCUEQOQGUSWGOCVK\CFQ
PC(KIWTCOQVKXQRGNQSWCNUGLWUVKECCFGPKQGUVTCVIKECFGRQNVKECURDNKECU
focalizadas.
As cidades gmeas revelam uma dinmica internacional de desenvolvimento
CEQRNCFQ G KPVGTFGRGPFGPVG GPVTG RQNQU HTQPVGKTKQU PQ PGEGUUCTKCOGPVG
EQPWTDCFQUSWGOWKVQTGEQTTGPVGOGPVGEQTRQTKECOOCKQTKPWPEKCTGERTQEC
GEQORNGOGPVCTKFCFGGOEQORCTCQCQWVTCUNQECNKFCFGUFQURTRTKQUVGTTKVTKQU
nacionais, tendo em conta que a proximidade espacial do entorno estimula
GURGEKCNK\CGURTQFWVKXCU
O surgimento paralelo de cidades em cada faixa da fronteira nacional, antes de se
tratar de uma horizontalidade produzida por um processo voluntrio e natural,
TGHGTGUG C WOC EQPUVTWQ VGTTKVQTKCN ETKCFC RQT XGTVKECNKFCFGU CTVKEKCNOGPVG
difundidas pela iniciativa reativa de governos nacionais.
Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

45

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

Figura 2 Fronteiras e cidades gmeas


ZONA DE FRONTEIRA

Interao
transfronteiria
entre grupos locais
e entre pases

Interao
com outros
pases
Sub-regio

FAIXA DE
FRONTEIRA

Limite Internacional

Cidades-gmeas

Interao com
sub-regio

Pas B

Pas A

Interao
com pas
vizinho

Interao com
outras cidades
e regies
nacionais

Pas B

Pas A

Interao com
governo
estadual e
governo central

FAIXA DE
FRONTEIRA

Fonte: MINISTRIO DA INTEGRAO NACIONAL (2005)

'ODQTC UG RQUUC UWUVGPVCT SWG C VGTOKPQNQIKC OCKU CFGSWCFC RCTC KFGPVKECT
CU NQECNKFCFGU VTCPUHTQPVGKTKCU KPVGTFGRGPFGPVGU UGLC EKFCFGU KTOU G PQ
necessariamente cidades gmeas pois os polos tm desenvolvimento evolutivo
acoplado, contudo no nascem necessariamente iguais ou ao mesmo tempo ,
CNKVGTCVWTCEKGPVECIGQITECGKPVGTPCEKQPCNKUVCCECDQWEQPUQNKFCPFQCGZRTGUUQ
que resta preservada neste estudo.
Originariamente consolidadas para desempenhar uma territorialidade geopoltica
PCU\QPCUFGHTQPVGKTCEQOHWPGUTGNCEKQPCFCUUGIWTCPCGFGHGUCFQVGTTKVTKQ
nacional por meio de batalhes militares, as cidades gmeas passaram a absorver
CQ NQPIQ FQ VGORQ PQXCU HWPGU FG WO RQPVQ FG XKUVC IGQGEQPOKEQ EQO C
KORNGOGPVCQFGDCUGUUECKUVTKDWVTKCUGCFWCPGKTCURTQRKEKCPFQTGRGPUCTCU
fronteiras com base em suas porosidades, pois h uma relativa abertura para o
VTCPUDQTFCOGPVQFGGHGKVQURQUKVKXQUGPGICVKXQUSWGRQVGPEKCNK\COCEQQRGTCQ
QWQEQPKVQKPVGTGUVCVCN
%QOQRQPVQUZQUIGQGUVTCVIKEQUFGRCUUCIGOFGWOETGUEGPVGXQNWOGFGWZQU
oriundos de grandes centros produtores nacionais, as cidades gmeas passaram a
FGUGORGPJCT WOC TGNGXCPVG HWPQ PC KPVGTPCEKQPCNK\CQ QW PCU KPKEKCVKXCU FG
KPVGITCQPCEKQPCNVQTPCPFQNCVGPVGCFGOCPFCRQTTGFGUFGKPHTCGUVTWVWTCFG
OQFQSWGUGEQORQTVGCETGUEGPVGGZRQTVCQRGNCXKCVTCPUHTQPVGKTKC
46

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

Dinmica fronteiria no arco norte brasileiro no contexto das reas de Livre Comrcio

5 REAS DE LIVRE COMRCIO COMO FENMENO


FRONTEIRIO AMAZNICO
1RTQEGUUQFGKPFWQFCHQTOCQVGTTKVQTKCNCOC\PKECEQODCUGGOWOCGUVTCVIKC
XGTVKECNK\CFCFGKPVGTXGPQSWGRTQOQXGUUGCKPVGITCQKPVTCPCEKQPCNFCTGIKQVGO
UKFQKFGPVKECFQEQOQWOHGPOGPQTGNCVKXCOGPVGTGEGPVGFGKPVGTXGPQGUVCVCN
%QPHQTOG2QTVQG%QUVC
 CKPFWQFCUWDUVKVWKQFGXGTVKECNKFCFGUGUVTCPgeiras por polticas nacionais, tambm formatadas de cima para baixo, pode ser visualizada em trs fases: defesa nacional, valorizao regional e desenvolvimento regional.
A fase de defesa nacional caracterizou-se pela viso geopoltica de garantir o
CFGPUCOGPVQJWOCPQFGDTCUKNGKTQUFGRTQOQXGTCKPVGITCQEQOCKPUVCNCQ
FGPQXCUKPHTCGUVTWVWTCUQWCCORNKCQFCULGZKUVGPVGUDGOEQOQFGKPFW\KTCU
RTKOGKTCUCGUFQ'UVCFQPCTGIKQHTQPVGKTKCEQOQUFGOCKURCUGUNKOVTQHGU
#UGIWPFCHCUGFGXCNQTK\CQTGIKQPCNFGUVCEQWUGRGNCEQPUVKVWKQFGWOUKUVGOC
FGOGFKFCUUGTXKQUQDTCUGGORTGGPFKOGPVQUPQUGUVCFQUGPQUVGTTKVTKQUEQOQ
objetivo de induzir o aproveitamento das potencialidades de cada localidade por meio
FQFGUGPXQNXKOGPVQFCCITQRGEWTKCGFCURTQFWGUGZVTCVKXCOKPGTCNGKPFWUVTKCN
(QKPCHCUGFGFGUGPXQNXKOGPVQTGIKQPCNEQPVWFQSWGUGFGPKWCTGIKQPCNK\CQFQ
KPVGTGUUGQEWRCQGGZRNQTCQFCURQVGPEKCNKFCFGUGPVTG#OC\PKC1EKFGPVCN
e Amaznia Oriental, aprimorando-se os processos planejados ou espontneos de
QEWRCQGEQNQPK\CQDGOEQOQUGKORNCPVCPFQKPEGPVKXQUUECKURQTOGKQFG
regimes aduaneiros aplicados em reas especiais,2 inicialmente com a Zona Franca
de Manaus (ZFM3) e posteriormente com as ALC em sentido estrito e as ZPE,4
todos espcies do gnero reas de livre comrcio.5
Fenmeno exclusivamente amaznico (propriamente nas faixas de fronteira da
#OC\PKC DTCUKNGKTC GO TGNCQ CQU RCUGU XK\KPJQU  CU #.% GUVQ NQECNK\CFCU
 0Q CTVKIQ KPVKVWNCFQ &KPOKEC HTQPVGKTKC PQ CTEQ UWN DTCUKNGKTQ PQ EQPVGZVQ FQ 4GIKOG FG 6TKDWVCQ
7PKHKECFC FG PQUUC CWVQTKC RWDNKECFQ PGUVC OGUOC QDTC CENCTCUG C FKHGTGPC GPVTG Q TGIKOG EQOWO FG
KORQTVCQGQUTGIKOGUCFWCPGKTQUGURGEKCKUGCRNKECFQUGOTGCUGURGEKCKUPQVRKEQ
3 O regime atualmente vigente para a Zona Franca de Manaus o previsto no Decreto-Lei n. 288, de 28/02/1967
(e em suas normas regulamentares e complementares), que define a ZFM como uma rea de livre comrcio de
KORQTVCQGGZRQTVCQGFGKPEGPVKXQUHKUECKUGURGEKCKUGUVCDGNGEKFCEQOCHKPCNKFCFGFGETKCTPQKPVGTKQTFC
#OC\PKCWOEGPVTQKPFWUVTKCNEQOGTEKCNGCITQRGEWTKQFQVCFQFGEQPFKGUGEQPOKECUSWGRGTOKVCOUGW
desenvolvimento, em face dos fatores locais e da grande distncia a que se encontram os centros consumidores
FGUGWURTQFWVQU%QPVWFQQPCUEKOGPVQFC<(/TGOQPVCCQCTVFC%QPUVKVWKQDTCUKNGKTCFG
SWGGUVCDGNGEKCWORNCPQFGXCNQTK\CQGEQPOKECFC#OC\PKCGPUGLCFQTFCGFKQFCNGKGHGVKXCOGPVG
criadora da zona franca manauara (Lei n. 3.173, de 06/06/1957).
 1TGIKOGCVWCNOGPVGXKIGPVGRCTCCU<QPCUFG2TQEGUUCOGPVQFG'ZRQTVCQQRTGXKUVQPC.GKP
de 20/07/2007 (e em suas normas regulamentares e complementares), que define a ZPE como uma rea de
livre comrcioEQOQGZVGTKQTFGUVKPCFCKPUVCNCQFGGORTGUCUXQNVCFCURCTCCRTQFWQFGDGPUCUGTGO
comercializados no exterior. Contudo, o nascimento da ZPE remonta ao Decreto-Lei n. 2.452, de 29/07/1988,
que instituiu regras que tornaram o regime pouco atrativo, a ponto de no existir nas duas dcadas seguintes
nenhuma empresa que o utilizasse. de se destacar, por fim, que as ZPE no so restritas Amaznia.
5 Poderamos, assim, falar em reas de livre comrcio em sentido amplo, abarcando as ALC, a ZFM e as ZPE,
ou em sentido estrito, restringindo-se ao regime das ALC. importante ainda no confundir o regime de ALC
com a rea de Livre Comrcio (ou Zona de Livre Comrcio Free Trade Area/Zone de Libre change), que
EQPUVKVWKQRTKOGKTQGUVIKQFGWORTQEGUUQFGKPVGITCQVTCVCFCPQCTVKIQ::+8DFQ)#66

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

47

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

de maneira concentrada, nos Estados do Acre, do Amazonas, de Rondnia e de


Roraima (Amaznia Ocidental6), embora tambm estejam presentes no Estado do
Amap (Amaznia Oriental), e buscam promover o desenvolvimento de tais regies
HTQPVGKTKCU G KPETGOGPVCT CU TGNCGU DKNCVGTCKU EQO QU RCUGU XK\KPJQU UGIWPFQ
CRQNVKECFGKPVGITCQNCVKPQCOGTKECPC
De forma diversa da ZFM e das ZPE, as ALC foram institudas individualmente por
NGIKUNCQHGFGTCNGURGEECECFCSWCNCUGWVGORQGOEKTEWPUVPEKCUFKHGTGPEKCFCU
FGCEQTFQEQOCRQNVKECPCEKQPCNGEQODGPGHEKQUGXGFCGUFKXGTUKECFQU7
No se poderia, a rigor, falar de um nico regime aduaneiro de rea de livre comrcio,
pois cada lei instituidora de ALC pode estabelecer regras prprias. Assim, o que
o Regulamento Aduaneiro (Decreto n. 6.759/2009) faz, em seus artigos 524 a 533,
OGTCOGPVGEQPUQNKFCTCUFKURQUKGUUQDTGCU#.%LETKCFCURQTNGKPQ$TCUKN
(relacionadas no Quadro 1), buscando elementos comuns que possibilitem indicar
caractersticas de um regime prprio.8 Entre tais elementos, a natureza aduaneiroVTKDWVTKC G C CFOKPKUVTCQ FC 5WRGTKPVGPFPEKC FC <QPC (TCPEC FG /CPCWU
(Suframa). Em geral, poderia ainda ser relacionada como caracterstica comum
a temporariedade da vigncia da ALC (25 anos9).
Quadro 1 Criao das reas de Livre Comrcio
1989

1991

AM

Tabatinga

Lei n. 7.965, de 22/12

RO

Guajar-Mirim

Lei n. 8.210, de 19/07

RR
AP

1994

AC

2008

RR

Pacaraima*

Lei n. 8.256, de 25/11

$QPO
Macap e Santana

Lei n. 8.387, de 30/12

Cruzeiro do Sul
Brasileia, com extenso para Epitaciolndia

Lei n. 8.857, de 08/03


Lei n. 11.732, de 30/06 (em nova
TGFCQ.GKP

Boa Vista*

Fonte: leis supracitadas


Nota: * A ALC de Pacaraima foi transferida para Boa Vista em 2008.

6 A Amaznia Ocidental, que abrange os quatro estados mencionados, foi assim delimitada no Decreto-Lei
n. 291, de 28/02/1967.
 8GLCUGCVVWNQKNWUVTCVKXQSWGCUWURGPUQFQRCICOGPVQFQKORQUVQFGKORQTVCQGFQ+2+
CTVKIQFQ
4GIWNCOGPVQ#FWCPGKTQ UGCRNKECCFGUVKPCGUFKHGTGPVGURCTCECFC#.%
v.g. beneficiamento de pecuria
TGUVTKVQU#.%FG$QC8KUVC$QPHKO/CECR5CPVCPC$TCUKNGKCG%TW\GKTQFQ5WNCITKEWNVWTCTGUVTKVQ
TGCFG)WCLCT/KTKOGCVKXKFCFGUFGEQPUVTWQGTGRCTQUPCXCKUTGUVTKVCUUTGCUFG)WCLCT/KTKO
e Tabatinga).
8 Considerando essas circunstncias, o Regulamento Aduaneiro viu-se obrigado a inserir comando residual

CTV GUVCDGNGEGPFQSWGQTGIKOGCVGPFGTCKPFCCQFKURQUVQPCNGIKUNCQGURGEHKECFGECFCTGCFGNKXTG
comrcio.
9 Em que pese no haver prazo para as ALC de Cruzeiro do Sul e Brasileia (com extenso para Epitaciolndia)
por veto ao art. 14 da lei instituidora nem prazo expresso na lei para as ALC de Macap e Santana (que remete
CRNKECQFC.GKPPQSWGEQWDGT 

48

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

Dinmica fronteiria no arco norte brasileiro no contexto das reas de Livre Comrcio

2QFGUG XKUWCNK\CT PC (KIWTC  WOC GURCEKCNK\CQ RCWVCFC GO FQKU CPEQU GO
primeiro lugar, concentrada, nos estados da Amaznia Ocidental, em razo da faixa
de fronteira continental com outros cinco pases sul-americanos, e, em segundo
lugar, isolada, no Amap.
Figura 3 Cidades brasileiras com reas de Livre Comrcio

Fonte: SUFRAMA (2012). SiteKPUVKVWEKQPCN#VWCNK\CGUFQUCWVQTGU

Como exposto, as ALC buscam promover o desenvolvimento das cidades


amaznicas localizadas nas faixas de fronteira na Amaznia Ocidental (em regra)
em razo dos vazamentos de renda de brasileiros que facilmente tm trnsito de
EQORTCPCUEKFCFGUHTQPVGKTKCUFQURCUGUXK\KPJQU
)WKCPC8GPG\WGNC%QNODKC
Peru e Bolvia).
Segundo Souza Cruz, Bispo e Silva (2008), a razo das ALC terem sido pensadas
inicialmente para os territrios da Amaznia Ocidental (em regra), conforme
RTGXKUQ PQTOCVKXC  QTKWPFC FG WOC RQNVKEC FG HQTOCQ UQEKQVGTTKVQTKCN PC
Amaznia Legal que buscava organizar a lgica do desenvolvimento regional com
base na teoria das vantagens comparativas (RICARDO, 1996) e da teoria dos polos
FGFGUGPXQNXKOGPVQFG2GTTQWZ
 
A Amaznia Ocidental tornou-se palco, em um primeiro momento, de uma
GUVTCVIKC FG KPVGTXGPQ UGVQTKCN SWG DWUECXC GUVTWVWTCT Q 2QNQ +PFWUVTKCN FG
Manaus (PIM) a partir de uma zona franca, funcional para o desenvolvimento
FC KPFWUVTKCNK\CQ PCUEGPVG G GO WO UGIWPFQ OQOGPVQ FG WOC GUVTCVIKC
FGUEGPVTCNK\CFCFGRTQOQQFCU#.%CFOKPKUVTCFCURGNC5WHTCOC
Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

49

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

# GUVTCVIKC FG KPVGTXGPQ UGVQTKCN DWUECXC PC #OC\PKC 1TKGPVCN GZRNQTCT


TGEWTUQU OKPGTCKU RTQOQXGT C GZRQTVCQ CITQRGEWTKC DGO EQOQ GUVKOWNCT
C HQTOCQ FG WOC CITQKPFUVTKC OQVKXQ RGNQ SWCN CU #.% GUVKXGTCO CWUGPVGU
FGUUGUGUVCFQUEQOGZEGQFQ#OCRSWGUGDGPGEKQWFGUWCRQUKQHTQPVGKTKC
geoestratgica.10

6 CARACTERIZAO DAS REAS DE LIVRE COMRCIO


A Amaznia Legal apresenta dois tipos de regimes aduaneiros aplicados em reas
GURGEKCKUIGPWKPCOGPVGTGIKQPCKUGHTQPVGKTKCUC<QPC(TCPECFG/CPCWUGCUTGCU
de Livre Comrcio.
#FOKPKUVTCFQURGNC5WHTCOCFGHQTOCFGUEGPVTCNK\CFC
RQTOGKQFG%QQTFGPCGU
Regionais Core em cada estado), a ZFM e as ALC foram criadas unilateralmente
pelo governo federal por leis com os objetivos de promover o desenvolvimento
FG TGIKGU HTQPVGKTKCU GURGEECU FC 4GIKQ 0QTVG FQ RCU G FG KPETGOGPVCT CU
TGNCGUDKNCVGTCKUEQOQURCUGUXK\KPJQUTGHQTCPFQCUUKOCRQNVKECKPVGTPCEKQPCN
FGKPVGITCQTGIKQPCN
#<QPC(TCPECFG/CPCWUEQOQGZRQUVQPCUGQHQKETKCFCRGNC.GKP
FGGOCVGPFKOGPVQCQEQOCPFQFQCTVFC%QPUVKVWKQFG

2NCPQ FG XCNQTK\CQ GEQPOKEC FC #OC\PKC  1 OQFGNQ ETKCFQ PC FECFC
de 1950, no entanto, no se assemelha ao atualmente regido pelo Decreto n. 288,
FG  'PSWCPVQ CSWGNG VTCVCXC FG CNIQ EQO HGKGU FG RQTVQ NKXTG
(o Decreto Regulamentar n. 47.757, de 03/02/1960, falava em extraterritorialidade),
GUVGCRTGUGPVCTGIKOGXQNVCFQKPFWUVTKCNK\CQGZVTCRQNCPFQKPENWUKXGQEQPEGKVQ
internacionalmente adotado para zona franca.
No seria desarrazoado, hoje, dizer que a Zona Franca de Manaus no uma
zona franca em sentido estrito.11 Alis, isso j foi reconhecido no Mercosul, que
ENCUUKEQWC<(/EQOQTGCCFWCPGKTCGURGEKCN12 assim entendida a parte do
10 %QPUKFGTCPFQCNIKECFGKPVGITCQEQOQTGUVCPVGFQRCUGGOHWPQFCRQUKQIGQGUVTCVIKECFGHTQPVGKTC
OCTVKOC EQO Q 1EGCPQ #VNPVKEQ EQOQ NQECNK\CQ RQTVWTKC FG GPVTCFC G UCFC FG HNWZQU EQOGTEKCKU FG
destino ou origem das Regies Norte e Centro-Oeste, no ano de 1991 os municpios amapaenses conurbados
FG/CECRG5CPVCPCHQTCODGPGHKEKCFQURGNCHQTOCQFCPKEC#.%RTGUGPVGPC#OC\PKC1TKGPVCN
11 #%QPXGPQFG-[QVQTGXKUCFCFKRNQOCSWGGUVCDGNGEGCUOGNJQTGURTVKECUGOOCVTKCCFWCPGKTCUQDQU
CWUREKQUFC1TICPK\CQ/WPFKCNFG#FWCPCUPQ%CRVWNQFGUGW#PGZQ'URGEHKEQ&FGHKPG\QPCUHTCPECU
como partes do territrio de um Estado nas quais as mercadorias introduzidas so geralmente consideradas, no
SWGUGTGHGTGCQUFKTGKVQUGKORQUKGUPCKORQTVCQEQOQUGGUVKXGUUGOHQTCFQVGTTKVTKQCFWCPGKTQ'UVC
GZVTCVGTTKVQTKCNKFCFGLPQECTCEVGTUVKECOCTECPVGPCNGIKUNCQFC<(/SWGJQLGVGOITCPFGRCTVGFG
UGWHQEQPCKPFWUVTKCNK\CQRCTCKPVGTPCQPQOGTECFQDTCUKNGKTQEQOVTKDWVCQTGFW\KFC2QTKUUQCWVQTGU
como Lopes Filho (1983), Sosa (1993), Meira (2002) e Trevisan (2008) sustentam que a ZFM no corresponde
efetivamente a uma zona franca.
12 Por meio da Deciso CMC n. 8/1994. Tal deciso, em seus Artigos 5 (podero operar no Mercosul as Zonas
Francas que atualmente estejam em funcionamento [...]) e 6 (as reas Aduaneiras Especiais existentes de Manaus
e Tierra del FuegoEQPUVKVWFCUGOTC\QFGUWCRCTVKEWNCTUKVWCQIGQITHKEC=? FKUVKPIWGQUKPUVKVWVQUPQ
mbito do bloco regional.

50

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

Dinmica fronteiria no arco norte brasileiro no contexto das reas de Livre Comrcio

territrio aduaneiro na qual se aplica um tratamento temporrio especial, com um


regime tributrio mais favorvel que o vigente no resto do territrio aduaneiro.13
# KPCFGSWCQ VGTOKPQNIKEC GPUGLQW C 2TQRQUVC FG 'OGPFC %QPUVKVWEKQPCN
PSWGCNVGTCCFGPQOKPCQFG<(/RCTC2+/
2QNQ+PFWUVTKCNFG/CPCWU 
mantidos os benefcios at 2023 (como j assegurado pela Emenda Constitucional
n. 42/2003). Embora a proposta ainda esteja em trmite no Congresso Nacional,
o novo nome j vem sendo utilizado nos produtos fabricados na ZFM.
0QSWGUGTGHGTGU#.%VGOCGURGEEQFGUVGGUVWFQJFGUGFGUVCECTSWGUWC
ETKCQ RCWNCVKPC DCUKECOGPVG PC FECFC FG 14 FKEWNVQW C GFKQ FG WOC
NGIKUNCQIGTCNGFGWOEQPEGKVQPQTOCVKXQEQOWO
EQOCGFKQFQ4GIWNCOGPVQ#FWCPGKTQFG
CTVFQ&GETGVQP
de 26/12/2009 hoje j derrogado pelo art. 529 do Regulamento Aduaneiro de
&GETGVQPFG SWGUGRCUUCCVGTWOCPQTOCFGPKPFQ
GO CDUVTCVQ CU #.% DTCUKNGKTCU EQOQ TGCU SWG UQD TGIKOG UECN GURGEKCN UQ
GUVCDGNGEKFCUEQOCPCNKFCFGFGRTQOQXGTQFGUGPXQNXKOGPVQFGTGCUHTQPVGKTKCU
GURGEECUFC4GIKQ0QTVGFQ2CUGFGKPETGOGPVCTCUTGNCGUDKNCVGTCKUEQOQU
RCUGUXK\KPJQUUGIWPFQCRQNVKECFGKPVGITCQNCVKPQCOGTKECPC
6CNFGPKQGPFQUUCFCEQOQWVTCURCNCXTCURQT#NDWSWGTSWG
 
As reas de Livre Comrcio foram criadas como parte de polticas que
objetivavam o desenvolvimento da regio amaznica, [pois] os benefcios
concedidos por meio de incentivos tributrios visam melhoria da qualidade
de vida de determinadas regies, [...] devido ao aumento do comrcio e da
SWCPVKFCFGFGGORTGUCURGNCETKCQFGPQXQUGORTGIQUGRQTEQPUGSWPEKC
RGNCHQTOCQFGWOETEWNQGEQPOKEQXKTVWQUQ

0QU HWPFCOGPVQU SWG LWUVKECTCO C HQTOCQ FG #.% PC #OC\PKC RQFGUG
QDUGTXCTCEQPWPEKCFGFQKUFKUEWTUQUUKOWNVPGQUSWGOWKVCUXG\GUUGEQPHWPFGO
justamente por conterem elementos complementares: um econmico e outro
poltico.
#VGQTK\CQGEQPOKECFGOQPUVTCSWGCNIKECFGHWPEKQPCOGPVQFGWOC#.%
baseada em um crculo virtuoso de crescimento econmico no qual os incentivos da
FGUQPGTCQUECNTGRTGUGPVCOQICVKNJQFGGUVOWNQPCGEQPQOKCEQOQWOVQFQ
RQKUKORCEVCOKPKEKCNOGPVGPCTGFWQFQURTGQUFGRTQFWQSWGRQTUWCXG\
KORCEVCOGOCWOGPVQVCPVQPCQHGTVC
GNGXCQFCRTQFWQ SWCPVQPCRTQEWTC
13 #FGHKPKQEQPUVCPQCTVFQ%FKIQ#FWCPGKTQFQ/GTEQUWNCRTQXCFQRGNC&GEKUQ%/%P
5QDQVVWNQ+:
TGCUEQO6TCVCOGPVQU#FWCPGKTQU'URGEKCKU QEFKIQTGNCEKQPCCU<QPCU(TCPECUCUTGCU
Aduaneiras Especiais e as Lojas Francas. de se destacar que o cdigo necessita ser incorporado ao ordenamento
jurdico dos Estados Partes, o que, at o momento, foi feito somente pela Argentina, por meio do Decreto n.
2.359, de 13/12/2012, que promulga a Lei n. 26.795/2012.
14 Em que pese ser da dcada de 1960 a ideia de estender os benefcios da ZFM Amaznia Ocidental, como se
depreende dos Decretos-Leis n. 291, de 28/02/1967, e n. 356, de 15/08/1968.

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

51

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

GNGXCQ FC FGOCPFC  Q SWG TGRGTEWVG RQUKVKXCOGPVG PQ OGTECFQ FG VTCDCNJQ

EQOIGTCQFGGORTGIQU 6CNNIKECRQFGUGTXKUWCNK\CFCPC(KIWTC
Figura 4 Lgica econmica das ALC

1
2

Comercializao

Produo

Desonerao fiscal

CRCULO
VIRTUOSO DO
CRESCIMENTO

Mercado de
Trabalho


(QPVG#.$737'437'
 #FCRVCGUFQUCWVQTGU

#RGUCTFGWOCRCTEKCNFGUQPGTCQUECNPQEWTVQRTC\QQDUGTXCUGSWGFGRGPFGPFQ
da sensibilidade do investimento privado e da capacidade ociosa, no lado da oferta,
bem como da propenso ao consumo e do nvel de endividamento dos consumidores,
do lado da demanda, o efeito multiplicador da queda dos impostos propiciado pelo
TGIKOGFC#.%RQFGIGTCTPQOFKQQWPQNQPIQRTC\QUWOCTGEQORQUKQFCU
TGEGKVCUGUVCVCKUGOHWPQFQCWOGPVQFCCTTGECFCQVTKDWVTKCRTQRKEKCFQRGNQ
CWOGPVQFQEQPUWOQGFCRTQFWQ
'UUCVGQTK\CQGEQPOKECSWGGODCUCCRQNVKECFCU#.%GLWUVKECUWCGEKPEKCC
RCTVKTFCVGUGFQEKENQXKTVWQUQFGFGUGPXQNXKOGPVQGPEQPVTCEQORTQXCQRTVKEC
SWCPFQUGVQOCOGOEQPUKFGTCQQUFCFQUFC<(/WOCXG\SWGCTGPPEKCUECN
de cada R$ 1 compensada mais que proporcionalmente por um retorno de R$ 1,37
PCCTTGECFCQVTKDWVTKCINQDCNGPXQNXGPFQQUGPVGUIQXGTPCOGPVCKUFC7PKQFQ
Estado do Amazonas e do municpio de Manaus (SUFRAMA, 2009).
52

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

Dinmica fronteiria no arco norte brasileiro no contexto das reas de Livre Comrcio

#VGQTK\CQRQNVKECRQTUGWVWTPQEGPVTCUGPCRTQOQQFQFGUGPXQNXKOGPVQFG
municpios presentes em fronteiras internacionais na Amaznia, buscando integrNQUCQTGUVCPVGFQRCURQTOGKQFCGZVGPUQFGCNIWPUDGPGHEKQUUECKUFQOQFGNQ
FC<(/COFGHQTVCNGEGTQUUGVQTGUEQOGTEKCNCITQKPFWUVTKCNGGZVTCVKXQ
&C RCUUCIGO FQU CTIWOGPVQU RQNVKEQU G GEQPOKEQU SWG LWUVKECTCO C ETKCQ
FGUGVG#.%PC#OC\PKC.GICNRCTCCRTVKECFCQRGTCEKQPCNK\CQTGIKUVTCUGC
GUVTWVWTCQFGWOCCTSWKVGVWTCPQTOCVKXCPCHQTOCFGTGIKOGCFWCPGKTQCRNKECFQ
GOTGCGURGEKCNRTQRQTEKQPCPFQEGTVQITCWFGTGPPEKCUECN
Em sntese, o tratamento tributrio nas ALC o seguinte: as mercadorias15 ingressam
PCU #.% EQO UWURGPUQ FC GZKIKDKNKFCFG FQ +ORQUVQ FG +ORQTVCQ
++  G FQ
+ORQUVQUQDTG2TQFWVQU+PFWUVTKCNK\CFQU
+2+ SWGUGEQPXGTVGGOKUGPQSWCPFQ
JQWXGTWOCFCUFGUVKPCGURTGXKUVCUPCNGK16 de regncia. Ao sarem das ALC para
o restante do territrio aduaneiro (exceto se para outra ALC, para a ZFM ou para a
#OC\PKC1EKFGPVCNPQUECUQUFGGZVGPUQFQUDGPGHEKQUFC<(/ ECOUWLGKVCU
CQVTCVCOGPVQFCFQUKORQTVCGU
#VCKUKPEGPVKXQUUQOCOUGQUTGNCEKQPCFQUCQWVTQUVTKDWVQUHGFGTCKU%QPVTKDWKQ
RCTCQ2TQITCOCFG+PVGITCQ5QEKCNGRCTCQ2TQITCOCFG(QTOCQFQ2CVTKOPKQ
FQ 5GTXKFQT 2DNKEQ
%QPVTKDWKQ RCTC Q 2+52CUGR  G %QPVTKDWKQ RCTC Q
(KPCPEKCOGPVQFC5GIWTKFCFG5QEKCN
%QPU GGUVCFWCKU+%/517
&CU SWCVTQ UKVWCGU FG CRTQXGKVCOGPVQ FG DGPGHEKQ UECN PQ TGIKOG FCU #.%
(esquematizadas na Figura 5), observa-se claramente que as empresas tm um padro
FGTGCNK\CQFGPGIEKQUSWGUGEQPEGPVTCPCcompra de bens nacionais, com um
menor grau de importaoQSWGTGRGTEWVGGOTGPPEKCUECNVCPVQGOTGNCQCQU
VTKDWVQUHGFGTCKU
+2+%QPVTKDWKQRCTCQ2+52CUGRG%QPU SWCPVQCQUGUVCFWCKU
(ICMS).

15 *TGUVTKGUGEQPOKECUCRNKECQFQTGIKOGGOVQFCUCU#.%RCTCCWVQOXGKUFGRCUUCIGKTQUDGDKFCU
CNEQNKECUHWOQGUGWUFGTKXCFQURGTHWOGUGCTOCUGOWPKGU0CU#.%FG6CDCVKPICG)WCLCT/KTKOJ
CKPFCTGUVTKQCDGPUHKPCKUFGKPHQTOVKEC
16 1CTVKIQFQ4GIWNCOGPVQ#FWCPGKTQDTCUKNGKTQ
&GETGVQP UKPVGVK\CCUFGUVKPCGUIGTCKUG
RQT#.%ECDGPFQFGUVCECTSWGCFGUQPGTCQRCTCQ++GQ+2+EQTTGURQPFGCWOCUWURGPUQFQRCICOGPVQ
EQPXGTVKFCGOKUGPQEQOCFGUVKPCQ&GUVCSWGUGSWGGOVQFCUCU#.%UGRGTOKVGCKPVGTPCQFCOGTECFQTKC
(sada para outros pontos do territrio nacional) como bagagem acompanhada de viajante, observado o mesmo
VTCVCOGPVQRTGXKUVQPCNGIKUNCQCRNKEXGN<QPC(TCPECFG/CPCWU
17 1UDGPGHEKQUHKUECKUGUVCFWCKUTGNCEKQPCFQUCQ+%/5RGTOKVGOSWGQRGTCGURTCVKECFCURQTGORTGUCUUKVWCFCU
PCU#.%RQUUCOQDVGTWOCTGFWQHKPCNFGECTICVTKDWVTKCFGCGOTC\QFCKUGPQVTKDWVTKCFGUUG
imposto nas remessas internas e interestaduais, bem como do crdito presumido concedido ao contribuinte
adquirente das mercadorias (EUZBIO, 2011).

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

53

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

Figura 5 Situaes de previso para desonerao tributria

(QPVG57(4#/#
 #FCRVCGUFQUCWVQTGU

As ALC plenamente implantadas (Tabatinga/AM, Guajar-Mirim/RO, Boa


Vista/RR e Macap-Santana/AP) se tornaram importantes para dinamizar o setor
EQOGTEKCN FQU OWPKERKQU G C CPNKUG FC GXQNWQ FC TGPPEKC UECN FGOQPUVTC
SWG GUVC  KPUKIPKECPVG FKCPVG FQ XQNWOG FG CTTGECFCQ VQVCN FQU OGUOQU
KORQUVQUQWFCTGEQORQUKQUECNEQOQCWOGPVQFCRTQFWQGFQEQPUWOQ
(OLIVEIRA, 2011).
Desde o surgimento do regime das ALC na dcada de 1990, observa-se que nos
municpios em que elas foram plenamente implementadas houve crescente
aumento do volume de compra de bens nacionais e um baixo e voltil volume de
KORQTVCGU18RGTEGRVXGNRGNCEQPVCDKNK\CQFQ+2+GFQ++

18 .QITCUGZKVQCUUKOGOTGNCQCWOFQUHCVQTGULWUVKHKECFQTGUFCU#.%EQOQRQNVKECTGCVKXCSWGXKUCC
VQTPCTQEQOTEKQOCKUCVTCVKXQPQUOWPKERKQUHTQPVGKTKQUDTCUKNGKTQUGOEQORCTCQUEKFCFGUIOGCUPQU
RCUGUXK\KPJQUDWUECPFQIGTCTRTGQUNQECKUOCKUEQORGVKVKXQUGGXKVCTQHWPEKQPCOGPVQFQcomrcio formiga,
propulsor de evaso fiscal e de renda brasileira no exterior. Tal xito tem ainda impacto positivo em outro
HCVQTLWUVKHKECFQTFCU#.%CTGFWQFCFGUKIWCNFCFGKPVTCTTGIKQPCNPC#OC\PKC

54

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

Dinmica fronteiria no arco norte brasileiro no contexto das reas de Livre Comrcio

#UTC\GURCTCQDCKZQFKPCOKUOQFCUKORQTVCGUCPVGQEQPUWOQFGRTQFWVQU
nacionais nas ALC so explicadas, principalmente, pela falta de tcnicos
especializados e de apoio logstico, pelo tamanho restrito do mercado municipal
GRGNCUFKEWNFCFGUPQTOCVKXCUQRGTCEKQPCKUPCKORQTVCQ
'O HWPQ FC GUECNC C #.% FG /CECR G 5CPVCPC#2 TGIKUVTC WO OGNJQT
CRTQXGKVCOGPVQ FQ TGIKOG G FGRQKU FG FWCU FECFCU FG QRGTCQ Q UGIOGPVQ
GORTGUCTKCNCRTQXGKVCUGFCUFGUQPGTCGUUECKUGOGUECNCFGETGUEGPVGRCTCEQORTCT
bens nacionais, importar bens G PCNOGPVG vender bens intranacionalmente para
o Par.

7 FUNCIONAMENTO DAS ALC NA FAIXA


DE FRONTEIRA AMAZNICA
%KTEWPUETKVCU VGTTKVQTKCNOGPVG C GURCQU FGNKOKVCFQU GO WO OWPKERKQ G C WO
VGORQRTGXKUVQFGTGPPEKCUECNFQGUVCFQCU#.%HQTCOETKCFCUEQOQQDLGVKXQ
de promover um desenvolvimento mais equilibrado na faixa de fronteira amaznica,
tomando como referncia o sucesso econmico, poltico e ambiental do modelo
da ZFM/PIM.
Nesse contexto propositivo, de um total de 98 municpios brasileiros da Amaznia
Legal, presentes na faixa de fronteira, observa-se que apenas nove se caracterizam
EQOQEKFCFGUIOGCUPCUNKPJCUVTCPUHTQPVGKTKCUFQ$TCUKNEQOQUFGOCKURCUGU
COC\PKEQU G SWG EKPEQ FGNGU HQTCO DGPGEKCFQU EQO #.% RCTC RTQOQQ FQ
FGUGPXQNXKOGPVQNQECNGFCKPVGITCQTGIKQPCN
+$)' 
A Figura 6 apresenta as cidades gmeas contempladas com ALC na Amaznia
Legal, destacando-se que o termo Amaznia Legal (inicialmente definido
PC .GK P   CVWCNOGPVG EQORTGGPFG EQPHQTOG FGNKOKVCQ FC
.GKP
EQOQUKORCEVQUFGEQTTGPVGUFC%QPUVKVWKQ(GFGTCNFGG
da Lei Complementar n. 31/1977), os seguintes estados: Acre, Amap, Amazonas,
Mato Grosso, Par, Rondnia, Roraima, Tocantins e parte do Maranho (oeste do
meridiano de 44o).

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

55

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

Figura 6 Cidades gmeas com ALC na Amaznia Legal

(QPVG$4#5+.
 #FCRVCGUFQUCWVQTGU

'UUGUFCFQUFGOQPUVTCOSWGCRQNVKECTGIKQPCNKUVCFGRTQOQQFQFGUGPXQNXKOGPVQ
GFCKPVGITCQTGIKQPCNPC#OC\PKCRQTOGKQFCU#.%VGOWOHQEQEQPEGPVTCFQ
em cidades gmeas nas linhas de fronteira, em detrimento de boa parte dos
municpios no interior da faixa de fronteira, em nmero dez vezes maior (em que
pese haver duas ALC em tais municpios: Boa Vista/RR e Macap-Santana/AP).
2QTOCKUSWGQTGIKOGFCU#.%VGPJCWOXKUENCTCOGPVGVTCPUHTQPVGTKQEQOHQEQ
em cidades gmeas brasileiras, observa-se paradoxalmente que em tais municpios
UGQDVOOGPQT
QWPGPJWOC GHGVKXKFCFGPCKORNGOGPVCQFQTGIKOGCFWCPGKTQ
#HCNVCFGTGIWNCOGPVCQFCU#.%GONKPJCFGHTQPVGKTCFG$TCUKNGKC'RKVCEKQNPFKC
#%
#.%$' FG$QPO44
#.%$ GFG2CECTCKOC4419 (ALCP) demonstra
que o regime aduaneiro em tais locais no saiu do papel, de modo que as empresas
ECFCUVTCFCU PC 5WHTCOC PC OCKQTKC FQU ECUQU PWPEC \GTCO WOC KORQTVCQ
RQT OGKQ FQ TGIKOG VGPFQ UKFQ DGPGEKCFCU CRGPCU EQO QU KPEGPVKXQU UECKU
principalmente de ICMS, oriundos de compras nacionais.
'UUCCWUPEKCFGGHGVKXKFCFGGPEQPVTCLWUVKECVKXCPCTGFW\KFCGUECNCEQOGTEKCNPGUUGU
municpios, na baixa demanda poltica e econmica e nas zonas de livre comrcio
19 A ALC de Pacaraima, por sua inoperncia, foi extinta, dando lugar ALC de Boa Vista em 2008.

56

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

Dinmica fronteiria no arco norte brasileiro no contexto das reas de Livre Comrcio

CNVCOGPVGFKPOKECUGCVTCVKXCUPCUEKFCFGUIOGCUFQURCUGUHTQPVGKTKQUEQOQ
Cobija (na Bolvia), Lethem (na Guiana) e Santa Elena de Uairn (na Venezuela).
1RCTCFQZQTGXGNCFQKURCFTGUFKUVKPVQUFGGXQNWQFCU#.%ECTCEVGTK\CFQURGNQ
dinamismo comercial em municpios de mdio porte e pela inrcia estacionria nos
municpios de pequeno porte em linhas de fronteira, como se percebe no Quadro 2.
Quadro 2 Operao das reas de Livre Comrcio
Empresas
Cadastradas na
Suframa (ECS)

Empresas Aptas
para Receberem
Benefcio Fiscal
(ERBF)

UF

ALC

ALC
Regulamentada
(ALCR)

AM

Tabatinga

Sim

181

72

509.961,38

RO

Guajar-Mirim

Sim

1.081

372

2.906.876,51

Boa Vista

Sim

3.450

1.680

2.978.566,42

$QPO

No

30

08

AP

Macap-Santana

Sim

no informado

no informado

BrasileiaEpitaciolndia

No

491

159

0,00

AC

Cruzeiro do Sul

No

503

292

0,00

RR

Volume de
Importaes (VI)
US$

0,00
28.198.907,99

(QPVGGNCDQTCQFQUCWVQTGU&CFQUHQTPGEKFQURGNC5WHTCOCGUWCU%QTG#PQFGTGHGTPEKC

&G WO NCFQ GPEQPVTCOUG CU #.% EQO FGUGORGPJQ RQ L EKVCFCU
#.%$'
e ALCB), ladeadas pela ALC de Cruzeiro do Sul/AC (ALCCS).20 De outro,
CU RTQXCU FC EQPVTKDWKQ FQ TGIKOG CQ FGUGPXQNXKOGPVQ TGIKQPCN QU VTU
municpios de mdio porte em faixa de fronteira (Boa Vista/RR, e Macap/AP e
Santana/AP) e os demais municpios na linha de fronteira de Rondnia, Amaznia
e Acre, cujas ALC j esto implantadas e apresentam anualmente um nmero
ETGUEGPVGFGGORTGUCUECFCUVTCFCUPC5WHTCOCFCUSWCKUWORGTEGPVWCNUKIPKECVKXQ
CRTGUGPVCFQEWOGPVCQCRVCCTGEGDGTQDGPGHEKQUECNEQTTGURQPFGPVGCQTGIKOG
Os casos das ALC de Tabatinga/AM (ALCT) e de Boa Vista/RR (ALCBV)
demonstram como o comprometimento municipal foi relevante para consolidar uma
parceria de recursos tcnicos e econmicos com a Suframa, no sentido de efetivar a
QRGTCEKQPCNK\CQFQTGIKOGRQTOGKQFCKPUVCNCQFQUGPVTGRQUVQUCFWCPGKTQU21
20 Diante da baixa maturidade dessas ALC, a dinmica do beneficiamento fiscal no caso das cidades gmeas acontece
RQTOGKQFQFGUGODCTCQFGOGTECFQTKCUPCU%QQTFGPCGU4GIKQPCKUFG%TW\GKTQFQ5WNG4KQ$TCPEQPQ
Acre, e de Boa Vista, em Roraima unidades descentralizadas da Suframa, em parceria com as Secretarias de
Fazenda (Sefaz) dos referidos estados.
21 Entrepostos aduaneiros de ALC so recintos alfandegados fechados, sob controle aduaneiro, instalados em
NQECKUGURGEHKEQUFGVGTOKPCFQURGNC5WHTCOCGRGNC4($NGXCPFQUGGOEQPVCCOGNJQTNQECNK\CQGOVGTOQU
de acesso aos portos e aos aeroportos eventualmente existentes nas ALC.

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

57

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

Os exemplos das ALC de Macap-Santana/AP (ALCMS) e Guajar-Mirim/RO


(ALCGM), por sua vez, espelham no somente o sucesso do comprometimento
OWPKEKRCN OCU RTKPEKRCNOGPVG C CVTCQ FG KPXGUVKOGPVQU GORTGUCTKCKU
EQPEGPVTCFQUPQUGVQTFGUGTXKQU
0QECUQTQPFQPKGPUGCNOFCFKPCOK\CQFQUGVQTFGUGTXKQUC#.%CFSWKTKW
RCTVKEKRCQ ETGUEGPVG PQ FGUGORGPJQ FC CITQKPFUVTKC GO )WCLCT/KTKO
TGGVKPFQPQPQVXGNTKVOQFGETGUEKOGPVQFG4QPFPKCGOHWPQFQCITQPGIEKQ
0QECUQCOCRCGPUGC#.%EQPEGPVTQWUGPCEQOGTEKCNK\CQFGDGPUKORQTVCFQU
tornando-se o hot spot de maior destaque entre as ALC, por apresentar maior
FKXGTUKECQFGUGVQTGUOCKQTSWCPVKFCFGFGGORTGUCUDGPGEKCFCUGOCKQTXQNWOG
FGKORQTVCGUGFGOQXKOGPVCQFGPQVCUUECKU
8GLCUGSWGGPSWCPVQPCEKFCFGCOCRCGPUGCUKORQTVCGUUQCEQORCPJCFCURGNC
RTQNKHGTCQFGGUETKVTKQUFGFGURCEJQCFWCPGKTQGO/CECRG5CPVCPCPCUFGOCKU
ALC no h mais que um ou dois escritrios abertos, e os empresrios ainda carecem
FGKPHQTOCQGOTGNCQCEQORTCUGKORQTVCGUCQCORCTQFQTGIKOG
1RCTCFQZQCRTGUGPVCFQTGGVGSWGQURTQDNGOCUPCKORNGOGPVCQFG#.%GO
linha de fronteira so normalmente relacionados pequena escala municipal para
CTTGECFCTTGEWTUQUGOQFGUVCECRCEKFCFGFGOQDKNK\CQFCURTGHGKVWTCURGTCPVGQ
governo do estado e os parlamentares federais, o que repercute na falta de recursos
para implantar as estruturas fsicas necessrias ao alfandegamento.22
Os problemas detectados nas ALC pouco operantes implicam, em regra, o no
alcance dos objetivos desejados. Contudo, podem ocasionar mal ainda maior: a
IGTCQFGGORTGIQUPQQWVTQNCFQFCHTQPVGKTCGQXC\COGPVQFGTGPFCPCEKQPCN
(efeito diametralmente oposto ao desejado). Veja-se, por exemplo, o caso da ALCB
e da ALCBE, para as quais se obteve, em trabalho de campo e dados da Suframa, a
KPHQTOCQFGSWGCURQWECUGORTGUCUSWGUGDGPGEKCOFQUKPEGPVKXQUUECKUHC\GO
WOCVTKCPIWNCQEQOGTEKCNTGXGPFGPFQQURTQFWVQUKORQTVCFQUCQUOWPKERKQU
de Cobija (Bolvia) e Lethem (Guiana).
6CNFKPOKECEQOGTEKCNVTCPUHTQPVGKTKCCEQPVGEGGODQCRCTVGFCHCKZCFGHTQPVGKTC
DTCUKNGKTCGUGGZRNKECRGNCCVTCQFQUEGPVTQUEQOGTEKCKUFCUEKFCFGUIOGCUFG
RCUGUXK\KPJQUSWGRQUUWGOFGUTGIWNCOGPVCQFQOGTECFQFGVTCDCNJQEODKQ
desvalorizado e menor incidncia tributria, o que acaba por induzir o investimento
por empresrios brasileiros, bem como por incentivar o consumo de brasileiros nas
cidades gmeas estrangeiras.

22 Quando se analisa o caso de Cruzeiro do Sul, verifica-se o exemplo da letargia poltica para estabelecer parcerias
EQOC5WHTCOCCFGURGKVQFGQOWPKERKQCRTGUGPVCTCFGPUCOGPVQVCPVQUGVQTKCNGOUGTXKQUGPCCITQKPFUVTKC
quanto populacional, propcio para dinamizar a demanda comercial.

58

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

Dinmica fronteiria no arco norte brasileiro no contexto das reas de Livre Comrcio

8 CONSIDERAES FINAIS
As regies de fronteira sul-americanas tm passado nas ltimas trs dcadas por uma
TGNGKVWTCIGQGUVTCVIKECSWGKPGZKQPCQENUUKEQRCTCFKIOCIGQRQNVKEQEQPKVKXQ
GFGEQPVGPQFCU\QPCUFGUGIWTCPCGOFKTGQCWOPQXQOQFGNQIGQRQNVKEQ
cooperativo baseado nas zonas de contato crticas para alavancar o processo de
KPVGITCQTGIKQPCNVTCPUPCEKQPCN
#KPVGTRTGVCQFCUHTQPVGKTCUVTCFKEKQPCNOGPVGCUUQEKCFCCWOCCIGPFCPGICVKXC
SWG TGGVKC EQPVGPEKQUQU RQVGPEKCKU G HTCIOGPVCGU GURCEKCKU CDTKW GURCQ C
WOCTGNGKVWTCRQUKVKXCFGTGCUGUVTCVIKECUFGEQPXGTIPEKCGKPVGITCQTGIKQPCN
SWG OQFKECO G FQ QTKIGO C PQXCU HQTOCU FG VGTTKVQTKCNKFCFG
)#&'.*#
COSTA, 2007).
'ODQTC Q $TCUKN HCC NKOKVG EQO  RCUGU UWNCOGTKECPQU G VGPJC CGU
paradiplomticas sistematizadas por 11 estados e 588 municpios, sua faixa de
HTQPVGKTC EQPIWTCUG JKUVQTKECOGPVG EQOQ WOC TGIKQ RQWEQ FGUGPXQNXKFC G
marginalizada pelas polticas pblicas nacionais, realidade a ser mudada com a
ETGUEGPVGRGTEGRQFCUHTQPVGKTCUEQOQTGCURTKQTKVTKCURCTCQFGUGPXQNXKOGPVQ
PCEKQPCNGCKPVGITCQTGIKQPCN
nesse contexto que surge o modelo econmico das ALC com a natureza de regime
aduaneiro aplicado em rea especial, tendo como motor de impulso uma poltica
VGORQTCNFGTGPPEKCUECNFKTGEKQPCFCCHQOGPVCTCCVKXKFCFGGORTGUCTKCNPCTGIKQ
O dinamismo do regime das ALC, no entanto, proporcional ao tamanho do
mercado do municpio-sede, restando patente a assimetria entre cidades pertencentes
faixa de fronteira e linha de fronteiraFGOQPUVTCPFQSWGQKPEGPVKXQUECNRWTQPQ
UWEKGPVGRCTCICTCPVKTQGUVOWNQFQKPXGUVKOGPVQGORTGUCTKCNGOVQFQUQUECUQU
Se, por um lado, as ALC de Guajar Mirim/RO (ALCGM) e Tabatinga/AM (ALCT)
acabaram se revelando positivas para o desenvolvimento municipal, a despeito
FGUQHTGTGOEQOCEQPEQTTPEKCFCUEKFCFGUIOGCUFG)WC[CTCOGTP
$QNXKC G
.GVEKC
%QNODKC TGURGEVKXCOGPVGRQTQWVTQNCFQC#.%FG$QPO44
#.%$ 
a extinta ALC de Pacaraima/RR (ALCP) e a ALC de Brasileia/Epitaciolndia/
AP (ALCBE) acabaram inoperantes ante a dinmica das cidades gmeas de Lethem
(Guiana), Santa Elena de Uairn (Venezuela) e Cobija (Bolvia).
FGUGEQPENWKTCUUKOSWGCRQNVKECFGETKCQFG#.%GOOWPKERKQURGSWGPQU
FCNKPJCFGHTQPVGKTCWVKNK\QWHTOWNCKPCFGSWCFC#QSWGRCTGEGCTGEGPVGGFKQ
FC .GK P  FG  SWG RGTOKVG C KPUVCNCQ FG NQLCU HTCPECU
EQO
KUGPQFG+++2+%QPUKORQTVCQG%QPVTKDWKQRCTCQ2+52CUGRKORQTVCQ 
em sedes de municpios autorizados, caracterizados como cidades gmeas de cidades
estrangeiras na linha de fronteira do Brasil, buscou uma frmula alternativa. No
GPVCPVQ EQOQ C NGK CKPFC PQ HQK TGIWNCOGPVCFC G UGSWGT HQTCO FGPKFQU QU
Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

59

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

municpios autorizados em que poder ser operado o regime ou o modelo23 de loja,


UGTKCRTGEQEGSWCNSWGTOCPKHGUVCQRQKUJWOCVGPFPEKCOCKQTFGCINQOGTCQ
de lojas francas no sul do pas.
A experincia consolidada da ALCMS como caso de sucesso mais proeminente revelase como benchmarkingWOCXG\SWGUGORTGJQWXGGEKPEKCVCPVQPQlobby poltico,
uma vez que o modelo de ALC era direcionado originalmente para a Amaznia
1EKFGPVCNSWCPVQPQCRTQXGKVCOGPVQFGDGPGHEKQUUECKURCTCCKORNCPVCQFG
WOOQFGNQFGEQOGTEKCNK\CQFGRTQFWVQUKORQTVCFQUTGFGURCEJCFQURCTC$GNO
PA e outros municpios amapaenses.
# #.%$8 GODQTC CKPFC GUVGLC GO OCVWTCQ FGOQPUVTC EQOQ C GUECNC
populacional e o baixo grau de desenvolvimento industrial foram funcionais
RCTCGUVKOWNCTCCFGUQFGGORTGUCURCTCQCRTQXGKVCOGPVQFQUKPEGPVKXQUUECKU
concentradamente ligados compra de produtos de outros estados por empresas j
consolidadas, mas tambm aproveitados por pequenas novas empresas que importam
bens de informtica. de se destacar que j h tambm uma ZPE aprovada em Boa
Vista, o que pode incrementar ainda mais o processo de desenvolvimento regional
EQODCUGGOKPEGPVKXQUUECKU
#XCTKXGNSWGGZRNKECQOGNJQTFGUGORGPJQFC#.%/5GOEQORCTCQEQOC
ALCBV reside no grau de aproveitamento das potencialidades do modelo ALC,
seja pelo tempo de experincia, seja pela proximidade da concorrncia aduaneira/
tributria de cidades gmeas de pases vizinhos, seja pelo transbordamento comercial
dos produtos.24
Em que pese o xito, podem, contudo, ser encontrados problemas comuns quanto
QRGTCEKQPCNK\CQFQTGIKOGOGUOQGOTGNCQU#.%KORNCPVCFCUGGORNGPQ
funcionamento, seja em faixa de fronteira (ALCMS e ALCBV), seja em linha de
fronteira (ALCGM e ALCT).
Segundo Albuquerque (2011), com base em dados empricos do empresariado,
observa-se que entre os principais entraves existentes nas ALC implantadas e em
pleno funcionamento destacam-se o custo de transporte, a escassez de mo de obra
GURGEKCNK\CFCCUFKEWNFCFGUFGFGUGODCTCQCFWCPGKTQGQFGUEQPJGEKOGPVQFQU
GORTGUTKQUUQDTGDGPGHEKQUFGFGUQPGTCQUECNFQTGIKOG
#FGOCKUTGEQTFGUGSWGCETKCQFG#.%PQ$TCUKNPQRQUUWKVCNEQOQCU<2'GC
<(/WOCNGIKUNCQPKECUGPFQECFCTGCETKCFCRQTNGKGURGEECEQOEQOCPFQU
diferenciados, o que impactou em hiatos de funcionamento nos municpios em linha
23 A expectativa de mercado de que o modelo seja mais aberto e descentralizado que o atualmente utilizado em
aeroportos internacionais duty frees areos (quase monopolista).
24 1OCKQTVGORQFGGZRGTKPEKCFC#.%/5EQPLWICFQEQOCRTQZKOKFCFGFG$QC8KUVCGOTGNCQCEGPVTQUFG
evaso de renda em Santa Elena (Venezuela) e Lethem (Guiana), ou, ainda, a existncia em Roraima de grandes
XC\KQUFGOQITHKEQUGRTQDNGOCUFGNQIUVKECGCRGPCUQWVTQUOWPKERKQUFGOQPUVTCOSWGC#.%$8VGO
menor potencial atrativo.

60

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

Dinmica fronteiria no arco norte brasileiro no contexto das reas de Livre Comrcio

FGHTQPVGKTC
EKFCFGUIOGCU GEGTVCOGPVGFKEWNVCCEQORTGGPUQFQTGIKOGRGNQ
empresariado em geral.
inegvel, com base nas discusses aqui empreendidas, a relevncia das ALC
EQOQ XGEWNQ FG RTQOQQ FQ FGUGPXQNXKOGPVQ TGIKQPCN PC HCKZC FG HTQPVGKTC
amaznica, no obstante possa o modelo ser aprimorado e combinado com outros
nos municpios brasileiros em linha de fronteira e em municpios de mdio porte,
com potenciais setores econmicos atrativos.

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

61

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

REFERNCIAS
ALBUQUERQUE, C. R. C. reas de Livre Comrcio: o caso de Boa Vista.
&KUUGTVCQFGOGUVTCFQ2QTVQ#NGITG7(4)57(44
$'0-1).+2+'6<#As regies ganhadoras: distritos e redes os novos
RCTCFKIOCUFCIGQITCCGEQPOKEC1GKTCU%GNVC'FKVQTC
BRASIL. MINISTRIO DA INTEGRAO NACIONAL. Proposta de
Reestruturao do Programa de Desenvolvimento da Faixa de Fronteira.
Braslia: MI, 2005.
DIETZ, C. I. Cenrios contemporneos da fronteira Brasil-Argentina: as
KPHTCGUVTWVWTCU GUVTCVIKECU G Q RCRGN FQU CVQTGU PQ RTQEGUUQ FG EQQRGTCQ
KPVGITCQ&KUUGTVCQFGOGUVTCFQ2QTVQ#NGITG7(4)5
EUZBIO, E. F. Fronteira e horizontalidade na Amaznia: as cidades gmeas
FG 6CDCVKPIC
$TCUKN  G.GVEKC
%QNODKC &KUUGTVCQFG OGUVTCFQ5Q 2CWNQ
USP, 2011.
)#&'.*#%#)%156#.+PVGITCQFGHTQPVGKTCUCUCFGPQEQPVGZVQ
de uma poltica nacional de desenvolvimento. Cadernos de Sade Pblica, v. 23,
n. 2, 2007.
INSTITUTO BRASILEIRO DE GEOGRAFIA E ESTATSTICA (IBGE).
Cadastro dos municpios brasileiros da faixa de fronteira. Rio de Janeiro:
IBGE, 2012.
LOPES FILHO, Osris de Azevedo. Regimes aduaneiros especiais. So Paulo:
Revista dos Tribunais, 1983.
MAGALHES, M. G. S. D. O Estado de Roraima e as fronteiras com a Venezuela
e a Guiana. Revista Textos & Debate, n. 12, 2007.
MARTIN, A. R. Fronteiras e naes: repensando a geografia. So Paulo:
Contexto, 1992.
MATTOS, C. M. Uma geopoltica pan-amaznica. Rio de Janeiro: Biblioteca do
Exrcito, 1980.
MEIRA, Liziane Angelotti. Regimes aduaneiros especiais. So Paulo: IOB, 2002.
OLIVEIRA, J. L. C. Zona Franca de Manaus: um estudo sobre a renncia dos
GPVGUHGFGTCVKXQUGQUDGPGHEKQUUQEKQGEQPOKEQUIGTCFQU&KUUGTVCQFGOGUVTCFQ
Porto Alegre: UFRGS, 2011.
PEITER, P. C. A geografia da sade na faixa de fronteira continental do Brasil
na passagem do milnio. Tese de doutorado. Rio de Janeiro: UFRJ, 2005.
62

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

Dinmica fronteiria no arco norte brasileiro no contexto das reas de Livre Comrcio

AAAAAA%QPFKEKQPGUFGXKFCUKVWCEKPFGNCUCNWF[FKURQPKDKNKFCFFGUGTXKEKQUFG
UCNWFGPNCHTQPVGTCFG$TCUKNWPGPHQSWGIGQITEQCaderno de Sade Pblica,
n. 23, suplemento 2, 2007.
2'4417: ( Ensaio sobre a filosofia do novo desenvolvimento. Lisboa:
(WPFCQ%CNQWUVG)WNDGPMKCP
______. Lconomie du sicle XX. Paris: Presses Universitaires de France, 1969.
21461 , %156# / A rea de Livre Comrcio de Macap e Santana:
questes geoeconmicas. Macap: O Dia, 1999.
RICARDO, David. Princpios de economia poltica e tributao. Trad. Paulo
Henrique Ribeiro Sandroni. So Paulo: Nova Cultural, 1996.
47%-'46 # # # 2QNVKEC 0CEKQPCN FG 1TFGPCOGPVQ 6GTTKVQTKCN $TCUKN
WOC RQNVKEC VGTTKVQTKCN EQPVGORQTPGC GO EQPUVTWQ Scripta Nova. Revista
Electrnica de Geografa y Ciencias SocialesXQN:+P
SOSA, Roosevelt Baldomir. Comentrios Lei Aduaneira: do art. 249 ao art. 410
do Dec. 91.030/1985. So Paulo: Aduaneiras, 1993.
517<#%47<)#$+521 45 5+.8# #<$ #ETKCQFG<QPCUFG
2TQEGUUCOGPVQFG'ZRQTVCQGFGTGCUFG.KXTG%QOTEKQEQOQKPUVTWOGPVQU
FG TGFWQ FQ FGUGSWKNDTKQ KPVTCTTGIKQPCN PC #OC\PKC 1EKFGPVCN Revista
Exampaku, v. 1, n. 1, 2008.
SECRETARIA DA RECEITA FEDERAL (SRF). Demonstrativo dos gastos
tributrios 2011. Braslia: SRF, 2010.
______. Demonstrativo dos gastos tributrios. Est. 2008. Braslia: SRF, 2011.
______. Demonstrativo dos gastos tributrios 2012. Braslia: SRF, 2012a.
______. Demonstrativo dos gastos tributrios: estimativas bases efetivas 2009
Srie 2007 a 2011. Braslia: SRF, 2012b.
SUPERINTENDNCIA DA ZONA FRANCA DE MANAUS (Suframa).
Cartilha de incentivos fiscais. Manaus: Suframa, 2011.
AAAAAA)CPJQUVTKDWVTKQGUQEKCNFC<(/UWRGTCOTGPPEKCUECNSuframa Hoje,
CPQ:PCIQ
TREVISAN, Rosaldo. Atuao estatal no comrcio exterior em seus aspectos
tributrio e aduaneiro&KUUGTVCQFGOGUVTCFQ2QPVKHEKC7PKXGTUKFCFG%CVNKEC
do Paran. Curitiba, 2008.

Cad. Fin. Pbl., Braslia, n. 12, p. 39-63, dez. 2012

63

Dinmica transfronteiria no arco sul brasileiro


no contexto do Regime de Tributao Unificada
Eloisa Maieski Antunes
Servidora da UTFPR. Pesquisadora convidada
da Universit Paris 1 Panthon/Sorbonne
Pesquisadora na Univille e na Unipampa

GO+PVGITCGU'EQPOKECU$KPCEKQPCKUG
Desenvolvimento Social em Regies de Fronteiras)
&QWVQTCPFCGO)GQITCC'EQPOKEC
7(24
Mestre em Engenharia Urbana

Eli Martins Senhoras


2TQHGUUQTGRGUSWKUCFQTFQ&GRCTVCOGPVQFG4GNCGU
Internacionais (DRI), bem como dos Programas de
/GUVTCFQGO)GQITCC
22))'1 GGO5QEKGFCFG
e Fronteiras (PPG-SOF) da Universidade Federal de
Roraima (UFRR)
Graduado, especialista, mestre, doutor e
ps-doutorando em Cincias Jurdicas

Rosaldo Trevisan

FGN 'UVG
2CTCIWC[  HQEWUGF QP VJG UVWF[ QH VJG
7PKHKGF 6CZ 4GIKOG
467  5VTWEVWTGF KP HKXG
sections, the article analyzes the border dynamics
contexted by the RTU implementation, including
an initial evaluation of the regime impact in the
perspective of its main players. Based on the analysis,
this text provides subsidies for a theoretical and
empirical understanding about the RTU, regime
for which there is no academic study published,
highlighting customs and tax aspects, and its
economic and social consequences.

Keywords
Foz do Iguau. Unified Tax Regime. Border.

1 INTRODUO

Auditor-Fiscal da Receita Federal do Brasil


Consultor do FMI nas reas tributria/aduaneira
%QPUGNJGKTQFQ%CTH/(#UUGUUQTFG/QFGTPK\CQ
#FWCPGKTCFC1TICPK\CQ/WPFKCNFG#FWCPCU
Doutorando (UFPR) e Mestre (PUC-PR) em Direito
Pesquisador em matria tributria (UFPR e UCB)
e aduaneira (Unicamp)

A importncia do comrcio internacional


na economia global evidente.
O desenvolvimento econmico encontra
UWDUVCPEKCN HWPFCOGPVQ PCU TGNCGU
comerciais internacionais entre os
Estados, pois o comrcio exterior
EQPVTKDWKRCTCCGUVTWVWTCQFCRTQFWQ
Resumo
PCEKQPCNGRCTCQGSWKNDTKQFCDCNCPC
Este texto discute a dinmica fronteiria nas
comercial.
EKFCFGUIOGCUFG(Q\FQ+IWCW
$TCUKN G%KWFCF
FGN 'UVG
2CTCIWCK  VQOCPFQ EQOQ TGHGTPEKC
o estudo do Regime de Tributao Unificada

467  'UVTWVWTCFQ GO EKPEQ UGGU Q CTVKIQ


analisa a dinmica transfronteiria no contexto da
implementao do RTU, incluindo uma avaliao
inicial do impacto do regime na perspectiva dos
seus principais operadores. Com base na anlise, o
texto fornece subsdios para a compreenso terica
e emprica do RTU, regime para o qual ainda no
h estudo acadmico publicado, com destaque para
os aspectos aduaneiros e tributrios e seus reflexos
econmicos e sociais.

Palavras-chave
Foz do Iguau. Regime de Tributao Unificada.
Fronteira.

# TGNCQ GPVTG EQOTEKQ GZVGTKQT


e territrio torna-se bem explcita
SWCPFQUGGUVWFCOTGIKGUHTQPVGKTKCU
#U KPVGTCGU GURCEKCKU RQFGO UGT
compreendidas como um amplo e
complexo conjunto de deslocamento
de pessoas, mercadorias, capital e
KPHQTOCQ UQDTG Q GURCQ IGQITEQ
VTCPUHTQPVGKTKQ#UTGNCGURQFGOUGT
de amplitudes diferenciadas e variar em
frequncia, conforme a distncia entre o
agente atuante e a fronteira.

Para quem vive do comrcio


VTCPUHTQPVGKTKQJWOCFKXGTUKFCFGFG
Abstract
HCVQTGUSWGKPVGTHGTGOPCEQOGTEKCNK\CQ
This paper discusses the border dynamics in the dos produtos, como entraves burocrticos
VYKPEKVKGUQH(Q\FQ+IWCW
$TC\KN CPF%KWFCF
G NGICKU HCNVC FG CIKNKFCFG FQU UGTXKQU
Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

65

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

RTGUVCFQUPCUECDGEGKTCUFCUHTQPVGKTCUFKURCTKFCFGUFGRTGQUGPVTGQUOGTECFQU
FGECFCNCFQFCNKPJCFKXKUTKCKPVGTPCEKQPCNTGUVTKGUCQVTPUKVQFGOGTECFQTKCU
FGXCTGLQFGEKUGUIQXGTPCOGPVCKUWPKNCVGTCKUGFKHGTGPCUFGVTCVCOGPVQCFWCPGKTQ
PCKORQTVCQGPCGZRQTVCQFGRTQFWVQU
/'0&10# 
A esses fatores acrescente-se o referente logstica internacional segura, de crescente
importncia mundial, como destacam Morini e Leoce (2011), apresentando estudo
FQ$CPEQ/WPFKCNSWGCRQPVCQ$TCUKNGORQUKQKPVGTOGFKTKC1SWCPVQGEEKC
logstica.
1U EQOGTEKCPVGU HTQPVGKTKQU UQ HQTVGOGPVG KORCEVCFQU PQU RGTQFQU FG ETKUGU
financeiras nacionais e/ou internacionais e com ajustes cambiais da poltica
econmica. Medidas econmicas errneas podem trazer prejuzos socioeconmicos
a ambos os lados da fronteira, como fechamento de estabelecimentos comerciais e
desemprego.
'ODQTCUGLCKORQTVCPVGGPGEGUUTKQQEQPVTQNGPCPEGKTQGHGVWCFQRGNQ$CPEQ
%GPVTCNCNKOKVCQFCTGOGUUCFGOQGFCUVCODOIGTCFGUGSWKNDTKQQECUKQPCPFQ
SWGFCFQXQNWOGFGXGPFCUGFKOKPWKQFQWZQFGVWTKUVCUSWCPFQQEODKQPQ
est favorvel (MENDONA, 2009).
A permeabilidade e o acesso a um dos lados da fronteira so regidos por dois sistemas:
WOQEKCNGWOKPXKUXGNEQOQEQPEGKVWC/GPFQPC
 1UKUVGOCGZVTCQEKCN
(invisvel) fundado na informalidade (frequentemente na ilicitude), de forma
velada. O contrabando,2 como exemplo de tal sistema invisvel, constitui atividade
NGUKXCCQUKPVGTGUUGUPCPEGKTQUFQRCURQKUCNOFGQECUKQPCTQPQTGEQNJKOGPVQ
dos tributos eventualmente devidos, torna desleal a concorrncia com os produtos
similares do mercado nacional e gera empregos fora do pas. Alm disso, a forma
FG EQOGVKOGPVQ FC KPHTCQ TGPQXCUG KPEGUUCPVGOGPVG G GPIGPFTCOUG PQXQU
CTVKHEKQUFKEWNVCPFQQEQODCVGFQKNEKVQRGNCUKPUVKVWKGUTGURQPUXGKU5GO
(Q\FQ+IWCWv.g., a Secretaria da Receita Federal do Brasil (RFB) apreendeu cerca
de R$ 180 milhes em mercadorias entre janeiro e novembro de 2010 (RFB, 2012).
Nas reas de fronteiras ocorre o controle aduaneiro das mercadorias que entram
no pas ou dele saem, afetado diretamente pelas normas aduaneiras e pelos
RTQEGFKOGPVQUFGECFCGPVGGUVCVCNFCNKPJCFKXKUTKC6CODOGZKUVGWOCFKHGTGPC
FGEODKQGFGTGIKOGUFGVTKDWVCQRTKPEKRCNOGPVGGPVTGQURCUGUUWNCOGTKECPQU
SWGFKUHWPEKQPCNRCTCCKPVGITCQTGIKQPCNGCECDCRQTKPFW\KTCPGEGUUKFCFGFG
1 O ndice de eficcia logstica (sigla LPI, em ingls) do Banco Mundial ranqueia o Brasil na 41aRQUKQGPVTGQU
RCUGURGUSWKUCFQU&GUVCECPFQUGCRGPCUQKVGOCFOKPKUVTCQCFWCPGKTCQ$TCUKNRCUUCaRQUKQ
(http://www.worldbank.org).
2 Entenda-se contrabando aqui em seu sentido lato, abarcando no s aquilo que nosso direito penal (Cdigo
2GPCNCTVKIQ FGHKPGEQOQEQPVTCDCPFQ
GPVTCFCQWUCFCFGOGTECFQTKCFGKORQTVCQQWGZRQTVCQ
proibida) como tambm o descaminho (entrada ou sada de mercadoria sem o pagamento dos impostos ou
direitos devidos, dolosamente). Tal unio em um nico tipo penal ocorre em vrios pases, como a Argentina
GC+VNKC
,#2+#55#.$#44#%0 

66

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

Dinmica transfronteiria no arco sul brasileiro no contexto do Regime de Tributao Unificada

UGVTCDCNJCTWPKNCVGTCNOGPVGEQOCCFQQFGTGIKOGUCFWCPGKTQVTKDWVTKQUGO
GURGEKCNPCU\QPCUVTCPUHTQPVGKTKCUECTCEVGTK\CFCURQTEQPEGPVTCQFGTGFGUGWZQU
Uma das metas da Poltica de Desenvolvimento da Faixa de Fronteira no arco sul
fomentar o desenvolvimento econmico regional e incentivar o comrcio exterior
GPVTGQU'UVCFQURQTOGKQFGRQNVKECUFGKPVGITCQGEQPOKEC0GUUGEGPTKQ
C4($OCKUGURGEKECOGPVGRQTOGKQFGUWC5WDUGETGVCTKCFG#FWCPCG4GNCGU
Internacionais (Suari), exerce um papel fundamental no processo, sendo responsvel
RQTRTQXGTCUGIWTCPCCEQPCPCGCHCEKNKVCQ3 para o comrcio internacional.
A RFB deve estar atenta para evitar que sejam descumpridas as normas legais
VTKDWVTKCU G CFWCPGKTCU SWG TGIGO CU QRGTCGU FG EQOTEKQ KPVGTPCEKQPCN
Entretanto, primordial para o Brasil que tal tarefa seja cumprida sem expor
KORQTVCFQTGU GZRQTVCFQTGU G EKFCFQU GO IGTCN C FKEWNFCFGU FGUPGEGUUTKCU
GZEGUUKXCU#TGNGXPEKCFQVGOCVCOCPJCSWGLIWTQWEQOQWOCFCUOKUUGU
da RFB.4#UUKOCOGNJQTHQTOCFGUGQDVGTGUUCHCEKNKVCQFQEQOTEKQGZVGTKQT
UGEGTVKECPFQFGSWGVQFQUQUQRGTCFQTGUEWORTCOUWCUQDTKICGUVTKDWVTKCU
e aduaneiras espontaneamente (LIMA, 2007).
0Q CTEQ UWN NQECNK\CFQ PC TGC FG KPWPEKC FQ /GTEQUWN EQPHQTOG C FKXKUQ
RWDNKECFCRGNQ/KPKUVTKQFC+PVGITCQ0CEKQPCN
(KIWTCFQCTVKIQ&KPOKEC
HTQPVGKTKCPQCTEQPQTVGDTCUKNGKTQPQEQPVGZVQFCUTGCUFG.KXTG%QOTEKQFG
PQUUCCWVQTKCRWDNKECFQPGUVCOGUOCQDTC HQKKPUVKVWFQWOTGIKOGFGVTKDWVCQ
FKHGTGPEKCFCSWGGUVUGPFQCRNKECFQPCHTQPVGKTC(Q\FQ+IWCW%KWFCFFGN'UVG
a mais dinmica do arco.5
&GUFGGUVGOQRGTCQQ4GIKOGFG6TKDWVCQ7PKECFC
467 TGIKFQ
RGNC .GK P  FG  SWG RGTOKVG C HQTOCNK\CQNGICNK\CQ FG
microimportadores que vendem no Brasil mercadorias adquiridas na fronteira Foz
FQ+IWCW%KWFCFFGN'UVG1TGIKOGVGORQTQDLGVKXQTCEKQPCNK\CTQEQOTEKQRQT
XKCVGTTGUVTGPCTGHGTKFCHTQPVGKTCUKORNKECPFQCVTKDWVCQGQEQPVTQNGCFWCPGKTQ
'UUGTGIKOGKPEGPVKXCQWZQNEKVQFGOGTECFQTKCUPCTGIKQHTQPVGKTKCRQTSWG
permite aos microimportadores adquirir licitamente determinadas mercadorias no
 &GPVTQFCENCUUKHKECQRQTPUCFQVCFCGPECTGUGCHCEKNKVCQEQOGTEKCNEQOQCKFGPVKHKECQ
GGNKOKPCQ FG
TGUVTKGUFGUPGEGUUTKCUCQEQOTEKQGZVGTKQTDQORTGEKUCTEQOQHG\.CUECPQ
 SWGGUVCOQUHCNCPFQ
FCTGFWQFGDCTTGKTCUDWTQETVKECUVEPKECUUCPKVTKCUFGVTCPURQTVGFGNKDGTFCFGFGVTPUKVQGVE6TCVCUG
FQVGOCDWUECPFQJCTOQPK\CQGRCFTQPK\CQKPVGTPCEKQPCNEQOQLGTCRTGEQPK\CFQPC%QPXGPQFG
-[QVQVCPVQGOUGWQTKIKPCNFGSWCPVQGOUWCXGTUQTGXKUCFCFG
 'OVQFCUCUOGPGUSWGGPEQPVTCOQUGZRTGUUQHCEKNKVCQPCUOKUUGUFGFKXGTUCU#FWCPCUFQOWPFQ
UGIWGUGQVGTOQEQOUGIWTCPC
64'8+5#0 GPQHQKFKHGTGPVGPQ$TCUKN5GDGOFGNKOKVCFCUCU
GZRTGUUGUHCEKNKVCQGUGIWTCPCUQGNGOGPVQUEQORNGOGPVCTGUGPQCPVCIPKEQU%QOQCHKTOC%QGNJQ

 CTGNCQGPVTGQUVGTOQUPQCFGIWCGC\GKVGOCUCFGHGTOGPVQGVTKIQ
 #FKHGTGPEKCQVTKDWVTKCHC\UGRTGUGPVGGOFKXGTUCUHTQPVGKTCUGPVTGQ$TCUKNGQWVTQU'UVCFQURCTVGUFQ/GTEQUWN
mas, como afirma Oliveira (2006), endossado por Sausi e Oddone (2010), no Mercosul no h fronteira, h
fronteiras, pois o ambiente plural transformou as fronteiras em ambientes singulares, com singularidade em
TGNCQCQVGTTKVTKQPCQGUKPIWNCTKFCFGUGPVTGUK#UUKOECFCHTQPVGKTCPKECDCUVCXQNVCTQUQNJQURCTC
C HTQPVGKTC EQPVGORNCFC EQO Q 467
(Q\ FQ +IWCW%KWFCF FGN 'UVG  RCTC EQPEQTFCT EQO C QDUGTXCQ
EQPENWKPFQSWGCUQNWQGPIGPFTCFCEQOQTGIKOGVGXGRQTHQEQGZCVCOGPVGRQPVWCNOGPVGGUUCHTQPVGKTC

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

67

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

Paraguai dentro de limites estabelecidos. Criando a oportunidade para o exerccio


regular de atividades de comrcio exterior a microempresas brasileiras e a lojistas
RCTCIWCKQU G RTQRQTEKQPCPFQ Q ETGUEKOGPVQ FC HQTOCNK\CQ FQ EQOTEKQ PC
TGIKQFGHTQPVGKTCDWUECUGCWOGPVCTQEWORTKOGPVQFCUQDTKICGUVTKDWVTKCUG
aduaneiras, contribuindo para o desenvolvimento econmico e social tanto brasileiro
quanto paraguaio.
'UVG GUVWFQ VGO RQT QDLGVKXQ CPCNKUCT C FKPOKEC VTCPUHTQPVGKTKC PQ OWPKERKQ
FG(Q\FQ+IWCW
24 PQEQPVGZVQFCKORNGOGPVCQFQ4GIKOGFG6TKDWVCQ
7PKECFCKPENWKPFQWOCCXCNKCQKPKEKCNFQKORCEVQFQTGIKOGPCRGTURGEVKXCFQU
seus principais operadores.
0CUGQGHGVWCFCWOCFKUVKPQGPVTGQUTGIKOGUCFWCPGKTQUGURGEKCKUGQUTGIKOGU
FKHGTGPEKCFQUFGVTKDWVCQ
ECUQFQ467 0CUGQUQFGVCNJCFQUQUCVTKDWVQUG
QURTQEGFKOGPVQUCFQVCFQUPCUQRGTCGUCQCORCTQFQ4670CUGQGHGVWCFC
WOCCXCNKCQRTGNKOKPCTFQTGIKOGVQOCPFQUGGOEQPVCCUQRGTCGUTGCNK\CFCU
GCXKUQFQURTKPEKRCKUQRGTCFQTGUVGEGPFQUGPCUGSWPEKCEQPUKFGTCGUPCKU

2 REGIMES ADUANEIROS ESPECIAIS E REGIMES


DE TRIBUTAO DIFERENCIADA NA IMPORTAO
2CTCSWGUGRQUUCUKVWCTQ4GIKOGFG6TKDWVCQ7PKECFCPQEQPVGZVQVTKDWVTKQ
G CFWCPGKTQ DTCUKNGKTQ  RTGEKUQ GUVCDGNGEGT WOC FKUVKPQ DUKEC GPVTG Q SWG UG
designa hoje por regimes aduaneiros especiais e o que se denomina de regimes
FGVTKDWVCQFKHGTGPEKCFCPCKORQTVCQ

2.1 REGIMES ADUANEIROS ESPECIAIS


4GIKOGCFWCPGKTQCFGUVKPCQCRNKEXGNOGTECFQTKCCUGTQDLGVQFGWOFGURCEJQ
CFWCPGKTQFGKORQTVCQQWFGGZRQTVCQGOHWPQFCUECTCEVGTUVKECUFCQRGTCQ
de comrcio exterior e da escolha do declarante considerando-se os parmetros
GUVCDGNGEKFQURGNCNGIKUNCQCFWCPGKTC
64'8+5#0 6
0Q $TCUKN QU TGIKOGU CFWCPGKTQU UQ ENCUUKECFQU GO
C  EQOWPU QW IGTCKU
(b) especiais e (c) aplicados em reas especiais.
 1 %QPUGNJQ FG %QQRGTCQ #FWCPGKTC
%%#  OCKU EQPJGEKFQ EQOQ 1TICPK\CQ /WPFKCN FG #FWCPCU
(OMA), define, em seu glossrio, regime aduaneiro como tratamento aplicvel pela Aduana s mercadorias
sujeitas a controle aduaneiro. O Glossrio de Termos Aduaneiros e de Comrcio Exterior da Aladi, por sua
vez, conceitua regime aduaneiro como o tratamento aplicvel s mercadorias submetidas a controle aduaneiro,
FGCEQTFQEQOCUNGKUGTGIWNCOGPVQUCFWCPGKTQUUGIWPFQCPCVWTG\CGQUQDLGVKXQUFCQRGTCQ2TG\G
Gonzlez, alinhados com o modelo europeu, definem regime como o estatuto aduaneiro sob o qual podem ser
EQNQECFCUCUOGTECFQTKCUSWCPFQQQRGTCFQTCRTGUGPVCCQUUGTXKQUCFWCPGKTQUCFGENCTCQG#FWCPCU2QPEG
(2000) esclarece que para cada destino aduaneiro a lei atribui um tratamento ou estatuto, composto de vrias
matrias, o que configura o regime aduaneiro. Arremate-se o tema com Basalda (1999), que reconhece que a
GZRTGUUQTGIKOGUCFWCPGKTQUCNWFGVCPVQUFGUVKPCGUCFWCPGKTCUEQOQCQUTGIKOGUCFWCPGKTQUGURGEKCKUG
UTGIWNCGUTGHGTGPVGUUQRGTCGUCFWCPGKTCU

68

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

Dinmica transfronteiria no arco sul brasileiro no contexto do Regime de Tributao Unificada

1UTGIKOGUCFWCPGKTQUEQOWPUQWIGTCKUUQCKORQTVCQGCGZRQTVCQFGPKVKXCU
tratados no Livro V do Regulamento Aduaneiro (Decreto n. 6.759/2009). Sua
RTKPEKRCNECTCEVGTUVKECCFGPKVKXKFCFGSWGCECTTGVCPCKORQTVCQCRCTVKTFQ
FGUGODCTCQCFWCPGKTQ
NKDGTCQFCOGTECFQTKC CNKXTGEKTEWNCQFCOGTECFQTKC
no territrio aduaneiro brasileiro.
Por sua vez, os regimes aduaneiros especiais so caracterizados pela temporariedade
GGOTGITCRGNCUWURGPUQFCGZKIKDKNKFCFGFQUVTKDWVQUKPEKFGPVGUPCQRGTCQ5Q
tratados no Ttulo I do Livro IV do Regulamento Aduaneiro.
Os regimes aduaneiros especiais so, em regra, incentivos ao desenvolvimento
econmico (por isso so denominados, em vrios pases, de regimes aduaneiros
econmicos), por meio de benefcios relativos aos tributos aduaneiros aliados a
UKORNKECGURTQEGFKOGPVCKU
64'8+5#0 FGPKQCNKPJCFCEQOQSWG
j estabeleciam Sosa7 (1996), Meira8 (2002) e Folloni9 (2005).
1UTGIKOGUCFWCPGKTQUGURGEKCKURQFGOUGIWPFQCUECTCEVGTUVKECUFCQRGTCQFG
comrcio exterior, ser agrupados em quatro categorias (TREVISAN, 2008):10
xTGIKOGFGVTPUKVQKPVGTPQQWKPVGTPCEKQPCNFGOGTECFQTKCU11
xTGIKOGU FG KORQTVCQ QW GZRQTVCQ VGORQTTKC FG OGTECFQTKCU RCTC

GZRQUKQOCPWUGKQQWWVKNK\CQ12
xTGIKOGUFGKORQTVCQQWGZRQTVCQVGORQTTKCFGOGTECFQTKCURCTCUGTGO

UWDOGVKFCUQRGTCQFGCRGTHGKQCOGPVQ13 e
xregimes de depsito temporrio de mercadorias, sob controle aduaneiro, em

local habilitado.14
7 Sosa destaca o carter temporrio dos regimes aduaneiros especiais diante da definitividade do regime comum,
afirmando que os regimes so denominados especiais para diferenci-los daqueles ingressos em que o interesse
CFWCPGKTQEGUUCEQOQFGUGODCTCQFCOGTECFQTKC0QOGUOQUGPVKFQ%CTNWEEK
 
 5QFGPQOKPCFQUTGIKOGUCFWCPGKTQUGURGEKCKUCSWGNGUSWGUGFKUVKPIWGOFQTGIKOGEQOWOFGKORQTVCQ
GFGGZRQTVCQGOFGEQTTPEKCFGKPEGPVKXQUHKUECKUEQPEGTPGPVGUCQUKORQUVQUUQDTGQEQOTEKQGZVGTKQTG
FGEQPVTQNGCFWCPGKTQGOTGNCQCQUDGPUQDLGVQFCQRGTCQ6CNEQPEGKVQGPFQUUCFQRQT.QRGUG/QTKPK
(2006).
9 Os regimes aduaneiros especiais podem ser definidos a partir de duas caractersticas que apresentam. Em
RTKOGKTQNWICTVTCVCUGFGTGIKOGUVTKDWVTKQUFKHGTGPEKCFQUCRNKECFQUPCUQRGTCGUFGEQOTEKQGZVGTKQT
[...] Em segundo lugar, muitas vezes a concesso, pela autoridade administrativa aduaneira, desses regimes
CFWCPGKTQUGURGEKCKUKORNKECCNOFGVTCVCOGPVQVTKDWVTKQFKHGTGPEKCFQFKUVKPGUVCODOPQSWGFK\TGURGKVQ
HKUECNK\CQCFWCPGKTCFQURTQFWVQUSWGGPVTCOGUCGOFQVGTTKVTKQPCEKQPCN
10 #RGTHGKQCPFQENCUUKHKECQCPVGTKQTOGPVGCFQVCFCGO6TGXKUCP
 
11 No Brasil, esta categoria abarca o regime aduaneiro especial de trnsito aduaneiro.
12 0Q$TCUKNGUVCECVGIQTKCCDTCPIGQUTGIKOGUCFWCPGKTQUGURGEKCKUFGCFOKUUQVGORQTTKCGZRQTVCQVGORQTTKC
Repex e Repetro (em parte).
13 No Brasil, esta categoria compreende os regimes aduaneiros especiais de admisso temporria para
CRGTHGKQCOGPVQCVKXQGZRQTVCQVGORQTTKCRCTCCRGTHGKQCOGPVQRCUUKXQ4GEQH4GEQODrawback, Reporto
(em parte) e entreposto aduaneiro (em parte).
14 No Brasil, esta categoria inclui os regimes aduaneiros especiais de entreposto aduaneiro (em parte), loja franca,
FGRUKVQGURGEKCNFGRUKVQCHKCPCFQFGRUKVQCNHCPFGICFQEGTVKHKECFQGFGRUKVQHTCPEQ

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

69

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

Por derradeiro, os regimes aduaneiros aplicados em reas especiais (Zona Franca


FG/CPCWUTGCUFG.KXTG%QOTEKQG<QPCUFG2TQEGUUCOGPVQFG'ZRQTVCGU 
como o prprio nome sugere, so vinculados a locais fsicos, buscando reduzir
desigualdades e promover o desenvolvimento regional.
1RCICOGPVQQWPQFQUVTKDWVQUKPEKFGPVGUPCKORQTVCQPQECTCEVGTUVKEC
demarcadora deste ou daquele regime aduaneiro. H a possibilidade tanto de existir
KUGPQQWKOWPKFCFGPQTGIKOGEQOWO
v.g.GOKORQTVCGUFGPKVKXCU EQOQ
de exigncia de pagamentos em alguns regimes aduaneiros especiais (v.g. admisso
VGORQTTKCRCTCWVKNK\CQGEQPOKEC 
0QTGIKOGEQOWOCVTKDWVCQFCUKORQTVCGUPQTOCNOGPVGGHGVWCFCOGFKCPVG
CENCUUKECQFQRTQFWVQEQOCEQPUGSWGPVGDWUECFCCNSWQVCEQTTGURQPFGPVG
na Tarifa Externa Comum. No entanto, essa regra excepcionada nos chamados
TGIKOGU FG VTKDWVCQ FKHGTGPEKCFC PC KORQTVCQ UQDTG QU SWCKU FKUEQTTGTGOQU
a seguir.

2.2 REGIMES DE TRIBUTAO DIFERENCIADA


NA IMPORTAO
0CU KORQTVCGU FGHKPKVKXCU
UQD Q TGIKOG CFWCPGKTQ EQOWO QW IGTCN 
Q4GIWNCOGPVQ#FWCPGKTQTGNCEKQPCSWCVTQGZEGGUCQSWGUGTKCQRTQEGFKOGPVQ
EQOWO FG SWCPVKECQ FQU VTKDWVQU C RCICT PC KORQTVCQ
FGVGTOKPCQ FG
alquota com base na Tarifa Externa Comum, multiplicando-a pela base de clculo
GPEQPVTCFCEQOCORCTQPQ#EQTFQFG8CNQTCQ#FWCPGKTCFQ)CVV 
#RTKOGKTCGZEGQVTCVCFCPQCTVKIQFQ4GIWNCOGPVQ#FWCPGKTQGTGHGTGUG
C OGTECFQTKCU KORQTVCFCU PC KORQUUKDKNKFCFG FG UWC KFGPVKECQ GO TC\Q FG
UGWGZVTCXKQQWEQPUWOQGFGFGUETKQIGPTKECPQUFQEWOGPVQUEQOGTEKCKUGFG
transporte disponveis.
A segunda (artigos 99 e 100 do Regulamento Aduaneiro) versa sobre o Regime
FG6TKDWVCQ5KORNKECFC
465 CRNKEXGNCDGPUKPVGITCPVGUFGTGOGUUCRQUVCN
internacional.
A terceira (artigos 101 e 102 do Regulamento Aduaneiro) dispe sobre o Regime de
6TKDWVCQ'URGEKCN
46' CRNKEXGNCDGPUEQORTGGPFKFQUPQEQPEGKVQFGDCICIGO
PQOQPVCPVGSWGGZEGFGTQNKOKVGFGKUGPQRCTCCXKCFGVTCPURQTVG
75RCTC
CUXKCUVGTTGUVTGWXKCNGNCEWUVTGG75RCTCCUXKCUCTGCGOCTVKOC GCDGPU
CFSWKTKFQUGONQLCUHTCPECUFGEJGICFCSWGGZEGFGTGOQNKOKVGFGKUGPQRTGXKUVQ
GOPQTOCGURGEEC
75 
# SWCTVC GZEGQ  GZCVCOGPVG Q HQEQ FGUVG GUVWFQ Q 4GIKOG FG 6TKDWVCQ
7PKECFC
467  CETGUEGPVCFQ CQ 4GIWNCOGPVQ #FWCPGKTQ
CTVKIQ #  RGNQ
Decreto n. 7.213/2010.
70

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

Dinmica transfronteiria no arco sul brasileiro no contexto do Regime de Tributao Unificada

Assim, de se esclarecer que o RTU no constitui um regime aduaneiro especial,


mas um regiOGFGVTKDWVCQFKHGTGPEKCFCFGPVTQFQTGIKOGCFWCPGKTQEQOWOQW
IGTCNFGKORQTVCQEQORCICOGPVQWPKECFQFQUVTKDWVQUFGXKFQUPCKORQTVCQ
GFGURCEJQCFWCPGKTQUKORNKECFQ
&QRQPVQFGXKUVCFQEQPVTKDWKPVGCUKORNKECQFGEQTTGPVGFCCFQQFGWOC
DCUGPKECRCTCENEWNQFQUFDKVQUUECKUTGFW\QEWUVQFCUQDTKICGUCEGUUTKCUG
FKURGPUCCPGEGUUKFCFGFGTGEWTUQUCFKHGTGPVGUKPUVPEKCURCTCCUQNWQFGEQPKVQU
FGKPVGTRTGVCQ0CXKUQFQUEQCKPVGITCQFGECFCUVTQUGCUECNK\CQEQPLWPVC
CWOGPVCOCGEKPEKCPQEQODCVGHTCWFGGUQPGICQCQOGUOQVGORQGO
que permitem obter substanciais economias administrativas (REZENDE, 2000).
A teoria econmica mostra os benefcios de uma tarifa nominal uniforme, resultando
GOCNQECQGEKGPVGFGTGEWTUQURTQFWVKXQUCNKCFCUKORNKECQFCCFOKPKUVTCQ
CFWCPGKTC5GIWPFQ-WOGG2CKPK
 QTGIKOGFGVCTKHCWPKHQTOGCRTGUGPVC
um nvel de bem-estar maior que um regime de tarifas diferenciadas, minimizando
o desvio de recursos para atividades improdutivas.

3 REGIME DE TRIBUTAO UNIFICADA (RTU)


1 4GIKOG FG 6TKDWVCQ 7PKHKECFC HQK KPUVKVWFQ RGNC .GK P 15
(popularmente conhecida como Lei dos Sacoleiros) e regulamentado pelo Decreto
n. 6.956, de 09/09/2009, tendo a RFB complementado a disciplina do regime por
OGKQFC+PUVTWQ0QTOCVKXCPFG
3.1 ASPECTOS TRIBUTRIOS
1467RGTOKVGCKORQTVCQFGFGVGTOKPCFCUOGTECFQTKCURTQEGFGPVGUFQ2CTCIWCK
RQTXKCVGTTGUVTGPCHTQPVGKTC(Q\FQ+IWCW%KWFCF&GN'UVGOGFKCPVGQRCICOGPVQ
WPKECFQFQUKORQUVQUGEQPVTKDWKGUHGFGTCKUFGXKFQUEQOFGURCEJQCFWCPGKTQ
UKORNKECFQ
1TGIKOGVGOEQOQDGPGEKTKQUQUOKETQKORQTVCFQTGUXCTGLKUVCUQRVCPVGURGNQ
4GIKOG'URGEKCN7PKECFQFG#TTGECFCQFG6TKDWVQUG%QPVTKDWKGUFGXKFQU
pelas Microempresas e Empresas de Pequeno Porte Simples Nacional, ou seja,
microempresrios que tm receita bruta anual de at R$ 360.000,00, conforme
a Lei Complementar n. 123, de 14/12/2006,16 habilitados pela RFB.
O pagamento de tributos federais ao amparo do RTU efetuado mediante a
CRNKECQFCCNSWQVCFG17 sobre o valor da mercadoria, observados os valores
15 A rigor, o regime tem origem na Medida Provisria n. 380, de 28/06/2007, de iniciativa do Poder Executivo,
como se tratar adiante.
16 %QO C TGFCQ SWG NJG FGW C .GK %QORNGOGPVCT P  FG 
Q NKOKVG GTC QTKIKPCNOGPVG FG
R$ 240.000,00).
17 6CNRGTEGPVWCNTGRTGUGPVCCCNSWQVCCRUCTGFWQRTQOQXKFCRGNQ2QFGT'ZGEWVKXQRQTOGKQFQ&GETGVQ
n. 6.956/2009 (a Lei n. 11.898/2009 estabeleceu originalmente a alquota de 42,25%, permitindo ao Poder
Executivo reduzi-la em at 33 pontos percentuais).

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

71

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

de referncia mnimos estabelecidos pela RFB. O percentual corresponde aos


seguintes tributos:
xCVVWNQFGKORQUVQFGKORQTVCQ
Q2QFGT'ZGEWVKXQRQFGOCPGLCT

GUUCCNSWQVCFGC 
x7,87% a ttulo de imposto sobre os produtos industrializados IPI (o Poder

'ZGEWVKXQRQFGOCPGLCTCCNSWQVCFGC 
xCVVWNQFG%QPUKORQTVCQG
xCVVWNQFG%QPVTKDWKQRCTCQ2+52CUGRKORQTVCQ

1+ORQUVQFG%KTEWNCQFG/GTECFQTKCUGUQDTG2TGUVCQFG5GTXKQU6TCPURQTVG
+PVGTGUVCFWCNG+PVGTOWPKEKRCNGFG%QOWPKECQ
+%/5 SWGPQFGEQORGVPEKC
da Unio, cobrado de acordo com o percentual do estado de origem do
microempresrio. Entretanto, a Lei n. 11.898/2009 prev a possibilidade de convnio
GPVTGQUGUVCFQUDTCUKNGKTQURCTCCKPENWUQFQ+%/5PQRCICOGPVQWPKECFQCQ
amparo do RTU.
Com fundamento no comando legal, o Conselho Nacional de Poltica Fazendria

%QPHC\  CWVQTK\QW C 4($ C CTTGECFCT Q +%/5 FCU KORQTVCGU TGCNK\CFCU RGNQ


467GTGFW\KWCDCUGFGENEWNQPGUUCUQRGTCGURCTC
KPFGRGPFGPVGOGPVG
FCENCUUKECQFQRTQFWVQ RQTOGKQFQ%QPXPKQ+%/5PFG
publicado no DOUFGGTCVKECFQRGNQ#VQ&GENCTCVTKQPFG
13/07/2012, ressalvando-se na clusula oitava que o convnio no se aplica para o
Estado de Mato Grosso do Sul.
#UKORQTVCGUCQCORCTQFQ467FGXGTQTGURGKVCTQNKOKVGOZKOQCPWCNFG
valor de R$ 110 mil, com limites trimestrais de R$ 18 mil para o 1o e o 2o trimestres
e de R$ 37 mil para o 3o e o 4o trimestres. As mercadorias que podem ser importadas
ao amparo do regime (lista positiva) esto relacionadas no anexo do Decreto
n. 6.956/2009. A lista positiva importante porque responde pela viabilidade de
HWPEKQPCOGPVQFQ467UGHQTOWKVQTGUVTKVKXCQ467PQUGVQTPCCVTCVKXQGUG
for muito liberal, a indstria nacional pode sofrer um impacto econmico negativo
pela debilidade na concorrncia entre os importadores e os fabricantes nacionais.
# NKUVC RQFG UGT TGXKUCFC RGTKQFKECOGPVG EQO DCUG GO TGEQOGPFCGU FG WOC
comisso encarregada do monitoramento do regime.
A Comisso de Monitoramento do RTU (CMRTU) composta por representantes
do Ministrio do Desenvolvimento, da Indstria e Comrcio Exterior (MDIC),
responsvel pela presidncia, por representantes da Fazenda, da Cincia e Tecnologia
G FCU 4GNCGU 'ZVGTKQTGU RQT WO TGRTGUGPVCPVG FG ECFC WOC FCU %CUCU FQ
Congresso Nacional, por dois representantes de entidades representativas do setor
industrial (sendo uma do Polo Industrial de Manaus), indicados pelo MDIC, e por
WOTGRTGUGPVCPVGFQUGVQTFGEQOTEKQGUGTXKQU
VCODOKPFKECFQRGNQ/&+% 
72

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

Dinmica transfronteiria no arco sul brasileiro no contexto do Regime de Tributao Unificada

# %/467 VGO CKPFC GPVTG UWCU HWPGU C RTQRQUKQ FG TGEQOGPFCGU RCTC
FGPKQFQUNKOKVGUCPWCKUGVTKOGUVTCKUGFCCNSWQVCFQTGIKOG
3.2 ASPECTOS PROCEDIMENTAIS
1WZQFGQRGTCQFQTGIKOGVQFQKPHQTOCVK\CFQQSWGGNKOKPCFWRNKEKFCFGU
RGTOKVKPFQ CQ OGUOQ VGORQ OCKQT HCEKNKVCQ CQ OKETQKORQTVCFQT G OGNJQT
EQPVTQNGRCTCC#FWCPC'OUPVGUGCQRGTCQRCUUCRGNCUUGIWKPVGUGVCRCU
xo responsvel habilitado pela empresa microimportadora ou seu representante

ETGFGPEKCFQFKTKIGUGCQ2CTCIWCKRCTCGHGVWCTCUCSWKUKGUFGOGTECFQTKCU

EQPUVCPVGUFCNKUVCRQUKVKXCGFGPVTQFQUNKOKVGURGTOKVKFQU 
xo estabelecimento vendedor lojista paraguaio (apenas os autorizados

pelo Paraguai a vender no regime), ao efetuar a venda18 para a empresa


microimportadora brasileira habilitada no RTU, emite as correspondentes
faturas comerciais19 de forma eletrnica, em sistema informatizado de controle

5KUVGOC467 FC4($
xQTGRTGUGPVCPVGETGFGPEKCFQFCGORTGUCOKETQKORQTVCFQTCGHGVWCCUQNKEKVCQ

de transporte no Sistema RTU, e o condutor do veculo cadastrado a operar


no Sistema RTU (txi, van ou veculo da empresa) atesta cincia do incio do
VTCPURQTVGKPVGTPCEKQPCNGOTGEKPVQGURGEEQFC#FWCPCRCTCIWCKC20
xa mercadoria adquirida no Paraguai entra no territrio brasileiro

acompanhada pelo responsvel habilitado ou pelo representante credenciado


FCOKETQGORTGUCEQPFW\KFCGOXGEWNQECFCUVTCFQ
xo responsvel habilitado ou o representante credenciado da empresa

microimportadora dirige-se ao local destinado ao despacho de mercadorias


PC#FWCPCDTCUKNGKTC
xa Aduana brasileira atesta a concluso do transporte internacional da

OGTECFQTKCPQ5KUVGOC467
xQ TGRTGUGPVCPVG ETGFGPEKCFQ FC GORTGUC OKETQKORQTVCFQTC EQPTOC QU

FCFQUFCHCVWTCTGIKUVTCFQUPQUKUVGOCKPHQTOCVK\CFQGTGIKUVTCCFGENCTCQ
FGKORQTVCQCQCORCTQFQ467
&467 21
18 O lojista paraguaio dever acondicionar a mercadoria em volumes e lacr-los com etiquetas geradas pelo Sistema
RTU.
19 0QCFOKVKFQCITWRCTPWOCOGUOCHCVWTCEQOGTEKCNOGTECFQTKCUFKURGPUCFCUFGNKEGPEKCOGPVQ
CWVQTK\CQ
para importar) e outras sujeitas a tratamento administrativo especfico, devendo o representante da empresa
microimportadora, nesse caso, solicitar a emisso de faturas distintas para as mercadorias.
20 Os volumes etiquetados devero ser submetidos ao controle da Aduana paraguaia, com registro no Sistema
RTU.
21 #FGENCTCQIGTCFCRGNCUKORNGUEQPHKTOCQFQUFCFQUGNGVTQPKECOGPVGTGEGREKQPCFQUFC
U HCVWTC
U GOKVKFC
U 
PQ2CTCIWCK#UUKOUGGUVKXGTGOEQTTGVQUGUUGUFCFQUPQPGEGUUTKQTGFKIKVCTQWCETGUEGPVCTKPHQTOCGU

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

73

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

xC FGENCTCQ TGIKUVTCFC  UWDOGVKFC  UGNGQ RCTC EQPHGTPEKC CFWCPGKTC

UGIWPFQETKVTKQUGUVCDGNGEKFQURGNC4($
xo representante credenciado da empresa microimportadora efetua a impresso

dos Darf correspondentes e o pagamento dos tributos federais, recolhendo


ainda o ICMS, segundo as normas do estado de domiclio da empresa
OKETQKORQTVCFQTCG
xPQJCXGPFQKTTGIWNCTKFCFGUCOGTECFQTKCFGUGODCTCCFC
NKDGTCFC GRCUUC

C VGT NKXTG EKTEWNCQ PQ VGTTKVTKQ PCEKQPCN


CEQORCPJCFC FG PQVC UECN
GURGEECFQTGIKOGSWGRGTOKVGCXGPFCGZENWUKXCOGPVGCEQPUWOKFQTPCN 
3.3 VEDAES E ASPECTOS SANCIONATRIOS
2CTCRQUUKDKNKVCTGHGVKXQEQPVTQNGUQDTGCUQRGTCGUHQTCOCKPFCRTGXKUVCUCNIWOCU
XGFCGUFKCPVGFGNKOKVCGUQRGTCEKQPCKUFC4($GRGPCNKFCFGUGURGEECURCTC
os casos de descumprimento das regras do RTU.
#NIWOCUXGFCGUTGHGTGOUGCJQTTKQUFGQRGTCQFQTGIKOG*QLGCUQRGTCGU
podero ser registradas no Sistema RTU de segunda a sexta-feira, exceto feriados,
PQUJQTTKQUGUVCDGNGEKFQURGNC&4((Q\FQ+IWCWRCTCGOKUUQFGHCVWTCRGNQ
XGPFGFQTRCTCIWCKQFCUJUJ22RCTCUQNKEKVCQFGVTCPURQTVGRGNQTGRTGUGPVCPVG
ETGFGPEKCFQFCUJUJRCTCTGIKUVTQFQKPEKQFGVTCPURQTVGRGNCCWVQTKFCFG
RCTCIWCKCFCUJUJGRCTCTGIKUVTQFC&GENCTCQFG+ORQTVCQ
&467 
das 8h s 17h.
1WVTCU XGFCGU UQ TGNCEKQPCFCU CQ VKRQ FG OGTECFQTKC 1 467 PQ RQFG UGT
aplicado s seguintes mercadorias (lista negativa): mercadorias que no sejam
FGUVKPCFCUCEQPUWOKFQTPCNCTOCUGOWPKGUHQIQUFGCTVKHEKQGGZRNQUKXQU
DGDKFCU
KPENWUKXGCNEQNKECU EKICTTQUXGEWNQUCWVQOQVQTGUGOIGTCNGGODCTECGU
FGVQFQVKRQ
KPENWUKXGUWCURCTVGUGRGCUEQOQRPGWU OGFKECOGPVQUDGPUWUCFQU
GDGPUEQOKORQTVCQUWURGPUCQWRTQKDKFCPQ$TCUKN
0QUECUQUGOSWGUGKFGPVKECTGOOGTECFQTKCUFGKORQTVCQRTQKDKFCQWUWURGPUC
GHGVWCTUGCCRTGGPUQRCTCPUFGCRNKECQFCRGPCFGRGTFKOGPVQ0CJKRVGUG
de a empresa no se enquadrar nas regras do Simples Nacional, ela ser tambm
excluda do RTU. A Lei n. 11.898/2009 prev ainda multas proporcionais para os
casos de excesso de mercadoria em valor ou quantidade.

22 6QFCUCUOGPGUTGHGTGOUGCQJQTTKQDTCUKNGKTQ

74

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

Dinmica transfronteiria no arco sul brasileiro no contexto do Regime de Tributao Unificada

4 AVALIAO INICIAL DO RTU A PARTIR


DA PERSPECTIVA DOS AGENTES
#RGUCT FQ DCKZQ XQNWOG FG QRGTCGU TGCNK\CFCU CQ CORCTQ FQ TGIKOG FGUFG Q
KPEKQFGUWCRNGPCQRGTCQGOHGXGTGKTQFGRQUUXGNGHGVWCTWOCCXCNKCQ
inicial do RTU sob a perspectiva de seus principais operadores, obtida em pesquisa
exploratria,23 tarefa que se empreender a partir da categoria de cidades gmeas.
4.1 PREMISSAS PARA A AVALIAO
Dorfman e Roses (2005) conceituam cidades gmeas como pares de centros urbanos
frente a frente em um limite internacional, conurbados ou no, que apresentam
FKHGTGPVGU PXGKU FG KPVGTCQ HTQPVGKTC UGEC QW WXKCN FKHGTGPVGU CVKXKFCFGU
GEQPOKECUPQGPVQTPQXCTKXGNITCWFGCVTCQRCTCOKITCPVGUGFKUVKPVQURTQEGUUQU
JKUVTKEQU6CNCUKVWCQFG(Q\FQ+IWCWG%KWFCFFGN'UVGPKECUEKFCFGUPCU
SWCKUQNGIKUNCFQTRGTOKVKWCCRNKECQFQ467
Ciudad del Este constitui o maior centro comercial do Paraguai, destacando-se seu
EQOTEKQGZVGTKQTEQOQ$TCUKNITCCUHCEKNKFCFGFGCEGUUQGUKVWCQEQPLWICFC
CNKCFCCDGPGHEKQUUECKU24 concedidos pelo governo paraguaio. Alm de ser um
KORQTVCPVG EGPVTQ FG TGGZRQTVCQ25 de mercadorias, a cidade alberga ainda
CNIWOCUKPFUVTKCUOCSWKNCFQTCUCVTCFCURQTDGPGHEKQUUECKUGRGNQOGTECFQ
CDGTVQEQOCETKCQFQ/GTEQUWN
76'2+ 
(Q\ FQ +IWCW NQECNK\CFC PC VTRNKEG HTQPVGKTC $TCUKN#TIGPVKPC2CTCIWCK  WOC
das principais portas de entrada de mercadorias procedentes do Mercosul. As
OGTECFQTKCUKORQTVCFCUXKC(Q\FQ+IWCWGOUWCOCKQTKCUQRTQEGFGPVGUFQ
2CTCIWCKQWFC#TIGPVKPCJCXGPFQCKPFCKORQTVCGUGOXQNWOGUOCKUOQFGUVQU
da China, dos Estados Unidos, do Chile, da Bolvia, da Holanda, do Canad e da
Alemanha (fonte: Sistema AliceWeb MDIC). Mas a estatstica mais preocupante
da regio de contrabando/descaminho, frequentemente noticiada pela imprensa,
GSWGPQGPEQPVTCRCTOGVTQURTGEKUQUFGOGPUWTCQGODQTCUGLCPQVQTKCOGPVG
UKIPKECVKXC
O RTU busca exatamente minimizar essa estatstica preocupante, permitindo que
brasileiros adquiram mercadorias em Ciudad del Este legalmente, de forma quase
23 Envolvendo levantamento bibliogrfico, entrevistas com pessoas que tiveram experincias prticas com o
problema pesquisado e anlise de casos.
24 O correspondente paraguaio ao RTU o RFC (Rgimen Fronterizo de Comercializacin), institudo pelo Decreto
PGTGIWNCOGPVCFQRGNCU4GUQNWGU5'6
Subsecretaria de Estado de Tributacin) ns. 63/2011 e
GRGNCU4GUQNWGU&0#
Direccin Nacional de Aduanas) ns. 21/2012, 51/2012 e 101/2012. Antes
FCETKCQFQ4(%LJCXKCDGPGHEKQUGUVCDGNGEKFQURGNQRgimen de Turismo, disciplinado pelo Decreto n.
6.406/2005.
25 #GZRTGUUQTGGZRQTVCQWVKNK\CFCCSWKGOUGPVKFQNCVQUGIWKPFQQEQPEGKVQFG4CVVK
 CDCTECPFQ
tanto a sada de mercadorias importadas a ttulo definitivo quanto as importadas a ttulo temporrio. Contudo,
EQPXOFGUVCECTSWGPQ$TCUKNCGZRTGUUQWVKNK\CFCPCNGIKUNCQCRGPCURCTCFGUETGXGTCUCFCFQRCUFG
mercadorias importadas em carter no definitivo, sem cobertura cambial.

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

75

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

VQ UKORNKECFC SWCPVQ WO XKCLCPVG CU CFSWKTG G RQUUCO TGXGPFNCU


VCODO
NGICNOGPVG PQ$TCUKNCWORTGQEQORGVKVKXQ26
4.2 OPERADORES DO RTU E A PESQUISA EFETUADA
A pesquisa abarcou os trs principais operadores do RTU (Figura 1): o sacoleiro
DTCUKNGKTQ
OKETQGORTGUTKQ QCIGPVGUECNK\CFQT
HWPEKQPTKQFC4($GO(Q\FQ
+IWCW GQGORTGUTKQRCTCIWCKQ27
1 RGTN FG ECFC QRGTCFQT  FKHGTGPEKCFQ 'O IGTCN Q UCEQNGKTQ VGO RQWEQ
ECRKVCNFGIKTQDCKZCGUEQNCTKFCFGGUGWRGTNGEQPOKEQUGGPSWCFTCPCENCUUG%
1CIGPVGUECNK\CFQT
HWPEKQPTKQFC4GEGKVC(GFGTCN&4((Q\FQ+IWCW RQUUWK
HQTOCQUWRGTKQTRQTGZKIPEKCFQECTIQ
#(4($G#64($ 1UNQLKUVCURCTCIWCKQU
por sua vez, apresentam variados portes, tendo sido selecionado para a pesquisa
WONQLKUVCFGITCPFGRQTVGSWGVGOXQNWOGFGGZRQTVCQEQPUKFGTXGNGKPVGTGUUG
PCUKUVGOCVK\CQFQ467RCTCCNCXCPECTUWCUXGPFCU
CRTKOGKTCNQLCRCTCIWCKCC
cadastrar-se e a utilizar o RTU).
Figura 1 Operadores do RTU

Funcionrio da RFB em
Foz do Iguau

Microempresrio
(sacoleiro)

Lojista paraguaio

(QPVGGNCDQTCQFQUCWVQTGU

26 #FGNKOKVCQFGUVGGUVWFQPQRGTOKVKWQCRTQHWPFCOGPVQGOFWCUSWGUVGUFGGNGXCFCTGNGXPEKCUQDTGQ467
que certamente mereceriam uma oportuna retomada. A primeira refere-se possibilidade ou impossibilidade
LWTFKECFGGUVCDGNGEKOGPVQFGVCNTGIKOGPQEQPVGZVQFQ/GTEQUWNGUWCCPNKUGNW\FC%NWUWNCFC0CQ
Mais Favorecida do Gatt/OMC. A segunda atinente Tarifa Externa Comum (TEC), vigente no mbito do
/GTEQUWNRGNCSWCNCUCNSWQVCUFQKORQUVQFGKORQTVCQFGVQFQUQU'UVCFQURCTVGUFQDNQEQFGXGTKCOUGTCU
OGUOCUQSWGPGWVTCNK\CTKCUWDUVCPEKCNOGPVGQUGHGKVQUFQ467TGFW\KPFQQUVTKDWVCQKPVGTPC'OTGNCQ
CGUUGUGIWPFQVRKEQ
6'% FGUVCSWGUGSWGJJQLGUWDUVCPEKCKUGFKXGTUKHKECFCUGZEGGU6CTKHC'ZVGTPC
%QOWOFQ/GTEQUWNEQPHQTOGFGVCNJC/GKTC
 0QSWGUGTGHGTGVTKDWVCQKPVGTPC
GUUGPEKCNOGPVGCQ
IVA, inexistente no Brasil), as assimetrias so ainda maiores, sendo nesse aspecto o cenrio no muito diferente
do europeu, analisado criticamente por Novoa (2005).
27 H ainda outros operadores, como o transportador das mercadorias ao amparo do regime (que pode ser o
prprio microimportador) e o funcionrio da Aduana paraguaia, de igual importncia, mas menor relevncia
to somente para fins deste estudo.

76

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

Dinmica transfronteiria no arco sul brasileiro no contexto do Regime de Tributao Unificada

Os questionrios utilizados na pesquisa foram aplicados a operadores representantes


de cada uma das categorias: vinte microempresrios habilitados no RTU/usurios
frequentes (escolhidos aleatoriamente com base na lista disponvel do stio da
4($ VTUCWFKVQTGUUECKUFC4GEGKVC(GFGTCNFQ$TCUKN
#(4($ SWGVTCDCNJCO
FKTGVCOGPVGEQOCFKPOKECFCHTQPVGKTCGQTGIKOGGWONQLKUVCRCTCIWCKQ1U
questionrios foram compostos por questes abertas, diferentes para cada agente,
G IWTCO CQ PCN FGUVG GUVWFQ GO #RPFKEG #U TGURQUVCU QDVKFCU PQTVGCTCO C
TGFCQFQUVRKEQUSWGUGIWGO
4.3 A FUNDAMENTAO E O HISTRICO DO RTU
# &4((Q\ FQ +IWCW  WOC FCU KPUVKVWKGU TGURQPUXGKU RGNQ EQODCVG CQ
EQPVTCDCPFQFGUECOKPJQ FG OGTECFQTKCU PC HTQPVGKTC G UGWU GUHQTQU UQ
frequentemente articulados com o de outros rgos, como a Polcia Federal,
DWUECPFQOCKQTCDTCPIPEKCGGEEKCPCUCGU
1467PCUEGFGWOCFGOCPFCUQEKCNFCEQOWPKFCFGHTQPVGKTKCRTGNKOKPCTOGPVG
OCVGTKCNK\CFCGOFQEWOGPVQFKTKIKFQ4($GOOCTQFGPQSWCNUGRTQRWPJC
OCKQTHQTOCNK\CQFQEQOTEKQHTQPVGKTKQGPVTG$TCUKNG2CTCIWCKEQOGURGEKCN
PHCUGGO%KWFCFFGN'UVG
2; G(Q\FQ+IWCW
$4 6CNFQEWOGPVQHTWVQFG
FKUEWUUGUVTCXCFCUGOTGWPKGUTGCNK\CFCUGO$TCUNKCG(Q\FQ+IWCWGOOCTQFG
2006, no marco do Plano de Contingncia acordado entre os pases em abril de 2005.
2QFGUG CHKTOCT SWG C KPVGPUKHKECQ FC FGOCPFC RGNQ TGIKOG  FKTGVCOGPVG
TGNCEKQPCFCCQTGETWFGUEKOGPVQFCCQUECNPCHTQPVGKTCPCFECFCFGSWG
trouxe tanto impactos positivos (como a melhoria no cumprimento espontneo
FCU QDTKICGU VTKDWVTKCU G CFWCPGKTCU G C FKOKPWKQ FC EQPEQTTPEKC FGUNGCN
com a apreenso de produtos contrabandeados/descaminhados ou ainda piratas/
contrafeitos28 SWCPVQPGICVKXQU
FKOKPWKQFCTGPFCFCRQRWNCQHTQPVGKTKCFG
CODCUCUEKFCFGUFGRGPFGPVGFCCVKXKFCFGXKUVQSWGQCWOGPVQFCUECNK\CQPQ
HQKCEQORCPJCFQFGRQNVKECURDNKECUSWGRGTOKVKUUGOCKPUGTQFGUUCURGUUQCUPC
GEQPQOKCHQTOCNGUQUVKECQRTQUUKQPCNK\CQFCCVKXKFCFGFGNKVKXCFGHTQPVGKTC
EQOCFGUEQDGTVCFGPQXCUHQTOCUGPQXCUXKCUGUUGPEKCNOGPVGCWXKCNGCCTGC
de prosperar a clandestinidade).
Com base nas respostas obtidas nas entrevistas, estima-se que haja aproximadamente
15 mil sacoleiros e laranjas29 que trabalham de forma ilegal na fronteira entre Foz
28 Entenda-se aqui, na linha do Trips (ou ADPIC Acordo sobre aspectos dos Direitos de Propriedade Intelectual
TGNCEKQPCFQUCQ%QOTEKQ CTVDGOEQOOCTECEQPVTCHGKVCEQOQCSWGNGSWGQUVGPVGUGOCWVQTK\CQ
OCTECKFPVKECCQWVTCTGIKUVTCFCFKHKEWNVCPFQCFKUVKPQGPVTGGUVCUGDGORKTCVGCFQEQOQCSWGNGSWGXKQNG
direito autoral ou conexo.
29 Entenda-se por sacoleiro a pessoa que adquire mercadorias em Ciudad del Este (em regra, com seus recursos)
GCUTGXGPFGPQ$TCUKNGRQTNCTCPLC
QWOWNC CSWGNCRGUUQCSWGTGEGDGFGVGTOKPCFCSWCPVKCRCTCETW\CT
a fronteira com uma mercadoria estrangeira que pertence a terceiro, entregando-a em local determinado
no Brasil. Poderamos sinteticamente dizer que o sacoleiro um comerciante, enquanto o laranja um
RTGUVCFQTFGUGTXKQ

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

77

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

FQ+IWCWG%KWFCFFGN'UVGQUSWCKUVOCRGTEGRQFGSWGUGWVTCDCNJQOCKU
relevante do que a gravidade da ilegalidade cometida. Ao que parece, a conscincia
da ilicitude aparentemente atenuada por um componente psicolgico (beirando
a sociolgico) de que a clandestinidade menos lesiva ao pas que o desemprego.
Diante da expressividade do nmero de sacoleiros e da consequente presso social
IGTCFCRCTCCNGICNK\CQFCCVKXKFCFGCNKCFCCQEQORTQOKUUQDKNCVGTCNTGHGTKFQPQ
incio deste tpico, o Poder Executivo sensibilizou-se a ponto de constituir um
ITWRQVEPKEQ
EQOCRCTVKEKRCQFC4($ SWGEQPEGDGWWOOQFGNQPQTOCVKXQ
RTQEGFKOGPVCN G KPHQTOCVK\CFQ RCTC QRGTCEKQPCNK\CQ FQ TGIKOG # RTKOGKTC
iniciativa normativa do Poder Executivo foi a Medida Provisria n. 380, de
28/06/2007, que acabou revogada (por motivos polticos, para desobstruir a pauta de
XQVCQ RGNC/GFKFC2TQXKUTKCPFGRQUVGTKQTOGPVGEQPXGTVKFC
na Lei n. 11.580, de 27/11/2007. O texto redigido pelo Poder Executivo foi ento
reproduzido em projeto parlamentar que resultou na Lei n. 11.898, de 08/01/2009.
%QPVWFQCUKORNGURWDNKECQFCNGKPQFGWGHGVKXKFCFGCQTGIKOGXKUVQSWGGTC
necessria a concluso de uma ferramenta informatizada (no caso, brasileira30) que
permitisse a transmisso em tempo real dos dados da fatura de venda pelo lojista
paraguaio RFB, assim como o registro de sada na Aduana paraguaia e o de
KPITGUUQPQ$TCUKNVWFQKUUQEQOQKPVWKVQFGCWVQOCVK\CTQWZQFGKPHQTOCQ
minimizando a necessidade de conhecimento tcnico do sacoleiro, sendo a
FGENCTCQFGKORQTVCQCWVQOCVKECOGPVGIGTCFCPQ$TCUKNEQODCUGPQUFCFQU
enviados ao sistema pelos usurios paraguaios.
)GTQWUG WOC UKUVGOVKEC FG KORQTVCQ SWG CRTQXGKVC QU FCFQU FC GZRQTVCQ
GXKVCPFQUGCTGFKIKVCQ
SWGCRTGUGPVCTKUEQFGTWFQFGKPHQTOCQ GCFWRNKEKFCFG
de atividades, materializando em procedimento o que Trevisan (2012) denomina
de a terceira Lei de Newton, aplicada ao comrcio exterior.31 A sistemtica poderia
OWKVQDGOUGTCFCRVCFCGWOFKCIGPGTCNK\CFCCQWPKXGTUQFGKORQTVCGUDTCUKNGKTCU
15KUVGOC467EQOGQWCQRGTCTRCTCECFCUVTCOGPVQFGQRGTCFQTGUDTCUKNGKTQU
em 03/01/2011 (mdulo cadastramento), e em fevereiro de 2012 passaram a ser
RQUUXGKUQTGIKUVTQGQEQPVTQNGKPHQTOCVK\CFQFGVQFCCQRGTCQFGUFGCEQORTC
PQ2CTCIWCKCVQFGUGODCTCQ
NKDGTCQ FCOGTECFQTKCPQ$TCUKN
Se antes de 2012 no era possvel ir ao Paraguai e adquirir mercadorias para revenda
FGHQTOCNEKVCCIQTCQ467QRGTOKVGEQOFGURCEJQUKORNKECFQGRCICOGPVQ
WPKECFQFQUVTKDWVQUHGFGTCKUKPEKFGPVGUDCUVCSWGUGEQPUVKVWCWOCOKETQGORTGUC
habilitando-se perante a RFB a operar no regime.
30 'ODQTCCUPGIQEKCGURCTCKORNGOGPVCQFQTGIKOGVGPJCOUKFQDKNCVGTCKULCOCKUJQWXGWOCEQTFQHQTOCN
GPVTGQURCUGURCTCKPUVKVWKQFQTGIKOG#UUKOEQOQCNGKSWGKPUVKVWKQ467VQVCNOGPVGDTCUKNGKTCQUKUVGOC
informatizado que o controla tambm o . O lojista paraguaio assim como o funcionrio da Aduana paraguaia
so usurios do sistema brasileiro. Portanto, o sistema brasileiro pioneiro tanto por ser bilngue (portugus/
espanhol) quanto por ter usurios (inclusive cadastradores) dos dois pases. Para tanto, foram basicamente
WPKHQTOK\CFCUCUNGIKUNCGUFC4($$4FC5'62;GFC&0#2;UQDTGUGIWTCPCFCKPHQTOCQ
31 #ECFCKORQTVCQEQTTGURQPFGWOCGZRQTVCQFGOGUOCKPVGPUKFCFGRQTOFGUGPVKFQQRQUVQ

78

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

Dinmica transfronteiria no arco sul brasileiro no contexto do Regime de Tributao Unificada

4.4 OS AGENTES ECONMICOS TRANSFRONTEIRIOS


E A TRIBUTAO
1EQOTEKQNEKVQPCHTQPVGKTC(Q\FQ+IWCW%WKFCFFGN'UVGGPXQNXGDCUKECOGPVG
SWCVTQ UKVWCGU
RTGUUWRQPFQUG Q NCFQ DTCUKNGKTQ EQOQ EQORTCFQT 
C  C FQ
TGUKFGPVG DTCUKNGKTQ FC TGIKQ HTQPVGKTKC SWG CFSWKTG RTQFWVQU PGEGUUTKQU C UWC
UWDUKUVPEKCPCEKFCFGGUVTCPIGKTCXK\KPJC
D CFQXKCLCPVGDTCUKNGKTQSWGCFSWKTGDGPU
KPENWFQUPQEQPEGKVQFGDCICIGOPQ2CTCIWCK
E CFQKORQTVCFQTEQOWODTCUKNGKTQ
SWGRTQOQXGCGPVTCFCPQRCUFGOGTECFQTKCGUVTCPIGKTCRTQEGFGPVGFQ2CTCIWCK
G
F CFQOKETQKORQTVCFQTJCDKNKVCFQPQ4672CTCECFCWOCFGUUCUIWTCUGZKUVG
WOVTCVCOGPVQVTKDWVTKQGURGEEQGCCPNKUGFGVCKUVTCVCOGPVQU
UKPVGVK\CFCPC
(KIWTC RGTOKVGWOCOGNJQTXKUWCNK\CQFCNQUQCSWGPQTVGKCQ467
Figura 2 Agentes econmicos transfronteirios e tributao
Residente na
fronteira

Viajante
(turista)

Importador
comum

Microimpor tador
(sacoleiro)

Iseno
(comrcio
formiga)

RTE
(bagagem)

Regime
comum (TEC)

RTU
(lista +)

(QPVGGNCDQTCQFQUCWVQTGU

0C RTKOGKTC UKVWCQ C .GK P 


CTV o ++ H  EQPEGFGW KUGPQ FQ
KORQUVQFGKORQTVCQGUVGPFKFQCQ+2+
CTVo EQPVTKDWKQRCTCQ2+52CUGR
G  %QPU
RGNQ CTV o, II, e da Lei n. 10.865/2004), desde que os bens sejam
trazidos do exterior no comrcio caracterstico das cidades situadas nas fronteiras
terrestres, destinados subsistncia da unidade familiar.
A IN SRF n. 104/1984, que disciplina o chamado comrcio formiga, esclarece ainda
SWGCKUGPQCRNKEXGNUQOGPVGCOGTECFQTKCURTQFW\KFCUPQRCUFGCSWKUKQQW
no Brasil. Fica evidente, no caso, que o agente econmico envolvido (v.g., brasileiro
TGUKFGPVGGO(Q\FQ+IWCWSWGCFSWKTGCNKOGPVQUFGQTKIGORCTCIWCKCQWDTCUKNGKTC
em um mercado em Ciudad del Este) no pode comercializar os bens.
No caso de viajante que traz bagagem do exterior, h, da mesma forma, um
VTCVCOGPVQ VTKDWVTKQ GURGEEQ  Q 46' L OGPEKQPCFQ PQ VRKEQ  FGUVG
GUVWFQ&GUVCSWGUGSWGVCODOCSWKXGFCFCCEQOGTEKCNK\CQGOXKTVWFGFQ
prprio conceito de bagagem (Deciso CMC n. 53/2008), que exclui bens que,
RGNCSWCPVKFCFGPCVWTG\CQWXCTKGFCFGRGTOKVCORTGUWOKTKORQTVCQEQOPU
Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

79

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

comerciais ou industriais (a IN SRF n. 1.059/2010 detalha, em seu art. 33, limites


SWCPVKVCVKXQUGFGXCNQTRCTCHTWKQFCKUGPQTGNCVKXCCDCICIGO 
0CKORQTVCQEQOWOVGTEGKTQECUQRQTPUOGPEKQPCFQPQURQUUXGNOCU
WUWCNSWGUGKORQTVGRCTCTGXGPFC%QPVWFQFGXGQKORQTVCFQTQDVGTJCDKNKVCQ
PC 4($ G CFQVCT VQFCU CU RTQXKFPEKCU PGEGUUTKCU CQ TGIKUVTQ FC FGENCTCQ FG
KORQTVCQGCQCEQORCPJCOGPVQFQEQTTGURQPFGPVGFGURCEJQ
EQOQCENCUUKECQ
FG OGTECFQTKCU FG CEQTFQ EQO CU TGITCU FQ 5KUVGOC *CTOQPK\CFQ C XCNQTCQ
CFWCPGKTC GO EQPHQTOKFCFG EQO Q #TVKIQ 8++ FQ )CVV G Q NKEGPEKCOGPVQ FC
KORQTVCQ UG PGEGUUTKQ RGNC 5GEGZ  RTQEGFKOGPVQU GO IGTCN VGEPKECOGPVG
inacessveis ao sacoleiro.
de se reiterar assim que no se apresentava, antes do RTU, meio lcito vivel para
que o sacoleiro adquirisse mercadorias no Paraguai e as revendesse no Brasil. Essa
TGUVTKQCNKCFCUWDUVCPEKCNFKHGTGPCFGVTKDWVCQGPVTGQURCUGUGCQGNGXCFQ
WZQFGRGUUQCUPCTGIKQHTQPVGKTKC(Q\FQ+IWCW%KWFCFFGN'UVGRQTEGTVQ
EQPVTKDWKWRCTCCETGPCNQECNIGPGTCNK\CFCRQTOGSWKXQECFCFGSWGCRTVKECFG
VCNEQOTEKQ
EQOQRTQUUQQWEQOQEQORNGOGPVCQFGTGPFC CRGUCTFGKNGICN
no era socialmente (e at juridicamente) condenvel.
1467UWTIGCUUKOEQOQWOCCNVGTPCVKXCFGNGICNK\CQFCCVKXKFCFGFQUCEQNGKTQ
RGTOKVKPFQCKORQTVCQRCTCTGXGPFCFKTGVCCQEQPUWOKFQTPCNEQOUKORNKECQ
FQFGURCEJQGWPKECQFQRCICOGPVQFQUVTKDWVQUHGFGTCKUKPEKFGPVGUOGFKFCU
que tornam o processo menos tcnico e, por consequncia, mais acessvel ao pblico
em geral.
Nessa linha, o RTU no tem como alvo nem o viajante, nem o residente na fronteira,
nem o grande ou o mdio importador. Alis, recorde-se que o enquadramento como
OKETQGORTGUCEQPFKQRCTCQTGIKOG
%QOQCECDCPQTOCNOGPVGECPFQOGPQUQPGTQUQKORQTVCTRGNQ467HQTCOETKCFCU
OGFKFCURCTCGXKVCTWOFGUNQECOGPVQFQGKZQFCUKORQTVCGUEQOWPURCTCQTGIKOG

OGFKCPVGHTCEKQPCOGPVQQECUKQPCPFQFKUVQTGUPCGEQPQOKC EQOQCTGUVTKQFC
WVKNK\CQFQ467CFGVGTOKPCFQUNKOKVGU
FGXCNQTGGXGPVWCNOGPVGSWCPVKVCVKXQU 
e a determinadas mercadorias (lista positiva), assim como a obrigatoriedade de venda
FKTGVCCEQPUWOKFQTPCNGQOQPKVQTCOGPVQFQKORCEVQFQTGIKOGRQT%QOKV
(que j foi institudo pela Portaria MDIC n. 18/2010).
4.5 O RTU ATUALMENTE
Em que pese ter sido efetivamente implantado em fevereiro de 2012, o RTU teve
UWCRTKOGKTCQRGTCQUQOGPVGGOLWPJQFQOGUOQCPQ
#RGUCTFGRTCVKECOGPVGVQFCKPHQTOCQUQDTGQ467GUVCTFKURQPXGNPQUVKQ
da RFB (http://www.receita.fazenda.gov.br/aduana/rtu), no qual se encontra a
80

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

Dinmica transfronteiria no arco sul brasileiro no contexto do Regime de Tributao Unificada

NGIKUNCQPCPVGITCCEQORCPJCFCFGWOCECTVKNJCFQTGIKOGWOFGVCNJCOGPVQ
RCUUQCRCUUQFGWOCQRGTCQWOCUGQFGRGTIWPVCUGTGURQUVCUGKPHQTOCGU
sobre os documentos e os formulrios necessrios, as mercadorias admitidas, as
microempresas optantes e as lojas de Ciudad del Este cadastradas, entre outras,
ainda parece haver uma mescla de falta de conhecimento do regime com receio

RGNCEWNVWTCFGHWICFQUEQIGTCFCEQOCENCPFGUVKPKFCFG 
At o momento h 529 microempresas brasileiras optantes e 26 lojas paraguaias
ECFCUVTCFCU,HQTCOTGCNK\CFCUQRGTCGUFGKORQTVCQCQCORCTQFQTGIKOG
somando a importncia de R$ 138.746,56, com recolhimento de R$ 34.684,69 em
VTKDWVQUHGFGTCKU1)TEQOQUVTCCFKUVTKDWKQFCUOKETQGORTGUCUKORQTVCFQTCU
RQTWPKFCFGFC(GFGTCQFGUVCECPFQSWG5Q2CWNQQGUVCFQEQOOCKQTXQNWOG
FGKORQTVCGUUGIWKFQRGNQ4KQ)TCPFGFQ5WNGRQT/CVQ)TQUUQ32
Nas estatsticas de comrcio exterior, sem considerar o RTU, So Paulo tambm
aparece como o principal destino de mercadorias oriundas do Paraguai, constituindose naturalmente no s em centro consumidor (pela densidade populacional e pela
renda) como em centro distribuidor, devido sua dinmica logstica e comercial.
O aparecimento do Estado do Rio Grande do Norte na tabela aponta para a
existncia de microempresrios interessados em comercializar produtos adquiridos
no regime, principalmente telefones celulares, mesmo em regies nas quais os custos
de transporte33 em tese se tornariam um empecilho.
Grfico 1 Empresas importadoras por unidade da Federao

(QPVG&GNGICEKCFC4GEGKVC(GFGTCNGO(Q\FQ+IWCW

32 Por municpio, os principais destinos das mercadorias adquiridas ao amparo do RTU foram Pelotas (RS), So
Paulo (SP), Natal (RN), Novo Hamburgo (RS), Chapec (RS) e Umuarama (PR).
33 #FKUVPEKCTQFQXKTKCGPVTG(Q\FQ+IWCWG0CVCNFGCRTQZKOCFCOGPVGMO

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

81

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

# 6CDGNC  CRTGUGPVC C FKUVTKDWKQ FCU QRGTCGU PQU OGUGU FQ CPQ EQO QU
respectivos valores, em reais.
Tabela 1 Distribuio das operaes do RTU por ms
Ms
Junho
Agosto
Setembro
Outubro
Novembro

Quantidade-operaes

Total importado (R$)

Tributos federais (R$)

01
04
03
07
11

763,00
36.195,08
15.758,39
27.401,86
58.628,23

190,72
9.048,53
3.939,23
6.849,91
14.656,30

(QPVG&GNGICEKCFC4GEGKVC(GFGTCNGO(Q\FQ+IWCW


1XQNWOGCVWCNFGQRGTCGUFQ467RGTEGRVKXGNOGPVGKPHGTKQTGZRGEVCVKXCFC
4($#UQNWQVGEPQNIKECFGXCPIWCTFCCVQOQOGPVQCKPFCUWDWVKNK\CFCGQ
FGUEQPJGEKOGPVQPQUFQURTQEGFKOGPVQUFGQRGTCQ
GOSWGRGUGQEQOGPVCFQ
no incio deste tpico), mas das vantagens que o RTU oferece, assim como uma
HCNUCRGTEGRQFCUFGUXCPVCIGPUUQQURTKPEKRCKUHCVQTGUCOKVKICTCRTQNKHGTCQFG
WUWTKQUFQKPEKRKGPVGTGIKOG&CCDWUECPGUVGGUVWFQFCKPFKECQFCUXCPVCIGPU
e das desvantagens do RTU justamente por aqueles que j so operadores do regime.
4.6 VANTAGENS E DESVANTAGENS
NA PERCEPO DOS OPERADORES
Com base nos questionrios aplicados a alguns dos principais operadores do RTU,
HQK RQUUXGN XGTKECT UWC RGTEGRQ C TGURGKVQ FCU XCPVCIGPU G FCU FGUXCPVCIGPU
do regime.
Na viso do microimportador, as vantagens relacionadas, em geral, so:

C CNGICNK\CQFGUWCCVKXKFCFG
D CUGIWTCPCFGSWGCOGTECFQTKCXCKEJGICT
CQFGUVKPQPCN
E CVTKDWVCQGORCVCOCTOGPQTSWGPCKORQTVCQEQOWO

F  C RQUUKDKNKFCFG FG NKDGTCQ GO SWCPVKFCFGU EQOGTEKCKU FG RTQFWVQU EQOQ


VGNGHQPGU EGNWNCTGU RGCU G CEGUUTKQU RCTC EQORWVCFQTGU tablets e aparelhos de
UQORCTCECTTQU
G CUKORNKECQPQFGURCEJQCFWCPGKTQGPQRCICOGPVQFQU
VTKDWVQUG
H QDCKZQTKUEQFGRCICOGPVQFGOWNVCRQTENCUUKECQKPEQTTGVCFC
mercadoria importada (previamente cadastrada pelo lojista paraguaio no Sistema
RTU). As vantagens apontadas no destoam das indicadas pelos lojistas paraguaios
(que acrescentam a facilidade de cadastramento das lojas no Paraguai e o incremento
PQXQNWOGFGXGPFCU GRGNC4GEGKVC(GFGTCNFQ$TCUKN
SWGCITGICCUKORNKECQ
FQEQPVTQNGVGPFQGOXKUVCCKPHQTOCVK\CQ 
#UFGUXCPVCIGPUFQTGIKOGPCRGTEGRQFQOKETQKORQTVCFQTUQ
C CDWTQETCEKC
RCTC Q ECFCUVTCOGPVQ PC 4GEGKVC (GFGTCN G
D  C CWUPEKC PC NKUVC RQUKVKXC FG
equipamentos mais modernos de informtica, como aparelhos wireless, e de
produtos de bazar, brinquedos, perfumaria e artigos para casa, todos comumente
82

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

Dinmica transfronteiria no arco sul brasileiro no contexto do Regime de Tributao Unificada

comercializados no Brasil. Os lojistas paraguaios fazem coro a essa segunda


FGUXCPVCIGOKPFKECPFQSWGCCDTCPIPEKCFCNKUVCRQUKVKXCCKPFCVOKFC2QTO
PCRGTEGRQFC4($CRQPVQWUGSWGQTGIKOGCKPFCGUVCSWOFCUGZRGEVCVKXCU
PQIWCTFCPFQEQORCVKDKNKFCFGEQOQGUHQTQGZRGPFKFQGOUWCETKCQ
Percebeu-se nitidamente que o fator mais desmotivador entre os microempresrios
CGZEGUUKXCTGUVTKQPCNKUVCRQUKVKXCSWGJQLGPQKPENWKQURTQFWVQUSWGVO
OCKQT IKTQ EQOGTEKCN Q SWG OKPKOK\C QU NWETQU G FKEWNVC C EQPEQTTPEKC EQO
empresas de maior porte.
#4($GOTGNCQCVCNHCVQTKPHQTOCSWGQ%QOKVFG/QPKVQTCOGPVQFQ467
CEQORCPJCGCXCNKCCUQRGTCGURGTKQFKECOGPVGGGNCDQTCTGNCVTKQUVTKOGUVTCKUSWG
apontam as necessidades de aprimoramento do regime. Nesse contexto, podem ser
GHGVWCFCUTGUVTKGUCFKEKQPCKUQWCORNKCGUFGGUEQRQFGCEQTFQEQOQUKORCEVQU
KFGPVKECFQUPCGEQPQOKCPCEKQPCNDTCUKNGKTC
KORQTVCPVGFGUVCECTCKPFCSWGQRTKPERKQSWGPQTVGQWCGNCDQTCQFCNKUVCHQKC
RTQVGQFCKPFUVTKCPCEKQPCN#UUKOQVGOCFGXGUGTGUVWFCFQEQORQPFGTCQ
DWUECPFQUG WOC OGNJQT UQNWQ RCTC GXGPVWCN EQPHNKVQ FG KPVGTGUUGU GPVTG
representantes da indstria nacional e microempresrios.

5 CONSIDERAES FINAIS
14GIKOGFG6TKDWVCQ7PKECFCKPFWDKVCXGNOGPVGWOCRQVGPVGHGTTCOGPVC
FGKPEGPVKXQNGICNK\CQFQEQOTEKQNGXCFQCECDQPCHTQPVGKTC(Q\FQ+IWCW
Cuidad del Este.
O RTU alinha-se ainda s melhores prticas de gesto pblica, porque incentiva
Q EWORTKOGPVQ GURQPVPGQ FG QDTKICGU VTKDWVTKCU G CFWCPGKTCU G CLWFC VCPVQ
PCSWGUVQFCVTCPURCTPEKCGOTGNCQCQTGEQNJKOGPVQFQUVTKDWVQUSWCPVQPC
GORTGICDKNKFCFGFCRQRWNCQ
#KORNCPVCQFQ467CKPFCTGEGPVGGRQTVCPVQUQKORQTVCPVGUCUCXCNKCGU
KPKEKCKUEQOQCCSWKVTCCFCRCTCQCRTKOQTCOGPVQFCUKUVGOVKECFGQRGTCQFQ
TGIKOGFQUKUVGOCGQCRC\KIWCOGPVQFGGXGPVWCKUKPVGTGUUGUEQPKVCPVGUGPVTGCU
partes envolvidas.
6TCVCPFQUGOCKUGURGEKECOGPVGFCTGXKUQFCNKUVCRQUKVKXCWOCFCUSWGUVGUSWG
FGCEQTFQEQOQCSWKGZRQUVQVGPFGCICPJCTEQTRQETUGSWGCUQNWQTGRQWUC
GOEQPVGORNCTCQOGUOQVGORQCCHGVCQFCRTQFWQKPFWUVTKCNPCEKQPCNGC
viabilidade da atividade comercial do microimportador.
PGUUGGSWKNDTKQSWGUGRQFGKPEGPVKXCTCHQTOCNK\CQFQEQOTEKQHTQPVGKTKQ
FKOKPWKPFQ Q EQPVTCDCPFQFGUECOKPJQ G CKPFC CWOGPVCPFQ C CTTGECFCQ
tributria.
Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

83

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

REFERNCIAS
ALBARRACN, Hctor Guillermo Vidal. Delitos aduaneros. 3. ed. Corrientes/
Argentina: Mave, 2010.
$#5#.&#4KECTFQ:CXKGT Mercosur y derecho de la integracin. Buenos
Aires: Abeledo-Perrot, 1999.
CARLUCCI, Jos Lence. Uma introduo ao direito aduaneiro. 2. ed. So Paulo:
Aduaneiras, 2001.
COELHO. Flvio Jos Passos. Facilitao comercialFGUCQRCTCWOC#FWCPC
moderna. So Paulo: Aduaneiras, 2008.
&14(/#0#415'5)6$ 4GIKQPCNKUOQHTQPVGKTKQGQCEQTFQRCTCQU
PCEKQPCKUHTQPVGKTKQUDTCUKNGKTQUWTWIWCKQU+P1.+8'+4#6%/FG
1TI 
Territrio sem limites: estudo sobre fronteiras. Campo Grande: UFMS, 2005.
FOLLONI, Andr Parmo. Tributao sobre o comrcio exterior. So Paulo:
Dialtica, 2005.
-7/'*QPQTKQ2#+0+)WKFC/GTEQUWNQFKNGOCGPVTGWPKQCFWCPGKTCGTGC
de livre comrcio. Revista de Economia Poltica, n. 25 (4), 2005.
JAPIASS, Carlos Eduardo Adriano. O contrabando: uma reviso de seus
fundamentos tericos. Rio de Janeiro: Lumen Juris, 2000.
LASCANO, Julio Carlos. Aduanas: de la facilitacin del comercio a la tentacin del
proteccionismo. In: PONCE, Andrs Rohde (Coord.). Crisis financiera global:
impactos en la actividad aduanera. Reunin Mundial de Derecho Aduanero. Mxico:
IIFA, 2010.
LIMA, Srgio Luiz Messias. O acompanhamento tributrio: um novo paradigma
GOUECNK\CQRCTCC4GEGKVC(GFGTCNFQ$TCUKN'UEQNCFG#FOKPKUVTCQ(C\GPFTKC

'UCH /QPQITCCRTGOKCFC$TCUNKC
.12'5 2CVTEKC 8KVVK /14+0+ %TKUVKCPQ 4GIKOGU CFWCPGKTQU GURGEKCKU FG
GZRQTVCQWOCEQORCTCQGPVTGGZRQTVCQVGORQTTKCGPVTGRQUVQCFWCPGKTQ
PC GZRQTVCQ G &CE  &GRUKVQ #NHCPFGICFQ %GTVKECFQ Rev. de Negcios
Internacionais, Piracicaba, 4(6), p. 39-45, 2006.
MEIRA, Liziane Angelotti. Regimes aduaneiros especiais. So Paulo: IOB, 2002.
AAAAAAAA+PVGITCQTGIKQPCNGVTKDWVQUUQDTGQEQOTEKQGZVGTKQTPQ/GTEQUWN
Revista da PGFN, Braslia, PGFN, v. 1, n. 2, jul.-dez. 2011.
MENDONA, C. Impactos de processos de integrao em zonas de fronteira:
QETGUEKOGPVQFQUWZQUEQOGTEKCKUGQFGUGPXQNXKOGPVQGOEKFCFGUIOGCUFQ
/GTEQUWN$TCUNKC%GPVTQFG2GUSWKUCG2U)TCFWCQUQDTGCU#OTKECU
(Srie Ceppac).
84

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

Dinmica transfronteiria no arco sul brasileiro no contexto do Regime de Tributao Unificada

MORINI,%TKUVKCPQ.'1%+)WUVCXQLogstica internacional segura: operador


GEQPOKEQCWVQTK\CFQGCIGUVQFGHTQPVGKTCUPQUEWNQ::+5Q2CWNQ#VNCU
1&&10'0CJWGN5#75+,QU.WKU4JK.CEQQRGTCEKPVTCPUHTQPVGTK\CGPVTG
las unidades subnacionales del Mercosur. Revista de la Facultad de Ciencias
Econmicas y Administrativas de la Universidad de Nario X :+ P 
(2o sem. 2010).
1.+8'+4#6%/6KRQNQIKCFCUTGNCGUHTQPVGKTKCUGNGOGPVQURCTCQFGDCVG
terico-prtico. In: OLIVEIRA, T. C. M. de (Org.) Territrio sem limites: estudo
sobre fronteiras. Campo Grande: UFMS, 2006.
24'< /KIWGN %CDGNNQ )10<.'< ,QU /KIWGN %CDGNNQ Procedimientos
aduaneros I. Madrid: Taric, 2004.
PONCE, Andres Rohde. Derecho aduanero mexicano. v. 2. Cidade do Mxico:
Isef, 2000.
0181#%UCT)CTEKC'N+8#[GNEQOGTEKQKPVGTPCEKQPCNGURGEKCNTGHGTGPEKCC
la problemtica de la Unin Europea. In: TRRES, Heleno Taveira. Comrcio
internacional e tributao. So Paulo: Quartier Latin, 2005.
RATTI, Bruno. Comrcio internacional e cmbio. 11. ed. So Paulo: Aduaneiras, 2008.
REZENDE, Fernando. Globalizao, federalismo e tributao. 3o Curso de
4GNCGU(KUECKU+PVGTIQXGTPCOGPVCKU$TCUNKC'UCH
SECRETARIA DA RECEITA FEDERAL DO BRASIL (RFB). Stio web.
Disponvel em: <http://www.receita.fazenda.gov.br/Aduana>. Acesso em: 12/12/2012.
SOSA, Roosevelt Baldomir. A Aduana e o comrcio exterior. So Paulo:
Aduaneiras, 1996.
64'8+5#04QUCNFQ1UTGIKOGUCFWCPGKTQUDTCUKNGKTQUGC%QPXGPQFG-[QVQ
revisada. In: MENEZES, Wagner (Coord.). Estudos de direito internacional.
v. 11. Curitiba: Juru, 2007.
________. Atuao estatal no comrcio exterior, em seus aspectos tributrio e
aduaneiro&KUUGTVCQ
/GUVTCFQ 2QPVKHEKC7PKXGTUKFCFG%CVNKECFQ2CTCP
Curitiba, 2008.
AAAAAAAA#TGXKUQCFWCPGKTCFGENCUUKECQFGOGTECFQTKCUPCKORQTVCQGC
UGIWTCPCLWTFKECWOCCPNKUGUKUVGOVKEC+P$4#0%12CWNQ)QPGV/'+4#
.K\KCPG #PIGNQVVK %144'+# 0'61 %GNUQ FG $CTTQU
%QQTF  Tributao e
direitos fundamentais conforme a jurisprudncia do STF e do STJ. So Paulo:
Saraiva, 2012.
UTEPI. Negocios en el Paraguay: elementos del costo pas. Cooperacin de la
Organizacin de las Naciones Unidas para el Desarrollo. Disponvel em: <http://
YYYOKEIQXR[KOCIGUEQUVQARCKUARCTCIWC[RFH>. Acesso em: 12/12/2012.
Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

85

Eloisa Maieski Antunes/Eli Martins Senhoras/Rosaldo Trevisan

APNDICE
Perguntas aos auditores da RFB em Foz do Iguau
%QOQEQOGQWQRTQLGVQFQ467!
2. Qual o principal objetivo do RTU?
+PKEKCNOGPVGQRTQLGVQVGXGCNIWOCRTGQEWRCQEQOGXCUQFGFKXKUCU!
4. Existiu um estudo prvio para segmentar o pblico-alvo do RTU?
5. Houve alguma parceria com o governo paraguaio?
6. A RFB tem projetos para aplicar o RTU em outras regies de fronteira?
3WCNCGZRGEVCVKXCGOTGNCQCQPOGTQFGQRGTCGUFQ467!
8. A lista positiva ser revisada periodicamente?
Perguntas aos microempresrios varejistas
1.
2.
3.
4.

A microempresa j utilizou o RTU?


Em caso negativo da resposta acima, por que ainda no utilizou?
Em sua opinio, quais as vantagens que apresenta o RTU?
Qual produto poderia ser includo na lista positiva do RTU?
Perguntas aos lojistas paraguaios

%QOQHQKCKORNCPVCQFQ5KUVGOC467PCGORTGUC!
3WCNCRTKPEKRCNFKEWNFCFGFWTCPVGCKORNCPVCQFQ5KUVGOC467!
*QWXGRTQDNGOCRCTCCENCUUKECQFQURTQFWVQUXGPFKFQU!
3WCNUWCQRKPKQGOTGNCQNKUVCRQUKVKXC!

86

Cad. Fin. Pbl., Braslia, n. 12, p. 65-86, dez. 2012

Dissoluo irregular e responsabilidade tributria


dos gestores de sociedades empresrias
Alisson Fabiano Estrela Bonfim
Procurador da Fazenda Nacional, em exerccio na
%QQTFGPCQ)GTCNFC4GRTGUGPVCQ,WFKEKCNFC
Fazenda Nacional, em Braslia-DF
Especializado em direito tributrio pela Escola
5WRGTKQTFG#FOKPKUVTCQ(C\GPFTKC
'UCH

Resumo
A dissoluo irregular pode ser compreendida como
o desaparecimento da sociedade empresria sem o
cumprimento dos requisitos legais obrigatrios sua
extino, que passa a existir apenas formalmente,
mas desprovida de patrimnio suficiente para
saldar suas dvidas. A jurisprudncia admite a
responsabilizao de scios e administradores de
sociedades empresrias na hiptese de dissoluo
irregular, com fundamento no art. 135, III, do
CTN. Embora haja certa controvrsia na doutrina,
entendemos ser possvel tal responsabilizao.
No que concerne identificao dos scios e dos
administradores que podero ser responsabilizados,
a posio mais razovel e que melhor equilibra os
interesses do Fisco com o entendimento dos tribunais
ptrios no sentido de que tanto o gestor da poca
do fato gerador quanto o da poca da dissoluo
irregular respondem pelos dbitos, a depender do caso
concreto. Assim, em regra, apenas os scios-gerentes e
os administradores que o fossem poca da dissoluo
da empresa respondam por seus dbitos fiscais, uma
vez que o ilcito que autoriza a responsabilizao a
dissoluo irregular. Excepcionalmente, possibilitase a responsabilizao dos gestores da poca do fato
gerador, desde que comprovada a existncia de ato
ilcito, tal como fraude.

Palavras-chave
Direito tributrio. Responsabilidade tributria.
Dissoluo irregular. Gestores de sociedades
empresrias.

Abstract
The irregular dissolution can be understood as the
disappearance of the business company without
complying with the mandatory legal requirements
to their extinction, which comes into existence only
formally, but lacks sufficient equity to pay off their
debts. The case law supports the accountability of
partners and managers of business companies in the
event of dissolution irregular, based on art. 135, III,
Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

of the CTN. Although there is some controversy


on the doctrine, we believe that accountability is
possible. Regarding the identification of partners and
managers who may be liable, the more reasonable
position and that best balances the interests of the
Treasury with the understanding of the courts is
patriotic in the sense that both the manager at the
time of the triggering event as the time of irregular
dissolution liable for debts, depending on the case.
Thus, as a rule, only the managing partners and
administrators who were at the time of dissolution
of the company account for their tax liabilities,
since the tort liability is authorizing the dissolution
irregular. Exceptionally, to allow the accountability
of managers at the time of the triggering event has
been proved the existence of tort such as fraud.

Keywords
Tax law. Tax liability. Irregular dissolution.
Corporate managers entrepreneurs.

1 INTRODUO
A responsabilidade tributria dos
gestores de sociedades empresrias
suscita acalorados debates na doutrina e
na jurisprudncia sob os mais variados
aspectos. Um dos mais relevantes,
complexos e polmicos diz respeito
responsabilidade em decorrncia da
FKUUQNWQKTTGIWNCTFCGORTGUC
Os incisos III e VII do art. 134 do
Cdigo Tributrio Nacional (CTN)
dispem, respectivamente, que, nos
casos de impossibilidade de exigncia
F Q  E W O R T K O G P V Q  F C  Q D T K I C Q
principal pelo contribuinte, respondem
solidariamente com este, nos atos em que
intervierem ou pelas omisses de que
forem responsveis, os administradores
de bens de terceiros pelos tributos
devidos por estes, e os scios, no caso
FG NKSWKFCQ FG UQEKGFCFG FG RGUUQCU
O inciso III do art. 135 do mesmo
87

Alisson Fabiano Estrela Bonfim

diploma legal, por seu turno, preconiza que os diretores, os gerentes ou os


representantes de pessoas jurdicas de direito privado so pessoalmente responsveis
RGNQUETFKVQUEQTTGURQPFGPVGUCQDTKICGUVTKDWVTKCUTGUWNVCPVGUFGCVQURTCVKECFQU
EQOGZEGUUQFGRQFGTGUQWKPHTCQFGNGKEQPVTCVQUQEKCNQWGUVCVWVQU
# RCT FGUUCU RTGXKUGU Q 5WRGTKQT 6TKDWPCN FG ,WUVKC
56,  EQPUQNKFQW Q
entendimento recentemente cristalizado na Smula n. 4351FGSWGCFKUUQNWQ
KTTGIWNCTFCUQEKGFCFGGORTGUTKCVCODOCWVQTK\CCTGURQPUCDKNK\CQVTKDWVTKC
dos scios-gerentes e dos administradores.
0QQDUVCPVGCRCEKECQFQVGOCPQODKVQLWTKURTWFGPEKCNRCTVGFCFQWVTKPC
CKPFCEQPVTQXGTVGSWCPVQCVCNRQUUKDKNKFCFG1USWGCFXQICORQUKQEQPVTTKC
CUUGXGTCO SWG C UKORNGU FKUUQNWQ KTTGIWNCT PQ LWUVKHKEC C CVTKDWKQ FG
responsabilidade tributria aos gestores das empresas, pois tal fato pode decorrer
FGWOCUTKGFGTC\GUSWGPQNJGURQFGTKCOUGTKORWVCFCU#FGOCKUCFKUUQNWQ
irregular no se enquadraria na previso constante do art. 135 do CTN, na medida
GO SWG PQ  HCVQ IGTCFQT FG VTKDWVQ CNIWO KUVQ  FC FKUUQNWQ PQ FGEQTTG
QDTKICQVTKDWVTKCPQXC
'OQWVTQXTVKEGOGUOQFGPVTGQUSWGUGNKCOCQGPVGPFKOGPVQPQUGPVKFQFC
CFOKUUKDKNKFCFGFCTGURQPUCDKNK\CQFQUIGUVQTGUPQECUQFGFKUUQNWQKTTGIWNCTPQ
h consenso sobre quais scios e administradores poderiam ser chamados a responder
RGNCUFXKFCUUECKUFCUUQEKGFCFGUGORTGUCTKCKU2CTCCNIWPUUQOGPVGQUFCRQECFQ
HCVQIGTCFQTFQVTKDWVQCKPFCSWGPQQHQUUGOSWCPFQFCFKUUQNWQFCGORTGUC
2CTCQWVTQUURQFGOUGTTGURQPUCDKNK\CFQUQUIGUVQTGUFQOQOGPVQFCFKUUQNWQ
OGUOQSWGPQQHQUUGORQECFQHCVQIGTCFQT7OCVGTEGKTCRQUKQUWUVGPVC
SWGQEQTTGPFQCFKUUQNWQKTTGIWNCTFCUQEKGFCFGGORTGUTKCUQOGPVGRQFGTQ
ser responsabilizados por dvidas tributrias aqueles que eram scios-gerentes ou
terceiros no scios com poderes de gerncia poca do fato gerador do tributo e
FCFKUUQNWQFCGORTGUC2QTOJWOCSWCTVCEQTTGPVGUGIWPFQCSWCNVCPVQQ
IGUVQTFCRQECFQHCVQIGTCFQTSWCPVQQFCRQECFCFKUUQNWQKTTGIWNCTTGURQPFGO
pelos dbitos, em qualquer caso.
Nesse diapaso, este trabalho ter como objetivos principais: (i) investigar se o
QTFGPCOGPVQLWTFKEQRVTKQCFOKVGCFKUUQNWQKTTGIWNCTFCUQEKGFCFGGORTGUTKC
EQOQECWUCFGTGURQPUCDKNK\CQVTKDWVTKCFGUGWUIGUVQTGUG
KK CXCNKCTSWCKUFQU
scios e dos administradores podero efetivamente ser responsabilizados.
%QOQQDLGVKXQUGURGEEQURQTUWCXG\DWUECTGOQU
K GZRNKEKVCTQSWGUGTKCC
FKUUQNWQKTTGIWNCTTGVTCVCPFQUKVWCGUSWGRQFGOECTCEVGTK\NCG
KK CDQTFCTQU
posicionamentos da doutrina e dos tribunais ptrios, em especial do STJ.
1 Presume-se dissolvida irregularmente a empresa que deixar de funcionar no seu domiclio fiscal, sem
EQOWPKECQCQUTIQUEQORGVGPVGUNGIKVKOCPFQQTGFKTGEKQPCOGPVQFCGZGEWQHKUECNRCTCQUEKQIGTGPVG

88

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

Dissoluo irregular e responsabilidade tributria dos gestores de sociedades empresrias

%QOGHGKVQCGUEQNJCFQVGOCFGXGWUGEQPUVCVCQFGUWCCEGPVWCFCTGNGXPEKC
LWTFKECRQNVKECGUQEKCNQSWGGXKFGPEKCUWCXKCDKNKFCFGEKGPVEC
0QCURGEVQLWTFKEQCUSWGUVGUCVKPGPVGUFKUUQNWQKTTGIWNCTGTGURQPUCDKNK\CQ
dos gestores de sociedades empresrias so extremamente polmicas, conforme
salientamos linhas atrs. Isso se deve, em grande medida, prpria lei, que no
permite uma compreenso clara e objetiva do assunto, gerando dubiedades e
KPEGTVG\CU #NOFKUUQQVGOC GOCRTGQ FKUEWVKFQ GOOKNJCTGU FG RTQEGUUQU
judiciais por todo o pas, o que avulta a importncia do seu estudo.
#TGNGXPEKCRQNVKECGUQEKCNRQTUGWVWTPQFGEQTTPEKCFQHCVQFGSWGCEQDTCPC
do crdito tributrio deve ocorrer de maneira clere (quanto menor o tempo
FG TGEWRGTCQ FQ ETFKVQ OGPQTGU CU EJCPEGU FG GUXC\KCOGPVQ RCVTKOQPKCN FQ
devedor), GEKGPVG
QDVGPQFQUOGNJQTGUTGUWNVCFQUEQOQOGPQTFKURPFKQFG
TGEWTUQUJWOCPQUOCVGTKCKUGPCPEGKTQU Glegtima
EQOQDUGTXPEKCFCNGIKUNCQ
pertinente e respeito aos direitos fundamentais do contribuinte).
1TCPCOGFKFCGOSWGUGKPXGUVKICCNGIKUNCQRVTKCGCRCTVKTFCUGXGTKECUGC
FKUUQNWQKTTGIWNCTFCUQEKGFCFGGORTGUTKCTGCNOGPVGCWVQTK\CCTGURQPUCDKNK\CQ
dos scios e dos administradores e, em caso positivo, quais destes podero ser
efetivamente responsabilizados, os predicados referidos no pargrafo anterior
TGUVCORTGGPEJKFQUWOCXG\SWGCEQTTGVCKFGPVKECQFQTGURQPUXGNVTKDWVTKQ
CECTTGVC
K EGNGTKFCFGPQTGFKTGEKQPCOGPVQFCGZGEWQUECNGEQPUGSWGPVGOGPVG
CIKNKFCFGPCTGEWRGTCQFQETFKVQVTKDWVTKQ
KK GEQPQOKCRTQEGUUWCNGXKVCPFQUG
QFKURPFKQFGTGEWTUQUJWOCPQUOCVGTKCKUGPCPEGKTQUEQOFKNKIPEKCUKPHTWVHGTCU
EWUVCURTQEGUUWCKUGJQPQTTKQUCFXQECVEKQUG
KKK UGIWTCPCLWTFKECVCPVQRCTCC
Fazenda Pblica quanto para os gestores de sociedades empresrias.
Nessa senda, buscaremos oferecer os subsdios bsicos e essenciais para a compreenso
FQVGOCEQPVTKDWKPFQCUUKORCTCQFGDCVGFGKFGKCUGRCTCQCRGTHGKQCOGPVQFQ
sistema.

2 CONCEITO E CARACTERIZAO DE
DISSOLUO IRREGULAR
As sociedades empresrias dissolvem-se nas hipteses previstas em lei. No caso das
sociedades contratuais, o art. 1.033 do Cdigo Civil (CC) prescreve que a sociedade se
dissolve, dentre outras hipteses, quando ocorrer o consenso unnime dos scios ou
CFGNKDGTCQFQUUEKQURQTOCKQTKCCDUQNWVCPCUQEKGFCFGFGRTC\QKPFGVGTOKPCFQ
Tratando-se de sociedades de capital, o art. 206 da Lei n. 6.404, de 15 de dezembro
FGFKURGSWGCEQORCPJKCUGFKUUQNXGRQTGZGORNQOGFKCPVGCFGNKDGTCQ
da assembleia-geral.

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

89

Alisson Fabiano Estrela Bonfim

0GUUGUECUQUQECOKPJQPQTOCNRCTCCGZVKPQFCGORTGUCFGOCPFCCQDUGTXPEKC
de uma srie de requisitos, didaticamente sintetizados por Arajo (2010, p. 215),
nos seguintes termos:
=?CRTKOGKTCHCUGFK\TGURGKVQRTRTKCFKUUQNWQSWGQCVQSWGEQPUKUVG
PCFGNKDGTCQFQUUEKQUFGGPEGTTCTCUQEKGFCFG#UGIWPFCHCUGCNKSWKFCQ
SWCPFQJCTGCNK\CQFQCVKXQQRCICOGPVQFQRCUUKXQGCFKUVTKDWKQGPVTG
os scios, dos valores que, eventualmente, restarem dessa conta. J a terceira e
NVKOCHCUGKORNKECCGHGVKXCGZVKPQEQOCFGUEQPUVKVWKQFCRGUUQCLWTFKEC
por meio da baixa respectiva no registro competente.

No observado esse caminho natural, estaremos diante do que se denomina


dissoluo irregular ou de fato.
6TCVCUGCFKUUQNWQKTTGIWNCTFQFGUCRCTGEKOGPVQFCUQEKGFCFGGORTGUTKCUGOQ
EWORTKOGPVQFQUTGSWKUKVQUNGICKUQDTKICVTKQUUWCGZVKPQSWGRCUUCCGZKUVKT
CRGPCU HQTOCNOGPVG OCU FGURTQXKFC FG RCVTKOPKQ UWEKGPVG RCTC UCNFCT UWCU
dvidas.
0C OGUOC VTKNJC 5WUUOCPP
  GPUKPC SWG C FKUUQNWQ KTTGIWNCT RQFG UGT
EQORTGGPFKFC EQOQ C UKVWCQ GO SWG C GORTGUC UG FGUCVKXC QW UKECOGPVG
desaparece, sem a observncia dos procedimentos inerentes baixa no registro
EQTTGURQPFGPVGFKUUKRCPFQUGWUDGPUUGOUCNFCTQDTKICGURGPFGPVGUKPENWUKXG
UECKU
#UUKU RQT UWC XG\ CTOC PQ JCXGT RQUUKDKNKFCFG FG UG EJGICT C WOC FGPKQ
EQPEGKVWCN
HGEJCFCGFQVKRQUGUQOGPVGU FQSWGUGLCFKUUQNWQKTTGIWNCTRCTC
PUFGCVTKDWKQFGTGURQPUCDKNKFCFGCQUUEKQUGCQUCFOKPKUVTCFQTGUOCUTGEQPJGEG
CRQUUKDKNKFCFGFGUGXKUWCNK\CTCNIWOCUUKVWCGUGOSWGVCNTGURQPUCDKNKFCFGCQTC
como nas duas seguintes:
OFCUCVKXKFCFGUFCGORTGUCEQOKPGZKUVPEKCFGDGPUFGUWCRTQRTKGFCFG
e sem qualquer providncia por parte dos scios, quanto autofalncia ou,
CQOGPQUKPHQTOCQLWPVQCQUTIQUEQORGVGPVGUUQDTGCKPCVKXKFCFG
transferncia de quotas da sociedade para terceiros, com registro na Junta
%QOGTEKCNOCUUGOTGIKUVTQPQUTIQUFCCFOKPKUVTCQVTKDWVTKC
#55+5
2007, p. 161).

%QPHQTOGUGPQVCCJKRVGUGOCKUEQOWOFGECTCEVGTK\CQFCFKUUQNWQKTTGIWNCT
QEQTTG SWCPFQ FC PQ NQECNK\CQ FC GORTGUC PQ GPFGTGQ KPHQTOCFQ GO UGWU
registros, em outras palavras, a empresa que deixar de funcionar no seu domiclio
UECN UGO EQOWPKECQ CQU TIQU EQORGVGPVGU2 0GUUG ECUQ J XKQNCQ U
FKURQUKGUNGICKUSWGCUQDTKICOCOCPVGTGOCVWCNK\CFQUUGWUTGIKUVTQUPQVCFCOGPVG
 6CN UKVWCQ TGUVQW GZRTGUUCOGPVG EQPUKIPCFC PC TGEGPVG 5OWNC P  FQ 56, 2TGUWOGUG FKUUQNXKFC
irregularmente a empresa que deixar de funcionar no seu domiclio fiscal, sem comunicao aos rgos competentes,
NGIKVKOCPFQQTGFKTGEKQPCOGPVQFCGZGEWQHKUECNRCTCQUEKQIGTGPVG.

90

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

Dissoluo irregular e responsabilidade tributria dos gestores de sociedades empresrias

o que dispem os arts. 1.150 e 1.151 do CC e 32 da Lei n. 8.934, de 18 de novembro


de 1994:
Art. 1.150. O empresrio e a sociedade empresria vinculam-se ao Registro
Pblico de Empresas Mercantis a cargo das Juntas Comerciais, e a sociedade
simples ao Registro Civil das Pessoas Jurdicas, o qual dever obedecer s
PQTOCU ZCFCU RCTC CSWGNG TGIKUVTQ UG C UQEKGFCFG UKORNGU CFQVCT WO FQU
tipos de sociedade empresria.
Art. 1.151. O registro dos atos sujeitos formalidade exigida no artigo
antecedente ser requerido pela pessoa obrigada em lei, e, no caso de omisso
ou demora, pelo scio ou qualquer interessado.
ho Os documentos necessrios ao registro devero ser apresentados no prazo
de trinta dias, contados da lavratura dos atos respectivos.
h o Requerido alm do prazo previsto neste artigo, o registro somente
produzir efeito a partir da data de sua concesso.
ho As pessoas obrigadas a requerer o registro respondero por perdas e danos,
em caso de omisso ou demora.
Art. 32. O registro compreende:
I a matrcula e seu cancelamento: dos leiloeiros, tradutores pblicos e
KPVTRTGVGUEQOGTEKCKUVTCRKEJGKTQUGCFOKPKUVTCFQTGUFGCTOC\PUIGTCKU
II O arquivamento:
C FQUFQEWOGPVQUTGNCVKXQUEQPUVKVWKQCNVGTCQFKUUQNWQGGZVKPQ
FGTOCUOGTECPVKUKPFKXKFWCKUUQEKGFCFGUOGTECPVKUGEQQRGTCVKXCU
b) dos atos relativos a consrcio e grupo de sociedade de que trata a Lei
noFGFGFG\GODTQFG
c) dos atos concernentes a empresas mercantis estrangeiras autorizadas
CHWPEKQPCTPQ$TCUKN
F FCUFGENCTCGUFGOKETQGORTGUC
G FGCVQUQWFQEWOGPVQUSWGRQTFGVGTOKPCQNGICNUGLCOCVTKDWFQU
CQ 4GIKUVTQ 2DNKEQ FG 'ORTGUCU /GTECPVKU G #VKXKFCFGU #PU QW
FCSWGNGUSWGRQUUCOKPVGTGUUCTCQGORTGUTKQGUGORTGUCUOGTECPVKU
+++CCWVGPVKECQFQUKPUVTWOGPVQUFGGUETKVWTCQFCUGORTGUCUOGTECPVKU
registradas e dos agentes auxiliares do comrcio, na forma de lei prpria.

$CUVCWOCEGTVKFQFQQEKCNFG,WUVKCCVGUVCPFQSWGCUQEKGFCFGPQHQKGPEQPVTCFC
PQGPFGTGQFGENCTCFQCQ(KUEQRCTCSWGUGGUVCDGNGCWOKPFEKQFGFKUUQNWQ
KTTGIWNCT#NOFGUUCJKRVGUGRQUUXGNECTCEVGTK\CTCFKUUQNWQKTTGIWNCTRQT
outros meios, como, por exemplo:

K KPHQTOCGU FC ,WUVKC FQ 6TCDCNJQ FG SWG C RGUUQC LWTFKEC PQ RCIC QU
GORTGICFQU

KK SWCPFQCRGUUQCLWTFKECHQKFGENCTCFCKPCRVC

KKK SWCPFQJKPHQTOCQPQ5KUVGOC+PVGITCFQFG+PHQTOCGUUQDTG1RGTCGU
+PVGTGUVCFWCKU EQO /GTECFQTKCU G 5GTXKQU
5KPVGITC  FG SWG C GORTGUC GUV
KPCVKXCG
Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

91

Alisson Fabiano Estrela Bonfim

KX CWUPEKCFGFGENCTCQFQKORQUVQFGTGPFCQWCRTGUGPVCQFGUVCPCUKVWCQ
de inativa.
Em todos esses casos, depreende-se que a empresa, no obstante formalmente
existente, deixou de exercer as atividades para as quais foi constituda e no procedeu
UHQTOCNKFCFGUNGICKUPGEGUUTKCURCTCUWCTGIWNCTFKUUQNWQ

3 DISSOLUO IRREGULAR E
RESPONSABILIDADE TRIBUTRIA
H tempos a jurisprudncia dos tribunais ptrios, em especial do STJ, vem admitindo
C RQUUKDKNKFCFG FG TGURQPUCDKNK\CQ FG UEKQU G CFOKPKUVTCFQTGU FG UQEKGFCFGU
GORTGUTKCUPCJKRVGUGFGFKUUQNWQKTTGIWNCTEQOHWPFCOGPVQPQCTV+++
do CTN, conforme se depreende dos arestos adiante colacionados:
':'%71(+5%#.+%/'/$#4)1551%+'&#&'2143716#5
RESPONSABILIDADE DO SCIO-GERENTE. O SCIO-GERENTE,
DE ACORDO COM O ART. 135, DO CTN, E RESPONSVEL
PELAS OBRIGAES TRIBUTRIAS RESULTANTES DE ATOS
PRATICADOS COM INFRAO DA LEI, CONSIDERANDO-SE
COMO TAL A DISSOLUO IRREGULAR DA SOCIEDADE, SEM
O PAGAMENTO DOS IMPOSTOS DEVIDOS. RECURSO PROVIDO.
(RESP. 199100014400, ILMAR GALVO, STJ SEGUNDA TURMA, DJ
DATA: 29/04/1991 PG: 05258.)
64+$764+1 ':'%71 (+5%#. 51%+'&#&' 214 %16#5
DE RESPONSABILIDADE LIMITADA. SCIO-GERENTE.
RESPONSABILIDADE TRIBUTRIA. I A JURISPRUDNCIA DE
NOSSOS TRIBUNAIS E COPIOSA NO SENTIDO DE QUE CONSTITUI
INFRAO DA LEI, COM CONSEQUENTE RESPONSABILIDADE
DO SCIO-GERENTE PELOS DBITOS FISCAIS DA EMPRESA,
COMO DEVEDOR SUBSTITUTO, A DISSOLUO IRREGULAR
DA SOCIEDADE, MEDIANTE O DESAPARECIMENTO DA FIRMA
QUE FIZERA PARTE. PRECEDENTES. II RECURSO CONHECIDO
E PROVIDO.
(RESP. 199200053653, JOS DE JESUS FILHO, STJ SEGUNDA TURMA,
DJ DATA: 14/03/1994 PG: 04494.)

A ratio decidendiFGUUGULWNICFQUTGUKFGPQHCVQFGCNGIKUNCQGZKIKTFQUIGUVQTGUFG
GORTGUCUCOCPWVGPQFQUECFCUVTQUGORTGUCTKCKUCVWCNK\CFQUKPENWKPFQUGCQUCVQU
TGNCVKXQUOWFCPCFGGPFGTGQFQUGUVCDGNGEKOGPVQUGQUTGHGTGPVGUFKUUQNWQ
da sociedade, de tal sorte que o descumprimento desse dever pelos scios-gerentes
GRGNQUCFOKPKUVTCFQTGUEQTTGURQPFGKPHTCQFCNGKGRQTVCPVQTGURQPUCDKNKFCFG
tributria nos termos do art. 135, III, do CTN.

92

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

Dissoluo irregular e responsabilidade tributria dos gestores de sociedades empresrias

'UUG GPVGPFKOGPVQ HQK OCPVKFQ CQ NQPIQ FQU CPQU EQO CNIWOCU XCTKCGU RQT
CSWGNC%QTVG5WRGTKQTTGUVCPFQRCEKECFQRQTUWC2TKOGKTC5GQRQTQECUKQFQ
julgamento dos Embargos de Divergncia no Recurso Especial n. 716.412/PR, cuja
ementa a seguir reproduzimos:
TRIBUTRIO. NO LOCALIZAO DA EMPRESA. DISSOLUO
IRREGULAR. RESPONSABILIDADE DO GESTOR. ART. 135, III,
DO CTN.
1. Hiptese em que o Tribunal a quo decidiu pela responsabilidade dos
UEKQUIGTGPVGU TGEQPJGEGPFQ GZKUVKTGO KPFEKQU EQPETGVQU FG FKUUQNWQ
irregular da sociedade por impossibilidade de se localizar a sede da empresa,
estabelecimento encontrado fechado e desativado, etc..
&KUUFKQGPVTGQCETFQGODCTICFQ
UGIWPFQQSWCNCPQNQECNK\CQFQ
GUVCDGNGEKOGPVQPQUGPFGTGQUEQPUVCPVGUFQUTGIKUVTQUGORTGUCTKCNGUECN
PQRGTOKVGCTGURQPUCDKNKFCFGVTKDWVTKCFQIGUVQTRQTFKUUQNWQKTTGIWNCTFC
sociedade) e precedentes da Segunda Turma (que decidiu pela responsabilidade
GOKFPVKECUKVWCQ 
3. O scio-gerente que deixa de manter atualizados os registros empresariais
GEQOGTEKCKUGOGURGEKCNSWCPVQNQECNK\CQFCGORTGUCGUWCFKUUQNWQ
viola a lei (arts. 1.150 e 1.151, do CC, e arts. 1o, 2o, e 32, da Lei n. 8.934/1994,
GPVTGQWVTQU #PQNQECNK\CQFCGORTGUCGOVCKUJKRVGUGUIGTCNGIVKOC
RTGUWPQiuris tantumFGFKUUQNWQKTTGIWNCTGRQTVCPVQTGURQPUCDKNKFCFGFQ
gestor, nos termos do art. 135, III, do CTN, ressalvado o direito de contradita
GO'ODCTIQU'ZGEWQ
4. Embargos de Divergncia providos.

'4'UR244GN/KPKUVTQ*GTOCP$GPLCOKP2TKOGKTC5GQLWNICFQ
em 12/09/2007, DJe 22/09/2008.)

Conforme asseverado pelo ministro Herman Benjamin, em seu voto condutor:


2CTGEGKPFKUEWVXGNSWGCFKUUQNWQKTTGIWNCTFCGORTGUCUGFGZCVCOGPVGPCU
hipteses em que o gerente deixa de cumprir as formalidades legais exigidas
RCTCQECUQFGGZVKPQFQGORTGGPFKOGPVQGOGURGEKCNCSWGNCUCVKPGPVGUCQ
registro empresarial.
&GHCVQQDTKICQFQUEKQIGTGPVGOCPVGTCVWCNK\CFQUQUTGIKUVTQUTGNCVKXQU
sua empresa, nos termos dos artigos 1.150 e 1.151 do Cdigo Civil:
[...]
Neste sentido, a Lei dos Registros Mercantis (Lei n. 8.934/1994) exige a
OCPWVGPQFQUFCFQUECFCUVTCKUFCUGORTGUCUKPENWKPFQUWCNQECNK\CQ
[...]
Assim, nos termos da lei, os gestores das empresas devem manter atualizados
QUECFCUVTQUGORTGUCTKCKUKPENWKPFQQUCVQUTGNCVKXQUOWFCPCFGGPFGTGQ
FQUGUVCDGNGEKOGPVQUGGURGEKCNOGPVGTGHGTGPVGUFKUUQNWQFCUQEKGFCFG
O descumprimento desses encargos por parte dos scios-gerentes corresponde,
KTTGOGFKCXGNOGPVGKPHTCQFCNGKGRQTVCPVQTGURQPUCDKNKFCFGVTKDWVTKC
nos termos do art. 135, III, do CTN.

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

93

Alisson Fabiano Estrela Bonfim

4GEGPVGOGPVGQ56,TCVKEQWVCNRQUKEKQPCOGPVQCQGFKVCTC5OWNCPSWG
assim dispe:
Presume-se dissolvida irregularmente a empresa que deixar de funcionar no
UGWFQOKENKQUECNUGOEQOWPKECQCQUTIQUEQORGVGPVGUNGIKVKOCPFQ
QTGFKTGEKQPCOGPVQFCGZGEWQUECNRCTCQUEKQIGTGPVG

5OWNC2TKOGKTC5GQLWNICFQGO&,G

'QHG\PQXCOGPVGSWCPFQFCCRTGEKCQFQLWNICOGPVQFQ#ITCXQ4GIKOGPVCNPQ
Agravo de Instrumento n. 1.265.124/SP, cujo acrdo recebeu a seguinte ementa:
241%'557#. %+8+. ' 64+$764+1 ':'%71 (+5%#.
&+551.71+44')7.#44'&+4'%+10#/'061&#':'%71
PARA O SCIO-GERENTE. MATRIA FTICO-PROBATRIA.
SMULA N. 07/STJ. ARTIGO 543-C, DO CPC. RESOLUO STJ
8/2008. ARTIGO 557, DO CPC. APLICAO.
1TGFKTGEKQPCOGPVQFCGZGEWQUECNGUGWUEQPUGEVTKQUNGICKURCTCQ
scio-gerente da empresa, somente cabvel quando reste demonstrado
SWGGUVGCIKWEQOGZEGUUQFGRQFGTGUKPHTCQNGKQWEQPVTCQGUVCVWVQ
QWPCJKRVGUGFGFKUUQNWQKTTGIWNCTFCGORTGUC2TGEGFGPVGU4'52P
5%FGUVGTGNCVQT&,FG4'URP/)&,FG
4'URP45&,FG'4'URP
45&,FGG#I4IPQU'4'URP/)FGUVGTGNCVQT
DJ de 25/10/2004.
2. In casuEQPUVCFCEGTVKFQFQ1EKCNFG,WUVKC
 NGPEQPVTGKWO
imvel abandonado, parcialmente demolido. Indagando no vizinho [...] a
mim declarou que a requerida havia se mudado e que desconhecia onde
a mesma se encontrava, motivo pelo qual deixei de cit-la. Em parecer
RTQHGTKFQ RGNC 2TQEWTCFQTKC 'UVCFWCN EQPUVC
U  G  FQ G56, 
A executada foi dissolvida de forma irregular, encerrou suas atividades
sem proceder baixa nos rgos competentes, deixando em aberto dbitos
RCTCEQOQGUVCFQEQPHQTOGEGTVKFQFQ5T1EKCNFG,WUVKC
3. Nada obstante, a jurisprudncia do STJ consolidou o entendimento de
SWGCEGTVKFQGOKVKFCRGNQ1EKCNFG,WUVKCCVGUVCPFQSWGCGORTGUC
FGXGFQTC PQ OCKU HWPEKQPC PQ GPFGTGQ EQPUVCPVG FQU CUUGPVCOGPVQU
FC ,WPVC %QOGTEKCN  KPFEKQ FG FKUUQNWQ KTTGIWNCT CRVQ C GPUGLCT Q
TGFKTGEKQPCOGPVQ FC GZGEWQ RCTC Q UEKQIGTGPVG C GUVG EQORGVKPFQ
se for de sua vontade, comprovar no ter agido com dolo, culpa, fraude
QWGZEGUUQFGRQFGTQWCKPFCPQVGTJCXKFQCFKUUQNWQKTTGIWNCTFC
empresa (Precedentes: REsp. 953.956/PR, Rel. Ministro Mauro Campbell
/CTSWGU5GIWPFC6WTOCLWNICFQGO&,G#I4I
no REsp. 672.346/PR, Rel. Ministro Humberto Martins, Segunda Turma,
LWNICFQGO&,G4'UR454GN/KPKUVTQ
(TCPEKUEQ(CNEQ2TKOGKTC6WTOCLWNICFQGO&,
e AgRg no Ag 752.956/BA, Rel. Ministra Denise Arruda, Primeira Turma,
julgado em 05/12/2006, DJ 18/12/2006).
&GUVCUQTVGCEQIPKQCEGTECFCQEQTTPEKCQWPQFCFKUUQNWQKTTGIWNCT
QWFGKPHTCQNGKQWGUVCVWVQRGNQUCNWFKFQUUEKQUKORQTVCPQTGGZCOG
94

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

Dissoluo irregular e responsabilidade tributria dos gestores de sociedades empresrias

do conjunto ftico-probatrio da causa, o que no se admite em sede de


recurso especial (Smula n. 07/STJ).
#RNKECQFQGPVGPFKOGPVQUGFKOGPVCFQPC5OWNCPFQ56,in verbis:
0QUGEQPJGEGFQTGEWTUQGURGEKCNRGNCFKXGTIPEKCSWCPFQCQTKGPVCQ
FQVTKDWPCNUGTOQWPQOGUOQUGPVKFQFCFGEKUQTGEQTTKFC
6. luz da novel metodologia legal, publicado o acrdo do julgamento do
recurso especial, submetido ao regime previsto no artigo 543-C, do CPC,
os demais recursos j distribudos, fundados em idntica controvrsia,
devero ser julgados pelo relator, nos termos do artigo 557, do CPC (artigo
5o, I, da Res. STJ 8/2008).
7. Agravo regimental desprovido.
(AgRg no Ag 1265124/SP, Rel. Ministro Luiz Fux, Primeira Turma, julgado
em 11/05/2010, DJe 25/05/2010.)

8UGRQTVCPVQSWGPQODKVQLWTKURTWFGPEKCNRCEEQSWGCFKUUQNWQKTTGIWNCT
FCUQEKGFCFGECTCEVGTK\CCVQKNEKVQCRVQCGPUGLCTCTGURQPUCDKNK\CQFQUUEKQU
IGTGPVGUGFQUCFOKPKUVTCFQTGUGSWGCEGTVKFQFQQEKCNFG,WUVKCCVGUVCPFQSWG
CUQEKGFCFGPQHQKGPEQPVTCFCPQGPFGTGQFGENCTCFQCQ(KUEQRTQXCKPEKFKTKC
FGFKUUQNWQKTTGIWNCTGUVCDGNGEGPFQWOCRTGUWPQjuris tantum em favor do ente
tributante. No campo doutrinrio, porm, no h consenso.
/CEJCFQFGHGPFGSWGCNKSWKFCQKTTGIWNCTFCUQEKGFCFGGORTGUTKCIGTCCRTGUWPQ
FCRTVKECFGCVQUCDWUKXQUQWKNGICKUCRVQUCIGTCTCTGURQPUCDKNK\CQFQUUGWU
IGUVQTGU'KUUWCNKQ
Em concluso, a questo em exame pode ser assim resumida: (a) os
scios-gerentes, diretores e administradores de sociedades por quotas de
responsabilidade limitada, ou annimas, em princpio no so pessoalmente
TGURQPUXGKU RGNCU FXKFCU VTKDWVTKCU FGUVCU
D  GO UG VTCVCPFQ FG +2+ QW
FGKORQUVQFGTGPFCTGVKFQPCHQPVGJCXGTVCNTGURQPUCDKNKFCFGRQTHQTC
FCFKURQUKQGZRTGUUCFQ&GETGVQ.GKP
E TGNCVKXCOGPVGCQU
demais tributos, a responsabilidade em questo s existir quando a pessoa
LWTFKECVGPJCECFQUGOEQPFKGUGEQPOKECURCTCTGURQPFGTRGNCFXKFCGO
FGEQTTPEKCFGCVQURTCVKECFQUEQOGZEGUUQFGRQFGTGUQWXKQNCQFCNGKFQ
EQPVTCVQQWFQGUVCVWVQ
F CNKSWKFCQKTTGIWNCTFCUQEKGFCFGIGTCCRTGUWPQ
da prtica desses atos abusivos ou ilegais (MACHADO, 2005, p. 169 destaque
no original).

0COGUOCNKPJC%QNJQ
R CUUGXGTCSWGCFKUUQNWQQWQFGUHC\KOGPVQ
de fato da sociedade, v.g.KPHTCQFQNQUC#RTQRQUKVCFCCTGURQPUCDKNKFCFGFQU
scios.
Em sentido contrrio, porm, Bodnar (2005, p. 130-131) entende que no existe
RTGXKUQ NGICN FG CVTKDWKQ FKTGVC FG TGURQPUCDKNKFCFG CRGPCU RGNC FKUUQNWQ
KTTGIWNCT &G CEQTFQ EQO UWCU NKGU =? C UKORNGU FKUUQNWQ KTTGIWNCT PQ
ECTCEVGTK\CCVQCDWUKXQSWCPFQPQFGOQPUVTCFCCRTGUGPCFQURTGUUWRQUVQURCTC
Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

95

Alisson Fabiano Estrela Bonfim

TGURQPUCDKNK\CQ GURGEKCNOGPVG Q PGZQ FG ECWUCNKFCFG GPVTG Q HCVQ


FKUUQNWQ
irregular) e o dano (inadimplemento tributrio). o que tambm defende Bim
(2001, p. 119-144):
2TGUWOKTSWGEQOCFKUUQNWQFCUQEKGFCFG
HGPOGPQEQPVKPGPVG QEQTTGTKCO
tais requisitos desconhecer o que ordinariamente acontece, impossibilitando,
assim, falar em uma pretensa presuno hominis. Instabilidade econmica,
ECNQVG FQU FGXGFQTGU CWOGPVQ FC ECTIC VTKDWVTKC FGUXCNQTK\CQ ECODKCN
so apenas alguns dos fatores que ilidem o dolo ou a culpa para caracterizar a
TGURQPUCDKNKFCFGVTKDWVTKCFQUCFOKPKUVTCFQTGU+UUQFGUIWTCQUTGSWKUKVQU
RCTCCKPUVKVWKQFGWOCRTGUWPQEQOWOQWTGNCVKXCUGRTGXKUVCGONGKL
que dever haver gravidade, concordncia e preciso no raciocnio que liga o
HCVQEQPJGEKFQCQFGUEQPJGEKFQ5QOCFQCKUUQCFOKVKTUGSWGFCFKUUQNWQ
irregular da sociedade houve dolo ou culpa por parte dos administradores
KPEQPEGDXGNPQ'UVCFQFG&KTGKVQSWGPGUVGJCRTGUWPQFGKPQEPEKC
que no permite que se presuma a culpabilidade de algum. Faz-se mister
FGOQPUVTNCQWUGLCRTQXCTPQOPKOQSWGJQWXGCVQUFCCFOKPKUVTCQ
que distraram o patrimnio do credor em prejuzo do Fisco e que eles
FGEQTTGTCOFGWOCXKQNCQFQFGXGTFGFKNKIPEKCSWGPQTVGKCCIGTPEKCFG
qualquer sociedade.
&GUVGOQFQRGNQUOQVKXQUUWRTCGZRQUVQUECTCEVGTK\CTCFKUUQNWQKTTGIWNCT
FCUQEKGFCFGEQOQECWUCUWEKGPVGFCTGURQPUCDKNKFCFGVTKDWVTKCFGVGTEGKTQU
inconstitucional e ilegal.

%QOCFGXKFCXPKCCQUSWGCFXQICOSWGCFKUUQNWQKTTGIWNCTPQCECTTGVCTKCC
responsabilidade tributria dos scios-gerentes e dos administradores porque tal
fato pode decorrer de uma srie de razes que no lhes poderiam ser imputadas,
pensamos que a tese no se sustenta.
De fato, o exerccio da atividade econmica envolve vrios riscos, tais como
instabilidade econmica, calote dos devedores, aumento da carga tributria,
FGUXCNQTK\CQ ECODKCN EQOQ GZGORNKECFQU RQT $KO
 R   que
podem, eventualmente, culminar no insucesso do empreendimento e no consequente
encerramento das atividades da empresa.
%QPVWFQCTGURQPUCDKNK\CQFQUUEKQUPQCFXOFCOGTCGZVKPQFCGORTGUC
mas da conduta dos scios e dos administradores que optaram em simplesmente
fechar as portas do estabelecimento e dar as costas aos seus credores, ao invs de
TGCNK\CTGOCNKSWKFCQFCUQEKGFCFGGOEQPUQPPEKCEQOQUFKVCOGUNGICKUQWCV
mesmo de postular a autofalncia, se fosse o caso.
6CODOPQUGPVKFQFCKORQUUKDKNKFCFG2CWNUGPUWUVGPVCSWGCJKRVGUGFGFKUUQNWQ
irregular no se enquadra na previso constante do art. 135 do CTN, na medida em
SWGPQHCVQIGTCFQTFGVTKDWVQCNIWOKUVQFCFKUUQNWQPQFGEQTTGQDTKICQ
VTKDWVTKCPQXCWOCXG\SWGPQTOCNOGPVGUGXGTKECRQUVGTKQTOGPVGCQUHCVQU
IGTCFQTGUSWGKORNKECTCOQUWTIKOGPVQFQUETFKVQUGZKIKFQUPCGZGEWQUECN
96

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

Dissoluo irregular e responsabilidade tributria dos gestores de sociedades empresrias

Nas suas palavras:


&WTCPVGOWKVQVGORQCFKUUQNWQKTTGIWNCTHQKCRQPVCFCFGOQFQWPUUQPQ
EQOQ C JKRVGUG OCKU ECTCEVGTUVKEC FC TGURQPUCDKNK\CQ FQU UEKQU EQO
HWPFCOGPVQPQCTV+++FQ%60156,VGORTGEGFGPVGUTGCTOCPFQSWG
CFKUUQNWQKTTGIWNCTEQPIWTCCTGURQPUCDKNKFCFGGPQUGPVKFQSWGKPXGTVGQ
PWUFCRTQXC/CUCJKRVGUGFGFKUUQNWQKTTGIWNCTCTKIQTPQUGGPSWCFTC
na previso constante do art. 135 do CTN. Isso porque no fato gerador de
VTKDWVQCNIWOFCFKUUQNWQRTQRTKCOGPVGPQFGEQTTGQDTKICQVTKDWVTKC
PQXC # FKUUQNWQ KTTGIWNCT  XKC FG TGITC RQUVGTKQT CQU HCVQU IGTCFQTGU
SWGKORNKECTCOQUWTIKOGPVQFQUETFKVQUGZKIKFQUPCGZGEWQUECN=?
1%60PQGUVCDGNGEGUQNKFCTKGFCFGRGNCUFXKFCUUECKUPGUVGECUQGC.%
GUVCDGNGEGCTGURQPUCDKNKFCFGUQNKFTKCFQUEKQCRGPCUPCUKVWCQ
de microempresa e empresa de pequeno porte baixada sem o pagamento dos
tributos devidos (PAULSEN, 2011, p. 1021-1022).

Esse nos parece ser o argumento mais forte no sentido da impossibilidade de se atribuir
responsabilidade tributria aos gestores de sociedades empresrias. Realmente, o
caput do art. 135 do CTN preconiza que so pessoalmente responsveis pelos
crditos correspondentes a obrigaes tributrias resultantes de atos praticados com
GZEGUUQFGRQFGTGUQWKPHTCQFGNGKEQPVTCVQUQEKCNQWGUVCVWVQUFCPFQCGPVGPFGT
SWGCFXKFCUECNFGXGTKCPGEGUUCTKCOGPVGCFXKTFGCVQURTCVKECFQUEQOGZEGUUQFG
RQFGTGUQWKPHTCQFGNGKEQPVTCVQUQEKCNQWGUVCVWVQU
'UUGTCEKQEPKQEGTVCOGPVGKPXKCDKNK\CTKCCTGURQPUCDKNK\CQFGIGUVQTGUFGGORTGUCU
RQKUEQOQCRQPVCFQRQT2CWNUGPCFKUUQNWQKTTGIWNCTPQHCVQIGTCFQTFGVTKDWVQ
algum, e, em regra, levada a efeito em momento posterior aos fatos geradores
SWGKORNKECTCOQUWTIKOGPVQFQUETFKVQUGZKIKFQUPCGZGEWQUECNPQVGPFQ
Q EQPFQ FG HC\GT PCUEGT QDTKICQ VTKDWVTKC PQXC 0QVGUG RQTO SWG GUUG
entendimento levaria concluso, a contrario sensuFGSWGCFKUUQNWQKTTGIWNCTFC
UQEKGFCFGGORTGUTKCUQOGPVGLWUVKECTKCCTGURQPUCDKNK\CQFGUGWUIGUVQTGUUGFGNC
UWTIKUUGWOCQDTKICQVTKDWVTKCPQXCQSWGCECTTGVCTKCCKPGZQTXGNEQPUVCVCQ
de que o tributo, no caso, seria originrio de um ato ilcito.
Sucede, porm, que o art. 3o do CTN claro e expresso ao consignar que o tributo
VQFCRTGUVCQRGEWPKTKCEQORWNUTKCGOOQGFCQWEWLQXCNQTPGNCUGRQUUC
exprimir, que no constitua sano de ato ilcito, instituda em lei e cobrada mediante
atividade administrativa plenamente vinculada. Ora, se o tributo no pode ser
FGEQTTPEKC FG WOC UCPQ RQT CVQ KNEKVQ EQOQ RTGVGPFGT CVTGNCT C FKUUQNWQ
KTTGIWNCT
CVQKNEKVQ CQUWTIKOGPVQFGQDTKICQVTKDWVTKCPQXCRCTCUQOGPVGCUUKO
RQUUKDKNKVCTCTGURQPUCDKNK\CQFGUEKQUGCFOKPKUVTCFQTGU!
#NOFCKORTQRTKGFCFGGZRQUVCVCNRQUKQNGXCTKCCGZENWKTUGCTGURQPUCDKNKFCFG
toda vez que os atos irregulares, violadores da lei ou do estatuto, fossem posteriores
QEQTTPEKCFQHCVQIGTCFQTFQVTKDWVQQSWGKORNKECTKCKPLWUVKEXGNTGFWQPQ
alcance da regra jurdica em estudo.
Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

97

Alisson Fabiano Estrela Bonfim

Explicitadas as principais correntes doutrinrias, cumpre-nos agora responder,


GHGVKXCOGPVGUGECDXGNCTGURQPUCDKNK\CQFQUUEKQUIGTGPVGUGFQUCFOKPKUVTCFQTGU
FGUQEKGFCFGUGORTGUCTKCKUGOFGEQTTPEKCFCFKUUQNWQKTTGIWNCTGECUQCTOCVKXQ
em qual dispositivo legal se enquadraria tal responsabilidade tributria. Entendemos
SWGCFKUUQNWQKTTGIWNCTRQFGUKOCECTTGVCTCTGURQPUCDKNKFCFGVTKDWVTKCFGUEKQU
e administradores de empresas.
Seja enquadrada na norma de responsabilidade tributria prevista no art. 134, seja na
GUVCDGNGEKFCPQCTVCFKUUQNWQKTTGIWNCTUQDTGRGUGQDTKICQVTKDWVTKCRCTC
alterando-a no polo passivo, agregar ao contribuinte de origem (a pessoa jurdica) o
responsvel tributrio solidrio (a pessoa fsica dos scios). H aqui a solidariedade
entre o contribuinte e o responsvel (solidariedade em sentido estrito).
Estamos, portanto, em pleno acordo com o entendimento de Assis (2007, p. 157),
segundo o qual:
1GZEGUUQFGRQFGTQWKPHTCQNGKEQPVTCVQQWGUVCVWVQCSWGCNWFGQCTV
 CV RQFG UG HC\GT RTGUGPVG PQ OQOGPVQ KPKEKCN PC QTKIGO FC TGNCQ
jurdica tributria, que todavia exsurge entre a pessoa jurdica e o Fisco e,
somente em momento posterior (quando dado relevo ao excesso de poder ou
KPHTCQ OQFKECFCKPEQTRQTCPFQCQRQNQRCUUKXQFCQDTKICQVTKDWVTKC
o responsvel.
E mais: como o fato ou circunstncia superveniente a acarretar a responsabilidade
RQFGUGTRQUVGTKQTCQUWTIKOGPVQFCQDTKICQVTKDWVTKCCFOKPKUVTCFQTGUG
scios incorporados sociedade podem ser responsabilizados, se derem causa
insolvncia da empresa. O que no pode o inverso, um scio que saiu da
sociedade antes do fato jurdico tributrio ser responsabilizado.

1DUGTXGUGCUUKOSWGPQRGNQHCVQFGCFKUUQNWQKTTGIWNCTQEQTTGTGOITCPFG
parte dos casos, aps a ocorrncia do fato gerador do tributo que os scios e os
administradores estariam isentos de responsabilidade. Sua conduta ilcita no pode
ser desconsiderada pelo ordenamento jurdico, sob pena de se conferir um verdadeiro
salvo conduto aos gestores que simplesmente fecharam as portas do estabelecimento
sem a observncia das formalidades pertinentes, que incluem, dentre outras, o
pagamento dos seus credores.
2GPUCTFGOQFQEQPVTTKQUKIPKECTKCFK\GTCQUIGUVQTGUGORTGUCTKCKU#DTCOC
GORTGUCGGZGTCOPQTOCNOGPVGCUCVKXKFCFGU5GCUQEKGFCFGECTFGXGPFQGPQ
houver como pagar suas dvidas, especialmente as de natureza tributria, fechem as
portas, dividam os bens entre os scios e estar tudo tranquilo. O Fisco no poder
buscar seus bens, porque o encerramento irregular da empresa ocorreu depois do fato
IGTCFQTFQUVTKDWVQUFGXKFQU1DXKCOGPVGKUUQPQGPVTCPCECDGCFGPKPIWO
&GCEQTFQEQO2CWNUGPQEQTTGVQGPSWCFTCOGPVQFCFKUUQNWQKTTGIWNCTEQOQ
ECWUC FG TGURQPUCDKNK\CQ FQU IGUVQTGU FG UQEKGFCFGU GORTGUTKCU TGUKFKTC PQ
art. 50 do CC:
98

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

Dissoluo irregular e responsabilidade tributria dos gestores de sociedades empresrias

# FKUUQNWQ KTTGIWNCT HC\ KUVQ UKO EQO SWG UG RTGUWOC C EQPHWUQ FG
RCVTKOPKQUEQONQEWRNGVCOGPVQFQUUEKQUFCPFQGPUGLQKPXQECQFQ
Cdigo Civil de 2002: Art. 50. Em caso de abuso da personalidade jurdica,
ECTCEVGTK\CFQRGNQFGUXKQFGPCNKFCFGQWRGNCEQPHWUQRCVTKOQPKCNRQFG
o juiz decidir, a requerimento da parte, ou do Ministrio Pblico quando lhe
EQWDGTKPVGTXKTPQRTQEGUUQSWGQUGHGKVQUFGEGTVCUGFGVGTOKPCFCUTGNCGU
FGQDTKICGUUGLCOGUVGPFKFQUCQUDGPURCTVKEWNCTGUFQUCFOKPKUVTCFQTGUQW
scios da pessoa jurdica (PAULSEN, 2011, p. 1022).

No reputamos acertado tal entendimento, pois, como visto, a CF/1988


reservou lei complementar o estabelecimento de normas gerais em matria de
NGIKUNCQ VTKDWVTKC GURGEKCNOGPVG UQDTG C QDTKICQ VTKDWVTKC G EQPVTKDWKPVGU
QSWGGXKFGPVGOGPVGCHCUVCCRQUUKDKNKFCFGFGCVTKDWKQFGTGURQPUCDKNKFCFGRQT
intermdio de lei ordinria.
Nesse sentido, Souza e Funaro (2007, p. 38-64) asseveram:
A reserva de lei complementar impede que a responsabilidade de scios ou
administradores por abuso da personalidade jurdica prevista no Cdigo Civil
UGLCCRNKECFCGOOCVTKCVTKDWVTKC.GKQTFKPTKCPQRQFGVTCVCTFGUWLGKQ
passiva, matria exclusivamente regulada no Cdigo Tributrio Nacional.
'UUCCNKUCTC\QSWGLWUVKEQWCTGXQICQFQCTVFQ%FKIQ%KXKNSWG
FKURWPJCUQDTGCEQORGPUCQFGFXKFCUUECKUGRCTCUECKU

Relembramos, por oportuno, que a inconstitucionalidade formal, por estabelecimento


de responsabilidade tributria por meio de lei ordinria, foi justamente um dos
fundamentos utilizados pelo STF para fulminar o art. 13 da Lei n. 8.620/1993,
SWCPFQFCCRTGEKCQFQ4GEWTUQ'ZVTCQTFKPTKQP
#UUKU
R RQTUWCXG\CFW\SWGCFKUUQNWQKTTGIWNCTUGGPSWCFTCTKC
nos arts. 134 ou 135 do CTN, a depender da anlise do caso concreto, para que se
perquira se o terceiro agiu com culpa ou dolo:
%QOQ C EWNRC QW Q FQNQ FGXG UGT EQORTQXCFQ ECTGEG WOC KPVGTRTGVCQ
ECUWUVKEC#UQNWQXCKFGRGPFGTFGECFCUKVWCQGOEQPETGVQ#UUKOUG
por um lado certo que o simples inadimplemento de tributo se constitui
KPHTCQFGNGKUQOGPVGCCPNKUGFQUHCVQUGEKTEWPUVPEKCUKTFGOQPUVTCTUG
o scio tinha razes ou no para deixar de efetuar o pagamento.
[...]
0CFKUUQNWQKTTGIWNCTFGUQEKGFCFGURQTFGUQDGFKPEKCNGIKUNCQEKXKNG
EQOGTEKCNECDGRGTSWKTKTFCCVWCQFGECFCRGUUQCHUKECGURGEKCNOGPVGRCTC
se a responsabilidade ser com base no art. 134 (se comprovada s culpa) ou
no art. 135 (se existir dolo).

0QVGUGSWGCFKUVKPQVGOTGNGXQPCOGFKFCGOSWGQGPSWCFTCOGPVQPQCTV
TGUVTKPIGCTGURQPUCDKNK\CQQDTKICQVTKDWVTKCRTKPEKRCNGCNKOKVCCQOQPVCPVG
FQXCNQTFQVTKDWVQCETGUEKFQFGLWTQUGOWNVCFGOQTCGPSWCPVQCCRNKECQFQ
Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

99

Alisson Fabiano Estrela Bonfim

art. 135 acarreta a responsabilidade tambm pelas penalidades por descumprimento


FCQDTKICQCEGUUTKCGRGNCOWNVCFGQHEKQ
0QQDUVCPVGCRGTEWEKPEKCFCNKQGZRQUVCEQORTGGPFGOQUSWGCTGURQPUCDKNK\CQ
FQUIGUVQTGUFGUQEKGFCFGUGORTGUTKCUGOFGEQTTPEKCFGFKUUQNWQKTTGIWNCTGPEQPVTC
fundamento no art. 135, III, do CTN, consoante se vem aplicando a jurisprudncia
FQUVTKDWPCKURVTKQU+UUQRQTSWGPQEQPEGDGOQUCFKUUQNWQKTTGIWNCTEWNRQUCFG
uma empresa. Pode ocorrer, isto sim e frequentemente ocorre , que os gestores,
RQTSWCNSWGTOQVKXQ
FGUEQPJGEKOGPVQFCNGIKUNCQOCWCUUGUUQTCOGPVQLWTFKEQ
EQPVDKNGVE PQVGPJCOCGZCVCPQQFCUEQPUGSWPEKCUCFXKPFCUFCFKUUQNWQ
irregular da empresa, o que, porm, no os exime de responsabilidade, tendo em
vista que ningum se escusa de cumprir a lei, alegando que no a conhece (DecretoLei n. 4.657, de 4 de setembro de 1942, art. 3o).
Com efeito, o fechamento da sociedade empresria sem o cumprimento dos
TGSWKUKVQUNGICKUFGEQTTGPGEGUUCTKCOGPVGFGWOCFGNKDGTCQFGUGWUIGUVQTGUPGUUG
sentido. H, evidentemente, um momento em que os scios e/ou administradores
se renem e decidem fechar as portas. Perceba-se, portanto, a existncia do dolo,
SWGRQFGUGTGURGEEQSWCPFQUGVGOQKPVGPVQFGGPEGTTCTCUCVKXKFCFGUGFKUUKRCT
QUDGPUUQEKCKUUGOUCNFCTCUQDTKICGURGPFGPVGUKPENWUKXGUECKUQWGXGPVWCN
quando, embora no haja tal objetivo, os gestores assumem, com sua conduta, os
riscos de produzi-lo.
#FXKTVCUGRQTOSWGGUUGGPVGPFKOGPVQPQKORNKECCVTKDWKQFGTGURQPUCDKNKFCFG
objetiva ou de culpa presumida dos gestores empresariais, que podero perfeitamente
UG FGHGPFGT PQ EWTUQ FQ RTQEGUUQ FG GZGEWQ UECN RQT OGKQ FQU EQORGVGPVGU
embargos, nos termos do art. 16 da LEF, provando que no concorreram para a
FKUUQNWQKTTGIWNCTFCUQEKGFCFG

4 A IDENTIFICAO DOS GESTORES QUE PODEM SER


CHAMADOS A RESPONDER PELO DBITO FISCAL
DA EMPRESA IRREGULARMENTE DISSOLVIDA
No que concerne s microempresas e s empresas de pequeno porte, no h dvidas,
RQKU Q h o do art. 9o da LC n. 123, 14 de dezembro de 2006, preconiza que a
responsabilidade tributria deve ser atribuda aos scios da poca do fato gerador:
Art. 9o1TGIKUVTQFQUCVQUEQPUVKVWVKXQUFGUWCUCNVGTCGUGGZVKPGU
DCKZCU 
referentes a empresrios e pessoas jurdicas em qualquer rgo envolvido no
registro empresarial e na abertura da empresa, dos 3 (trs) mbitos de governo,
QEQTTGT KPFGRGPFGPVGOGPVG FC TGIWNCTKFCFG FG QDTKICGU VTKDWVTKCU
previdencirias ou trabalhistas, principais ou acessrias, do empresrio, da
sociedade, dos scios, dos administradores ou de empresas de que participem,
sem prejuzo das responsabilidades do empresrio, dos scios ou dos
CFOKPKUVTCFQTGURQTVCKUQDTKICGUCRWTCFCUCPVGUQWCRUQCVQFGGZVKPQ
100

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

Dissoluo irregular e responsabilidade tributria dos gestores de sociedades empresrias

[...]
h o 0Q ECUQ FG GZKUVPEKC FG QDTKICGU VTKDWVTKCU RTGXKFGPEKTKCU QW
trabalhistas referido no caput deste artigo, o titular, o scio ou o administrador
da microempresa e da empresa de pequeno porte que se encontre sem
movimento h mais de 3 (trs) anos poder solicitar a baixa nos registros
dos rgos pblicos federais, estaduais e municipais independentemente do
pagamento de dbitos tributrios, taxas ou multas devidas pelo atraso na
GPVTGICFCUTGURGEVKXCUFGENCTCGUPGUUGURGTQFQUQDUGTXCFQQFKURQUVQPQU
hho e 5o deste artigo.
[...]
ho#UQNKEKVCQFGDCKZCPCJKRVGUGRTGXKUVCPQho deste artigo importa
responsabilidade solidria dos titulares, dos scios e dos administradores do
perodo de ocorrncia dos respectivos fatos geradores.
[...]

'O TGNCQ U FGOCKU UQEKGFCFGU GORTGUTKCU RQFGO UGT GPWOGTCFCU CQ OGPQU
SWCVTQRQUKGUSWCKUUGLCO
C UQIGUVQTFCRQECFQHCVQIGTCFQTTGURQPFGRGNQUFDKVQU
D UQIGUVQTFCRQECFCFKUUQNWQKTTGIWNCTTGURQPFGRGNQUFDKVQU
E UQIGUVQTSWGQGTCVCPVQRQECFQHCVQIGTCFQTSWCPVQRQECFCFKUUQNWQ
KTTGIWNCTTGURQPFGRGNQUFDKVQU
F VCPVQQIGUVQTFCRQECFQHCVQIGTCFQTSWCPVQQFCRQECFCFKUUQNWQKTTGIWNCT
respondem pelos dbitos, em qualquer caso.
#RTKOGKTCRQUKQUWUVGPVCSWGUQOGPVGTGURQPFGORGNQUFDKVQUUECKUFCGORTGUC
irregularmente dissolvida os scios-gerentes ou os administradores da poca do fato
gerador. Logo, irrelevante o fato de no mais exercerem os poderes de gerncia
RQECFCFKUUQNWQ
Esse foi o posicionamento recentemente adotado pela Segunda Turma do STJ
por ocasio do julgamento do Agravo Regimental no Agravo de Instrumento n.
1.394.554/RJ,3 cujo acrdo recebeu a seguinte ementa:
PROCESSUAL CIVIL E TRIBUTRIO. AUSNCIA DE PREQUESTIONAMENTO. SMULA 282/STF. REDIRECIONAMENTO. ART. 135
DO CTN. VERIFICADA A DISSOLUO IRREGULAR DA EMPRESA.
RESPONSABILIDADE DO SCIO-GERENTE POCA DOS FATOS
GERADORES.
1. Hiptese em que no se conheceu do Recurso Especial quanto matria
(arts. 105 e 123 do CTN e art. 6o h o FC .GK FG +PVTQFWQ CQ %FKIQ
%KXKN SWGPQHQKGURGEKECOGPVGGPHTGPVCFCRGNQ6TKDWPCNFGQTKIGOFCFC
a ausncia de prequestionamento.
Incidncia, por analogia, da Smula 282/STF.
3 Relator ministro Herman Benjamin, julgado em 07/06/2011, DJe 10/06/2011 (destaques nossos).

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

101

Alisson Fabiano Estrela Bonfim

1TGFKTGEKQPCOGPVQFC'ZGEWQ(KUECNRCTCQUEKQIGTGPVGFCGORTGUC
cabvel apenas quando demonstrado que este agiu com excesso de poderes,
KPHTCQ  NGK QW EQPVTC Q GUVCVWVQ QW PQ ECUQ FG FKUUQNWQ KTTGIWNCT FC
GORTGUCPQUGKPENWKPFQQUKORNGUKPCFKORNGOGPVQFGQDTKICGUVTKDWVTKCU
8GTKECFCCFKUUQNWQKTTGIWNCTFCGORTGUCQTGFKTGEKQPCOGPVQFC'ZGEWQ
Fiscal somente possvel contra o scio-gerente da sociedade poca do fato gerador,
o que no ocorre no caso dos autos.
4. Agravo Regimental no provido.

0QVGUGSWGCRQUKQGOGZCOGPFCRQTCVTKDWKTTGURQPUCDKNKFCFGCQIGUVQTRGNQ
UKORNGUKPCFKORNGOGPVQFCQDTKICQVTKDWVTKCRGNCUQEKGFCFGFGUEQPUKFGTCPFQ
SWGQKNEKVQSWGCWVQTK\CCTGURQPUCDKNK\CQCFKUUQNWQKTTGIWNCT
Sucede, porm, que o STJ no admite, como visto, o simples inadimplemento de
QDTKICGUVTKDWVTKCUEQOQEKTEWPUVPEKCCRVCCCECTTGVCTCTGURQPUCDKNKFCFGFQ
gestor, sendo indispensvel, para tanto, que tenha agido com excesso de poderes ou
KPHTCQNGKCQEQPVTCVQUQEKCNQWCQGUVCVWVQFCGORTGUCRQUKQGUUCRCEKECFC
por ocasio do julgamento do Recurso Especial n. 1.101.728/SP, submetido ao
TGIKOGFQCTV%FQ%2%GRQUVGTKQTOGPVGTCVKECFCRGNCGFKQFC5OWNC
n. 430/STJ.
1TCUGQIGUVQTPQEQPEQTTGWFGHQTOCCNIWOCRCTCCFKUUQNWQKTTGIWNCTKUVQ
UGPQGZKUVGWONKCOGGPVTGUWCEQPFWVCGCFKUUQNWQFCGORTGUCTGUVCGXKFGPVG
que sua responsabilidade decorrer do mero inadimplemento tributrio, servindo
CFKUUQNWQCRGPCUEQOQICVKNJQRCTCQTGFKTGEKQPCOGPVQFCGZGEWQUECN
0GUUG UGPVKFQ EQPTCUG Q GZEGTVQ FQ XQVQ EQPFWVQT RTQHGTKFQ RGNQ OKPKUVTQ
Hamilton Carvalhido no julgamento dos Embargos de Divergncia no Agravo de
Instrumento n. 1.105.993/RJ:
Ocorre, porm, que julgando o REsp. n. 1.101.728/SP, tambm submetido ao
regime do artigo 543-C do Cdigo de Processo Civil, da relatoria do Ministro
6GQTK #NDKPQ <CXCUEMK &,G  C 2TKOGKTC 5GQ TGHGTGPFQW Q
posicionamento, j reiteradamente adotado, no sentido de que a simples falta
FGRCICOGPVQFQVTKDWVQPQEQPIWTCRQTUKUPGOGOVGUGEKTEWPUVPEKC
que acarreta a responsabilidade subsidiria do scio, prevista no artigo 135
do Cdigo Tributrio Nacional.
[...]
Desse modo, no constituindo a mera falta de pagamento do tributo fato que
acarreta, por si s, a responsabilidade do scio e restando incontroverso no
CETFQGODCTICFQSWGRQECFCFKUUQNWQKTTGIWNCTFCUQEKGFCFGQQTC
GODCTICPVGPQIWTCXCEQOQUEKQIGTGPVGKPECDXGNQTGFKTGEKQPCOGPVQ
FQGZGEWVKXQUECNEQPVTCGZUEKQVQUQOGPVGRQTSWGGTCIGTGPVGCQVGORQ
FQHCVQIGTCFQTUGGNGLPQQGTCSWCPFQFCFKUUQNWQKTTGIWNCT
que a responsabilidade pessoal do administrador em casos tais no decorre da
ausncia de pagamento do dbito per se, mas da prpria dissoluo irregular, que
no se lhe pode imputar. (destacamos)
102

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

Dissoluo irregular e responsabilidade tributria dos gestores de sociedades empresrias

&GCEQTFQEQOCUGIWPFCRQUKQRQTUGWVWTPQUQOGPVGQIGUVQTFCRQECFC
FKUUQNWQ KTTGIWNCT TGURQPFG RGNQU FDKVQU UECKU FC GORTGUC 0CU RCNCXTCU FG
2CWNUGP
R 5RQFGOUGTTGURQPUCDKNK\CFQURGNCFKUUQNWQKTTGIWNCTQU
IGTGPVGUSWGNJGFGTCOECWUCQWUGLCQUIGTGPVGURQTQECUKQFCRTRTKCFKUUQNWQ
'UUC UQNWQ RCTGEG KOWPG U ETVKECU 5G FG HCVQ Q KNEKVQ SWG CWVQTK\C C
TGURQPUCDKNK\CQFQUUEKQUIGTGPVGUGFQUCFOKPKUVTCFQTGUCFKUUQNWQKTTGIWNCT
PCFC OCKU PCVWTCN G NIKEQ SWG CRGPCU QU SWG Q HQUUGO  RQEC FC FKUUQNWQ
TGURQPFCORGNQUFDKVQUUECKUFCGORTGUC
0QQDUVCPVGCNIKECFQTCEKQEPKQCCFQQKTTGUVTKVCGFGUOGFKFCFGUUCVGQTKC
FCTKCIWCTKFCCWOCHTCWFGEQOWOGPVGQDUGTXCFCGORTQEGUUQULWFKEKCKUFGGZGEWQ
UECNEQPUWDUVCPEKCFCPCWVKNK\CQFGNCTCPLCUQWVGUVCUFGHGTTQKUVQFG
indivduos desprovidos de patrimnio que ingressam nos quadros sociais apenas
RCTCIWTCTEQOQTGURQPUXGKURGNCFKUUQNWQKTTGIWNCTEQOQQDLGVKXQFGHTWUVTCT
os credores, em especial o Fisco, e blindar o patrimnio dos verdadeiros scios da
pessoa jurdica.
2CUUCPFQVGTEGKTCRQUKQVGOQUSWGUQOGPVGQIGUVQTSWGQGTCVCPVQRQEC
FQHCVQIGTCFQTSWCPVQRQECFCFKUUQNWQKTTGIWNCTTGURQPFGRGNQUFDKVQUFC
sociedade empresria. Perceba-se que esse entendimento bem mais restritivo
que os anteriores. No basta que o scio-gerente ou o administrador ostente
VCN EQPFKQ CRGPCU  RQEC FQ HCVQ IGTCFQT VCORQWEQ CRGPCU PQ OQOGPVQ FC
FKUUQNWQKTTGIWNCTKPFKURGPUXGNSWGGUVGLCRTGUGPVGPQUFQKUOQOGPVQU&KVQ
de outro modo: o redirecionamento s possvel quanto ao gestor que promoveu a
FKUUQNWQKTTGIWNCTGEWOWNCVKXCOGPVGVGPJCCFOKPKUVTCFQCUQEKGFCFGSWCPFQFQ
no adimplemento do tributo. Esse posicionamento o que, atualmente, predomina
no STJ, conforme atestam os julgados adiante reproduzidos:
EMBARGOS DE DIVERGNCIA EM AGRAVO DE INSTRUMENTO.
':'%71 (+5%#. 4'&+4'%+10#/'061 #46+)1  &1
CDIGO TRIBUTRIO NACIONAL. DISSOLUO IRREGULAR
DA SOCIEDADE POSTERIOR RETIRADA DO SCIO-GERENTE.
INCABIMENTO.
1.1TGFKTGEKQPCOGPVQFCGZGEWQUECNPCJKRVGUGFGFKUUQNWQKTTGIWNCTFC
sociedade, pressupe a permanncia do scio na administrao da empresa ao
tempo da ocorrncia da dissoluo.
2TGEGFGPVGUFGCODCUCU6WTOCUSWGEQORGOC2TKOGKTC5GQ
3. Embargos de divergncia acolhidos.

'#I 4, 4GN /KPKUVTQ *COKNVQP %CTXCNJKFQ 2TKOGKTC 5GQ


julgado em 13/12/2010, DJe 01/02/2011.) (destacamos)
PROCESSUAL CIVIL. TRIBUTRIO. AGRAVO REGIMENTAL
'/ 4'%7451 '52'%+#. ':'%71 (+5%#. 51%+'&#&'
'/24'54+# ':'%76#&# &+551.8+&# +44')7.#4/'06'
POR PRESUNO. RESPONSABILIZAO DE SCIOS QUE NO
Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

103

Alisson Fabiano Estrela Bonfim

INTEGRAVAM O QUADRO SOCIETRIO POCA DO FATO


GERADOR. IMPOSSIBILIDADE. NECESSIDADE DE COMPROVAO
DOS REQUISITOS DO ART. 135, III, DO CTN.
1. Caso em que se discute a responsabilidade tributria de scios por dvida
UECNEQPUVKVWFCGORQECSWGPQKPVGITCXCOQSWCFTQUQEKGVTKQFCUQEKGFCFG
GORTGUTKC GZGEWVCFC EQPUKFGTCFC RGNQ CETFQ TGEQTTKFQ RQT RTGUWPQ
irregularmente dissolvida.
2. Agravo regimental no qual se sustenta: (i) inaplicabilidade da Smula n. 7 do
56,CQECUQG
KK SWGCFKUUQNWQKTTGIWNCTFCUQEKGFCFGGORTGUTKCGZGEWVCFC
enseja a responsabilidade dos scios, mesmo que venham a integrar o quadro
UQEKGVTKQCRUCEQPUVKVWKQFCFXKFCGZGEWVCFC
3. No caso, o acrdo recorrido no consignou que houve a sucesso
empresarial, mas to somente que duas novas scias foram admitidas no quadro
UQEKCNFCUQEKGFCFGGORTGUTKC0GUUGEQPVGZVQPQJEQOQKPHGTKTXKQNCQ
ao art. 133 do CTN, pois para se chegar concluso de que houve a sucesso
empresarial necessrio seria o reexame do conjunto ftico-probatrio, o que,
em sede de recurso especial, no possvel, luz do entendimento sedimentado
na Smula n. 7 do STJ.
4. 1RGFKFQFGTGFKTGEKQPCOGPVQFCGZGEWQUECNSWCPFQHWPFCFQPCFKUUQNWQ
irregular da sociedade executada, pressupe a permanncia de determinado scio
na administrao da empresa no momento da ocorrncia dessa dissoluo, que
 CPCN Q HCVQ SWG FGUGPECFGKC C TGURQPUCDKNKFCFG RGUUQCN FQ CFOKPKUVTCFQT
Ainda, embora seja necessrio demonstrar quem ocupava o posto de gerente no
momento da dissoluo, necessrio, antes, que aquele responsvel pela dissoluo
tenha sido tambm, simultaneamente, o detentor da gerncia na oportunidade
do vencimento do tributo. que s se dir responsvel o scio que, tendo poderes
para tanto, no pagou o tributo (da exigir-se seja demonstrada a deteno de
IGTPEKCPQOQOGPVQFQXGPEKOGPVQFQFDKVQ GSWGCFGOCKUEQPUEKGPVGOGPVG
optou pela irregular dissoluo da sociedade (por isso, tambm exigvel a prova
FCRGTOCPPEKCPQOQOGPVQFCFKUUQNWQKTTGIWNCT 
'&ENPQU'&ENPQ#I4I
no REsp. 1.009.997/SC, Rel. Ministra Denise Arruda, Primeira Turma, julgado
GO&,G 
5. Agravo regimental no provido.

#I4IPQ4'UR524GN/KPKUVTQ$GPGFKVQ)QPCNXGU2TKOGKTC
Turma, julgado em 17/12/2009, DJe 02/02/2010.) (destaque no original)

%QOQUGPQVCFGVQFCUCURQUKGUGZRQUVCUGUUCUGOFXKFCCSWGOCKUFKEWNVCC
TGURQPUCDKNK\CQFQUIGUVQTGUGORTGUCTKCKU%QOGHGKVQCFKPOKECFCXKFCUQEKGVTKC
muitas vezes faz com que o gestor da poca do fato gerador no seja o mesmo do
OQOGPVQFCFKUUQNWQKTTGIWNCTGXKEGXGTUCRTCVKECOGPVGKPXKCDKNK\CPFQSWCNSWGT
tentativa de incurso no patrimnio dos scios e dos administradores.
0Q HQUUG Q DCUVCPVG Q GPVGPFKOGPVQ GO GZCOG RCFGEG FC OGUOC FGEKPEKC
CRQPVCFCPCRQUKQCPVGTKQTKUVQCRQUUKDKNKFCFGFGCNDGTICTKPOGTCUHTCWFGU
basta que o scio-gerente da poca do fato gerador coloque um laranja em seu lugar
no quadro societrio e encerre as atividades empresariais para que seu patrimnio
seja, ao menos momentaneamente, salvaguardado. At que se desvende e se prove
104

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

Dissoluo irregular e responsabilidade tributria dos gestores de sociedades empresrias

C HTCWFG EQTTGUG Q TKUEQ FG GXCUQ RCVTKOQPKCN EQO C EQPUGSWGPVG HTWUVTCQ


dos credores.
Nas palavras de Lacerda (2010, p. 355):
1TCCTGHGTKFCEQTTGPVGPQUGCIWTCCOCKUCEGTVCFCWOCXG\SWGXGOGO
benefcio daqueles que, responsveis pelo inadimplemento do tributo, na
tentativa de eximir-se do crdito transferem suas quotas, e os scios que as
adquirem, como no detinham essa qualidade no momento do fato gerador,
podem extinguir irregularmente a sociedade sem que lhes seja atribuda
nenhuma responsabilidade.

&GCEQTFQEQOCSWCTVCRQUKQVCPVQQIGUVQTFCRQECFQHCVQIGTCFQTSWCPVQQ
FCRQECFCFKUUQNWQKTTGIWNCTTGURQPFGORGNQUFDKVQUGOSWCNSWGTECUQ6TCVCUG
FGGPVGPFKOGPVQOCKUGZXGNGHCXQTXGNCQUKPVGTGUUGUFQ(KUEQPCOGFKFCGOSWG
NJGRGTOKVGPCJKRVGUGFGFKUUQNWQKTTGIWNCTTGURQPUCDKNK\CTQUUEKQUIGTGPVGUG
os terceiros no scios com poderes de gerncia poca do fato gerador do tributo,
CKPFCSWGPQQHQUUGOSWCPFQFCFKUUQNWQFCGORTGUCGXKEGXGTUC
A ideia subjacente que os scios-gerentes ou terceiros no scios com poderes de
gerncia poca do fato gerador, com sua conduta de no efetuar o pagamento dos
tributos devidos pela empresa, contriburam, de forma decisiva, para o aumento
FGUGWRCUUKXQGEQPUGSWGPVGOGPVGRCTCUWCFKUUQNWQKTTGIWNCT#NOFKUUQPQ
UGRQFGQNXKFCTSWGCUEQPXGPGURCTVKEWNCTGUPQRQFGOUGTQRQUVCU(C\GPFC
Pblica com o escopo de afastar a responsabilidade pelo pagamento de tributo, nos
termos do art. 123 do CTN:4
#TV5CNXQFKURQUKGUFGNGKGOEQPVTTKQCUEQPXGPGURCTVKEWNCTGU
relativas responsabilidade pelo pagamento de tributos, no podem ser
QRQUVCU(C\GPFC2DNKECRCTCOQFKECTCFGPKQNGICNFQUWLGKVQRCUUKXQ
FCUQDTKICGUVTKDWVTKCUEQTTGURQPFGPVGU

Tambm deveriam responder pelo dbito aqueles que, apesar de no integrarem a


GORTGUCSWCPFQFQHCVQIGTCFQTFQVTKDWVQGUVCXCOPCEQPFKQFGUEKQUIGTGPVGU
QWVGTEGKTQUPQUEKQUEQORQFGTGUFGIGTPEKCRQECFCFKUUQNWQKTTGIWNCTVGPFQ
em vista que a conduta ilcita causadora de dano ao errio seria uma s, composta
por pelo menos dois atos: o no pagamento do tributo pelos gestores da poca do
HCVQ IGTCFQT SWG UG TGVKTCTCO FC GORTGUC CPVGU FG UWC FKUUQNWQ KTTGIWNCT G C
postura dos scios-gerentes ou de terceiros no scios com poder de gerncia que
ingressaram na sociedade aps o fato gerador e a extinguiram irregularmente, sendo
certo que se deveria presumir que aqueles que ingressaram na empresa aps o fato
4 No tocante aos dbitos tributrios anteriores cesso das cotas sociais, o ulterior desligamento do executado,
SWGGTCUEKQCQVGORQFQHCVQIGTCFQTPQGZENWKUWCTGURQPUCDKNKFCFGVTKDWVTKCRQTUWEGUUQFGQDTKICGU
desde que verificadas as hipteses do art. 135, III, do CTN, haja vista que as convenes particulares acerca da
responsabilidade tributria no so oponveis Fazenda Pblica (TRF-1a Regio AC 2009.01.99.036573-5/
MG, Rel. Desembargadora Federal Maria do Carmo Cardoso, Oitava Turma, e-DJF1, p. 496 de 23/10/2009).
(destacamos)

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

105

Alisson Fabiano Estrela Bonfim

gerador do tributo tinham conhecimento da existncia, em nome desta, de dbitos


tributrios em aberto e, apesar disso, dissolveram a sociedade irregularmente sem
saldar o passivo tributrio.
Com base nos argumentos explicitados, consubstanciados na Nota PGFN/CDA
n. 1.184/2009 e no Parecer PGFN/CRJ n. 40/2010, a Procuradoria-Geral da
Fazenda Nacional (PGFN) editou a Portaria n. 180, de 25 de fevereiro de 2010,
FKURQPFQ UQDTG C CVWCQ PQ VQECPVG  TGURQPUCDKNK\CQ FG EQFGXGFQTGU EWLQ
art. 2o prescrevia o seguinte:
Art. 2o A incluso do responsvel solidrio na Certido de Dvida Ativa
FC7PKQUQOGPVGQEQTTGTCRUCFGENCTCQHWPFCOGPVCFCFCCWVQTKFCFG
competente da Secretaria da Receita Federal do Brasil (RFB) ou da
Procuradoria-Geral da Fazenda Nacional (PGFN) acerca da ocorrncia de ao
OGPQUWOCFCUSWCVTQUKVWCGUCUGIWKT
+GZEGUUQFGRQFGTGU
++KPHTCQNGK
+++KPHTCQCQEQPVTCVQUQEKCNQWGUVCVWVQ
+8FKUUQNWQKTTGIWNCTFCRGUUQCLWTFKEC
Pargrafo nico. Na hiptese de dissoluo irregular da pessoa jurdica, os sciosgerentes e os terceiros no scios com poderes de gerncia poca da dissoluo,
bem como do fato gerador, devero ser considerados responsveis solidrios.

# RCTVKT FGUUC RQTVCTKC CQ UG FGRCTCTGO EQO GZGEWGU UECKU EQO KPFEKQU FG
FKUUQNWQKTTGIWNCTPQVCFCOGPVGEGTVKFQGZCTCFCRQTQEKCNFG,WUVKCCVGUVCPFQ
PQVGTNQECNK\CFQCGORTGUCPQGPFGTGQKPHQTOCFQQURTQEWTCFQTGUFC(C\GPFC
Nacional deveriam considerar como responsveis solidrios os scios-gerentes e os
VGTEGKTQUPQUEKQUEQORQFGTGUFGIGTPEKCRQECFCFKUUQNWQDGOEQOQFQ
fato gerador.
Sucede, porm, que o entendimento fazendrio no encontrou ressonncia no
,WFKEKTKQSWGUGOQUVTQWTGHTCVTKQCQTGFKTGEKQPCOGPVQFQGZGEWVKXQUECNGO
desfavor do scio-gerente ou do administrador da poca do fato gerador, visto que
GUVG PQ EQPEQTTGW FG HQTOC CNIWOC RCTC C FKUUQNWQ KTTGIWNCT PQ RQFGPFQ
RQTVCPVQUGTTGURQPUCDKNK\CFQRGNQUFDKVQUUECKUFCGORTGUC
Percebe-se, portanto, que todas as teorias apresentadas anteriormente possuem
FGEKPEKCUTC\QRGNCSWCNC(C\GPFC0CEKQPCNEQPUVCVQWCPGEGUUKFCFGFGDWUECT
WOCRQUKQSWGRTGUGTXCUUGUGWUKPVGTGUUGUTGURGKVCUUGQUFKTGKVQUFQUEQPVTKDWKPVGU
e observasse os entendimentos predominantes na jurisprudncia dos tribunais
superiores ptrios.
Com foco nessa ideia, estudos desenvolvidos em parceria pela PGFN e pela Secretaria
da Receita Federal do Brasil (RFB) possibilitaram o surgimento de uma quinta
vertente, no sentido de que tanto o gestor da poca do fato gerador quanto o da
RQECFCFKUUQNWQKTTGIWNCTTGURQPFGORGNQUFDKVQUa depender do caso concreto.
106

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

Dissoluo irregular e responsabilidade tributria dos gestores de sociedades empresrias

Segundo tal posicionamento, em regra, apenas os scios-gerentes e os administradores


SWGQHQUUGORQECFCFKUUQNWQFCGORTGUCTGURQPFGORQTUGWUFDKVQUUECKU
WOCXG\SWGQKNEKVQSWGCWVQTK\CCTGURQPUCDKNK\CQCFKUUQNWQKTTGIWNCT#V
CPGPJWOCFKHGTGPCGOTGNCQUGIWPFCRQUKQ#ITCPFGFKUVKPQTGUKFGPQ
HCVQFGGZEGREKQPCNOGPVGUGTRQUUXGNCTGURQPUCDKNK\CQFQUIGUVQTGUFCRQEC
do fato gerador, desde que comprovada a existncia de ato ilcito, tal qual fraude.
Resolve-se, assim, o multicitado problema dos scios laranjas ou testas de
HGTTQ RQKURGNQGPVGPFKOGPVQGOVGNC UGTKCRQUUXGNFGUEQPUKFGTCTCCNVGTCQ
societria fraudulenta e responsabilizar os verdadeiros scios, isto , aqueles que
verdadeiramente conduzem os destinos da empresa.
%TGOQUSWGCRQUKQGOGZCOGFGHCVQCOCKUTC\QXGNGCSWGOGNJQTGSWKNKDTC
os interesses do Fisco com o entendimento dos tribunais ptrios, conferindo maior
UGIWTCPCLWTFKECCQPGDWNQUQUKUVGOCFGTGURQPUCDKNKFCFGVTKDWVTKCFGNKPGCFQPQ
CTN. No por outra razo que a PGFN, revendo seu posicionamento anterior, o
adotou, alterando o pargrafo nico do art. 2o da Portaria n. 180/2010,5 que passou
CQUVGPVCTCUGIWKPVGTGFCQ
2CTITCHQPKEQ0CJKRVGUGFGFKUUQNWQKTTGIWNCTFCRGUUQCLWTFKECFGXGTQ
ser considerados responsveis solidrios:
I os scios-gerentes e os terceiros no scios com poderes de gerncia poca
FCFKUUQNWQKTTGIWNCT
II os scios-gerentes e os terceiros no scios com poderes de gerncia
RQECFCFKUUQNWQKTTGIWNCTDGOEQOQQURQECFQHCVQIGTCFQTSWCPFQ
comprovado que a sada destes da pessoa jurdica fraudulenta.

6TCVCUG UGO FXKFC FG WO ITCPFG RCUUQ PC TCEKQPCNK\CQ FCU CVKXKFCFGU FC
KPUVKVWKQGXKVCPFQUGCKPVGTRQUKQFGTGEWTUQUHCFCFQUCQKPUWEGUUQDGOEQOQ
CEQPFGPCQFC7PKQCQRCICOGPVQFGJQPQTTKQUCFXQECVEKQUGOFGEQTTPEKC
FGTGFKTGEKQPCOGPVQUKPFGXKFQUFGGZGEWGUUECKU

5 QUESTES PROCEDIMENTAIS
No obstante o ltimo posicionamento exposto seja efetivamente o mais razovel,
WOKORQTVCPVGSWGUVKQPCOGPVQFGNGCXWNVCEQOQEQORTQXCTCHTCWFGPCGZGEWQ
UECN!1VGOCRQNOKEQGEGTVCOGPVGEQORQTVCTKCWOVTCDCNJQGURGEEQRCTC
abord-lo com a profundidade merecida. Por hora, limitar-nos-emos a delinear as
FWCURTKPEKRCKUXGTVGPVGUUQDTGCSWGUVQCOFGPQFGUDQTFCTOQUFQUQDLGVKXQU
deste estudo.
A primeira vertente, capitaneada por Paulsen, sustenta, baseada em doutrina
espanhola e alem, que a responsabilidade do terceiro deve: (i) ser necessariamente
apurada em processo administrativo no qual reste demonstrada a ocorrncia do
 #CNVGTCQHQKTGCNK\CFCRGNC2QTVCTKC2)(0PFGFGQWVWDTQFG

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

107

Alisson Fabiano Estrela Bonfim

RTGUUWRQUVQFGHCVQGURGEEQFCTGURQPUCDKNKFCFGQRQTVWPK\CPFQUGCFGHGUCFQ
TGURQPUXGN
KK CIWCTFCTQKORNGOGPVQFCEQPFKQUWURGPUKXCEQPUWDUVCPEKCFCRGNQ
inadimplemento e pela insolvncia do contribuinte, do que deve ser dado cincia
CQTGURQPUXGNG
KKK UGTRTGEGFKFCRGNCRQUUKDKNKFCFGFGQTGURQPUXGNTGCNK\CTQ
pagamento voluntrio do dbito. Nas suas palavras:
0QJFXKFCSWGPQUGGZKIGFQ(KUEQSWGXCLW\QRCTCGOCQFG
EQPJGEKOGPVQXGTTGEQPJGEKFCVCNQDTKICQFGVGTEGKTQ/CUVCODOPQ
pode haver dvida quanto necessidade de o Fisco apurar administrativamente
tal responsabilidade, assegurando ao suposto responsvel o devido processo
legal, o que pressupe a possibilidade de oferecer defesa administrativa.
[...]
Conforme j destacamos alhures, a exigncia de um ato administrativo que
FGENCTGHWPFCOGPVCFCOGPVGCQEQTTPEKCFQRTGUUWRQUVQFGHCVQGURGEEQ
FCTGURQPUCDKNKFCFGUGLCGNGSWCNHQTKORGUWCGHGVKXCXGTKECQ#UUKO
que a autoridade ter que analisar os fatos, determinar a ilicitude que tenha
EQPVTKDWFQRCTCQUWTIKOGPVQFCQDTKICQQWRCTCQUGWKPCFKORNGOGPVQ
GGPSWCFTNCFGPVTGCUJKRVGUGUNGICKUFGTGURQPUCDKNK\CQFQUIGTGPVGU
[...]
#KPVKOCQFQTGURQPUXGNCEGTECFQCVQFGFGENCTCQFGTGURQPUCDKNKFCFG
impe-se para assegurar-lhe a possibilidade de defesa. Mas, alm disso, deve ser
oportunizado ao responsvel o pagamento voluntrio do crdito tributrio.
[...]
No possvel, pelo fato de se designar o terceiro como responsvel
tributrio, subtrair-lhe a possibilidade de pagamento voluntrio no prazo
administrativo de 30 dias contados do momento em que, j esgotada a
discusso administrativa da responsabilidade que lhe tenha sido imputada,
UGLC EKGPVKECFQ FG SWG C EQDTCPC EQPVTC Q EQPVTKDWKPVG TGUVQW HTWUVTCFC
remanescendo dbito a ser satisfeito (PAULSEN, 2011, p. 111-132).

Note-se, portanto, que, em apertada sntese, a ideia consiste em instaurar um


processo administrativo no escopo de apurar a responsabilidade do terceiro, com
CRQUUKDKNKFCFGFGWVKNK\CQFQUOGKQUGFQUTGEWTUQUKPGTGPVGUEQPVTCFKVTKQG
CORNCFGHGUCGCQPCNECUQUGVGPJCFGEKFKFQRGNCTGURQPUCDKNK\CQEQPHGTKTCQ
TGURQPUXGNRTC\QFGVTKPVCFKCURCTCQRCICOGPVQFQFDKVQUQDRGPCFGKPUETKQ
em dvida ativa.
No ponto, cumpre noticiar recente deciso proferida pela Segunda Turma do STF,
que entendeu, por unanimidade, que os scios s podem ser responsabilizados
UG VKXGTGO RCTVKEKRCFQ FQ RTQEGUUQ CFOKPKUVTCVKXQ SWG FKUEWVKW C EQDTCPC FQU
tributos, devendo ser aplicados os princpios constitucionais da ampla defesa e do
contraditrio desde a fase administrativa. Eis a ementa do acrdo:
Ementa: AGRAVO REGIMENTAL. TRIBUTRIO.
RESPONSABILIDADE TRIBUTRIA. AUSNCIA DE CORRETA
CARACTERIZAO JURDICA POR ERRO DA AUTORIDADE
FISCAL. VIOLAO DO CONTRADITRIO, DA AMPLA DEFESA
108

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

Dissoluo irregular e responsabilidade tributria dos gestores de sociedades empresrias

' &1 &'8+&1 241%'551 .')#. +0':+560%+# 01 %#51


CONCRETO. Os princpios do contraditrio e da ampla defesa aplicam-se
RNGPCOGPVG  EQPUVKVWKQ FQ ETFKVQ VTKDWVTKQ GO FGUHCXQT FG SWCNSWGT
espcie de sujeito passivo, irrelevante sua nomenclatura legal (contribuintes,
responsveis, substitutos, devedores solidrios, etc.). Porm, no caso em
GZCOG JQWXG QRQTVWPKFCFG FG KORWIPCQ KPVGITCN FC EQPUVKVWKQ FQ
ETFKVQVTKDWVTKQPQQDUVCPVGQUNCRUQUFGNKPIWCIGOFCCWVQTKFCFGUECN
#UUKOGODQTCQCETFQTGEQTTKFQVGPJCGTTCFQCQCTOCTUGTQTGURQPUXGN
VTKDWVTKQGUVTCPJQCQRTQEGUUQCFOKPKUVTCVKXQ
OQVKXCQGHWPFCOGPVCQ
so requisitos de validade de qualquer ato administrativo plenamente
vinculado), bem como ao concluir ser possvel redirecionar ao responsvel
VTKDWVTKQCCQFGGZGEWQUECNKPFGRGPFGPVGOGPVGFGGNGVGTIWTCFQPQ
RTQEGUUQCFOKPKUVTCVKXQQWFCKPUGTQFGUGWPQOGPCEGTVKFQFGFXKFCCVKXC

(NU QNCRUQTGUWOGUGFGENCTCQNCVGTCN
obiter dictum) completamente
irrelevante ao desate do litgio. Agravo regimental ao qual se nega provimento.
(RE 608426 AgR, Relator(a): Min. JOAQUIM BARBOSA, Segunda Turma,
julgado em 04/10/2011, DJe-204 DIVULG 21/10/2011 PUBLIC 24/10/2011
EMENT VOL-02613-02 PP-00356.)

'OEQPVTCRQUKQ%CORQUCRGUCTFGTGEQPJGEGTCFKEWNFCFGGOUQNWEKQPCTC
SWGUVQ PQVCFCOGPVG GO TC\Q FCU FGEKPEKCU FQ UKUVGOC DTCUKNGKTQ EQPUKFGTC
CDUWTFCCKPUVCWTCQFGWORTQEGUUQFGEQPJGEKOGPVQPQDQLQFCGZGEWQUECNQW
OGUOQFGWORTQEGUUQCFOKPKUVTCVKXQEQOCPCNKFCFGFGCRWTCTCTGURQPUCDKNKFCFG
do gestor, dada sua total incompatibilidade com a natureza do processo executivo.
&GCEQTFQEQOUWCNKQ
7OCCPNKUGOCKUFGVKFCFCSWGUVQTGXGNCSWGQTGFKTGEKQPCOGPVQFCGZGEWQ
UECNEQPVTCQIGUVQTFCUQEKGFCFGCECDCPWOCGPETW\KNJCFCCRTQFWQFG
RTQXCU
FCRTVKECFGCVQUEQOGZEGUUQFGRQFGTGUQWKPHTCQNGKEQPVTCVQ
social ou estatuto), hoje exigida do Fisco, incompatvel com a natureza do
processo executivo. Com efeito, parece absurdo abrir, dentro do processo
FGGZGEWQWORTQEGUUQFGEQPJGEKOGPVQ
FGENCTCVKXQ FGUVKPCFQCCHGTKT

KPENWUKXG RQT OGKQ FG RTQFWQ FG RTQXCU  C TGURQPUCDKNKFCFG FQ IGUVQT
6CORQWEQRCTGEGHC\GTUGPVKFQCRCTCNKUCQFQRTQEGUUQLWFKEKCNKPUVCWTCFQ
contra a pessoa jurdica para que a Fazenda instaure processo administrativo
destinado a apurar a responsabilidade do gestor.
Como visto, houve a passagem de um sistema de responsabilidade objetiva,
em que os gestores respondiam sempre pelas dvidas sociais no honradas,
para um sistema de responsabilidade subjetiva fundada na prtica de atos com
GZEGUUQFGRQFGTGUQWKPHTCQNGK#QOGUOQVGORQPCGZGEWQUECNPQ
JRTGUWPQFGEWNRCFQUIGUVQTGUPGOUGEQPJGEGQOGECPKUOQRGNQSWCNC
CFOKPKUVTCQRQFGTKCRTQFW\KTCRTQXCFCQEQTTPEKCFGKPHTCQNGKFGXG
KPKEKCTWORTQEGUUQCFOKPKUVTCVKXQRCTCCRWTCQFGTGURQPUCDKNKFCFG!%CDG
KPUVCWTCTWORTQEGUUQFGEQPJGEKOGPVQFGPVTQFQRTQEGUUQFGGZGEWQ!
'POEQPENWKUGSWGPQ$TCUKNEQOGZEGQFQUECUQUFGFKUUQNWQKTTGIWNCT
CRGPCUUGUCDGSWGC(C\GPFCSWGOFGXGRTQXCTOCUPQUGRQFGCTOCTEQO
um mnimo grau de certeza, o que deve provar (o que pode ser considerado
Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

109

Alisson Fabiano Estrela Bonfim

KPHTCQNGK PGOEQOQRTQXCT
RTQEGUUQCFOKPKUVTCVKXQQWLWFKEKCN 
'UUCUKVWCQMCHMKCPCEQPFW\PCRTVKECKTTGURQPUCDKNKFCFGVTKDWVTKCFQU
gestores, abrindo-se mo de poderoso instrumento de garantia do cumprimento
FCQDTKICQVTKDWVTKCGGUVKOWNCPFQUGCKPCFKORNPEKC
%#/215
p. 126-127).

%QOQUGQDUGTXCFGUUCUDTGXGUEQPUKFGTCGUQRTQDNGOCPQFGHEKNUQNWQG
o complicado sistema brasileiro de responsabilidade tributria no oferece respostas
satisfatrias para o enfrentamento das questes que se colocam e que brevemente
estaro s portas do Judicirio.

6 CONCLUSES
# FKUUQNWQ KTTGIWNCT RQFG CECTTGVCT C TGURQPUCDKNKFCFG VTKDWVTKC FG UEKQU G
administradores de empresas, com fundamento no art. 135, III, do CTN, consoante
vem aplicando a jurisprudncia dos tribunais ptrios, pois no concebemos a
FKUUQNWQKTTGIWNCTEWNRQUCFGWOCGORTGUC*PQECUQQFQNQSWGRQFGUGT
GURGEEQSWCPFQUGVGOQKPVGPVQFGGPEGTTCTCUCVKXKFCFGUGFKUUKRCTQUDGPUUQEKCKU
UGOUCNFCTCUQDTKICGURGPFGPVGUKPENWUKXGUECKUQWGXGPVWCNSWCPFQGODQTC
no haja tal objetivo, os gestores assumem, com sua conduta, os riscos de produzi-lo.
# PQTOC FG TGURQPUCDKNKFCFG VTKDWVTKC UQDTGRGUG  QDTKICQ VTKDWVTKC RCTC
alterando-a no polo passivo, agregar ao contribuinte de origem (a pessoa jurdica) o
responsvel tributrio solidrio (a pessoa fsica dos scios). Tal raciocnio vlido,
diga-se de passagem, mesmo entre aqueles que sustentam o enquadramento da
FKUUQNWQKTTGIWNCTPQKPEKUQ8++FQCTVFQ%6
0QUGFGHGPFGCCVTKDWKQFGTGURQPUCDKNKFCFGQDLGVKXCQWFGEWNRCRTGUWOKFC
dos gestores empresariais, os quais podero defender-se no curso do processo de
GZGEWQUECNWVKNK\CPFQEQORGVGPVGUGODCTIQU
# RQUKQ OCKU TC\QXGN G SWG OGNJQT GSWKNKDTC QU KPVGTGUUGU FQ (KUEQ EQO Q
entendimento dos tribunais ptrios, desenvolvida com base em estudos levados
a efeito pela PGFN e pela RFB, no sentido de que tanto o gestor da poca do
HCVQIGTCFQTSWCPVQQFCRQECFCFKUUQNWQKTTGIWNCTTGURQPFGORGNQUFDKVQUC
depender do caso concreto.
Assim, em regra, apenas os scios-gerentes e os administradores que o fossem poca
FCFKUUQNWQFCGORTGUCTGURQPFGORQTUGWUFDKVQUUECKUWOCXG\SWGQKNEKVQ
SWGCWVQTK\CCTGURQPUCDKNK\CQCFKUUQNWQKTTGIWNCT/CUGZEGREKQPCNOGPVG
RQUUKDKNKVCUGCTGURQPUCDKNK\CQFQUIGUVQTGUFCRQECFQHCVQIGTCFQTFGUFGSWG
comprovada a existncia de ato ilcito, tal qual fraude.
No que concerne s microempresas e s empresas de pequeno porte, no h dvidas,
RQKUQho do art. 9o da LC n. 123/2006 preconiza que a responsabilidade tributria
deve ser atribuda aos scios da poca do fato gerador.
110

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

Dissoluo irregular e responsabilidade tributria dos gestores de sociedades empresrias

REFERNCIAS
#4#,1 ,WNKCPC (WTVCFQ %QUVC 1U OGKQU FG RTQXC RCTC C ECTCEVGTK\CQ
FC FKUUQNWQ KTTGIWNCT FG UQEKGFCFGU EQO HKPU FG TGURQPUCDKNK\CQ FG UGWU
representantes legais: crticas jurisprudncia do STJ. In:0'&'4/CTEQU8KPKEKWU
5#06+'WTKEQ/CTEQU&KPK\FG('44#)76/CTKC4KVC
%QQTF A prova no
processo tributrio. So Paulo: Dialtica, 2010.
ASSIS, Emanuel Carlos Dantas de. Arts. 134 e 135 do CTN: responsabilidade culposa
e dolosa dos scios e administradores de empresas por dvidas tributrias da pessoa
LWTFKEC+P('44#)76/CTKC4KVC0'&'4/CTEQU8KPKEKWUResponsabilidade
tributria. So Paulo: Dialtica, 2007.
$+/ 'FWCTFQ (QTVWPCVQ &KUUQNWQ KTTGIWNCT FC GORTGUC PQ GPUGLCFC C
responsabilidade tributria de seus administradores. Revista Tributria e de
Finanas Pblicas, v. 9, n. 41, p. 119-144, nov./dez. 2001.
BODNAR, Zenildo. Responsabilidade tributria do scio-administrador.
Curitiba: Juru, 2005.
CAMPOS, Gustavo Caldas Guimares de. Execuo fiscal e efetividade: anlise
do modelo brasileiro luz do sistema portugus. So Paulo: Quartier Latin do
Brasil, 2009.
COLHO, Sacha Calmon Navarro. Curso de direito tributrio brasileiro. 9. ed.
Rio de Janeiro: Forense, 2008.
.#%'4&#5CTCFG(TCPC1TGFKTGEKQPCOGPVQFCGZGEWQUECNPQUECUQUFG
FKUUQNWQKTTGIWNCT+P:5#0615*GTVC4CPK6GNGU&'75&#4+PITKF%CTQNKPG
%CXCNECPVGFG1NKXGKTC.#%'4&#5CTCFG(TCPC
%QQTF Execuo fiscal: um
VGOCCVWCNUQDFKHGTGPVGUQNJCTGU$TCUNKC%QPUWNGZ'FKGU
MACHADO, Hugo de Brito. Curso de direito tributrio. 26. ed. So Paulo:
Malheiros, 2005.
PAULSEN, Leandro. Direito tributrio %QPUVKVWKQ G %FKIQ 6TKDWVTKQ 
luz da doutrina e da jurisprudncia. 13. ed. Porto Alegre: Livraria do Advogado
Editora, 2011.
______. O ato declaratrio de responsabilidade tributria dos scios: comentrios
2QTVCTKC2)(0P+P5#0615*GTVC4CPK6GNGU&'75&#4+PITKF
%CTQNKPG%CXCNECPVGFG1NKXGKTC.#%'4&#5CTCFG(TCPC
%QQTF Execuo
fiscalWOVGOCCVWCNUQDFKHGTGPVGUQNJCTGU$TCUNKC%QPUWNGZ'FKGU
______. Responsabilidade tributria: seu pressuposto de fato especfico e as
GZKIPEKCU RCTC Q TGFKTGEKQPCOGPVQ FC GZGEWQ UECN C FQWVTKPC GUVTCPIGKTC Q
RE 562.276 e a Portaria PGFN 180/2010. Revista Ajufergs, Porto Alegre, n. 7,
p. 111-132, 2011.
Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

111

Alisson Fabiano Estrela Bonfim

517<#*COKNVQP&KCUFG(70#41*WIQ#FGUEQPUKFGTCQFCRGTUQPCNKFCFG
jurdica e a responsabilidade tributria dos scios e administradores. Revista
Dialtica de Direito Tributrio (RDDT), So Paulo, n. 137, p. 38-64, fev. 2007.
SUSSMANN, Mrio Antnio. As vexatae quaestiones FC FKUUQNWQ KTTGIWNCT
Circulus: Revista da Justia Federal do Amazonas, v. 3, n. 5, p. 196-205, jan./
jun. 2005.
TORRES, Ricardo Lobo. Curso de direito financeiro e tributrio. 14. ed. Rio
de Janeiro: Renovar, 2007.

112

Cad. Fin. Pbl., Braslia, n. 12, p. 87-112, dez. 2012

Reflexes sobre o gasto pblico e o


crescimento econmico no Brasil e no mundo:
contribuies baseadas na reviso integrativa
Valdocu de Queiroz
2J&GO(KPCPCU%QTRQTCVKXCURGNC7PKXGTUKFCFG
de Salamanca, Espanha

Johan Hendrik Poker Junior


Professor Doutor na Faculdade de Cincias
Aplicadas (FCA) e na
Universidade Estadual de Campinas (Unicamp)

Resumo
Este artigo tem como principal objetivo apresentar
reflexes a respeito da relao entre o gasto pblico
e o crescimento econmico. Estruturado com dados
nacionais e internacionais, o estudo possibilitou a
identificao das principais variveis e metodologias
utilizadas na literatura, constituindo-se em um
significativo instrumento destinado, em especial,
orientao de novas pesquisas e formulao
de polticas pblicas facilitadoras do crescimento
econmico. O mtodo aplicado, conhecido como
reviso integrativa, permite a ampliao do
entendimento e a aplicabilidade das evidncias
oferecidas com base em dados de pases desenvolvidos
e em desenvolvimento. Os resultados apontam o
importante papel desempenhado pelos investimentos
pblicos como motivadores do crescimento econmico.

Palavras-chave
Gasto pblico. Crescimento econmico. Reviso
integrativa.

Abstract
This paper focuses on the relation between public
expenditure and economic growth. Building upon
the cross-country data, the study allowed identifying
the main variables and methodologies used in the
literature, resulting in an important tool to be taken
account by researchers and policy decision makers
to facilitate economic growth. By using a specific
methodology, known as integrative review, the
study show evidence to improve understanding and
applicability of research findings from developed
and developing countries. The results point out the
important role played by public investments in
contributing to economic growth.

Keywords

1 INTRODUO
Desde a perspectiva terica, intuitivo
CUUWOKTSWGQUICUVQURDNKEQUKPWGPEKCO
o crescimento econmico. Entretanto,
toda teoria depende de pressupostos que
podem ser totalmente verdadeiros ou
no (SOLOW, 1956). Seguindo essa linha
de pensamento, este artigo pretende
ampliar a compreenso e a aplicabilidade
dos conhecimentos oferecidos pela
literatura terica, combinados com as
GXKFPEKCUGORTKECUCTGURGKVQFCTGNCQ
entre o gasto pblico e o crescimento
econmico no Brasil e no mundo.
Conforme pode ser constatado nas
UGGU UGIWKPVGU WO EQPUKFGTXGN
nmero de estudos apresenta evidncias
UQDTGCEQTTGNCQGPVTGQICUVQRDNKEQ
e o crescimento econmico. Alguns
trabalhos sugerem que a magnitude do
GHGKVQFGRGPFGFCEQORQUKQFQICUVQ
Tambm existem pesquisas apontando
WOC TGNCQ RQUKVKXC CV FGVGTOKPCFQ
NKOKVG
'5%1$#4 215#&#  
apresentando resultado decrescente se
QUNKOKVGUHQTGOWNVTCRCUUCFQU
KPGZQ
PCEWTXCFCTGNCQGPVTGICUVQRDNKEQ
e crescimento econmico). H pesquisas
SWG KPFKECO WOC TGNCQ PGICVKXC GO
HWPQFGGXGPVWCNKPGEKPEKCFQUGVQT
pblico, especialmente em pases em
desenvolvimento, com o argumento de
que grande parte dos recursos pblicos
destinada, por exemplo, defesa e aos
pagamentos de juros relativos dvida
pblica. Destacam-se ainda estudos que
UWIGTGO PQ GZKUVKT EQTTGNCQ GPVTG
os gastos pblicos e o crescimento
econmico.

Public expenditure. Economic growth. Integrative


review.
Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

113

Valdocu de Queiroz/Johan Hendrik Poker Junior

Ainda merece destaque a existncia de corrente fundamentada na Lei de Wagner,


SWGUWIGTGCTGNCQFGECWUCNKFCFGGPVTGQETGUEKOGPVQGEQPOKEQGQICUVQRDNKEQ
GPSWCPVQ C CDQTFCIGO MG[PGUKCPC TGNCEKQPC QU ICUVQU RDNKEQU CQ ETGUEKOGPVQ
GEQPOKEQ 5KORNKECPFQ RCTC 9CIPGT C ECWUCNKFCFG RQFG UGT TGRTGUGPVCFC
EQPHQTOGCGSWCQ
 RQTUWCXG\CTGNCQMG[PGUKCPCRQFGCUUWOKTCGZRTGUUQ
FGPKFCRGNCGSWCQ
 0GPJWOCFGNCURQFGUGTXKUVCEQOUKORNKEKFCFG#TGNCQ
gasto e crescimento no constante e linear ao longo do tempo, existem limites a
partir dos quais os acrscimos no so produtivos, alm da endogeneidade observvel
PCUTGNCGUFCUXCTKXGKU
3,%*

(1)

*3,%

(2)

onde PIB o Produto Interno Bruto e G, os gastos do governo.


0GUUG EQPVGZVQ GUVG CTVKIQ RTGVGPFG CRTGUGPVCT TGGZGU C TGURGKVQ FC TGNCQ
entre o gasto pblico federal e o crescimento econmico no Brasil e no mundo.
Assim, com o objetivo de ampliar o entendimento e a aplicabilidade das evidncias
oferecidas pelos estudos tericos e empricos sobre o tema, o mtodo de pesquisa
utilizado tem como base a reviso integrativa proposta em sua verso mais atual
RQT 6QTTCEQ
  G 9JKVVGOQTG G -PCNH
  'UUC OGVQFQNQIKC RGTOKVG C
DWUECCCXCNKCQETVKECGCUPVGUGFCUGXKFPEKCUFKURQPXGKUCTGURGKVQFQVGOC
KPXGUVKICFQUGPFQUGWRTQFWVQPCNQGUVCFQCVWCNFQEQPJGEKOGPVQCRTQRQUKQ
FGKPVGTXGPGUGHGVKXCUDGOEQOQCKFGPVKECQFGNCEWPCUSWGFKTGEKQPCORCTC
o desenvolvimento de futuras pesquisas.
&GUUCHQTOCGUVGGUVWFQQDLGVKXCFCTWOCEQPVTKDWKQRCTCCNKVGTCVWTCCECFOKEC
e para os tomadores de deciso no mbito governamental, uma vez que sintetiza
as concluses de diversos autores a respeito da efetividade dos gastos pblicos, seu
direcionamento e as consequncias econmicas.
1TGUVCPVGFGUVGCTVKIQGUVGUVTWVWTCFQGOSWCVTQUGGU#UGIWPFCEQTTGURQPFG
a fundamentos tericos. A terceira descreve a metodologia utilizada. A quarta
apresenta a anlise e os resultados da reviso integrativa. A ltima apresenta as
EQPUKFGTCGUPCKU

2 FUNDAMENTOS TERICOS
#ETKUGGEQPOKECKPKEKCFCPQPCNFGFGECTVGTGURGEEQPQUQOGPVGRQT
sua magnitude mundial, com risco sistmico frequente, mas por ter como epicentro
QURCUGUFGUGPXQNXKFQUGUVGPFGPFQUGFQUKUVGOCPCPEGKTQRCTCOWKVQUUGVQTGU
produtivos, provocou o enfraquecimento dos componentes da demanda agregada
GGXKFGPEKQWCURGEVQUSWGUWIGTGOCHCNVCFGJCDKNKFCFGFQOGTECFQPCPEGKTQRCTC
se autorregular.
114

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

Reflexes sobre o gasto pblico e o crescimento econmico no Brasil e no mundo:


contribuies baseadas na reviso integrativa

A intensidade da crise fez com que as polticas pblicas se distanciassem dos


RQUVWNCFQUFQPGQNKDGTCNKUOQFQOKPCPVGFGUFGPUFCFECFCFG NGXCPFQ
KORQTVCPVGU GEQPQOKCU C DWUECTGO KPURKTCQ MG[PGUKCPC RCTC GXKVCT QU GTTQU
de 1929.
-G[PGUFGHGPFKCWOCCDGTVCKPVGTXGPQFQ'UVCFQPCGEQPQOKCPQEWTVQRTC\Q
EQO C PCNKFCFG FG FQOKPCT ETKUGU G FGRTGUUGU G CNECPCT Q GSWKNDTKQ G WO
ETGUEKOGPVQEQPUVCPVG0GUUGEQPVGZVQCURQNVKECUUECNGOQPGVTKCVOWORCRGN
HWPFCOGPVCNPCGEQPQOKCEQOQHQTOCFGICTCPVKTWOCLWUVGCPVKEENKEQCOFG
manter o nvel de atividade econmica, principalmente por meio de investimentos.
# RTQRQUVC MG[PGUKCPC FG WO IQXGTPQ OCKU CVWCPVG PC FGVGTOKPCQ FCU
variveis macroeconmicas contrria poltica do laissez-faire, defendida pelos
economistas clssicos.
&GUFGCRGTURGEVKXCMG[PGUKCPCQTGUWNVCFQFQICUVQRDNKEQPCGEQPQOKCRQFGUGT
entendido via efeito multiplicador (CARVALHO, 2008). A seguir, um exemplo,
EQODCUGPQOQFGNQMG[PGUKCPQUKORNKECFQEQOQPXGNFQRTQFWVQFGVGTOKPCFQ
pelo nvel da demanda agregada (DA):1
< '$ &,*

(3)

Y=C +S+T

(4)

C = S + c( Y T) ; 0<c<1

(5)

T=T

(6)

* *

(7)

I=I

(8)

onde Y = produto, C = consumo, I = investimento, G = gasto do governo,


5RQWRCPC6VTKDWVQUGERTQRGPUQOCTIKPCNCEQPUWOKT
5GKPEQTRQTCTOQUCUHWPGU
 C
 PC
 CRUCUFGXKFCUQRGTCGUCNIDTKECU
teremos:
(9)
  OWNVKRNKECFQT MG[PGUKCPQFQUKPITGUUQU5G QIQXGTPQ
onde
CWOGPVCQICUVQRDNKEQUGOCNVGTCGUPQUKORQUVQUUWRQOQUSWGIGTCFQWO
FEKVUECNGSWGQPXGNFQRTQFWVQGQUKPITGUUQUUGCLWUVCORCTCKIWCNCTQCWOGPVQ
na demanda agregada. Assim teremos:
1 Universidad Autnoma Metropolitana, Mxico, 1997.

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

115

Valdocu de Queiroz/Johan Hendrik Poker Junior

(10)
# GSWCQ
  UKIPKEC SWG WO CETUEKOQ PQ ICUVQ FQ IQXGTPQ RTQFW\KT WO
aumento no produto, que ser necessariamente um mltiplo desse acrscimo. Por
exemplo, se a propenso marginal a consumir for igual a 0,8, o multiplicador ser
igual a 5. Ento, para cada real de acrscimo no gasto pblico produzir-se- um
aumento de R$ 5,00 no valor do produto.
'OEQPVTCRQUKQFQWVTKPCMG[PGUKCPCPCRGTURGEVKXCFG9CIPGTQICUVQRDNKEQ

HCVQTGPFIGPQ KPWGPEKCFQRGNQETGUEKOGPVQGEQPOKEQ2CTC-G[PGUQICUVQ
RDNKEQWOHCVQTGZIGPQGRQFGUGTKPWGPEKCFQRQTKPVGTXGPGUFQ'UVCFQ
EQO C PCNKFCFG FG RTQOQXGT Q ETGUEKOGPVQ GEQPOKEQ 6QFCXKC PQ UG RQFG
EQPVGUVCTCOCKQTKPWPEKCFCUJKRVGUGUMG[PGUKCPCUPCEQPFWQFGGEQPQOKCU
de diversos pases.
2CTC 9CIPGT C RCTVKEKRCQ FQ IQXGTPQ PC GEQPQOKC ETGUEG FG CEQTFQ EQO Q
crescimento econmico do pas. Uma economia em estado crescente promove um
CWOGPVQFQUGVQTRDNKEQQWUGLCQRGTEGPVWCNFQUICUVQURDNKEQUEQOTGNCQCQ
2+$CWOGPVCTGOHWPQFQETGUEKOGPVQFGUVG2CTC)QHHOCP
 CJKRVGUGFG
Wagner pode ser entendida como: O crescimento e desenvolvimento econmico
implica aumento das atividades do setor pblico, e o percentual desse aumento,
EQOTGNCQCQICUVQGZEGFGTQCWOGPVQper capita.
9CIPGTCTIWOGPVCSWGQUDGPURDNKEQUUQDGPUUWRGTKQTGUUKIPKECPFQSWGQ
crescimento da renda vem acompanhado de um aumento nas atividades do setor
RDNKEQ0QEQPVGZVQFG9CIPGTGZKUVGOVTUTC\GURCTCCRCTVKEKRCQETGUEGPVG
do Estado medida que a economia cresce (BIRD, 1971), quais sejam:
#WOGPVQFCUHWPGUCFOKPKUVTCVKXCUGRTQVGVQTCUFQIQXGTPQ1ETGUEKOGPVQ
GEQPOKEQXGOCEQORCPJCFQFGTGNCGUUQEKCKUOCKUEQORNGZCUEQOQVCODO
EQPVTKDWK RCTC C GZRCPUQ FGOQITEC G FG WTDCPK\CQ NGXCPFQ Q 'UVCFQ
C UG VQTPCT OCKU CVWCPVG PC RTQVGQ VTCDCNJKUVC G PC TGCNK\CQ FG CVKXKFCFGU
administrativas que, consequentemente, resultam em um aumento dos gastos
RDNKEQURCTCCOCPWVGPQFCQTFGOGCTGIWNCQFCGEQPQOKC
'ZRCPUQFQUICUVQUEQOCEWNVWTCGQDGOGUVCTRTKPEKRCNOGPVGEQOTGNCQ
SWGNGUFGUVKPCFQUGFWECQGTGFKUVTKDWKQFGTGPFC
#NIWPUUGVQTGUEQOQQVGEPQNIKEQDGOEQOQCPGEGUUKFCFGFGKPXGUVKOGPVQU
PCPEGKTQU GO FGVGTOKPCFQU TGCU RQFGO HCEKNKVCT C ETKCQ FG OQPQRNKQU
privados, que o Estado deveria evitar ou pelo menos neutralizar seus efeitos para
RTQOQXGTCGEKPEKCGEQPOKEC
Publicada em 1892, somente a partir do livro de Musgrave e Peacock (1958), a Lei de
Wagner teve sua importncia reconhecida entre os pesquisadores do setor pblico.
116

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

Reflexes sobre o gasto pblico e o crescimento econmico no Brasil e no mundo:


contribuies baseadas na reviso integrativa

%QODCUGPCUQDUGTXCGUFQRTRTKQ9CIPGTQEWORTKOGPVQFCNGK
6+/ 
condiciona-se:
CQCWOGPVQFCTGPFCPCEKQPCNFCTGPFCper capitaGFQDGOGUVCTIGTCN
KORQTVPEKCFQRTQITGUUQVGEPQNIKEQ
CQGUVCFQEQPUVKVWEKQPCNGFGOQETVKEQQWUGLCRCTVKEKRCQFCRQRWNCQPCU
FGEKUGURQNVKECUGPCPEGKTCU
#Q NQPIQ FQU CPQU XTKQU GUVWFQU VO CRTGUGPVCFQ GXKFPEKCU UQDTG C TGNCQ
entre o gasto pblico e o PIB, tendo como base a Lei de Wagner e/ou a doutrina
MG[PGUKCPC2QTGZGORNQ%JQY%QVUQOKVKUG-YCP
 GPEQPVTCTCOGXKFPEKCU
SWGEQPTOCOC.GKFG9CIPGTGPSWCPVQQUTGUWNVCFQUFG9CJCD
 KPFKECO
QEQPVTTKQ/CUGZKUVGOGUVWFQUSWGEQPTOCO9CIPGTG-G[PGUEQOTGUWNVCFQU
SWGCRQPVCOECWUCNKFCFGGPVTGQ2+$GQUICUVQURDNKEQUGXKEGXGTUC
5#/7&4#/
0#+4 8#+6*+.+0)#/  0#4#;#0 GV CN   'O RCUGU GO
desenvolvimento, Gandhi (1971) e Ram (1987) evidenciam a Lei de Wagner. Todavia,
GUVWFQUOCKUTGEGPVGUCRTGUGPVCOTGUWNVCFQUSWGEQPTOCOVCPVQ9CIPGTSWCPVQ
-G[PGUGORCUGUGOFGUGPXQNXKOGPVQ
5#/7&4#/0#+48#+6*+.+0)#/
0#4#;#0GVCN 
importante ressaltar que estudos publicados recentemente vm apontando para
a causalidade bidirecionalQWUGLCCUXCTKXGKU2+$GICUVQRDNKEQKPWGPEKCOUG
OWVWCOGPVG # UKOWNVCPGKFCFG GPVTG CU XCTKXGKU RQFG UGT C LWUVKECVKXC RCTC C
EQPTOCQFG9CIPGTG-G[PGUGOWOCOGUOCGEQPQOKC
6CODO GZKUVGO GUVWFQU GUVTWVWTCFQU EQO DCUG PC EQORQUKQ FQ ICUVQ UGO
WOCCDQTFCIGOGZRNEKVCFC.GKFG9CIPGTVCORQWEQFCUJKRVGUGUMG[PGUKCPCU
Muitos deles indicam quais gastos so considerados produtivos e no produtivos.
Considerando esse enfoque, as evidncias sugerem um consenso sobre a produtividade
dos investimentos, incluindo aqueles destinados pesquisa e ao desenvolvimento
(P&D).
5QNQY
 EJCOQWCCVGPQUQDTGCKORQTVPEKCFCOWFCPCVGEPQNIKECRCTC
o crescimento econmico. Mais recentemente, vrios autores vm examinando os
HCVQTGUSWGKPWGPEKCOQETGUEKOGPVQGEQPOKEQRQTGZGORNQ-KPIG.GXKPG
 .C 2QTVC GV CN   G  .C 2QTVC .QRG\FG5KNCPGU G 5JNGKHGT
4CLCPG<KPICNGU$GEM.GXKPGG.QC[\C$GEMG.GXKPG
&GOKTI-WPVG/CMUKOQXKE
0GUUGEQPVGZVQFGCEQTFQEQOKORQTVCPVGUOQFGNQUFGETGUEKOGPVQCKPQXCQ
tecnolgica resultado de projetos em pesquisa e desenvolvimento ou P&D

41/'4)4155/#0*'.2/#0#)*+10*19+66 
Portanto, considerando a perspectiva da literatura de crescimento, no existem
dvidas sobre o importante papel desempenhado por P&D para o desenvolvimento
Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

117

Valdocu de Queiroz/Johan Hendrik Poker Junior

FG PQXQU RTQFWVQU G RTQEGUUQU FG KPQXCQ %QOQ TGUWNVCFQ GURGEKCN CVGPQ
vem sendo voltada aos projetos P&D, que no so mais considerados despesas e
sim investimentos que conduzem a retornos superiores. importante ressaltar
que esses investimentos tambm podem exercer o papel de varivel proxy para as
oportunidades de crescimento (BILLET et al., 2007).
'PVTGVCPVQEQOQGPHCVK\CO$QQVJGVCN
 QFGUGPXQNXKOGPVQGCKORNCPVCQ
FGCVKXKFCFGUFG2&GZKIGOXWNVQUQUCRQTVGUFGTGEWTUQUPCPEGKTQU#UUKOQ
investimento do governo nessa rea de fundamental importncia, dado que o
ITCWFGKPHQTOCQCUUKOVTKECGZKUVGPVGPQURTQLGVQU2&OWKVQUWRGTKQTCQ
TGNCEKQPCFQEQOQUKPXGUVKOGPVQUGOCVKXQUVCPIXGKU
#$11&;.'8 G
RQTEQPUGSWPEKCGNGXCQUEWUVQUFGPCPEKCOGPVQFQURTQLGVQU#NOFKUUQQU
problemas de agncia, a miopia do mercado e a busca de retornos no curto prazo
incentivam os executivos a decidirem por investimentos em ativos tangveis em
detrimento dos projetos P&D.
%QOQFQEWOGPVCCNKVGTCVWTCPCPEGKTCCOCIPKVWFGFCUKORGTHGKGUFGOGTECFQ
ECWUCFCURGNQURTQDNGOCUFGCIPEKCGKPHQTOCQCUUKOVTKECGUVEQTTGNCEKQPCFC
EQO CU RTVKECU FG IQXGTPCPC EQTRQTCVKXC
.# 2146# GV CN  
&'/+4)-706/#-5+/18+%(4#0%+55/+6*,'05'0
47$#%- 1UHCVQTGUFGIQXGTPCPCEQTRQTCVKXCEQOQCUECTCEVGTUVKECUFQU
UKUVGOCUPCPEGKTQGNGICNUQGNGOGPVQUHWPFCOGPVCKURCTCRTQOQXGTCTGFWQ
FGVCKUKORGTHGKGU2QTEQPUGSWPEKCCUDQCURTVKECUFGIQXGTPCPCEQTRQTCVKXC
PXGNRCUEQPVTKDWGORCTCCTGFWQFQUEWUVQUFGPCPEKCOGPVQFQURTQLGVQU2&
/GTGEGTGIKUVTQCGZKUVPEKCFGCTVKIQUCECFOKEQUEQOWOCCORNCFGPKQFG
IQXGTPCPCEQTRQTCVKXCSWGGPVTGQWVTQUHCVQTGUKPEQTRQTCOCUECTCEVGTUVKECUFQU
UKUVGOCUPCPEGKTQGNGICNFQURCUGUIWCTFCPFQEQPUQPPEKCEQOQURTKPERKQU
da Organization for Economic Cooperation and Development (OECD) sobre
IQXGTPCPCEQTRQTCVKXC
Os resultados dos estudos nessa rea sugerem que os tomadores de deciso do
IQXGTPQFGXGORTGUVCTOCKUCVGPQCQUKPFKECFQTGUFGDQCURTVKECUFGIQXGTPCPC
GO GURGEKCN CU TGNCEKQPCFCU CQU UKUVGOCU PCPEGKTQ G NGICN EQOQ KPUVTWOGPVQU
RCTC UWDUKFKCT C HQTOWNCQ FG RQNVKECU HCEKNKVCFQTCU FQU RTQLGVQU 2& G
consequentemente, para fomentar o crescimento econmico.
Nesse sentido, La Porta et al. (1997, 2000) argumentam que um sistema legal
que protege os investidores contribui para o desenvolvimento do sistema
PCPEGKTQ 1 UKUVGOC NGICN GZGTEG WO RCRGN HWPFCOGPVCN PC FKHGTGPEKCQ FQ
ITCWFGFGUGPXQNXKOGPVQFQUUKUVGOCUPCPEGKTQUFQURCUGU5QOCUGVCODOC
KORQTVPEKCFGUUGUUKUVGOCURCTCTGFW\KTCUKORGTHGKGUFGOGTECFQ
&'/+4)
-706 /#-5+/18+%  6QFCXKC PQ  WO ITCPFG POGTQ FG NGKU FG
RTQVGQCQKPXGUVKFQTSWGXCKOGNJQTCTQITCWFGIQXGTPCPCFGWORCUOCUUKO
seu efetivo cumprimento.
118

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

Reflexes sobre o gasto pblico e o crescimento econmico no Brasil e no mundo:


contribuies baseadas na reviso integrativa

Segundo um importante estudo publicado em 1998, realizado por La Porta et al,


SWGEQPVTKDWKWRCTCCETKCQFGWOCPQXCEKPEKCFGPQOKPCFCLaw and Finance,
Q$TCUKNCKPFCPGEGUUKVCFGCXCPQURCTCUGUKVWCTGPVTGQURCUGUEQOOGNJQTPFKEG
FGRTQVGQCQUKPXGUVKFQTGU6QFCXKCFGXKFQCNVCEQORNGZKFCFGFGWOUKUVGOC
legal, so necessrios novos estudos para investigar e aprimorar o atual grau de
desenvolvimento do sistema legal brasileiro.
0Q EQPVGZVQ NGICN G FC SWCNKFCFG FQ ICUVQ RDNKEQ ECDG FGUVCECT C RWDNKECQ
da Lei Complementar n. 101, de 4 de maio de 2000, conhecida como a Lei de
Responsabilidade Fiscal (LRF).
#.4(TGIWNCOGPVCQUCTVKIQUGFC%QPUVKVWKQGFKUEKRNKPCPQTOCUFG
PCPCU RDNKECU XQNVCFCU RCTC C TGURQPUCDKNKFCFG PC IGUVQ UECN VGPFQ EQOQ
referncia os princpios de transparncia, controle e responsabilidade, disciplinados
GONGIKUNCGUEQOQCUFQU'UVCFQU7PKFQU
Budget Enforcement Act BEA) e da
Nova Zelndia (Fiscal Responsibility Act).

3 METODOLOGIA
1 OVQFQ UGNGEKQPCFQ RCTC GNCDQTCQ FGUVG CTVKIQ EQPJGEKFQ EQOQ TGXKUQ
KPVGITCVKXCCFXOFCPCNKFCFGSWCNGUVGVTCDCNJQUGFGUVKPC5GTWOQTKGPVCFQT
FQU RTQEGUUQU FGEKUTKQU FG IGUVQTGU RDNKEQU PC TGNCQ GPVTG ICUVQ RDNKEQ G
ETGUEKOGPVQGEQPOKEQ1OVQFQCRTGUGPVCKORQTVCPVGUXCPVCIGPUGOTGNCQ
s alternativas existentes, conforme pode ser visto a seguir.
5GIWPFQCQTICPK\CQRTQRQUVCRQT$QVGNJQ%WPJCG/CEGFQ
 QUVKRQUFG
reviso literria dividem-se em dois grupos: reviso narrativa eTGXKUQDKDNKQITEC
sistemtica (Tabela 1).
Tabela 1 Diferenas entre reviso bibliogrfica sistemtica e reviso narrativa
Itens

Reviso narrativa

Reviso bibliogrfica sistemtica

Questo

Ampla

'URGEEC

Fonte

(TGSWGPVGOGPVGPQGURGEKECFC
potencialmente com vis

5GNGQDCUGCFCGOETKVTKQUCRNKECFQU
uniformemente

5GNGQ

Varivel

#XCNKCQETKVGTKQUCGTGRTQFWVXGN

#XCNKCQ

Varivel

Criteriosa e reprodutvel

Sntese

Qualitativa

Quantitativa

Fonte: adaptado de Botelho, Cunha e Macedo (2011)

A reviso sistemtica est composta por quatro mtodos com caractersticas


GURGEECUSWCKUUGLCO

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

119

Valdocu de Queiroz/Johan Hendrik Poker Junior

meta-anlise combina resultados de vrios estudos, empregando os dados


em inferncias estatsticas e melhorando a objetividade e a validade dos
TGUWNVCFQUVTKDWVTKCFCUVEPKECUGUVCVUVKECUFGRNCPGLCOGPVQGZRGTKOGPVCN
tem como obstculo a necessidade de existncia de numerosos estudos para sua
KORNGOGPVCQ
reviso sistemticaQTICPK\CCUGNGQFGCTVKIQUFGOCPGKTCETKVGTKQUCCXCNKCPFQ
QU FG HQTOC ETVKEC TGFW\KPFQ Q XKU FG UGNGQ FQ CWVQT UKPVGVK\CPFQQU GO
VRKEQUGURGEEQU
reviso qualitativa incluem-se aqui as categorias conhecidas como metassnteses,
metaestudos, grounded theoryGOGVCGVPQITCCVQFCUGNCUXQNVCFCUUPVGUGFQU
CEJCFQUGOGUVWFQUSWCNKVCVKXQUKPFKXKFWCKURCTCCEQPUVTWQFGPQXCUVGQTKCU
No adequada a este estudo dadas as caractersticas quantitativas das pesquisas
CSWKEQPUKFGTCFCU
reviso integrativa resume o passado da literatura emprica ou terica para
fornecer uma compreenso mais abrangente de um fenmeno (BROOME, 2000).
Partindo de um determinado tema, analisa o conhecimento construdo, sintetiza
e gera novos resultados.
Segundo Botelho, Cunha e Macedo (2011) e Mendes, Silveira e Galvo (2008), as
GVCRCUCUGTGOEQPUKFGTCFCUPCTGXKUQKPVGITCVKXCUQ
K KFGPVKECQFQVGOCG
UGNGQFCSWGUVQFGRGUSWKUC
KK ETKVTKQURCTCKPENWUQFGGUVWFQUPCDWUECPC
NKVGTCVWTC
KKK FGPKQFCUKPHQTOCGUCUGTGOGZVTCFCUFQUGUVWFQUUGNGEKQPCFQUG
ETKVTKQFGECVGIQTK\CQ
KX CXCNKCQFQUGUVWFQUKPENWFQUPCTGXKUQKPVGITCVKXC

X KPVGTRTGVCQFQUTGUWNVCFQUG
XK CRTGUGPVCQFCUPVGUGFQEQPJGEKOGPVQ

4 ANLISE E RESULTADOS DA REVISO INTEGRATIVA


%QODCUGPQUCTVKIQUUKPVGVK\CFQUPQ#PGZQRQFGUGKFGPVKECTCUFKXGTUCU
EQTTGPVGU CECFOKECU C TGURGKVQ FC TGNCQ GPVTG ICUVQ RDNKEQ G ETGUEKOGPVQ
econmico. A tabela que compe o Anexo 1 apresenta aspectos relevantes para
o entendimento dos artigos, que, alm de compor este estudo, deve incentivar
RGUSWKUCFQTGUGIGUVQTGURDNKEQUGNCDQTCQFGGUVWFQUGKORNCPVCQFGCGU
que visam a fomentar o crescimento econmico.
Dos 32 artigos considerados, 11 referem-se a estudos nacionais, enquanto 21 so de
ECTVGTKPVGTPCEKQPCN#CDQTFCIGOKPVGTPCEKQPCNRGTOKVGKFGPVKECTCGZKUVPEKC
FGXCTKCGUPCUFKOGPUGUFQUGUVWFQUEQPUKFGTCFQUPCCPNKUG
1RGTQFQFGRWDNKECQFQUGUVWFQUXCKFGC#FGEKUQFGKPENWKTPC
anlise os estudos mais recentes deveu-se ao interesse em prover conhecimentos
UKIPKECVKXQUCQUVQOCFQTGUFGFGEKUQFQIQXGTPQEQPUKFGTCPFQGOGURGEKCNQ
momento econmico atual.
120

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

Reflexes sobre o gasto pblico e o crescimento econmico no Brasil e no mundo:


contribuies baseadas na reviso integrativa

Cada coluna do Anexo 1 pode ser vista como um dos objetivos que estudos sobre a
TGNCQICUVQRDNKEQUWCSWCNKFCFGGETGUEKOGPVQGEQPOKEQFGXGOCDQTFCTQW
CVOGUOQCFOKVKTEQOQNKOKVCQRCTCETKCTWOCEQPVGZVWCNK\CQFQOQFGNQ
proposto que o aproxime da realidade qual este se prope a representar.
#UUKO RQFGOQU UKPVGVK\CT QU UGIWKPVGU HCVQTGU RCTC WO GUVWFQ FC TGNCQ ICUVQ
pblico, sua qualidade e crescimento econmico:
FKUETKOKPCQFQUICUVQURDNKEQUUGIWPFQCGUHGTCIQXGTPCOGPVCN
FKUETKOKPCQFQUICUVQURDNKEQUUGIWPFQCPCNKFCFGRTQRQUVC
OGPUWTCQFCSWCNKFCFGFCCRNKECQFQUTGEWTUQUICUVQU
GORTGIQFGFCFQUOWNVKPCEKQPCKU
GORTGIQFGXCTKXGKUKPVGTXGPKGPVGU
WVKNK\CQFGQWVTCUOGFKFCUFGETGUEKOGPVQGEQPOKEQ
RGTKQFKEKFCFGFCUTKGJKUVTKECFGFCFQUGORTGICFC
OGVQFQNQIKCUSWCPVKVCVKXCUGORTGICFCUPCCPNKUG
TGUWNVCFQUGPEQPVTCFQUPQUGUVWFQUEQPUKFGTCFQU

Primeiramente, vale entender se para os estudos contemplados a discriminao


dos gastos pblicos segundo a esfera governamental um dos fatores de relevncia.
A importncia em se considerar o gasto segundo a esfera governamental est na
TGGZQUQDTGCGUVTWVWTCHGFGTCNKUVC'UUGHCVQTRCTGEGUGTFGRCTVKEWNCTKPVGTGUUGFQU
pesquisadores nacionais, visto que, dentre os artigos nacionais analisados, trs dos
CTVKIQUEQPUKFGTCOGOCNIWOITCWCFGEQORQUKQRQTGUHGTCUIQXGTPCOGPVCKU
GWOGUVWFCGURGEKECOGPVGQICUVQFQUGUVCFQU2QTUWCXG\PGPJWOFQUCTVKIQU
KPVGTPCEKQPCKUFGFKECCVGPQCGUVGHCVQT
6CNFKUVKPQGPVTGQUGUVWFQUPCEKQPCKUGKPVGTPCEKQPCKUKPFKECWOCRTGQEWRCQ
FCCECFGOKCPCEKQPCNGOTGNCQCQURCRKUFCUGUHGTCUIQXGTPCOGPVCKUPQICUVQ
RDNKEQPCIGTCQFGETGUEKOGPVQGEQPOKEQGQRCRGNFCUGUHGTCU#CWUPEKC
desse fator nos estudos internacionais pode indicar que, segundo a viso acadmica
fora do Brasil, a questo das esferas governamentais de importncia menor em
TGNCQCQWVTQUHCVQTGU
Por sua vez, a importncia da FKUETKOKPCQGPVTGCUPCNKFCFGUFGICUVQ muito mais
GORTGICFCRGNQUGUVWFQUFQKUCTVKIQUPCEKQPCKUGORTGICTCOCFKUETKOKPCQFQU
gastos, enquanto quatro abordaram apenas parte dos gastos ou focaram em um tipo
GURGEEQFGICUVQQUEKPEQQWVTQUFQUCTVKIQUPCEKQPCKUPQVTCVCOQICUVQFG
maneira decomposta. Por sua vez, dos 21 artigos internacionais considerados, apenas
VTUNGXCTCOGOEQPVCCFGEQORQUKQFQUICUVQURNGPCOGPVGGPSWCPVQFG\ETKCTCO
ECVGIQTKCUUKORNKECFQTCU
GZICUVQFGECRKVCNICUVQEQTTGPVGGKPXGUVKOGPVQ QW
CDQTFCTCOICUVQUGURGEEQU

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

121

Valdocu de Queiroz/Johan Hendrik Poker Junior

1UTGUWNVCFQUGPEQPVTCFQUKPFKECOCKORQTVPEKCFCEQORQUKQFQUICUVQURCTCQ
ETGUEKOGPVQGEQPOKEQ)CUVQUFGFKHGTGPVGUPCVWTG\CUVOTGNCGUFKHGTGPVGUEQO
QETGUEKOGPVQGEQPOKEQ&GUUCHQTOCQUGUVWFQUSWGEQPUKFGTCOCEQORQUKQ
FQUICUVQURGTOKVGOCKFGPVKECQFQRCRGNFGUGORGPJCFQRGNQICUVQRDNKEQPQ
crescimento econmico. Outro fator relevante para o crescimento econmico
a qualidade do gasto pblicoFCFCCECRCEKFCFGFGGUUGHCVQTOQFKECTVQVCNOGPVG
CUTGNCGUFQUICUVQUGORTGGPFKFQURQTWOIQXGTPQGQETGUEKOGPVQGEQPOKEQ
do pas. Surpreendentemente, essa varivel ainda no vem sendo utilizada com
frequncia nos estudos (tanto nas pesquisas nacionais quanto nas internacionais).
Dos 11 artigos nacionais, apenas um utiliza indicador de qualidade dos gastos,
e nos estudos internacionais, sete artigos utilizam algum tipo de medida de qualidade
do gasto pblico.
6QKORQTVCPVGSWCPVQCPCNKUCTQUICUVQUGUWCEQORQUKQGZCOKPCTCTGNCQFGUVGU
com o crescimento econmico em ambientes diversos, adquirindo, dessa forma,
UWDUFKQURCTCFGEKUGUTGNCVKXCUCEQPFKGUGEQPOKECUGURGEECUQDUGTXCFCUPQU
pases tratados nos estudos. Assim, o emprego de dados multinacionais um fator com
ITCPFGUEQPVTKDWKGUPQGUVWFQFCTGNCQICUVQRDNKEQGETGUEKOGPVQGEQPOKEQ
0GUUGEQPVGZVQPCTGXKUQKPVGITCVKXCCSWKTGCNK\CFCHQTCOKFGPVKECFQUFQKUGUVWFQU
nacionais, dos 11 considerados, que utilizaram dados multinacionais, enquanto 15 dos
21 estudos internacionais utilizaram bases de dados multinacionais. Esses nmeros
podem ser explicados pelos propsitos aos quais a maioria dos artigos nacionais se
destina perante os artigos internacionais. Os primeiros buscam, principalmente,
CPCNKUCTCUTGNCGUJKUVTKECU
XCTKXGKUGZIGPCUPQEQPVTQNXGKU FGVGTOKPCPVGU
FCUTGNCGUGPEQPVTCFCU1UGIWPFQITWRQRQTUWCXG\GUVWFCCUTGNCGUGPVTG
QUICUVQURDNKEQUGQETGUEKOGPVQGEQPOKEQPCRTGUUWRQUKQFGSWGCUXCTKXGKU
exgenas sejam secundrias diante das variveis consideradas no estudo.
A questo anterior enseja a prxima: esto sendo empregadas variveis intervenientes
nos estudos analisados? Parte da resposta a essa questo foi tratada anteriormente,
dado o interesse de destaque para a qualidade do gasto (uma das variveis
intervenientes mais importantes). No entanto, existem outras variveis a ser
consideradas. Nos artigos analisados, encontraram-se dois estudos nacionais dos 11
presentes no estudo no qual foram consideradas variveis intervenientes entre o gasto
pblico e o crescimento econmico, enquanto oito dos 21 estudos internacionais
trataram alguma varivel interveniente alm da qualidade, previamente destacada.
OWKVQOCKUFKHEKNKFGPVKECTQKORCEVQFGXCTKXGKUKPVGTXGPKGPVGUPQEQPVTQNXGKU
quando se estuda bases multinacionais, no entanto nestas possvel trabalhar de
HQTOCOCKUCRTQHWPFCFCCTGNCQFGXCTKXGKUGZIGPCUOGPUWTXGKUGEQPVTQNXGKU
UQDTGCTGNCQICUVQRDNKEQGETGUEKOGPVQGEQPOKEQ
Nos estudos nacionais, as variveis exgenas testadas foram carga tributria e
UWRGTXKVFEKVGPSWCPVQPQUGUVWFQUKPVGTPCEKQPCKUHQTCOVGUVCFCUCUXCTKXGKU
122

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

Reflexes sobre o gasto pblico e o crescimento econmico no Brasil e no mundo:


contribuies baseadas na reviso integrativa

UWRGTXKVFEKVVCOCPJQFQIQXGTPQXQNCVKNKFCFGFQUICUVQUXQNCVKNKFCFGFQ2+$
receita bruta de impostos e estatais, taxa de desemprego, volume de crdito presente
na economia, mobilidade do capital e volume de gasto privado.
A diversidade de variveis exgenas testadas internacionalmente pode ser explicada
em conjunto com a multinacionalidade das bases: para obter um modelo econmico
EQOOCKQTRQFGTGZRNKECVKXQGUGOXKGUGUPQUGUVKOCFQTGUGPVTGCTGNCQICUVQ
pblico e crescimento econmico, os estudos fazem uso de variveis exgenas
SWGRQVGPEKCNOGPVGKPWGPEKGOCTGNCQGFGEGPTKQUOCKUFKXGTUQU1UITCWUFG
UWEGUUQPQUGUVWFQUUQXCTKXGKUUGPFQCNIWPURCTVKEWNCTKFCFGUFCEQPFKQXKXKFC
por alguns dos pases estudados (como o caso da mobilidade do capital, varivel
KORQTVCPVGPCUGEQPQOKCUFC\QPCFQGWTQ 2QTUWCXG\QUWRGTXKVFEKVOCKU
KORQTVCPVGPCDWUECFCKPWPEKCFQETGUEKOGPVQGEQPOKEQPQICUVQRDNKEQOCU
no o oposto. Considerando-se o cenrio econmico recente no Brasil, podem ser
percebidas oportunidades no uso de algumas das variveis propostas em estudos
internacionais.
Alm dos fatores abordados, pode-se tambm avaliar a utilizao de outras medidas
de crescimento econmicoQWCFGEQORQUKQFQETGUEKOGPVQGEQPOKEQGOQWVTQU
HCVQTGUSWGTGKVCOQETGUEKOGPVQUWUVGPVXGNPCEKQPCN&GPVTGQUCTVKIQUPCEKQPCKU
HQTCOGPEQPVTCFQUEKPEQGUVWFQUSWGWVKNK\CTCOXCTKXGKUGURGEECU
OGNJQTCUGO
PFKEGUFGGFWECQUCFGQWKPHTCGUVTWVWTC 0QUCTVKIQUKPVGTPCEKQPCKUSWCVTQ
estudos consideraram variveis tais como fator de demanda agregada, fator de
produtividade e investimento, produtividade das empresas, consumo agregado e
total da infraestrutura nacional.
Mesmo sendo uma varivel operacional para crescimento econmico consolidada,
o PIB (em ingls: gross domestic product GDP) uma varivel sujeita a crticas,
XKUVQSWGECRVWTCCRGPCUQXCNQTFCRTQFWQFGDGPUFGEQPUWOQGFGECRKVCNG
UGTXKQUXKUXGKUGOGPUWTXGKUFCPFQOCTIGOCSWGUVKQPCOGPVQUTGNCVKXQUCQUDGPU
GCQUUGTXKQUKPVCPIXGKURTGUGPVGUPCUGEQPQOKCU2QTGUUCTC\QCWVKNK\CQFG
outras variveis, ou de variveis complementares, deve ser considerada em estudos
relacionando gasto pblico e crescimento econmico.
Os dois fatores a serem tratados a seguir, a periodicidade das sries histricas de dados
empregadas nos artigos e a metodologia quantitativa empregada na anliseTGGVGO
CURGEVQU OCKU QRGTCEKQPCKU FC CPNKUG FC TGNCQ ICUVQ RDNKEQ G ETGUEKOGPVQ
econmico.
O primeiro desses dois fatores, a periodicidade das sries histricas, de grande
KORQTVPEKCRCTCSWGHCVQTGUGZIGPQURCTVKEWNCTOGPVGEQPFKGUOCETQGEQPOKECU
INQDCKUPQKPWGPEKGOVCPVQPCGUVKOCVKXCFCTGNCQGPVTGQICUVQRDNKEQGQ
crescimento econmico, pois com o uso de perodos mais longos acrescenta-se
KPHQTOCQRCTCCUGUVKOCVKXCUOGNJQTCPFQQUGUVKOCFQTGUPQOQFGNQGUVCVUVKEQ
Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

123

Valdocu de Queiroz/Johan Hendrik Poker Junior

Em contrapartida, o emprego de perodos longos pode ser uma armadilha, uma


XG\ SWG Q OCKQT KPVGTGUUG FQU IGUVQTGU RDNKEQU CQ EQPUKFGTCTGO GUUCU TGNCGU
compreender o contexto atual e suas tendncias futuras. Assim, importante
manter um equilbrio entre o tamanho do perodo histrico e sua relevncia para
os contextos atual e futuro.
1UGUVWFQUPCEKQPCKUEQPUKFGTCFQU\GTCOWUQFGFCFQUCVQCPQFGVGPFQ
a maioria utilizado dados anteriores a esta data. O artigo com um perodo mais
amplo utiliza os dados de gastos pblicos e crescimento econmico a partir de 1948.
Convm mencionar que a maioria dos estudos no utiliza mais de vinte anos de
histrico para suas estimativas.
Os artigos internacionais utilizam dados mais recentes, utilizando o mais atual,
publicado em 2012, dados de at 2010 em sua srie. A maior parte dos estudos
internacionais utiliza sries entre 15 e 30 anos para seus estudos. Tambm para os
artigos internacionais o perodo histrico mais longo se inicia em 1948.
O segundo dos dois fatores operacionais dos estudos diz respeito s metodologias
FGCPNKUGGORTGICFCU1RTKPEKRCNFGUCQFGUUCUVEPKECUECRVCTCKPVGTTGNCQ
GPVTGICUVQURDNKEQUGETGUEKOGPVQGEQPOKEQWOITCPFGFGUCQEQPUKFGTCPFQUG
a quantidade de variveis exgenas presentes no contexto deste estudo. Para tanto,
empregam-se, preferencialmente, metodologias de srie temporal. No entanto,
RTGUGPVGCPGEGUUKFCFGFGUGFGEQORQTQUICUVQURDNKEQUGFGUGEQPUKFGTCTCKPWPEKC
de variveis exgenas, o problema obriga o emprego de tcnicas multivariadas.
#NO FKUUQ  KORQTVCPVG NGODTCT FC PGEGUUKFCFG FG GZVTCKT KPHQTOCGU
interpretveis. Dessa forma, no se despreza o emprego de estudos descritivos para
esse tipo de problema de pesquisa.
Dos 11 artigos nacionais, trs utilizaram estatsticas descritivas para referenciar
exogeneidades e desenvolver anlises qualitativas-quantitativas na questo de
RGUSWKUC QWVTQU EKPEQ GORTGICTCO VEPKECU OWNVKXCTKCFCU UGO GHGKVQ FG UTKGU
temporais (regresso pooled FG SWCFTCFQU OPKOQU QTFKPTKQU  G VTU GUVWFQU
GUVCDGNGEGTCOTGNCGURQTOGKQFCVEPKECFGCPNKUGFGFCFQUGORCKPGNSWGNGXC
em conta tanto a temporalidade da srie de dados quanto permite mltiplas variveis
PCUTGNCGU
Entre os 21 artigos internacionais, constatou-se que: a) o emprego de estatsticas
FGUETKVKXCUQEQTTGGOCRGPCUWOFQUGUVWFQUD QKVQGUVWFQUWVKNK\CTCOVEPKECU
multivariadas sem efeitos de temporalidade (regresses pooled  E  PQXG GUVWFQU
\GTCOWUQFGVEPKECUFGFCFQUGORCKPGNQWFGUTKGUVGORQTCKUEQOVGUVGFG
ECWUCNKFCFG FG )TCPIGT
DWUECPFQ C KPVGTTGNCQ GPVTG QU ICUVQU RDNKEQU G Q
ETGUEKOGPVQGEQPOKEQGXKEGXGTUCEQOQPCUGSWCGU
 G
 GF VTUGUVWFQU
KPVGTPCEKQPCKU \GTCO WUQ FG TGXKUQ DKDNKQITEC EQO FKHGTGPVGU VEPKECU
VCKU
como reviso narrativa, reviso integrativa e meta-anlise).
124

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

Reflexes sobre o gasto pblico e o crescimento econmico no Brasil e no mundo:


contribuies baseadas na reviso integrativa

Finalmente, deve-se agora discutir os resultados apresentados pelos artigos analisados.


5WEGFGCSWGUVQSWCKUCUTGNCGUKFGPVKECFCUPQUGUVWFQUCPCNKUCFQU!
Para responder a essa questo, importante mencionar a natureza dos estudos
acadmicos: o pesquisador, assim como qualquer indivduo, sujeito s ideologias
de seu contexto cultural, poltico e econmico, e, dessa forma, pode, ao conceber
UGWUGUVWFQUETKCTWORTQFWVQSWGTGKVCGORCTVGUGWUFGUGLQUGCPUGKQU2QTGUUC
TC\QEQPEGDGTGUVWFQUFGSWGUVGUVQUGPUXGKUEQOQCTGNCQCSWKVTCVCFCWO
FGUCQGQUGUVWFQUCSWKUKPVGVK\CFQUFGXGOUGTXKUVQUEQOQTKIQTEKGPVEQEQOQ
SWCNHQTCOHQTOWNCFQUQWUGLCEQOWOCEQPCPCSWGUGEQPFKEKQPCUNKOKVCGU
KPGHXGKUFQURGUSWKUCFQTGUGFCUKPHQTOCGUGFCUVEPKECURQTGNGUWVKNK\CFCU
'PVTGQUCTVKIQUPCEKQPCKUEQPUKFGTCFQUFQKUGPEQPVTCOWOCTGNCQRQUKVKXCGPVTG
ICUVQRDNKEQGETGUEKOGPVQGEQPOKEQVTUCTVKIQUGPEQPVTCOTGNCGURQUKVKXCU
EQPFKEKQPCFCUPCVWTG\CGCQXQNWOGFQICUVQRDNKEQWOCTVKIQGPEQPVTCTGNCQ
negativa entre gasto pblico e crescimento econmico em pases sem indstria blica
PCEKQPCNGQPFGQICUVQEQOFGHGUCHQKGNGXCFQPQUCPQUEQPUKFGTCFQUPQGUVWFQG
QUEKPEQTGUVCPVGUPQUGRTQRGOCGUVCDGNGEGTTGNCGUFGECWUCNKFCFG
0QUGUVWFQUKPVGTPCEKQPCKUUGVGCTVKIQUGPEQPVTCOTGNCGURQUKVKXCUFGECWUCNKFCFG
GPVTGQICUVQRDNKEQGQETGUEKOGPVQGEQPOKEQEKPEQCTVKIQUGPEQPVTCOTGNCGU
positivas, mas condicionadas natureza do gasto, e neles alguns gastos chegam a ter
TGNCQPGICVKXCEQOQETGUEKOGPVQGEQPOKEQFQKUGUVWFQUGPEQPVTCOTGNCQ
negativa entre gastos pblicos e crescimento econmico, novamente em pases
onde o gasto com defesa foi elevado, mas com uma indstria blica inexistente.
&QU TGUVCPVGU WO GUVWFQ PQ GPEQPVTQW TGNCQ UKIPKECVKXC GPVTG CU XCTKXGKU
EQPUKFGTCFCUGUGKUQWVTQURQTUWCPCVWTG\CPQGUVCDGNGEGTCOTGNCGUGPVTGICUVQ
pblico e crescimento econmico.
Assim, ao realizar a reviso integrativa dos artigos selecionados, foram encontradas
GXKFPEKCU SWG EQPTOCO C RTGFQOKPPEKC FQ GHGKVQ RQUKVKXQ RTQFW\KFQ RGNQU
ICUVQURDNKEQUPQETGUEKOGPVQGOGURGEKCNSWCPFQEQPUKFGTCFCCFGEQORQUKQ
dos gastos, mtodo que possibilita apresentar resultados efetivos e no viesados na
TGNCQGUVWFCFC

5 CONSIDERAES FINAIS
%QODCUGPCTGXKUQKPVGITCVKXCFQUCTVKIQUUGNGEKQPCFQUHQKRQUUXGNKFGPVKECT
os principais fatores componentes dos estudos que relacionam o gasto pblico
e o crescimento econmico. Ao considerar a origem e a forma de tratamento
FCFC C GUUGU HCVQTGU PQU FKHGTGPVGU CTVKIQU RQFGUG HC\GT CNIWOCU EQPUKFGTCGU
CTGURGKVQFCTGNCQGUVWFCFC
K CFKUETKOKPCQFQUICUVQURDNKEQUUGIWPFQC
GUHGTCIQXGTPCOGPVCNHCVQTFCOCKQTTGNGXPEKCRCTCQUGUVWFQUPCEKQPCKU
KK C
FKUETKOKPCQFCPCNKFCFGFQICUVQRDNKEQKVGOGUUGPEKCNRCTCCEQORTGGPUQ
Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

125

Valdocu de Queiroz/Johan Hendrik Poker Junior

FGUWCUFKUVKPVCUTGNCGUEQOQETGUEKOGPVQGEQPOKEQ
KKK CSWCNKFCFGFQICUVQ
XCTKXGNKPVGTXGPKGPVGSWGPQRQFGUGTKIPQTCFCPQUGUVWFQUFGUUCTGNCQ
KX Q
GORTGIQFGFCFQUOWNVKPCEKQPCKURCTCCCPNKUGRQUUKDKNKVCQGZCOGFCUKPHQTOCGU
SWGFGQWVTCHQTOCPQRQFGTKCOUGTQDVKFCU
X CKPFCECDGCDWUECRQTXCTKXGKU
KPVGTXGPKGPVGU PC TGNCQ ICUVQ RDNKEQ G ETGUEKOGPVQ GEQPOKEQ RQFGPFQ
FGUUCURGUSWKUCUUWTIKTGOEQPVTKDWKGUKORQTVCPVGURCTCQGUVWFQICUVQRDNKEQ
ETGUEKOGPVQGEQPOKEQ
XK CWVKNK\CQFGQWVTCUXCTKXGKUKPUVTWOGPVCKURCTCC
TGRTGUGPVCQFQETGUEKOGPVQGEQPOKEQCNOFQ2+$RQFGVTC\GTEQPVTKDWKGU
UWDUVCPEKCKUCQUGUVWFQUHWVWTQU
XKK QGORTGIQFGHGTTCOGPVCUFGCPNKUGECFCXG\
OCKUCFGSWCFCUGCWVKNK\CQRNCPGLCFCFGUTKGUJKUVTKECUFGFCFQUXOVQTPCPFQ
os estudos contemporneos cada vez mais robustos em suas concluses.
2QT O GUVG CTVKIQ CRTGUGPVC CURGEVQU TGNGXCPVGU RCTC Q GPVGPFKOGPVQ OCKU
CRTQHWPFCFQFCTGNCQGPVTGICUVQRDNKEQGETGUEKOGPVQGEQPOKEQ#FGOCKU
EQPUVKVWKUGGOUKIPKECVKXQKPUVTWOGPVQFGUVKPCFQQTKGPVCQFGPQXCURGUSWKUCU
GHQTOWNCQFGRQNVKECUIQXGTPCOGPVCKUOQVKXCFQTCUFQETGUEKOGPVQGEQPOKEQ

126

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

Reflexes sobre o gasto pblico e o crescimento econmico no Brasil e no mundo:


contribuies baseadas na reviso integrativa

REFERNCIAS
#$11&; & $ .'8 $ +PHQTOCVKQP CU[OOGVT[ 4& CPF KPUKFGT ICKPU
The Journal of Finance, v. 55, i. 6, p. 2747-2766, dez. 2000.
#$4#*1 , (KPCPEKCOGPVQ G ICUVQ RDNKEQ FC GFWECQ DUKEC PQ $TCUKN G
EQORCTCGUEQOCNIWPURCUGUFC1%&'G#OTKEC.CVKPCEduc. Soc., Campinas,
v. 26, n. 92, p. 841-858, Especial, out. 2005.
#$7$#&'45#$73#40#5)QXGTPOGPVGZRGPFKVWTGUOKNKVCT[URGPFKPI
CPFGEQPQOKEITQYVJECWUCNKV[GXKFGPEGHTQO'I[RV+UTCGNCPF5[TKCJournal of
Policy Modeling, v. 25, i. 6-7, p. 567-583, Sept. 2003.
#(1051#PVPKQ(74%'4+&CXKFG)QXGTPOGPVUK\GEQORQUKVKQPXQNCVKNKV[
and economic growth. European Journal of Political Economy, Elsevier, v. 26(4),
p. 517-532, Dec. 2010.
#)*+102*19+662#/QFGNQHITQYVJVJTQWIJETGCVKXGFGUVTWEVKQP
Econometrica, v. 60(2), p. 323-351, 1992.
#9#0 4 7 #<+& 6 5*'4 ( )TQYVJ KORNKECVKQPU QH IQXGTPOGPV
GZRGPFKVWTGU KP 2CMKUVCP CP GORKTKECN CPCN[UKU Interdisciplinary Journal of
Contemporary Research in BusinessXKUUWGR,WN[
$'%- 6 .'8+0' 4 +PFWUVT[ ITQYVJ CPF ECRKVCN CNNQECVKQP FQGU JCXKPI C
OCTMGV QT DCPMDCUGF U[UVGO OCVVGT! Journal of Financial Economics, v. 64,
p. 147-180, 2002.
$'%- 6 .'8+0' 4 .1#;<# 0 Finance and the sources of growth.
Journal of Financial Economics, 58(1-2), p. 261-300, 2000.
$'<'44#4#4+PEGPVKXQURCTCCRTQOQQFCSWCNKFCFGFQICUVQRDNKEQ
fortalecendo o vnculo entre recursos e resultados. Prmio SOF, 2008.
BILLETT, M. T. et al. Growth opportunities and the choice of leverage, debt
OCVWTKV[CPFEQXGPCPVUThe Journal of FinanceXQN.:++P
$+4&4/9CIPGTU.CYQHGZRCPFKPI5VCVGCEVKXKV[Public Finance, n. 26,
p. 1-26, 1971.
$116* ) ) NC / 5#*.564/ 2 GV CN *QY FQGU VJG CHHGEV VJG UVQEM
market valuation of R&D spending? Journal of Financial Intermediation, n. 15,
p. 197-214, 2006.
$16'.*1..4%70*#%%#/#%'&1/1OVQFQFCTGXKUQ
integrativa nos estudos organizacionais. Gesto e Sociedade, Belo Horizonte,
v. 5, n. 11, p. 121-136, maio/ago. 2011. Disponvel em: <www.ges.face.ufmg.br>.
ISSN: 1980-5756.
Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

127

Valdocu de Queiroz/Johan Hendrik Poker Junior

BROOME, M. A. Integrative literature reviews for the development of concepts.


+P41&)'45$.-0#(.-#
'F Concept development in nursing:
foundations, techniques, and applications. 2. ed. Philadelphia: Saunders, c. 2000.
p. 231-250.
$470'6,()$'46'#/#3WCNKFCFGFQICUVQRDNKEQGOGFWECQ
nas redes pblicas estaduais e municipais. XIII Prmio Tesouro Nacional. Braslia:
STN, 2008.
BUSATO, L. M. The quality of public expenditure and its influence on economic
growth: evidences from the State of Rio Grande do Sul (RS). Working Paper.
9CUJKPIVQP&%6JG)GQTIG9CUJKPIVQP7PKXGTUKV[
CNDIDO JR., J. O. Os gastos pblicos no Brasil so produtivos? Revista
Planejamento e Polticas Pblicas, n. 23, jun. 2001.
%#48#.*1(,%'SWKNDTKQUECNGRQNVKECGEQPOKECMG[PGUKCPC. Revista
Anlise Econmica, Porto Alegre, n. 50, p. 7-25, 2008.
%*#-4#$146; 5 '4# &#$.#0144+5 ' The quality of public
investment. IMF Working Paper, n. 9/154, 2009. Disponvel em: <http://ssrn.
com/abstract=1442256>. Acesso em: 12/12/2012.
%*19 ; ( %1651/+6+5 , -9#0 # /WNVKXCTKCVG EQKPVGITCVKQP CPF
ECWUCNKV[6GUVQH9CIPGTyUJ[RQVJGUKUGXKFGPEGHTQOVJG7-Applied Economics,
n. 34, p. 1671-1677, 2002.
COORAY, A. Government expenditure, governance and economic growth.
Comparative Economic Studies, v. 51 (3), p. 401-418, 2009.
DAO, M. Q. Government expenditure and growth in developing countries.
Progress in Development Studies, v. 12, n. 1, p. 77-82, 2012.
&'/+4)-706 # /#-5+/18+% 8 .CY PCPEG CPF TO ITQYVJ
Journal of Finance, v. 53(6), p. 2107-2137, 1998.
AAAAA(WPFKPIITQYVJKPDCPMDCUGFCPFOCTMGVDCUGFPCPEKCNU[UVGOUGXKFGPEG
HTQOTONGXGNFCVCJournal of Financial Economics, v. 65(3), p. 337-363, 2002.
&+8+01,#5+.8#,44.5Composio dos gastos pblicos e crescimento
econmico dos municpios brasileiros 6TCDCNJQ CRTGUGPVCFQ PQ :::8+++
Encontro Nacional de Economia da Anpec, Salvador, 2010.
&10#6*./+.15//+.15.Public investment and economic growth
in the European Union Member States. Disponvel em: <http://mpra.ub.unimuenchen.de/12954/MPRA>. Paper n. 12954. Acesso em: 12/12/2012.

128

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

Reflexes sobre o gasto pblico e o crescimento econmico no Brasil e no mundo:


contribuies baseadas na reviso integrativa

'5%1$#4 , ( 215#&# % ' %TGEKOKGPVQ GEQPOKEQ [ ICUVQ RDNKEQ
GZRGTKPEKCU KPVGTPCEKQPCNGU [ GN ECUQ EQNQODKCPQ  Monetria, vol.
::8++PR
FEDERAO DAS INDSTRIAS DO ESTADO DO RIO DE JANEIRO
(FIRJAN). Ajuste do gasto pblico e retomada do crescimento econmico. Rio
de Janeiro: Firjan, 2002.
(.14+01/+*#+$1)&#022WDNKEGZRGPFKVWTGRQNKE[KPVJGEQPVGZVQH
economic crisis: challenges and implications. Annals of Faculty of Economics
(CEWNVCVGCFGVKKPG'EQPQOKEG, v. 3, n. 1, p. 294-299, 2009.
(4#0%+5,5/+6*##IGPE[EQUVUCPFKPPQXCVKQPUQOGGORKTKECNGXKFGPEG
Journal of Accounting & Economics, v. 19(2-3), p. 383-409, 1995.
(4'+6#5742%#56410'61##%.7+%4GNCQGPVTGICUVQU
pblicos e crescimento econmico: uma anlise com dados em painel para o
Nordeste. Conj. & Planej., Salvador, n. 162, p. 50-57, jan./mar. 2009.
FURCERI, D. Stabilization effects of social spending: empirical from a panel of
OECD countries. Working Paper. Paris: OECD, 2009.
GANDHI, V. P. Wagners Law of public expenditure: do recent cross-section
EQPTOKV!Public Finance, n. 26, p. 44-56, 1971.
)'//'.. 0 -0'..'4 4 5#0< + The composition of government
expenditure and economic growth: some evidence from OECD countries,
in European Commission, Directorate-General Economic and Financial
Affairs, European EconomyVJGSWCNKV[QHRWDNKEPCPEGUCPFGEQPQOKEITQYVJ
Occasional Papers 45, p. 17-46. Paris: OECD, Mar. 2009.
)*15*5)4')14+17#6JGEQORQUKVKQPQHIQXGTPOGPVURGPFKPICPF
growth: is current or capital spending better? Oxford Economic Papers, Oxford,
X
KUUWG RTUVRWDNKUJGFQPNKPG/CTEJ
)+14&#01 4 61//#5+01 2 %#5+4#)*+ / .G FGVGTOKPCPVK
FGNNGHEKGP\CFGNUGVVQTGRWDDNKEQKNTWQNQFGNNCEWNVWTC+P%#00#4+.
'F 
Mezzogiorno e politiche regionali. Roma: Banca dItalia, 2009. p. 253-278.
)1((/#0+,1PVJGGORKTKECNVGUVKPIQH9CIPGTyU.CYCVGEJPKECNPQVG
Public Finance, v. 23(3), p. 359-364, 1968.
)4155/#0)/*'.2/#0'3WCNKV[NCFFGTUKPVJGVJGQT[QHITQYVJ
Rev. Econ. Stud., v. 58(1), p. 43-61, 1991.
*#5*+/<#&' 0 /;.'5 ) &  )TQYVJ CPF RWDNKE KPHTCUVTWEVWTG
Macroeconomics Dynamics, 14 (Supple), p. 258-274, 2010. ISSN: 1469-8056.
Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

129

Valdocu de Queiroz/Johan Hendrik Poker Junior

*'#.& & +ORTQXKPI VJG SWCNKV[ QH RWDNKE GZRGPFKVWTG +P /#+# # GV CN
Importncia da melhoria da qualidade do gasto pblico no Brasil. Braslia:
II Congresso Consad de Gesto Pblica, 2009.
*+./+05#(##Globalization, public expenses and economic growth:
GXKFGPEGHTQO6WTMG[/PCEQ%GOC7PKXGTUKV[QH/QPCEQ9QTMKPI2CRGT
2006.
+4/'0#-7'*0'.,2TQFWEVKXGIQXGTPOGPVGZRGPFKVWTGCPFGEQPQOKE
growth. Journal of Economic Surveys 9KNG[ $NCEMYGNN X 
  R 
Sept. 2009.
,'05'0/%47$#%-56JGOCTMGVHQTEQTRQTCVGEQPVTQNVJGUEKGPVKE
evidence. Journal of Financial Economics, v. 11(1-4), p. 5-50, 1983.
,+4#0;#-7.-$4#*/#54'0'66JGTGNCVKQPUJKRDGVYGGPIQXGTPOGPV
expenditures and economic growth in Thailand. Journal of Economics and
Economic Education Research, v. 8, n. 1, p. 93-102, 2007.
-';0'5,/General theory of employment, interest and money. London:
Macmillan, 1936.
-+0) 4 ) .'8+0' 4 Finance and growth: Schumpeter might be right.
Quarterly Journal of Economics, v. 108 (3), p. 717-737, 1993.
-+4%*0'4 / %+/#&1/1 , *#726/'+'4 5 Transmission of
government spending shocks in the Euro Area: time variation and driving forces.
Frankfurt: European Central Bank, Working Paper, n. 1219, 2010.
.# 2146# 4 .12'<&'5+.#0'5 ( 5*.'+('4 # 9JCV YQTMU KP
securities laws? Journal of FinanceXQN.:+
 R
LA PORTA, R. et al. Investor protection and corporate governance. Journal of
Financial Economics, v. 58(1-2), p. 3-27, 2000.
AAAAAA.CYCPFPCPEGJournal of Political Economy, v. 106 (6), p. 1113-1155,
1998.
AAAAAA.GICNFGVGTOKPCPVUQHGZVGTPCNPCPEGThe Journal of Finance, v. 52 (3),
p. 1131-1150, 1997.
.1+<+&'5 , 8#/817-#5 ) )QXGTPOGPV GZRGPFKVWTG CPF GEQPQOKE
ITQYVJGXKFGPEGHTQOVTKXCTKCVGECWUCNKV[VGUVKPIJournal of Applied Economics,
7PKXGTUKFCFFGN%GOCXQN8+++PR/C[
/#46+05455+.8#),%,#;/',4()Gasto pblico com infraestrutura de transporte e performance dos estados brasileiros: 1986-2003. Rio
de Janeiro: Enanpad, 2007.
130

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

Reflexes sobre o gasto pblico e o crescimento econmico no Brasil e no mundo:


contribuies baseadas na reviso integrativa

/'0&'5-&55+.8'+4#4%%2)#.81%/4GXKUQKPVGITCVKXC
OVQFQFGRGUSWKUCRCTCCKPEQTRQTCQFGGXKFPEKCUPCUCFGGPCGPHGTOCIGO
Texto Contexto Enferm., Florianpolis, v. 17(4), p. 758-764, out./dez. 2008.
/12*)QXGTPOGPVGZRGPFKVWTGUCPFGEQPQOKEITQYVJVJGUWRRN[CPFFGOCPF
sides. Fiscal Studies, v. 28, n. 4, p. 497-522, 2007.
/1*#2#64#5/+5*4#2%QORQUKVKQPQHRWDNKEGZRGPFKVWTGQPJGCNVJ
CPFGEQPQOKEITQYVJCEQKPVGITCVKQPCPCN[UKUCPFECWUCNKV[VGUVKPIJournal of
Public FinanceXQN+:P
MOTTA, A. R. O combate ao desperdcio no gasto pblicoWOCTGGZQDCUGCFC
PCEQORCTCQGPVTGQUUKUVGOCUFGEQORTCRTKXCFQRDNKEQHGFGTCNPQTVGCOGTKECPQ
GDTCUKNGKTQ&KUUGTVCQFGOGUVTCFQ7PKECOR%CORKPCU
/75)4#8'42'#%1%-#2Classics in the theory of public finance.
London: Macmillan & Co. Ltd., 1958.
0#4#;#0224#5#&#5+0)*$#6GUVQHVJG9CIPGTUJ[RQVJGUKUHQT
the Fiji Islands. Journal of Applied Economics, v. 40, n. 21, p. 2793-2801, 2008.
1.+8'+4#04$470+#.&+#5(+.*1,/O isomorfismo e a Lei de
Responsabilidade FiscalWOGUVWFQUQDTGCGXQNWQFQUICUVQURDNKEQU8KVTKC
ENAPG, 2010.
PIRES, J. M. Desenvolvimentismo versus liberalismo econmico no perodo
populista e o gasto pblico social. Economia e Sociedade, Campinas, v. 19, n. 3
(40), p. 529-556, dez. 2010.
RAHMAN, M. Causal relationship among education expenditure, health
GZRGPFKVWTG CPF )&2 C ECUG UVWF[ HQT $CPINCFGUJ International Journal of
Economics and Finance, n. 3, 2011.
4#,#0 4 ) <+0)#.'5 . (KPCPEKCN FGRGPFGPEG CPF ITQYVJ American
Economic Review, v. 88, p. 559-589, 1998.
4#/49CIPGTUJ[RQVJGUKUKPVKOGUGTKGUCPFETQUUUGEVKQPRGTURGEVKXGUGXKFGPEG
from Real data for 115 countries. Review of Economics & Statistics, v. 69 (2),
p. 194-204, 1987.
41&4+)7'5486'+:'+4#'%Gasto pblico e crescimento econmico
no Brasil: uma anlise comparativa dos gastos das esferas de governo. Rio de Janeiro:
RBE, 2010.
41%*# ( )+7$'46+ # % %QORQUKQ FQ ICUVQ RDNKEQ G ETGUEKOGPVQ
GEQPOKEQWOCCXCNKCQOCETQGEQPOKECFCSWCNKFCFGFQUICUVQUFQUGUVCFQU
brasileiros. Econ. Aplic., So Paulo, v. 11, n. 4, p. 463-485, out./dez. 2007.
Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

131

Valdocu de Queiroz/Johan Hendrik Poker Junior

ROMER, P. M. Endogenous technological change. Polit. Econ., v. 98, p. 71-102,


1990.
5#/7&4#/ / 0#+4 / 8#+6*+.+0)#/ 5 -G[PGU CPF 9CIPGT QP
government expenditures and economic development: the case of a developing
GEQPQO[Empirical Economics, v. 36 (3), p. 697-712, 2009.
5%*#.6'))'4%#614).'4$)TQYVJGHHGEVUQHRWDNKEGZRGPFKVWTG
on the state and local level: evidence from a sample of rich governments. Applied
Economics, 38, p. 1181-1192, 2006.
SILVA, A. A. P. et al. Eficincia na alocao de recursos pblicos destinados
educao, sade e habitao em Minas Gerais. Rio de Janeiro: Enanpad, 2010.
5+.8#4#%#5641,#Evoluo e dinmica do gasto pblico no Brasil:
anlise pela metodologia da despesa efetiva do governo federal (1995-2005). Salvador:
ENAPG, 2008.
SILVA JR., R. L. S. Composio dos gastos pblicos e crescimento econmico
dos municpios brasileiros&KUUGTVCQ
/GUVTCFQGO'EQPQOKCFG'ORTGUCU 
UCB, Braslia, 2009.
5+0'8+%+'0' . 8#5+.+#75-#+6' # 2WDNKE GZRGPFKVWTG RQNKE[ KP VJG
EQPVGZVQHE[ENKECNFGXGNQROGPVEconomics and Management, 2009.
5,$'4)2)QXGTPOGPVGZRGFKVWTGUGHHGEVQPGEQPQOKEITQYVJVJGECUGQH
Sweden 1960-2001. Social Science and Business Administration Programmes,
p. 130, 2003.
51.194/#EQPVTKDWVKQPVQVJGVJGQT[QHGEQPQOKEITQYVJQuarterly
Journal of Economics, v. 70, n. 1, p. 65-94, 1956.
TIM, H. Das Gesetz der wachsenden Staatsausgaben. Finanzarchiv, v. 2, p. 201247, 1961.
TORRACO, R. J. Writing integrative literature reviews: guidelines and examples.
Human Resource Development Review, v. 4 (3), p. 356-367, 2005.
WAHAB, M. Economic growth and government expenditure: evidence from a
PGYVGUVURGEKECVKQPAppl. Econ., v. 51 (1), p. 29-39, 2004.
9*+66'/14'4-0#.(-6JGKPVGITCVKXGTGXKGYWRFCVGFOGVJQFQNQI[
Journal of Advanced Nursing, v. 52(5), p. 546-553, 2005.

132

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012


No

No

The relationship between


2007 government expeditures and No
economic growth

No

No

No

Government expeditures
and economic growth: the
UWRRN[CPFFGOCPFUKFGU

Public investment and


economic growth in the
European Union member
states

6JGSWCNKV[QHRWDNKE
PCPEGUCPFGEQPQOKE
growth

,KTCP[CMWN-
Brahmasrene, T.

Mo, P. H.

$CTTKQU5
Schaechter, A.

2008

Donath, L. Et al. 2008

2007

2004

Parcial

No

Parcial

No

%TGEKOKGPVQGEQPOKEQ[
gasto pblico: experincias
KPVGTPCEKQPCNGU[GNECUQ
colombiano, 1982-99

'UEQDCT,(
Posada, C.E.

No

Government expediture and


economic growth: evidence
2004
No
HTQOVTKXCTKCVGECWUCNKV[
testing

.QK\KFGU,
Vamvoukas, G.

Parcial

2003
No

Sim

No

No

No

Sim

No

No

No

Sim

Sim

No

No

Sim

Sim

No

Sim

No

No

No

Sim (excedente
monetrio
superavit)

No

No

No

No

Sim

Sim

Sim

Sim

Sim

Sim

Sim

Sim

Diversos
intervalos

2000-2006

1970-1985

1982-1999

Sim (fator
de demanda
agregada de
produtividade
e investimento)

No

Regresso
(OLS)

4GNCQ

Gasto Positivo em
PIB

NA

Panel Data

Meta-anlise
e Reviso
Integrativa

Gasto de capital
Positivo em PIB,
outros Gastos
Negativo em PIB

Gasto Positivo
em PIB, PIB no
UKIPKECVKXQGO
Gasto

Regresso
(OLS) e
causalidade
de Granger

Regresso
(OLS)

Dependente de pases
pobres, mdios
ou ricos

Gastos Positivo em
PIB para os trs
pases, PIB Positivo
para Gastos na
)TEKCG7-

Gasto de capital
Positivo em PIB,
Gasto corrente
Negativo em PIB

Estatstica
descritiva

Teste de
7-G+TNCPFC
causalidade
(1960-1995) Grcia
de Granger e
(1948-1995)
EQKPVGITCQ

1967-2001

1993-2006

No

Metodologia

Teste de
Gasto Negativo
Egito (1975-1998) causalidade
(para todos os
Israel (1967-1998) de Granger e
gastos, especialmente
Siria (1973-1998) EQKPVGITCQ
Militar) em PIB
de Johansen

Perodo
analisado

No

No

No

No

No

Gasto
Gasto por Qualidade Benchmark
Variveis
4GNCQ 4GNCQEQO
por
PCNKFCFG do gasto internacional intervenientes
PIB
outras variveis
esfera

Government expeditures
effect on economic growth:
the case of sweden 19602001

Sjberg, P.

Ttulo

Sim

#DW$CFGT5
Abu-Qarn, A. S.

Ano

Government expeditures,
OKNKVCT[URGPFKPICPF
2003 GEQPQOKEITQYVJECWUCNKV[ No
CPFGXKFGPEGHTQO'I[RV
+UTCGNCPF5[TKC

Autor

(N)acional/(I)
nternacional

ANEXO
Reflexes sobre o gasto pblico e o crescimento econmico no Brasil e no mundo:
contribuies baseadas na reviso integrativa

133

134

2009

2010

%CUKTCIJK/
)KQTFCPQ4
Tommasino, P.

-KTEJPGT/
%KOCFQOQ,
Hauptmeier, S.

No

No

The composition of
government expenditure
2009
and economic growth:
some evidence from OECD
countries

Gemmell,
0-PGNNGT4
Sanz, I.

2009

Transmission of
Government spending
shocks in the euro area

No

Stabilization Effects of
Social Spending: Empirical
from a panel of OECD
Countries

Furceri, D.

No

No

Productive government
expediture and economic
growth

2009

+TOGP#
-WGJPGN,

Behind public sector


GHEKGPE[VJGTQNGQH
culture and institutions

No

No

Government expediture,
governance and economic
growth

2009

%QQTC[#

Parcial

Sim

Parcial

Parcial

Sim

No

/CETQ2QNKE[CPF+PFWUVT[
Growth: The Effect of
No
%QWPVGT%[ENKECN(KUECN
2QNKE[

#IJKQP2
-JCTTQWDK'

2008

Parcial

Government size,
2008 EQORQUKVKQPXQNCVKNKV[CPF No
economic growth

#HQPUQ#
Furceri, D.

No

Sim

No

Sim

No

Sim

No

Sim

Sim

Sim

No

Sim

Sim

No

Sim

Sim

Sim

Sim

Sim (crdito
a consumidor
PCN

No

Sim (taxa de
desemprego)

No

No

Sim (tamanho)

No

Sim (tamanho,
volatilidade e
receita)

No

Sim

No

Sim

Sim

Sim

Sim

No

Sim

Sim

Sim (consumo)

No

No

No

No

No

Sim
(produtividade
das empresas)

No

No

Gasto
Gasto por Qualidade Benchmark
Variveis
4GNCQ 4GNCQEQO
por
PCNKFCFG do gasto internacional intervenientes
PIB
outras variveis
esfera

Parcial

2008

)JQUJ5
Gregoriou, A.

Ttulo

The composition of
government spending and
No
growth: is current or capital
spending better

Ano

Autor

(N)acional/(I)
nternacional

1980-2008

2006

Diversos
intervalos

1980-2003
incompleto

No se aplica

1996-2003

1980-2005

1970-2004

1972-1999

Perodo
analisado

NA

Gasto e Qualidade
Positivos em PIB

NA

Gasto Negativo
(para todos os gastos)
em PIB

Gasto Positivo em
PIB inclusive gasto
operacional e de
OCPWVGPQ

4GNCQ

Regresso
DC[GUKCPC

NA

Regresso
com varivel
resposta
Qualidade

)CUVQVGOTGNCQ
varivel com
PIB dependendo
de variveis no
observadas (tendo
VGORQEQOQRTQZ[

)CUVQEQO'FWECQ
e Infraestrutura
Posivo em PIB, no
UKIPKECVKXQPQU
demais
Reviso
integrativa e
Panel Data

Gasto Positivo em
Regreso
PIB (como suavisador
(OLS, TS e
de choques
GMM)
econmicos)

Ensaio
Terico

Regresso
(GMM)

Panel Data

Panel Data

Panel Data

Metodologia

Valdocu de Queiroz/Johan Hendrik Poker Junior

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

Ano

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012


No

No

Government expenditure
and growth in developing
countries

Globalization,
PublicExpenses and
Economic Growth:
'XKFGPEGHTQO6WTMG[

Sim

No

Gasto pblico com


infraestrutura de transporte
2007
e performance dos estados
brasileiros

Abraho, J.

Martins, R. S.
Et al.

No

Financiamento e gasto
RDNKEQFCGFWECQDUKEC
2005
PQ$TCUKNGEQORCTCGU
com alguns pases da OCDE
e Amrica Latina

Ajuste do gasto pblico e


retomada do crescimento
econmico

FIRJAN

2002

No

No

Growth implications of
government expeditures
in Pakistan: An enpirical
CPCN[UKU

WP

*KNOK0
Safa, A.

No

Parcial

Parcial

No

Parcial

No

No

Parcial

Parcial

No

No

No

Parcial

No

No

No

No

No

Sim

Sim

No

Sim

Sim

No

Sim

No

No

No

No

Sim (gasto
privado)

No

Sim (poltica
UECN

Sim
(mobilidade
do capital)

Sim

No

No

Sim

Sim

Sim

Sim

No

No

No

No

No

No

1986-2003

1995-2002

Diversos
intervalos

1947-1995

1987-2004

2008/2010

1973-2007

Sim (Gasto
Produtivo,
Gasto NoProdutivo,
Investimento)

No

2004

Perodo
analisado

Sim (infraestrutura e
gasto pblico)

Gasto
Gasto por Qualidade Benchmark
Variveis
4GNCQ 4GNCQEQO
por
PCNKFCFG do gasto internacional intervenientes
PIB
outras variveis
esfera

Growth and public


infrastructure

Ttulo

Os gastos pblicos no Brasil


Cndido Jr., J. O. 2001
so produtivos?

2012

Dao, M. Q.

2011

Awan et al.

*CUJKO\CFG0
2010
/[NGU)&

Autor

(N)acional/(I)
nternacional

NA

4GNCQ

Panel Data

Estatstica
descritiva

Gasto em
Infraestrutura,
transporte e
EQOWPKECQ
Positivo em PIB

NA

NA

Gasto Negativo
sem Investimentos,
Positivo com
Investimentos em
PIB
Panel Data
e Regresso
(OLS)

Estatstica
descritiva

Gasto No
UKIPKECVKXQGO2+$

Gasto Positivo em
PIB

Regresso
(OLS)

Regresso
(OLS)

Gasto de capital
e Gasto corrente
produtivo Positivos
Panel Data
em PIB, Gasto
corrente improdutivo
Negativo em PIB

Regresso
simples

Metodologia

Reflexes sobre o gasto pblico e o crescimento econmico no Brasil e no mundo:


contribuies baseadas na reviso integrativa

135

136
No

'XQNWQGFKPOKECFQ
gasto pblico no Brasil:
2008 Anlise pela metodologia da
despesa efetiva do Governo
Federal (1995-2005)

4GNCQGPVTGICUVQU
pblicos e crescimento
econmico: uma anlise
2009
com dados em painel para o
Nordeste

FC5KNXC4#
Abraho, J. C.

Freitas, U. R. P.
Et al.

Sim

'EKPEKCPCCNQECQFG
recursos pblicos destinados
No
GFWECQUCFGG
JCDKVCQGO/KPCU)GTCKU

Silva, A. A. P.
Et al.

2010

No

Sim

Gasto pblico e crescimento


econmico no Brasil:
uma anlise comparativa
dos gastos das esferas de
governo

4QFTKSWGU48
2010
Teixeira, E. C.

Sim

Sim

Desenvolvimentismo versus
liberalismo econmico no
perodo populista e o gasto
pblico social

Pires, J. M.

2010

Divino, J. A.,
Silva Jr., R. L. S.

N
No

No

No

Parcial

No

%QORQUKQFQUICUVQU
pblicos e crescimento
econmico dos municpios
brasileiros

2010

No

2007

%QORQUKQFQICUVQ
pblico e crescimento
GEQPOKEQWOCCXCNKCQ
Parcial
macroeconmica da
qualidade dos gastos dos
estados brasileiros

4QEJC(
Giuberti, A. C.

Sim
(relativa)

No

No

No

No

No

No

No

No

No

No

No

No

No

No

Sim

No

Sim

Sim (superavit)

Sim (carga
tributria)

No

No

Sim

No

Sim

Sim

Sim

Sim

1948-1998

2004

Sim (variveis
RCTCGFWECQ
saude e
infraestr)

1930-1964

1991-2000

1999-2007

1995-2005

1986-2003

Perodo
analisado

No

No

No

No

No

No

Gasto
Gasto por Qualidade Benchmark
Variveis
4GNCQ 4GNCQEQO
por
PCNKFCFG do gasto internacional intervenientes
PIB
outras variveis
esfera

Ttulo

Ano

Autor

(N)acional/(I)
nternacional

DEA (Data
Envelopment
#PCN[UKU

Regresso
(OLS)

Meta-anlise
e Estatstica
descritiva

Regresso
(OLS)

Regresso
(OLS)

Estatstica
descritiva

Panel Data

Metodologia

NA

Gasto de capital
Positivo em PIB,
Gasto corrente no
UKIPKECVKXQGO2+$

NA

Gasto Positivo em
PIB

Gasto de capital
Positivo em PIB,
Gasto corrente
Negativo em PIB

0QUKIPKECVKXQ

Gasto de capital
Positivo em PIB,
Gasto corrente
Positivo at 61% da
Despesa Corrente
em PIB

4GNCQ

Valdocu de Queiroz/Johan Hendrik Poker Junior

Cad. Fin. Pbl., Braslia, n. 12, p. 113-136, dez. 2012

O aproveitamento das economias de escala pelo


Sistema de Registro de Preos
Felipe Ribeiro Alves Morais
%JGHGFC&KXKUQFG.KEKVCo (MDS)
Agente Administrativo do Ministrio do
Desenvolvimento Social e Combate Fome (MDS)
2U)TCFWCFQGO#FOKPKUVTCQ1TCOGPVTKQ
Financeira pela Esaf

Resumo
Este artigo tem o propsito de apresentar e aplicar,
por meio dos resultados de uma pesquisa emprica dos
certames realizados no portal de compras do governo
federal, um modelo economtrico para precificao
de objetos adquiridos pela administrao pblica via
CFGUQUCVCUFQ5KUVGOCFG4GIKUVTQFG2TGQU
542 .
Neste trabalho, propomos uma alternativa diferente
da apresentada recentemente pelo Tribunal de
%QPVCUFC7PKQ
6%7 SWGRQTOGKQFQ#ETFQ
n. 1.233/2012-Plenrio, limitou os quantitativos
contratados em todos os contratos derivados de
uma ata de registro de preos ao quantitativo
mximo previsto no instrumento convocatrio.
O decreto que regulamentou o SRP inovou nos
procedimentos de compras governamentais ao
permitir que inmeros rgos utilizassem registros
de preos provenientes de outra licitao para suas
aquisies e contrataes. Pela antiga sistemtica,
j modificada pela nova interpretao da Corte de
Contas, o licitante vencedor de uma licitao para
registro de preo poderia obter elevados lucros com
os seguidos acrscimos de fornecimento, uma vez
que, nas sucessivas aquisies, o preo permanece o
mesmo. luz dessas questes, tomamos modelo na
literatura que sugere que essas novas quantidades
adquiridas pela administrao sejam fornecidas
por preos ajustados, tendo como fundamento o
aproveitamento das economias de escala devido
multiplicao do fornecimento. Com base
nesse modelo comprovamos sua consistncia e
apresentamos um mtodo para clculo desse novo
preo, o que geraria economia para a administrao
pblica na aquisio dessas quantidades adicionais.

Palavras-chave
Sistema de Registro de Preos. Economias de escala.

Abstract
This article has the purpose to present and to apply,
by means of results of an empiric research of the
events that were done in the shopping portal of
selling of the federal government, one econometric

model to set prices of objects acquired by the Public


Administration by means of the accession of the
OKPWVGU QH VJG 5[UVGO QH 4GIKUVGT QH 2TKEGU
542 
Through this work we propose a different alternative
to the one which was recently presented by the
6TKDWPCN FG %QPVCU FC 7PKQ
6%7  YJKEJ D[
means of the agreement n. 1233/2012-Plenario
limited the quantity contracted by all contracts
derived from a minute of register of prices to the
maximum quantity desired in the summoning
instrument. The Decree that regulated the SRP,
innovated in the governmental procedures of the
government procurement whenever it let that
different places use the price registered coming from
another bidding to their acquisitions and contracts.
To an old systematic, already modified by a new
interpretation of Cut out of Accounts, the bidder
winner of a bidding to register the price could obtain
high profits once that in the successive acquisitions,
the price keeps the same. The point of this question
is, we take as a model in the literature that suggests
these quantities acquired by the administration
will be provided by the adjusted prices, taking as
a base the economy due to the multiplication of
the supply. Starting from this model we proved its
consistency and presented a method to calculate
this new price, what generates economy to the
Public Administration in the acquisition of these
additional quantities.

Keywords
Price Registration System. Economies of scale.

1 INTRODUO
#RGUCTFGGZRTGUUCPC.GKFG.KEKVCGU
e Contratos (LCC), as vantagens da
economia de escala pouco vm sendo
tratadas pelos gestores governamentais.
Tal vantagem, recorrentemente, tem
UKFQ GORTGICFC PCU CSWKUKGU RGNQ
setor privado, sejam empresas sejam
indivduos. No entanto, com o advento
FC TGIWNCOGPVCQ FQ 5KUVGOC FG
4GIKUVTQFG2TGQU
542 GUUGGZEGNGPVG
conceito microeconmico poder ter seu
uso potencializado.

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

137

Felipe Ribeiro Alves Morais

O SRP, mesmo sendo um procedimento vigente desde a Lei n. 8.666/1993, pouco


foi explorado nas compras no setor pblico, principalmente devido ao fato de a
PKECOQFCNKFCFGNKEKVCVTKCRCTCUWCWVKNK\CQVGTUKFQCEQPEQTTPEKCOQFCNKFCFG
FGOQTCFCGEQORNGZCFGGZGEWQ2QTOEQOCXKIPEKCFQ&GETGVQP
que regulamentou o SRP, seu uso tornou-se mais frequente pela possibilidade do
uso do prego, caracterizado pela sua celeridade nos trmites processuais. A maior
novidade do decreto foi permitir que vrios rgos administrativos diferentes daquele
SWGRTQOQXGWCNKEKVCQRWFGUUGODGPGEKCTUGFCCVCFGTGIKUVTQFGRTGQURCTC
UWCUCSWKUKGU
Entretanto, do modo como estava sendo utilizado esse procedimento, percebia-se
que as economias de escala no eram expressamente absorvidas pelo poder pblico,
WOCXG\SWGQURTGQUFQUQDLGVQUNKEKVCFQURGTOCPGEGOZQUKPFGRGPFGPVGOGPVG
da quantidade de fornecimento, proporcionando ganhos de rendimento de escala
para os fornecedores. Recentemente, a Corte de Contas, por intermdio de um
CETFQPQEQPVGZVQFCUCSWKUKGUFGVGEPQNQIKCFCKPHQTOCQFGEKFKWTGUVTKPIKT
em demasia, o instrumento do SRP.
Nesse sentido, este trabalho prope-se a mostrar o resultado de uma pesquisa emprica
UQDTGQDLGVQUNKEKVCFQUWUWCNOGPVGRGNCCFOKPKUVTCQRblica no exerccio de 2010,
EWLQURTGQUUQTGGUVKOCFQURQTOGKQFCCRNKECQFGWOOQFGNQGEQPQOVTKEQC
UGTGUVWFCFQGFGOQPUVTCFQFGOQFQSWGTGKVCOCUGZKUVGPVGUGEQPQOKCUFGGUECNC

/14#+5 1VTCDCNJQEGPVTCUWCUCVGPGUPCWVKNK\CQFQHWPFCOGPVQ
OKETQGEQPOKEQ FC GEQPQOKC FG GUECNC CRNKECPFQ WO OVQFQ FG CRTQRTKCQ
econmica ao procedimento de compras inovado pelo Decreto n. 3.931/2001, em
uma anlise diferente daquela meramente jurdica, costumeiramente empregada.
Para incio do trabalho, CDQTFCFQQCTECDQWQNGICNGCCRNKECDKNKFCFGFQ5KUVGOC
FG4GIKUVTQFG2TGQURCTCCUCSWKUKGUIQXGTPCOGPVCKUOQUVTCPFQVQFCUCUUWCU
XCPVCIGPUGTGUUCNVCPFQCSWGUVQFCCFGUQFCCVCFGTGIKUVTQFGRTGQURQTQWVTQU
rgos. Posteriormente, estudado o conceito microeconmico de rendimentos de
escala e a conexo dessGEQPEGKVQNGIKUNCQXKIGPVGRCTCCUEQORTCUIQXGTPCOGPVCKU
Dando prosseguimento, apresentamos os modelos terico e economtrico, testados
G CXCNKCFQU XKC CRNKECQ FQU FCFQU TGVKTCFQU FC RGUSWKUC GORTKEC 2QT O UQ
CPCNKUCFQU QU TGUWNVCFQU FC RGUSWKUC C O FG UG ECNEWNCT EQO DCUG PQ OVQFQ
CRTGUGPVCFQQUPQXQURTGQUFQUQDLGVQURGUSWKUCFQUXGTKECPFQQSWCPVQRQFGTKC
ter sido economizado caso o modelo economtrico fosse posto em prtica pela
CFOKPKUVTCQRblica.

2 ARCABOUO LEGAL DO SISTEMA DE REGISTRO DE PREOS


#.GKFG.KEKVCGUG%QPVTCVQU.GKPFGFGLWPJQFGCQFKURQT
em seu art. 15, inciso II, que as compras pblicas sempre que possvel devero ser
RTQEGUUCFCURGNQ5KUVGOCFG4GIKUVTQFG2TGQU
542 KPVTQFW\KWPQQTFGPCOGPVQ
138

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

O aproveitamento das economias de escala pelo Sistema de Registro de Preos

LWTFKEQPCEKQPCNWOPQXQRTQEGFKOGPVQCUGTWVKNK\CFQRGNCCFOKPKUVTCQRDNKEC
O pargrafo 3oFQCTVKIQUWRTCEKVCFQFGVGTOKPCSWGQ5KUVGOCFG4GIKUVTQFG2TGQU
ser regulamentado por decreto, atendidas as peculiaridades regionais.
No plano federal, o SRP foi regulamentado pelo Decreto n. 3.931, de 19 de setembro
de 2001. Conforme se extrai do art. 1o, inciso I, do mencionado decreto, o SRP
WOEQPLWPVQFGRTQEGFKOGPVQURCTCTGIKUVTQHQTOCNFGRTGQUTGNCVKXQURTGUVCQ
FGUGTXKQUG CSWKUKQFGDGPURCTCEQPVTCVCGUHWVWTCU
&GCEQTFQEQOQ&GETGVQPQTGIKUVTQFGRTGQFCTUG pelas modalidades
licitatrias da concorrncia, com base na Lei n. 8.666/1993, ou do prego, conforme
previso na Lei n. 10.520/2002. Assim, no h de se confundir o SRP com modalidade
NKEKVCVTKCEQOQCNIWPUCFOKPKUVTCFQTGUCTOCO6TCVCUGFGWORTQEGFKOGPVQC
UGTWVKNK\CFQSWCPFQCCFOKPKUVTCQRblica se deparar com certas circunstncias,
CUSWCKUCKPFCUGTQVTCVCFCUPGUVCUGQ'OUWOCUGWRTQEGFKOGPVQPQFKHGTG
FQURTQEGFKOGPVQUCUGTGOWVKNK\CFQUPCUNKEKVCGUEQPXGPEKQPCKUQWUGLCUWCHCUG
KPVGTPCRGTOCPGEGCOGUOCPGEGUUKVCPFQFCGNCDQTCQFQ2TQLGVQ$UKEQQWFQ
6GTOQFG4GHGTPEKCEQOCUFGXKFCUGURGEKECGUFQUQDLGVQUCUGTGONKEKVCFQU
7OCFCUFKHGTGPCUFQ5KUVGOCFG4GIKUVTQFG2TGQUSWGCQRCTVKEKRCTFQEGTVCOG
QNKEKVCPVGCRTGUGPVCUWCRTQRQUVCEQODCUGPQRTGQFGWOCWPKFCFGFQKVGOQW
FQQDLGVQNKEKVCFQGPQUQDTGQSWCPVKVCVKXQVQVCNEQOQCEQPVGEGPCUNKEKVCGU
VTCFKEKQPCKU1WVTCFKHGTGPCQEQTTGSWCPFQCFKURWVCFCNKEKVCQVGTOKPCRQKUC
empresa consagrada vencedora no assinar, como no procedimento tradicional,
o termo de contrato administrativo ou outro equivalente, mas a ata de registro de
RTGQU 0GUUG FQEWOGPVQ ECT TGIKUVTCFQ Q RTGQ QHGTVCFQ RCTC C WPKFCFG FQ
objeto licitado sobre o qual o licitante se consagrou vencedor. O prazo de validade
da ata no poder ser superior a um ano, conforme art. 4o do Decreto n. 3.931/2001.
Outro fato inovador trazido pelo SRP, talvez o mais interessante, est no fato de
PQQDTKICTCCFOKPKUVTCQCCFSWKTKTVQFQQSWCPVKVCVKXQKPHQTOCFQPCCVC'UUC
CGZRNKECQRGNCSWCNQUNKEKVCPVGUEQPEQTTGORGNQXCNQTWPKVTKQFQRTQFWVQRQKUC
CFOKPKUVTCQPQGUVQDTKICFCCCFSWKTKTQSWCPVKVCVKXQVQVCNNKEKVCFQECDGPFQNJG
o juzo de convenincia e oportunidade quanto deciso ao quantitativo realmente
necessrio, de acordo com sua real demanda. Nesse sentido, o Decreto n. 3.931/2001,
alterado pelo Decreto n. 4.342, de 23 de agosto de 2002, indica em quais hipteses
UGTCFQVCFQQTGIKUVTQFGRTGQUin verbis:
Art. 2 Ser adotado, preferencialmente, o SRP nas seguintes hipteses:
+SWCPFQRGNCUECTCEVGTUVKECUFQDGOQWUGTXKQJQWXGTPGEGUUKFCFGFG
EQPVTCVCGUHTGSWGPVGU
++SWCPFQHQTOCKUEQPXGPKGPVGCCSWKUKQFGDGPUEQORTGXKUQFGGPVTGICU
RCTEGNCFCU QW EQPVTCVCQ FG UGTXKQU PGEGUUTKQU  #FOKPKUVTCQ RCTC Q
FGUGORGPJQFGUWCUCVTKDWKGU
+++SWCPFQHQTEQPXGPKGPVGCCSWKUKQFGDGPUQWCEQPVTCVCQFGUGTXKQU
RCTCCVGPFKOGPVQCOCKUFGWOTIQQWGPVKFCFGQWCRTQITCOCUFGIQXGTPQG
Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

139

Felipe Ribeiro Alves Morais

+8SWCPFQRGNCPCVWTG\CFQQDLGVQPQHQTRQUUXGNFGPKTRTGXKCOGPVGQ
SWCPVKVCVKXQCUGTFGOCPFCFQRGNC#FOKPKUVTCQ

#UUKOVQFCXG\SWGCCFOKPKUVTCQUGFGRCTCTEQOUKVWCGUEQOQCUVTC\KFCU
pelo art. 2o do Decreto n. 3931/2001, o SRP tornar-se- o procedimento indicado
RCTCNKEKVCQ
Uma das vantagens do SRP reside na economia processual, reduzindo a quantidade
FGNKEKVCGUFGQDLGVQUUGOGNJCPVGUGJQOQIPGQU#PVGUFQ542VQFCXG\SWG
CCFOKPKUVTCQPGEGUUKVCUUGFGTGKVGTCFCUCSWKUKGUFQOGUOQQDLGVQRTGEKUCXC
TGCNK\CTPQXQURTQEGFKOGPVQUNKEKVCVTKQU%QOCKPUVKVWKQFQTGIKUVTQFGRTGQU
DCUVCWOCPKECNKEKVCQRQKUQURTGQUECOTGIKUVTCFQUGRGTOCPGEGOFKURQPXGKU
RCTCCCFOKPKUVTCQRGNQRGTQFQFGCVWOCPQ
Outra grande vantagem do SRP est no fato da desnecessidade de recursos
QTCOGPVTKQURCTCCDGTVWTCFQRTQEGFKOGPVQNKEKVCVTKQXKC542QUSWCKUUQOGPVG
seroPGEGUUTKQUSWCPFQFCGHGVKXCEQPVTCVCQQWCSWKUKQ0GUUGUGPVKFQWO
TIQ SWG GUVGLC EQO TGEWTUQU DNQSWGCFQU PQ RTGEKUC CIWCTFCT C NKDGTCQ FQU
recursos para realizar os procedimentos licitatrios, e assim que os recursos estiverem
CDGTVQULRQFGFGKOGFKCVQCFSWKTKTQUKVGPURQTOGKQFCCVCFGTGIKUVTQFGRTGQU
j assinada.
Estas e outras vantagens so citadas pelo professor Fernandes (2010, p. 28), que
CUUKO GZRG =? Q 5KUVGOC FG 4GIKUVTQ FG 2TGQU EQPUVKVWKUG GO KORQTVCPVG
instrumento de gesto no qual as demandas so incertas, frequentes ou de difcil
OGPUWTCQ=?&KUEQTTGCKPFCQOGUOQCWVQTSWGQUKUVGOCFGCSWKUKQRQT
RTGQU TGIKUVTCFQU XKCDKNK\C CQ IGUVQT CPVGTEKRCTUG U FKEWNFCFGU G EQPFW\KT Q
procedimento licitatrio com vrios meses de antecedncia, evitando as sistemticas
urgncias de atendimento.
O doutrinador Justen Filho (2005, p. 144) converge em entendimento com Fernandes
(2010), vejamos:
15KUVGOCFG4GIKUVTQFG2TGQU
542 WOCFCUOCKUVGKUGKPVGTGUUCPVGU
CNVGTPCVKXCUFGIGUVQFGEQPVTCVCGUEQNQECFCFKURQUKQFC#FOKPKUVTCQ
2DNKEC#UXCPVCIGPURTQRKEKCFCURGNQ542CVCWVQTK\COCKPVGTRTGVCQFG
SWGUWCKPUVKVWKQQDTKICVTKCRQTVQFQUQUGPVGUCFOKPKUVTCVKXQUPQUG
tratando de uma mera escolha discricionria.

No conceito de Niebuhr (2008, p. 315), o SRP um procedimento especial destinado


GEKPEKCPQIGTGPEKCOGPVQFGEQPVTCVQUFGDGPUGUGTXKQURQTKPVGTOFKQFQ
SWCNQXGPEGFQTFCNKEKVCQCUUKPCCVCFGTGIKUVTQFGRTGQUEQORTQOGVGPFQUGC
QHGTGEGTCRTGQWPKVTKQZQQQDLGVQNKEKVCFQFGCEQTFQEQOCUPGEGUUKFCFGUFC
CFOKPKUVTCQPCSWCPVKFCFGGPQRTC\QRTGZCFQUPQGFKVCNPQRQFGPFQGUUG
prazo ultrapassar um ano.
140

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

O aproveitamento das economias de escala pelo Sistema de Registro de Preos

Tendo essas funcionalidades, o SRP, que dever obedecer a todos os princpios


KPGTGPVGUUCSWKUKGUIQXGTPCOGPVCKUUWUVGPVCUGPQQTFGPCOGPVQLWTFKEQXKIGPVG
EQOQHGTTCOGPVCFGKORQTVCPVGFGUDWTQETCVK\CQGIGUVQRCTCQCPFCOGPVQFCU
compras governamentais.

3 A POLMICA DOS CARONAS NO


SISTEMA DE REGISTRO DE PREOS
Com o intuito de regulamentar o procedimento inserido no inciso II do art. 15
FC.GKP5KUVGOCFG4GIKUVTQFG2TGQUQ&GETGVQP
inovou o SRP, ao permitir que rgos no participantes do certame original
RWFGUUGODGPGEKCTUGFCCVCTGIKUVTCFCFGQWVTQrgo, desde que autorizados por
este e mediante consulta ao licitante vencedor. Ou seja, mesmo que no tivessem
RCTVKEKRCFQ FG PGPJWO RTQEGFKOGPVQ KPVGTPQ FC NKEKVCQ EQOQ GNCDQTCQ FQ
termo de referncia ou do projeto bsico, esses rgos no participantes poderiam
DGPGEKCTUGFGUUCNKEKVCQRCTCCSWKUKQFQQDLGVQFGUGLCFQ'UUCRQUUKDKNKFCFG
vem sendo alcunhada de carona. A previso do carona est insculpida no art. 8o
do referido decreto, o qual dispe:
##VCFG4GIKUVTQFG2TGQUFWTCPVGUWCXKIPEKCRQFGTUGTWVKNK\CFCRQT
SWCNSWGTTIQQWGPVKFCFGFC#FOKPKUVTCQSWGPQVGPJCRCTVKEKRCFQFQ
certame licitatrio, mediante prvia consulta ao rgo gerenciador, desde que
devidamente comprovada a vantagem.
1o1UTIQUGGPVKFCFGUSWGPQRCTVKEKRCTCOFQTGIKUVTQFGRTGQUSWCPFQ
FGUGLCTGO HC\GT WUQ FC #VC FG 4GIKUVTQ FG 2TGQU FGXGTQ OCPKHGUVCT UGW
interesse junto ao rgo gerenciador da Ata para que este indique os possveis
HQTPGEGFQTGUGTGURGEVKXQURTGQUCUGTGORTCVKECFQUQDGFGEKFCCQTFGOFG
ENCUUKECQ
2o%CDGTCQHQTPGEGFQTDGPGEKTKQFC#VCFG4GIKUVTQFG2TGQUQDUGTXCFCU
CUEQPFKGUPGNCGUVCDGNGEKFCUQRVCTRGNCCEGKVCQQWPQFQHQTPGEKOGPVQ
independentemente dos quantitativos registrados em Ata, desde que este
HQTPGEKOGPVQPQRTGLWFKSWGCUQDTKICGUCPVGTKQTOGPVGCUUWOKFCU
3o#UCSWKUKGUQWEQPVTCVCGUCFKEKQPCKUCSWGUGTGHGTGGUVGCTVKIQPQ
podero exceder, por rgo ou entidade, a cem por cento dos quantitativos
TGIKUVTCFQUPC#VCFG4GIKUVTQFG2TGQU

#UUKO RGNC TGFCQ FQ FGETGVQ WO TIQ SWG PQ RCTVKEKRQW FG PGPJWO
RTQEGFKOGPVQFCNKEKVCQRQFGFGUFGSWGCWVQTK\CFQRGNQTIQFGVGPVQTFCCVC
GFGEQPUWNVCCQHQTPGEGFQTXGPEGFQTWUWHTWKTFGUUCNKEKVCQRCTCUWCUCSWKUKGU
GEQPVTCVCGU#KPFCFGCEQTFQEQOQcaput do art. 8o citado, basta apenas que
o rgo carona1FGOQPUVTGSWGQQDLGVQRQUUWKRTGQXCPVCLQUQQSWGRQFGUGT
XGTKECFQXKCRGUSWKUCOGTECFQNIKEC
 %QO C KPUVKVWKQ FQ ECTQPC RQFG UGT SWG QU TIQU RTGHKTCO UGT OCKU ECTQPCU FQ SWG IGTGPEKCFQTGU
principalmente pelos custos que enseja um procedimento licitatrio. No entanto, desconsideraremos esse fato
PGUVGVTCDCNJQRQKUXKUCOQUCCVKPIKTGEQPQOKCUFGGUECNCRCTCVQFCCCFOKPKUVTCQRDNKEC

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

141

Felipe Ribeiro Alves Morais

No entanto, diante da novidade, muitos estudiosos do tema, inclusive grandes


FQWVTKPCFQTGU TGNCVCO SWG Q FKURQUVQ CQ RGTOKVKT C IWTC FQ ECTQPC HGTKW C
FKURQUKQEQPVKFCPQCTVFC%QPUVKVWKQ(GFGTCNCQKPQXCTEQOWOCGUREKG
FGUWDUVKVWVKXQNGICNFQRTQEGFKOGPVQNKEKVCVTKQPQRGTOKVKFQRGNC%QPUVKVWKQ
XKIGPVG %QPHQTOG C .GK FG .KEKVCGU G %QPVTCVQU QU PKEQU RTQEGFKOGPVQU
excludentes de procedimento licitatrio so a dispensa e a inexigibilidade. Sendo
CUUKOCQCFOKVKTGUUGRTQEGFKOGPVQQFGETGVQGUVCTKCXKQNCPFQC%QPUVKVWKQFG
1988 e a Lei n. 8.666/1993.
Nesse sentido, Justen Filho (2011) entende como invlido o procedimento em
SWGUVQCTOCPFQSWG
A prtica da carona invlida. Frustra o princpio da obrigatoriedade da
NKEKVCQ EQPIWTCPFQ FKURGPUC FG NKEKVCQ UGO RTGXKUQ NGIKUNCVKXC 0Q
ECDGKPXQECTCGZKUVPEKCFGWOCNKEKVCQCPVGTKQTGKUSWGVCNNKEKVCQVKPJC
PCNKFCFGGNKOKVGFGPKFQUPQGFKVCN

A aplicabilidade do decreto quanto possibilidade de carona tambm posta em


dvida por Niebhr (2006, p. 15), principalmente quanto ao princpio da legalidade,
uma vez que apenas a lei poderia inovar sobre tal possibilidade:
Agora, no constitucionalmente admissvel que regulamento administrativo,
um decreto da lavra do presidente da Repblica, crie o carona sem qualquer
lastro legal, inovando a ordem jurdica por meio da outorga autnoma de
competncia aos agentes administrativos, com repercusses de monta na
esfera jurdica de terceiros.

Assim, ao surpreender o ordenamento jurdico com a possibilidade de um rgo


CFGTKTCCVCUFGTGIKUVTQFGRTGQUFGQWVTQTIQQFGETGVQPQFK\GTFGCNIWPU
GUVWFKQUQUGZVTCRQNQWUWCUHWPGUTGIWNCOGPVCFQTCU'PVGPFGUGCUUKOSWGGUUC
KPQXCQFGXGTKCUGTGFKVCFCRQTOGKQFGWOCNGK
O egrgio Tribunal de Contas da Unio h muito vem discutindo sobre o tema,
FGOQPUVTCPFQ VQFC RTGQEWRCQ ,WTKURTWFGPEKCNOGPVG UWCU RTKOGKTCU FGEKUGU
foram no sentido da legalidade do procedimento, apontando para vantagens
operacionais do SRP, a exemplo dos Acrdos Plenrio ns. 158/2003, 3.165/2003,
214/2006, 1.095/2007, 665/2008 e 324/2009, citados por Silva (2010).
7OCETFQFGUKIPKECVKXCKORQTVPEKCPGUVCFKUEWUUQQFGP2NGPTKQ
GOSWGUGCPCNKUCXCCCFGUQCVCFGTGIKUVTQFGRTGQUFGTIos caronas que
]HUDPHOHYDUXP contrato inicial de R$ 32 milhes para quase R$ 2 bilhes. Esse
CETFQHC\TGEQOGPFCesRCTCSWGQ/KPKUVTKQFQ2NCPGLCOGPVQ1TCOGPVQG
)GUVQ
/21) CFQVGRTQXKFPEKCUEQOXKUVCUTGCXCNKCQFCUTGITCUCVWCNOGPVG
GUVCDGNGEKFCURCTCQTGIKUVTQFGRTGQUPQ&GETGVQP2QTOQ/21)
impetrou pedido de reexame contra o acrdo, atualmente na fase de recurso.
142

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

O aproveitamento das economias de escala pelo Sistema de Registro de Preos

0QGPVCPVQQ#ETFQP2NGPTKQVTQWZGPQXCKPVGTRTGVCQCQho
do artigo 8o do Decreto n. 3.931/2001, informando que, em obedincia ao princpio
FC XKPEWNCQ CQ KPUVTWOGPVQ EQPXQECVTKQ FC .GK P  CU WPKFCFGU
administrativas devem gerenciar a ata de forma que a soma dos quantitativos
contratados em todos os contratos derivados da ata no supere o quantitativo
mximo previsto no edital.
Diante do citado acrdo, caso um rgo licite pelo SRP o quantitativo de cem
unidades de um certo objeto, todos os rgos interessados em aderir a essa ata,
inclusive o rgo gerenciador, s podero adquirir o mximo de cem unidades.
Pela antiga sistemtica, o quantitativo mximo de cem unidades era para cada um
dos rgos interessados em aderir a essa ata, o que poderia aumentar, em muito, a
quantidade a ser fornecida.
Entretanto, no concordamos com a proposta da %QTVGFG%QPVCUSWGCOFGFCT
WOCTGURQUVCCQWUQKPFKUETKOKPCFQGKNKOKVCFQFCUECTQPCUNKOKVQWCUCSWKUKGU
EQPVTCVCGUCQSWGGUVGZRTGUUQPQGFKVCNOGUOQSWGGUUCPQUGLCCNKVGTCNKFCFG
do previsto no Decreto n. 3.931/2001.
1HGTGEGOQU PGUVG VTCDCNJQ WOC UQNWQ FKHGTGPVG FC GORTGICFC RGNQ 6%7 CQ
vislumbrarmos a possibilidade de aproveitamento dos ganhos de economia de
GUECNCPQHQTPGEKOGPVQFGDGPUCFOKPKUVTCQRblica pelas inmeras adeses s
DWDVGHUHJLVWURGHSUHoRVXPDYH]TXGEQOCKPUVKVWKQFQECTQPCCSWCPVKFCFG
FGDGPUHQTPGEKFQURQFGUGTKNKOKVCFCOGPVGCWOGPVCFCGOTGNCQCQSWCPVKVCVKXQ
inicial, gerando enormes lucros aos detentores de uma ata. Para tanto, utilizar-se-
como modelo para este trabalho o mtodo apresentado por Silva (2010) para que
GUUGICPJQUGLCTGXGTVKFQGOGEQPQOKCFQHQTPGEGFQTRCTCCCFOKPKUVTCQRDNKEC

4 CONCEITO DE ECONOMIAS DE ESCALA


Para se aplicar e melhor compreender o mtodo proposto para as compras
governamentais, tendo em vista a possibilidade de incremento nas quantidades
iniciais licitadas via o SRP, h de se explanar sobre o conceito dos rendimentos de
escala ou economias de escala.
&GCEQTFQEQOQUGPUKPCOGPVQUFG8CTKCP
 G-WRHGTG*CUGPENGXGT
 
TGPFKOGPVQFGGUECNCNGXCGOEQPUKFGTCQQEQORQTVCOGPVQGZKUVGPVGGPVTGQU
EWUVQUFGRTQFWQFGWOQDLGVQQWFGWOCCVKXKFCFGKPFWUVTKCNGUWCSWCPVKFCFG
RTQFW\KFC&GUUCHQTOCVGOQUCHWPQFQEWUVQ%
S , que depende da quantidade
produzida q.
Nesse sentido, podem ocorrer rendimentos de escala de trs tipos: constantes,
decrescentes e crescentes. Os rendimentos de escala so constantes quando, por
GZGORNQCQUGVTKRNKECTCSWCPVKFCFGFGKPUWOQQDVOUGQVTKRNQFCRTQFWQQW
UGLCQUEWUVQUETGUEGOGFGETGUEGOPCOGUOCRTQRQTQFCSWCPVKFCFGRTQFW\KFC
Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

143

Felipe Ribeiro Alves Morais

Matematicamente, pode-se representar o fenmeno por meio da expresso:


3C(x1,x2,...,xn) = C(3x1, 3x2,..., 3xn). Ampliando o entendimento, se todos os insumos
aumentam numa razo k, os custos aumentaro nesta mesma razo, ou seja, C(q)/q
EQPUVCPVGRCTCSWCNSWGTRTQFWQq.
No caso dos rendimentos decrescentes de escala, a expresso matemtica pode ser
representada da seguinte forma: C(kx1, kx2,...,kxn) > kC (x1, x2,...,xn . Quando em
determinada indstria ou certo bem acontece esse fenmeno,KiRTXHVHHYLGHQFLD
como deseconomias de escala, pois os custos crescem mais que proporcionalmente
RTQFWQCUUKOC(q)/q ser crescente quando q for aumentado.
Agora, quando se fala em rendimentos crescentes de escala porque os insumos
utilizados crescem proporcionalmente mais do que o aumento dos custos
empregados. Por exemplo, poder acontecer que, ao multiplicar os insumos por uma
razo k, obter-se-o custos menores do que k vezes. A expresso que pode indicar
o relatado pode ser expressa como: C(kx1, kx2,..., kxn) < kC (x1, x2,...,xn). Nesse caso,
diz-se que houve economias de escala, em que a razo C(q)/q decrescente com o
CWOGPVQFCRTQFWQq.
%QPUKFGTCPFQUGCUCSWKUKGUPQUGVQTRDNKEQFGHEKNEQORTGGPUQCVRGNQU
resultados da pesquisa emprica que fundamentou este artigo, que os custos de
RTQFWQ FGETGUEGO EQO Q CWOGPVQ FC SWCPVKFCFG VGPFQ CUUKO TGPFKOGPVQU
crescentes de escala. Alm disso, adotaremos a hiptese de rendimentos crescentes
FGGUECNCNGXCPFQGOEQPVCVCODOSWGCUGORTGUCUHQTPGEGFQTCUFGDGPUGUGTXKQU
CVWCOGOWOPXGNFGRTQFWQFKUVCPVGFGUWCECRCEKFCFGOZKOCKPUVCNCFCFG
HQTOCSWGPQGZKUVGOGPVTCXGUHUKEQURCTCCWOGPVCTCTDKVTCTKCOGPVGUWCRTQFWQ
no impactando, assim, nos seus custos.

5 ESTUDOS SOBRE ECONOMIA DE ESCALA APLICADOS AOS


PROCEDIMENTOS LICITATRIOS
1FGXGTEQPUVKVWEKQPCNFGNKEKVCTKPFKECFQPQKPEKUQ::+FQCTVFC%CTVC/CIPC
e devidamente regulamentado pela LCC, ressalta, em seu artigo 3oSWGCNKEKVCQUG
destina, entre outras coisas, UGNGQFCRTQRQUVCOCKUXCPVCLQUCRCTCCCFOKPKUVTCQ
Tendo essa premissa em mente a busca da vantajosidade , a Lei n. 8.666/1993
RTGXXTKQUOGECPKUOQURCTCSWGCCFOKPKUVTCQRDNKECUGNGEKQPGFGPVTQFQU
princpios que regem os procedimentos licitatrios, tais como a isonomia entre os
NKEKVCPVGUGCNGICNKFCFGFQURTQEGFKOGPVQUCOGNJQTRTQRQUVCRCTCUWCUCSWKUKGU
GEQPVTCVCGUGPVTGQUSWCKUGUVCGEQPQOKCFGGUECNC'UVCGUVRTGXKUVCPC..%
no seu art. 23 pargrafos 1o e 7o, os quais seguem abaixo:
Art. 23 [...]
1o#UQDTCUUGTXKQUGEQORTCUGHGVWCFCURGNC#FOKPKUVTCQUGTQFKXKFKFCU
em tantas parcelas quantas se comprovarem tcnica e economicamente viveis,
144

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

O aproveitamento das economias de escala pelo Sistema de Registro de Preos

RTQEGFGPFQUGNKEKVCQEQOXKUVCUCQOGNJQTCRTQXGKVCOGPVQFQUTGEWTUQU
FKURQPXGKU PQ OGTECFQ G  CORNKCQ FC EQORGVKVKXKFCFG UGO RGTFC FC
economia de escala.
7o Na compra de bens de natureza divisvel e desde que no haja prejuzo
RCTCQEQPLWPVQQWEQORNGZQRGTOKVKFCCEQVCQFGSWCPVKFCFGKPHGTKQT
FGOCPFCFCPCNKEKVCQEQOXKUVCU CORNKCQFCEQORGVKVKXKFCFGRQFGPFQ
QGFKVCNZCTSWCPVKVCVKXQOPKOQRCTCRTGUGTXCTCGEQPQOKCFGGUECNC

0GUUGEQPVGZVQCDWUECFGGEQPQOKCFGGUECNCRGNCCFOKPKUVTCQPQUWTIGEQOQ
mera formalidade e discricionariedade pelo administrador pblico, mas, sim, como
FGXGTGCVQXKPEWNCFQCQGZGTEEKQFGUWCUCVTKDWKGU#UUKOECDGCVQFQUQUCIGPVGU
GPXQNXKFQUPCUEQORTCURDNKECUCDWUECRGNCOGNJQTIGUVQFGUWCUCSWKUKGUCO
FGUGCORNKCTGOQUICPJQUGOGUECNCCHCXQTFCCFOKPKUVTCQRDNKEC2QTOPQ
isso que presenciamos nas compras do setor pblico, no qual a falta de gesto e de
planejamento fazem com que o governo compre mais caro do que devia, afastandose de um dos principais mandamentos licitatrios.
Isso posto, as compras pblicas devem ser planejadas, de tal sorte que as economias
FGGUECNCPQUGLCOFGURGTFKCFCU#TGURGKVQFQVGOC,WUVGP(KNJQ
R 
ressalta que em uma economia de escala, o aumento de quantitativos produz a
TGFWQ FQU RTGQU 2QT KUUQ PQ VGTKC ECDKOGPVQ C #FOKPKUVTCQ HTCEKQPCT CU
EQPVTCVCGUUGKUUQCECTTGVCTCWOGPVQFQUUGWUEWUVQU
De acordo com Fernandez (2010, p. 379), o TCU reiteradamente vem alertando os
TIQUSWCPVQCQUUGWURNCPGLCOGPVQUFGCSWKUKGUCOFGCRTQXGKVCTCUGEQPQOKCU
de escala, vejamos:
TCU determinou: [...] prever o consumo anual de materiais, bem como o de
expediente e instrucional, com o objetivo de realizar o menor nmero possvel
FGNKEKVCGUCWHGTKPFQFGUUCHQTOCGEQPQOKCFGGUECNCPCUCSWKUKGUHGKVCU
Fonte: TCU. Processo n. 250.104/1997-0. Deciso n. 614/1999-Plenrio.
6%7QTKGPVQW=?CXCNKGRTGXKCOGPVGTGCNK\CQFGNKEKVCGUFGUEGPVTC
lizadas nos Estados, a convenincia de se proceder ao levantamento das
FGOCPFCURCTCPUFGTGCNK\CQFGWOPKEQRTQEGFKOGPVQNKEKVCVTKQXKUCPFQ
QDVGPQFGRTGQUOGPQTGU
Fonte: TCU. Processo n. TC-006.929/2003-0. Acrdo n. 876/2004-Plenrio.

Nesse sentido, visando a dar aplicabilidade ao mandamento legal, Silva (2010)


CRTGUGPVC WO OVQFQ FG CRTQRTKCQ GEQPOKEC FQU ICPJQU FG GUECNC RGNC
CFOKPKUVTCQRDNKECQSWCNUGTXGEQOQDCUGRCTCGUVGVTCDCNJQ
Com a possibilidade do aumento das quantidades a serem adquiridas pela
CFOKPKUVTCQRGNCCFGUQUCVCUFGTGIKUVTQFGRTGQU5KNXC
 TGUUCNVQWSWG
QURTGQUFQUQDLGVQUFGXGOUGTCLWUVCFQUSWCPFQJQWXGTCWOGPVQFCSWCPVKFCFG
demandada, capturando, desse modo, as economias de escala embutidas nos custos
Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

145

Felipe Ribeiro Alves Morais

FCGORTGUC&GCEQTFQEQOQCWVQTQOVQFQDCUGKCUGPCOCPWVGPQFQNWETQ
QDVKFQRGNQNKEKVCPVGXGPEGFQTPQOQOGPVQFQEGTVCOG#UUKOZCPFQUGQNWETQ
FQHQTPGEGFQTCSWCPVKFCFGCFKEKQPCNFGXGUGTHQTPGEKFCCWORTGQKPHGTKQTCQ
inicial, devido s economias de escala presentes.

6 METODOLOGIA
6.1 O MODELO TERICO
Fazemos uso, neste trabalho, do modelo desenvolvido por Silva (2010). Dessa forma,
antes de passarmos para o pretenso modelo economtrico, faz-se necessrio, nesta
UWDUGQCRTGUGPVCTOQUQEKVCFQOQFGNQ5KNXC
 CUUKOFGUETGXGUGWOQFGNQ
Utilizemos, pois, o equacionamento clssico de Contabilidade de Custos que
busca estimar o lucro LFGWOCTOCRGNCFKHGTGPCGPVTGCTGEGKVCGQEWUVQC
partir da quantidade produzida qFQRTGQFGXGPFCpFQEWUVQZQCf e do
custo varivel unitrio Cv. Assim, a frmula do lucro ser:

L = R(q), C(q),

(1)

/ ST(&I&YT).

(2)

Podemos observar que C(q) apresenta rendimentos crescentes de escala, uma


vez que C(q)/q decrescente em q, de acordo com a seguinte frmula e a
Figura 1:

C(q)
C
-------- ------f + Cv
q
q

(3)

Figura 1 Curva de custos em funo da quantidade

Fonte: adaptado de Silva (2010)

146

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

O aproveitamento das economias de escala pelo Sistema de Registro de Preos

1DUGTXCUG SWG UG FKXKFKTCO QU VGTOQU FC GSWCQ ENUUKEC EQPVDKN
C(q) = Cf + Cv q pela quantidade q1CWVQTTGUUCNVCSWGCGSWCQCRTGUGPVCFC
permite tratar os rendimentos de escala para quaisquer faixas de quantidade
produzida.
1OQFGNQWVKNK\CFQRQT5KNXC
 NGXCGOEQPUKFGTCQQRTGQpGOHWPQFC
quantidade q#UUKOFCFCWOCNKEKVCQEWLQQDLGVQUGLCEQORTCFQCWORTGQp
e a uma quantidade qEQOQOQUVTCFQPC(KIWTCCEQPVTCVCQRQUUWKTGEGKVCR
representada no ponto A, e custo C, no ponto B. O lucro L, ento, corresponde ao
segmento AB1RTGQpTGRTGUGPVCFQRGNCKPENKPCQFCTGVCFGTGEGKVCGPSWCPVQ
o q contratado se encontra no eixo das abscissas.
Figura 2 Economias de escala no acrscimo do fornecimento

Fonte: adaptado de Silva (2010)

%QPVKPWCPFQCGZRNKECQFG5KNXC
 SWCPFQCCFOKPKUVTCQRCUUCCPGEGUUKVCT
de um fornecimento maior do bem no nvel de q, a receita do novo nvel de
fornecimento R corresponder ao ponto D, e a despesa, ao ponto E. O lucro L
corresponder ao segmento DEQSWGUGTQDXKCOGPVGOCKQTSWGQFCEQPVTCVCQ
inicial devido aos rendimentos crescentes de escala, visto que a receita aumenta
proporcionalmente, enquanto o custo aumenta menos que proporcionalmente
com a quantidade fornecida.
Silva (2010) demonstra, com base no entendimento j citado, uma frmula para
GZRWTICTQNWETQGZEGFGPVGTGUWNVCPVGFCOCLQTCQFCSWCPVKFCFGHQTPGEKFC
%CDG#FOKPKUVTCQGZRWTICTVCNNWETQGZEGPFGPVGTGUWNVCPVGFCOCLQTCQ
da quantidade fornecida do bem conjugada com a existncia de rendimentos
ETGUEGPVGUFGGUECNC+UUQRQFGUGTHGKVQUGGUVCDGNGEGTOQUWOPQXQRTGQFG
OQFQSWGQNWETQUGLCGSWKXCNGPVGUKVWCQCPVGTKQTPQXCNQTEQTTGURQPFGPVG
Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

147

Felipe Ribeiro Alves Morais

ao segmento AB. Podemos obter isso se passarmos uma reta paralela curva
de custo a partir de A, encontrando o ponto F GHQTCPFQSWGQNWETQL no
nvel de fornecimento q seja FE, obviamente equivalente AB#GSWCQ
da reta que passa por A, onde a receita R e a quantidade fornecida q, e tem
KPENKPCQKIWCNTGVCFGEWUVQUGT

(4)
No ponto , a nova receita que impomos ser igual a =( )+ e, por
EQPUGIWKPVGQPQXQRTGQKORQUVQp ser:

Podemos chamar a razo q/q como o acrscimo de fornecimento, um fator


C'PVQQCLWUVGFGRTGQp/p ser:
(5)
Observe que, como a > 1, temos que 1/a est entre 0 e 1. Lembre tambm
que, necessariamente, Cv/p<1 #UUKO Q CLWUVG GSWKXCNG C WOC RQPFGTCQ

EQODKPCQEQPXGZC GPVTGCv/p e 1, ou seja, caso a = 1 (nenhum acrscimo),


p/p ser 1 (nenhum reajuste), enquanto se a muito grande, p/p tender a Cv/p.

#UUKO EQO DCUG PC GZRNCPCQ FGOQPUVTCFC Q GSWCEKQPCOGPVQ SWG HQTPGEGT


QPQXQXCNQTFQRTGQGUGTXKTEQOQRCTOGVTQRCTCCRGUSWKUCWVKNK\CFCPGUVG
VTCDCNJQFCFQRGNCGSWCQ
 
Fazendo uma breve anlise sobre o mtodo apresentado, deIiFLOYHUKECQSWGQ
PQXQRTGQp tender ao patamar dos custos variveis do objeto licitado, medida
SWGOCKUSWCPVKFCFGUHQTGOCFSWKTKFCURGNCCFOKPKUVTCQRQKU1/a tender a 0 e
tender a 1, restando pGOHWPQFQCv.
Silva (2010) tambm ressalta que quanto menor for o valor de Cv maior ser o
FGUEQPVQPQRTGQEQOQCETUEKOQFGHQTPGEKOGPVQ#NOFKUUQTGUUCNVCCKPFC
SWGQOVQFQFGCLWUVGFGRTGQSWCPVQGEQPQOKCFGGUECNCKPFGRGPFGPVGFQ
EWUVQZQWOCXG\SWGPCOWFCPCFGUKVWCQFCSWCPVKFCFGKPKEKCNRCTCCPCN
CGORTGUCEQPVKPWCCUGTTGOWPGTCFCRGNQOGUOQPXGNFGEWUVQZQ
+UUQRQUVQFKCPVGFQOVQFQFGUGPXQNXKFQRCTCRTGEKECQFQURTGQUFCUCSWKUKGU
CFKEKQPCKUCITCPFGSWGUVQCQDVGPQFQEWUVQXCTKXGNCv. Silva (2010) cita
CNIWOCU RQUUKDKNKFCFGU RCTC C QDVGPQ FGUUC XCTKXGN 'PVTGVCPVQ VGPEKQPCOQU
estimar o Cv por meio de pesquisa emprica no portal de compras do governo
federal, ao levantar um rol de certames de um mesmo objeto, cujos resultados sero
tratados PCUGQ
148

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

O aproveitamento das economias de escala pelo Sistema de Registro de Preos

6.2 O MODELO EMPRICO


O modelo de Silva (2010) pode ser tratado econometricamente com o objetivo
de obtermos o valor de custos variveis para determinados objetos licitados pela
CFOKPKUVTCQRDNKEC&GUGPXQNXGPFQCGSWCQ
 VGOQU

(6)
em que y = p, x = q e A = (p-Cv )q.
'PVGPFGUGSWGCGSWCQFGUETGXGWOEQORQTVCOGPVQFGRTGQUFGWOFGVGTOKPCFQ
DGOGOHWPQFGFKXGTUCUSWCPVKFCFGUGOSWGQRTGQp e a quantidade q so apenas
um caso particular, ou seja, um ponto na curva da Figura 1. Mas percebe-se que os
valores de p e q, que se encontram incorporados constante A, no interessam, e
seu desconhecimento no prejudica o modelo economtrico que ora propomos.
O parmetro a ser buscado o intercepto do modelo linear, ou seja, o valor dos
custos variveis Cv. De modo mais exato, podemos utilizar o modelo recproco para
estimar o Cv (GUJARATI, 2006, p. 148), o qual pode ser expresso por:
(7)
em que 1 corresponde ao Cv procurado. O modelo recproco ainda se caracteriza
RGNC UWC NKPGCTKFCFG G CUUKO RQFG UGT EQPUKFGTCFQ RCTC GHGKVQU FG GZGEWQ FC
econometria, visto que a propriedade da linearidade, segundo Gujarati (2006,
p. 33), envolve somente os parmetros 1 e 2, no havendo de se considerar a
inverso da varivel x.
1OQFGNQEKVCFQCRTGUGPVCQUUGIWKPVGUCURGEVQUSWCPFQCWOGPVCKPFGPKFCOGPVG
o termo 2
aproxima-se de zero (2 constante) e Y aproxima-se do valor limite
ou assinttico 1. O modelo demonstra que, independentemente do aumento de x,
o limite que a varivel dependente Y assumir o de 1.
Fazendo-se um paralelo entre o modelo economtrico recproco aqui concebido e
QOQFGNQVGTKEQFGOQPUVTCFQRQT5KNXC
 FGHEKNXGTKECQCEQPUKUVPEKC
entre os dois modelos, uma vez que, com o aumento da quantidade q'QRTGQp' tende
ao valor do custo varivel Cv, que o valor assinttico de 1 do modelo recproco.
O modelo citado pode ser representado pela Figura 3:
Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

149

Felipe Ribeiro Alves Morais

Figura 3 Modelo recproco: Y 1+ 2

Fonte: adaptado de Gujarati (2006, p. 148)

6.3 ECONOMIA POTENCIAL A SER GERADA PELA UTILIZAO


DO MODELO ECONOMTRICO
Uma vez demonstrada a frmula para RTGEKECQSWCPVQGEQPQOKCFGGUECNC
FKURQTGOQU WO ITEQ GZRNKECVKXQ
(KIWTC   RCTC KNWUVTCQ FC GEQPQOKC SWG
RQFGTKCUGTIGTCFCECUQQOQFGNQFG5KNXC
 HQUUGWVKNK\CFQRGNCCFOKPKUVTCQ
p~EOLFD2YDORUHFRQRPL]DGROHYDHPFRQVLGHUDomRDVDGHV}HVGH apenas uma ata
FGTGIKUVTQFGRTGQUGCSWKUKGUCFKEKQPCKUKPPKVGUKOCKU
Figura 4 Economia potencial a ser gerada pelas adeses

(QPVGGNCDQTCQFQCWVQT

0QVCUG SWG PQ RTQEGFKOGPVQ XKIGPVG CU CSWKUKGU CFKEKQPCKU UQ ZCFCU PQ
RTGQ p JQOQNQICFQ SWCPFQ FC TGCNK\CQ FQ EGTVCOG EQO DCUG PC SWCPVKFCFG
q inicial. Assim, independentemente do aumento da quantidade adquirida pelos
TIQUQRTGQOCPVOUGEQPUVCPVG7UCPFQQOQFGNQGUVWFCFQQRTGQRCTCCU
quantidades acima do previsto diminui at se aproximar do valor assinttico Cv.
150

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

O aproveitamento das economias de escala pelo Sistema de Registro de Preos

&GUUCHQTOCCRUCNVKOCCFGUQFCCVCTGIKUVTCFCCVQOFGUWCXKIPEKCSWCPFQ
VKXGTOQUQPOGTQFCSWCPVKFCFGPCNqfCFSWKTKFCXGTKECTGOQUSWGCGEQPQOKC
corresponder rea hachurada da Figura 4. Lembramos que o modelo apenas se
presta para quantitativos superiores quantidade inicialmente contratada.
6.4 OBTENO DOS DADOS PARA A PESQUISA
Para comprovar a aplicabilidade do modelo desenvolvido por Silva (2010) e atingir
Q O RTQRQUVQ FQ GUVWFQ HQK TGCNK\CFC WOC RGUSWKUC GORTKEC FG NKEKVCGU L
realizadas no sistema de compras do governo federal (www.comprasnet.gov.br).
Os objetos pesquisados foram a resma de papel A4 e o grampeador mdio. Aps
CPNKUGXGTKEQWUGSWGUGVGTKCCUECTCEVGTUVKECUFGUGLCFCURCTCCRNKECQFQOQFGNQ
#FGUETKQFQRCRGNRGNQEFKIQFGOCVGTKCKUFQ5KUVGOC+PVGITCFQFG#FOKPKUVTCQ
FG 5GTXKQU )GTCKU
5KCUI  HQK RCRGN # OCVGTKCN RCRGN CNECNKPQ EQORTKOGPVQ
297 mm, largura 210 mm, gramatura 75 g/m2EQTDTCPECGRCTCQITCORGCFQTHQK
ITCORGCFQTVTCVCOGPVQUWRGTEKCNRKPVCFQOCVGTKCNOGVCNVKRQOGUCECRCEKFCFG
UCRNKECQRCRGNVCOCPJQITCORQ
6.5 TESTES ESTATSTICOS PARA COMPROVAO DO RESULTADO
, TGUUCNVCOQU SWG C ITCPFG SWGUVQ FQ OQFGNQ  C QDVGPQ FQ XCNQT FQ EWUVQ
varivel Cv dos objetos licitados por meio de pesquisa dos certames concludos.
2QTOVGOQUFGXGTKECTUGQUTGUWNVCFQUCEJCFQUVmRFRQiYHLV estatisticamante
a ponto de serem de fato utiliziYHLVRGNCCFOKPKUVTCQECUQQOVQFQRTQRQUVQ
neste trabalho fosse posto em prtica.
&KCPVGFKUUQWVKNK\COQUVGUVGUGUVCVUVKEQURCTCEQPTOCTCTQDWUVG\FCRGUSWKUC7O
FQURCTOGVTQUWVKNK\CFQUHQKQEQGEKGPVGFGFGVGTOKPCQR2, que uma medida
FGSWCNKFCFGFGWOOQFGNQGEQPQOVTKEQ
KPFKECQITCWFGEQTTGNCQGPVTGFWCU
XCTKXGKUPQECUQGOCPNKUGQRTGQWPKVTKQGCSWCPVKFCFGNKEKVCFC GQXCNQTp

XCNQTFCRTQDCDKNKFCFGVCODOEQPJGEKFQEQOQPXGNFGUKIPKEPEKCGZCVQQW
QDUGTXCFQ 2QTOGKQFGUUGUVGUVGURQFGTGOQUEQPTOCTQPXGNFGUKIPKEPEKC
FCUKPHQTOCGUFGENCTCPFQSWGQTGUWNVCFQUWEKGPVGOGPVGTQDWUVQFQRQPVQ
de vista estatstico.
0CUGQUGIWKPVGCRTGUGPVCOQUQUTGUWNVCFQUFCRGUSWKUCEQOCEQPUGSWGPVGQDVGQ
do Cv e dos testes estatsticos.

7 RESULTADOS
Foram coletados durante a pesquisa 193 itens/certames para o objeto resma de papel
A4 e 168 para grampeador.
Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

151

Felipe Ribeiro Alves Morais

Os dados foram dispostos em uma planilha de Excel para que, por meio dessa
ferramenta, fossem calculados o Cv FQU QDLGVQU Q ITEQ FC TGITGUUQ NKPGCT G
UWCGSWCQDGOEQOQCTQDWUVG\FQOQFGNQGEQPQOVTKEQEQODCUGGOVGUVGU
GUVCVUVKEQUEQOQQEQGEKGPVGFGFGVGTOKPCQR2 e o valor p.
#NO FKUUQ XKUCPFQ C WOC KPXGUVKICQ OCKU RTQHWPFC WOC XG\ SWG Q OQFGNQ
RTQRQUVQHC\WOCTGNCQNKOKVCFCGPVTGQRTGQGCSWCPVKFCFGGEKGPVGFGSWG
QWVTCUXCTKXGKURQFGOGZRNKECTQRTGQFGWODGOHC\GOQUVCODOQENEWNQFQ
CvNGXCPFQGOEQPUKFGTCQQWVTQUCURGEVQU
7.1 PESQUISA DA RESMA DE PAPEL A4
No tocante ao objeto resma de papel A4, a pesquisa foi dividida em trs grupos,
fazendo a econometria e os testes estatsticos com base em todos os dados achados
(nacional), por intervalos de quantidades e pelas regies dos locais dos rgos
licitantes.
7.1.1 DADOS NACIONAIS

%QOQLTGNCVCFQEQPUKFGTCPFQUGVQFCUCUQDUGTXCGUUQEQORWVCFQURCTCQ
objeto resma de papel A4 193 certames. Tendo como base todo esse quantitativo,
encontramos o custo varivel , conforme apresentado nas Tabelas 1 e 2 e na Figura 5.
Tabela 1 Apresentao do Cv (interseo) e do valor p para o valor unitrio
da resma de papel A4, considerando-se o total de certames.
Coeficientes

Erro-padro

Stat t

Valor p

Interseo

9,307303065

0,125945037

73,89972067

1,8637E-142

8CTKXGN:

1,87531125

1,714836395

1,093580272

0,275516393

Fonte: MORAIS (2011)

Tabela 2 Valor do R2 considerando todos os certames para resma de papel A4.


Estatstica de regresso
R-mltiplo

0,078882122

R-quadrado

0,006222389

R-quadrado ajustado

0,001019365

Erro-padro

1,736634673

1DUGTXCGU

193

Fonte: MORAIS (2011)

152

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

O aproveitamento das economias de escala pelo Sistema de Registro de Preos

Figura 5 Total de certames para resma de papel A4

Valor unitrio homologado


R$ 30,00
R$ 25,00

y = 1,8753x + 9,3073
R = 0,0062

R$ 20,00
Valor unitrio
Homologado

R$ 15,00

Linear (Valor unitrio


Homologado)

R$ 10,00
R$ 5,00
R$ 0,00
(QPVGGNCDQTCQFQCWVQT

Nota-se pelas tabelas que, apesar de o R2 ser to reduzido, a robustez estatstica do


KPVGTEGRVQQWUGLCFQEWUVQXCTKXGNEQPTOCFCRGNQXCNQTFQXCNQTp, que bem
KPHGTKQTCQPXGNFGUKIPKEPEKC
7.1.2 DADOS POR REGIO

reproduzido o estudo anterior para as cinco regies brasileiras, conforme Tabela 3.


Tabela 3 Dados da resma de papel A4 por regio.
R2

P-valor do intercepto Cv

Regies

Quantidade de itens

Custo varivel (Cv)

CO

60

R$ 8,99

0,32

1,294E-50

SE

35

R$ 8,63

0,19

1,56361E-34

NE

37

R$ 9,34

0,067

4,764E-32

SU

27

R$ 8,84

0,0019

9,21781E-30

NO

34

R$ 10,22

0,00011

6,25133E-19

Fonte: MORAIS (2011)

Com base na tabela podemos tirar algumas concluses. A Regio Centro-Oeste


a mais representativa. Por ter Braslia como uma de suas cidades, onde se localiza a
maioria dos rgos federais, acaba por compor um grande quantitativo de certames.
Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

153

Felipe Ribeiro Alves Morais

O custo varivel Cv menor na Regio Sudeste, seguido pelas Regies Sul, Centro1GUVG G 0QTFGUVG ECPFQ C 4GIKQ 0QTVG EQO Q OCKQT XCNQT 3WCPVQ C GUUCU
caractersticas desse resultado, apesar de no ser tema deste trabalho, pode ser
GZRNKECFQRGNCOCKQTKPFWUVTKCNK\CQPCTGIKQEGPVTQUWNFQRCUEQOEQPUGSWGPVG
maior nmero de empresas e fornecedores prximos aos rgos demandantes. Dessa
forma, os custos logsticos, como o de transporte, podem ter elevado o valor desse
material para as Regies Norte e Nordeste.
Observa-se que, no obstante os maus resultados do R2, os valores pVmRSRVLWLYRV
apontando, ao menos, para um CvGUVCVKUVKECOGPVGUKIPKECVKXQ
7.1.3 DADOS POR INTERVALOS DE QUANTIDADE

Para estudo dos dados, segundo a quantidade inicial licitada das resmas, separamolos em quatro intervalos, conforme Tabela 4.
Tabela 4 Dados da resma de papel A4 pelas quantidades.
Quantidades de

Custo varivel (Cv)

itens/certames

(R$)

0-500

43

500-1.000

43

1000-5.000

69

Acima de 5.000

38

Quantidades

R2

P-valor

10,34

0,00014

5,22452E-24

9,85

0,0036

2,25094E-22

8,43

0,081

2,95747E-40

8,13

0,0027

4,849E-26

Fonte: MORAIS (2011)

Com base na tabela das quantidades apresentadas, podemos comprovar o efeito


FCUGEQPQOKCUFGGUECNCPQURTGQUSWGFKOKPWGOSWCPFQUGEQORTCGOOCKQTGU
quantidades. o que se observa na tabela a cada intervalo de maior quantidade
VGOQUOGPQTGUEWUVQUXCTKXGKUPCNK\CPFQPQKPVGTXCNQFGEGTVCOGURCTCOCKUFG
5 mil unidades, onde encontramos o menor Cv.
Observa-se que, no obstante os maus resultados do R2, os valores p so, mais uma
YH]SRVLWLYRVDSRQWDQGRDRPHQRVSDUDXPCvGUVCVKUVKECOGPVGUKIPKECVKXQUGPFQ
isso o que mais importa.
7.1.4 ECONOMIA POTENCIAL A SER GERADA DAS ADESES
DAS LICITAES PARA RESMA DE PAPEL A4

0GUVCUWDUGQHCTGOQUWOGUVWFQJKRQVVKEQEQOQQDLGVKXQFGFGOQPUVTCTC
aplicabilidade do modelo economtrico no caso de sucessivas adeses de uma das
CVCURGUSWKUCFCUCOFGXGTKECTCGEQPQOKCSWGRQFGTKCUGTIGTCFC

154

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

O aproveitamento das economias de escala pelo Sistema de Registro de Preos

Sendo assim, para o exerccio proposto, escolhemos o Comando Militar da


Amaznia, 16a Brigada de Infantaria da Selva, localizado na cidade de Tef/AM,
que realizou o Prego Eletrnico (SRP) n. 03/2010, item 93, para resma de papel
#PCSWCPVKFCFGFGTGUOCUNKEKVCQFKURQPXGNPQRQTVCNFGEQORTCUFQ
governo federal, cujo valor unitrio homologado foi de R$ 11,00.
Para a tarefa, consideramos que foi adquirido o quantitativo total2 indicado pelo
rgo gerenciador e, a partir desse momento, que seriam solicitadas adeses pelos
demais rgos. Assim, imaginemos que a esta ata foram solicitadas cinco adeses
nas quantidades representadas na Tabela 5. Desse modo, foram calculados os novos
RTGQUGCGEQPQOKCSWGRQFGTKCVGTUKFQIGTCFC0GUVGGZGORNQCRNKECTGOQUQCv
nacional, de R$ 9,30. Para o clculo, utilizamos o mtodo proposto por Silva (2010)
GFGOQPUVTCFQPCUWDUGQFGUVGVTCDCNJQ

onde pQRTGQNKEKVCFQp QPQXQRTGQa a razo q/q, em que q a quantidade inicial e qCUQOCFGVQFCUCUCSWKUKGU


Tabela 5 Economia gerada das suposies de adeses da Ata de Registro de
Preos do Comando Militar da Amaznia, 16a Brigada de Infantaria da Selva,
Prego 03/2010, item 93.
Suposio

Preo unitrio

Valor total da

Valor total da

de qtds.

ajustado (p)

qtd. pelo preo

qtd. pelo valor

solicitadas

(R$)

homologado (R$)

ajustado (R$)

1a adeso

1.500

10,36

16.500,00

15.540,00

960,00

2a

rgo
carona

Economia
gerada (R$)

adeso

2.000

10,00

22.000,00

20.000,00

2.000,00

3a adeso

1.000

9,90

11.000,00

9.900,00

1.100,00

4a

adeso

2.000

9,77

22.000,00

19.540,00

2.460,00

5a adeso

1.500

9,70

16.500,00

14.550,00

1.950,00

88.000,00

79.530,00

8.470,00

Valor total
Fonte: MORAIS (2011)

%QOQFGOQPUVTCFQPC6CDGNCCECFCCFGUQQRTGQNKEKVCFQ ajustado, tendendo


ao valor do Cv # VVWNQ FG WOC OGNJQT KNWUVTCQ ECNEWNCTGOQU EQO DCUG PC
HTOWNCKPFKECFCRGNCGSWCQ
 Qp da 1a adeso. Assim, temos:

 +ORQTVCPVGTGUUCNVCTSWGQOQFGNQUCRNKECFQCRCTVKTFCCSWKUKQFGSWCPVKFCFGUWRGTKQTKPFKECFCPC#VC

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

155

Felipe Ribeiro Alves Morais

#KPFCEQOTGNCQ tabela, vislumbramos que, no caso hipottico das adeses da


ata do Comando Militar da Selva, nas quantidades indicadas, a economia gerada
RCTCCCFOKPKUVTCQUGTKCFG4EGTECFGGOTGNCQCQEWUVQSWGC
CFOKPKUVTCQVGTKCFGFGUGODQNUCTPQRTQEGFKOGPVQPQTOCNWOXCNQTSWGFCTKC
para comprar mais 770 resmas pelo valor homologado ou mais de 870 resmas,
EQPUKFGTCPFQUGQNVKOQRTGQCLWUVCFQ
4GUUCNVCOQUSWGCGEQPQOKCIGTCFCRCTCCCFOKPKUVTCQRDNKECEQOQWOVQFQ
Muitos podem questionar que o rgo realizador do certame e gerenciador da ata,
que teve todo o trabalho com os procedimentos licitatrios,QmRREWHYHHFRQRPLD
DOJXPDPDVGHVFRQVLGHUDPRVWDODQiOLVHHYLVDPRVao cmputo da economia para
os cofres pblicos.
7OHCVQOWKVQKORQTVCPVGCUGTQDUGTXCFQSWGEQOCQDVGPQFQCv via pesquisa
GPVTGNKEKVCGUFGXTKQUrgos, possvel e de fato foi constatado na pesquisa que
CNIWPUEGTVCOGUQDVKXGTCORTGQUJQOQNQICFQUCDCKZQFQCv estimado. Lembramos,
entretanto, que cada fornecedor possui o Cv do seu objeto, que, certamente,
KPHGTKQTCQRTGQQHGTVCFQPQUEGTVCOGU#UUKOTGUUCNVCOQUSWGRCTCWVKNK\CQ
FQOQFGNQGEQPQOVTKEQRCTCQDVGPQFQUPQXQURTGQUPQUGRQFGCFOKVKTCv
OCKQTSWGQRTGQJQOQNQICFQ
7.2 PESQUISA DO GRAMPEADOR
Para pesquisa do objeto grampeador, realizamos procedimento idntico ao
tratamento para resma de papel A4, calculando a econometria e os testes estatsticos
com base em todos os dados achados (nacional).
7.2.1 DADOS NACIONAIS

J informamos que para o objeto grampeador foram computados 168 itens/certames.


6QFCXKCCITCPFGOCKQTKCFCUNKEKVCGURCTCGUVGOCVGTKCNFGGZRGFKGPVG de pouca
quantidade, com alguns certames, porm, contendo, mesmo assim, grandes volumes.
Dessa forma, visando a ter as quantidades licitadas mais uniformes, so calculados
156

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

O aproveitamento das economias de escala pelo Sistema de Registro de Preos

FQKUFGUXKQURCFTQFCUSWCPVKFCFGUGNKOKPCPFQUGCUQDUGTXCGUSWGECTCOCNO
dessa medida de disperso. Restaram, assim, 144 itens.
Isso posto, os dados so tratados da mesma forma que os dados para a resma de papel
A4, calculando-se o Cv, o R2 e o valor pEQOQRQFGUGTXGTKECFQPCU6CDGNCUG
7 e na Figura 6.
Tabela 6 Apresentao do Cv (interseo) e do valor p para o valor unitrio
do grampeador considerando-se o total de certames
Coeficientes
Interseo
Varivel X 1

Erro-padro

7,466593339
0,735813856

0,301408251
2,183707003

Stat t
24,7723588
0,336956311

Valor p
2,0914E-53
0,73664734

Fonte: MORAIS (2011)

Tabela 7 Valor do R2 considerando-se todos os certames para o grampeador


Estatstica de regresso
R-mltiplo
R-quadrado
R-quadrado ajustado
Erro-padro
1DUGTXCGU

0,028265448
0,000798936
0,006237692
3,330939128
144

Fonte: MORAIS (2011)

Figura 6 Total de certames para o grampeador

Fonte: elaborao do autor

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

157

Felipe Ribeiro Alves Morais

Com base nas tabelas e na Figura 6, o Cv PCEKQPCN FQ ITCORGCFQT EQW GO
R$ 7,46. No obstante a medida de qualidade R2 ser reduzida, o parmetro intercepto
UKIPKECVKXQRQKUQXCNQTpDGOKPHGTKQTCQPXGNFGUKIPKEPEKC
7.2.2 ECONOMIA POTENCIAL A SER GERADA DAS
ADESES DAS LICITAES PARA GRAMPEADOR

Efetuando-se procedimento idntico aos dados da resma de papel A4, calculamos o


SWCPVQRQFGTKCUGTGEQPQOK\CFQRCTCCCFOKPKUVTCQUGHQUUGWVKNK\CFQQOQFGNQ
RTQRQUVQ&GUUCHQTOCRCTCGZGORNKECTQGUVWFQHC\GOQUPQXCOGPVGQENEWNQFC
GEQPQOKCVGPFQEQOQDCUGUWRQUKGUFGCFGUGUGPVTGWOFQUrgos analisados.
2CTCQGZGORNQVQOCOQUQ+PUVKVWVQ(GFGTCNFG'FWECQ%KPEKCG6GEPQNQIKC
do Tringulo Mineiro Campus Uberaba, que realizou o Prego Eletrnico (SRP)
P KVGO RCTCITCORGCFQTPCSWCPVKFCFGFG WPKFCFGUNKEKVCQ
disponvel no portal de compras do governo federal, cuja empresa vencedora ofertou
Q RTGQ FG 4  +OCIKPCTGOQU SWG C GUUC #VC CFGTKTCO SWCVTQ ECTQPCU PCU
SWCPVKFCFGUKPFKECFCUPC6CDGNCPCSWCNVCODOFKURQTGOQUQUPQXQURTGQU
e a quantidade economizada. O Cv utilizado foi o nacional, de R$ 7,46.
Tabela 8 Economia gerada das suposies de adeses da Ata de Registro de
Preos do Instituto Federal de Educao, Cincia e Tecnologia do Tringulo
Mineiro Campus Uberaba, Prego 01/2010, item 64
rgo
carona

Suposio
de qtds.
solicitadas

Preo unitrio
ajustado (p)
(R$)

Valor total da
qtd. pelo preo
homologado (R$)

Valor total da
qtd. pelo preo
ajustado (R$)

Economia
gerada
(R$)

1a adeso
2a adeso
3a adeso
4a adeso

100
150
200
180

8,54
8,21
7,99
7,88

900,00
1.350,00
1.800,00
620,00

854,00
1.231,50
1.598,00
1.418,40

46,00
118,5
202,00
201,60

5.670,00

5.101,90

568,10

Valor total
Fonte: MORAIS (2011)

0QXCOGPVGRCTCWOCOGNJQTGNWEKFCQFQOVQFQECNEWNCOQUQRTGQCLWUVCFQ
p para a 1aCFGUQEQODCUGPCGSWCQ
 #UUKOVGOQU

Considerando-se os resultados obtidos na tabela, constatamos que, a cada adeso,


QRTGQWPKVTKQFQDGOFKOKPWKCVUGCRTQZKOCTFQCv de R$ 7,46. A economia
IGTCFC ECUQ Q OQFGNQ HQUUG WVKNK\CFQ RCTC CU CSWKUKGU CFKEKQPCKU VTCTKC WO
158

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

O aproveitamento das economias de escala pelo Sistema de Registro de Preos

GEQPQOKCFG4RCTCCCFOKPKUVTCQQWUGLCCRTQZKOCFCOGPVGFG
GO TGNCQ CQ ICUVQ VQVCN EQPUKFGTCPFQ QU VTOKVGU FCU CFGUGU EQPXGPEKQPCKU
A ttulo de exemplo, o valor economizado daria para comprar 63 grampeadores
RGNQRTGQJQOQNQICFQQWWPKFCFGURGNQNVKOQRTGQCLWUVCFQ

8 CONCLUSES
Apesar de a economia de escala ser tpico tratado h mais tempo na LCC, esse
GNGOGPVQOKETQGEQPOKEQICPJQWFGUVCSWGEQOCGFKQFQ&GETGVQP
CQRQUUKDKNKVCTCOWNVKRNKECQFCUSWCPVKFCFGUHQTPGEKFCURGNQWUQUKORNKECFQFG
WOTGIKUVTQFGRTGQU
Todavia, pela sistemtica recentemente utilizada, os rgos caronas adquirem as
SWCPVKFCFGUCFKEKQPCKURGNQXCNQTRCEVWCFQPCEQPVTCVCQKPKEKCNPQRQUUKDKNKVCPFQ
CUUKOSWGCCFOKPKUVTCQCDUQTXCGEQPQOKCUFGGUECNCFGEQTTGPVGUFQHQTPGEKOGPVQ
multiplicado. A literatura detectou tal problema e desenvolveu um mtodo para
aproveitamento das economias de escala por meio do custo varivel (Cv) dos objetos
NKEKVCFQU G EQPUGSWGPVG ENEWNQ FQ PQXQ RTGQ FQ QDLGVQ Q SWCN  CRTGUGPVCFQ
e demonstrado neste artigo por meio de uma pesquisa emprica.
Sendo o Cv FG FKHEKN QDVGPQ FGOQPUVTCOQU SWG WOC FCU CNVGTPCVKXCU RCTC
seu clculo pode ser por meio de pesquisa emprica dos objetos a serem licitados,
fazendo uso dos certames realizados no portal de compras do governo federal
(www.comprasnet.gov.br). Foi comprovado isso para dois objetos licitados: resma de
papel A4 e grampeador. Com o rol dos certames levantados para esses objetos, usando
as ferramentas do Excel foi calculado o valor do CvGQUPQXQURTGQUCLWUVCFQU
&GCEQTFQEQOQUTGUWNVCFQUOQUVTCFQUCQDVGPQGORTKECFQKPVGTEGRVQCv,
RQT OGKQ FQU EGTVCOGU TGCNK\CFQU EQPTOQWUG EQPUKUVGPVG G EQPXGN RQKU QU
valores encontrados para os valores pEWLQPXGNFGUKIPKEPEKCHQKZCFQGO
CRTGUGPVCTCOTGUWNVCFQUDGOKPHGTKQTGUCGUVCOGFKFCQSWGPQUFEQPCPCPC
WVKNK\CQFGUVGRCTOGVTQ
3WCPVQCQUTGUWNVCFQUCEJCFQURCTCQEQGEKGPVGFGFGVGTOKPCQ42, seus valores
no foramWmRH[SUHVVLYRVRTXHGHPRQVWUDTXHDTXDQWLGDGHOLFLWDGDQmRpD~QLFD
YDULiYHODH[SOLFDUQRTGQFQQDLGVQGZKUVKPFQQWVTQUHCVQTGUSWGFGXGTKCOEQORQT
o modelo economtrico. Nessa linha, propusemos o clculo do Cv pelas regies
DTCUKNGKTCUPQECUQFCTGUOCFGRCRGN#PQKPVWKVQFGXGTKECTCKPWPEKCTGIKQPCN
PQRTGQFQQDLGVQ&GUUCHQTOCQOQFGNQQTCWVKNK\CFQRQFGTUGTQDLGVQFGPQXQU
GUVWFQUEQOQQDLGVKXQFGCRGTHGKQNQEQOCKPENWUQFGQWVTCUXCTKXGKUCNOFC
SWCPVKFCFGSWGRQFGTKCOKPWGPEKCTPQRTGQFGWODGO
#KPFCEQOTGNCQCQUTGUWNVCFQU\GOQUWOCCPNKUGFQRQVGPEKCNFCGEQPQOKC
que poderia ser gerada caso o mtodo aqui proposto fosse utilizado. Os resultados
Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

159

Felipe Ribeiro Alves Morais

CRQPVCTCORCTCGEQPQOKCUUKIPKECVKXCUFGEGTECFGGOTGNCQCQEWUVQFQ
RTGQJQOQNQICFQKPKEKCNOGPVGPCEQPVTCVCQ
&KCPVGFQUTGUWNVCFQUSWGUGEQPTOCTCOEQPUKUVGPVGURCTCCCOQUVTCRGUSWKUCFC
CCFOKPKUVTCQRblica, caso colocasse em prtica o modelo economtrico para
cmputo do valor ajustado para os fornecimentos adicionais, poderia, por meio de
um rgo central, levantar e atualizar, periodicamente, no portal de compras do
governo federal (www.comprasnet.gov.br) os valores homologados dos certames,
EQODCUGPQEFKIQ%CVOCV5KUVGOCFG%CVCNQICQFG/CVGTKCKURCTCRCFTQPK\CQ
dos objetos e, assim, calcular os custos variveis dos materiais, disponibilizando-os
no portal citado para conhecimento dos rgos e dos licitantes.
O custo varivel desses bens poderia ser calculado sob vrias ticas: por estado, por
TGIKQRQTKPVGTXCNQUFGSWCPVKFCFGUGVE#UUKOQTIQIGTGPEKCFQTFCNKEKVCQ
informaria no instrumento convocatrio qual o custo varivel a ser utilizado para
TGCLWUVGPQURTGQUFCUCFGUGUFGUWCCVC4GUUCNVCOQUEQOQLKPHQTOCFQPCUGQ
FQUTGUWNVCFQUSWGCWVKNK\CQFQOQFGNQRCTCECRVWTCFCUGEQPQOKCUFGGUECNC
UUGTGEC\SWCPFQQRTGQQDVKFQPCNKEKVCQHQTOCKQTSWGQEWUVQXCTKXGN
obtido nas pesquisas. Caso no o seja, considera-se o custo varivel equivalente ao
RTGQQDVKFQ
Concordamos que o tema carona bastante polmico e suscita vrios debates e
questionamentos, principalmente no campo jurdico. Exatamente por isso tentamos
mostrar que, apesar da aparente fragilidade do seu decreto regulamentador,
podemos utilizar esse mecanismo para emprego de um mandamento que quase
sempre no posto em prtica pelos rgo pblicos, que so as economias em escala.
Isso posto, discordamos do entendimento do Tribunal de Contas da Unio, que,
por intermdio do Acrdo n. 1.233/2012-Plenrio, simplesmente limita as adeses
CQSWGGUVZQPQGFKVCN'UUCFGEKUQFC%QTVGFG%QPVCUFGECTVGTEQPUGTXCFQT
acaba por eliminar as vantagens das economias de escala que o governo poderia
extrair em suas compras.
%QPENWOQUSWGQ5KUVGOCFG4GIKUVTQFG2TGQUFGHCVQWOOGECPKUOQKORQTVCPVG
para as compras governamentais, sendo suas funcionalidades de grande valia para
Q RNCPGLCOGPVQ G C IGUVQ FCU CSWKUKGU RDNKECU #FKEKQPCNOGPVG Q OQFGNQ
CRTGUGPVCFQRQFGUGTCRGTHGKQCFQPQUGPVKFQFQCRTQXGKVCOGPVQFCUGEQPQOKCU
de escala, tal como foi exercitado e comprovado neste trabalho.

160

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

O aproveitamento das economias de escala pelo Sistema de Registro de Preos

REFERNCIAS
$+66'0%17465KFPG[Licitao passo a passo. 5. ed. Rio de Janeiro: Temas
& Ideias, 2006.
BRASIL. Decreto n. 3.931, de 19 de setembro de 2001. Regulamenta o Sistema de
4GIKUVTQFG2TGQURTGXKUVQPQCTVFC.GKPFGFGLWPJQFGG
d outras providncias. Presidncia da Repblica. Disponvel em: <http://www.
planalto.gov.br/ccivil_03/decreto/2001/D3931htm.htm>. Acesso em: 25/05/2011.
AAAAAA.GKPFGFGLWPJQFG4GIWNCOGPVCQCTVKPEKUQ::+FC
%QPUVKVWKQ(GFGTCNKPUVKVWKPQTOCURCTCNKEKVCGUGEQPVTCVQUFC#FOKPKUVTCQ
Pblica e d outras providncias. Presidncia da Repblica. Disponvel em: <http://
www.planalto.gov.br/ccivil_03/LEIS/L8666cons.htm>. Acesso em: 25/05/2011.
('40#0&'5 , 7 , %CTQPC GO UKUVGOC FG TGIKUVTQ FG RTGQU WOC QRQ
KPVGNKIGPVGRCTCTGFWQFGEWUVQUGEQPVTQNGO Pregoeiro, Curitiba, p. 27-32, nov.
'FKQGURGEKCN
______. Vade-mcum de licitaes e contratos. 3. ed. Belo Horizonte: Frum, 2008.
GUJARATI, D. N. Econometria bsica6TCFWQ/CTKC,QU%[JNCT/QPVGKTQ
Rio de Janeiro: Elsevier, 2006. 148 p.
JUSTEN FILHO, M. TCU restringe a utilizao de carona no sistema de
registro de preos. Disponvel em: <http://www.justen.com.br//informativo.
php?&informativo=6&artigo=294&l=pt.>. Acesso em: 25/05/2011.
______. Comentrios Lei de Licitaes e Contratos Administrativos. 11. ed.
So Paulo: Dialtica, 2005.
-72('4&*#5'0%.'8'4.
1TI Economia industrial: fundamentos
tericos e prticas no Brasil. Rio de Janeiro: Elsevier, 2002.
MORAIS, F. R. A. O sistema de registro de preos e a economia de escala no setor
pblicoWOGUVWFQFGECUQPCUEQORTCUIXGTPCOGPVCKU/QPQITCC
'URGEKCNK\CQ
GO(KPCPCU2DNKECU 'UEQNCFG#FOKPKUVTCQ(C\GPFTKC$TCUNKC
0+'$7*4 , / %CTQPC GO CVC FG TGIKUVTQ FG RTGQU CVGPVCFQ XGGOGPVG CQU
princpios de direito administrativo. Revista Znite de Licitaes e Contratos
ILC, So Paulo, n. 143, jan. 2006.
______. Prego presencial e eletrnico. 5. ed. Curitiba: Znite, 2008.
4'+525/1ECTQPCPQ5KUVGOCFG4GIKUVTQFG2TGQUILC Informativo de
Licitaes e Contratos, Curitiba, n. 167, jan. 2008.
SILVA, A. H. L. da. Economia de escala das compras governamentais: problema
QWUQNWQ!Revista de Direito Pblico da Economia RDPE, Belo Horizonte,
ano 8, n. 30, p. 9-25, abr./jun. 2010.
Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

161

Felipe Ribeiro Alves Morais

TRIBUNAL DE CONTAS DA UNIO (TCU). Acrdo-TCU n. 1.233, de


 FG OCKQ FG  6/5  )GUVQ G WUQ FG VGEPQNQIKC FC KPHQTOCQ

6+ 4GNCVTKQEQPUQNKFCFQVTCDCNJQUCDTCPIGPFQQTICPK\CGURDNKECU
HGFGTCKU %QPUKFGTCGU C TGURGKVQ FCU EQPVTCVCGU FG UQNWGU FG 6+ RGNQ
UKUVGOC FG TGIKUVTQ FG RTGQU
542  %QPUKFGTCGU UQDTG Q VGOC IQXGTPCPC
EQTRQTCVKXCGIQXGTPCPCFG6+4GEQOGPFCGUGFGVGTOKPCGU&KURQPXGNGO
<https://contas.tcu.gov.br/juris/Web/Juris/ConsultarTextual2/Jurisprudencia.
faces?colegiado=PLENARIO&numeroAcordao=1233&anoAcordao=2012>.
Acesso em: 14/02/2013.
______. 1487/2007 ATA 32 PLENRIO, de 1o de agosto de 2007. Necessidade
FGCRGTHGKQCOGPVQFCPQTOCVK\CQFCUKUVGOVKECFG#VCFG4GIKUVTQFG2TGQU
%QPJGEKOGPVQ2TQEGFPEKCRCTEKCN&GVGTOKPCQ%KPEKC/QPKVQTCOGPVQ&KURQPXGN
em: <https://contas.tcu.gov.br/juris/Web/Juris/ConsultarTextual2/Jurisprudencia.
faces?colegiado=PLENARIO&numeroAcordao=1487&anoAcordao=2007>.
Acesso em: 14/02/2013.
VARIAN, Hal. R. MicroeconomiaRTKPERKQUDUKEQU6TCFWQ/CTKC,QU%[JNCT
Monteiro e Ricardo Doninelli. Rio de Janeiro: Campus, 2006.

162

Cad. Fin. Pbl., Braslia, n. 12, p. 137-162, dez. 2012

Planejamento tributrio e a norma cogente no tributria


Igaro Jung Martins
Auditor-Fiscal da Receita Federal do Brasil
Bacharel em Cincias Contbeis (UFRGS) e Direito
(PUCRS). Especialista em Direito Tributrio (Esaf)

Resumo
O planejamento tributrio estrutura-se com base
em negcios jurdicos, disciplinados por normas
cogentes no tributrias. O conhecimento dessas
normas permite ao intrprete a identificao de
XEKQU
GZKUVPEKCQWPQFGRCVQNQIKCUFGFKTGKVQ #
existncia de uma patologia de direito um critrio
jurdico seguro para identificar um planejamento
tributrio abusivo. Essa concluso foi possvel em
razo da pesquisa instrumental sobre as trs fases
do planejamento, didaticamente organizadas por
Marco Aurlio Greco, e de como o conhecimento
das patologias do direito privado necessrio para
interpretao do planejamento tributrio, que deve
recair sobre o fato, desnudado das qualificaes
jurdicas que as partes lhe atribuem, o que no diz
respeito aplicao da analogia ou interpretao
econmica, mas sim em investigar a real situao
antecedente e consequente ocorrncia dos negcios
jurdicos que integram o planejamento tributrio
e verificar se h motivos legtimos para sua
ocorrncia, em outras palavras, se h propsito
negocial. Durante o estudo, foram analisados 18
casos de planejamento tributrio julgados pelo
%QPUGNJQ#FOKPKUVTCVKXQFG4GEWTUQU(KUECKU
%CTH 
e para sistematiz-los utilizamos a metodologia
Normative Systems. Ao final, conclui-se que, nessa
segunda fase do planejamento tributrio, a cincia
do direito apresenta elementos suficientes e seguros
para considerar como no abusivo o planejamento
tributrio que se encontre livre de patologias e
quando verificadas razes extratributrias (propsito
PGIQEKCN  RCTC C TGCNK\CQ FQ PGIEKQ LWTFKEQ
Nessas circunstncias o planejamento tributvel
oponvel ao Fisco. Ser, contudo, inoponvel quando
existir qualquer tipo de patologia (simulao, abuso
FGFKTGKVQHTCWFGNGKXI PGUUGECUQQNCPCOGPVQ
de ofcio, tendente a recuperar o tributo no
recolhido, se d ao amparo do art. 149, inciso VII, do
%FKIQ6TKDWVTKQ0CEKQPCN
%60 &GUPGEGUUTKQ
portanto, para os casos em que provada a existncia
de uma patologia de direito, a regulamentao do
pargrafo nico do art. 116 do CTN para que o
Fisco considere abusivo o planejamento tributrio.
A regulamentao desse dispositivo do CTN levarnos- terceira fase do planejamento tributrio,

isto , apenas com a edio de uma Norma Geral


Antielisiva existir procedimento que permita ao
Fisco imiscuir-se em planejamentos tributrios livres
de qualquer patologia de direito. Nessa terceira fase,
caber ao sujeito passivo demonstrar a existncia de
causa extratributria para a realizao do negcio
jurdico para que este seja considerado planejamento
tributrio vlido.

Palavras-chave
Planejamento tributrio. Norma cogente no
tributria. Patologias do direito. Negcio jurdico.
Propsito negocial.

Abstract
The tax planning is structured from legal
business, ruled by non-tax applicable standards.
The knowledge of these rules allows addiction
identification by the interpreter (whether or
PQV NCY RCVJQNQI[ GZKUVU  6JG GZKUVGPEG QH C NCY
pathology is a safe legal criteria used to identify an
abusive tax planning. This conclusion was made
possible from the instrumental research over the
three stages of planning, didactically organized
by Marco Aurlio Greco and how the knowledge
of private law pathology is fundamental for tax
planning demonstration, which should be based on
the fact, striped from its attached legal qualifications,
not only in regard of the analog application or
economic reading, but in investigate the real
background situation and the following occurrence
of legal transactions which forms tax planning
and also check if there is legitimate reasons for its
occurrence, in other words, if business purposes
exists. Throughout the study, eighteen tax planning
scenarios were evaluated and systemized by the
#FOKPKUVTCVKXG%QWPEKNQH(KUECN#RRGCNU
#%(# 
while the Normative Systems methodology was used.
In the end, one may conclude that, in the second
stage of tax planning, the Legal Science presents
sufficient and secure evidences to be considered as
non-abusive, the tax planning which is released from
pathologies and when the extra taxation subject

DWUKPGUU RWTRQUG  KU XCNKFCVG VQ VJG GUVCDNKUJOGPV


of the legal transaction, in those circumstances the
taxable planning opposes to the tax authorities.
However, it will not contest when any kind of
pathology exist (simulation, abuse of rights, fraud
CICKPUVVJGNCYXI KPUWEJECUGVJGNCWPEJQH
the business, the pledge to reclaim non-collected tax
is protected by the article 149, paragraph VII of the

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

163

Igaro Jung Martins

%FKIQ6TKDWVTKQ0CEKQPCN
%60 +VKUVJGTGHQTGWPPGEGUUCT[VQVJGGZCORNGUYJGTGVJGGZKUVGPEGQHC
legal pathology exists, prevailing of the sole paragraph of CTNs article 116, so the tax authorities considers
the tax planning as abusive. The regulation of this provision made by CTN will take us to the third stage
of Tax planning, or just issuing an Anti Tax Fraud General Rule, there will be a procedure allowing the
Tax Authorities to interfere in tax planning, free from any legal pathology. In the third stage it will be up
to the taxable person validates the existence of an extra taxation factor when executing a legal business and
it could be considered as a valid tax planning.

Keywords
Tax planning. Non-tax applicable standards. Legal pathologies. Legal transaction. Business purpose.

1 INTRODUO
#TGSWCNKECQFQUHCVQURTCVKECFCRGNQ(KUEQVGORTQRQTEKQPCFQSWGUVKQPCOGPVQU
por aqueles que defendem a liberdade absoluta para contratar. Para eles, quaisquer
hipteses no previstas de forma estrita e literal no texto da lei tributria caracterizam
CWVKNK\CQFCKPVGTRTGVCQGEQPOKECCCRNKECQFCCPCNQIKCRCTCGZKIKTVTKDWVQU
GRQTEQPUGSWPEKCCKORQUKQFGGNGXCFQITCWFGKPUGIWTCPCLWTFKEC
A norma tributria incide sobre fatos tpicos, todavia estes, por vezes, podem
receber roupagem inusual em decorrncia das inmeras possibilidades que o direito
privado oferece. O Novo Cdigo Civil positivou princpios e regras sobre os quais
CLWTKURTWFPEKCGQUFQWVTKPCFQTGULUGFGDTWCXCOJCNIWOVGORQ2CUUCTCOC
KPVGITCTQ0QXQ%FKIQ%KXKNKPUVKVWVQUGUQNWGUPQTOCVKXCUFQVCFQUFGEGTVC
UGFKOGPVCQGGUVCDKNKFCFGSWGVKXGTCOEQOQPCNKFCFGCEQNJGTOQFGNQULWTFKEQU
validamente elaborados pela jurisprudncia construtiva de nossos tribunais.1
O direito tributrio e o direito privado esto umbilicalmente ligados. O prprio
Cdigo Tributrio Nacional (CTN), Lei n. 5.172, de 25 de outubro de 1966, art. 109,
reconhece a importncia dos princpios gerais de direito privado para a pesquisa da
FGPKQFQEQPVGFQGFQCNECPEGFGUGWUKPUVKVWVQURTGUGTXCPFQCCWVQPQOKCFQ
FKTGKVQVTKDWVTKQGOTGNCQCQUGHGKVQUSWGCPQTOCVTKDWVTKCRQTXGPVWTCXGPJCC
GUVCDGNGEGT1NGIKUNCFQTVTKDWVTKQXCNGUGFGUUGUEQPEGKVQURCTCSWCNKENQU
A par desses novos instrumentos de direito privado, uma questo ainda restava mal
TGUQNXKFCPQFKTGKVQVTKDWVTKQGSWGHQKHWPFCOGPVCNRCTCCOKITCQFCRTKOGKTC
para a segunda fase do planejamento tributrio. Por que apenas a patologia do tipo
UKOWNCQRQFGTKCUGTTGLGKVCFCRGNQ(KUEQ!#UFGOCKURCVQNQIKCUGUGWUGHGKVQUSWG
tambm maculam o negcio jurdico, consagradas no direito privado continuavam
C UGT FG CEGKVCQ QDTKICVTKC RGNQ (KUEQ! %QOQ EKPEKC Q FKTGKVQ FGXG RCTC C
mesma premissa, apresentar o mesmo resultado. Nasce, ento, a segunda fase do
planejamento tributrio: liberdade, salvo patologias (GRECO, 2008, p. 186).
 'ZRQUKQFG/QVKXQUFQ5WRGTXKUQTFC%QOKUUQ4GXKUQTCG'NCDQTCFQTCFQ%FKIQ%KXKNRTQH/KIWGN4GCNG
item 4. Disponvel em: <http://200.251.3.5/download/codigocivil.pdf>. Acesso em: 17/09/2011.

164

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

1EQPJGEKOGPVQFCURCVQNQIKCUFGFKTGKVQRTKXCFQKORQTVCPVGRCTCCKPVGTRTGVCQ
do planejamento tributrio, em que pese o posicionamento contrrio da doutrina
clssica, ainda arraigada primeira fase do planejamento tributrio, em que tudo
XNKFQUGPQJQWXGTUKOWNCQ
5QDTG C KPVGTRTGVCQ RTGQEWRCOQPQU GO FGOQPUVTCT ETKVTKQU UGIWTQU RCTC
concluir que na atual fase do planejamento tributrio no se est a utilizar a analogia
QW C KPVGTRTGVCQ GEQPOKEC #SWK WO EQORQPGPVG CUUWOG GURGEKCN TGNGXQ C
existncia de propsito negocial, ou seja, cabe ao aplicador da norma tributria
XGTKECT UG GZKUVGO OQVKXQU GZVTCVTKDWVTKQU SWG LWUVKSWGO Q RNCPGLCOGPVQ
tributrio.

2 PLANEJAMENTO TRIBUTRIO
2.1 CONCEITO
O conceito de planejamento tributrio no unnime na doutrina, ainda que seja
EQPUGPUQFQUSWGGUETGXGOUQDTGQVGOCUWCHWPQFGGEQPQOK\CTVTKDWVQU&GEQTTG
FQGZGTEEKQFCNKDGTFCFGFGCQGOGZRNQTCTGXGPVWCNNCEWPCPQQTFGPCOGPVQ
LWTFKEQOCUFGXGUGTCNIQRTXKQ0QECUQRTXKQCQPCUEKOGPVQFCQDTKICQ
tributria. Para Andrade Filho (2009, p. 10), a licitude do planejamento tributrio
PQGUVWPKECOGPVGPCQDUGTXPEKCFQTKVQHQTOCNFQUCVQUQWPGIEKQULWTFKEQU
indispensvel que os atos ou negcios existam (produzam os efeitos que so
prprios).
#GEQPQOKCFGQRQGUVCTKCHQTCFQEQPEGKVQFGRNCPGLCOGPVQRCTC)TGEQ

p. 100), pois corresponde a escolhas que o ordenamento positivamente coloca
FKURQUKQFQEQPVTKDWKPVG(WPFCOGPVCQCWVQTUWCRQUKQFGSWGCEQPFWVCRGNC
QRQFGRCICTOGPQUVTKDWVQUWOCGUEQNJCSWGQQTFGPCOGPVQGZRTGUUCOGPVG
cria e cujos efeitos tributrios j esto assegurados. O referido doutrinador salienta
SWGPQUGEQPIWTCGEQPQOKCFGQRQSWCPFQQEQPVTKDWKPVGEQPUVTKRQT
OGKQFGWOCOQPVCIGOQWUWDUVKVWKQLWTFKECQRTGUUWRQUVQFGHCVQFCQRQ
Nessa hiptese, est-se diante de um caso de planejamento que poder ser ou no
GEC\RGTCPVGQ(KUEQ
)4'%1R 'OUGPVKFQEQPVTTKQ#DTCJCO

R FGHGPFGSWGRNCPGLCOGPVQVTKDWVTKQKPENWKCGEQPQOKCFGQRQ
'PVGPFGOQU SWG GODQTC CU QRGU FG GEQPQOKC FG VTKDWVQU GUVGLCO 
FKURQUKQFQEQPVTKDWKPVGPCNGKGUVGFGXGTTGCNK\CTCUWCKFGPVKECQ
PQ
VGZVQ NGICN  C OGPUWTCQ FG KPVGTGUUG
EWUVQDGPGHEKQ  C PGEGUUKFCFG
QW
PQ  FG KORNGOGPVCT OWFCPCU GUVTWVWTCKU PCU UWCU CVKXKFCFGU GEQPOKECU
RCTCCFGSWCQQRQRCTCGPVQGUQOGPVGCRUFGEKFKTUGKTQRVCTRGNC
QRQUECNFGTGFWQFGKORQUVQU

O planejamento tributrio deve observar a legitimidade de meios e deve ocorrer


CPVGUFQHCVQIGTCFQT#UUKORNCPGLCOGPVQVTKDWVTKQRQFGUGTFGPKFQEQOQQ
Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

165

Igaro Jung Martins

RTQEGFKOGPVQOGVQFQNIKEQFGUVKPCFQCPNKUGGUGNGQFGCNVGTPCVKXCURTXKQ
CQPCUEKOGPVQFCQDTKICQVTKDWVTKCFGFKECFQCDWUECTCOGPQTECTICVTKDWVTKC
RCTCWOCUKVWCQHVKECSWGRQFGGPXQNXGTCOQFGNCIGOFGQRGTCGUQWCUKORNGU
WVKNK\CQFGQRGUGZRTGUUCOGPVGRTGXKUVCUPQQTFGPCOGPVQLWTFKEQ
2.2 ELISO FISCAL E EVASO FISCAL
Eliso e evaso tm naturezas jurdicas antagnicas. Eliso a atividade lcita
destinada a economizar tributos, que se d pelo planejamento prvio e anterior
CQ PCUEKOGPVQ FC QDTKICQ VTKDWVTKC  UKPPKOQ FG RNCPGLCOGPVQ VTKDWVTKQ
(ANDRADE FILHO, 2009, p. 90).
2QTUWCXG\GXCUQUECNCGEQPQOKCKNEKVCQWHTCWFWNGPVCFGVTKDWVQU
/#4+05
 R   3WCPFQ C EQPFWVC GXCUKXC  VKRKECFC RGNC NGK RGPCNVTKDWVTKC GNC
 FGPKFC EQOQ UQPGICQ UECN UWLGKVC RQTVCPVQ  UCPQ 0WOC RTKOGKTC
CPNKUGQWCKPFCFQRQPVQFGXKUVQVGTKEQCRCTVKTFCFGPKQFGGNKUQGGXCUQ
TGNCVKXCOGPVGHEKNKFGPVKECTCNKPJCFKXKUTKCFGWOCGFGQWVTC2QTWONCFQ
GNKUQEQPUKUVGPCNKEKVWFGFQUOGKQUGPCQEQTTPEKCFGUVGUCPVGUFQHCVQIGTCFQT
evaso, por outro, decorre de um processo ilcito e, quanto ao aspecto temporal,
ocorre durante ou depois do fato gerador (MARINS, 2002, p. 33).
Cabe ressaltar, para que no se conclua de forma equivocada, que o critrio temporal
PQDCUVCRQTUKUEQOQLWUVKECVKXCCDUQNWVCRCTCCEQPUKFGTCQFCNKEKVWFGGFC
NGIKVKOKFCFGFQHCVQ/GUOQPQECUQFGCQRGTCQUGFCTCPVGUFCQEQTTPEKCFQ
HCVQIGTCFQTHC\UGPGEGUUTKQSWGCTGHGTKFCQRGTCQUGLCNEKVCGOUGPVKFQCORNQ
Torres traz ainda o conceito de eluso tributria, que decorre da liberdade negocial
do agente, sempre vinculada a trs possibilidades de escolha: causa, forma e tipo.
Quando o contribuinte se afasta de alguma dessas trs possibilidades est praticando
uma conduta elusiva, isto , no exerccio da liberdade privada, mas maculada pela
ausncia de legitimidade.
2.3 NORMA ANTIELISIVA
7OCPQTOCCPVKGNKUKXCEQOQUGFGRTGGPFGFCUWCFGPQOKPCQPQUGFGUVKPC
a dispor de ferramentas para enfrentar condutas evasivas, que j possuem, na lei
OCVGTKCN ETKVTKQU GURGEEQU FG UCPQ 0QTOCU CPVKGNKUKXCU RQFGO UGT IGTCKU
QWGURGEECU 5Q IGTCKUSWCPFQ UGXCNGOFG TGITCUQWRTKPERKQU LWTFKEQU SWG
EQPVGPJCOGZRTGUUGUCORNCUGZXGKUGKPFGVGTOKPCFCU
RQTOFGVGTOKPXGKU 
Exemplo de norma geral para combater prticas elisivas a traduzida no pargrafo
nico do art. 116 do CTN, inserido pela Lei Complementar n. 104, de 10 de janeiro
de 2001.
Para Greco (2008, p. 468), a referida norma no se aplica s patologias dos negcios
LWTFKEQU
UKOWNCQCDWUQFGFKTGKVQGHTCWFGNGK OCUGUVCDGNGEGKPUVTWOGPVQU
166

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

RCTCCPNKUGFGPGIEKQUGNKUKXQUCKPFCSWGPQRCFGCOFGSWCNSWGTXEKQLWTFKEQ
Tal dispositivo, de carter geral, abre a possibilidade para aferir se esses negcios
se subsumem ao princpio da capacidade contributiva, razo pela qual entende a
PGEGUUKFCFGFGRTQEGFKOGPVQGURGEKCNRCTCCCPNKUGFGUUCUWDUWPQ
0QTOCU CPVKGNKUKXCU GURGEECU FGUVKPCOUG C HGEJCT NCEWPCU FQ QTFGPCOGPVQ
OGFKCPVGCETKCQFGRTGUWPGUNGICKU'ZGORNQUTGITCUFGRTGQUFGVTCPUHGTPEKC2
TGITCU FG FKURQPKDKNK\CQ FG NWETQU PQ GZVGTKQT3 XGFCQ FG EQORGPUCQ FG
RTGLW\QUUECKUFCRGUUQCLWTFKECKPEQTRQTCFC4 etc.
2.4 AS TRS FASES DO PLANEJAMENTO TRIBUTRIO
)TGEQ
R CQCPCNKUCTCGXQNWQFQRNCPGLCOGPVQVTKDWVTKQGUVCDGNGEGW
que trs fases se destacam, todas elas tendo como tema central a oponibilidade
ao Fisco.
Antes de explicar cada uma dessas fases, o autor destaca que durante muitos anos
vigoraram dois critrios para a anlise do planejamento tributrio: o primeiro de
ECTVGTETQPQNIKEQPQUGPVKFQFGSWGQUCVQUSWGKORNKECUUGOTGFWQFCECTIC
VTKDWVTKCFGXGTKCOQEQTTGTCPVGUFQPCUEKOGPVQFQHCVQIGTCFQTQUGIWPFQETKVTKQ
residiria na licitude, no sentido de que os atos praticados deveriam resultar de atos
lcitos, fato que os tornaria inquestionveis pelo Fisco.
#CPNKUGENUUKECFQRNCPGLCOGPVQVTKDWVTKQ
ETQPQNIKEQGNKEKVWFG EQOGQWC
RGTFGTGURCQSWCPFQUGRCUUQWCPNKUGFQUCVQUCRCTVKTFCGEEKCFGUVGURGTCPVGQ
(KUEQ0GUUGCURGEVQ)TGEQ
R PQUGPUKPCSWGUGVTCVCFGGEEKCUQOGPVG
RGTCPVGQ(KUEQRQKUQOGUOQPGIEKQRQFGIGTCTGHGKVQUGOXTKCUFKTGGUGGO
TGNCQCXTKCURGUUQCU
Assim como a no oponibilidade ao Fisco no produz efeitos para as demais
pessoas evolvidas, os efeitos do negcio jurdico para essas pessoas no podem ser
VTCPURNCPVCFQUCWVQOCVKECOGPVGRCTCQODKVQUECN2QTGZGORNQCQDUGTXPEKC
de uma determinada norma editada por uma agncia reguladora produz efeitos
RGTCPVGGUVCOCUGUUCQDUGTXPEKCPQRQTUKUUWEKGPVGRCTCRTQFW\KTGHGKVQU
perante o Fisco.
2.4.1 FASE DA LIBERDADE ABSOLUTA
Esta fase do planejamento tributrio est associada liberdade absoluta do indivduo
em poder agir como bem entender para dispor dos seus negcios, salvo os atos ilcitos
TGCNK\CFQUFGRQKUFCQEQTTPEKCFQHCVQIGTCFQTQWEQOUKOWNCQ1KPFKXFWQU
aceita ser tributado (agredido, como refere o autor (GRECO, 2008, p. 129)) naquilo
que no pode escapar.
2 Lei n. 9.430, de 27 de dezembro de 1996, arts. 18 a 24-B.
3 Medida Provisria n. 2.158-34, de 27 de julho de 2001, art. 74.
4 Decreto-Lei n. 2.341, de 29 de junho de 1987, art. 33.

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

167

Igaro Jung Martins

Greco (2008, p. 126) destaca o desenho clssico da eliso tributria, anterior ao fato
IGTCFQTNKEKVWFGGUGOUKOWNCQSWGGUVNKICFCCQXEKQFGXQPVCFG%QPUGSWPEKC
da legalidade estrita o banimento da analogia no direito tributrio (CTN, art. 108,
+h 7OCFCUECTCEVGTUVKECUFGUUCHCUGCGSWKRCTCQFQFKTGKVQVTKDWVTKQGFQ
direito penal, fato que inequivocadamente igualava o valor propriedade ao valor
liberdade.
O contribuinte, nesta fase, tem liberdade absoluta para se auto-organizar: ao Fisco,
UNEKVQEQDTCTVTKDWVQUQDTGHCVQGURGEKECFCOGPVGFGUETKVQPCNGK&GUUCHQTOC
tudo o que no esteja descrito de forma pormenorizada na norma est fora da sua
incidncia, portanto lacuna.
'OFGEQTTPEKCFKUUQPGUVCHCUGUWTIKTCOKPOGTCUQRGTCGUOGTCOGPVGHQTOCKUQ
que teve como consequncia um aumento exponencial de normas tributrias, sempre
destinadas a preencher as lacunas normativas, que invariavelmente demandavam
ITCPFGGUHQTQKPVGTRTGVCVKXQGFGQTKGPVCQCQUCIGPVGUUECKUGCQUEQPVTKDWKPVGU
ECWUCPFQKPUGIWTCPCLWTFKEC
Esse modelo privilegia o antagonismo entre o lcito e o ilcito, a prevalncia da forma,
KPENWUKXGEQOQOCPKHGUVCQFCXQPVCFGGOSWGCUKOWNCQUGTKCWOXEKQFGUUC
vontade. Greco (2008, p. 135) resume esta fase concluindo que o modelo sustenta
SWGCNKEKVWFGFQOGKQWVKNK\CFQKORNKECCCEGKVCQFQTGUWNVCFQGPVGPFKFQEQOQ
efeito tributrio..
2QTOCQCTOCTSWGCUKOWNCQUGTKCWOXEKQFGXQPVCFGCFKUEWUUQUQDTG
C NKEKVWFG QW PQ FQ RNCPGLCOGPVQ VTKDWVTKQ TGECK GO XGTKECT UG J QW PQ
FWCUXQPVCFGUWOCTGCNGQWVTCCRCTGPVG#UKOWNCQCDUQNWVCFGRGPFGTKCFGUG
demonstrar a existncia dessas duas vontades, ou seja, que a vontade aparente no
corresponde vontade real. Este o principal equvoco dos que se posicionam
PGUVCRTKOGKTCHCUGFQRNCPGLCOGPVQVTKDWVTKQEQPUKFGTCTCUKOWNCQEQOQXEKQ
de vontade.
5KOWNCQPQGUVPQRNCPQFCXQPVCFGOCUFCECWUCFQPGIEKQLWTFKEQEQOQ
CTOC)QOGU
R &GUUCHQTOCRCTCXGTKECTUGQPGIEKQUKOWNCFQ
deve-se analisar a compatibilidade entre sua causa e o prprio negcio, qual o
propsito de se realizar determinado negcio jurdico. Por que realizar um contrato
de leasingGPQWOCEQORTCGOXGPFCCRTC\Q!3WCNCTC\QRCTCWOCUWDUETKQ
FGECRKVCNUGIWKFCFGEKUQGPQWOCCNKGPCQFGCGU!
Greco (2008, p. 184) esclarece a origem e a razo que embasam essa necessria
OWFCPCUQDTGQQDLGVQFGCPNKUGFCUKOWNCQ
%QOKUUQEQOGCOQUCOQPVCTQSWGDTCECDGC0COGFKFCGOSWGQFGDCVG
UQDTGUKOWNCQFGUNQECFQRCTCQGNGOGPVQECWUCVCODOUGFGUNQECQHQEQ
do querer para o fazer. A corrente doutrinria dominante no Brasil, que
XCUKOWNCQEQOQXEKQFGXQPVCFGCRQKCUGPCFQWVTKPCEKXKNKUVCHTCPEGUC
168

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

em que o fundamental era amarrar o poder do rei prestigiando a autonomia


da vontade individual. [...] O pensamento de Orlando Gomes est em sintonia
EQO C FQWVTKPC CNGO SWG PQ CRTGUGPVCXC CSWGNC QDUGUUQ FC 4GXQNWQ
Francesa, ao contrrio, na Alemanha a autoridade do imperador germnico
PWPECHQKEQNQECFCGOFXKFC0QJCXKCWOEQPHTQPVQVQCITCPVGEQOC
autoridade, portanto no relevante amarrar o exerccio do poder garantindo
a vontade individual. [...] Desta perspectiva, o elemento chave a causa (ou
motivo) do negcio jurdico, e no a vontade. Se o vcio da causa, ento
temos de perguntar: por que o contribuinte fez isso? At que ponto o negcio
jurdico que fez compatvel com a causa invocada?

Conclui o autor que o negcio simulado se motivo no existir, ou se for


KPEQORCVXGNEQOQPENGQFQPGIEKQCFQVCFQQWUGGZKUVKTWOCKPCFGSWCQGPVTG
o motivo real e o motivo aparente (GRECO, 2008, p. 184). Passa-se a no mais
analisar a questo da vontade real e aparente, mas a causa real do negcio jurdico.
2.4.2 FASE DA LIBERDADE RELATIVA
O planejamento tributrio deixa de ser analisado apenas sob o ponto de vista
HQTOCN
RTKOGKTCHCUG OCUVCODOUQDQPIWNQFGUWCWVKNK\CQEQPETGVCFQ
seu funcionamento e dos resultados decorrentes, luz dos valores da igualdade, da
UQNKFCTKGFCFGGFCLWUVKC
Greco (2008, p. 195) explica esse novo enfoque:
'ODQTCTGEQPJGCSWGQEQPVTKDWKPVGVGOQFKTGKVQFGQTICPK\CTUWCXKFC

FGUFGSWGQHCCCVGPFGPFQCQUTGSWKUKVQUFCNKEKVWFGFQUOGKQURTGXKGFCFGGO
TGNCQCQHCVQIGTCFQTKPGZKUVPEKCFGUKOWNCQUGOFKUVQTGUQWCITGUUGU
ao ordenamento), sou imediatamente conduzido concluso (alis, aceita de
forma praticamente unnime nos pases ocidentais) de que um direito absoluto
GKPEQPVTCUVXGNPQUGWGZGTEEKQIWTCSWGTGRWIPCGZRGTKPEKCOQFGTPC
de convvio em sociedade, fundamentalmente informada pelo princpio da
solidariedade social e no pelo individualismo exacerbado.

Nesta segunda fase do planejamento tributrio, a anlise passa a se preocupar se o


direito foi exercido tal qual originalmente previsto no ordenamento. Greco (2008,
p. 195) explica que essa anlise tem amparo no abuso de direito, oriundo do direito
civil,5 categoria construda para inibir prticas que, embora possam encontrar-se
PQ ODKVQ FC NKEKVWFG KORNKECO PQ UGW TGUWNVCFQ WOC FKUVQTQ PQ GSWKNDTKQ
FQTGNCEKQPCOGPVQGPVTGCURCTVGU0GUUCUUKVWCGUQCVQCDWUKXQUGTUGORTG
inoponvel ao Fisco.

5 Art. 187 do Cdigo Civil. Tambm comete ato ilcito o titular de um direito que, ao exerc-lo, excede
manifestamente os limites impostos pelo seu fim econmico ou social, pela boa-f ou pelos bons costumes.

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

169

Igaro Jung Martins

&GRQKUFGEQOQQCDWUQFGFKTGKVQRCUUQWCUGTGZRTGUUCOGPVGSWCNKECFQ
como ato ilcito, sua existncia faz desaparecer um dos requisitos do planejamento
tributrio, o de estar sustentado em atos lcitos. Nas palavras de Greco (2008, p.
 #EQPIWTCQFGWOCVQKNEKVQ
RQTCDWUKXQ KORNKECPQGUVCTOQUOCKU
diante de um caso de eliso, mas sim de evaso.
Nessa fase do planejamento tributrio, a causa do negcio fator preponderante,
QPGIEKQFGXGUGCRQKCTGOUKVWCGUTGCKUGPQGZENWUKXCOGPVGUECKU5GCECWUC
for exclusivamente pagar menos tributos, ser abusiva.
Greco (2008, p. 203) explica:
[...] os negcios jurdicos que no tiverem nenhuma causa real predominante,
a no ser conduzir a um menor imposto, tero sido realizados em desacordo
EQOQRGTNQDLGVKXQFQPGIEKQGEQOQVCNCUUWOGOWOECTVGTCDWUKXQ
PGUVGECUQQ(KUEQCGNGURQFGUGQRQTFGUSWCNKECPFQQUUECNOGPVGRCTC
TGSWCNKENQUUGIWPFQCFGUETKQPQTOCVKXQVTKDWVTKCRGTVKPGPVGUKVWCQ
SWGHQKGPEQDGTVCRGNQFGUPCVWTCOGPVQFCHWPQQDLGVKXCFQCVQ

4GUUCNVGUGEQPVWFQSWGCTGSWCNKECQFQUCVQUQWPGIEKQUPQRQFGUGTGHGVWCFC
pelo Fisco sob o argumento da abusividade. Caber ao Fisco o nus de provar que a
PCNKFCFGFQPGIEKQHQKGZENWUKXCOGPVGUECNRCTCSWGUGLWUVKSWGCTGSWCNKECQ
No que se refere fraude lei, trata-se, como se ver em tpico prprio sobre as
patologias do direito, de uma observncia da lei apenas formalmente, mas com o
QDLGVKXQFGCVKPIKTWOOEQPVTTKQCQGURTKVQFCNGK0QUGGUVFKCPVGFGWOC
ilicitude, mas de causa de nulidade do negcio jurdico.6
2.4.3 FASE DA LIBERDADE COM CAPACIDADE CONTRIBUTIVA
Greco (2008, p. 307) explica que a terceira fase do debate do planejamento tributrio
pode ser denominada como liberdade com capacidade contributiva.
Assim, ainda que o negcio jurdico seja lcito e no sofra de nenhuma das patologias,
PGOCUUKOQEQPVTKDWKPVGRQFGTCIKTEQOQDGOGPVGPFGTRQKUUWCCQFGXGUGT
analisada sob a perspectiva da capacidade contributiva.
6QFCXKCCCRNKECQFGRTKPERKQUUQDTGVWFQRCTCFGUSWCNKECTQUGHGKVQUFGPGIEKQU
LWTFKEQUJFGUGTGHGVWCFCEQORQPFGTCQ)TGEQ
R TGEQPJGEGSWG
se est diante de um risco ao ingressarmos nesta terceira fase, saindo da fase do
VWFQRGTOKVKFQRCTCWOVWFQRTQKDKFQ0QUGGUVCTOCPFQEQPVWFQ
SWGWOCQRGTCQSWGDWUSWGWOCOGPQTECTICVTKDWVXGNQGNGOGPVQPKEQRCTC
UWCTGEWUCRGNQ(KUEQVCORQWEQRQFGCCFQQFGWOCHQTOCLWTFKECNEKVCGNKXTG
de patologias servir de escudo ao contribuinte.
6 Art. 166 do Cdigo Civil. nulo o negcio jurdico quando [...]
 8+VKXGTRQTQDLGVKXQHTCWFCTNGKKORGTCVKXC=?

170

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

A rigor, para Greco (2008, p. 354), o modelo de abordagem funcional para os


casos de planejamento tributrio passa a ser o de analisar cada caso concreto, pois
pretender resolver todas as questes tributrias olhando apenas para o texto frio
da lei adotar um legalismo mope, distanciado da realidade. Para isso, ganham
ainda mais relevncia a anlise dos fatos e suas caractersticas.
0QJPGUUCHCUGEQOQCTOCTGOVGUGSWGFGVGTOKPCFCUQRGTCGUPQUQ
admitidas como de planejamento tributrio vlido (exceto aquelas que se enquadram
nas duas fases anteriores). A anlise do caso concreto passa necessariamente pela
XCNQTCQFQUHCVQUGFGXGNGXCTGOEQPVCCUKVWCQCPVGTKQTGRQUVGTKQTFQEQPVGZVQ
FQPGIEKQLWTFKEQQWUGLCCLWUVKECQFCEQPFWVC
2QTLWUVKECQSWGPQUGEQPHWPFGEQOGZRNKECQ
SWGGUVNKICFCTGNCQFC
ECWUCNKFCFG GPVGPFCUGCVTKDWKTWOCCXCNKCQOQTCNQWLWTFKECRCTCCCQKUVQ
RCTCCEGNGDTCQFQPGIEKQLWTFKEQ
'OTGNCQCQ$TCUKN)TGEQ
R GPUKPCSWGLWNVTCRCUUCOQUCRTKOGKTCHCUG

NGICNKFCFGUGOUKOWNCQ GODQTCTGEQPJGCSWGCKPFCGZKUVCOXQ\GUFKUUQPCPVGU
quanto a isso. Para ele, encontramo-nos atualmente na segunda fase, em que
KPFKURGPUXGNPQJCXGTRCVQNQIKCUPQPGIEKQLWTFKEQQWUGLCQRGTCQGOHTCWFG
lei ou fruto de abuso de direito no est protegida pelo ordenamento positivo.
importante frisar que enquanto nas duas primeiras fases se est diante de vcios
do negcio, portanto de incumbncia do Fisco provar a existncia desses vcios
ao analisar o negcio jurdico. Na terceira fase do planejamento tributrio, a prova
FCLWUVKECQECDGTCQEQPVTKDWKPVGRQKUUGNGRQFGTFGOQPUVTCTRQUKVKXCOGPVG
QU OQVKXQU G C EQPITWPEKC FCU QRGTCGU KPENWUKXG EQO GNGOGPVQU GZVGTPQU
ao negcio, que redundaram em menor carga tributria, ou seja, a existncia de
propsito negocial.
2.5 IGUALDADE TRIBUTRIA E CAPACIDADE CONTRIBUTIVA
#GZKUVPEKCQWPQFCKIWCNFCFGFGEQTTGFCTGNCQGPVTGFQKUQWOCKUUWLGKVQUC
RCTVKTFGWOETKVTKQFGEQORCTCQ#KIWCNFCFGVTKDWVTKCPQCNIQUKORNGUPQ
FKTGKVQ1GUVWFQFCKIWCNFCFGGZKIGWOETKVTKQFGFKHGTGPEKCQQWPCURCNCXTCU
FGXKNC
R WOCRTQRTKGFCFGTGNGXCPVGWOCTGNCQFGRGTVKPPEKCG
congruncia GPVTGQETKVTKQGUEQNJKFQGQOCUGTCNECPCFQ#NOFKUUQRTGEKUQ
UCDGTUGFGHCVQCURGUUQCUUQKIWCKU
GSWCNQETKVTKQRCTCFGPKTGUUCKIWCNFCFG 
e se devem ou no ser tratadas de forma igual (igualdade prescritiva).
vila (2009, p. 410) defende que os juzos comparativos dependem da anlise dos
fatos, ou seja, se as pessoas tm as propriedades selecionadas como relevantes pela
PQTOC'NGGZGORNKECCUUKOUWCCTOCQ
De fato, duas pessoas podem ser iguais ou diferentes segundo o critrio da
idade, mas devero ser tratadas de modo diferente para votar em alguma
Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

171

Igaro Jung Martins

GNGKQUGWOCVKXGTCVKPIKFQCOCKQTKFCFGPQCNECPCFCRGNCQWVTCGFGXGTQ
UGT VTCVCFCU KIWCNOGPVG RCTC RCICT KORQUVQU RQTSWG C EQPETGVK\CQ FGUUC
PCNKFCFGKPFKHGTGPVGKFCFG

O mesmo autor, ao analisar o caput do art. 5o da CRFB, ressalta que a Lei Maior
assegura a igualdade formal, igualdade perante a lei, e a igualdade material, igualdade
PCNGK#KIWCNFCFGHQTOCNCUUGIWTCCCRNKECQWPKHQTOGFCNGK7OCOGUOCNGK
no pode ser aplicada de um modo para um contribuinte e de outro para outro
contribuinte
8+.#R #KIWCNFCFGPCNGKUKIPKECSWGPQDCUVCSWG
esta seja aplicada a todos (igualdade formal), mas que seja igual para todos. preciso
SWGGNCRTRTKCPQVGPJCWOCFKUVKPQCTDKVTTKC
8+.#R QSWG
PQUNGXCSWGUVQFCKUQPQOKCKUVQVTCVCTFGHQTOCFKHGTGPVGUKVWCGUSWGPQ
so iguais na medida em que elas se diferenciam.
No que diz respeito igualdade formal, exsurge a necessidade de analisar a igualdade
e a legalidade, sobretudo pelo carter geral e abstrato da lei. Esse ponto de
fundamental importncia para a anlise dos casos de planejamento tributrio, pois
FK\TGURGKVQPCURCNCXTCUFGXKNC
R TGNCQGPVTGCIGPGTCNKFCFGG
RQTOCKURCTCFQZCNSWGKUUQRQUUCRCTGEGTCRTGUGTXCQFCKIWCNFCFGRCTVKEWNCT
#CPNKUGFCTGITCIGTCNGCDUVTCVC
NGK GCRTGUGTXCQFCKIWCNFCFGRCTVKEWNCTUGTXGO
FGCTIWOGPVQRCTCCVWCQRGNQUEQPVTKDWKPVGUEQOQKPUVTWOGPVQRCTCPQRCICTQW
pagar menos tributos. O contribuinte busca amparo para o planejamento tributrio
GOWOCPQTOCIGTCNSWGPQEQPVGORNCQWPQUGFGUVKPCCUWCUKVWCQRCTVKEWNCT
UQDQCTIWOGPVQFGSWGCPQTOCNJGEQPEGFGVTCVCOGPVQVTKDWVTKQDGPEQ
Ao abrir o captulo que trata sobre o Sistema Tributrio Nacional, o art. 145 da
%4($GOUGWho, consagra o princpio da capacidade contributiva e, implicitamente,
QFCKIWCNFCFGVTKDWVTKCCQFGPKTSWGQUKORQUVQUVGTQECTVGTRGUUQCNGUGTQ
graduados segundo a capacidade econmica do contribuinte, ou seja, contribuintes
com mesma capacidade contributiva devem ser onerados na mesma medida.
Capacidade contributiva diz respeito capacidade econmica do contribuinte,
que tem duas dimenses: uma subjetiva e outra objetiva. Capacidade contributiva
subjetiva trata em considerar o contribuinte com outros que se encontram em
UKVWCGUFKHGTGPVGUFCUWC%CRCEKFCFGEQPVTKDWVKXCQDLGVKXCFK\TGURGKVQUQRGTCGU
concretamente praticadas pelo contribuinte (VILA, 2009, p. 194). Nesta ltima
dimenso, a capacidade contributiva especialmente importante para o planejamento
tributrio.
)TGEQ
R ECVGITKEQCQCTOCTSWGUJCXGTKUQPQOKCVTKDWVTKCUG
VQFQUCSWGNGUSWGUGGPEQPVTCOPCOGUOCEQPFKQVKXGTGOFGUWRQTVCTCOGUOC
ECTICUECN1WUGLCOGUOQSWGQUOGKQUUGLCONEKVQURCTCRCICTOGPQUVTKDWVQU
ainda assim se estar ferindo a igualdade.

172

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

3 NORMA COGENTE NO TRIBUTRIA


3.1 NOVOS PRINCPIOS DE DIREITO PRIVADO
#RCTVKTFCUNVKOCUFECFCUFQUEWNQ::QFKTGKVQEQOQKPUVTWOGPVQRQNVKEQ
CDUQTXGWQUKFGCKUFG'UVCFQUQEKCNEWLCHWPQRCUUCCUGTTGIWNCTCUTGNCGUGPVTG
os indivduos, priorizando valores como a solidariedade e a igualdade.
0QFGUGORGPJQFGUUCPQXCHWPQQ'UVCFQPQCDCPFQPQWQUENUUKEQURTKPERKQU
da autonomia privada, da liberdade e da propriedade, por exemplo, mas os revestiu de
PQXQUEQPVQTPQUEWLCKPVGTRTGVCQGPEQPVTCTHWPFCOGPVQPQUFGOCKURTKPERKQU
KPUGTKFQUPC%QPUVKVWKQ
0GUUG UGPVKFQ ICPJCO GURGEKCN TGNGXQ RTKPERKQU EQOQ C HWPQ UQEKCN FQ
contrato,7 KUVQ  RCTC C KPVGTRTGVCQ FQU EQPVTCVQU EQPEGKVQU SWG CV OGCFQU
FQUEWNQ::GTCOKTTGNGXCPVGUVCKUEQOQLWUVKCUQEKCNGUQNKFCTKGFCFGRCUUCOC
ser conjugados com os demais princpios clssicos. Abraham (2007, p. 175) explica
SWGCGZRTGUUQHWPQFK\TGURGKVQCQRCRGNFGXGTQWQDTKICQSWGCNIQQW
CNIWO RQUUWK RGTCPVG FGVGTOKPCFC UKVWCQ GPSWCPVQ UQEKCN FK\ TGURGKVQ CQ
que interessa sociedade, portanto aquilo que nos conduz ideia de interesse
RDNKEQQWFGHQTOCOCKUGURGEECCVTCXUFCUWRTGOCEKCFQKFGCNUQEKCNUQDTG
o individual.
10QXQ%FKIQ%KXKNEQPUCITCGUUGUXCNQTGUCQGUVCDGNGEGTSWGCHWPQUQEKCNFQ
EQPVTCVQWOCNKOKVCQECRCEKFCFGFGEQPVTCVCT8GFGSWGPGPJWOCEQPXGPQ
RTKXCFCRTGXCNGEGTUQDTGRTGEGKVQUFGQTFGORDNKECRCTCCUUGIWTCTCHWPQUQEKCN
da propriedade e dos contratos.9
&GUUCHQTOCQRTKPERKQFCHWPQUQEKCNFQUEQPVTCVQURCUUCCUGTWONKOKVCFQT
externo aos contratantes, servindo, portanto, para mitigar os efeitos do contrato
RGTCPVGQOGKQGOSWGUGTGCNK\CQSWGUGVGOFGPQOKPCFQRQTGHGKVQUGZVGTPQU
FCUQDTKICGU
#$4#*#/R 1EQPVTCVQRCUUCCKPVGTGUUCTCRGUUQCU
QWCWOCEQNGVKXKFCFGSWGPQHC\RCTVGFCTGNCQLWTFKECKPENWUKXGQ(KUEQ1U
contratantes continuam livres para contratar, mas a liberdade para estabelecer
clusulas e termos contratuais no pode causar prejuzos a terceiros.
3.2 BOA-F E OS NEGCIOS JURDICOS
5GCHWPQUQEKCNFQUEQPVTCVQUWONKOKVCFQTGZVGTPQCQUEQPVTCVCPVGUCDQCH
WONKOKVCFQTKPVGTPQ#GZKUVPEKCFCDQCHEQPFKQFGXCNKFCFGFQUEQPVTCVQU
 'ZRQUKQFG/QVKXQUFQ5WRGTXKUQTFC%QOKUUQ4GXKUQTCG'NCDQTCFQTCFQ%FKIQ%KXKNRTQHGUUQT/KIWGN
4GCNGKVGOFC2CTVG'URGEKCN.KXTQ+&Q&KTGKVQFCU1DTKICGU&KURQPXGNGOJVVR
download/codigocivil.pdf>. Acesso em: 17/09/2011.
 %FKIQ%KXKNCTV#NKDGTFCFGFGEQPVTCVCTUGTGZGTEKFCGOTC\QGPQUNKOKVGUFCHWPQUQEKCNFQ
contrato.
 %FKIQ%KXKNCTVRCTITCHQPKEQ0GPJWOCEQPXGPQRTGXCNGEGTUGEQPVTCTKCTRTGEGKVQUFGQTFGO
RDNKECVCKUEQOQQUGUVCDGNGEKFQURQTGUVG%FKIQRCTCCUUGIWTCTCHWPQUQEKCNFCRTQRTKGFCFGGFQUEQPVTCVQU

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

173

Igaro Jung Martins

prevista no Cdigo Civil10 como clusula geral dos contratos. Abraham (2007,
p. 195) esclarece que a boa-f, vinculada ao princpio da probidade, constante no
mesmo art. 422 do Cdigo Civil, desloca a ideia da boa-f subjetiva (vinculada ao
aspecto psicolgico do indivduo) para a boa-f objetiva, que conduz a um padro
de comportamento jurdico-social.
#DQCHRQTVCPVQFGUGORGPJCVTUHWPGUPQQTFGPCOGPVQLWTFKEQ
K PQTOC
JGTOGPWVKECJDKNCQRTGGPEJKOGPVQFGNCEWPCU
KK EQOQGNGOGPVQETKCFQTFG
FGXGTGULWTFKEQUPCOGFKFCGOSWGKORGURCTVGUCUCVKUHCQFGKPVGTGUUGUUQEKCKU
G
KKK EQOQNKOKVCFQTCQGZGTEEKQFGFKTGKVQUUWDLGVKXQUEQODCUGPCCRNKECQFG
OCPFCOGPVQUEQOQCNGCNFCFGGCEQTTGQ
#$4#*#/R 
1PGIEKQLWTFKEQGZRTGUUQFCOCPKHGUVCQFCXQPVCFGFCURCTVGUSWGDWUECO
WOGHGKVQLWTFKEQGURGEEQUGLCGNGFGEQTTGPVGFCEQPUVKVWKQFCOQFKECQQW
FCGZVKPQFGFKTGKVQU%QOQCDQCHQDLGVKXCWOCENWUWNCIGTCNFQUEQPVTCVQU
SWGKORGNKOKVCGUCQUEQPVTCVCPVGUSWCPFQPQQDUGTXCFCCDQCHGUVCTGOQU
diante de um negcio antijurdico, passvel, portanto, de ser decretada sua nulidade.
2QTOKPFKURGPUXGNTGUUCNVCTCKORQTVPEKCFQRTKPERKQFCDQCHQDLGVKXCRCTC
o alinhamento efetivo do direito e da tica, conforme explicitado por Miguel Reale,
supervisor da Comisso Revisora e Elaboradora do Cdigo Civil:
Tornar explcito, como princpio condicionador de todo o processo
hermenutico, que a liberdade de contratar s pode ser exercida em consonncia
EQOQUPUUQEKCKUFQEQPVTCVQKORNKECPFQQUXCNQTGURTKOQTFKCKUFCDQCHG
da probidade. Trata-se de preceito fundamental, dispensvel talvez sob o enfoque
de uma estreita compreenso positivista do Direito, mas essencial adequao
das normas particulares concreo tica da experincia jurdica.11 (grifo nosso)

3.3 RELATIVIDADE DAS CONVENES PARTICULARES


1U EQPVTCVQU IGTCNOGPVG ETKCO FKTGKVQU G QDTKICGU GPVTG CU RCTVGU  RTGEKUQ
SWG CNIWO IWTG EQOQ EQORTCFQT GO WO EQPVTCVQ RCTC SWG RQUUC CFSWKTKT
a propriedade de um bem, por exemplo.12
#TGNCVKXKFCFGFCUEQPXGPGURCTVKEWNCTGUFGEQTTGFQRTKPERKQFCHWPQUQEKCN
devidamente sopesada com os princpios da proporcionalidade e da razoabilidade.
Dessa forma, ainda que imediatamente o contrato diga respeito s partes, em
TC\Q FC HWPQ UQEKCN FQU EQPVTCVQU FGXKFCOGPVG UQRGUCFC RGNQU RTKPERKQU FC
proporcionalidade e da razoabilidade, h de se analisar se ele no irradia efeitos para
10 #TV1UEQPVTCVCPVGUUQQDTKICFQUCIWCTFCTCUUKOPCEQPENWUQFQEQPVTCVQEQOQGOUWCGZGEWQ
os princpios de probidade e boa-f.
11 'ZRQUKQ FG /QVKXQU FQ 5WRGTXKUQT FC %QOKUUQ 4GXKUQTC G 'NCDQTCFQTC FQ %FKIQ %KXKN RTQHGUUQT
/KIWGN4GCNGKVGOCNPGCDFC2CTVG'URGEKCN.KXTQ+&Q&KTGKVQFCU1DTKICGU&KURQPXGNGO
<http://200.251.3.5/download/codigocivil.pdf>. Acesso em: 17/09/2011.
12 'PVTGCUGZEGGUEKVCOQUEQOQGZGORNQCUGUVKRWNCGUGOHCXQTFGVGTEGKTQU
%FKIQ%KXKNCTVC 
e o testamento (Cdigo Civil, art. 1.857).

174

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

a coletividade, terceiros privados e o Fisco. Mais do que isso, se o negcio jurdico


celebrado no causa prejuzos injustos ou no desejados pelo ordenamento, que
EQNQSWGO CU RCTVGU GO UKVWCQ FG FGUKIWCNFCFG GO TGNCQ U FGOCKU RGUUQCU
que possuam a mesma capacidade contributiva.
0GUUG RQPVQ OGTGEGO FGUVCSWG C GEEKC FC QDTKICQ UWTIKFC RGNC EGNGDTCQ
FQEQPVTCVQGUWCQRQPKDKNKFCFGRGTCPVGVGTEGKTQUKPGIXGNCGEEKCRGTCPVGCU
partes do contrato celebrado para assegurar o direito do terceiro em subscrever
e integralizar capital, para ingressar como novo scio em uma sociedade, e o
subsequente contrato de ciso da sociedade que permite ao antigo scio sair
com o dinheiro integralizado pelo novo scio.
A questo que se pe se esses contratos so oponveis a terceiros ou, ainda, se o Fisco
e a sociedade so obrigados a aceitar os efeitos que irradiam para terceiros. Nessas
JKRVGUGUJQHGPUCCQRTKPERKQFCECRCEKFCFGEQPVTKDWVKXCRGNCURCTVGUGOTGNCQ
VGTEGKTCRGUUQCSWGEQPHQTOGGZGORNQVCODOVGPJCGHGVWCFQWOCCNKGPCQ
FGWOCRCTVKEKRCQUQEKGVTKCOCUWVKNK\CFQCUHQTOCULWTFKECUVRKECUGFKTGVCU
3.4 PATOLOGIAS DO DIREITO
#GZKUVPEKCFGWOCRCVQNQIKCFQFKTGKVQRTKXCFQKPWGPEKCCCPNKUGFQPGIEKQ
LWTFKEQSWGGUVTWVWTCQRNCPGLCOGPVQVTKDWVTKQ#NOFCUKOWNCQCPCNKUCTUG
QQUPGIEKQULWTFKEQUKPFKTGVQUSWGPCNKQFG#NXGU
R FGRGPFGO
de dois requisitos. O primeiro que as partes usem um negcio tpico e desejado
RQTGNCU1UGIWPFQTGSWKUKVQCNVGTCTCPCNKFCFGFQPGIEKQRTCVKECFQ
PCNKFCFG
QDLGVKXC  QW UGLC EQOQ CU RCTVGU DWUECO QWVTC PCNKFCFG PQTOCNOGPVG EQO
CWVKNK\CQFGRCEVQUQWENWUWNCUGZVTCXCICPVGURCTCCPWNCTCPCNKFCFGQDLGVKXC
da norma ou o instituto do ordenamento.
3.4.1 SIMULAO

#UKOWNCQECWUCFGPWNKFCFGFQPGIEKQLWTFKEQGGUVFKUEKRNKPCFCPQ%FKIQ
Civil, art. 167. Negcio jurdico simulado, como ensina Alves (2002, p. 64),
CSWGNGSWGETKCWOCCRCTPEKCRCTCQEWNVCTQSWGTGCNOGPVGUGFGUGLC#UKOWNCQ
ser absoluta quando no se destinar a ocultar outro negcio jurdico, e relativa
quando existir outro negcio dissimulado, isto , tem-se um negcio aparente e um
negcio oculto.
0CUKOWNCQCDUQNWVCCURCTVGUPIGOSWGQPGIEKQGZKUVGOCUPCXGTFCFGGNG
FGURTQXKFQFGEQPVGFQ0CUKOWNCQTGNCVKXCVGOUGWOPGIEKQCRCTGPVGSWG
no traduz a causa (ou motivo) do negcio jurdico, pois a causa est no negcio
real, que est dissimulado.
5QPGEGUUTKQUVTUTGSWKUKVQURCTCECTCEVGTK\CTCUKOWNCQ
Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

175

Igaro Jung Martins

C FKXGTIPEKCGPVTGCXQPVCFGKPVGTPCGCOCPKHGUVCFC
D PGEGUUKFCFGFGGZKUVPEKCFGWOCEQTFQUKOWNCVTKQG
c) o negcio tem por objetivo enganar terceiros estranhos ao ato simulado.
7OGZGORNQFGUKOWNCQCXGPFCGHGVWCFCRQTCUEGPFGPVGRCTCFGUEGPFGPVGRCTC
GPEQDTKTWOCFQCQGOCFKCPVCOGPVQFGNGIVKOC
3.4.2 FRAUDE LEI

Fraude lei ou fraude civil corresponde hiptese em que algum busca, no


prprio ordenamento, uma norma para contornar a aplicabilidade de uma norma
imperativa. Busca-se uma norma de cobertura para contornar norma que prev uma
consequncia no desejada pelo agente.
A fraude lei pode existir mesmo quando no h conduta ilcita, hiptese em que
PQJXKQNCQFCPQTOCFGFKTGKVQEKXKN%QPIWTCFCCJKRVGUGFGHTCWFGNGK
est-se diante de uma das causas de nulidade do negcio jurdico.13
:CXKGT
DR FGHGPFGPQUGTCRNKEXGNQKPUVKVWVQFGHTCWFGNGKCQFKTGKVQ
VTKDWVTKQRQTJCXGTFWCUFKHGTGPCUTGNGXCPVGUFGUUGTCOQEQOQFQFKTGKVQRTKXCFQ
#RTKOGKTCFKHGTGPCSWGCHTCWFGNGKPCUTGNCGURTKXCFCUUGUKVWCQWPQECORQ
FCKNKEKVWFGQWPQFCPWNKFCFGKUVQRTQFW\EQPUGSWPEKCUPCUTGNCGURTKXCFCU
Para o direito tributrio, a existncia de fraude lei estaria no campo da eliso,
VGPFQEQOQPKEQGHGKVQCKPGEEKCFGENCTCFCRGNQ(KUEQFGOQFQCRGTOKVKTC
este aplicar por analogia a um ato ou negcio extratpico norma tributria aplicvel
CCVQQWPGIEKQVRKEQGEQPQOKECOGPVGGSWKXCNGPVG
:#8+'4DR 
#UGIWPFCFKHGTGPCSWGHTCWFGNGK PQFKTGKVQ RTKXCFQUGUKVWCPQECORQFC
KPVGTRTGVCQ
XQPVCFG FC NGK  G PQ FKTGKVQ VTKDWVTKQ FK\ TGURGKVQ  KPVGITCQ
CPCNIKECRQKUQGURTKVQFCNGKPQUWEKGPVGRCTCEQPFW\KTEQPENWUQFGSWG
a norma tributria se aplica a todos os atos de efeitos econmicos equivalentes

:#8+'4DR 
Alves (2002, p. 68) explica que na fraude lei o agente observa a letra da lei, mas
RCTCCNECPCTWOOEQPVTTKQCQGURTKVQFCNGKQWUGLCCSWKNQSWGCURCNCXTCUFC
lei tentaram exprimir. Na fraude lei h duas normas. A primeira escondida, e a
segunda, aparente, que serve para contornar a primeira.
#DTCJCO
 R   HC\ WOC KORQTVCPVG FKUVKPQ GPVTG C HTCWFG  NGK G C
UKOWNCQ

13 Art. 166 do Cdigo Civil. nulo o negcio jurdico quando [...]


 8+VKXGTRQTQDLGVKXQHTCWFCTNGKKORGTCVKXC=?

176

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

&CFCGUVCGUVTWVWTCTGUVCCVCODOCFKUVKPQRCTCEQOCUKOWNCQGO
que a manobra ardil est no ato ou negcio realizado (simulado) e no pelo uso
da norma, j que na fraude lei, os atos e negcios realizados so efetivamente
pretendidos e no simulados. E, isto, o que ocorre, igualmente, nos casos de
negcio jurdico indireto e no abuso de formas.

Por derradeiro, importante ressaltar que o art. 166 do Cdigo Civil diz ser nulo
o negcio jurdico quando este tiver por objeto fraudar lei imperativa, como so as
NGKUVTKDWVTKCUSWGPQRQFGOUGTCHCUVCFCUQWUQHTGTOQFKECGURQTEQPXGPGU
particulares que buscam a incidncia de norma aparente, de menor nus tributrio
(CTN, art. 123).
'ZGORNQFGHTCWFGNGKCFGPQOKPCFCQRGTCQFGECUCGUGRCTCPCSWCNWOC
sociedade empresria admite novo scio para, logo em seguida, cindir-se parcialmente,
OCUECTCPFQWOCCNKGPCQFGRCTVKEKRCQUQEKGVTKC#PQXCUQEKGFCFGFGEQTTGPVG
FCEKUQGRGTVGPEGPVGGZENWUKXCOGPVGCQUCPVKIQUUEKQUFCUQEKGFCFGEKPFKFCEC
com os valores integralizados pelo novo scio. Na antiga sociedade, agora com os
PQXQUUEKQUGZENWUKXCOGPVGECOQUFGOCKUCVKXQU
3.4.3 ABUSO DE DIREITO

Previsto no Cdigo Civil Brasileiro,14 o abuso de direito decorre da necessidade de


se distinguir critrios vinculados existncia do direito e critrios ligados ao seu uso
(GRECO, 2008, p. 195). Trata-se de um limite funcional do direito e se caracteriza
SWCPFQUGXCNGFGWOCPQTOCRCTCDWUECTPCNKFCFGFKXGTUCFCUWCJKRVGUGPCNUVKEC
CWVKNK\CQKTTGIWNCTFGWOCPQTOCRGTCPVGQQTFGPCOGPVQ
Diferentemente da fraude lei, em que o agente se utiliza de uma norma de cobertura
para contornar norma que produz efeitos indesejados, no abuso de direito no h
FXKFCUQDTGCPQTOCKPEKFGPVGOCUEGPUWTCSWCPVQCQGZEGUUQPCUWCWVKNK\CQ
O abuso de direito est intimamente ligado boa-f objetiva, pois o dever de no
CDWUCTUKIPKECCIKTFGCEQTFQEQOWORCFTQFGEQORQTVCOGPVQLWTFKEQUQEKCN
JCTOPKEQGQEQTTGSWCPFQUGWVKNK\CWOFKTGKVQEQOPCNKFCFGFKXGTUCRCTCQ
SWCNQQTFGPCOGPVQCUUGIWTCUGWWUQQWCKPFCSWCPFQUGXGTKECWOCFKUVQTQ
HWPEKQPCNFGWOFKTGKVQRCTCKPKDKTCGEEKCFCNGKUGOWOCTC\QUWEKGPVGSWG
CLWUVKSWG
KORQTVCPVGTGUUCNVCTSWGCIWTCFQCDWUQFGFKTGKVQPQECUQEQPETGVQGPEQPVTC
opositores, sob o argumento de que no se pode responsabilizar algum pelo exerccio
FQUGWFKTGKVQ/CUEQOQUCNKGPVC#NXGU
R KUUQNGXCTKCCWOCEQPEGRQ
absolutamente individualista e contrria tendncia socializante do direito, no
UGPVKFQFGCVGPFGTHWPQUQEKCNFQUFKTGKVQUTC\QRGNCSWCNQGZGTEEKQFGWO
14 Art. 187 do Cdigo Civil. Tambm comete ato ilcito o titular de um direito que, ao exerc-lo, excede
manifestamente os limites impostos pelo seu fim econmico ou social, pela boa-f ou pelos bons costumes.

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

177

Igaro Jung Martins

direito no pode ser abusivo. O referido jurista assim se refere ao abuso de direito:
O abuso de direito se caracteriza pelo exerccio egostico, anormal do direito, sem
motivos legtimos, com excessos intencionais ou voluntrios, dolosos ou culposos,
nocivos a outrem, contrrio ao critrio econmico e social do direito em geral.
Com esteio no Cdigo Civil de 2002, Greco (2008, p. 202) destaca trs hipteses
possveis de abuso de direito:
C CDWUQSWCNKECFQPQODKVQFQFKTGKVQEKXKN
CTVFQ%% HCVQSWGEQPIWTCTKC
WOCVQKNEKVQPQRTGUUWRQUVQFGKPEKFPEKCFCPQTOC
D CDWUQPQGZGTEEKQFGEQPFWVCUUECNOGPVGTGIWNCFCU
E CDWUQPCRGTURGEVKXCFGNGIKUNCGUGURGEECU
Qualquer dessas hipteses contamina o planejamento tributrio, pois a consequncia
do abuso de direito a ilicitude do ato.
Note-se, ainda, que uma das consequncias do abuso de direito no mbito civil sua
TGRCTCQCQRTGLWFKECFQRQTRGTFCUGFCPQU0QODKVQVTKDWVTKQQRTGLWFKECFQ
o Fisco, ou seja, se na esfera privada a contraparte prejudicada pode pleitear o
FGUHC\KOGPVQFQPGIEKQPCGUHGTCVTKDWVTKCQ(KUEQVGTEGKTQGOTGNCQCQPGIEKQ
jurdico, por essa razo ele no tem interesse no desfazimento do negcio jurdico,
OCUUKOGOKPXQECTSWGGUUGPGIEKQKPGEC\RCTCGNG
Sobre o abuso de direito e sua oponibilidade ao Fisco, Abraham (2007, p. 210-211)
enftico:
Tendo sido expressamente acolhida a teoria do abuso de direito no nosso
QTFGPCOGPVQRTKXCFQSWCNSWGTVGPVCVKXCFGRNCPGLCOGPVQUECNSWGGPXQNXC
um ato que possa ser considerado realizado atravs de atos em abuso de direito
estar fora do campo da licitude, desprotegido no apenas pelo ordenamento
jurdico civil, mas principalmente, desconsiderado pelo direito tributrio como
legtimo a reduzir ou afastar a ocorrncia do fato gerador. E mais, permitir
o questionamento por qualquer interessado, inclusive o Fisco, na forma do
CTVFQ%FKIQ%KXKNCNOFGPCNOGPVGKORQTCUWCTGSWCNKECQRCTC
KFGPVKECTQQWVTQCVQGHGVKXCOGPVGRTGVGPFKFQGONKPJCEQOQCTVFC
Carta Civil, dando-se a devida efetividade ao pargrafo nico do art. 116 do
Cdigo Tributrio Nacional.

Exemplo de abuso de direito o caso de uma pessoa jurdica que ultrapassou o


NKOKVGFGTGEGKVCDTWVCRCTCUGOCPVGTPQTGIKOGFGCRWTCQFQKORQUVQFGTGPFC
pelo lucro presumido e faz uma ciso para que cada uma das pessoas jurdicas
(a original e a cindida) se enquadre no limite legal de faturamento para essa forma de
VTKDWVCQUKORNKECFC1CDWUQFGFKTGKVQGZRTGUUCOGPVGEQPUKFGTCFQEQOQCVQ
ilcito (CC, art. 187), ou seja, caracteriza uma conduta tributria evasiva (GRECO,
2008, p. 199).
178

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

3.4.4 ABUSO DE FORMA

#DWUQFGHQTOCGUVNKICFQWVKNK\CQCDWUKXCFGHQTOCULWTFKECUXNKFCU0GUUG
ponto, um cuidado especial deve ser tomado pelo intrprete, pois existe a liberdade
contratual, que decorre da garantia constitucional da liberdade de iniciativa (CRFB,
art. 1o, inciso IV, art. 5o, caput, e art. 170, caput).
+FGPVKECTCNKPJCVPWGSWGUGRCTCQCDWUQFGHQTOCGCNKDGTFCFGEQPVTCVWCNPQ
simples. Para alguns, o abuso de forma sequer poderia ser catalogado como uma
espcie de patologia, mas um tipo de fraude lei que se realiza pelo abuso de formas.
Greco (2008, p. 275), todavia, explica que a desconformidade manifesta entre a forma
e o contedo so caractersticas prticas para trat-la como uma categoria autnoma
entre o rol das demais patologias.
Abuso de forma , antes de qualquer coisa, um instrumento para levar a efeito
QWVTCURCVQNQIKCUCDWUQFGFKTGKVQHTCWFGNGKGUKOWNCQSWCPFQUGCPCNKUCQ
negcio da perspectiva da causa, ou seja, a existncia da desconformidade entre a
HQTOCGQEQPVGFQUKIPKECSWGQPGIEKQCUUKOCRTGUGPVCFQPQEQTTGURQPFG
quele que a forma exibe, mas a outro negcio travestido de forma inadequada
(GRECO, 2008, p. 275).
3.4.5 FALTA DE MOTIVOS LEGTIMOS

O Cdigo Civil estabelece ser nulo o negcio jurdico quando o motivo


determinante for ilcito,15GCPWNXGNQPGIEKQLWTFKEQEWLCFGENCTCQFGXQPVCFG
decorra de erro substancial.16 5G Q OQVKXQ FGVGTOKPCPVG RCTC C TGCNK\CQ FQ
PGIEKQLWTFKEQHQTHCNUQCOCPKHGUVCQFGXQPVCFGEQPUWDUVCPEKCFCPQPGIEKQ
restar viciada.17
/QVKXQCTC\QSWGFGVGTOKPQWCEGNGDTCQFQPGIEKQLWTFKEQCUKVWCQQW
a circunstncia determinante que faz nascer o ato, portanto anterior a este. Motivo
 UWDLGVKXQ PVKOQ RUKEQNIKEQ GZXGN OWVXGN FG KPFKXFWQ RCTC KPFKXFWQ
(MONTEIRO, 1990, p. 28).
A causa do negcio jurdico objetiva, ligada razo econmico-jurdica do ato
ou razo econmico-social que une as partes (ABRAHAM, 2007, p. 213). Por
exemplo, na compra e venda, a causa objetiva do negcio para o vendedor o
TGEGDKOGPVQFQRTGQ
No caso de um planejamento tributrio, fundamental, para a compreenso da
QRGTCQCPCNKUCTQOQVKXQFGVGTOKPCPVGRCTCCTGCNK\CQFQUPGIEKQU5GQOQVKXQ
15 Art. 166. nulo o negcio jurdico quando: [...]
 +++QOQVKXQFGVGTOKPCPVGEQOWOCCODCUCURCTVGUHQTKNEKVQ=?
16 #TV5QCPWNXGKUQUPGIEKQULWTFKEQUSWCPFQCUFGENCTCGUFGXQPVCFGGOCPCTGOFGGTTQUWDUVCPEKCN
que poderia ser percebido por pessoa de diligncia normal, em face das circunstncias do negcio.
17 #TV1HCNUQOQVKXQUXKEKCCFGENCTCQFGXQPVCFGSWCPFQGZRTGUUQEQOQTC\QFGVGTOKPCPVG

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

179

Igaro Jung Martins

HQTHCNUQXKEKCFCGUVCTCOCPKHGUVCQFGXQPVCFGCGNGXKPEWNCFC5QDTGCCWUPEKC
FGOQVKXQUGUGWUTGGZQUPQODKVQVTKDWVTKQ6QTTGU
R ECVGITKEQ
0GPJWOC NGK RQFGT ICTCPVKT C OCPWVGPQ FG WO PGIEKQ OGUOQ RCTC
GHGKVQUUECKUSWCPFQGNGUGSWGTRQUUCGZKUVKTLWTKFKECOGPVG'OCKUSWGGUVC
ausncia de causa seja projetada para levar o Fisco ao erro ou a impossibilidade
de arrecadar os tributos que seriam devidos, no fosse a manobra praticada.

3.5 NEGCIO JURDICO INDIRETO


1PGIEKQLWTFKEQKPFKTGVQRQTXG\GUKPXQECFQRGNQUEQPVTKDWKPVGURCTCLWUVKECT
RNCPGLCOGPVQUVTKDWVTKQU0GIEKQLWTFKEQKPFKTGVQPCFCOCKUFQSWGCWVKNK\CQ
de um negcio jurdico tpico para obter resultado de um outro negcio jurdico.
:CXKGT
DR FGPQOKPCEQOQPGIEKQKPFKTGVQQPGIEKQLWTFKEQSWGCU
RCTVGUEGNGDTCORCTCCVTCXUFGNGCVKPIKTPUFKXGTUQUFQUSWGTGRTGUGPVCOCGUVTWVWTC
VRKECFCSWGNGGUSWGOCPGIQEKCN&GUVCECQTGHGTKFQCWVQTSWGCGNGKQRGNCURCTVGU
da estrutura do negcio indireto permite obter um resultado econmico anlogo
ou equivalente, todavia sem se submeter ao regime tributrio aplicvel ao negcio
FKTGVQSWGGEQPQOKECOGPVGNJGEQTTGURQPFG
:#8+'4DR 
Como ensina Greco (2008, p. 280), em matria tributria, negcio jurdico indireto
UGTXGRCTCQDVGTWOOGSWKXCNGPVGCQWVTQPGIEKQRCTCQSWCNQPWUVTKDWVTKQ
seria mais elevado. Nesse sentido, o negcio indireto o instrumento para reduzir
a carga tributria.
Existem dois elementos essenciais no negcio jurdico indireto: o elemento objetivo,
SWGFGEQTTGFCFKXGTIPEKCGPVTGCGUVTWVWTCFQPGIEKQ
PUVRKEQUSWGNJGUQ
RTRTKQU GQUPUSWGCURCTVGURTGVGPFGOCVKPIKTQUGIWPFQGNGOGPVQCKPVGPQ
FGGZENWKTQWTGFW\KTCKPEKFPEKCVTKDWVTKC
:#8+'4DR 
#KPFCSWGRQUUCRCTGEGTEQOCUKOWNCQTGNCVKXC
PGIEKQCRCTGPVGSWGPQVTCFW\
o real motivo das partes, pois este se encontra dissimulado), o negcio indireto
XCNGUGFGWOCPKECIWTCVRKECGODQTCKPWUWCNRCTCQECUQ0QPGIEKQLWTFKEQ
indireto no h nada dissimulado, tudo aparente.
Uma caracterstica do negcio jurdico indireto que se trata de apenas um negcio
LWTFKEQFKHGTGPVGFCUKOWNCQTGNCVKXCGOSWGJFQKUPGIEKQU
WOCRCTGPVGG
outro subjacente). Outra questo que necessariamente devem ser utilizadas formas
tpicas, pois se o agente se utiliza de uma forma atpica o negcio jurdico direto.
0QPGIEKQLWTFKEQKPFKTGVQSWGFGRGPFGFCWVKNK\CQFGHQTOCUVRKECUCURCTVGU
para evitar os efeitos indesejados dessas formas, introduzem clusulas que anulam,
OQFKECOQWPGWVTCNK\COQUGHGKVQUPQFGUGLCFQUFQPGIEKQVRKEQ
Greco (2008, p. 280) explica que, nessas hipteses, em que as partes incluem clusulas
que anulam os efeitos tpicos do negcio jurdico, est-se diante de uma nova forma,
180

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

ou seja, uma forma atpica, que, portanto, descaracteriza o negcio jurdico indireto.
/CKUCKPFCCQDVGPQFGWOOFKUVKPVQFQPGIEKQLWTFKEQURQUUXGNUGPQ
HTCWFCTCNGKQWUGLCCCPNKUGFQECUQGCEQORTQXCQFGSWGPQJHTCWFGNGK
UQEQPFKGURCTCCGZKUVPEKCFGPGIEKQLWTFKEQKPFKTGVQ5GJQWXGTHTCWFGNGK
ou abuso de direito, o negcio jurdico estar contaminado (GRECO, 2008, p. 281).
Exemplo de negcio jurdico indireto um contrato de compra e venda com clusula
FGTGVTQXGPFCRCTCICTCPVKTGORTUVKOQUGOFGVTKOGPVQFCHQTOCNK\CQFGEQPVTCVQ
de emprstimo com garantia hipotecria.

4 INTERPRETAO E PLANEJAMENTO TRIBUTRIO


4.1 A INTERPRETAO DO PLANEJAMENTO TRIBUTRIO
#SWGUVQEGPVTCNPCKPVGTRTGVCQFQRNCPGLCOGPVQVTKDWVTKQCPCNKUCTQUHCVQU
GUGJFKXGTIPEKCUQDTGCSWCNKECQLWTFKECCVTKDWFCCGUVGURGNQEQPVTKDWKPVG
e pelo Fisco. O grande debate sobre o planejamento tributrio est justamente na
RQUUKDKNKFCFGFGTGSWCNKECQFQUHCVQURGNQ(KUEQUQDTGVWFQEQODCUGPQUPQXQU
conceitos de direito privado trazidos pelo Cdigo Civil de 2002.
Os clssicos, defensores de que a primeira fase do planejamento tributrio ainda
XKIGCNGICOSWGCTGSWCNKECQFQUHCVQURGNQ(KUEQTGVKTCCUGIWTCPCLWTFKECFC
TGNCQVTKDWVTKCQWCKPFCSWGUGGUVCTKCCCRNKECTCCPCNQIKCXGFCFCRGNQCTV
+ho, do CTN.
)TGEQ
R RQTUWCXG\GZRNKECSWGPCKPVGTRTGVCQFQRNCPGLCOGPVQ
VTKDWVTKQ C NIKEC DKXCNGPVG PQTOC G HCVQ VGOUG OQUVTCFQ KPUWEKGPVG QW
KPCFGSWCFC5GCPQTOCGQHCVQUWDOGVKFQUKPVGTRTGVCQRQTFKXGTUCURGUUQCU
so os mesmos, a concluso de todos deveria ser no mesmo sentido, conduzindo
CWOPKEQTGUWNVCFQ0CGNKUQCKPUWEKPEKCFCNIKECDKXCNGPVGECGXKFGPVG
RQKUPQJEQOQFK\GTGOCDUVTCVQSWGEGTVCEQPFWVCEQPIWTCTWOCGNKUQQW
planejamento aceitvel, ou no? (GRECO, 2008, p. 424).
# KPVGTRTGVCQ FQ RNCPGLCOGPVQ VTKDWVTKQ RQTVCPVQ TGSWGT PQXQU EQPEGKVQU
para sua compreenso. A realidade mais complexa que os conceitos (GRECO,
2008, p. 451). Dessa forma, alm da norma e do fato, devem ser consideradas as
circunstncias em que se deram o negcio jurdico, tais como poca, local, valores,
interesses, expectativas, objetivos visados.
7OCFKTGVTK\SWGUGVGOOQUVTCFQGEC\PCUQNWQFCRTQDNGOVKECFGKPVGTRTGVCQ
e compreenso do planejamento tributrio em vrios ordenamentos a ideia de
abuso.
%QOOCVK\GUFKHGTGPVGUGXCTKCPFQGOHWPQFCUFKXGTUCUOCPGKTCURGNCU
quais o direito positivo de cada pas regula a matria, encontra-se, como tema
Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

181

Igaro Jung Martins

TGEQTTGPVGCRTGQEWRCQEQOCIWTCFQCDWUQUGLCCDWUQFQFKTGKVQFG
o contribuinte se auto-organizar visando pagar menos tributos, seja abuso
FGHQTOCUPGUUCQTICPK\CQOCUUGORTGCD WUWU
GZEGUUQWUQCNOFQ
que prprio etc.). Ou seja, surge a ideia do uso de um instrumento jurdico
anormal (GRECO, 2008, p. 448).

#PCNKUCTCEQPFWVCRCTCXGTKECTUGGNCQWPQCDWUKXCQNJCTQUHCVQUGSWCNKENQU
NQIQCKPVGTRTGVCQFQRNCPGLCOGPVQFGRGPFGTFCNGKFQUHCVQUGFCSWCNKECQ
jurdica desses fatos.
0GUUCPQXCCDQTFCIGOQ(KUEQVGOFWRNQPWUFCRTQXCRTQXCTSWGCSWCNKECQ
LWTFKECFQUHCVQUPQCSWGNCCVTKDWFCRGNQEQPVTKDWKPVGGRTQXCTCSWCNKECQ
jurdica que entende aplicvel.
4.2 ANALOGIA E REQUALIFICAO DOS FATOS
#CRNKECQFCCPCNQIKCXGFCFCRCTCGZKIKTVTKDWVQEQPHQTOGGZRTGUUQPQRCTITCHQ
primeiro do art. 108 do CTN. Tal fato decorre, em especial, do princpio da
legalidade, consubstanciado no art. 150, I, da CRFB.
A analogia e seu uso ganham relevo quando se est diante dos fatos, do caso concreto.
0CKPVGTRTGVCQRQTCPCNQIKCQKPVTRTGVGPQETKCFKTGKVQPQXQOCUGUVGPFGQ
HCVQCQCNECPEGPQTOCGZKUVGPVG#CPCNQIKCEQPVWFQFKHGTGFCTGSWCNKECQFQU
fatos, que se d quando se est diante de um negcio jurdico indireto. Analogia
aplicar uma regra a outro caso similar para o qual no h dispositivo expresso.
4GSWCNKECTWVKNK\CTWOCPQTOCGZKUVGPVGGCRNKEXGNCQHCVQSWGPQHQKCRNKECFC
GOFGEQTTPEKCFGWOCTVKEKCNKUOQGOCNIWPUFQUGNGOGPVQUFGUWDUWPQFQU
fatos norma originalmente invocada.
4.3 INTERPRETAO ECONMICA
#KPVGTRTGVCQGEQPOKECRTKXKNGIKCQHCVQGEQPOKEQRCTCEQODCUGPGNGDWUECT
WOC NGK FG KPEKFPEKC EQPIWTCPFQ WO RTQEGUUQ UGOGNJCPVG  CPCNQIKC XKUVQ
que o intrprete busca uma norma de incidncia que julga ser mais adequada s
caractersticas econmicas do fato.
2CTC#PFTCFG(KNJQ
R QGKZQVGTKEQFCKPVGTRTGVCQGEQPOKECQ
princpio da capacidade contributiva, que, no seu entender, posto equivocadamente
GORQUKQFGUWRTGOCEKCGOTGNCQCQRTKPERKQFCNGICNKFCFG
)TGEQ
 R   HC\ KORQTVCPVG FKUVKPQ GPVTG KPVGTRTGVCQ GEQPOKEC G
EQPUKFGTCQGEQPOKECFQHCVQIGTCFQTRCTCPUFGCRNKECQFCNGKVTKDWVTKC
0CEQPUKFGTCQGEQPOKECRCTVGUGFCNGKEQPUVTKUGQEQPEGKVQNGICNRCTC
UCDGTSWCNQVKRQRTGXKUVQPCNGKXCKUGRCTCQHCVQEQPUVTKUGQEQPEGKVQFG
fato considerando os seus aspectos jurdicos, econmicos, mercadolgicos,
182

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

EQPEQTTGPEKCKU GVE GPO VQFQU QU CURGEVQU TGNGXCPVGU RCTC EQPUVTWNQ G


volta-se para a lei para saber se ele est enquadrado ou no. Isto incluir a
XCTKXGNGEQPOKECCQNCFQFGQWVTCUXCTKXGKUPCEQPUVTWQFQEQPEGKVQFG
fato, para saber o que ele (GRECO, 2008, p. 164).

1QDLGVKXQFCEQPUKFGTCQGEQPOKECCQNCFQFCUQWVTCUXCTKXGKUUCDGTFGHCVQ
QSWGQEQTTGW+PUVTWOGPVQSWGVQTPCKTTGNGXCPVGCKPXGUVKICQUQDTGCXQPVCFG
do agente, pois as coisas no so aquilo que queremos, mas aquilo que fazemos
(GRECO, 2008, p. 164). No importa a vontade manifestada no instrumento
negocial, mas a vontade concreta, manifestada pela conduta realizada, e, para isso,
CEQPUKFGTCQGEQPOKECFQUHCVQUKORQTVCPVGRCTCSWCNKENQU
4.4 SUBSTNCIA E FORMA DOS ATOS OU NEGCIOS JURDICOS
Os negcios jurdicos so regidos por normas de direito privado. O art. 104 do
Cdigo Civil estabelece trs requisitos para que o negcio jurdico seja vlido:

K CIGPVGECRC\
KK QDLGVQNEKVQRQUUXGNFGVGTOKPCFQQWFGVGTOKPXGN
KKK HQTOC
prescrita ou no defendida em lei.
Ainda que a forma seja um dos requisitos legais do negcio jurdico, o art. 18318 deixa
hialina a subsistncia do negcio que se puder provar por outro meio quando for
FGENCTCFCCKPXCNKFCFGFQKPUVTWOGPVQ'UUGFKURQUKVKXQTGHQTCCKFGKCFGRTGXCNPEKC
da substncia sobre a forma e que tais elementos podem divergir entre si. O art. 167
TGHQTCGUUCKFGKCCQVTCVCTFCFGUEQPUKFGTCQFQPGIEKQUKOWNCFQ19
No direito tributrio, todavia, a validade ou no do negcio jurdico no tem
relevncia para a incidncia tributria (CTN, art. 118).20 A questo que se pe se esse
FKURQUKVKXQUGTKCUWEKGPVGRCTCKPXQECTCRTGXCNPEKCFCUWDUVPEKCUQDTGCHQTOC
notadamente para impedir prticas evasivas, quando no h uma correspondncia
GPVTGCKPVGPQGQSWGHQKFGENCTCFQRGNCURCTVGUPQKPUVTWOGPVQ
Para essa concluso, portanto, necessrio provar a existncia de alguma anomalia
FGUUC HCNVC FG EQTTGURQPFPEKC GPVTG C FGENCTCQ G C KPVGPQ 7O OVQFQ FG
RGTSWKTKQUQDTGGUUCFKUUQPPEKCCPCNKUCTQUHCVQUCPVGEGFGPVGUGUWDUGSWGPVGU
CQPGIEKQLWTFKEQ1SWGCURCTVGUHC\GOGXKFGPEKCEQOOCKUUGIWTCPCQSWG
porventura tenha sido declarado em qualquer instrumento. Nesse sentido, o
CTVFQ%%RTKXKNGIKCCKPVGPQUQDTGQUGPVKFQNKVGTCNFCNKPIWCIGO21
18 Art. 183 do CC. A invalidade do instrumento no induz a do negcio jurdico sempre que este puder provar-se
por outro meio.
19 Art. 167 do CC. nulo o negcio jurdico simulado, mas subsistir o que se dissimulou, se vlido for na
substncia e na forma.
20 #TV#FGHKPKQNGICNFQHCVQIGTCFQTKPVGTRTGVCFCCDUVTCKPFQUG
I. da validade jurdica dos atos efetivamente praticados pelos contribuintes, responsveis, ou terceiros, bem
EQOQFCPCVWTG\CFQUGWQDLGVQQWFQUUGWUGHGKVQU
II. dos efeitos dos fatos efetivamente ocorridos.
21 #TVFQ%%0CUFGENCTCGUFGXQPVCFGUGCVGPFGTOCKUKPVGPQPGNCUEQPUWDUVCPEKCFCFQ
que ao sentido literal da linguagem.

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

183

Igaro Jung Martins

Andrade Filho (2009, p. 240) destaca que se a forma no corresponde a um ato ou


PGIEKQLWTFKEQUKPEGTQGUVCOQUFKCPVGFGWOCUKOWNCQFQEQPVTTKQPQJ
critrio jurdico capaz de afastar o regime jurdico adotado pelo particular.
0GUUG CURGEVQ PQ EQPEQTFCOQU EQO Q TGHGTKFQ CWVQT RQKU PQ KFGPVKECOQU
critrio jurdico seguro para considerar apenas uma das patologias de direito, a
UKOWNCQGFGURTG\QUFGOCKURCVQNQIKCUHTCWFGNGKCDWUQFGFKTGKVQCDWUQFG
forma, negcio jurdico indireto ou falta de motivos legtimos.
4.5 DESCONSIDERAO DA FORMA JURDICA
A regra geral que os negcios celebrados de boa-f produzam efeitos entre as
partes e perante terceiros. Todavia, nem sempre a boa-f est presente nos negcios
jurdicos, como tambm nestes pode existir algum vcio.
Alm da nulidade, que decorre da existncia de vcio insanvel sobre algum dos
requisitos essenciais do negcio jurdico, e da anulabilidade, que pode produzir
efeitos at que algum conteste sua validade, h a questo da inoponibilidade do
PGIEKQLWTFKEQQWUGLCQPGIEKQLWTFKEQRQFGUGTXNKFQGGEC\GPVTGCURCTVGU
OCUPQUGTGEC\RGTCPVGVGTEGKTQUQSWGCNIWPUCWVQTGUEJCOCOFGKPGEEKC
relativa (PINTO, 1992, p. 606).
No mbito tributrio, o pargrafo nico do art. 116 do CTN tem o condo de
CWVQTK\CTCFGUEQPUKFGTCQFGCVQUQWPGIEKQULWTFKEQUSWGDWUSWGOFKUUKOWNCT
a ocorrncia do fato gerador do tributo ou a natureza dos elementos constitutivos
FC QDTKICQ VTKDWVTKC QDUGTXCFQU QU RTQEGFKOGPVQU C UGTGO FGPKFQU GO NGK
QTFKPTKC 'UUC FGUEQPUKFGTCQ PCFC OCKU  FQ SWG PGICT GHGKVQU FQU PGIEKQU
LWTFKEQURCTCPUUECKU
4.6 PROPSITO NEGOCIAL
O propsito negocial est relacionado ideia de causa do negcio jurdico. Em
mbito tributrio diz respeito a uma causa extratributria, ou seja, quais fatores, aqui
no includa a economia tributria, levaram os agentes a celebrar o negcio jurdico,
OCKUCKPFCPQHQUUGOCUXCPVCIGPUVTKDWVTKCUUGCQRGTCQVGTKCUKFQGHGVWCFC
do mesmo modo. No h propsito negocial nos atos ou negcios jurdicos sem
causa sincera (ANDRADE FILHO, 2009, p. 256).
Sobre a causa do negcio jurdico, Gomes (2002, p. 54) explica que h duas anlises a
serem consideradas: uma de ordem objetiva e outra subjetiva. A corrente doutrinria
objetivista distingue a causa do contrato de trs modos:
2GNQRTKOGKTQCECWUCCHWPQGEQPOKEQUQEKCNFQEQPVTCVQ2GNQUGIWPFQ
o resultado jurdico objetivo que os contratantes visam a obter quando o
GUVKRWNCO2GNQVGTEGKTQCTC\QFGVGTOKPCPVGFCCQSWGOQXGCURCTVGUC
celebrar determinado contrato.
184

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

#EQPEGKVWCQUWDLGVKXCFCECWUCCEQPUKFGTCWOOQVKXQVRKEQFQEQPVTCVQSWG
PQUGEQPHWPFGEQOQUOQVKXQUKPFKXKFWCKU'UVGUUQKTTGNGXCPVGUUCNXQGZEGGU
PCNGK/QVKXQUVRKEQURQTUWCXG\PQUQCPVGEGFGPVGUOCUECWUCPCNKUVQQ
OSWGCVWCUQDTGCXQPVCFGRCTCNJGFGVGTOKPCTCCVWCQPQUGPVKFQFGEGNGDTCT
certo contrato (GOMES, 2002, p. 55), de tal forma que irrelevante saber a razo
que leva uma pessoa a emprestar, por exemplo, determinada quantia em dinheiro
a outra, ou seja, pouco importa se o fez para ajudar ou para auferir juros.
Na anlise do planejamento tributrio, portanto, a vontade psicolgica de
economizar tributo irrelevante. Relevante para o direito ser o motivo tpico do
contrato. Gomes (2002, p. 55) explica que se o propsito negocial contrrio lei
QWOQTCNCKPXCNKFCQFQEQPVTCVQUGLWUVKECRQTVGTcausa ilcita ou imoral.
(grifo no original)
No direito tributrio, a expresso propsito negocial decorre do que a common
law denomina de business purpose. Nos pases que adotam a common law e mais
recentemente nos ordenamentos da civil law, como explica Di Pietro (2002, p. 114),
professor da Universidade de Bolonha, purposeVTCFW\UGGOWOCRTGQEWRCQGO
EQNKICTHCVQUIGTCFQTGUCPVKGNKUKXQUEQOKPVGTGUUGUKPVGPVQUUKVWCGUTC\GUSWG
atendam atividade econmica e comercial.
Ao se introduzir o conceito de propsito para a anlise do negcio jurdico, estUG VTCDCNJCPFQ EQO IWTCU HQTC FQ ECORQ LWTFKEQ
ECVGIQTKC OGVCLWTFKEC 
&+
2+'641R HCVQSWGGPUGLCEQPUKFGTXGNFKEWNFCFGRCTCCCFOKPKUVTCQ
tributria e tambm para os juzes.
A anlise do propsito negocial no pode ser considerada em termos subjetivos.
'NCFGXGUGTHGKVCGOVGTOQUQDLGVKXQUQSWGUKIPKECFK\GTSWGQPGIEKQLWTFKEQ
tem de ser suportado por razes econmicas fundadas, reais, existentes e vlidas.
0GUUG UGPVKFQ QRTQHGUUQT &K 2KGVTQ
 R   PQU F WOC EQPVTKDWKQ
KORQTVCPVG RCTC C KPVGTRTGVCQ FQ RNCPGLCOGPVQ VTKDWVTKQ CQ CTOCT SWG CU
razes econmicas e purposeTGRTGUGPVCOWOGNGOGPVQSWCNKECFQTFQHCVQIGTCFQT
Explica o referido doutrinador:
ENCTQSWGSWCPFQFKIQGHGKVQUUECKUUKIPKECSWGUGVTCVCFGPQTOCUSWG
produzem efeito somente em um ordenamento, ou seja, QUPUFCCRNKECQFCU
normas tributrias no tm, na verdade, o interesse de intervir sobre a esfera da
autonomia privada#UTGNCGURTKXCFCUOGUOQUGPFQEQPFW\KFCUCUKVWCGU
SWCNKECFCUEQOQGNKUKXCUEQPVKPWCOCUGTRQTKPUVTWOGPVQURTKXCFQU (grifo
nosso)

&KCPVGFQXEWQPQTOCVKXQRGNCPQTGIWNCOGPVCQFQRCTITCHQPKEQFQCTV
116 do CTN e pelo que foi dito at aqui sobre propsito negocial, importante
TGUUCNVCTSWGPQJSWCNSWGTGURCQLWTFKEQRCTCSWGQ(KUEQRQUUCUGKOKUEWKT
quanto ao mrito do negcio privado, de mbito eminentemente privado, mas
Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

185

Igaro Jung Martins

GZKUVGCRQUUKDKNKFCFGFGCPCNKUCTQUHCVQUVCNSWCNUGCRTGUGPVCOGTGSWCNKENQUECUQ
estejam desprovidos de suporte econmico, real, existente e vlido.
Andrade Filho (2009, p. 256) considera que a ideia de propsito negocial
reducionista, na medida em que se limita a cogitar sobre a existncia ou no de uma
PCNKFCFGRCTCQPGIEKQGOUKRQTVCPVQPQNGXCGOEQPUKFGTCQQEQPVGZVQGO
que os negcios foram gerados e sua utilidade para os particulares.
2CTCEQTTKIKTKUUQEQPUKFGTCQFQPGIEKQHQTCFQEQPVGZVQRTQRGQTGHGTKFQ
CWVQTCPQQFGRTQRUKVQGORTGUCTKCNRCTCNGXCTGOEQPVCCNKEKVWFGFQUOGKQU
jurdicos adotados.
Como dito, o propsito negocial aproxima-se bastante da causa do negcio jurdico.
Certo , tambm, que o Cdigo Civil determina nulidade do negcio jurdico
cujo motivo determinante seja ilcito,22 hiptese em que os efeitos dessa nulidade
RTQFW\KTQ GHGKVQU PQ ODKVQ VTKDWVTKQ 6QFCXKC JCXGT UKVWCGU GO SWG C
inexistncia de causa, ou do propsito negocial, no enseja a nulidade do negcio
RTKXCFQUGPFQUWEKGPVGRCTCUGTXKTFGUWRQTVGRCTCCTGSWCNKECQFQHCVQIGTCFQT
seja por circunstncias econmicas seja empresariais, de cunho mais amplo.
Andrade Filho (2009, p. 258) entende que a anlise consubstanciada no motivo ou
PCPCNKFCFGGZVTCVTKDWVTKCNGXCCUKVWCGUCDUWTFCUOGFKFCSWGCFOKVGSWG
FQRQPVQFGXKUVCVTKDWVTKQCPGIEKQUKFPVKEQURQUUCOUGTCVTKDWFCUUQNWGU
distintas. Aduz o referido autor que esse tipo de anlise inverte a ordem natural
das coisas a norma tributria passa a ter importncia menor que a circunstncia
pessoal, eventualmente prevista em outra norma existente. O autor fundamenta
UWCRQUKQCTOCPFQSWGGOEGTVCUEKTEWPUVPEKCUCPQTOCVTKDWVTKCFGURTG\CC
causa (ou propsito negocial). Nesse ponto divergimos do referido autor.
#RTGOKUUCPGIEKQUKFPVKEQUVOUQNWGUFKUVKPVCUPQXNKFC#PCNKUCPFQUG
o propsito negocial sob um ponto de vista mais amplo, ou seja, considerando-se a
EKTEWPUVPEKCGEQPOKEC
QWGORTGUCTKCN KPKEKCNGRQUVGTKQTFQUCIGPVGUPCTGCNK\CQ
do negcio jurdico, o aplicador da norma tem instrumentos para avaliar se os
negcios so, de fato e de direito, idnticos. Se o forem, a norma tributria aplicada
deve ser a mesma em ambos os casos. Sendo os negcios apenas formalmente iguais,
OCUFGHCVQFKHGTGPVGUCTGSWCNKECQFQUHCVQUPGEGUUTKCGRQTVCPVQRCTCGUUGU
JCXGTPGEGUUCTKCOGPVGUQNWGULWTFKECUFKUVKPVCU
Alguns autores entendem que a simples economia de tributos integra o conceito
de gesto de uma empresa e, como tal, deve ser observada pelo administrador
diligente. Todavia, a simples economia de tributos no pode ser enquadrada como
ECWUC QDLGVKXC FQ PGIEKQ LWTFKEQ QW UGLC Q OQVKXQ VRKEQ QW C PCNKFCFG FQ
negcio, como explicado anteriormente com base no esclio de Orlando Gomes.
22 Art. 166. nulo o negcio jurdico quando: [...]
 +++QOQVKXQFGVGTOKPCPVGEQOWOCCODCUCURCTVGUHQTKNEKVQ=?

186

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

No h como confundir causa do negcio jurdico e causa para economizar tributos.


#PCNKFCFGGEQPOKEQUQEKCN
QWECWUCQDLGVKXC FQPGIEKQLWTFKEQSWGFGXG
PQTVGCT C KPXGUVKICQ UQDTG C GZKUVPEKC QW PQ FQ RTQRUKVQ PGIQEKCN EWLC
anlise dar-se- considerando-se as circunstncias econmicas ou empresariais e a
FGENCTCQFGXQPVCFGEQPUWDUVCPEKCFCPQUKPUVTWOGPVQUSWGUGTXKTCOFGUWRQTVG
ao negcio jurdico formalizado no mbito do direito privado.

5 ESTUDO DE CASOS DE PLANEJAMENTO TRIBUTRIO


O estudo de casos teve como objeto de anlise as decises proferidas pelo Carf
(ento Conselhos de Contribuintes). Para tanto, importamos a metodologia do
Normative Systems, proposta originalmente por Alchourrn (2003) e utilizada na
obra coordenada pelo professor Schoueri ((2010). O mtodo consiste, em resumo,
GOXGTKECTUGJUKUVGOCVK\CQPCCPNKUGFGWOEQPLWPVQFGPQTOCUKUVQUG
com base em determinadas propriedades se obtm determinadas concluses.
Com o objetivo de proporcionar maior clareza, separamos os casos pelo nome
RTGRQPFGTCPVGFCUQRGTCGU+FGPVKECFQUQUECUQUHQKCRNKECFCCQUTGURGEVKXQU
julgados a metodologia do Normative Systems para duas propriedades: P1 Propsito
NegocialGZKUVPEKCFGOQVKXQUGZVTCVTKDWVTKQUGP2 Existncia de Patologia
do DireitoKUVQUGTGUVQWEQORTQXCFCCGZKUVPEKCFGUKOWNCQHTCWFGNGK
abuso de direito, abuso de forma ou falta de motivos legtimos. O resumo dessa
CPNKUGGPEQPVTCUGPC6CDGNCCQPCNFGUVGECRVWNQ'OECFCECUQFGRNCPGLCOGPVQ
VTKDWVTKQCPVGUFGCFGPVTCOQUPCCPNKUGHG\UGDTGXGGZRNKECQUQDTGCQRGTCQ
RCTCPUFGEQORTGGPUQGOHCEGFCGURGEKEKFCFGFQVGOC
5.1 GIO INTERNO DECORRENTE DE
REORGANIZAO SOCIETRIA
Sntese da operaoCIWTCFQIKQCPVKICPQQTFGPCOGPVQDTCUKNGKTQGCFSWKTKW
grande relevo com a Lei n. 8.031, de 12 de abril de 1990, que instituiu o Plano
0CEKQPCN FG &GUGUVCVK\CQ %QO C GFKQ FQ CTV o da Lei n. 9.532, de 10 de
FG\GODTQFGRCUUQWUGCCFOKVKTSWGQIKQRCIQPCUCSWKUKGUFCUGORTGUCU
(pblicas ou privadas) pela holding fosse aproveitado pela empresa adquirida, visto
que nas holdings PQTOCNOGPVG PQ GTC RQUUXGN C COQTVK\CQ FQ IKQ RQKU Q
resultado dessas empresas majoritariamente decorrente de equivalncia patrimonial,
que neutra tributariamente. Com o advento da Lei n. 9.532, de 1997, nasceram as
KPEQTRQTCGUTGXGTUCUSWCPFQCEQPVTQNCFCKPEQTRQTCUWCEQPVTQNCFQTC
6QFCXKCTGUUCNVGUGCPQXCNGKVTCVQWFCCOQTVK\CQFQIKQRCIQFGUVKPCFQEQORTC
entre partes independentes e no relacionadas. No gio interno, no mesmo grupo
GEQPOKEQPQJRCICOGPVQRCTCCSWKUKQFGEQPVTQNGFGPQXCUQEKGFCFGOCU
WOCUGSWPEKCFGTGQTICPK\CGUUQEKGVTKCURCTCIGTCTIKQFGUKOGUOQSWGUGT
COQTVK\CFQPCCRWTCQFQNWETQVTKDWVXGN
Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

187

Igaro Jung Martins

5.2 GIO PAGO PARA AQUISIO DE CONTROLE SOCIETRIO


Sntese da operaoCQRGTCQIKQRCIQRCTCCSWKUKQFGEQPVTQNGUQEKGVTKQ
FKHGTG FC QRGTCQ FG IKQ KPVGTPQ VTCVCFQ PQ VRKEQ CPVGTKQT 0GUUG VKRQ
FG QRGTCQ J GHGVKXC OWFCPC FG EQPVTQNG FC EQORCPJKC RGNC CSWKUKQ FC
RCTVKEKRCQCEKQPTKC1IKQRCUUXGNFGCOQTVK\CQRTGXKUVQPQCTVo da Lei
PFGCSWGNGRCIQPCUCSWKUKGUFGEQPVTQNGFGWOCUQEKGFCFGEWLC
OQVKXCQUGLCQXCNQTFGTGPVCDKNKFCFGHWVWTCFCUQEKGFCFGCFSWKTKFCGOHWPQ
da previso de resultados a serem auferidos em exerccios futuros. A questo que
UGFKUEWVGPGUUGVKRQFGQRGTCQUGJOQVKXQURCTCQRCICOGPVQFQIKQQW
UGLCFKUEWVGUGQNCWFQSWGFGPGCGZRGEVCVKXCFGTGUWNVCFQUHWVWTQUGSWGUGTXGO
FGECWUCRCTCQRCICOGPVQFCRCTVKEKRCQUQEKGVTKCGOXCNQTGUUWRGTKQTGUCQUGW
valor patrimonial.
5.3 INCORPORAO S AVESSAS
Sntese da operaoQ&GETGVQ.GKPFGCTVXGFCCEQORGPUCQ
de prejuzos da empresa sucedida pela empresa sucessora, no entanto no h
XGFCQ RCTC C EQORGPUCQ FG RTGLW\QU RTRTKQU CKPFC SWG C RGUUQC LWTFKEC
VGPJC RCTVKEKRCFQ FG WO GXGPVQ FG TGQTICPK\CQ UQEKGVTKC &KCPVG FKUUQ J
diversos casos em que a empresa lucrativa e capitalizada incorporada pela empresa
FGEKVTKCFGVGPVQTCFGITCPFGUGUVQSWGUFGRTGLW\QUSWGUGRGTFGTKCOECUQC
empresa rentvel incorporasse a empresa com prejuzo. A questo que se impe
CPCNKUCTUGCKPEQTRQTCQUCXGUUCUSWGQEQTTGWPQRNCPQHQTOCNQEQTTGWFG
HCVQ2QFGJCXGTOQVKXCGUECWUCUQDLGVKXCURCTCSWGFGVGTOKPCFCUQRGTCGU
FG KPEQTRQTCQ QEQTTCO FG HQTOC KPXGTUC UGLCO GNCU FG PCVWTG\C GEQPOKEC

TGFWQFGEWUVQUGEKPEKC TGIWNCVTKCU
FGVGTOKPCFCURQTTIQUFQIQXGTPQ 
QWFGEQTTGPVGUFGCURGEVQUUQEKGVTKQU
CUUQEKCQEQOQWVTCUGORTGUCUQWGXKVCT
CRWNXGTK\CQFGECRKVCNGTGOWPGTCQFQUUEKQU 
5.4 OPERAO CASA E SEPARA
Sntese da operaoCQRGTCQECUCGUGRCTCFGUVKPCUGCGXKVCTCKPEKFPEKC
FGICPJQFGECRKVCNRGNCCNKGPCQFGEQVCUQWCGUFGWOCRGUUQCLWTFKEC2CTC
evitar essa incidncia, duas pessoas jurdicas se unem para formar o capital de outra
RGUUQCLWTFKEC
EWLCUEQVCUQWCGUUQQDLGVQFCPGIQEKCQUKOWNCFC #RTKOGKTC
pessoa jurdica, detentora da empresa objeto, integra a sociedade com o ativo, e a
UGIWPFCEQOQFKPJGKTQUWEKGPVGRCTCCSWKUKQFCRCTVKEKRCQUQEKGVTKC#VQ
contnuo, normalmente com pequeno lapso temporal, as pessoas jurdicas saem
FCUQEKGFCFGEQORQUKGUKPXGTVKFCUCRTKOGKTCEQOFKPJGKTQGCUGIWPFCEQOC
RCTVKEKRCQUQEKGVTKC

188

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

5.5 DEBNTURES
Sntese da operao: debntures so ttulos emitidos por sociedade annima e tm
EQOQPCNKFCFGECRVCTTGEWTUQUCOGPQTGUEWUVQUSWGQQHGTGEKFQRGNQOGTECFQ
encontrando-se regulados nos arts. 52 a 74 da Lei n. 6.404, de 15 de dezembro de
1976. As ofertas de debntures podem ser pblicas (por intermdio de bolsa de
valores ou de mercado de balco) ou restritas a nmero reduzido de pessoas. Nas
QHGTVCURDNKECUCTGOWPGTCQFCUFGDPVWTGUCRTGUGPVCWOCTGNCQRTZKOCFQU
VVWNQU FG TGPFC ZC EQO VCZCU NKIGKTCOGPVG UWRGTKQTGU GO FGEQTTPEKC FQ TKUEQ
assumido pelo debenturista ser maior do que para um aplicador em um fundo de
TGPFCZCFGWOCKPUVKVWKQPCPEGKTC0CUQHGTVCUTGUVTKVCURQTQWVTQNCFQPQ
JVTCPURCTPEKCUQDTGCVCZCFGTGOWPGTCQGUQDTGQUCFSWKTGPVGUFGUUGUVVWNQU
5.6 AES EM TESOURARIA
Sntese da operao C QRGTCQFG CGUGO VGUQWTCTKC  WVKNK\CFC EQOQRCUUQ
RTGNKOKPCTRQTWOCRGUUQCLWTFKECKPXGUVKFQTCSWGRTGVGPFGCNKGPCTRCTVKEKRCGU
em companhia investida (integrante do seu ativo investimento). A investidora
CNKGPCCUCGUFGUWCRTRTKCGOKUUQSWGUGGPEQPVTCOGOVGUQWTCTKCRCTCWOC
VGTEGKTC RGUUQC G RCUUQ UGIWKPVG RGTOWVC UGO VQTPC GUUCU CGU
SWG TGVQTPCO
RCTCUWCVGUQWTCTKC RGNCUCGUFCEQORCPJKCKPXGUVKFCSWGKPVGITCXCOUGWCVKXQ
# CNKGPCQ FCU CGU GO VGUQWTCTKC PQTOCNOGPVG UG F RQT XCNQTGU DCUVCPVG
UWRGTKQTGUCQXCNQTRCVTKOQPKCNFGUUCUCGUGPQTOCNOGPVGGSWKXCNGPVGCQXCNQT
FGOGTECFQFCUCGUFCEQORCPJKCKPXGUVKFCSWGKPVGITCXCQCVKXQFCEQORCPJKC
FGVGPVQTCFCUCGUGOVGUQWTCTKC#UUKOCRUCRGTOWVCUGOVQTPCFCUCGUC
EQORCPJKCSWGFGVKPJCCUCGUGOVGUQWTCTKCECEQOQFKPJGKTQGCEQORCPJKC
SWG PQ RTKOGKTQ OQOGPVQ JCXKC EQORTCFQ CU CGU GO VGUQWTCTKC EC EQO CU
CGU FC EQORCPJKC KPXGUVKFC SWG KPVGITCXCO QTKIKPCTKCOGPVG Q CVKXQ FCSWGNC
pessoa jurdica.
5.7 SUBCAPITALIZAO
Sntese da operaoCQRGTCQFGUWDECRKVCNK\CQQEQTTGSWCPFQWOCGORTGUC
celebra contrato de mtuo (emprstimo de dinheiro) para uma pessoa jurdica
NKICFCGUQDTGQSWCNPQEQTTGTKUEQFGKPCFKORNPEKCCQKPXUFGWOCUWDUETKQ
FG ECRKVCN 1 DGPGHEKQ FG UG WVKNK\CT WOC QRGTCQ FG GORTUVKOQ CQ KPXU FG
WOCUWDUETKQFKTGVCFGECRKVCNGUVPCRQUUKDKNKFCFGFGFGFW\KTFGURGUCUFGLWTQU
GEQOKUUQTGFW\KTQNWETQTGCNGCDCUGFGENEWNQFCEQPVTKDWKQUQEKCNUQDTGQ
lucro lquido.
5.8 SEGREGAO DE PESSOA JURDICA
Sntese da operao C QRGTCQ FG UGITGICQ FG RGUUQC LWTFKEC UG F RGNC
KPVGTRQUKQFGWOCRGUUQCPQGNQRTQFWVKXQQWEQOGTEKCNRCTCIGTCTETFKVQUFC
Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

189

Igaro Jung Martins

EQPVTKDWKQRCTCQ2TQITCOCFG+PVGITCQ5QEKCN
2+5 GFC%QPVTKDWKQRCTC
Q(KPCPEKCOGPVQFC5GIWTKFCFG5QEKCN
%QPU RGNCGORTGUCCFSWKTGPVGVTKDWVCFC
RQTGUUCUEQPVTKDWKGURGNQTGIKOGPQEWOWNCVKXQQWUGLCCGORTGUCKPVGTRQUVC
PCECFGKCRTQFWVKXCVTKDWVCFCRGNQTGIKOGEWOWNCVKXQFGUUCUEQPVTKDWKGUEQO
incidncia total de 3,65% sobre sua receita, e a empresa adquirente, tributada sob o
TGIKOGFCPQEWOWNCVKXKFCFGNCPCCETFKVQQXCNQTFGUQDTGCUCSWKUKGU
efetuadas da empresa interposta.
'UUC QRGTCQ VCODO QEQTTG SWCPFQ J EKUQ FCU CVKXKFCFGU FC GORTGUC EQO
o objetivo de se manter nos limites de receita bruta admitidos para regimes de
VTKDWVCQ OCKU HCXQTGEKFC VCKU EQOQ NWETQ RTGUWOKFQ G QRVCPVGU FQ 4GIKOG
'URGEKCN7PKECFQFG#TTGECFCQG%QPVTKDWKGUFGXKFQURGNCU/KETQGORTGUCU
e Empresas de Pequeno Porte ( Simples Nacional).
5.9 COMPENSAO DE PREJUZOS ALM DA TRAVA DE 30%
Sntese da operao: a Lei n. 8.981, de 20 de janeiro de 1995, arts. 42 e 58, limitou a
EQORGPUCQFGRTGLW\QUUECKUGCDCUGFGENEWNQPGICVKXCFC%QPVTKDWKQ5QEKCN
sobre Lucro Lquido (CSLL) em 30% da base de clculo do imposto de renda ou
FCEQPVTKDWKQUQEKCNFGVCNHQTOCSWGJCXGPFQTGUWNVCFQVTKDWVXGNRGNQOGPQU
70% dele seria objeto de incidncia dos referidos tributos. A Cmara Superior de
4GEWTUQU(KUECKURCUUQWCCFOKVKTCEQORGPUCQKPVGITCNFGRTGLW\QUGFCDCUG
FGENEWNQFC%5..PQUECUQUFGGZVKPQFCRGUUQCLWTFKECUQDQCTIWOGPVQFG
SWGCNGKCQNKOKVCTCEQORGPUCQGOCUUGIWTQWQFKTGKVQEQORGPUCQFG
todas as bases negativas acumuladas e que, em casos de descontinuidade da empresa,
ECDGTKCCKPVGITCNEQORGPUCQGOTC\QFCKORQUUKDKNKFCFGFGGUUGURTGLW\QUUGTGO
utilizados em anos posteriores.231CDWUQXGTKECUGSWCPFQCGZVKPQFCUQEKGFCFG
se d apenas formalmente.
5.10 OPERAES DE SWAP INTRAGRUPO
Sntese da operao: o termo swap, de origem na lngua inglesa, no tem uma
VTCFWQRCTCQRQTVWIWU0QOGTECFQPCPEGKTQWOCGZRTGUUQNCTICOGPVG
WVKNK\CFCRCTCQRGTCGUSWGUKTXCOFGKPUVTWOGPVQFGhedge
RTQVGQ 5WCHWPQ
permitir a troca de indexadores de um ativo ou passivo de tal forma que limite
perdas e preserve ganhos. Por exemplo: um exportador que no quer sofrer perdas
FGEQTTGPVGUFGWOCXCNQTK\CQECODKCNRQKUCXCNQTK\CQFQTGCNRGTCPVGQFNCT
norte-americano faria suas receitas diminurem. Para travar as perdas decorrentes
FC XCNQTK\CQ ECODKCN Q GZRQTVCFQT RQFG HC\GT WOC QRGTCQ swap para troca
FG KPFGZCFQTGU 2QT GZGORNQ XCTKCQ ECODKCN RQT VCZC FG LWTQU FQ OGTECFQ
KPVGTDCPETKQ
&+  #UUKO CKPFC SWG JCLC WOC FGUXCNQTK\CQ FQ FNCT PQTVG
23 Acrdo n. CSRF/01-04.258, 1a Turma da Cmara Superior de Recursos Fiscais, sesso de 02/12/2002,
4GNCVQT %QPUGNJGKTQ %GNUQ #NXGU (GKVQUC 0Q OGUOQ UGPVKFQ QU #ETFQU P  FG 
P%54(FGGPFG

190

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

COGTKECPQGUUCFKHGTGPCUGTEQDGTVCRGNCTGOWPGTCQFQswap (contrato futuro)


atrelado taxa de juros. Nesse caso, o exportador ter uma receita de venda de
GZRQTVCQOGPQTOCUVGTICPJCFQPQOGTECFQFGVCZCFGLWTQU1hedge garante
que a receita necessria para fazer frente s despesas seja preservada em moeda
PCEKQPCN0CQWVTCRCTVGSWGOCUUWOKWCRQUKQRCUUKXCGOLWTQU&+GETGFQTCPC
taxa de cmbio ter perdas. A Lei n. 8.981, de 1995, regulou os efeitos tributrios das
QRGTCGUFGhedge0CUQRGTCGUFGswap intragrupos, o ganho e a perda podem
UQHTGTFGUNQECOGPVQUCTVKEKCKUPQITWRQGEQPOKEQ
5.11 EXPORTAO PARA PESSOA LIGADA CENTRO DE
REFATURAMENTO
Sntese da operao: centro de refaturamento, livremente traduzido do ingls
reinvoicing center, diz respeito a empresa sediada no exterior, normalmente em
WORCUFGVTKDWVCQHCXQTGEKFCSWGVGOEQOQHWPQKPVGTOGFKCTQUPGIEKQUFG
WOCGORTGUCPCEKQPCNEQOUGWUENKGPVGUPQGZVGTKQT'UUCKPVGTOGFKCQVQFCXKC
PQ UG F RGNQ KPUVKVWVQ FC TGRTGUGPVCQ EQOGTEKCN OCU EQOQ WO EGPVTQ FG
TGHCVWTCOGPVQIWTCPFQEQOQCFSWKTGPVGFCGORTGUCPCEKQPCNGEQOQXGPFGFQT
para o cliente desta no exterior. A vantagem tributria est em direcionar os
TGUWNVCFQURCTCRCUGUFGDCKZCRTGUUQUECN3WCPFQJGHGVKXCOGPVGCRTGUVCQ
FGUGTXKQUQWCKPVGTXGPQGHGVKXCFCGORTGUCNQECNK\CFCPQGZVGTKQTCUXGPFCU
GHGVWCFCURGNCGORTGUCPCEKQPCNGUVQUWLGKVCUUTGITCUFGRTGQFGVTCPUHGTPEKC
(princpio CTOUNGPIVJ .24 Nos casos de centros de refaturamento, estes intervm
apenas formalmente nos negcios.
5.12 CONSOLIDAO DOS RESULTADOS PELO MTODO DO
NORMATIVE SYSTEMS
#Q RTQEGFGT  EQPUQNKFCQ FQU ECUQU GO GUVWFQ XGTKECUG SWG FQU  ECUQU C
RTGOKUUCGZKUVPEKCFGRTQRUKVQPGIQEKCN2HQKTGNGXCPVGRCTCCOCPWVGPQ
ou cancelamento da exigncia em 17 casos, dos quais em 15 (88%) foi considerada
como determinante. O resultado do julgamento foi que esse fator determinante,
QWUGLCPQUFG\ECUQUGOSWGPQGZKUVKCOOQVKXQUGZVTCVTKDWVTKQUQNCPCOGPVQ
foi mantido, e nos cinco casos em que existiam outros motivos alm da economia
FGVTKDWVQUCGZKIPEKCUECNHQKECPEGNCFC'OCRGPCUFQKUECUQU
PUG GUUC
RTGOKUUCHQKFGURTG\CFCRGNQLWNICFQTQSWCNPCUTC\GUFGFGEKFKTTOQWRQUKQ
alinhada primeira fase do planejamento tributrio, ou seja, liberdade absoluta,
GZEGVQUKOWNCQ
24 O Princpio Arms Length consiste, sinteticamente, em tratar os membros de um grupo multinacional como
se eles atuassem como entidades separadas, no como partes inseparveis de um negcio nico. Devendo-se
VTCVNQUEQOQGPVKFCFGUUGRCTCFCU=?#1%&'FGHKPGEQOQRTGQarms length como aquele que teria sido
CEQTFCFQ GPVTG RCTVGU PQ TGNCEKQPCFCU GPXQNXKFCU PCU OGUOCU VTCPUCGU QW GO VTCPUCGU UKOKNCTGU PCU
OGUOCUEQPFKGUQWGOEQPFKGUUGOGNJCPVGUPQOGTECFQCDGTVQ%QOQXKUVQCEKOCUGTGUVGQRCTOGVTQ
RCTCCEQPXGTUQFGXCNQTGUGZRTGUUQUGOTGCKUFGITWRQRCTCQUTGCKUFGOGTECFQ
5%*17'4+R 

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

191

Igaro Jung Martins

No que se refere existncia de patologia de direito privado P2 , igualmente


CXGTKECQFGUUCRTGOKUUCTGNGXCPVGRCTCCCPNKUGFQUECUQUFGRNCPGLCOGPVQ
tributrio. Em 16 (94%) dos 17 casos em que a premissa foi considerada, o julgamento
considerou esse fator determinante, ou seja, nos dez casos em que se constatou existir
RCVQNQIKCFGFKTGKVQRTKXCFQQNCPCOGPVQHQKOCPVKFQCQRCUUQSWGPQUUGKUECUQU
GOSWGQTIQFGLWNICOGPVQGPVGPFGWPQJCXGTRCVQNQIKCCGZKIPEKCUECNHQK
ECPEGNCFC'OCRGPCUWOECUQCRGUCTFCGZKUVPEKCFCRCVQNQIKCQNCPCOGPVQHQK
ECPEGNCFQGOFGEQTTPEKCFGVGTJCXKFQRTQRUKVQPGIQEKCNPCQRGTCQ
ECUQP 
#VCDGNCUGIWKPVGFGOQPUVTCFGHQTOCUKPVVKECCUEQPENWUGUFCCRNKECQFQOVQFQ
Normative Systems
Operao
gio interno
gio interno
gio pago
gio pago
+PEQTRQTCQUCXGUUCU
+PEQTRQTCQUCXGUUCU
Casa e separa
Casa e separa
Debntures
Debntures
#GUGOVGUQWTCTKC
5WDECRKVCNK\CQ
5WDECRKVCNK\CQ
5GITGICQFG2,
%QORGPUCQCNOFCVTCXC
Swap intragrupo
Swap intragrupo
Centro de refaturamento

Caso
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18

Acrdo

P1

P2

Resultado
do julgamento

105-17.219
No
Sim
Mantida a exigncia
101-96.724
No
Sim
Mantida a exigncia
105-16.774
Sim
No
Cancelada a exigncia
1402-00.342
Sim
No
Cancelada a exigncia
101-94.127
Sim
Sim
Cancelada a exigncia
101-96.142
No
Sim
Mantida a exigncia
101-95.537
No
Sim
Mantida a exigncia
101-95.818
No
Sim
Mantida a exigncia
101-94.986
No
Sim
Mantida a exigncia
107-08-029
Sim
No
Cancelada a exigncia
101-96.066
No
Sim
Mantida a exigncia
101-95-014
No
No
Cancelada a exigncia
9101-00-287
No
Sim
Mantida a exigncia
103-23.357
No
No
Cancelada a exigncia
105-15.908 Prejudicada
Sim
Mantida a exigncia
101-93.616
Sim
No
Cancelada a exigncia
105-17.257
No
Prejudicada Mantida a exigncia
105-17.083
No
Sim
Mantida a exigncia

(QPVGGNCDQTCQFQCWVQT

6 CONCLUSO
Planejamento tributrio atividade lcita e encontra-se no campo da eliso tributria.
Planejamento tributrio abusivo, diferentemente, infringe a lei tributria e encontraUGPQECORQFCGXCUQ+FGPVKECTUGGUVCOQUFKCPVGFGWOCHQTOCGNKUKXCQWGXCUKXC
nem sempre fcil ao depararmos com o caso concreto. Durante todo o processo
de estudo, percebemos que parte dos doutrinadores e dos operadores do direito
CKPFCRTQRCICHCNVCTWOETKVTKQLWTFKEQSWGRTQRQTEKQPGGUVCDKNKFCFGGUGIWTCPC
jurdicas. Para estes, causa espcie que depois de transcorrido considervel lapso
VGORQTCNXGPJCQ(KUEQGTGSWCNKSWGQUHCVQURCTCGZKIKTVTKDWVQUUQDTGVWFQSWCPFQ
o contribuinte aparentemente observou as regras de direito privado, algumas vezes
EQOCEJCPEGNCFGTIQUFGTGIKUVTQFCUQRGTCGU
192

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

8GTKECOQUSWGQFKTGKVQRTKXCFQGUGWUKPUVKVWVQUPQUVGTOQURTGEQPK\CFQURGNQ
art. 109 do CTN, nos apresentavam um critrio jurdico vlido e seguro para
desconsiderar os negcios jurdicos celebrados pelo contribuinte quando ainda nos
GPEQPVTXCOQUPCRTKOGKTCHCUGFQRNCPGLCOGPVQVTKDWVTKQCGZKUVPEKCFCUKOWNCQ
Constatamos tambm que a norma cogente no tributria se encontra positivada sob
PQXCDCUGKFGQNIKECPCSWCNXCNQTGUEQOQCDQCHCTGNCVKXKFCFGFCUEQPXGPGU
G RTKPEKRCNOGPVG C HWPQ UQEKCN FQ EQPVTCVQ RCUUCO C UGT DCNK\CFQTGU RCTC Q
KPVTRTGVGCUUKOEQOQQUQQUXCNQTGUENUUKEQUEQOQCRTQRTKGFCFGGCUEQPXGPGU
particulares. Nesse sentido, o Novo Cdigo Civil nos traz novos elementos para a
anlise do negcio jurdico: as patologias do direito privado e as suas consequncias
jurdicas.
Na segunda fase do planejamento tributrio, demonstramos que esses critrios
jurdicos do direito privado, tais como a existncia das outras patologias de direito

PQOCKUTGUVTKVQUGZKUVPEKCFCUKOWNCQ UQUGIWTQUGGEC\GURCTCCCPNKUG
FQUECUQUFGRNCPGLCOGPVQVTKDWVTKQQWUGLCCQDUGTXCQFCPQTOCEQIGPVGPQ
tributria livre de patologias deve ser aceita pelo Fisco nessa segunda fase.
#KFGPVKECQFCRCVQNQIKCFGFKTGKVQRTKXCFQPQGPVCPVQPQQDTKICQCWFKVQT
UECNTGURQPUXGNRGNQNCPCOGPVQFGQHEKQCSWCNKECTQVKRQFGRCVQNQIKCRQKU
KUUQPQTGSWKUKVQRCTCCEQPUVKVWKQFQETFKVQVTKDWVTKQ
%60CTV 
#URCVQNQIKCUUQIWTCUSWGPQRNCPQRTVKEQPQTOCNOGPVGUGKPVGTTGNCEKQPCO
UGPFQOWKVCUXG\GUFKHEKNKFGPVKECTSWCNRCVQNQIKCKUQNCFCOGPVGGUVRTGUGPVG25
#QCWFKVQTUECNECDGFGUETGXGTQUHCVQUFGHQTOCRQTOGPQTK\CFCGCRNKECTCPQTOC
tributria de incidncia sobre os fatos revelados, jamais sobre os fatos formalmente
aparentes.
&GOQPUVTCOQUUGTCDUQNWVCOGPVGFKHGTGPVGUCCRNKECQFCCPCNQIKCGCTGSWCNKECQ
FQUHCVQUEQOQVCODOQUQCKPVGTRTGVCQGEQPOKECGCEQPUKFGTCQGEQPOKEC
dos fatos e, mais importante, como o propsito negocial, de origem no direito anglosaxo, um critrio vlido para a anlise do planejamento tributrio.
Nesse sentido, impe-se ao intrprete da norma que analise o fato antes e depois da
EGNGDTCQFQPGIEKQLWTFKEQRCTCSWGUQDTGGUUGHCVQUGRQUUCXGTKECTUGQEQTTGW
CUKVWCQFGPKFCGONGKEQOQPGEGUUTKCGUWEKGPVGQEQTTPEKCFQHCVQIGTCFQT
FCQDTKICQRTKPEKRCNVCNEQOQRTGEQPK\CFQPQCTVFQ%60
Ao analisarmos as razes de julgar adotadas pelo Carf em 18 casos de planejamento
tributrio, verificamos que a existncia de patologias do direito privado foi
determinante para 94% dos julgados, e que a ocorrncia de propsito negocial foi
relevante para 88% dos casos.
25 %QPUGNJGKTQ/TKQ,WPSWGKTC(TCPEQ,PKQTPCFGENCTCQFGXQVQPQ#ETFQPFC2TKOGKTC
Cmara do ento Conselho de Contribuintes, sesso de 19/05/2005.

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

193

Igaro Jung Martins

Nossa concluso, portanto, que o Fisco, na segunda fase do planejamento


tributrio, em que nosso ordenamento nos situa, isto , diante da ausncia de uma
norma geral antielisiva, que nos poderia levar para a terceira fase do planejamento
VTKDWVTKQNKDGTFCFGEQOECRCEKFCFGEQPVTKDWVKXCRQFGGFGXGCHCUVCTCUSWCNKECGU
LWTFKECUCVTKDWFCURGNQUWLGKVQRCUUKXQUGORTGSWGXGTKECTGEQORTQXCTCGZKUVPEKC
de uma patologia do direito privado e a inexistncia de razes extratributrias para
o negcio jurdico (propsito negocial).

194

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Planejamento tributrio e a norma cogente no tributria

REFERNCIAS
ABRAHAM, Marcus. O planejamento tributrio e o direito privado. So Paulo:
Quartier Latin, 2007.
ALCHOURRN, Carlos E. Introduccin a la metodologa de las ciencias
jurdicas y sociales. Biblioteca Virtual Universal, 2003. Disponvel em: <http://
www.biblioteca.org.ar/libros/89293.pdf>. Acesso em: 24/04/2012.
ALVES, Jos Carlos Moreira. Figuras correlatas: abuso de forma, abuso de direito,
FQNQPGIEKQULWTFKEQUUKOWNCFQUHTCWFGNGKPGIEKQKPFKTGVQGFKUUKOWNCQ
In: SEMINRIO INTERNACIONAL SOBRE ELISO FISCAL. Anais...
Braslia: Esaf, 2002.
AMARO, Luciano. Direito tributrio brasileiro. 5. ed. rev. e atual. So Paulo:
Saraiva, 2000.
ANDRADE FILHO, Edmar Oliveira. Planejamento tributrio. So Paulo:
Saraiva, 2009.
VILA, Humberto. Teoria da igualdade tributria. So Paulo: Malheiros, 2009.
BALEEIRO, Aliomar. Direito tributrio brasileiro. 11. ed. 9. tiragem. Atualizado
por Misabel Abreu Machado Derzi. Rio de Janeiro: Forense, 2001.
$'%-'4#NHTGFQ#WIWUVQTeoria geral do direito tributrio. 3. ed. So Paulo:
Lejus, 1998.
CARVALHO, Paulo de Barros. Curso de direito tributrio. 14. ed. rev. e atual.
So Paulo: Saraiva, 2002.
%#5641 .GQPCTFQ (TGKVCU FG /QTCGU
1TI  $'4)#/+0+ #FQNHQ GV CN
Planejamento tributrio: anlise de casos. So Paulo: MP Editora, 2010.
COLHO, Sacha Calmon Navarro. Curso de direito tributrio brasileiro. 6. ed.
Rio de Janeiro: Forense, 2001.
DI PIETRO, Adriano. Panorama internacional e a experincia da Itlia. In:
SEMINRIO INTERNACIONAL SOBRE ELISO FISCAL. Anais... Braslia:
Esaf, 2002.
GOMES, Orlando. Introduo ao direito civil. 4. ed. Rio de Janeiro: Forense, 1974.
______. Contratos. 25. ed. Rio de Janeiro: Forense, 2002.
GRECO, Marco Aurlio. Planejamento tributrio. 2. ed. So Paulo: Dialtica, 2008.
MACHADO, Hugo de Brito. Curso de direito tributrio. 12. ed. rev., atual. e
ampl. So Paulo: Malheiros, 1997.
Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

195

Igaro Jung Martins

MARINS, James. Eliso tributria e sua regulao. So Paulo: Dialtica, 2002.


MELLO, Marcos Bernardes de. Teoria do fato jurdico: plano da existncia. 8. ed.
So Paulo: Saraiva, 1998.
MONTEIRO, Washington de Barros. Curso de direito civilFKTGKVQFCUQDTKICGU
1a Parte. So Paulo: Saraiva, 1990.
0#5%+/'061%CTNQU8CNFGT
%QQTF /#46+05+XGU)CPFTCFC5KNXCGVCN
Comentrios ao Cdigo Tributrio Nacional. Rio de Janeiro: Forense, 1998.
0'&'4/CTEQU8KPKEKWU.2'</CTKC6GTG\C/CTVKPG\Processo administrativo
fiscal federal comentado. So Paulo: Dialtica, 2002.
OLIVEIRA, Ricardo Mariz de. Fundamentos do imposto de renda. So Paulo:
Quartier Latin, 2008.
PAULSEN, Leandro. Direito tributrio%QPUVKVWKQG%FKIQ6TKDWVTKQNW\
da doutrina e da jurisprudncia. 12. ed. rev. e atual. Porto Alegre: Livraria do
Advogado, 2010.
PINTO, Carlos Alberto da Mota. Teoria geral do direito civil. 3. ed. Coimbra:
Coimbra, 1992.
SANTI, Eurico Marcos Diniz de. Decadncia e prescrio no direito tributrio.
So Paulo: Max Limonad, 2000.
5%*17'4+.WU'FWCTFQ
%QQTF (4'+6#54QFTKIQFG
1TI Planejamento
tributrio e o propsito negocial: mapeamento de decises do Conselho de
Contribuintes de 2002 a 2008. So Paulo: Quartier Latin, 2010.
______. Preos de transferncia no direito tributrio brasileiro. 2. ed. rev.
So Paulo: Dialtica, 2008.
TORRES, Heleno. Direito tributrio internacional. So Paulo: Editora Revista
dos Tribunais, 2001.
______. Direito tributrio e direito privado CWVQPQOKC RTKXCFC UKOWNCQ
e eluso tributria. So Paulo: Editora Revista dos Tribunais, 2003.
:#8+'4#NDGTVQDo lanamento: teoria geral do ato, do procedimento e do
processo tributrio. 2. ed. reform. e atual. Rio de Janeiro: Forense, 2001a.
______. Tipicidade da tributao, simulao e norma antielisiva. So Paulo:
Dialtica, 2001b. p. 59.
AAAAAA#PQTOCIGTCNCPVKGNKUQFC/2PGCVTKDWVCQRQTCPCNQIKCWOC
brutal agresso ao Princpio da Legalidade. Revista Tributria de Finanas
Pblicas, So Paulo, Revista dos Tribunais, n. 47, p. 39-42, 2002.
YAMASHITA, Douglas (Coord.). Planejamento tributrio luz da jurisprudncia. So Paulo: Lex Editora, 2007.
196

Cad. Fin. Pbl., Braslia, n. 12, p. 163-196, dez. 2012

Polticas keynesianas anticclicas no Brasil:


estabilizao e desenvolvimento econmico
Danielle Sandi Pinheiro

Abstract

Professora Adjunta II do
&GRCTVCOGPVQFG#FOKPKUVTCQFC7P$
Doutora em Economia pela
Universidade de Braslia (UnB)

The article attempts to carry out an analysis of


the Brazilian economic panorama in the period
between 2003 and 2012, based on keynesian
economic doctrine and monetary and fiscal policies
implemented by the Government during this
period. Initially, we had a background about the
revitalization of the keynesian economic thought
after the outbreak of the financial crisis of 2008 and
the subsequent questioning of neo-liberal monetarist
paradigm. Then we conduct a synthesis of the most
important arguments of the keynesian theory, like
the concepts of effective demand, marginal propensity
to consume, multiplier of the income and others
concepts. Subsequently, we examine the situation
and national economic policy implemented in the
mandates of Presidents Lus Incio Lula da Silva
and the first two years of Dilma Roussef through
critical examination of fiscal and monetary policies
applied. We seek with this expose synthetically as the
keynesian assumptions may be applied by the State
with the purpose of promoting not only short-term
adjustments in the economy, but also effectively
guide the economic activity with a view to growth
and economic development on a sustainable basis. In
this sense, at the end of the work, we make, concisely,
a theoretical discussion about the role of the State in
its possibilities of intervention in order to promote
the sustainable development process.

Carlos Frederico Rubino P. de Alverga


#PCNKUVCFG(KPCPCUG%QPVTQNGFC5GETGVCTKCFQ
Tesouro Nacional
Economista graduado na UFRJ
Mestre em Cincia Poltica pela UnB

Juliana Sandi Pinheiro


/GUVTGGO4GNCGU+PVGTPCEKQPCKURGNC7P$
&QWVQTCPFCFQ%GPVTQFG'UVWFQU#XCPCFQU
Multidisciplinares (Ceam) da UnB

Resumo
O artigo intenta proceder a uma anlise do panorama
econmico brasileiro no perodo entre 2003 e 2012,
com fundamento na doutrina econmica keynesiana
e nas polticas monetria e fiscal implementadas
pelo governo nesse perodo. Inicialmente, feita
uma contextualizao sobre a revitalizao do
pensamento econmico keynesiano aps a ecloso
da crise financeira de 2008 e o consequente
questionamento do paradigma monetarista
neoliberal. Depois, realizada uma sntese dos
mais relevantes argumentos da teoria keynesiana,
tais como os conceitos de demanda efetiva, propenso
marginal a consumir, multiplicador da renda,
etc. Posteriormente, so examinadas a conjuntura
e a poltica econmica nacional executada nos
mandatos de Lus Incio Lula da Silva e nos dois
primeiros anos do mandato de Dilma Rousseff, por
intermdio do exame crtico das polticas fiscal e
monetria aplicadas. Busca-se, com essa perspectiva,
expor sinteticamente como as premissas keynesianas
podem ser aplicadas pelo Estado com o propsito de
promover no somente ajustes de curto prazo na
economia, mas tambm efetivamente orientar a
atividade econmica com vistas ao crescimento e ao
desenvolvimento econmico em bases sustentveis.
Nesse sentido, ao final do trabalho, abordada,
de forma concisa, uma discusso terica acerca
do papel do Estado como agente promotor do
desenvolvimento econmico.

Palavras-chave
Polticas fiscal e monetria. Teoria keynesiana.
Desenvolvimento econmico.

Keywords
Fiscal and monetary policies. Keynesian theory.
Economic development.

1 INTRODUO
#U VWTDWNPEKCU GEQPOKEQPCPEGKTCU
internacionais tm exposto a fragilidade
macroeconmica do sistema de mercado,
tendo sido necessria a contnua
KPVGTXGPQFQ'UVCFQEQOQHQTOCFG
estabilizar os ciclos inerentes atividade
econmica. Observa-se que as livres
HQTCUFGOGTECFQUQ\KPJCUPQUQOGPVG
tm se revelado incapazes de promover
WOCCNQECQFQUTGEWTUQUPQUGPVKFQFG
UQNWQFQUFGUGSWKNDTKQUGEQPOKEQU

Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

197

Danielle Sandi Pinheiro/Carlos Frederico Rubino P. de Alverga/Juliana Sandi Pinheiro

como tambm no esto sendo hbeis em gerar renda e emprego de maneira


sustentvel e includente.
#UUKOCGHGVKXCHQTOWNCQFGRTQRQUVCURCTCCUQNWQFQURTQDNGOCURGTVKPGPVGU
ao sistema de economia de mercado acaba sendo atribuda ao Estado devido ao seu
RQFGTFGXKCDKNK\CTGKORNGOGPVCTRQNVKECUSWGGUVKOWNCOCGZRCPUQFCRTQFWQ
ao mesmo tempo em que promovem o desenvolvimento econmico e social.
Portanto, apesar das crises cclicas do sistema, o crescimento econmico conduzido
UQDGUUCRGTURGEVKXCRQFGGUVKOWNCTQKPETGOGPVQFQGORTGIQCECRCEKVCQFQU
VTCDCNJCFQTGUGCEQPUGSWGPVGGNGXCQFCRTQFWVKXKFCFGGOWOETEWNQXKTVWQUQ
PQ SWCN Q FGUGPXQNXKOGPVQ  PCVWTCNOGPVG CNECPCFQ RQT OGKQ FQ GUVOWNQ
capacidade produtiva.
RTGEKUQPQRGTFGTFGXKUVCPGUUGEQPVGZVQSWGQRTQEGUUQFGVTCPUHQTOCQFQU
benefcios do crescimento econmico em aprimoramento da qualidade de vida
FC RQRWNCQ EQO XKUVCU CQ FGUGPXQNXKOGPVQ GEQPOKEQ G UQEKCN VTCPUEGPFG
a perspectiva de curto prazo e vai ao encontro de uma ampla demanda na qual cada
XG\OCKUJQENCOQTFCUQEKGFCFGRQTWO'UVCFQSWGGHGVKXGQHWPEKQPCOGPVQGEC\
FQUOGTECFQUCQOGUOQVGORQGOSWGUGRTGQEWRGEQOCTGFWQFCUFGUKIWCNFCFGU
UQEKCKUCRTQOQQFQFGUGPXQNXKOGPVQGEQPOKEQGCOGNJQTKCFCUEQPFKGUFG
vida em bases sustentveis.
Essa perspectiva primordial atribuda ao Estado na atividade econmica e no
atendimento s demandas sociais um paradigma fundamental para o processo
de desenvolvimento do Brasil. Seu embasamento encontra eco nos pressupostos
Cepalinos. Tais pressupostos se fundamentam, sinteticamente, na viso de que
o Estado, ao exercer as tarefas de promotor e participante do crescimento e do
desenvolvimento econmico e social, est igualmente trabalhando para cumprir
UGWUQDLGVKXQUHWPEKQPCKUGEQPOKEQUGOVGTOQUFCUHWPGUCNQECVKXCFKUVTKDWVKXC
e estabilizadora sobre o sistema econmico como um todo.
Tendo-se em vista esse contexto, este trabalho fundamenta-se na perspectiva de expor
UKPVGVKECOGPVGEQOQCURTGOKUUCUMG[PGUKCPCURQFGOUGTCRNKECFCURGNQ'UVCFQEQO
o propsito de promover no somente ajustes de curto prazo na economia, mas
tambm efetivamente orientar a atividade econmica com vistas ao crescimento e
ao desenvolvimento econmico em bases sustentveis. Portanto, vislumbra-se neste
ensaio considerar a perspectiva de um Estado que, embora no descuide das polticas
econmicas de curto prazo para fazer frente s crises cclicas do sistema, tambm
busca, concomitantemente, promover o desenvolvimento no longo prazo do pas.
#SWGUVQSWGUWTIGUGTGHGTGKPVGPUKFCFGFCRCTVKEKRCQFGUUG'UVCFQGSWCNUGW
ITCWFGKPVGTXGPQPCGEQPQOKC
&GUUG OQFQ PC RTKOGKTC UGQ FGUVG GPUCKQ  TGCNK\CFC WOC UPVGUG FQ KFGTKQ
MG[PGUKCPQEQPVGZVWCNK\CFCCUGIWKTEQOWOCCPNKUGUKPVVKECFQRCPQTCOCFC
GEQPQOKC DTCUKNGKTC PQU RGTQFQU RT G RUETKUG PCPEGKTC OWPFKCN #Q PCN
198

Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

Polticas keynesianas anticclicas no Brasil: estabilizao e desenvolvimento econmico

ser abordada uma discusso terica resumida acerca do papel do Estado em


UWCU RQUUKDKNKFCFGU FG KPVGTXGPQ PC UQEKGFCFG PQ SWG UG TGHGTG CQ RTQEGUUQ FG
desenvolvimento.

2 O CONTEXTO PS-CRISE DE 2008 DE REVALORIZAO DO


IDERIO KEYNESIANO
2QFGOQU EQPUKFGTCT SWG Q EQPUGPUQ MG[PGUKCPQ FWTQW FQ VTOKPQ FC 5GIWPFC
Guerra Mundial (1945) at a ascenso de Margaret Thatcher ao poder no Reino
Unido em 1979. Nesse intervalo de quase um quarto de sculo, o referido consenso
proporcionou ao capitalismo seus denominados anos de ouro, caracterizados por
crescimento econmico e estabilidade monetria. O aludido consenso consistiu no
GPVGPFKOGPVQOCLQTKVTKQJGIGOPKEQRGNCFQWVTKPCGEQPOKECUQDTGCGEEKC
FCTGIWNCQRDNKECFCGEQPQOKCFGOGTECFQECRKVCNKUVCRGNQ'UVCFQOGFKCPVGQ
GZGTEEKQFCURQNVKECUUECNGOQPGVTKCFGEWPJQMG[PGUKCPQEQOCPCNKFCFGFG
OCPVGTUQDEQPVTQNGPQQDUVCPVGCUWVWCGUGQUEKENQUGEQPOKEQUFGGZRCPUQ
GEQPVTCQFCQHGTVCCKPCQGQFGUGORTGIQ
3WCPFQCKPCQKPKEKQWUGWRTQEGUUQFGTGETWFGUEKOGPVQPCUGIWPFCOGVCFGFC
FECFCFGCRUCRTKOGKTCETKUGFQRGVTNGQQKFGTKQMG[PGUKCPQEQOGQW
a ser removido da doutrina econmica pelo neoliberalismo, pelos monetaristas
CFGRVQUFCUGZRGEVCVKXCUTCEKQPCKUGFCRTGRQPFGTCPVGTGFWQFGTGIWNCQRGNQ
Estado na economia capitalista.
Entretanto, com a crise do mercado de hipotecas dos Estados Unidos, a falncia
FQU RTKPEKRCKU DCPEQU JKRQVGETKQU GUVCFWPKFGPUGU FG KPUVKVWKGU PCPEGKTCU
EQPUKFGTCFCUFGTKUEQ\GTQRGNCUCIPEKCUFGENCUUKECQFGTKUEQUFGOQPVCFQTCU
da indstria automobilstica norte-americana e da maior seguradora do mundo,
C #+) GUVCVK\CFC RGNQ IQXGTPQ COGTKECPQ G VCODO GO FGEQTTPEKC FC OCEKC
KPVGTXGPQ FQU RTKPEKRCKU $CPEQU %GPVTCKU FQ OWPFQ  CFQVCPFQ WOC RQNVKEC
monetria expansionista de baixas taxas de juros para tentar propiciar a retomada
FCCVKXKFCFGGEQPOKECQEQTTGWWOCTGFGUEQDGTVCFQRGPUCOGPVQFG-G[PGUG
FCKPVGTXGPQTGIWNCVTKCFQ'UVCFQPCGEQPQOKCECRKVCNKUVCRQTKPVGTOFKQFQ
GZGTEEKQ FCU RQNVKECU UECN G OQPGVTKC FG EWPJQ MG[PGUKCPQ 5GTKC Q TGVQTPQ
FQ'UVCFQMG[PGUKCPQGZGTEGPFQCHWPQGUVCDKNK\CFQTCFQIQXGTPQPCGEQPQOKC
0QKPEKQFCCRNKECQFCUVGTCRKCUFGTGIWNCQRDNKECRCTCGPHTGPVCOGPVQFCETKUG
PCPEGKTCFGSWGFGRQKUUGVTCPUHQTOQWGOETKUGGEQPOKECGZRCPFKPFQUG
RCTCCGEQPQOKCTGCNQEQTTGWWOCRTGFQOKPPEKCFCCRNKECQFCRQNVKECOQPGVTKC
expansionista, com um rebaixamento substancial das taxas de juros mediante
C KPLGQ OCEKC FG FNCTGU G GWTQU PC GEQPQOKC RGNQU $CPEQU %GPVTCKU PQTVG
americano e europeu, respectivamente. Mesmo com a taxa de juros extremamente
diminuta praticada pelas autoridades monetrias dos Estados Unidos e da Europa,
no houve o reativamento esperado da economia. Pode-se considerar que ocorreu
Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

199

Danielle Sandi Pinheiro/Carlos Frederico Rubino P. de Alverga/Juliana Sandi Pinheiro

WOCUKVWCQFGPQOKPCFCRQT-G[PGUFGCTOCFKNJCFCNKSWKFG\PCSWCNCTGFWQ
da taxa de juros incapaz de aumentar o investimento, o nvel de emprego e a renda
FGGSWKNDTKQFCGEQPQOKC5QOGPVGCRQNVKECUECNUGTKCGPVQGEC\RCTCCNECPCT
esses trs objetivos.
O governo brasileiro, que na poca da crise de 2008 possua reservas cambiais de
EGTECFG75DKNJGUFKCPVGFQEQTVGFCUNKPJCUFGPCPEKCOGPVQGZVGTKQTRCTC
as empresas brasileiras, disponibilizou recursos em montante substancial aos bancos
PCEKQPCKURCTCSWGGORTGUVCUUGOUGORTGUCU/CUXGTKEQWUGSWGQUDCPEQUPQ
Q\GTCOGQEQTTGWQEJCOCFQGORQCOGPVQFCNKSWKFG\RGNQSWCNQFKPJGKTQ
RGTOCPGEGWPQUEQHTGUFCUKPUVKVWKGUPCPEGKTCUGPQCVKPIKWQUGVQTRTQFWVKXQ
Possivelmente, j antecipando a ocorrncia de uma possvel armadilha da liquidez,
o governo nacional manteve a taxa de juros no mesmo patamar. Tendo em vista
C QEQTTPEKC FQ GORQCOGPVQ UWRTCOGPEKQPCFQ RQUVGTKQTOGPVG Q IQXGTPQ
DTCUKNGKTQ QRVQW RQT KORNGOGPVCT WOC RQNVKEC UECN GZRCPUKQPKUVC CPVKEENKEC
tentando estimular a retomada da atividade econmica e do investimento por
KPVGTOFKQFCEQPEGUUQFGKPEGPVKXQUUECKUGFGUQPGTCGUVTKDWVTKCU6CNRQNVKEC
aparentemente, rendeu bons resultados, na medida em que, segundo o Instituto
$TCUKNGKTQFG)GQITCCG'UVCVUVKEC
+$)' JQWXGETGUEKOGPVQGEQPOKEQGO
FGGOTGNCQCSWCPFQQRTQFWVQKPVGTPQDTWVQECKWUGIWPFQQ
mesmo instituto.
#QQRVCTRQTTGFW\KTCVTKDWVCQGOXG\FGGHGVWCTFKTGVCOGPVGFKURPFKQURDNKEQU
VCNXG\CCFOKPKUVTCQ.WNCVGPJCCUUKORTQEGFKFQRGNQHCVQFGQFGUGORTGIQPQ
ter disparado, mesmo no auge da crise, em 2009, quando registrou, na mdia, 8,1%
FCRQRWNCQGEQPQOKECOGPVGCVKXC
+$)' 1ICUVQRDNKEQFKTGVQRTGEQPK\CFQ
RQT -G[PGU UGTKC UGIWPFQ #HQPUQ
  OCKU CRTQRTKCFQ RCTC OQOGPVQU FG
depresso econmica, caracterizados por elevadas taxas de desemprego, o que no
aconteceu no Brasil na crise de 2008.

3 SNTESE DO MODELO KEYNESIANO DE INTERVENO DO


ESTADO NA ECONOMIA
Na economia de mercado capitalista existe a tendncia de um desequilbrio
HWPFCOGPVCNGPVTGCQHGTVCGCFGOCPFCCITGICFCUPCOGFKFCGOSWGFKEKNOGPVG
ocorre coincidncia quantitativa entre estas ltimas. Quase nunca a oferta igual
demanda, sendo, geralmente, maior ou menor. Isso decorre da incerteza de
que padecem os empresrios capitalistas sobre qual ser exatamente a demanda
pelos produtos que fabricam para venda aos consumidores. De modo geral, as
consequncias desse descasamento entre a oferta e a demanda agregadas so o
FGUGORTGIQGCKPCQSWGVGPFGOCQEQTTGTTGURGEVKXCOGPVGSWCPFQCFGOCPFC
agregada menor ou maior do que a oferta agregada.
200

Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

Polticas keynesianas anticclicas no Brasil: estabilizao e desenvolvimento econmico

&GCEQTFQEQO&KNNCTF
 G#HQPUQ
 RCTC-G[PGUPQUGWOQFGNQOCKU
elementar, os nveis de investimento, emprego e renda da economia (variveis
dependentes) so decorrncia das trs variveis independentes do modelo, que
so a propenso marginal a consumir (PMC, maior nas camadas mais pobres
FC RQRWNCQ  C VCZC FG LWTQU G C GEKPEKC OCTIKPCN FQ ECRKVCN
'/%  SWG
UKORNKECFCOGPVG UKIPKEC C TGPVCDKNKFCFG HWVWTC GURGTCFC FQ KPXGUVKOGPVQ GO
DGPUFGECRKVCNQWCVCZCFGNWETQGURGTCFC#URQNVKECUUECNGOQPGVTKCKPEKFGO
diretamente sobre as variveis independentes do modelo, e, indiretamente, afetam
as variveis dependentes.
#2/%FKTGVCOGPVGCHGVCFCRGNCRQNVKECUECNRQTOGKQFCKPEKFPEKCFCVTKDWVCQ
sobre a renda dos consumidores, a qual, se est alta, melhora as expectativas
empresariais e encoraja e estimula o investimento. Uma forma de aumentar o
TGPFKOGPVQFCRQRWNCQTGFW\KPFQCVTKDWVCQUQDTGCTGPFCGQEQPUWOQPCHCUG
TGEGUUKXCFQEKENQGEQPOKEQ#HWPQEQPUWOQTGRTGUGPVCCRTQRQTQFCTGPFC
FGUVKPCFCCQEQPUWOQQTGUVCPVGFCTGPFCFGUVKPCFQRQWRCPC#NGKRUKEQNIKEC
HWPFCOGPVCNFG-G[PGUCTOCSWGSWCPFQCWOGPVCCTGPFCQEQPUWOQVCODO
CWOGPVCOCUGORTQRQTQKPHGTKQTSWGNCFQKPETGOGPVQFCTGPFC
Quanto taxa de juros, esta diretamente afetada pela poltica monetria do governo,
na medida em que o controle sobre a oferta de dinheiro e, por conseguinte, sobre a
taxa de juros, exercido por uma autoridade monetria centralizada, o Banco Central,
por meio dos mecanismos do mercado aberto, do redesconto e do compulsrio
sobre os bancos comerciais, tem incidncia direta no investimento, afetando tanto
o nvel de emprego quanto a renda da economia. O controle da taxa de juros fazUGDCUKECOGPVGRGNQEQPVTQNGFCQHGTVCFGOQGFCRCTC-G[PGUCVCZCFGLWTQU
FGVGTOKPCFCRGNCKPVGTUGEQFCEWTXCFGFGOCPFCRQTOQGFCEQOCEWTXCFG
oferta de moeda.
O nvel das taxas de juros determinar se os empresrios investiro em bens de
capital ou nos ttulos da dvida pblica do governo remunerados pela taxa de juros,
ou se preferiro entesourar os recursos, caracterizando a preferncia pela liquidez.
De qualquer forma, os empresrios capitalistas s investiro em bens de capital, ou
seja, somente investiro no setor produtivo, se a EMC for superior taxa de juros.
#RTGHGTPEKCRGNCNKSWKFG\UKIPKECSWGQGORTGUTKQFGUGLCTGVGTOQGFCGOGUREKG

OQGFCEQOQTGUGTXCFGXCNQT GOXG\FGKPXGUVKTQSWGEQTTGURQPFGGURGEWNCQ
FCFGOCPFCRQTOQGFC+UUQHQKWOCPQXKFCFGKPUVKVWFCRQT-G[PGUPCFQWVTKPC
tendo em vista que o principal motivo at ento presente na teoria econmica para
LWUVKECTCTGVGPQFGOQGFCGTCCVTCPUCQ
RCTCVTQECRQTDGPUGUGTXKQU 
-G[PGUVCODOCRQPVCCRTGECWQEQOQWOCVGTEGKTCOQFCNKFCFGFCFGOCPFC
RQTOQGFCRGTVKPGPVGUCVKUHCQFGRQUUXGKUEQPVKPIPEKCUHWVWTCU#RTGXKUQ
FC RQUUKDKNKFCFG FC QEQTTPEKC FG GPVGUQWTCOGPVQ RQT GURGEWNCQ ECTCEVGTK\C
WOTQORKOGPVQEQOC.GKFG5C[SWGRTGEQPK\CSWGCQHGTVCIGTCUWCRTRTKC
Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

201

Danielle Sandi Pinheiro/Carlos Frederico Rubino P. de Alverga/Juliana Sandi Pinheiro

demanda, proporcionando, segundo os economistas neoclssicos, o equilbrio de


pleno emprego.
A teoria da preferncia pela liquidez, segundo a qual em vez de gastar o dinheiro
PQEQPUWOQQKPFKXFWQGPVGUQWTCOQGFCRCTCGURGEWNCQHC\EQOSWGRCTVGFC
TGPFCPQUGLCFGUVKPCFCCSWKUKQFCQHGTVCIGTCPFQUQDTCFGOGTECFQTKCUUGO
UGTGOEQPUWOKFCUGFGETUEKOQGOUGWURTGQUQSWGEQPVTCFK\C.GKFG5C[
1WVTQHCVQTSWGTGVKTQWCETGFKDKNKFCFGFC.GKFG5C[HQKCQEQTTPEKCFCETKUGFG
UWRGTRTQFWQGUWDEQPUWOQQEQTTKFCGOCSWCNFGUOGPVKWSWGFGUCLWUVGU
GPVTG QHGTVC G FGOCPFC CITGICFCU HQUUGO GURQPVCPGCOGPVG EQTTKIKFQU RGNC CQ
FC OQ KPXKUXGN FCU NKXTGU HQTCU FQ OGTECFQ SWG UGIWPFQ QU PGQENUUKEQU
restabeleceriam automaticamente o equilbrio (igualdade entre oferta e demanda
agregadas) no nvel de pleno emprego.
5GIWPFQ)CNDTCKVJ
R CTGXQNWQMG[PGUKCPCEQPUKUVKWDCUKECOGPVG
na descoberta da possibilidade da ocorrncia de equilbrio com desemprego, na
PGICQFC.GKFG5C[GPQCRGNQRCTCQIQXGTPQGORTGGPFGTICUVQUUGOVGTCU
TGEGKVCUPGEGUUTKCURCTCEQDTKNQUCOFGOCPVGTQPXGNFGFGOCPFCKUUQPWO
contexto de depresso econmica.
#'/%RQTUWCXG\CHGVCFCRGNCUEKVCFCURQNVKECUUECNGOQPGVTKCFCUGIWKPVG
HQTOCQIQXGTPQGZGTEGPFQCUHWPGUGUVCDKNK\CFQTCG
TG FKUVTKDWVKXCKPVGTHGTG
PCTGPFCFCUECOCFCUOCKURQDTGUFCRQRWNCQCUSWCKURQUUWGOOCKQT2/%
RQTOGKQFCVTKDWVCQOGPQTUQDTGCTGPFCFGUUCUECOCFCU#NOFKUUQQ'UVCFQ
CQ RTQRQTEKQPCT C TGFKUVTKDWKQ RCTC CU ENCUUGU OGPQU HCXQTGEKFCU FQU TGEWTUQU
CTTGECFCFQUEQOCVTKDWVCQOCKUUGXGTCKPEKFGPVGUQDTGCTGPFCFCUECOCFCUOCKU
ricas da sociedade, aumenta o poder de consumo dos mais desfavorecidos.
Como fato que a PMC maior nos estratos menos aquinhoados do que naqueles
mais abastados, incrementado o poder de demanda das classes mais baixas da
UQEKGFCFG'UUCUKVWCQTGRGTEWVGHCXQTCXGNOGPVGPCUGZRGEVCVKXCUFQUGORTGUTKQU
fazendo-os aumentar seus investimentos em razo da perspectiva de que a oferta
por eles propiciada ser consumida, e esse consumo lhes proporcionar lucro e
rentabilidade percentual maiores do que a taxa de juros controlada por uma poltica
monetria expansionista.
#UUKOQKPETGOGPVQFQRQFGTFGEQORTCFQUOCKURQDTGUKPWGPEKCRQUKVKXCOGPVG
as expectativas dos empresrios para que invistam mais, uma vez que eles tm a
RGTEGRQFGSWGC'/%UGTOCKQTETGUEGPVGGUWRGTKQTVCZCFGLWTQUFGETGUEGPVG
KPWGPEKCFCFKTGVCOGPVGRQTWOCRQNVKECOQPGVTKCGZRCPUKXCSWGKPFKTGVCOGPVG
afeta a EMC. Por exemplo, ao baixar acentuadamente a taxa de juros, o governo
UKPCNK\CSWGC'/%ETGUEGTQSWGRQFGKPWGPEKCTQUGORTGUTKQUCKPXGUVKTOCKU
em razo da melhoria gerada nas suas expectativas.
202

Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

Polticas keynesianas anticclicas no Brasil: estabilizao e desenvolvimento econmico

5GIWPFQ %CTFKO
 R   CU WVWCGU FC '/% G RQT EQPUGSWPEKC FQ
investimento so as causas principais da ocorrncia dos ciclos econmicos.
A volatilidade do nvel dos investimentos decorre da instabilidade das expectativas
dos empresrios (fator psicolgico), cujo esprito empreendedor denominado por
-G[PGUFGanimal spirit. Essas expectativas referem-se taxa de rendimento do
investimento em bens de capital (investimento produtivo) a EMC relativamente
ao emprego do capital em ttulos da dvida pblica remunerados pela taxa de juros
QW GO TGNCQ CQ GPVGUQWTCOGPVQ FC OQGFC RCTC GURGEWNCQ # KPEGTVG\C FQU
empresrios quanto ao futuro abrange tanto a EMC quanto a taxa de juros. Essa
EQPLWPVWTC RTQRQTEKQPC C CNVGTPPEKC FG RGTQFQU FG GZRCPUQ G EQPVTCQ FC
RTQFWQQHGTVCPCGEQPQOKCFGOGTECFQECRKVCNKUVC
0C HCUG GZRCPUKXC FQ EKENQ GEQPOKEQ UGIWPFQ QU RTGUUWRQUVQU MG[PGUKCPQU C
RQNVKECOQPGVTKCFGXGUGTTGUVTKVKXCEQOVCZCUFGLWTQUOCKUCNVCUGTGFWQFC
quantidade de moeda na economia, o que feito mediante a venda, pelo Banco
%GPVTCNFGVVWNQUFCFXKFCRDNKEC#RQNVKECUECNFGXGUGTOCKUCWUVGTCEQO
TGFWQFQUICUVQURDNKEQUGCWOGPVQFCVTKDWVCQUQDTGQUHCVQTGUFGRTQFWQ
EQOQHQTOCFGEQODCVGTCOCKQTCOGCCFCHCUGGZRCPUKQPKUVCFQEKENQGEQPOKEQ
CKPCQ#ODCUCURQNVKECUXKUCOCEQPVGTCFGOCPFCCITGICFCGCGXKVCTQ
CWOGPVQIGPGTCNK\CFQFQURTGQU0QSWGEQPEGTPGRQNVKECUECNCEQODKPCQ
FG OCKQT VTKDWVCQ EQO OGPQT FGURGUC RDNKEC EQPVTKDWK RCTC C QEQTTPEKC FG
UWRGTXKV UECN PCU EQPVCU FQ IQXGTPQ %QPHQTOG 2GTGKTC
 R   -G[PGU
RTQRWPJCCWVKNK\CQFCRQNVKECUECNEQORGPUCVTKCPCSWCNRTGICXC=?CIGTCQ
FGUWRGTXKVUFKCPVGFGCOGCCUFGKPCQ
0CHCUGTGEGUUKXCFQEKENQGEQPOKEQUGIWPFQQUMG[PGUKCPQUCRQNVKECOQPGVTKC
deve ser expansionista, com taxas de juros mais baixas para incentivar o investimento,
e se caracterizar pelo aumento da quantidade de moeda na economia, o que
efetivado por meio da compra, pelo Banco Central, de ttulos da dvida pblica.
# RQNVKEC UECN FGXG UGT OCKU GZRCPUKXC EQO KPETGOGPVQ FQU ICUVQU RDNKEQU
TGNCVKXQUCQQTCOGPVQRDNKEQFGECRKVCNEQOQHQTOCFGEQODCVGTCOCKQTCOGCC
da fase contracionista do ciclo econmico o desemprego. Alm disso, nessas
EKTEWPUVPEKCUQQWVTQEQORQPGPVGFCRQNVKECUECNCVTKDWVCQUQDTGQUHCVQTGU
FGRTQFWQFGXGTKCUGTKORNGOGPVCFQPQUGPVKFQFCTGFWQFCECTICVTKDWVTKC
Ambas as polticas estimulam a demanda agregada e evitam o aumento generalizado
do desemprego.
0QSWGRGTVKPGPVGRQNVKECUECNPCGVCRCEQPVTCEKQPKUVCFQEKENQGEQPOKEQ
VCNEQODKPCQFGOGPQTVTKDWVCQEQOOCKQTFGURGUCRDNKECEQPVTKDWKRCTCC
QEQTTPEKCFGFEKVUECNPCUEQPVCUFQIQXGTPQ&GCEQTFQEQO2GTGKTC

R   -G[PGU RTQRWPJC C WVKNK\CQ FC RQNVKEC UECN EQORGPUCVTKC PC SWCN
RTGICXCQCWOGPVQFQFEKVRDNKEQGORQECUFGTGEGUUQ#KPFCUGIWPFQQ
OGUOQCWVQT-G[PGUCFXQICXCSWGSWCPFQQEQTTGUUGKPUWEKPEKCFGFGOCPFC
Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

203

Danielle Sandi Pinheiro/Carlos Frederico Rubino P. de Alverga/Juliana Sandi Pinheiro

o governo deveria assumir um papel ativo de complementar os gastos privados, ou


reduzindo impostos ou realizando investimentos (PEREIRA, 2006, p. 51).
#RQNVKECUECNGZRCPUKQPKUVCPCHCUGFGEQPVTCQFCRTQFWQFQGORTGIQGFC
renda da economia como remdio para a crise tambm considerada por Vieira e
%CORQU
R SWGCTOCOSWGQUICUVQUEQOQDTCURDNKECUEQPVTKDWKTKCO
RCTCOWNVKRNKECTCTGPFCIGTCPFQGORTGIQURCTCCNIWPUETKCTUGKCOKPFKTGVCOGPVG
GORTGIQURCTCWOCITCPFGRCTEGNCFCRQRWNCQ
Acerca do assunto, Galbraith (1972, p. 232) escreve que hoje amplamente aceito
SWGPQECUQFGRTQEWTCKPUWEKGPVGGFGRTGUUQUGLCOTGFW\KFQUQUKORQUVQUGCU
FGURGUCURDNKECUCWOGPVCFCUCOFGCWOGPVCTCRTQEWTCCITGICFC#KPFCUQDTG
esse tema, Galbraith (1989, p. 240) informa:
#FGCQGQFGUGORTGIQGZKIGOOCKUICUVQURDNKEQUGOGPQUKORQUVQU
CODCUOGFKFCURQNKVKECOGPVGOWKVQCITCFXGKU#KPCQFQURTGQURQT
QWVTQNCFQGZKIGCTGFWQFQUICUVQURDNKEQUGQCWOGPVQFQUKORQUVQU
coisas pouqussimo agradveis politicamente.

Segundo os economistas, um incremento dos gastos do governo aumenta mais a


TGPFCFGGSWKNDTKQFCGEQPQOKCFQSWGWOCTGFWQFCVTKDWVCQUGPFQGUUCU
medidas cabveis na etapa contracionista do ciclo econmico.
No caso da depresso econmica, de que maneira poderia o aumento do investimento
FQIQXGTPQKPWGPEKCTPQCWOGPVQFCTGPFCFCGEQPQOKC!4GURQPFGPFQCGUUC
KPFCICQ-G[PGUFGUEQDTKWQGNGOGPVQSWGFGPQOKPQWFGGHGKVQOWNVKRNKECFQTRGNQ
qual um aumento do investimento causaria um aumento da renda correspondente
a (k = 1/s vezes o aumento do investimento), sendo k o multiplicador e s
a propenso marginal a poupar da economia.
No contexto de uma recesso econmica e do exerccio pelo governo de uma poltica
UECNGZRCPUKQPKUVCQOWNVKRNKECFQTCUUKOGZRNKECFQRQT5KPIGT
R 
As compras adicionais do governo proporcionam receitas adicionais s
empresas vendedoras, que as usam para pagar matrias-primas e salrios e
FKUVTKDWKTNWETQUQUCIGPVGUSWGQDVOGUVCUTGPFCUCFKEKQPCKUWUCOCQOGPQU
RCTVG FGNCU RCTC EQORTCT DGPU FG RTQFWQ
CU GORTGUCU  G FG EQPUWOQ
(os indivduos). Estas novas compras do lugar a novas receitas e ainda a novas
compras, etc. Este o mecanismo do multiplicador da demanda.

4GVQTPCPFQSWGUVQFCFGRTGUUQGEQPOKECCRQNVKECUECNGZRCPUKQPKUVCEQPVTCC
FGRTGUUQRQFGPQUGTPGEGUUCTKCOGPVGFGEKVTKCPGOQDTKICVQTKCOGPVGTGFWPFCT
GOGNGXCQFCFXKFCRDNKEC+UUQRQTSWGEQOCTGEWRGTCQFCCVKXKFCFGGEQPOKEC
haver aumento da receita tributria do governo, que pode at vir a ser igual ou
maior do que o gasto pblico adicional inicial, podendo resultar em equilbrio ou
UWRGTXKVGPQGOFEKVUECN
204

Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

Polticas keynesianas anticclicas no Brasil: estabilizao e desenvolvimento econmico

#OGPEKQPCFCRQNVKECUECNEQPVTCCFGRTGUUQEQOKPETGOGPVQFQUICUVQURDNKEQU
FGXGUGTEWUVGCFCPCPEKCFCRQTGPFKXKFCOGPVQFQIQXGTPQEQOQUDCPEQUQWUGLC
por incremento da dvida pblica e no por tributos pagos pelos cidados. No caso
de o governo tentar prevenir uma recesso, segundo Afonso (2010), a expanso dos
ICUVQURDNKEQURQFGTKCUGTPCPEKCFCRGNQUVTKDWVQURCIQURGNQUEKFCFQU
#NO FQ OWNVKRNKECFQT QWVTC PQXKFCFG FC VGQTKC MG[PGUKCPC HQK Q 2TKPERKQ FC
&GOCPFC'HGVKXCUGIWPFQQSWCNCQHGTVCCITGICFCFCGEQPQOKCFCFCZCPQEWTVQ
prazo, e o que determina efetivamente a renda da economia a demanda, a qual
RQFGUGTGZRTGUUCRGNCHTOWNC;% + )6 :/
CTGPFCFCGEQPQOKC
KIWCNUQOCFQEQPUWOQEQOQKPXGUVKOGPVQQICUVQFQIQXGTPQGCUGZRQTVCGU
UWDVTCFCFQVQVCNFQUVTKDWVQUEQOCUKORQTVCGU #UITCPFGUPQXKFCFGUFCVGQTKC
MG[PGUKCPCEKVCFCURQT%CTFKO
R HQTCOVGQTKCFQEQPUWOQVGQTKCFQ
OWNVKRNKECFQTRCRGNFCKPEGTVG\CPCFKPOKECFGWOCGEQPQOKCOQPGVTKC
-G[PGU VGXG WOC RGTEGRQ RKQPGKTC PQ UGPVKFQ FG EQPENWKT SWG Q 'UVCFQ RQT
OGKQFCVTKDWVCQGFQUUGWURTRTKQUFKURPFKQU
RQNVKECUECN GRQTKPVGTOFKQ
FQEQPVTQNGUQDTGCQHGTVCFGOQGFCRQTOGKQFCOCPKRWNCQFCVCZCFGLWTQU
(poltica monetria), poderia atuar diretamente sobre as variveis independentes do
modelo (a PMC, a taxa de juros e a EMC) e, dessa forma, atingir, indiretamente, as
variveis dependentes (os nveis de investimento, o emprego e a renda da economia)
para tentar corrigir os desequilbrios entre a oferta e a demanda agregadas da
GEQPQOKCRTKPEKRCKUECWUCUFQUFQKURTQDNGOCUGEQPOKEQUOCKUITCXGUCKPCQ
e o desemprego.
1UCLWUVGUGHGVWCFQURGNQ'UVCFQPQRQFGOUGTTGCNK\CFQURGNCNKXTGCQFCUHQTCU
FGOGTECFQ1WVTCPQXKFCFGFCVGQTKCMG[PGUKCPCHQKCFKXKUQFCENCUUKECQFQ
QTCOGPVQRDNKEQGPVTGEQTTGPVGGFGECRKVCN2CTC-G[PGUQQTCOGPVQEQTTGPVG
FQIQXGTPQFGXGGUVCTRGTOCPGPVGOGPVGGSWKNKDTCFQQSWGRQFGGUVCTFGEKVTKQQW
UWRGTCXKVTKQFGCEQTFQEQOCHCUGFQEKENQGEQPOKEQQQTCOGPVQFGECRKVCN
EWLCHWPQUGTXKTFGTGIWNCFQTFCFGOCPFCCITGICFCFGCEQTFQEQOCUWVWCGU
da atividade econmica.
1QTCOGPVQEQTTGPVGFGUVKPCFQOCPWVGPQGCQEWUVGKQFCUCVKXKFCFGUQTFKPTKCU
FQIQXGTPQDGOEQOQRTQFWQFGDGPURDNKEQU
FGHGUCPCEKQPCNUGIWTCPC
RDNKECCFOKPKUVTCQFCLWUVKCGVE GFGDGPUUGOKRDNKEQUQWOGTKVTKQU
UCFG
GFWECQEWNVWTCGVE %CTXCNJQ
R GZRNKECSWGQSWG-G[PGUDWUEC
CQRTQRQTCGNCDQTCQFGFQKUQTCOGPVQUCUGRCTCQGPVTGQEWORTKOGPVQFCU
HWPGUTQVKPGKTCUFQ'UVCFQ=?GQEWORTKOGPVQFGUWCUHWPGUCPVKEENKECU
2GNC CTIWOGPVCQ GZRQUVC RQFGUG EQPENWKT SWG C KPVGTXGPQ FQ 'UVCFQ PC
GEQPQOKCFGOGTECFQECRKVCNKUVCRTQRWIPCFCRQT-G[PGUPQPQUGPVKFQFGQ
'UVCFQCVWCTPQUKUVGOCGEQPOKEQEQOQRTQFWVQTFKTGVQFGDGPUGUGTXKQUQWUGLC
como Estado empresrio, proprietrio e administrador de empresas produtoras
FGDGPUGUGTXKQUGUKOEQOQTGIWNCFQTFQKPXGUVKOGPVQOGFKCPVGQGZGTEEKQFCU
Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

205

Danielle Sandi Pinheiro/Carlos Frederico Rubino P. de Alverga/Juliana Sandi Pinheiro

RQNVKECUUECNGOQPGVTKCEQOCPCNKFCFGFGVGPVCTEQORCVKDKNK\CTCFGOCPFC
agregada com a oferta agregada, atenuando os problemas mais graves que ocorrem
PQUKUVGOCECRKVCNKUVCQWUGLCCKPCQGQFGUGORTGIQ%CUQQ'UVCFQPGINKIGPEKG
Q FGUGORGPJQ FC UWC HWPQ TGIWNCFQTC G GUVCDKNK\CFQTC FQ UKUVGOC GEQPOKEQ
ECRKVCNKUVCPQGZGTEGPFQFGOCPGKTCCRTQRTKCFCCURQNVKECUUECNGOQPGVTKC
antes mencionadas, as consequncias sero deletrias para a sociedade, assim como
CEQPVGEGWPCETKUGGEQPOKEQPCPEGKTCQEQTTKFCGOSWGVGXGUGWUGHGKVQU
nefastos propagados para as principais economias do mundo capitalista.
%QTTQDQTCPFQGUUCCPNKUG%CTFKO
R KPHQTOCSWGCKPVGTXGPQFKTGVC

FQ'UVCFQ RQTVCPVQGUUGPEKCNOGPVGGUVTCPJCCQRGPUCOGPVQFG-G[PGU=?
Seu programa de poltica econmica certamente nada tem a ver com iniciativas
CORNCUFGGUVCVK\CQQWPCEKQPCNK\CQFGGORTGUCU2QTUWCXG\#HQPUQ

R KPHQTOCEKVCPFQQRTRTKQ-G[PGUSWGCHQTOCFGKPVGTXGPQFQ'UVCFQ
na economia preconizada pelo economista ingls consiste em o governo exercer
WOCKPWPEKCQTKGPVCFQTCUQDTGCRTQRGPUQCEQPUWOKTGORCTVGCVTCXUFGUGW
UKUVGOCFGVTKDWVCQGORCTVGRQTOGKQFCZCQFCVCZCFGLWTQU
1WVTQVRKEQTGNGXCPVGFCFQWVTKPCMG[PGUKCPCCUQEKCNK\CQFQKPXGUVKOGPVQ
2QFGUG EQPUKFGTCT SWG C CNWFKFC UQEKCNK\CQ RTQRQUVC RQT -G[PGU UGIWPFQ
Afonso (2012, p. 61), citando Dillard (1989), corresponde ao controle pblico
FQKPXGUVKOGPVQRTKXCFQRCTCEQORGPUCTGTGFW\KTCGPXGTICFWTCFCUWVWCGU
FCGEKPEKCOCTIKPCNFQECRKVCNGWOCCWVQTKFCFGOQPGVTKCHQTVGRCTCTGIWNCTC
oferta de dinheiro e diminuir a taxa de juros. Alm desse trecho, Afonso (2010,
p. 61) tambm informa, novamente mencionando Dillard (1986), que a referida
UQEKCNK\CQFQKPXGUVKOGPVQUGTKCWOCRQNVKECFGTGIWNCQFQKPXGUVKOGPVQ
EQOQQDLGVKXQFGPGWVTCNK\CTCUWVWCGUEENKECUFQKPXGUVKOGPVQRTKXCFQ
2QT O ECDG FGUVCECT WO KORQTVCPVG CURGEVQ FC VGQTKC MG[PGUKCPC NGXCPVCFQ
RQT#HQPUQ
 GSWGEQPUVKVWKWOCKPVGTRTGVCQGSWKXQECFCFQURQUVWNCFQU
MG[PGUKCPQU Q LW\Q FG SWG -G[PGU FGHGPFG C RQNVKEC UECN GZRCPUKQPKUVC G Q
incremento dos gastos pblicos em qualquer circunstncia ou conjuntura econmica.
Sobre o assunto, o referido autor escreve:
2CTC-G[PGUCRQNVKECUECNFGXGCUUWOKTRCRKUFKXGTUQUGOEQPLWPVWTCU
diferentes, ao contrrio do senso comum que supe que o economista defendeu
uma expanso permanente do gasto pblico em qualquer contexto. Tal receita
GTCTGEQOGPFCFCRCTCWOCUKVWCQDCUVCPVGGURGEECQ'UVCFQVGPFQSWG
assumir o comando da deciso de investir e de fomentar a demanda efetiva,
FGRQKU SWG C GEQPQOKC VKXGUUG GPVTCFQ GO EQNCRUQ G EQOQ TGCQ  ETKUG
(AFONSO, 2010, p. 2-3).

Em outro trecho o autor supracitado faz referncia ao mesmo assunto:


'PVGPFGUGSWG-G[PGUPQRTGIQWWOCWOGPVQFQICUVQRDNKEQRGTOCPGPVG
ou no longo prazo como muitos vieram a interpretar a partir de sua obra.
206

Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

Polticas keynesianas anticclicas no Brasil: estabilizao e desenvolvimento econmico

EQTTGVQUKOCVTKDWKTCGNGQKFGCNFGWOCRQNVKECUECNCPVKEENKECGOSWG
acumula supervits na fase de expanso do ciclo, para ampliar o gasto na fase
da depresso (AFONSO, 2010, p. 6).

%QTTQDQTCPFQCCTIWOGPVCQFG#HQPUQ#NXGUG8GTUUKOQ
R CTOCO
SWGQQTCOGPVQRDNKEQFGXGUGTFGEKVTKQSWCPFQCGEQPQOKCGUVGOTGVTCQ
e superavitrio, em perodos de expanso, funcionando, por conseguinte, como um
estabilizador automtico de demanda. Vasconcelos e Garcia (2010, p. 164) tambm
TCVKECOQSWGGUETGXG#HQPUQCTOCPFQSWGGODQTCQCTECDQWQVGTKEQETKCFQ
RQT-G[PGUGUVGLCDCUGCFQGOWOCUKVWCQFGFGUGORTGIQGNGRQFGUGTCRNKECFQ
mutatis mutandiRCTCWOCEQPLWPVWTCKPCEKQPTKC#EGTECFGUUGCUUWPVQ(GKL

R VGEGCUUGIWKPVGUEQPUKFGTCGU
-G[PGUHQKCEWUCFQFGVGTEQOUWCUKFGKCUKPFW\KFQQURQNVKEQUCRTCVKECTGO
polticas excessivamente expansionistas que resultaram no desastre nos
CPQU  &K\KCO SWG -G[PGU PQ QHGTGEGW WO KPUVTWOGPVQ CPCNVKEQ RCTC
NKFCTEQOQRTQDNGOCFCKPCQGVGTKCFGURTG\CFQGUUCSWGUVQ%QPVWFQ
XKOQU SWG GO UGW NVKOQ GPUCKQ %QOQ RCICT RGNC IWGTTC -G[PGU HC\
FKXGTUCUTGUGTXCUSWCPVQCQWUQFGUGWKPUVTWOGPVCNCPCNVKEQGOEQPFKGU
RQVGPEKCNOGPVGKPCEKQPTKCUGQHGTGEGPCQECUKQWOVTCVCOGPVQRCTCQVGOC

Dessa forma, pode-se concluir que, de acordo com a fase do ciclo econmico, o
ECTVGTFCRQNVKECUECNXCKXCTKCTPCHCUGTGEGUUKXCFQEKENQUGTGZRCPUKQPKUVCRCTC
auxiliar a economia a sair da recesso, por meio do incremento dos dispndios do
IQXGTPQGFCTGFWQFCVTKDWVCQUQDTGQEQPUWOQGQKPXGUVKOGPVQRTKXCFQUQSWG
vai aumentar o investimento, o nvel de emprego e a renda. Essa foi a caracterstica
SWGEQWOCKUHCOQUCQWRQRWNCTFQTGEGKVWTKQMG[PGUKCPQ/CUGUVGNVKOQPQUG
restringe a esse argumento, tanto que na fase expansiva do ciclo ocorrer o oposto:
CRQNVKECUECNUGTEQPVTCEKQPKUVCEQOTGFWQFQUICUVQURDNKEQUGCWOGPVQFC
VTKDWVCQUQDTGQEQPUWOQGQKPXGUVKOGPVQRTKXCFQURCTCEQODCVGTCCOGCCFG
CNVCIGPGTCNK\CFCFQURTGQUCKPCQCSWCNRQFGQEQTTGTPCGVCRCFGGZRCPUQ
do ciclo econmico.
%QTTQDQTCPFQ GUUG RQUKEKQPCOGPVQ )CNDTCKVJ G 5CNKPIGT
 R   CTOCO
SWGRCTC-G[PGURCTCGXKVCTSWGQURTGQUUWDCORTGEKUQTGUVTKPIKTQUICUVQU
governamentais, aumentar os impostos e reduzir os gastos privados. Os mesmos
CWVQTGU CUUGXGTCO SWG UG Q RTQDNGOC FC GEQPQOKC HQT C KPCQ CWOGPVCUG C
VTKDWVCQ G FKOKPWGOUG CU FGURGUCU FQ IQXGTPQ
)#.$4#+6* 5#.+0)'4
1980, p. 92). Foi exatamente isso que ocorreu no incio do mandato de Dilma
Roussef, em fevereiro de 2011, quando o governo brasileiro anunciou um corte no
QTCOGPVQPQOQPVCPVGFG4DKNJGU0QVCUGKPXCTKCXGNOGPVGSWGCUOGFKFCU
CRNKECFCURGNQ'UVCFQFGXGONGXCTGOEQPUKFGTCQVCPVQCURGEVQUEQPEGTPGPVGUU
metas de longo prazo referentes ao plano de governo quanto polticas econmicas
conjunturais para fazer frente a eventuais choques adversos da economia, como
QEQTTGWPCETKUGPCPEGKTCKPVGTPCEKQPCNFG
Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

207

Danielle Sandi Pinheiro/Carlos Frederico Rubino P. de Alverga/Juliana Sandi Pinheiro

4 PANORAMA DA ECONOMIA BRASILEIRA1


O contexto econmico brasileiro no perodo anterior crise internacional de 2008
HQKHQTVGOGPVGOCTECFQRQTHCVQUQEQTTKFQUPQRCUGOG#QPCNFG
2002, a dvida lquida do setor pblico chegou a 56% do PIB, o que remetia ao
temor de uma eventual moratria. Com efeito, em seu ltimo ano de governo, o
presidente Fernando Henrique Cardoso negociou uma extenso do acordo com o
(/+EQOQEQORTQOKUUQFGIGTCQFGUWRGTXKVRTKOTKQFGFQ2+$PQ
prximo perodo.
Assim, ao tomar posse em 2003, o presidente Lula deparou-se com problemas
TGNCVKXQUCQCWOGPVQFCFXKFCNSWKFCHQTVGFGRTGEKCQECODKCN
EWLQXCNQTFQ
FNCT EJGIQW C CVKPIKT CRTQZKOCFCOGPVG 4   KPCQ GNGXCFC G TKUEQRCU
superior a 2.000 pontos. As polticas econmicas aplicadas orientaram-se para
EQODCVGTCCOGCCKPCEKQPTKCTGFW\KTQGPFKXKFCOGPVQRDNKEQGTGEWRGTCTC
EQPCDKNKFCFGGZVGTPC
Nesse sentido, o governo aumentou, em junho, a taxa de juros nominal (Selic) para
CQCPQGTGXKUQWUWCUOGVCUFGKPCQ
EQODCUGPQ+2%# RCTCGO
2003 e 5,5% em 2004. Alm disso, elevou de 3,75% para 4,25% do PIB a meta de
supervit primrio durante todo o perodo de governo. Essas medidas resultaram
PCTGEWRGTCQFCEQPCPCGZVGTPCGPCUEQPUGSWGPVGUSWGFCUPCEQVCQFQFNCT
e do risco-pas. Com isso foi possvel retomar a trajetria de queda da taxa de juros
a partir de meados de 2003.
O desempenho da economia brasileira em 2004 esteve associado s medidas de
poltica econmica aplicadas em 2003. No que se refere poltica monetria, seu
objetivo fundamental norteou-se por manter os ganhos em termos da estabilidade
FGRTGQU&GUUCOCPGKTCCRCTVKTFGUGVGODTQCRQNVKECFGTGFWQFCVCZCFGLWTQU
PQOKPCNHQKTGXGTVKFCCRNKECPFQUGWOCGUVTCVIKCFGGNGXCQITCFWCN&GCEQTFQ
EQOCRGTEGRQFQIQXGTPQGUUCRQNVKECOQPGVTKCOCKUTGUVTKVKXCLWUVKECXCUG
porque a expanso registrada na atividade econmica no tenderia espontaneamente
a acomodar-se em ritmo de preenchimento do hiato do produto compatvel com a
EQPXGTIPEKCFCKPCQRCTCUWCVTCLGVTKCFGOGVCU
%QOTGNCQRQNVKECUECNGVTKDWVTKCCUOGFKFCUCRNKECFCUQDLGVKXCTCOFGOQFQ
IGTCNGUVKOWNCTCTGCNK\CQFGPQXQUKPXGUVKOGPVQUGOUGVQTGUGUVTCVIKEQUCO
de promover o crescimento sustentado da atividade econmica. As medidas foram
FKXKFKFCUGOSWCVTQITWRQUC OGFKFCUFGUVKPCFCUFGUQPGTCQFQUKPXGUVKOGPVQU
GCQGUVOWNQFCRQWRCPCFGNQPIQRTC\QD OGFKFCUFKTGEKQPCFCUTGFWQFQ
EWUVQFQKPXGUVKOGPVQGFCCSWKUKQFQUDGPUFGECRKVCNE OGFKFCUXQNVCFCURCTCC
FGUQPGTCQFGUGVQTGUGURGEEQUFCCVKXKFCFGGEQPOKECXKUCPFQCTGFW\KTCECTIC
1 Ser enfatizada neste tpico uma sntese das principais polticas econmicas aplicadas pelo governo, cujas fontes
FGRGUSWKUCUQTGHGTGPVGUURWDNKECGUFQ$CPEQ%GPVTCN

208

Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

Polticas keynesianas anticclicas no Brasil: estabilizao e desenvolvimento econmico

UECNUQDTGCNKOGPVQUGRTQFWVQUCITEQNCUF OGFKFCUFGUVKPCFCUKORNGOGPVCQFG
TGITCUTGNCEKQPCFCUEQOQOGTECFQFCEQPUVTWQEKXKNGEQOQUPQXQUKPUVTWOGPVQU
FGETFKVQGUGEWTKVK\CQ
'O  GXKFGPEKQWUG KPKEKCNOGPVG WOC EQPVKPWKFCFG PC EQPFWQ FC RQNVKEC
OQPGVTKC # GXQNWQ FC VCZC FG LWTQU TGGVKW FQKU FKHGTGPVGU OQOGPVQU PC
RTKOGKTCOGVCFGFQCPQHQKOCPVKFCCVTCLGVTKCFGGNGXCQITCFWCNFCVCZCFGLWTQU
COFGCFGSWCTQTKVOQFGGZRCPUQFCFGOCPFCOGVCCPWCNRCTCCKPCQ
Assim, em maio, a taxa de juros nominal atingiu 19,75% ao ano.
Tendo-se em vista a perspectiva de cenrios interno e externo favorveis, a Selic foi
mantida no mesmo patamar entre os meses de junho a agosto. Em setembro teve
KPEKQWOCRQNVKECOQPGVTKCOCKUGZRCPUKXCGOXKTVWFGFCRGTEGRQFGSWGC
KPCQGUVCTKCEQPVTQNCFCFGPVTQFCOGVC'OFG\GODTQCVCZCFGLWTQUVGTOKPQW
em 18%. Embora o PIB no tenha tido um crescimento to expressivo quanto aquele
FQ CPQ CPVGTKQT Q TKUEQRCU VGXG UWEGUUKXCU TGFWGU Q SWG CLWFQW C KORCEVCT
RQUKVKXCOGPVGCTGEWRGTCQFQUKPXGUVKOGPVQUPQRCU#RQNVKECUECNEQPVKPWQW
a ser conduzida de maneira austera com o intuito de manter a sustentabilidade da
dvida pblica. A meta de supervit primrio foi cumprida.
'O  C GXQNWQ FC GEQPQOKC DTCUKNGKTC HQK KORWNUKQPCFC RGNQ RTQEGUUQ FG
EQPUQNKFCQFQOGTECFQKPVGTPQGRGNCEQPVKPWKFCFGFCGZRCPUQFCGEQPQOKC
OWPFKCN +PVGTPCOGPVG Q FKPCOKUOQ GEQPOKEQ QEQTTGW GO TC\Q FC GNGXCQ
da renda real e da melhora das expectativas. A poltica monetria foi conduzida de
HQTOCCWUVGTCEQOXKUVCUCCUUGIWTCTCOCPWVGPQFCGUVCDKNKFCFGFGRTGQU2QTO
PQFGEQTTGTFQCPQJQWXGWOCOCKQTGZKDKNK\CQFCVCZCFGLWTQU#RQNVKEC
UECNEQPVKPWQWCUGTQTKGPVCFCRQTUWEGUUKXQUUWRGTXKVURTKOTKQUGTGFWQFC
GZRQUKQFCUEQPVCURDNKECU2QTEQPUGIWKPVGHQKOCPVKFCCVTCLGVTKCFGENKPCPVG
FCTGNCQFXKFC2+$GJQWXGOGNJQTCPQRGTNFCFXKFCNSWKFCFQUGVQTRDNKEQ
EQOCTGFWQFCUWCXQNCVKNKFCFGGCCORNKCQFQURTC\QUFGXGPEKOGPVQ
O desempenho do comrcio exterior foi o principal determinante do saldo positivo
em conta corrente. As polticas aplicadas ao setor externo visavam a aumentar a
resistncia da economia brasileira a eventuais choques externos. Nesse sentido, o
estoque de reservas internacionais foi acrescido e atingiu nveis recordes, o que foi
importante para enfrentar a crise de 2008. A dvida externa pblica permaneceu em
VTCLGVTKCFGTGFWQGOGNJQTKCFGRGTNGCRGTURGEVKXCFGOGNJQTKCFQUratings
atribudos pelas agncias de risco continuou.
'OCRQNVKECOQPGVTKCEQPVKPWQWUGPFQOQFGTCFCOGPVGGZKDKNK\CFCRCTC
HC\GTHTGPVGCWOEGPTKQFGCEGNGTCQFGRTGQUQDUGTXCFQGO0QFGEQTTGT
FQCPQTGFWGUPCVCZCFGLWTQUPQTVGCTCOUGRGNCRGTEGRQRQUVGTKQTFGSWG
CCNVCFQURTGQUGTCFGEQTTGPVGFGHCVQTGUGUUGPEKCNOGPVGVTCPUKVTKQU2QTKUUQ
apesar do ambiente externo apresentar um cenrio de menor liquidez e aumento da
volatilidade dos mercados globais na segunda metade do ano, o Comit de Poltica
Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

209

Danielle Sandi Pinheiro/Carlos Frederico Rubino P. de Alverga/Juliana Sandi Pinheiro

/QPGVTKC
%QRQO DTCUKNGKTQEQPUKFGTQWSWGCGXQNWQTGEGPVGFCKPCQGO
RCVCOCTEQPUKUVGPVGEQOCUOGVCUGTCEQPFK\GPVGEQOOCKQTGUTGFWGUPCVCZC
de juros. Assim, a partir de setembro deste ano a taxa de juros foi estabelecida em
11,25% ao ano, valor bem abaixo da taxa de 13% tomada como meta no incio do ano.
#RQNVKECOQPGVTKCHQKQTKGPVCFCFGHQTOCSWGCKPCQUGOCPVKXGUUGFGPVTQFCU
metas estabelecidas. Isso tambm permitiu que o pas absorvesse de forma suavizada
CUVWTDWNPEKCUFQOGTECFQPCPEGKTQKPVGTPCEKQPCNKPKEKCFCUCRCTVKTFGOGCFQU
de 2007, e contribuiu para que o aumento do dinamismo da demanda interna
PQUGFGVGTKQTCUUGGOTGURQUVCCWOCODKGPVGFGGNGXCQCEGPVWCFCFQURTGQU
CITEQNCU0GUUGCODKGPVGFGOCPWVGPQFQUICPJQUFGEQTTGPVGUFCGUVCDKNKFCFG
OCETQGEQPOKECGFGCFOKPKUVTCQCWUVGTCFCUEQPVCURDNKECUQFKPCOKUOQFC
demanda interna e externa assegurou um crescimento da economia brasileira em
0GUUGCPQVCODOHQTCOQDUGTXCFCUOGNJQTGUEQPFKGUFGETFKVQRCTCCU
famlias e para o setor privado, com impactos positivos sobre o mercado de trabalho.
Em 2008, o desempenho da atividade econmica internacional passou a ser afetado
de maneira mais acentuada pelos desdobramentos da crise no mercado subprime dos
EUA. Nesse sentido, para fazer frente a um cenrio global marcado por escassez
de crdito e indcios de crise sistmica, o governo brasileiro decidiu interromper a
trajetria de aumento dos juros praticada no incio do ano e passou a praticar uma
RQNVKECOQPGVTKCOCKUGZXGNZCPFQCVCZCFGLWTQUGOCQCPQPQPCN
do perodo.
A economia brasileira, aps ter apresentado um cenrio de expanso do consumo e
do investimento na maior parte do ano, passou a evidenciar no segundo trimestre
QUKORCEVQUFQCEKTTCOGPVQFCETKUGPCPEGKTCKPVGTPCEKQPCN'UUGUKORCEVQUHQTCO
sentidos fortemente no crdito e nas expectativas dos agentes. Portanto, nesse
PQXQEGPTKQFGTGFWQFQPXGNFCCVKXKFCFGGEQPOKECCURTKPEKRCKURQNVKECU
contracclicas aplicadas na rea monetria se direcionaram para a expanso do
ETFKVQEQOQQDLGVKXQFGICTCPVKTCUGZRQTVCGUGCNKSWKFG\PQOGTECFQRQTOGKQ
FGGORTUVKOQURGNQ$CPEQ%GPVTCNGOOQGFCGUVTCPIGKTCGRCTCCNKDGTCQFG
TGEWTUQUEQOCPCNKFCFGFGTGIWNCTK\CTCNKSWKFG\FQUKUVGOCPCPEGKTQPCEKQPCNG
incentivar o crescimento dos emprstimos.
#U OGFKFCU UECKU EQPEGPVTCTCOUG DCUKECOGPVG PC TGFWQ FG KORQUVQU G PQ
aumento dos gastos pblicos, em especial os gastos com investimentos em
infraestrutura. Com efeito, o PIB brasileiro terminou o ano com crescimento
de 5,1%, e a demanda interna continuou a sustentar o crescimento da atividade
GEQPOKECEQOTGEWRGTCQFQGORTGIQGFCTGPFC#VCZCFGFGUGORTGIQOFKC
anual situou-se em um patamar de 7,8%.
'OQCEKTTCOGPVQFQEGPTKQTGEGUUKXQPQUOGTECFQUPCPEGKTQUFGOCPFQW
OGFKFCUCFKEKQPCKUPCUGUHGTCUOQPGVTKCUECNGECODKCNRGNQIQXGTPQDTCUKNGKTQ
Basicamente, o objetivo das polticas econmicas adotadas consistia em oferecer
210

Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

Polticas keynesianas anticclicas no Brasil: estabilizao e desenvolvimento econmico

OGNJQTGUEQPFKGUFGNKSWKFG\KPVGTPCGRTQRQTEKQPCTGUVOWNQUFGOCPFCCITGICFC
SWGHCXQTGEGUUGOCTGVQOCFCFQETGUEKOGPVQ#RQNVKECOQPGVTKCHQKGZKDKNK\CFC
RQTOGKQFGUWEGUUKXQUEQTVGUPCVCZCFGLWTQUSWGVGTOKPQWRQTUGTZCFCGO
CQCPQ0CTGCUECNHQKOCPVKFCGCORNKCFCCRQNVKECFGTGFWQFGKORQUVQUUQDTG
produtos industrializados incidentes sobre eletrodomsticos, automveis, produtos
FCEQPUVTWQEKXKNOXGKUGDGPUFGECRKVCN'UUCUOGFKFCUXKUCXCOCCUUGIWTCTC
estabilidade relativa do nvel de emprego nesses segmentos intensivos em mo de
obra e fortalecer o dinamismo da demanda domstica.
'OQUOGTECFQUPCPEGKTQUKPVGTPCEKQPCKUTGIKUVTCTCOOGPQTXQNCVKNKFCFG
do que no ano anterior. Porm, presenciava-se um contexto de forte presso sobre
CUEQVCGUFCUcommodities agrcolas a partir do segundo semestre do ano, o que
KORCEVQWFKTGVCOGPVGQETGUEKOGPVQFCVCZCFGKPCQGQRTQEGUUQFGEQPFWQ
da poltica monetria. Nesse sentido, o Copom, aps manter a taxa de juros (Selic)
em 8,75% ao ano, terminou o perodo praticando uma poltica monetria mais
restritiva, com uma taxa de 10,75% ao ano. Adicionalmente, o governo adotou no
PCNFQCPQWOEQPLWPVQFGOGFKFCUFGPCVWTG\COCETQRTWFGPEKCNEQOQQDLGVKXQ
FG CRGTHGKQCT QU KPUVTWOGPVQU FG TGIWNCQ CUUGIWTCT C GUVCDKNKFCFG FQ UKUVGOC
PCPEGKTQPCEKQPCNGRGTOKVKTCEQPVKPWKFCFGFQFGUGPXQNXKOGPVQUWUVGPVXGNFQ
OGTECFQ FG ETFKVQ 'PVTG CU RTKPEKRCKU OGFKFCU GUVQ C GNGXCQ FQU FGRUKVQU
EQORWNUTKQU G FQ TGSWGTKOGPVQ FG ECRKVCN RCTC QRGTCGU FG ETFKVQ C RGUUQCU
fsicas com prazos superiores a 24 meses.
0Q UGVQT GZVGTPQ HQTCO CFQVCFCU RQNVKECU SWG QDLGVKXCTCO ETKCT EQPFKGU
HCXQTXGKU RCTC Q CWOGPVQ FC EQORGVKVKXKFCFG FCU GZRQTVCGU DTCUKNGKTCU
# EQPFWQ FC RQNVKEC ECODKCN HQK QTKGPVCFC RQT OGFKFCU SWG GXKVCUUGO SWG C
liquidez em moeda estrangeira resultasse em excessiva volatilidade e desequilbrios
no mercado de cmbio. Apesar das incertezas quanto efetiva melhora do cenrio
internacional, o processo de fortalecimento da economia brasileira traduziu-se em
um crescimento de 7,5% no ano.
#TGFWQFQPXGNFCCVKXKFCFGGEQPOKECCQNQPIQFGVCODOHQKEQORCVXGN
EQOCURQNVKECUGEQPOKECUCRNKECFCUFGUFGXKUCPFQCCLWUVCTCUEQPFKGUFG
liquidez interna e o descompasso entre a oferta e a demanda agregadas. Contudo, no
decorrer dos demais meses, ante um cenrio internacional cada vez mais restritivo e
devido aos recuos no nvel de capacidade instalada da economia, o Copom procedeu
a sucessivos cortes na taxa de juros, que chegou a 11% ao ano.
Assim, apesar do fraco desempenho da economia brasileira em 2011, a solidez
das contas externas brasileiras atenuou o impacto da volatilidade dos mercados
PCPEGKTQUKPVGTPCEKQPCKU&GUUGOQFQCEQPUKUVPEKCFCRQNVKECOCETQGEQPOKEC
DTCUKNGKTCDCUGCFCPQURKNCTGUOGVCUFGKPCQTGURQPUCDKNKFCFGUECNGEODKQ
WVWCPVGHQKEQPTOCFCRQTOGKQFCTGUKUVPEKCCQUEJQSWGUCFXGTUQUFGTKXCFQU
FCETKUGPCPEGKTCKPVGTPCEKQPCN
Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

211

Danielle Sandi Pinheiro/Carlos Frederico Rubino P. de Alverga/Juliana Sandi Pinheiro

Ao longo de 2012, o governo tem conduzido a poltica econmica com vistas a


incrementar o dinamismo do mercado interno ao mesmo tempo em que busca
FKXGTUKECTCRCWVCFGGZRQTVCGURCTCHC\GTHTGPVGCQEQPVGZVQTGEGUUKXQPQOGTECFQ
internacional, notadamente o europeu. A taxa de juros continuou a ser reduzida,
e na ltima reunio do Copom foi estabelecida em 7,14% ao ano. Os estmulos
UECKUVOUKFQEQPFW\KFQUEQOXKUVCUCCSWGEGTCFGOCPFCKPVGTPCRCTCGUVKOWNCT
o investimento.
Todavia, esses instrumentos de poltica econmica da forma como tm sido
conduzidos j esto evidenciando sinais de esgotamento, uma vez que o crescimento
do PIB no tem correspondido na mesma medida. O fraco desempenho da economia
DTCUKNGKTC PGUVG CPQ OQUVTC SWG UGT RTGEKUQ C CRNKECQ EQPEQOKVCPVG FG QWVTCU
polticas que visem a atacar problemas relativos competitividade. O atual governo
VGODWUECFQUQNWGURQTOGKQFGRNCPQUCNVGTPCVKXQUFGCGUVCKUEQOQQRNCPQFG
EQPEGUUGUPQUGVQTFGKPHTCGUVTWVWTCCTGFWQFQUEWUVQUFGRTQFWQFCKPFUVTKC
GCUFGUQPGTCGUFCHQNJCFGRCICOGPVQ
Observa-se que o governo considera em suas polticas no somente o uso dos
KPUVTWOGPVQUGUVCDKNK\CFQTGUFGEWTVQRTC\QOCUVCODOCCRNKECQEQPEQOKVCPVG
de medidas que visam a estimular e a dinamizar a economia na tentativa de
promover o desenvolvimento sustentvel de longo prazo. Mas uma questo que
ainda permanece se refere maneira de o Estado efetivamente intervir e estimular
CGEQPQOKCFCFCCUWCEQPEGRQGUVCDGNGEKFCGOUQEKGFCFG

5 ESTADO E SOCIEDADE NO PROCESSO


DE DESENVOLVIMENTO
1'UVCFQGOFGUGPXQNXKOGPVQECTGEGFGRQUUKDKNKFCFGUTGCKUFGKPQXCQGPSWCPVQ
isolado analiticamente da sociedade. O contrapeso de uma economia apoltica e
CUUQEKCNTGHQTCQEQPVTQNGRGNQOGTECFQGUGWUEKTEWKVQUFGCNKOGPVCQPCPEGKTC
perpetuando estados de subdesenvolvimento. Mas qual seria o papel do Estado
ento? H um papel estrito para o Estado?
Pensa-se em um Estado mediador, mas tambm gestor, regulador e interventor
SWCPFQQUEQPKVQUGCUFKUETGRPEKCUUQEKQGUVTWVWTCKUVCPVQPQODKVQFQOUVKEQ
quanto no domnio externo, assim o demandarem. Porm, no h uma frmula
homognea e hegemnica que represente um caminho linear que conduza
sociedades e Estados a padres mais elevados de desenvolvimento. As frmulas
WUWCKUEQPHQTOGTGUUCNVC*CTXG[
R UQOCTECFCURGNQFQOPKQ
espacial do mercado, que, balizado por um dispositivo sistmico de crises, garante e
perpetua a sucesso hegemnica e sua defesa disfuncional de interesses escusos, os
SWCKUEQORTQOGVGOQUEKTEWKVQURTQFWVKXQUGCUTGNCGUFGVTCDCNJQCQKPFW\KTGO
necessidades incompatveis e inconsistentes com a vida em sociedade e os recursos
provenientes da natureza.
212

Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

Polticas keynesianas anticclicas no Brasil: estabilizao e desenvolvimento econmico

'OQWVTCURCNCXTCUQFGUGPXQNXKOGPVQPQUGTGFW\VTCPUKQFGGEQPQOKCUFG
GUECNCRCTCGEQPQOKCUFGGUEQRQUGIWPFQCCEGRQGORTGICFCRQT*CTXG[

p. 155). Independentemente da frmula conceitual que empregam e dos pesos e das
OGFKFCUSWGFKUVTKDWGOGOTGNCQFKPOKECFQECRKVCNGFQVTCDCNJQEQOOCKQTQW
OGPQTRCTVKEKRCQFQ'UVCFQOCUUGORTGGOCUUGTQGRTGXCNPEKCFQUFKURQUKVKXQU
FG OGTECFQ RTQFWVKXQ G PCPEGKTQ VGQTKCU FG FGUGPXQNXKOGPVQ GEQPOKEQ
conforme nos lembra Willis (2005, p. 32-80) e de acordo com a perspectiva de
*CTXG[
R EQUVWOCOFKUVTKDWKTGURCEKCNOGPVGCFGUKIWCNFCFGRQT
meio do deslocamento residual dos sistemas produtivos, mas no dos seus ncleos
PCPEGKTQUFGEGPVTQUFGEKUTKQUGFKPOKEQUFQRTQITGUUQGEQPOKEQ
CEWOWNCQ
GZXGN  RCTC RGTKHGTKCU OGPQU FKPOKECU G UWDEQPVTCVCFCU PQ WUQ FC VGEPQNQIKC

HQTFKUOQ RGTKHTKEQ  HCEKNKVCPFQ ICPJQU GO GUECNC G C GZRNQTCQ FQU TGEWTUQU


naturais e do trabalho.
Romper com esses parmetros sistmicos de desigualdade e pobreza o grande
FGUCQ FQ 'UVCFQ EQOQ UQEKGFCFG PQ $TCUKN *KUVQTKECOGPVG C UQEKGFCFG G Q
Estado brasileiro padecem de crnicas vulnerabilidades estruturais associadas a uma
macroestrutura de poder cujos agentes centrais se mostram comprometidos com
GUVTCVIKCUFGFGUGPXQNXKOGPVQGFGKPUGTQKPVGTPCEKQPCNSWGEQPVTCFKVQTKCOGPVG
EQPVTKDWGO RCTC C RGTRGVWCQFG FGUKIWCNFCFGU UQEKQRQNVKECUG GEQPOKECUPQ
RCUITCCUCWOCEQODKPCQFGGUSWGOCUFGHQTCFGFGUCTVKEWNCQUQEKCNGFG
persuaso ideolgica. Essa a sntese dos argumentos do diplomata Samuel Pinheiro
Guimares no primeiro captulo do livro &GUCQUDTCUKNGKTQUPCGTCFQUIKICPVGU.
%QO DCUG PCU EQPEGRGU FG )WKOCTGU
   RQUUXGN CTIWOGPVCT SWG C
macroestrutura de poder, epifenmeno organizacional da sociedade brasileira que
encontra correspondncia na evolucionria sociedade internacional de matriz
europeia, estrutura-se em crculos concntricos de difuso centro-perifrica.
6CN CPCNQIKC GPEQPVTC TGURCNFQ PC EQPUVTWQ FQ UKUVGOC OWPFQ RTQRQUVC RQT
Wallerstein (2004) e nas ideias de expanso do capital como ideologia modernista
GZRTGUUCURQT*CTXG[
 6QFCXKC)WKOCTGU
 OCKUGZRNEKVQSWCPVQU
HWPGUFGEGPVTQGUTGURGEVKXCUXWNPGTCDKNKFCFGUUKUVOKECUUSWCKUCUUQEKGFCFGU
perifricas esto sujeitas.
Para o autor, as estratgias de desenvolvimento no Brasil, tradicionalmente, no
esto associadas aos anseios da sociedade como um todo, vinculando-se diretamente
CKPVGTGUUGUFGUGVQTGUFQOKPCPVGU
CITTKQKPFWUVTKCNPCPEGKTQTGNKIKQUQOKNKVCT
alm do legislativo, do judicirio e da alta burocracia). Tem-se, nesse contexto, um
RTQEGUUQFGTGRTQFWQFGFGUKIWCNFCFGUSWGTGUVTKPIGCRCTVKEKRCQFCUQEKGFCFG
civil aos canais decisrios dominados por agentes centrais.
%QPVWFQKORQTVCPVGTGCNCTSWGCTIWOGPVQUHWPFCOGPVCFQUGODCUGUFKEQVOKECU
EQOQGUVCQWUGLCSWGGPHQECOCUTGNCGUFGRQFGTGOWOCUQEKGFCFGUGIWPFQ
perspectivas antagonistas, por exemplo, quanto ao centro e periferia, ao Estado e
sociedade, ou mesmo quanto economia e poltica, tendem a legitimar as mesmas
Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

213

Danielle Sandi Pinheiro/Carlos Frederico Rubino P. de Alverga/Juliana Sandi Pinheiro

ECVGIQTKCUCPCNVKECUSWGRTQEWTCOEQPVGUVCT.QIQCRGUCTFGJCXGTGURCQRCTCQ
embate de vises estratgicas quanto gesto e ao desenvolvimento da sociedade
DTCUKNGKTCGFCUWCKPUGTQKPVGTPCEKQPCNJENCTCUNKOKVCGUSWCPVQRTQRQUKQ
FGEQPEGRGUCNVGTPCVKXCUSWGXGPJCOCHWPFCOGPVCTOWFCPCUGUVTWVWTCKUSWG
RTQOQXCOCNVGTCGUUKIPKECVKXCUPCOCETQGUVTWVWTCJGIGOPKECFGRQFGTGFG
seus agentes centrais.
Todavia, importante reconhecer que iniciativas administrativas do governo
brasileiro, principalmente em termos de polticas distributivas com forte apelo
social, de equilbrio macroeconmico e de investimento em infraestrutura, tm
GORTGGPFKFQ UGPUXGKU CNVGTCGU PQ RCFTQ GUVTWVWTCN FQ UWDFGUGPXQNXKOGPVQ
DTCUKNGKTQ 6TCVCUG FG WO RTQEGUUQ EQORNGZQ RQTSWG GPXQNXG C EQPUVTWQ G C
CNVGTCQFGOGPVCNKFCFGUCKPFCUWUEGVXGKUCQWVQRKUOQFQRTQITGUUQFKEQVOKEQ
de uma economia sem sociedade.
Entretanto, a sociedade civil organizada brasileira tambm vem desenvolvendo,
ao longo do tempo, um conjunto de tcnicas e metodologias transformadoras,
CRNKECFCU PC KPVGTCQ EQO C RQRWNCQ G CRTQRTKCFCU RQT GNC SWG TGRTGUGPVCO
CDWUECFGUQNWGURCTCCKPENWUQUQEKCNGCOGNJQTKCFCUEQPFKGUFGXKFCCU
chamadas tecnologias sociais. Essas tecnologias tambm se constituem em relevantes
instrumentos no processo de converso das vulnerabilidades estruturais da sociedade
brasileira em oportunidades para o desenvolvimento.

6 CONSIDERAES FINAIS
1CTVKIQFGFKECUGCCPCNKUCTEQOHWPFCOGPVQPCFQWVTKPCMG[PGUKCPCCHQTOC
pela qual foi conduzida a poltica econmica, principalmente as polticas monetria
GUECNFWTCPVGCIGUVQFQGZRTGUKFGPVG.WNCGPVTGQUCPQUFGCPQU
RGTQFQURTGRUETKUGPCPEGKTCFGGPQKPEKQFCCFOKPKUVTCQFG&KNOC
Roussef, nos anos de 2011 e 2012. Pelo fato de as bases conceituais e tericas das
OQFGTPCURQNVKECUUECNGOQPGVTKCUGHWPFCOGPVCTGOPQRGPUCOGPVQGEQPOKEQ
MG[PGUKCPQCPVGUFCCPNKUGGORTKECFQEQORQTVCOGPVQFCGEQPQOKCGFCRQNVKEC
GEQPOKECRTQEGFGWUGCWOCUPVGUGFQURTKPEKRCKUCURGEVQUFCFQWVTKPCFG-G[PGU
# ECTCEVGTUVKEC KPQXCFQTC FQ KFGTKQ MG[PGUKCPQ HQK FG SWG C KPVGTXGPQ FQ
'UVCFQ PC GEQPQOKC RQT OGKQ FQ FGUGORGPJQ FCU RQNVKECU UECN G OQPGVTKC
poderia amortecer e atenuar as consequncias da ocorrncia dos ciclos de expanso
GEQPVTCQFCRTQFWQGFCQHGTVCDCUKECOGPVGRQTOGKQFQEQPVTQNGFCFGOCPFC
CITGICFCGHGVKXC2CTVKPFQUGFQRTGUUWRQUVQVGTKEQFGSWGCQHGTVCZCPQEWTVQ
prazo e de que a demanda que determina a renda de equilbrio da economia

RTKPERKQFCFGOCPFCGHGVKXC Q'UVCFQRQFGRQTOGKQFCVTKDWVCQGFQUUGWU
RTRTKQUFKURPFKQUSWGUQQUGNGOGPVQUKPVGITCPVGUFCRQNVKECUECNKPWGPEKCT
positivamente o consumo, estimulando, assim, o incremento do investimento, que
CXCTKXGNOCKUKORQTVCPVGFQOQFGNQMG[PGUKCPQ0QSWGUGTGHGTGCQKPXGUVKOGPVQ
214

Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

Polticas keynesianas anticclicas no Brasil: estabilizao e desenvolvimento econmico

CNOFCURTRTKCUKPVGTXGPGUGOVGTOQUFGKPXGUVKOGPVQUFKTGVQUQWRCTEGTKCU
RDNKEQRTKXCFCURTQOQXKFCURGNQIQXGTPQCKPWPEKCFQ'UVCFQUGTKCGHGVKXCFC
tambm por meio do exerccio da poltica monetria, incidindo diretamente sobre a
taxa de juros, um dos principais determinantes do investimento, conforme abordado
PCUGQFQCTVKIQ
0C UGQ  HQK CPCNKUCFC C RQNVKEC UECN GZRCPUKQPKUVC FG EWPJQ MG[PGUKCPQ
RTCVKECFCRGNQIQXGTPQDTCUKNGKTQGOTGURQUVCETKUGPCPEGKTCFGSWGFGRQKU
UGVTCPUHQTOQWGOGEQPOKECGUGOCVGTKCNK\QWRGNCGHGVKXCQFGFGUQPGTCGU
VTKDWVTKCUGCEQPEGUUQFGKPEGPVKXQUUECKUGPQRGNCTGCNK\CQFGICUVQRDNKEQ
direto. Essa poltica foi bem-sucedida em 2010, quando a economia brasileira cresceu
FGRQKUFGWOCTGVTCQFGGO#RUWOCDTGXGUPVGUGCEGTECFQ
KFGTKQMG[PGUKCPQCRTGUGPVCFCPCUGQCKORQTVPEKCFCURQNVKECUMG[PGUKCPCU
CPVKEENKECU HQK FGUVCECFC PC UGQ  PC SWCN UG TGCNK\QW WO GZCOG GORTKEQ FQ
comportamento das polticas econmicas no perodo entre 2003 e 2012.
2QTOPCUGQHQKCDQTFCFCCSWGUVQFQFGUGPXQNXKOGPVQGEQPOKEQ(QKHGKVC
WOCETVKECUVGQTKCUSWGRTKXKNGIKCOQOGTECFQGOUGWUGIOGPVQPCPEGKTQEWLQU
ncleos no so deslocados espacial e territorialmente, ao contrrio do segmento
produtivo, que tem seus ncleos transferidos para a periferia do capitalismo na busca
FGTGFWQFQUEWUVQUFGRTQFWQ2QUVGTKQTOGPVGDCUGCFCPCQDTCFG)WKOCTGU
(2005), foram abordadas as estratgias de desenvolvimento econmico aplicadas no
$TCUKNXKPEWNCFCUPQUPGEGUUKFCFGUFCOCKQTKCFCRQRWNCQDTCUKNGKTCOCUUKO
CQUKPVGTGUUGUGUEQPXGPKPEKCUFCUGNKVGUFQUXCTKCFQUUGVQTGU
CITTKQPCPEGKTQ
religioso, burocrtico, etc.).
Considerando-se os problemas estruturais vinculados a nossa matriz de
desenvolvimento, as medidas de polticas econmicas e estratgias de crescimento
NGXCFCU C ECDQ RGNQ 'UVCFQ FGUFG C GUVCDKNK\CQ FC GEQPQOKC GHGVKXCOGPVG
CNECPCFCEQOQ2NCPQ4GCNGOVOEQPFW\KFQQRCUCWOPQXQRCVCOCTFG
SWCNKFCFGFGXKFC'UUCUOGFKFCUVOCECTTGVCFQWOCGZRTGUUKXCTGFKUVTKDWKQFC
renda nacional em prol dos setores menos aquinhoados da sociedade brasileira, a
OCPWVGPQFQGSWKNDTKQOCETQGEQPOKEQDCUGCFQPQVTKRFCUOGVCUFGKPCQ
TGURQPUCDKNKFCFG UECN G EODKQ WVWCPVG DGO EQOQ C DWUEC FC OGNJQTKC FCU
EQPFKGUFGKPHTCGUVTWVWTCFQRCU,WPVCOGPVGEQOCRCTVKEKRCQFCUQEKGFCFG
civil organizada por meio das tecnologias sociais, os ganhos oriundos da estabilidade
e do crescimento econmico tm o potencial de efetivamente atingir no futuro as
ECOCFCUOCKUECTGPVGUFCRQRWNCQDTCUKNGKTC

Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

215

Danielle Sandi Pinheiro/Carlos Frederico Rubino P. de Alverga/Juliana Sandi Pinheiro

REFERNCIAS
AFONSO, J-G[PGUInvestimento e poltica fiscal na crise. Trabalho apresentado
PQ+++'PEQPVTQFC#UUQEKCQ-G[PGUKCPC$TCUKNGKTC5Q2CWNQ
______. Keynes, crise e poltica fiscal. So Paulo: Saraiva, 2012.
#.8'568'455+/1/2QNVKECOQPGVTKCETKUGPCPEGKTCG'UVCFQWOC
CDQTFCIGOMG[PGUKCPCRevista Perspectiva Econmica, So Leopoldo, v. 6, n. 1,
p. 16-36, jan./jun. 2010.
BANCO CENTRAL DO BRASIL (BACEN). Boletim do Banco Central do
Brasil. Relatrio anual. Diversos volumes. Disponvel em: <http://www.bcb.
gov.br/?id=BOLETIMANO&ano=2011>. Acesso em: 11/2012.
%#48#.*1(%CTFKOFG'SWKNDTKQUECNGRQNVKECGEQPOKECMG[PGUKCPC
Revista Anlise Econmica, Porto Alegre, ano 26, n. 50, p. 7-25, set. 2008.
DILLARD, D. A teoria econmica de John Maynard Keynes. So Paulo: Livraria
Pioneira Editora, 1989.
FEIJ, R. Histria do pensamento econmico. So Paulo: Atlas, 2007.
FERRARI FILHO($+66'5(As polticas fiscal e monetria em Keynes:
reflexes para a economia brasileira no perodo ps-Plano Real. Trabalho
CRTGUGPVCFQPQ+++'PEQPVTQFC#UUQEKCQ-G[PGUKCPC$TCUKNGKTC5Q2CWNQ
)#.$4#+6*,5#.+0)'40A economia ao alcance de quase todos. So
Paulo: Livraria Pioneira Editora, 1980.
GALBRAITH, J. A sociedade afluente. Rio de Janeiro: Expresso e Cultura, 1972.
______. O pensamento econmico em perspectiva: uma histria crtica. So Paulo:
Livraria Pioneira Editora, 1989.
GUIMARES, S. P. Desafios brasileiros na era dos gigantes. Rio de Janeiro:
Contraponto, 2005. p. 15-71.
HARVEY, D. The condition of post modernity: CPGPSWKT[KPVQVJGQTKIKPUQH
cultural change. Cambridge: Blackwell, 1989. p. 141-172.
LEFTWICH, A. States of underdevelopment. In: LEFTWICH, Adrian. States
of developmentQPVJGRTKOCE[QHRQNKVKEUKPFGXGNQROGPV%CODTKFIG2QNKV[
Press, 2000. p. 71-104.
PEREIRA, J. Finanas pblicas C RQNVKEC QTCOGPVTKC PQ $TCUKN 5Q 2CWNQ
Atlas, 2006.
SINGER, P. O que economia. So Paulo: Brasiliense, 1996.
216

Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

Polticas keynesianas anticclicas no Brasil: estabilizao e desenvolvimento econmico

8#5%10%'.15 / )#4%+# / Fundamentos de economia. So Paulo:


Saraiva, 2010.
8+'+4#(+.*1(%#/2156#PNKUGFCUVGQTKCUMG[PGUKCPCUEQOPHCUGPQ
seu direcionamento para o atual contexto socioeconmico e jurdico mundial. Jus
Navigandi, Teresina, ano 12, n. 1281, 3 jan. 2007. Disponvel em: <http://jus.
uol.com.br/revista/texto/9355>. Acesso em: 13/12/2010.
WALLERSTEIN, I. The development of the concept of development. Sociological
Theory, v. 2, p. 102-116, 1984.
______. World system analysis: an introduction. Durham/London: Duke
7PKXGTUKV[2TGUU
WATSON, A. The evolution of international society: a comparative historical
CPCN[UKU.QPFTGU4QWVNGFIG
9+..+5 - Theories and practices of development. Oxon: Routledge, 2005.
p. 32-80.

Cad. Fin. Pbl., Braslia, n. 12, p. 197-217, dez. 2012

217

Simplificao e elaborao da legislao tributria infralegal:


notas sobre o acesso ao direito vigente e a gesto da elaborao
legislativa pelo Executivo
Fabiana de Menezes Soares
Professora Associada da Faculdade de Direito
da UFMG. Coordenadora do grupo de pesquisa
Observatrio para Qualidade da Lei
Doutora em Direito pela UFMG. Bolsista PQ1 do
CNPq Desenvolvimento Tecnolgico-Industrial

A coero, com seu imanente apelo ao


medo, tambm um convite a que a
sociedade dos homens, ao invs de ser
livre e feliz, se torne uma imensa e
sombria colnia de eunucos e escravos.
Que a abdicao da liberdade importe
alvio verdade e compreensvel.
O exerccio da autodeterminao
constitui, ao mesmo tempo, grandeza
e dor, crescimento e pena, morte e
ressurreio do ser humano. Quem
pois se recusa a liberdade, no padece a
angstia de decidir. Ao preo, porm,
de no crescer, de continuar sempre
menor, de um modo ou de outro, por
preguia ou covardia, como lembrava
Kant h quase duzentos anos.
Joo Baptista Villela.
Direito, coero e responsabilidade:
por uma ordem social no violenta.

Resumo
O sistema normativo da Receita Federal brasileira
definido como um sistema de mltiplas fontes de
direito, grande quantidade de atos normativos,
disposies normativas, contidas em tipos de atos
classificados, em tese, como atos administrativos
e/ou ordinatrios. Nesse cenrio, com tantos
impactos sobre o contribuinte e na prpria atividade
cotidiana da administrao pblica, faz-se necessrio
um diagnstico inicial que evidencie a necessidade de
uma poltica de boa legislao/regulao destinada
aos setores responsveis pela elaborao legislativa

CSWKEQORTGGPFKFCEQOQCVKXKFCFG PQ'ZGEWVKXQ
A questo ganha singular importncia no caso
da Receita Federal, marcada pela incidncia do
princpio da legalidade em sua vertente forte, em

face de sua elevada fora cogente, o que intensifica


a necessidade de uma ao legislativa dirigida
simplificao da sua tipologia de atos, que, por sua
vez, repercutir em outras perspectivas do sistema.
A vigncia da lei de acesso informao aponta para
um novo paradigma comunicativo no que se refere
s informaes jurdicas, notadamente aquelas que
atingem a conduta dos sujeitos e so veiculadas por
meio de atos provenientes do exerccio da atividade
de administrao fazendria, condio primeira
para o acesso ao direito vigente.

Palavras-chave
Simplificao de tipologia de atos normativos da
gesto da elaborao legislativa. Hierarquia dos atos
normativos. Otimizao da informao jurdica.
Melhoria na interao com o cidado.

Abstract
The system of regulation of the Brazilian Federal
Revenue Service is based on multiple sources and
a great number of normative acts, which are
contained in theoretically executive measures
and rulings. Within this environment, which has
such strong impact on the taxpayers and also on the
operations of Public Administration we have to
analyze the need for policies of Better legislation
and regulation directed towards the responsible
branches of government. This is even more
important in the case of the Revenue Service where
the principle of legality applies even more stringently
due to its strong coercive powers; the stronger is
the demand for legislative action to simplify the
typology of acts which will also strongly impact other
sectors of the system. The legal effect of the Access to
Information Act points to a new understanding
QHEQOOWPKECVKQP
D[VJG2WDNKE#FOKPKUVTCVKQP 
concerning juridical information. Much more so
in the case of measures that impact the behavior of
taxpayers and are published by the proper revenue
administration as a first condition for complying
with this law into force.

Keywords
Simplification of the typology of normative acts
executive lawmaking. Hierarchy of normative
acts. Optimization of juridical information.
Improvement of interaction with the taxpayers.

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

219

Fabiana de Menezes Soares

1 INTRODUO: POR QUE NECESSITAMOS INOVAR


NA GESTO DE ELABORAO DE ATOS NORMATIVOS
Este trabalho decorrncia de projeto de pesquisa desenvolvido pela Dired/Esaf
)TWRQFG2GUSWKUCGO(KPCPCU2DNKECUEWLQQDLGVKXQIGTCNHQTVCNGEGTC
capacidade de desenvolver pessoas e o objetivo estratgico fomentar e disseminar
estudos e pesquisas. Foi realizada pesquisa de campo1PC&KXKUQFG5KUVGOCVK\CQ
G&KHWUQFG0QTOCU
&KUKU %QQTFGPCQ)GTCNFG6TKDWVCQ
%QUKV /KPKUVTKQ
FC(C\GPFCRCTCTGEQPUVTWQFCECFGKCFGHQPVGUGOUGFGFGGNCDQTCQNGIKUNCVKXC
e compreenso da estrutura organizacional da Receita Federal do Brasil.
O Ministrio da Fazenda um dos mais antigos da Repblica, conforme pode ser
depreendido do art. 1o da Lei n. 23 de 30 de outubro de 1891, que reorganizou os
UGTXKQUFCCFOKPKUVTCQHGFGTCN%QOQWOFQUTIQUKPVGITCPVGUFCGUVTWVWTC
do Ministrio da Fazenda, acha-se a Secretaria da Receita Federal do Brasil (SRF),
que responde pelo recorte metodolgico deste estudo: o foco dirigido gesto da
GNCDQTCQNGIKUNCVKXCRGNQ'ZGEWVKXQ
&GPVTGUWCUEQORGVPEKCUUCNKGPVCOQUCKPVGTRTGVCQCCRNKECQGCGNCDQTCQ
FGRTQRQUVCURCTCQCRGTHGKQCOGPVQFCNGIKUNCQVTKDWVTKCGCFWCPGKTCHGFGTCNGC
KPVGTCQEQOQEKFCFQRQTOGKQFQUFKXGTUQUECPCKUFGCVGPFKOGPVQRTGUGPEKCNG
CFKUVPEKC
&GETGVQPEQOCUOQFKECGUFQ&GETGVQP 
Tais competncias, expressas via atos normativos, so interpretadas e tm seu alcance
FGPKFQRGNCCTVKEWNCQEQOQWVTQUCVQUPQTOCVKXQUGURGEKCNOGPVGC.GKFG#EGUUQ
+PHQTOCQ
.GKP 
#EQORTGGPUQFQFKTGKVQXKIGPVGCEGTVG\CUQDTGCECFGKCFGTGXQICGU
UQDTGVWFQ
CSWGNCUKORNEKVCU CKFGPVKECQFGEQPVGFQPQTOCVKXQXGKEWNCFQGOVKRQUFGCVQU
SWGGOVGUGUGTKCOCVQUCFOKPKUVTCVKXQUCNOFCUEQPFKGUFGTGEQPUVTWQFC
ECFGKCFGHQPVGUFGWOFCFQVGOC
JKGTCTSWKC VWFQKUUQTGURQPFGRGNCUGIWTCPC
jurdica.
A seguir encontra-se o Mapa Estratgico da Receita Federal do Brasil 2012-2015,
RQFGPFQUGQDUGTXCTEQOQGUVGUGCEJCCPCFQEQOCUNKPJCUFGWOCDQCIGUVQFC
GNCDQTCQNGIKUNCVKXC

1 Nossos sinceros agradecimentos auditora Cleusa Magalhes, servidora de carreira, lotada na Disis/Cosit/RFB
por todo o auxlio e materiais fornecidos na pesquisa de campo.

220

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

Fonte: Site da Receita Federal do Brasil

1 FKTGKVQ PC UWC FKOGPUQ UKODNKEC FG HQTC


EQGTQ  TGEGDG UQD Q KPWZQ
FC EQOWPKECQ VRKEC FC VGEPQNQIKC FC KPHQTOCQ WOC EQPQVCQ FKXGTUC SWG
CVKPIGVCODOQURTQEGUUQUFGGNCDQTCQNGIKUNCVKXCPQUGPVKFQFGRTQRKEKCTWO
conhecimento real do direito no plano da realidade. Tal perspectiva, por sua vez,
GZKIGFCCFOKPKUVTCQRDNKECCGUFGUKORNKECQCRVCUCIGTCTECPCKUFGKPVGTCQ
com a sociedade2PQUSWCKUCUKPHQTOCGULWTFKECURQUUCOPQUUGTCEGUUCFCUEQO
HCEKNKFCFGOCUEWLCHQTCXKPEWNCPVGFQUCVQUPQTOCVKXQU
JKGTCTSWKC UGLCCRTGGPFKFC
UGOWOPQVXGNGUHQTQRCTCTGEQPUVTWQFCECFGKCFGHQPVGU
A imagem da Receita Federal como o leo pronto a morder e a atacar o
EQPVTKDWKPVG PGEGUUKVC UGT TGRGPUCFC G CPCFC EQO QU PQXQU VGORQU GO HCEG
KPENWUKXGFCJQTK\QPVCNKFCFGSWGQIQXGTPQGNGVTPKEQRTQRKEKCPCUUWCUTGNCGU
com os cidados.
Em pases com uma cultura consolidada de accountability, como o Canad, nico
pas das Amricas forjado sob a gide de dois sistemas jurdicos (direito continental/
civil law/droi civil e direito consuetudinrio/common law) e, portanto, com singular
XKXPEKCGOUGFGFGEKTEWNCQFGOQFGNQULWTFKEQUCFQVCUGEQOQslogan institucional
FCCFOKPKUVTCQHGFGTCNServing canadians, ou Servindo aos canadenses.
 #ECFGKCFGXCNQTFC4GEGKVC(GFGTCNFQ$TCUKNGZRTGUUCPQUKVGKPENWKCKPVGTCQEQOCUQEKGFCFGUGIWTCPC
LWTFKECGUQNWQFGNKVIKQUCFOKPKUVTCQCFWCPGKTCHKUECNK\CQGEQODCVGCKNEKVQUVTKDWVTKQUGCFWCPGKTQU
CTTGECFCQGEQPVTQNGFGETFKVQVTKDWVTKQ#EGUUQGO

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

221

Fabiana de Menezes Soares

#Q NCFQ FC UKORNKECQ FC XCUVC VKRQNQIKC FG CVQU PQTOCVKXQU CGU EQOQ
EQPUQNKFCGU G CVQU TGXQECVTKQU RCTC OQFKHKECGU PQ GZRTGUUCU UQ WOC
PGEGUUKFCFGRCTCWOCRQNVKECGEKGPVGGOUGFGFGGNCDQTCQPQTOCVKXC
#FKURQUKQFGPQTOCUUQDTGRTQFWQFGCVQUPQTOCVKXQUXKCVKRQUFGCVQUSWG
GUVGLCOGOPXGKUOCKUGNGXCFQUFCJKGTCTSWKCWOCCQGEC\RCTCICTCPVKTC
GUVCDKNKFCFGGCKPVGTPCNK\CQRCWNCVKPCFGWOCEWNVWTCFGGNCDQTCQNGIKUNCVKXC
CUUGPVCFCUQDTGQURKNCTGUFQRNCPGLCOGPVQFCUKORNKECQFCEQPUQNKFCQGFC
CTVKEWNCQEQOCUFGOCKUHQPVGUFQFKTGKVQUQDTGCOCVTKC
%QPHQTOGQ5KUVGOCFG+PHQTOCGU,WTFKEQ6TKDWVTKCU
5KLWV GZKUVGOJQLG3
GOXKIQTCVQUGFKVCFQURGNC4GEGKVC(GFGTCNHTWVQFGCVKXKFCFGFGGNCDQTCQ
legislativa em franca expanso. Conforme a Portaria MF n. 203 de 14 de maio de
2012, que aprova o Regimento Interno da Secretaria da Receita Federal do Brasil,
CEQORGVPEKCFC%QQTFGPCQ)GTCNFG6TKDWVCQCEJCUGFKURQUVCPQCTV
+IGTGPEKCTCGNCDQTCQQCRGTHGKQCOGPVQCOQFKECQCTGIWNCOGPVCQ
C EQPUQNKFCQ C UKORNKECQ G C FKUUGOKPCQ FC NGIKUNCQ VTKDWVTKC
CFWCPGKTCGEQTTGNCVC
++KPVGTRTGVCTCNGIKUNCQVTKDWVTKCCFWCPGKTCGEQTTGNCVCCURTQRQUVCUFG
acordos e convnios internacionais e as normas complementares necessrias
UWCGZGEWQGGNCDQTCTCVQUPQTOCVKXQUFGQTKGPVCQGWPKHQTOK\CQFG
RTQEGFKOGPVQ
+++FGEKFKTRTQEGUUQUFGEQPUWNVCFGKPVGTRTGVCQFCNGIKUNCQVTKDWVTKC
CFWCPGKTCGEQTTGNCVCGTGEWTUQUFGFKXGTIPEKCUGORTQEGUUQFGEQPUWNVC
+8CUUGUUQTCTQUWDUGETGVTKQFG6TKDWVCQG%QPVGPEKQUQPCPQTOCVK\CQ
GO OCVTKC VTKDWVTKC G HQTPGEGT UWDUFKQU  HQTOWNCQ G  CXCNKCQ FC
RQNVKECVTKDWVTKC
8CPCNKUCTRTQLGVQUFGGOGPFCU%QPUVKVWKQRTQLGVQUFGNGKGOGFKFCU
provisrias, em todas as fases do processo legislativo, bem como minutas
de decretos e outros atos complementares de iniciativa de rgos do Poder
'ZGEWVKXQ
8+CPCNKUCTCURTQRQUKGUGQUGUVWFQUFGPCVWTG\CVTKDWVTKCCFWCPGKTCG
EQTTGNCVCCRTGUGPVCFQURQTGPVKFCFGUIQXGTPCOGPVCKUUQEKCKUGGORTGUCTKCKUG
8++OCPKHGUVCTUGUQDTGRTQRQUVCFGCVTKDWKQFGGHGKVQXKPEWNCPVGUOWNC
FQ%QPUGNJQ#FOKPKUVTCVKXQFG4GEWTUQU(KUECKU%CTHGOCTVKEWNCQEQO
a Cocaj.

A seu turno, a competncia da Disis no mbito da Receita Federal do Brasil a


seguinte (art. 89):
I elaborar, propor e manter atualizado manual que disponha sobre normas
FGRCFTQPK\CQRCTCGFKQFGCVQUPQODKVQFC4($
++  TGXKUCT G RTQRQT CFGSWCQ FCU RTQRQUVCU FG CVQU NGICKU G KPHTCNGICKU
elaborados na Cosit e nas demais Unidades Centrais da RFB, quanto aos
CURGEVQUFGEQPUVKVWEKQPCNKFCFGNGICNKFCFGGDQCVEPKECNGIKUNCVKXC
3 Disponvel em: <sijut2.receita.fazenda.gov.br>. Acesso em: 24/01/2013.

222

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

+++RTQOQXGTCFKUUGOKPCQFCNGIKUNCQVTKDWVTKCCFWCPGKTCGEQTTGNCVC
GFCLWTKURTWFPEKCCFOKPKUVTCVKXCG
+8  TGSWKUKVCT GURGEKECT FQEWOGPVCT JQOQNQICT KORNCPVCT CXCNKCT G
OCPVGTUKUVGOCUFGKPHQTOCQ.

2QT KPVGTOFKQ FG WOC QTFGO FG UGTXKQ


15%QUKV  FG  FG OCTQ FG 
HQK FKUEKRNKPCFC C GNCDQTCQ FG CVQU SWG FGPUKEQW C .%  G Q &GETGVQ
PCQFKURQTUQDTGCTGFCQFQUCVQUGUWCFGPQOKPCQGPCNKFCFGU
Os atos objeto da referida OS foram:
 UQNWQFGEQPUWNVC
5% 
 UQNWQFGFKXGTIPEKC
5& 
 UQNWQFGEQPUWNVCKPVGTPC
5%+ 
 FGURCEJQFGEKUTKQ
&& 
 RCTGEGT
 PQVCCQLWFKEKCN
 KPHQTOCQGOCQLWFKEKCN
 PQVCVEPKEC
06 
 KPHQTOCQ
 PQVC
 PQVCFGGPECOKPJCOGPVQ
12. nota executiva.
2QT UWC XG\ XKC QTFGO FG UGTXKQ
15%QUKV P   FG  FG QWVWDTQ FG 
disciplina-se o encaminhamento de projetos de atos normativos de competncia
dos rgos do Poder Executivo Federal e de minutas de atos administrativos da
RFB para reviso pela Cosit.
#QTFGOFGUGTXKQPCSWCNKFCFGFGCVQSWGQEWRCCRGTKHGTKCFCVKRQNQIKCFGCVQU

NGKCUGJKGTCTSWKC UGTKCQCVQCFGSWCFQOCPVGPCFGWOCRQNVKECFGHQOGPVQ
EWNVWTCFGWOCGNCDQTCQNGIKUNCVKXCFGSWCNKFCFGSWGUGEQCFWPGEQOPQUUQVGORQ!
# HQTOWNCQ FG RTQRQUVCU FC NGIKUNCQ VTKDWVTKC
CVQU NGICKU G KPHTCNGICKU 
EQORTGGPFG C GNCDQTCQ Q CRGTHGKQCOGPVQ C OQFKECQ C TGIWNCOGPVCQ
CEQPUQNKFCQCUKORNKECQGCFKUUGOKPCQFCNGIKUNCQVTKDWVTKCCFWCPGKTCG
EQTTGNCVCVQFCUCVKXKFCFGUFGEQORGVPEKCFC%QUKV0CDWUECFQCRGTHGKQCOGPVQ
dos atos normativos, o Regimento Interno da RFB incluiu na estrutura interna da
%QUKVWOCWPKFCFGEQOCCVTKDWKQFGTGXKUCTGRTQRQTCCFGSWCQFCURTQRQUVCU
de atos legais e infralegais, elaborados na Cosit e nas demais Unidades Centrais da
RFB, quanto aos aspectos de constitucionalidade, legalidade e boa tcnica legislativa
C&KXKUQFG5KUVGOCVK\CQG&KUUGOKPCQFG0QTOCU
No contexto da boa tcnica legislativa, destacam-se os aspectos formais, que
EQPUKUVGOPCXGTKECQFCEQTTGVCKPFKECQFQQDLGVQGFQODKVQFGCRNKECQ
Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

223

Fabiana de Menezes Soares

FQCVQFGUWCGUVTWVWTCQFCTGOKUUQCPQTOCUVCPVQKPVGTPCU
FKURQUKVKXQUFC
OKPWVC  SWCPVQ GZVGTPCU
C QWVTQU CVQU  FCU ENWUWNCU FG XKIPEKC G TGXQICQ
FCCTVKEWNCQSWCPVQCCITWRCOGPVQUGCFGUFQDTCOGPVQUKPENWKPFQEQPIWTCQ
FGRIKPCGHQTOCVCQGFCTGFCQ
O Manual de redao e elaborao de atos administrativos da Receita Federal do
Brasil4 veio a lume em 2011 sem o devido cumprimento da publicidade, posto que
disponibilizado somente na intranet, apesar de determinar critrios de validade dos
CVQUTGIWNCFQUCQFKURQTUQDTGUGWRTQEGFKOGPVQFGGNCDQTCQGRQTVCPVQRCUUXGN
FG EQPVTQNG RQT CSWGNGU CHGVCFQU RGNCU UWCU FKURQUKGU 6QFCXKC Q Manual no
FGPGCJKGTCTSWKCFQUVKRQUFGCVQUSWGTGIWNCEQPKVCPFQEQOCUPQTOCUUQDTGC
GNCDQTCQFGCVQUPQTOCVKXQUSWGFKUEKRNKPCOCXCUVCVKRQNQIKCIGTGPEKCFCRGNC4($
H atos com enunciados5 de ato administrativo e contedos de atos normativos
secundrios, expresso do choque entre o tipo do ato e a parte dispositiva de cunho
PQTOCVKXQ #U RQTVCTKCU RQT GZGORNQ UQ ENCUUKECFCU RGNQ Manual como atos
ordinatrios.
7OGZGORNQFCFGUCTOQPKCGPVTGQVKRQFQCVQGUWCFKURQUKQGPEQPVTCFQPC
2QTVCTKC54(FGGOXKIQTSWGFKURGUQDTGCGFKQFGCVQUFGPCVWTG\C
tributria e aduaneira, de atos administrativos, os despachos e a correspondncia
na Secretaria da Receita Federal.
A referida portaria, no seu art. 2o, dispe sobre duas categorias de atos: tributrios e
CFWCPGKTQU
KPUVTWQPQTOCVKXCPQTOCFGGZGEWQCVQFGENCTCVTKQKPVGTRTGVCVKXQ
CVQFGENCTCVTKQGZGEWVKXQEKTEWNCTUQNWQFGEQPUWNVCUQNWQFGFKXGTIPEKC
FGEKUQ GCFOKPKUVTCVKXQU
RQTVCTKCCVQFGFGUVKPCQFGOGTECFQTKCUQTFGOFG
UGTXKQ #RTRTKC2QTVCTKCGOXKIQTFKUEKRNKPCFGHQTOCIGTCNQRTQEGFKOGPVQ
FGGNCDQTCQFGCVQUFGEQORGVPEKCFC4($FGPUKECC.GK%QORNGOGPVCTP
GUGUWDOGVGCQ&GETGVQPSWGFKUEKRNKPCCRTQFWQFGCVQU
legais e atos normativos secundrios de competncia do Executivo: seu contedo
normativo com repercusses sobre o juzo de validade dos atos regulados.
Por sua vez, a Portaria MF n. 203, de 14 de maio de 2012 (publicada no DOU de
EQOGEEKCFKHGTKFCRCTCFGLWNJQFG CRTQXCQ4GIKOGPVQ
 )TWRQFG6TCDCNJQFKUEKRNKPCFQRGNCU2QTVCTKCU4($PFGFGLCPGKTQFGGPFGFGOCTQ
de 2008.
5 7OFQEWOGPVQPQTOCVKXQ
HQPVGFQFKTGKVQ WOCITGICFQFGGPWPEKCFQUFQFKUEWTUQRTGUETKVKXQ&K\UGFKUEWTUQ
RTGUETKVKXQ
FKTGVKXQPQTOCVKXQRTGEGRVKXQQWEQOQQSWGKTCOQUEJCOCT QFKUEWTUQGORTGICFQRCTCOQFKHKECTQ
comportamento dos homens. Diz-se enunciado qualquer expresso lingustica sob a forma acabada. Considera-se
que o enunciado no coincide (necessariamente) com o isolado artigo de lei, ou com o isolado pargrafo. Um
artigo de lei ou um pargrafo seu pode muito bem ser constitudo, como acontece, frequentemente, por uma pluralidade
de enunciados=?1TC
 EJCOQFKURQUKQSWCNSWGTGPWPEKCFQSWGHCCRCTVGFQFQEWOGPVQPQTOCVKXQ
QWUGLCSWCNSWGTGPWPEKCFQFQFKUEWTUQFCUHQPVGU
 EJCOQPQTOCVQFQGPWPEKCFQSWGEQPUVKVWCUGPVKFQQW
UKIPKHKECFQCVTKDWFQ
RQTSWCNSWGTWO CWOCFKURQUKQQWHTCIOGPVQFGFKURQUKQ
QWCWOCEQODKPCQFG
disposies, ou a uma combinao de fragmentos de disposies). Em outros termos, pode-se tambm dizer assim:
CFKURQUKQ
RCTVGFG WOVGZVQCKPFCRQTUGTKPVGTRTGVCFQCPQTOC
RCTVGFG WOVGZVQKPVGTRTGVCFQ
(GUASTINI, 2005, p. 24-26). (grifo nosso)

224

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

+PVGTPQFC5GETGVCTKCFC4GEGKVC(GFGTCNFQ$TCUKNSWGFKURGUQDTGCGNCDQTCQ
dos atos de sua competncia.
O Sijut, ao elencar a tipologia de sua base de dados, distingue dois tipos de portaria:
portaria e portaria normativa.6 Entretanto, esses tipos no aparecem distintos na
VKRQNQIKCFGCVQUGNGPECFCGOPGPJWOFQUCVQUPQTOCVKXQUUQDTGRTQFWQFGCVQU
como vimos, aparecem esparsos, desarticulados do prprio Manual de redao e
elaborao de atos administrativos.
#RTRTKCDWUECRQTCVQUPQTOCVKXQUUQDTGGNCDQTCQPQUKUVGOC5KLWVXKCNGIKUNCQ
RQTCUUWPVQ
GNCDQTCQFGCVQU RTQRKEKQWCGZVTCQFQ&GETGVQP
e de duas portarias: Portaria SRF n. 1.206/2002 (revogada pela Portaria SRF n.1.364,
de 10 de novembro de 2004) e Portaria SRF n. 001, de 2 de janeiro 2001. A busca pelo
FKTGKVQXKIGPVGXKC5KLWVGZRTGUUCHCNJCUPCKPFGZCQFQUFQEWOGPVQUCUQTFGPU
FGUGTXKQUSWGEQPVOVGTOQUEQOQGNCDQTCQGFKQOGUOQRGUSWKUCFCU
RGNCFCVCFQCVQGQWRWDNKECQPQTGUWNVCOGOPGPJWOFQEWOGPVQ7
A discusso sobre a tipologia de atos normativos secundrios no foi enfrentada
e encontra-se desconforme aos ditames em prol da maior unidade e coerncia
FQUKUVGOCGFGXKFCEQOWPKECQFGKPHQTOCQLWTFKECSWGVTCPUKVCXKCCVQU
conforme a Lei Complementar n. 95/1998, o Decreto n. 4.176/2002 e a Lei de
#EGUUQ+PHQTOCQ
.GKP 

2 A GESTO DA LEGISLAO NO EXECUTIVO:


TENDNCIAS E TENSES
1 RNCPGLCOGPVQ FG RQNVKECU RDNKECU C RTGQEWRCQ EQO C accountability,
QKPETGOGPVQFGOQFKECGUQTICPK\CEKQPCKURCTCCDQCIQXGTPCPCTGHQTCTCO
Q CODKGPVG FC CVKXKFCFG FG NGIKUNCQ EQOQ ao no mundo contemporneo
(DELLEY, 2004, p. 101-143). Essa dimenso, no entanto, exigiu uma maior
TCEKQPCNK\CQPQRTQEGUUQFGGNCDQTCQNGIKUNCVKXCGCTGVQOCFCFGGUVWFQUUQDTGC
RTQFWQFQFKTGKVQGOVQFCUCUUWCUXGTVGPVGU.GIKUNCVKXQ'ZGEWVKXQG,WFKEKTKQ
O foco deste trabalho encontra-se na disciplina normativa, que expressa, por sua vez,
o modelo de gesto do Executivo ao criar atos normativos primrios (via iniciativa
RTKXCVKXCQWFGNGICQNGIKUNCVKXC GPQGZGTEEKQFGUGWRQFGTTGIWNCOGPVCTNGKCUG
atos normativos secundrios.
 IWKUC FG TGEQPUVTWQ FQ EGPTKQ NGIKUNCVKXQTGIWNCVTKQ DTCUKNGKTQ C CIGPFC
NGIKUNCVKXCCEJCUGVQOCFCRGNCCVWCQFQ'ZGEWVKXQCQEQPVTTKQFQ.GIKUNCVKXQ
6 ltimo acesso em 24/01/2013. Disponvel em: <http://sijut2.receita.fazenda.gov.br/sijut2consulta/consulta.
action>.
 $WUECGONGIKUNCQRQTCUUWPVQGNCDQTCQFGCVQU&KURQPXGNGOJVVRYYYTGEGKVCHC\GPFCIQX
br/Legislacao/LegisAssunto/ElaboracaoAtos.htm>.
 #UQTFGPUFGUGTXKQOGPEKQPCFCUGFKURQPKDKNK\CFCUPGUVGGUVWFQHQTCOQDVKFCUFKTGVCOGPVGPC&KUKU
15
%QUKVPFGFGQWVWDTQFG15%QUKVPFGFGOCTQFG 

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

225

Fabiana de Menezes Soares

que tem uma disciplina restrita no que se refere tipologia de atos normativos, sua
FGPKQEQORGVPEKCGJKGTCTSWKC1'ZGEWVKXQPQVCDKNK\CUGRGNCXCTKGFCFGFG
VKRQUFGCVQUPQTOCVKXQUOGUOQPCCFOKPKUVTCQFKTGVCEQOQUGTFGOQPUVTCFQ
A tipologia dos atos normativos do Executivo, que no obedece a um padro
uniforme, concede azo criatividade da autoridade competente. Todavia,
CCVKXKFCFGFGGNCDQTCQPQTOCVKXCFQ'ZGEWVKXQVGOQDVKFQOCKQTZKVQSWCPVQ
VTCPUHQTOCQFGRTQRQUKGUGOPQTOCULWTFKECUFQSWGCSWGNCGPEGVCFCRGNQ
Legislativo, conforme quadro a seguir:
O Executivo e o Legislativo na arena do Congresso Nacional:
quantitativo de proposies 2006 a 2012

Origem e
situao

Proposies
do Executivo

Medidas
Projetos
Propostas de
provisrias, leis
Projetos de leis
Decretos
de leis
emendas
(projetos de lei
complementares
legislativos Total
ordinrias
Constituio
de converso,
(PLC)
(PDC )
(PL)
(PEC)
projetos de lei)
278

Proposies
do Legislativo
(Cmara dos
Deputados e
Senado Federal)
Proposies
do Executivo
transformadas
em normas
jurdicas
Proposies
do Legislativo
transformadas
em normas
jurdicas

249

168

15

4.846

9.222

825

117

272

468

304

15.197

374

293

(QPVG%GPVTQFG&QEWOGPVCQG+PHQTOCQ
%GFK %QQTFGPCQFG4GNCEKQPCOGPVQ2GUSWKUCG+PHQTOCQ

%QTRK %OCTCFQU&GRWVCFQURQTOGKQFGUQNKEKVCQ.GKFG#EGUUQ+PHQTOCQ2TQVQEQNQP
#SWGFKURQPKDKNK\QWCNKUVCIGOFCURTQRQUKGUGOUGVGODTQFG&KURQPXGNGO
<http://www.relacoesinstitucionais.gov.br/acesso-a-informacao/institucional/assuntos_parl/propostas-de-emenda-a-constituicao-1, http://www.relacoesinstitucionais.gov.br/acesso-a-informacao/institucional/assuntos_parl/projetos-de-lei/>. Acesso em: 29/09/2012.
Notas:
*1UFGETGVQUNGIKUNCVKXQUUQCVQURTKXCVKXQUFQ%QPITGUUQ0CEKQPCNGOGKQRCTCUWUVCQFCGEEKCFGCVQUPQTOCVKXQUFQ2QFGT'ZGEWVKXQSWGGZQTDKVGOFQRQFGTTGIWNCOGPVCTQWFQUNKOKVGUFCFGNGICQNGIKUNCVKXC
CTV
inciso VI, e art. 49 da CRFB/1988).
** H discrepncia entre os nmeros apresentados pelo Executivo e pelo Legislativo. Quanto a este quantitativo
HQKEQPUKFGTCFCCKPHQTOCQFC%OCTCFQU&GRWVCFQU

226

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

#CVKXKFCFGFGGNCDQTCQNGIKUNCVKXCFQ'ZGEWVKXQCEJCUGGOHTCPEQETGUEKOGPVQ
QEWRCCRCWVCGUVTCVIKECFCUCGUIQXGTPCOGPVCKUGRQTVCPVQPGEGUUKVCFGWOC
CDQTFCIGOFGIGUVQEQORCVXGNEQOCPCVWTG\CFCCVKXKFCFGFGETKCQGFGPKQ
FQURCTOGVTQUFGNGICNKFCFG2CTCVCNPQUQOQFQFGIGUVQFCGNCDQTCQFGCVQU
PQTOCVKXQUFGXGUGTTGRGPUCFQGOCGUSWGCVKPLCOCGUVTWVWTCQHWPEKQPCOGPVQ
e os servidores dos rgos com competncia normativa.
A legstica discute a melhoria da compreenso do texto legal, visa a aproximar o
NGIKUNCFQTQWCCWVQTKFCFGTGURQPUXGNRGNCGFKQFQCVQPQTOCVKXQFQEKFCFQ
uma abordagem mais abrangente do que redigir um dado ato normativo, pois
UKIPKECEQPUKFGTCTQtexto, mas tambm o contexto de quem recebe a mensagem,
RQTVCPVQ Q VGTOQ OCKU CFGSWCFQ  GNCDQTCQ 8GLCOQU Q UGIWKPVG FKCITCOC
(MORAND, 1999, p. 45).
LEGSTICA FORMAL

Contexto

Emissor

Mensagem
emitida

Mensagem recebida

Receptor

Canal

Codicao

Cdigo
Emissor

Decodicao

Cdigo
Comum

Cdigo
Receptor

Fonte: MORAND (1999)

6CNUKVWCQQEWRCUKPIWNCTTGNGXQUQDTGVWFQSWCPFQUGVTCVCFGUKUVGOCPQTOCVKXQ
EQO ITCPFG HQTC EQIGPVG HQTVG KPVGTXGPQ PC NKDGTFCFG CNVC CVKXKFCFG FG
FGPUKECQPQTOCVKXCDCKZCCFGTPEKCCQUEQPVGFQUOQTCKU
EQOQQQUKUVGOCFG
direito penal, por exemplo), com forte contedo tcnico, caractersticas do sistema
PCPEGKTQVTKDWVTKQ'UUGEQPLWPVQFGECTCEVGTUVKECURQUKEKQPCQEQPVTKDWKPVGEQOQ
um destinatrio JKRQUUWEKGPVGGOHCEGFQGZVTCQTFKPTKQGUHQTQGOTGEQPUVTWKTC
cadeia de fontes para conhecimento do direito vigente.
Vale ressaltar que sob o ponto de vista do destinatrio JKRQUUWEKGPVG no h
FKHGTGPCGPVTGNGKUGCVQUPQTOCVKXQUUGEWPFTKQU#KFGPVKECQFCJKGTCTSWKC
RTKOGKTCOGPVGGPFGTGCFCCQUFGUVKPCVTKQUFQUCVQUPQTOCVKXQUKPEWODKFQUFC
Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

227

Fabiana de Menezes Soares

UWCGZGEWQPQECUQGORCWVCC4($'PVQCIGUVQPCNUVKECCEJCUGKODTKECFC
EQOCGUFGUKORNKECQSWGXKUGOOGNJQTKCPCFKHWUQFGCVQUPQTOCVKXQUG
PCUWCEQORTGGPUQ1GZEGUUQFGVKRQUFGCVQUPQTOCVKXQUCNOFGKPVGPUKECT
CFKEWNFCFGFGEQORTGGPUQGCEGUUQCQFKTGKVQXKIGPVGRQFGETKCTFKUVQTGUSWG
XQFGUFGCGZQTDKVPEKCFGEQORGVPEKCCVCKPQXCQPCQTFGONGICN8
#UUKO Q OQFGNQ FG RTQFWQ FQ FKTGKVQ
CVQU PQTOCVKXQU RTKOTKQU G
UGEWPFTKQU GOCODKGPVGRNCPGLCFQSWGNGXGGOEQPVCCEKTEWNCQGHGVKXC
G GEKGPVG FC KPHQTOCQ LWTFKEC KPVGITC C PQQ FC SWCNKFCFG FQU CVQU
PQTOCVKXQUGEQPECVGPCUGEQOWOCODKGPVGFGEQPCPCCUGTGUVCDGNGEKFQ
entre contribuinte e Receita Federal. Esse modelo de gesto de projetos de atos
PQTOCVKXQUGPEQPVTCGEQPCNGIKUNCQDTCUKNGKTCFGPQTOCUUQDTGRTQFWQ
de normas, como ser evidenciado.

#UFKUEWUUGUUQDTGCUNKICGUGPVTGCSWCNKFCFGFCNGKGQFGUGPXQNXKOGPVQGEQPOKEQ
GUQEKCNQEWRCOWONWICTGODNGOVKEQVCPVQPCUTGEQOGPFCGUFC1%&'CKPFC
na dcada de 1990: Improving the quality of laws and regulations: economic, legal and
managerial techniques (OECD/Sigma, 1994), quanto nos documentos produzidos
pela Unio Europeia, tal como Mandelkern Report (2001), bem como nos programas
Better Regulation (2001) e Better Lawmaking (2002).
0GUUGUGUVWFQUTGUVQWEQPVGORNCFCCKORQTVPEKCFQFGUGPXQNXKOGPVQFCUCGU
GO RTQN FC SWCNKFCFG FC NGIKUNCQ RQT OGKQ FG VEPKECU G KPUVTWOGPVQU RCTC C
EQPUGEWQFCJCTOQPK\CQFCEQPUQNKFCQGFCUKORNKECQNGIKUNCVKXCU0GUUG
particular, deve ser ressaltada a experincia de bijuridismo e bilinguismo canadenses

51#4'5R SWGEWNOKPQWRQTUGCPVGEKRCTNGIKUNCQOWNVKNPIWG
FC7PKQ'WTQRGKC
7' GKPETGOGPVQWCUCGULCSWKTGHGTGPEKCFCU'UUGCURGEVQ
assume singular importncia em face do protagonismo crescente do Brasil ao longo
FQUNVKOQUXKPVGCPQUGFCKPWPEKCFGOQFGNQULWTFKEQUKPVGTPCEKQPCKUUQDTGC
NGIKUNCQDTCUKNGKTCGOGURGEKCNPCUGCTCFCIGUVQRDNKEC
#NO FKUUQ EQOQ RCTVG FG WOC GUVTCVIKC GO RTQN FG OCKQT UKORNKHKECQ
JCTOQPK\CQGOGNJQTKCPCEQOWPKECQFCKPHQTOCQLWTFKEC
#UGTXKQFQU
ECPCFGPUGU XGKEWNCFCXKCVKRQNQIKCFGCVQUPQTOCVKXQUCCFOKPKUVTCQRDNKEC
canadense, elaborou o Manual de regulaco federal (CANADA, 2010-2011) nas
XGTUGUGONPIWCKPINGUCGNPIWCHTCPEGUC'UUCCQCRTGUGPVCUGCTVKEWNCFCCarta
de direitos dos contribuintes, como ser explicitado oportunamente.
0Q$TCUKNCKPUVKVWKQFQ2TQITCOCFG(QTVCNGEKOGPVQFC%CRCEKFCFG+PUVKVWEKQPCN
RCTC)GUVQGO4GIWNCQ
2TQ4GI VTQWZGWOPQXQGNGOGPVQFKUEWUUQCEGTEC
FCOGNJQTKCFCGNCDQTCQNGIKUNCVKXCRGNQ'ZGEWVKXQ%QPHQTOGQCTVo, o Comit
Gestor do Pro Reg composto pela Casa Civil, pelo Ministrio da Fazenda e pelo
Ministrio do Planejamento. Os principais objetivos do Pro Reg so:
 1UTGHNGZQUFCCWUPEKCFGUKORNKHKECQGOUKUVGOCUPQTOCVKXQUEQORNGZQUXKCKORCEVQPQ,WFKEKTKQHQTCO
objeto de projeto de pesquisa financiado pelo CNPq (InovaDefesa.ning.com) (SOARES, 2012, p. 383-410).

228

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo






OGNJQTKCFQUKUVGOCTGIWNCVTKQ
OGNJQTKCFCEQQTFGPCQGPVTGQUGPVGUSWGRCTVKEKRCOFQRTQLGVQTGIWNCVTKQ
OGECPKUOQUFGRTGUVCQFGEQPVCU
RCTVKEKRCQGOQPKVQTCOGPVQRGNCUQEKGFCFGEKXKNFCSWCNKFCFGFCTGIWNCQFG
mercados.

'UUC CQ NGIKUNCVKXC GO UGFG FG SWCNKFCFG FC GNCDQTCQ NGIKUNCVKXC CTVKEWNCUG
com a Lei Complementar n. 95/1998 e com o Decreto n. 4.176/2002 e sinaliza
WOOQXKOGPVQPCQTICPK\CQFCCFOKPKUVTCQRDNKECDTCUKNGKTCPQUGPVKFQFG
OQFGTPK\CTQCRCTCVQFGTGFCQGGNCDQTCQFGCVQUPQTOCVKXQU
'PVTGVCPVQCKPUVKVWKQFQ2TQ4GIGOGUOQUWCGHGVKXCEQPVTKDWKQRQTOGKQFC
KPVGTPCNK\CQFGDQCURTVKECUFGSWCNKFCFGFCNGIKUNCQPCGUVTWVWTCQTICPK\CEKQPCN
PC CFOKPKUVTCQ RDNKEC DTCUKNGKTC GUVQ NQPIG FG UGT KFGPVKECFCU QW OGUOQ
GZRTGUUCUGOCGUPQUGKQFQUTIQUTGURQPUXGKURGNCGNCDQTCQPQTOCVKXCPC
CFOKPKUVTCQFKTGVC
OKPKUVTKQU 
# KPUVKVWKQ FQ 2TQ 4GI TGURQPFG RGNQ CVGPFKOGPVQ C RTKQTKFCFGU UGVQTKCKU FQ
Banco Interamericano de Desenvolvimento (BID):
 RQNVKECUQEKCNRCTCGSWKFCFGGRTQFWVKXKFCFG
 KPHTCGUVTWVWTCRCTCEQORGVKVKXKFCFGGDGOGUVCTUQEKCN
 KPUVKVWKGURCTCQETGUEKOGPVQGQDGOGUVCTUQEKCN
 RTQVGQFQOGKQCODKGPVG
 TGURQUVCOWFCPCENKOVKEC
 CWOGPVQPCUGIWTCPCCNKOGPVCT9
#RQNVKECFGTGIWNCQPUKVCCQ2TQ4GISWGGOVGUGCDTCPIGCUCGUPQTOCVKXCU
ministeriais, encontrou um arranjo institucional complexo e um ambiente pouco
CHGKVQ C WOC RTQUUKQPCNK\CQ SWG RQT UWC XG\ TGFWPFCUUG GO RTQEGUUQU FG
GNCDQTCQPQTOCVKXCOCKUUKPVQPK\CFQUEQOQUCXCPQUKPVGTPCEKQPCKUGOUGFG
FGDQCNGIKUNCQ
O Projeto de Decreto Legislativo10 n. 1711 de 2007 (arquivado) teve como objeto a
UWUVCQFCCRNKECQFQ&GETGVQPFGFGOCTQFGSWGKPUVKVWKWQ
2TQ4GI#LWUVKECVKXCDCUGQWUGPQTKUEQFGKPQXCQPCQTFGOLWTFKECRGTRGVTCFC
por atos normativos do Executivo:
O Decreto que ora se contesta vai de encontro com a autonomia das agncias
reguladoras [...] ele trata de atividades de superviso, tpicas das agncias,
e que no devem sofrer nenhuma ingerncia de cunho poltico. A autonomia
das agncias fundamental para que as mesmas possam desempenhar
9 Disponvel em: <http://www.iadb.org/pt/sobre-o-bid/estrategias-,6185.html>. Acesso em: 20/11/2012).
10 Nos termos do art. 49, V, inciso da CRFB/1988, o decreto legislativo um tipo de ato normativo que tem como
WOFQUGUEQRQUCUWUVCQFGGHKEEKCFGCVQPQTOCVKXQFQ'ZGEWVKXQSWGGZQTDKVGFQRQFGTTGIWNCOGPVCT
11 Proposta do deputado Jos Carlos Aleluia.

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

229

Fabiana de Menezes Soares

CFGSWCFCOGPVGUWCUHWPGUTC\QRQTSWGPQUGUWLGKVCOCQUCDQTEQPUVCPVG
de intempries polticas, vez que somente por lei podem ser criadas e
UWRTKOKFCUUWCUCVTKDWKGU

'UUCUKVWCQCITCXCFCUQDTGVWFQPQSWGVCPIGTGNCVKXK\CQFCOGTKVQETCEKC
nas agncias reguladoras (como vem sendo demonstrado na recente crnica poltica
DTCUKNGKTC 1WVTQGNGOGPVQFK\TGURGKVQDCKZCKPVGTPCNK\CQFCUDQCURTVKECUPQU
GUVTCVQUOKPKUVGTKCKUTGXGNCFCRGNCKPGZKUVPEKCFGTGIWNCOGPVQUXKPEWNCFQUCCGUFG
UKORNKECQJCTOQPK\CQGEQPUQNKFCQUQDTGCIGUVQFGRTQRQUVCUFGNGIKUNCQ
VTKDWVTKC
CVQUNGICKUGKPHTCNGICKU GCGURQPVWCKUGPEGVCFQURQTCNIWPUTIQU
FGPVTGQUSWCKUC&KXKUQFG5KUVGOCVK\CQG&KUUGOKPCQFG0QTOCU
&KUKU 

3 A SIMPLIFICAO NO QUADRO DA LEI


DE ACESSO INFORMAO
0QUCPQURQTOGKQFGCVQPQTOCVKXQQTKWPFQFCECFGKCFGHQPVGUFGNGIKUNCQ
inferior, a Receita Federal iniciou o saneamento do seu prprio sistema por meio
FGWOCFGENCTCQFGXKIPEKCGTGXQICQGZRTGUUCXGKEWNCFCGOCVQPQTOCVKXQFQ
VKRQ+PUVTWQ#+0HQKRWDNKECFCGOGC+0EQO
texto original publicado em 09/08/2000.
Todavia, a prtica de saneamento anual do sistema no consolidada no direito
DTCUKNGKTQGOUGFGFGIGUVQFCGNCDQTCQNGIKUNCVKXCFQ'ZGEWVKXQ0QECUQFC
RFB, o controle sobre vigncia e caducidade dos seus atos normativos no sofreu
PGPJWOCOGFKFCFGUCPGCOGPVQFGUUCOQPVCCRUQUEWNQ::+
0QFKTGKVQEQORCTCFQCGZRGTKPEKCECPCFGPUGFCTGRWDNKECQCPWCNFCNGIKUNCQ
GOXKIQTWOCDQCRTVKECKPURKTCFQTCQVKOK\CFCRGNC.GKFCU4GXQICGU
Statutes
Repeal Act- SRA).127OCCQUKOKNCTHQECFCPCNGIKUNCQKPHTCNGICNGPEGVCFCRGNC
RFB propiciaria um incremento da transparncia e do real acesso ao direito vigente.
#.GKFG#EGUUQ+PHQTOCQXGKQNWOGGO
GFGUFGOCKQFGCEJCUG
FKURQPXGNRCTCRTQFWQFGGHGKVQU EQOODKVQFGKPEKFPEKCUQDTGQ'ZGEWVKXQ
Q.GIKUNCVKXQGQ,WFKEKTKQ5WCXKIPEKCTGQTKGPVCPQUCFKHWUQFCKPHQTOCQ
LWTFKEC GURGEKECOGPVG FG PCVWTG\C NGIKUNCVKXQTGIWNCOGPVCT OCU Q EKTEWKVQ FG
KPHQTOCGUPGEGUUTKQCWOCLWUVKECQFCRTRTKCGZKUVPEKCFQCVQ
12 8GLCOQU C PQVEKC FGUVC CQ GO RTQN FQ UCPGCOGPVQ FQ UKUVGOC PQTOCVKXQ ECPCFGPUG
Cleaning up the
statutes) disponibilizada em http://laws-lois.justice.gc.ca/eng/Reports/, que, a seu turno, contm a base de
FCFQUFGKPHQTOCGULWTFKECUPQ/KPKUVTKQFC,WUVKCECPCFGPUGOn February 1 and 2, 2012 the Minister of
Justice tabled in the House of Commons and the Senate, respectively, the second Annual Report under the Statutes
Repeal Act
54# . The SRA helps ensure that consideration is given to bringing legislation into force. Until laws
come into force, they are not binding and have no legal effect. This report lists provisions of Acts that have not been
brought into force within 9 years of their enactment. All the listed laws will be repealed at the end of the year (that is,
QP&GEGODGT WPNGUUVJG[CTGDTQWIJVKPVQHQTEGDGHQTGVJCVFCVGQTCTGUQNWVKQPQHQPG*QWUGQH2CTNKCOGPV
defers their repeal. Provisions in 32 Acts listed in the 2011 Annual Report were repealed on December 31, 2011 by
operation of the SRA. Notice of the repeals has been published in the Canada Gazette, Part I.

230

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

0GUUGUGPVKFQDCUVCPVGGNWEKFCVKXQQITEQFGNGIUVKECOCVGTKCNFGPKFQEQOQ
RTQEGFKOGPVQEQORTGGPUKXQFKTKIKFQCQKPETGOGPVQFCGEEKCFQCVQCTVKEWNCPFQQ
EQO CGU G RQNVKECU RDNKECU CRU Q FGNKPGCOGPVQ FQ RTQDNGOC SWG OQVKXQW
o impulso para legislar.
Mais do que redigir, elaborar remete-nos a uma dimenso de planejamento
integrado do ato normativo, que, inclusive, considera seus aspectos comunicativoinformacionais e no somente sua estrutura lgico-redacional, ou mesmo as
EQPFKGUFGGZGEWVQTKGFCFGGGHGVKXKFCFGFQHWVWTQCVQPQTOCVKXQ
'UUC FKOGPUQ FC GNCDQTCQ PQTOCVKXC KPVGTGUUCPQU CIQTC VGPFQ GO XKUVC C
PCNKFCFGFGUVGVTCDCNJQQWUGLCFGOQPUVTCTQPXGNFGUQUVKECQFCIGUVQFG
projetos de atos normativos exigido na contemporaneidade. Vale dizer, a gesto da
GNCDQTCQ NGIKUNCVKXC PGEGUUKVC NGXCT GO EQPUKFGTCQ QU CURGEVQU RTQDNGOVKEQU
da tipologia de atos normativos, as tenses que envolvem o acesso ao direito vigente,
CTGEQPUVTWQFGECFGKCUFGHQPVGUCUGUVTCVIKCUEQOWPKECVKXCUGPVTGRQFGTRDNKEQ
e contribuintes (cidados e empresas).
1UTIQUEQOEQORGVPEKCUPQTOCVKXCUCQPCNFQUGWRTQEGUUQJGTOGPWVKEQ
RCTC C FGPUKECQ FQU CVQU PQTOCVKXQU FG UWC EQORGVPEKC FGXGO EQPHQTOCT
UWCCVKXKFCFGFGIGUVQFCGNCDQTCQNGIKUNCVKXC.GK%QORNGOGPVCTP
CQ&GETGVQPGTGEGPVGOGPVG.GKFG#EGUUQ+PHQTOCQ
8GLCOQU WO OQFGNQ FG KPVGTCQ GPVTG 4GEGKVC G EQPVTKDWKPVGU GZRTGUUQ XKC
diploma normativo, conhecido no direito canadense como Tax Payer Bill of Rights/
Charte des droits du contribuable13 Carta de direitos do contribuinte:

13 SiteFC4GEGKVC(GFGTCNECPCFGPUG
%CPCFC4GXGPWG#IGPE[#IGPEGFW4GXGPWFW%CPCFC &KURQPXGNGO
<http://www.cra-arc.gc.ca/E/pub/tg/rc4417/>. Acesso em: 01/10/2012.

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

231

Fabiana de Menezes Soares

1. You have the right to receive entitlements


and to pay no more and no less than what is
required by law.

O contribuinte tem o direito de receber o que lhe


devido e de pagar somente os valores estipulados
em lei.

2. ;QWJCXGVJGTKIJVVQUGTXKEGKPDQVJQHEKCN
languages.

O contribuinte tem direito a ser atendido numa das


duas lPIWCUQEKCKU

3. You have the right to privacy and


EQPFGPVKCNKV[

O contribuinte tem o direito privacidade e


EQPFGPEKCNKFCFG

4. You have the right to a formal review and a


subsequent appeal.

O contribuinte tem o direito a um recurso formal e


reviso consequente.

5. You have the right to be treated professionally,


courteously, and fairly.*

O contribuinte tem o direito de ser tratado de


HQTOCRTQUUKQPCNGFWECFCGLWUVC

6. You have the right to complete, accurate, clear, 1EQPVTKDWKPVGVGOQFKTGKVQCKPHQTOCGU


and timely information.*
precisas, claras, expedidas em um prazo razovel.
7. You have the right, as an individual, not to
pay income tax amounts in dispute before you
have had an impartial review.

O contribuinte tem o direito, como indivduo, de


no pagar o imposto de renda com valor sob litgio
CVQOFGWOCHCUGTGEWTUCNUGIWKFCFGTGXKUQ
imparcial.

8. You have the right to have the law applied


consistently.

O contribuinte tem o direito CRNKECQEQPUKUVGPVG


da lei.

9. You have the right to lodge a service complaint O contribuinte tem o direito de entrar com uma
and to be provided with an explanation of the TGENCOCQHQTOCNFQUGTXKQ
CVGPFKOGPVQ G
%CPCFC4GXGPWG#IGPE[UPFKPIU*
TGEGDGTWOCGZRNKECQFQUTGUWNVCFQURGNC4GEGKVC
10. You have the right to have the costs of
compliance taken into account when
administering tax legislation.*

O contribuinte tem o direito de descontar o custo


FGEWORTKOGPVQFCUUWCUQDTKICGUUECKU

11. You have the right to expect the Canada


Revenue Agency to be accountable.*

O contribuinte tem o direito a uma Receita que


preste contas pelos seus atos.

12. You have the right to relief from penalties


and interest under tax legislation because of
extraordinary circumstances.

O contribuinte tem o direito ao perdo de multas e


juros sob circunstncias extraordinrias.

13. You have the right to expect the Canada


Revenue Agency to publish its service
standards and report annually.*

O contribuinte tem o direito de esperar da CRA a


RWDNKECQCPWCNFQUGWFGUGORGPJQ

14. You have the right to expect the Canada


Revenue Agency to warn you about
questionable tax schemes in a timely manner.*

O contribuinte tem o direito de ser avisado pela


%4#FGRQUUXGKURTQDNGOCUGOUWCUFGENCTCGU
EQORTC\QUWEKGPVG

15. You have the right to be represented by a


person of your choice.*

O contribuinte tem o direito a um representante de


sua escolha.

* Service rights upheld by the Taxpayers


Ombudsman.

'UVGUGURGEKECOGPVGUQQUFKTGKVQUFGHGPFKFQU
pelo ombudsman.

232

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

Tratamento diferenciado para pequenos contribuintes


1. 6JG%CPCFC4GXGPWG#IGPE[
%4# KU
committed to administering the tax system in
a way that minimizes the costs of compliance
for small businesses.

A Receita compromete-se a administrar o sistema


tributrio para reduzir o custo de cumprimento
para pequenas empresas.

2. The CRA is committed to working with all


governments to streamline service, minimize
cost, and reduce the compliance burden.

A Receita compromete-se a colaborar com todos os


governos para uniformizar o atendimento, minimizar
custos e diminuir a carga de cumprimento.

3. The CRA is committed to providing service #4GEGKVCEQORTQOGVGUGCRTGUVCTQUUGTXKQUTGSWKUKofferings that meet the needs of small businesses. tados para atender s demandas de pequenas empresas.
4. The CRA is committed to conducting outreach A Receita compromete-se a fazer o mximo
activities that help small businesses comply
para ajudar pequenas empresas a cumprirem as
with the legislation we administer.
exigncias tributrias.
5. The CRA is committed to explaining how we
conduct our business with small businesses.

A Receita compromete-se a explicar ao contribuinte


(pequena empresa) os mtodos de atendimento.

A elaborao luz do contexto tcnico-legal atual de publicidade e transparncia


HQKCNVGTCFQPQRNCPQFCTGCNKFCFGRGNCVGEPQNQIKCFCKPHQTOCQ'UUCFKTGVTK\
HQKRQUKVKXCFCRGNC.GKFG#EGUUQ+PHQTOCQCQSWCNKECTCRWDNKEKFCFGQEKCN
(grifo nosso):
Art. 8o dever dos rgos e entidades pblicas promover, independentemente
de requerimentos, a divulgao em local de fcil acesso, no mbito de suas
competncias, de informaes de interesse coletivo ou geral por eles produzidas
ou custodiadas. [...]
h o Para cumprimento do disposto no caput, os rgos e entidades pblicas
devero utilizar todos os meios e instrumentos legtimos de que dispuserem, sendo
QDTKICVTKC C FKXWNICQ GO UVKQU QEKCKU FC TGFG OWPFKCN FG EQORWVCFQTGU

KPVGTPGV 
ho1UUVKQUFGSWGVTCVCQho devero, na forma de regulamento, atender,
entre outros, aos seguintes requisitos:
I conter ferramenta de pesquisa de contedo que permita o acesso informao
de forma objetiva, transparente, clara e em linguagem de fcil compreenso;[...]
8ICTCPVKTCCWVGPVKEKFCFGGCKPVGITKFCFGFCUKPHQTOCGUFKURQPXGKURCTC
CEGUUQ
8+OCPVGTCVWCNK\CFCUCUKPHQTOCGUFKURQPXGKURCTCCEGUUQ
8++KPFKECTNQECNGKPUVTWGUSWGRGTOKVCOCQKPVGTGUUCFQEQOWPKECTUG
RQTXKCGNGVTPKECQWVGNGHPKECEQOQTIQQWGPVKFCFGFGVGPVQTCFQUVKQG
VIII adotar as medidas necessrias para garantir a acessibilidade de contedo para
RGUUQCUEQOFGEKPEKCPQUVGTOQUFQCTVFC.GKPFGFGFG\GODTQ
de 2000, e do art. 9oFC%QPXGPQUQDTGQU&KTGKVQUFCU2GUUQCUEQO&GEKPEKC
aprovada pelo Decreto Legislativo n. 186, de 9 de julho de 2008.
ho1U/WPKERKQUEQORQRWNCQFGCV
FG\OKN JCDKVCPVGUECO
FKURGPUCFQU FC FKXWNICQ QDTKICVTKC PC KPVGTPGV C SWG UG TGHGTG Q h o,
Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

233

Fabiana de Menezes Soares

OCPVKFC C QDTKICVQTKGFCFG FG FKXWNICQ GO VGORQ TGCN FG KPHQTOCGU


TGNCVKXCUGZGEWQQTCOGPVTKCGPCPEGKTCPQUETKVTKQUGRTC\QURTGXKUVQU
no art. 73-B da Lei Complementar n. 101, de 4 de maio de 2000 (Lei de
Responsabilidade Fiscal).

A acessibilidade aos textos normativos14 e a compreenso do direito vigente luz


FCUPQXCUVGEPQNQIKCUFCKPHQTOCQPGUUGEQPVGZVQFGKPETGOGPVQFCEKTEWNCQ
FG KPHQTOCGU LWTFKECU RTQRKEKCO EQPFKGU RCTC WOC KPVGTCQ TGCN GPVTG
EQPVTKDWKPVGUG4GEGKVC0GUUGEGPTKQCIGUVQFCKPHQTOCQLWTFKECPQGZRTGUUC
UQOGPVGWOCFKOGPUQGUVTCVIKECFCCVWCQFCCFOKPKUVTCQRDNKECDTCUKNGKTC
ela nos remete aos princpios basilares da Repblica Federativa do Brasil, que
recebe modelos jurdicos criados em contextos supranacionais. Vejamos o quadro
EQORCTCVKXQFQUUKUVGOCUFGKPHQTOCQRTGUGPVGUGOCNIWPUOKPKUVTKQUEQOCNVC
CVKXKFCFGFGFGPUKECQFGCVQUPQTOCVKXQUNGICKU
Subsistemas normativos complexos x acesso informao jurdica normativa
Sistema de
KPHQTOCQ
jurdica para
destinatrios
internos e
externos

2TGUGPCFG
&GPKQ
2TGUGPC
tipologia de
+PVGTCQ
sobre quando
de
arquivo de
com Lexml15 atos normativos
usar o tipo
FGEQFKECQ

NGIKUNCQ
separada
normativo
da
multivigente) daquela dos atos
KPFGPKQFG
17
KPHQTOCQ
administrativos hierarquia)16

Ministrio do
Planejamento
1TCOGPVQG
Gesto (MPOG)

Silab

NO

NO

NO

NO

Ministrio da
Agricultura
Pecuria e
Abastecimento
(Mapa)

Sislegis

NO

NO

NO

NO

Ministrio do Meio
Ambiente (MMA)

+PHQTOCQ
no siteQEKCN
por temas

NO

SIM

SIM

NO

MF/RFB

Sijut

Em termos18

NO

Em termos19

NO

14 5QDTGQVGOCXGT5QCTGU
 4QDKPUQP
R &WCTVG
R G(TGKTG
R 
15 4GOKUUGUCNVGTCGUTGIWNCOGPVCQLWNICFQUGFQWVTKPCGZRTGUUQUPQsite.
16 #QEQOWPKECVKXCGORTQNFQFGUVKPCVTKQJKRQUUWHKEKGPVGEQPVTKDWKPVG
17 %CTVKNJCUCTSWKXQFGWFKQCTSWKXQFGXFGQVGZVQUUKORNKHKECFQUFKXWNICQCEGUUXGNCVTCGPVGGENCTC
18 O LexMl consta como link no site da RFB (<http://www.receita.fazenda.gov.br>), todavia o Sijut no integra
as fontes do direito.
19 O Manual de redao e elaborao de atos administrativos da Receita Federal do Brasil no define a hierarquia
G GPVTC GO EQPHNKVQ EQO PQTOCU UQDTG GNCDQTCQ SWG FKUEKRNKPCO XCUVC VKRQNQIKC FG CVQU QW OGUOQ CVQU
definidos como administrativos, ordinatrios ou mesmo de expediente, mas com contedos de atos normativos
secundrios.

234

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

4GUVCGXKFGPEKCFQGPVQSWGCUKORNKECQFCVKRQNQIKCFGCVQUPQTOCVKXQUGQU
OQFGNQUFGEQOWPKECQFCKPHQTOCQLWTFKECIWCTFCOUKPIWNCTGPGEGUUTKCTGNCQ
GUVCUKPVQPK\CFCEQOCUGZKIPEKCUEQPVGORQTPGCUFGVTCPURCTPEKCGRTQVGQFC
EQPCPCRQKUCFKEWNFCFGPCTGEQPUVTWQFCUHQPVGUFQFKTGKVQGZRTGUUCUGO
XCUVCVKRQNQIKCFGCVQUPQTOCVKXQUGNKFGCEQPCDKNKFCFGFQQTFGPCOGPVQNGICN20
6CNUKVWCQETKCWOCXWNPGTCDKNKFCFGVCPVQRCTCQdestinatrio-contribuinte quanto
para os destinatrios-executores: a prpria Fazenda.
No caso do Ministrio da Fazenda, no obstante o trabalho da Disis, a questo da
UKORNKECQFCVKRQNQIKCFGCVQUPQTOCVKXQUCQCRVCCKPETGOGPVCTCOGNJQTKC
PQCEGUUQGPCFKUUGOKPCQFQFKTGKVQXKIGPVGFKURQPKDKNK\CFQPCDCUGFQ5KLWV
TGXGNCPQUQFGUCQCUGTGPHTGPVCFQ
SWGUGCEJCEQPVGORNCFQPQ/CRC'UVTCVIKEQ
FC4GEGKVC(GFGTCNFQ$TCUKNTGHGTGPEKCFQPCUGQ &GWONCFQCXCUVC
VKRQNQIKCFGCVQUPQTOCVKXQUGFGQWVTQQCEGUUQCQFKTGKVQXKIGPVGEQPFKQRCTC
CEGTVG\CGCUGIWTCPCLWTFKECU
O Mapa Estratgico da Receita Federal do Brasil 2012-2015 elenca resultados
RTGVGPFKFQU
FGPVTGQWVTQU GGPWOGTCCGURCTCCNECPNQU&GPVTGQUTGUWNVCFQU
SWG IWCTFCO EQTTGURQPFPEKC EQO OGNJQTKC FC IGUVQ FG GNCDQTCQ NGIKUNCVKXC
podemos citar:
 CWOGPVQFCRGTEGRQFGGSWKFCFGPCCVWCQFCKPUVKVWKQ
 HQTVCNGEKOGPVQFCKOCIGOFCKPUVKVWKQRGTCPVGCUQEKGFCFG.
#RTQNKHGTCQFGPQTOCUUQDTGRTQFWQFGPQTOCUXGKEWNCFCURQTFKXGTUQUVKRQUFG
atos normativos, outro obstculo transparncia e ao acesso ao sistema normativo
QTKWPFQ FC 4($ # EQPUGSWPEKC  C XWNPGTCDKNK\CQ FC EQGTPEKC GPVTG UGWU
comandos (que sejam veiculadas por atos normativos, com hierarquia regulamentar
UWRGTKQT GFCTGURGEVKXCCQIQXGTPCOGPVCNCRVCCCUUGIWTCTWOKPETGOGPVQFC
efetividade da LC/1995 e do Decreto n. 4176/2002, em conformidade com as boas
RTVKECUFGIGUVQFCGNCDQTCQPQTOCVKXCPQEQPVGZVQFCUQEKGFCFGFCKPHQTOCQ
0QTOCU UQDTG RTQFWQ FG PQTOCU SWG UGLCO GURCTUCU FGUCTVKEWNCFCU EQO
TGXQICGU KORNEKVCU SWG RGTRGVWCO Q XKIQT FG EQPVTCFKGU UG EQPUVKVWGO GO
QDUVEWNQ CQ CRTKOQTCOGPVQ FC IGUVQ FC GNCDQTCQ NGIKUNCVKXC G HTCIKNK\CO C
EQPCPCKPHQTOCEKQPCNGPVTG4($GEQPVTKDWKPVG

20 &'4<+
 R   # ETGUEGPVG FGRGPFPEKC FQ KPFKXFWQ GO TGNCQ CQ 'UVCFQ EQOQ CNGTVQW
1$CEJQHFGUGPECFGKCCWTIPEKCFCRTQVGQFCEQPHKCPCLWUVCPCEQPVKPWKFCFGFQ2QFGTGUVCVCN#NKDGTFCFG
RQUUKDKNKFCFGFGGUVTWVWTCTCRTRTKCXKFCRTKXCFCFGCEQTFQEQOQURTRTKQURNCPQUGKUUQGZKIGGORTKOGKTQ
NWICTCEQPHKCDKNKFCFGFQQTFGPCOGPVQNGICN#RTQVGQFCEQPHKCPCHWPFCOGPVCUGPCHTOWNC quanto mais,
tanto mais, de modo que quanto maior for a presso da obrigatoriedade exercida pelo Poder Pblico, maior
a necessidade de se proteger o indivduo dependente que confiou nas decises estatais cogentes. Esta nota
essencial proteo da confianaCHCUVCCUWCCRNKECDKNKFCFGCQ'UVCFQRQKUPQUGRQFGKPXGTVGTCTGNCQFG
dependncia e de fragilidade. (grifo nosso)

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

235

Fabiana de Menezes Soares

7OCFGUUCUCGUGZRTGUUCWOOQFGNQFGaccountability, ou dados abertos (open


data).21#.GKFG#EGUUQ+PHQTOCQWOCFGUUCUCGUKPVGTPCNK\CFCPQUKUVGOC
LWTFKEQDTCUKNGKTQ'UUCCQRQTUWCXG\CEJCUGCTVKEWNCFCEQOQWVTQOQFGNQ
LWTFKEQFGDQCNGIKUNCQEWLCUPVGUGFGXKPVGCPQUFGFGUGPXQNXKOGPVQUGGPEQPVTC
expressa no mandado da Comisso Europeia:22
No contexto da estratgia de Lisboa renovada, centrada no crescimento e no
GORTGIQC%QOKUUQNCPQWWOCCORNCGUVTCVIKCXKUCPFQNGIKUNCTOGNJQT
para assegurar que o quadro regulamentar da Unio Europeia contribua para
incentivar o crescimento e o emprego, tendo simultaneamente em conta os
objetivos sociais e ambientaisGQUDGPGHEKQURCTCQUEKFCFQUGCUCFOKPKUVTCGU
nacionais. O Programa Legislar Melhor da Unio Europeia tem em vista a
OQFGTPK\CQGCUKORNKECQFCNGIKUNCQGZKUVGPVGWOCOGNJQTEQPEGRQ
das novas RTQRQUVCU NGIKUNCVKXCU G Q TGHQTQ FQ TGURGKVQ G FC GEEKC FCU
FKURQUKGUVGPFQGOEQPVCQRTKPERKQFCRTQRQTEKQPCNKFCFG
A Estratgia Legislar Melhor assenta em trs eixos principais:
 RTQOQQ FC EQPEGRQ G FC aplicao de instrumentos visando legislar
melhor a nvel da Unio EuropeiaPQOGCFCOGPVGUKORNKECQTGFWQ
FQUEWUVQUCFOKPKUVTCVKXQUGCXCNKCQFGKORCEVQ
 VTCDCNJCTGOOCKUGUVTGKVCEQNCDQTCQEQOQU'UVCFQU/GODTQURCTCCUUGIWTCT
que os princpios visando legislar melhor sejam aplicados de modo coerente
RQTVQFQUQUNGIKUNCFQTGUGOVQFCC7PKQ'WTQRGKC
 TGHQTCT WO FKNQIQ EQPUVTWVKXQ entre as partes interessadas e todos os
legisladores a nvel da Unio Europeia e dos Estados Membros.

#GU FG UKORNKECQ UQ CTVKEWNCFCU C RCEQVGU FG CVQU PQTOCVKXQU GO UGFG FG
RTQFWQ FQ FKTGKVQ GO TGCNKFCFGU EQO OQFGNQU FG IQXGTPCPC SWG GHGVKXCO
a accountability PQ UGKQ FCU UWCU QTICPK\CGU G UWCU TGNCGU EQO C UQEKGFCFG

EQPCPCEGTVG\CFQFKTGKVQGUGIWTCPCLWTFKEC 

21 Open data for development in Latin America and the Caribbean. Disponvel em: <http://www.od4d.org/
sobre-o-projeto/ #EGUUQGO#FKUUGOKPCQFCKPHQTOCQIQXGTPCOGPVCNGOHQTOCVQUCDGTVQU
CEGUUXGKUGGUVTWVWTCFQUVGOQRQVGPEKCNFGCWOGPVCTUWDUVCPEKCNOGPVGCVTCPURCTPEKCGCRTGUVCQFGEQPVCU
PQSWGVCPIGCGNCDQTCQGGZGEWQFGRQNVKECURDNKECUCNOFGCDTKTRQTVCURCTCCCORNCRCTVKEKRCQ
da sociedade nesse processo. Deste modo, a abertura de dados e o maior reconhecimento das demandas da
RQRWNCQSWGCFXOFGUVCCDGTVWTCVORCRGNKORQTVCPVGRCTCRTQOQXGTCKIWCNFCFGUQEKCNGCGHKEEKCFC
CFOKPKUVTCQRDNKEC(QKRGPUCPFQPKUVQSWGQW3C Brasil e a Comisso Econmica para a Amrica Latina e
o Caribe (Cepal GPECDGCTCOWORTQLGVQUQDTGo impacto e o potencial dos dados abertos para as polticas pblicas
na Amrica Latina e Caribe, financiado pelo Centro Internacional de Pesquisa e Desenvolvimento do Canad
(IDRC).
OD4D Open data for development apresenta-se como uma iniciativa que busca ampliar o conhecimento
existente sobre Dados Abertos e seu potencial de melhorar a qualidade das polticas pblicas na Amrica Latina
e Caribe e incentivar o desenvolvimento econmico local. Tambm quer constituir uma plataforma de dilogo
e intercmbio entre os atores (governos, cidados, desenvolvedores, acadmicos, etc.) que conduzem o debate
sobre o assunto, na regio como no mundo. [...]. O objetivo geral deste projeto de pesquisa contribuir para
QFGUGPXQNXKOGPVQFGGUVTCVIKCUFG&CFQU#DGTVQUSWGNGXGORTGUVCQFGEQPVCUUGTXKQUKPQXCFQTGUG
efetividade de polticas pblicas em setores estratgicos, promovendo uma economia do conhecimento mais
KPENWUKXCPC#OTKEC.CVKPCG%CTKDG2CTCCNECPCT esta meta, o projeto investiga as potencialidades dos Dados
Abertos nas polticas pblicas em 3 eixos: transparncia, novos servios, desenvolvimento equitativo.
22 Disponvel em: <http://ec.europa.eu/governance/better_regulation/index_pt.htm>. Acesso em: 10/11/2012.

236

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

1 HCVQT JWOCPQ TGRTGUGPVC WO KORQTVCPVG RCRGN PC KPQXCQ FC IGUVQ GO
GNCDQTCQ NGIKUNCVKXC 0GUUG EQPVGZVQ Q RCRGN FQU TGEWTUQU JWOCPQU PQ UGVQT
RDNKEQ HQK QDLGVQ FG TGEGPVG GUVWFQ KPVKVWNCFQ 1 RCRGN FCU KPUVKVWKGU PQU
KPEGPVKXQU RCTC C IGUVQ RDNKEC
/'0')7+0 $7)#4+0   PQ SWCN CU
EQPFKGUFGKPQXCQHQTCOCXCNKCFCUNGXCPFQUGGOEQPUKFGTCQCURQUKGUFQ
IGUVQT
OCKUCEQOQFCFQOCKUQWUCFQGOUWCUCGUQWOQVKXCFQRGNQCWOGPVQ
FGUGWTGVQTPQRTKXCFQ GUWCUKVWCQ
UGTXKFQTGUGUVXGKUVGPFGOCPQKPQXCTG
UGEQTTQORGOOGPQUQUUGTXKFQTGUEQOECTIQFGEQPCPCHQTCFQUSWCFTQUUQ
mais ousados, mas podem se corromper mais).
/GFKFCUEQOQCGUSWGOQVKXGOQUGTXKFQTGUVXGNCUGTRCTVEKRGGORTQEGUUQU
FG KPQXCQ G ECRCEKVCGUGO NGIKUNCGU EQORNGZCUEQORGOQ SWCFTQ RCTC C
melhoria da gesto pblica. Testadas por meio de modelos economtricos (mtodo
dos mnimos quadrados empilhados como o mtodo de regresso em painis), as
EQPENWUGUFQTGHGTKFQGUVWFQCRQPVCOCNIWOCUFKTGGUSWGUGEQCFWPCOEQOC
PGEGUUKFCFGFGKPETGOGPVQGUVTCVIKEQFGRTVKECUFGDQCIQXGTPCPC
PCUSWCKUC
IGUVQFCGNCDQTCQNGIKUNCVKXCGXKFGPVGOGPVGUGCEJCKPENWFC 
Nesse contexto, em face do ambiente comunicativo ensejado pela sociedade da
KPHQTOCQ G FG CGU FG ')QX C GNCDQTCQ G C EQOWPKECQ FC KPHQTOCQ
LWTFKEC PGEGUUKVCO UGT SWCNKECFCU  NW\ FGUUG PQXQ RCTCFKIOC PC TGNCQ GPVTG
CFOKPKUVTCQRDNKECGEKFCFQU

4 DIFUSO DA INFORMAO JURDICA E SIMPLIFICAO


DA TIPOLOGIA DE ATOS NORMATIVOS
O Regimento Interno da RFB, mencionado anteriormente, evidencia a existncia
FG FKXGTUQU TIQU SWG NKFCO EQO C GNCDQTCQ FG CVQU PQTOCVKXQU 6QFCXKC C
RTRTKCRGUSWKUCUQDTGGUUGUCVQUFKEWNVCFC
GZVTCQFGKPHQTOCGUGODCUG
de dados de cunho jurdico) na medida em que algumas ementas mencionam
GNCDQTCQ G QWVTCU GFKQ 1 RTRTKQ Manual de redao e elaborao dos
atos administrativos da Receita Federal menciona no seu ttulo to somente atos
administrativos, mas tem item prprio no qual discorre sobre atos administrativos,
normativos e ordinatrios.
8GTKHKECUG SWG C UKVWCQ EQPVGORQTPGC FC HTCPEC CVKXKFCFG NGIKUNCVKXC FQ
Executivo foi ignorada, como se no existisse uma lei complementar e um
decreto .%PG&GETGVQPSWGFKUEKRNKPCOGKFGPVKECO
WOC ECVGIQTKC CWVPQOC FG CVQU QTKWPFQU FC CFOKPKUVTCQ RDNKEC QU CVQU
normativos, que incluem aqueles primrios, fontes de competncias privativas do
Executivo: certas matrias a serem veiculadas via leis, as medidas provisrias e os
decretos, alm de todos aqueles que compem o conjunto dos atos normativos
secundrios.
Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

237

Fabiana de Menezes Soares

Nenhuma tipologia revista foi proposta, de modo que hoje existem, na base de dados
do Sijut, 79 tipos de atos (videSWCFTQ UGOSWCNSWGTFKUVKPQGPVTGCFOKPKUVTCVKXQU

GUWCUECVGIQTKCU GPQTOCVKXQU1UCVQUPQTOCVKXQUUQENCUUKECFQU23 como:


+0KPUVTWQPQTOCVKXC
#&CVQFGENCTCVTKQ
#&+CVQFGENCTCVTKQKPVGTRTGVCVKXQ
#&'CVQFGENCTCVTKQGZGEWVKXQ
20RCTGEGTPQTOCVKXQ
0'PQTOCFGGZGEWQ
'UUCENCUUKECQGPVTCGOEQPKVQEQOCUFGOCKUPQTOCUUQDTGRTQFWQFGPQTOCU

OGPEKQPCFCUCPVGTKQTOGPVG SWGQTCPQENCUUKECOQWFGUEQPUKFGTCOQEQPVGFQ
veiculado pelos tipos existentes. O caso mais emblemtico o da portaria, elencada
ora como ato administrativo, ora como ordinatrio ou normativo.
#CFOKPKUVTCQRDNKECECPCFGPUGCQRWDNKECTUGWManual de redao regulamentar
(Federal regulations manual/Manuel de la rglementation fdrale), o fez de forma
articulada com a Lei sobre Textos Regulamentares RSC, 1985, C.S-22 (lngua
inglesa) e LRC, 1985, Ch.S22 , cujo escopo o exame (planejamento) do projeto, sua
RWDNKECQGEQPVTQNG0QUGWCTVKIQo elenca 15 tipos de atos sobre os quais incidem
CUFKURQUKGUNGICKU
CQFGUKORNKECQ SWGUGTQGXKFGPEKCFQUOCKU frente.
Cabe ao manual canadense descrever minuciosamente o planejamento do desenho
FQCVQPQTOCVKXQQDLGVQFGGNCDQTCQ
2CTVHow to give drafting instructions
G2CTV&GXGNQRKPITGIWNCVKQPUVJGDCUKEUVGRUCPFRNCKPNCPIWCIGCRTQCEJ 

23 Manual de Redao da RFB (p. 108-111).

238

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

4.1 QUADROS COMPARATIVOS DE TIPOLOGIAS DE ATOS DO EXECUTIVO


(MPOG Tipologia de atos normativos no Executivo)
Sistema de
2TGUGPCFGVKKPHQTOCQ
pologia de atos
jurdica para Federal
normativos
Manuel de la
destinatrios regulation rglementation separada da de
internos e
atos adminismanual
fdrale
externos
trativos

Ministrio do
Planejamento
1TCOGPVQ
e Gesto
(MPOG)

Silab

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

NO

Tipologia de atos
apresentada

Apostilamento
Ata
Ato
Ato declaratrio
#WVQTK\CQ
Aviso
Aviso circular
Aviso de consulta pblica
#XKUQFGNKEKVCQ
Aviso de penalidade
#XKUQFGRTQTTQICQ
Carta circular
Chamada pblica
Comunicado
Concorrncia
Concorrncia internacional
Consulta pblica
Convnio
Convite
Deciso
Decreto executivo
&GNKDGTCQ
Despacho
&KURGPUCFGNKEKVCQ
Editais (diversos)
Extratos (diversos)
'ZRQUKQFGOQVKXQU
+PUVTWQPQTOCVKXC
+PUVTWQPQTOCVKXCEQPLWPVC
+PUVTWQPQTOCVKXCIGTCN
+PUVTWQPQTOCVKXCKPVGTOKPKUVGTKCN
Lei
.KEKVCQ
Medida provisria
Mensagem
Norma operacional
Ofcio circular
Ofcio circular conjunto
1TKGPVCQPQTOCVKXC
Parecer
Portarias (diversas)
Prego
Processo
4GEQOGPFCQ
4GUQNWQ
Resultados (diversos)
Sindicncia
Telex circular
Termo de compromisso
Termo de resciso contratual
6QOCFCFGRTGQ

239

Fabiana de Menezes Soares

MMA Tipologia de atos normativos no Executivo


Sistema de
KPHQTOCQLWTFKEC
para destinatrios
internos e externos
Ministrio do
Meio Ambiente
(MMA)

Federal
regulation
manual

Manuel de la
rglementation
fdrale

2TGUGPCFGVKRQNQIKC
de atos normativos
separada da de atos
administrativos

Tipologia
de atos
apresentada

SIM

5GRCTCQFC
NGIKUNCQRQT
temas

+PHQTOCQPQsite
QEKCNRQTVGOCU

Anvisa Tipologia de atos normativos no Executivo24


Sistema de
KPHQTOCQ
jurdica para
destinatrios
internos e
externos

Anvisa

Sade legis

Federal
regulation
manual

Manuel de la
rglementation
fdrale

2TGUGPCFG
tipologia de
atos normativos
separada
da de atos
administrativos

Em termos
(houve
UKORNKECQFC
tipologia)

Tipologia de atos apresentada

Ato administrativo
Agenda regulatria
Ato de diretor-geral
#WVQTK\CQ
Consulta pblica
&GNKDGTCQ
+PUVTWQ
+PUVTWQPQTOCVKXC
+PUVTWQFGUGTXKQ
0QTOCFGGZGEWQ
Norma operacional
Norma tcnica
1TKGPVCQPQTOCVKXCKPVGTPC
1TFGOFGUGTXKQ
Portaria conjunta
Portaria interministerial
Portaria
Protocolo
4GUQNWQFCFKTGVQTKC
colegiada
4GEQOGPFCQ
4GUQNWQ
Regimento interno
Rotina tcnica, smula

24 *WOCCQFGRNCPGLCOGPVQTGIWNCVTKQGOEWTUQCXCNKCQFGKORCEVQ

240

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

Ministrio da Fazenda/RFB Tipologia de atos normativos no Executivo


Sistema de
Federal
Manuel de la
KPHQTOCQLWTFKEC
regulation rglementation
para destinatrios
manual
fdrale
internos e externos
Ministrio da
Fazenda
Secretaria
da Receita
Federal (SRF)

Sijut
Link LexMl,
mas no possui
plataforma
integrada

2TGUGPCFGVKRQNQIKCFGCVQU
normativos separada da de atos
administrativos
NO
Possui Manual de redao e elaborao de atos administrativos disponvel somente na intranet, sem espeEKECTVQFQUQUCVQUPQTOCVKXQU

Tipologia
de atos
apresentada

79 tipos
de atos25

Agncia da Receita (Canad) Tipologia de atos normativos no Executivo


Sistema de
KPHQTOCQLWTFKEC
para destinatrios
internos e externos

Federal
regulation
manual

Manuel de la
rglementation
fdrale

Verso
inglesa
(disponvel
na
internet)

Verso
francesa
(disponvel
na
internet)

CRA
Canada
Revenue
#IGPE[ www.cra.gc.ca/rights
Agence
du
Revenu

2TGUGPCFG
tipologia de
atos normativos
separada
da de atos
administrativos

Tipologia de atos
apresentada

Rule, order, regulation,


ordinance, direction,
form, tariff of costs or fees,
No
letters patent, commission,
(O manual
warrant, proclamation,
determina sobre
by-law, resolution or other
o uso dos atos,
instrument issued, made or
a tipologia
established.
FGPKFCKPVGITC
Rglement, dcret,
a cultura de
ordonnance, proclamation,
GNCDQTCQ
arrt, rgle, rglement
no Executivo
administratif, rsolution,
canadense em
instruction ou directive,
face de uma lei
formulaire, tarif de droits,
especEC
de frais ou dhonoraires,
lettres patentes, commission,
mandat ou autre texte pris.

Fonte: Sijut
25 Acordo, ajuste, ajuste complementar, ajuste Simief, ato, ato complementar, ato Confaz, ato Cotepe, ato
FCU FKURQUKGU EQPUVKVWEKQPCKU VTCPUKVTKCU CVQ FGENCTCVTKQ CVQ FGENCTCVTKQ PQTOCVKXQ ato declaratrio
interpretativo ADI, ato declaratrio executivo ADE, ato de destinao de mercadorias ADM, ato normativo,
ato delegatrio, ato do presidente do Congresso Nacional, ato do presidente da Cmara dos Deputados, aviso,
ECTVCEKTEWNCT%QPUVKVWKQEKTEWNCTEQPXPKQEQPXPKQ'%(EQPXPKQ+%/5EQOWPKECFQEQPUWNVCRDNKEC
EQPXGPQFGETGVQFGciso, deciso normatiXCFGETGVQFGETGVQNGKFGNKDGTCQFGETGVQNGIKUNCVKXQFGEKUQ
PQTOCVKXCFGURCEJQGOGPFCEQPUVKVWEKQPCNGOGPFCEQPUVKVWEKQPCNFGTGXKUQGFKVCNGPWPEKCFQGZRQUKQFG
OQVKXQUKPUVTWQKPUVTWQGURGEKCNKPUVTWQPQTOCVKXC+0KPHQTOCQNGKNGKEQORNGOGPVCTOGOQTCPFQ
OGPUCIGOOGFKFCRTQXKUTKCPQTOCFGGZGEWQ0'PQTOCFGUGTXKQPQVCPQVCGZRNKECVKXCPQVCVEPKEC
QTFGOFGUGTXKQ15QHEKQEKTEWNCTQTKGPVCQPQTOCVKXCQTKGPVCQPQTOCVKXCKPVGTPCQTFGOFGUGTXKQ
RCTGEGTRCTGEGTFGETGFGPEKCOGPVQRCTGEGTFGQTKGPVCQRCTGEGTPQTOCVKXQ20RTQVQEQNQRTQVQEQNQ
ECF, protocolo ICMS, portaria, portaria normatiXCTGEQOGPFCQTGUQNWQTGUQNWQPQTOCVKXCUQNWQ
FGEQPUWNVCUQNWQFGFKXGTIPEKCUOWNCVGNGZEKTEWNCT
ITKHQPQUUQ 

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

241

Fabiana de Menezes Soares

)TCPFGRCTVGFCUVGPUGUSWGEGTECOCFKHWUQFCKPHQTOCQLWTFKECGURGEKECOGPVG
de natureza legislativo-regulamentar referente ao subsistema normativo da Receita
Federal, sistema do tipo complexo (em face da quantidade de tipos de atos normativos
GRTQHEWCCVKXKFCFGFGFGPUKECQKPHTCNGICNGPEGVCFCRGNQ/KPKUVTKQFC(C\GPFC 
VTKDWVCFCCWUPEKCFGWOCRQNVKECFGIGUVQHQECFCPCGNCDQTCQFCSWGNGVKRQ
FGNGIKUNCQUKVWCQSWGCVKPIGDQCRCTVGFQ'ZGEWVKXQDTCUKNGKTQ
7O OQFGNQ FG RNCPGLCOGPVQ NGIKUNCVKXQ EQOQ Q GUDQCFQ C UGIWKT GZKIG WOC
OQFKECQ PQ OQFQ EQOQ C IGUVQ FC GNCDQTCQ G FC FKURQPKDKNK\CQ FC
KPHQTOCQLWTFKECCEQPVGEGJQLGPCCFOKPKUVTCQRDNKEC
1&GETGVQP EQPVOPQUGW#PGZQ+WOKPUVTWOGPVQFGCXCNKCQ
FG KORCEVQ EQO DCKZQ ITCW FG KPVGTPCNK\CQ PC TQVKPC FQU IGUVQTGU RDNKEQU
DTCUKNGKTQU0QUUGWUUKUVGOCUFGIGUVQFCGNCDQTCQFGCVQUSWCPFQGZKUVGPVGU
no so contempladas ferramentas dessa natureza, como o caso da Secretaria da
Receita Federal.

Fonte: DELLEY (2004)

/QFGNQURTGUGPVGUPQUKUVGOCLWTFKEQPCEKQPCN
RQTGZTGURQPUCDKNKFCFGUECN UQ
QTKWPFQUFGRCUGUFGVTCFKQFGcommon law. Por sua vez, como foi mencionado,
pases de civil lawCRTGUGPVCOWOCVTCFKQPCSWCNCNGIKUNCQQEWRCWONWICT
EGPVTCN PQ UKUVGOC FCU HQPVGU FQ FKTGKVQ G C ECFC FKC C CVKXKFCFG FG GNCDQTCQ
NGIKUNCVKXCQEWRCEQPUKFGTXGNGURCQPQGNGPEQFGCGUIQXGTPCOGPVCKU
#UUKOCFKUEWUUQJQFKGTPCUQDTGQCXCPQOGVQFQNIKEQRCTCCIGUVQFGRTQLGVQU
NGIKUNCVKXQUCRVQUCRTQRKEKCTCRGTURGEVKXCFQRNCPGLCOGPVQGRCTCCTGEQPUVTWQ
FQEGPTKQRTGUGPVG
CUGTQDLGVQFCCQNGIKUNCVKXC RGTRCUUCCCTVKEWNCQFCTGFG
FG KPHQTOCGU LWTFKECU KFPGCU
RTKOTKCU CWVPVKECU PVGITCU G CVWCNK\CFCU 
RGTOKVKPFQQFGNKPGCOGPVQFQRTQDNGOCQDLGVQFCCQNGIKUNCVKXCFQUKORCEVQU
e dos afetados.
242

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

5 CONCLUSO
#GNCDQTCQNGIKUNCVKXCFQ'ZGEWVKXQWOCCVKXKFCFGSWGGZKIGWOOQFGNQFGIGUVQ
GURGEEQFKCPVGFQSWCFTQJQFKGTPQFCUQEKGFCFGFCKPHQTOCQCUGTEQPHQTOCFQ
RGNC.GKFG#EGUUQ+PHQTOCQ
# XCUVC VKRQNQIKC FG CVQU GZKUVGPVGU G FURCTGU PC CFOKPKUVTCQ RDNKEC FKTGVC G
indireta acha-se em desconformidade com a literatura jurdica especializada e com as
DQCURTVKECUGRQNVKECUFGDQCNGIKUNCQGZRTGUUCUGOOQFGNQUFGcivil law (direito
continental) e de common law.
#DCKZCSWCPVKFCFGFGGUVWFQUSWGVGPJCORQTQDLGVQCIGUVQFCGNCDQTCQNGIKUNCVKXC
RGNQ'ZGEWVKXQ
SWGNGXGGOEQPVCCGUVTWVWTCFQTIQQRGTNOWNVKFKUEKRNKPCT
FQU UGTXKFQTGU GPXQNXKFQU PQ RTQEGUUQ UWC ECRCEKVCQ G Q FGUGPXQNXKOGPVQ FG
HGTTCOGPVCU SWG RQUUCO CNKCT TGFCQ CQ RNCPGLCOGPVQ EQO XKUVCU  GHGVKXKFCFG
do futuro ato), notadamente nos subsistemas normativos complexos, como o
o referente Receita Federal, acaba por vulnerabilizar tanto o trabalho dos
FGUVKPCVTKQUGZGEWVQTGUSWCPVQQFQFGUVKPCVTKQJKRQUUWEKGPVGQEQPVTKDWKPVG
#CVKXKFCFGFGGNCDQTCQNGIKUNCVKXCGUVTCVIKEC#GUSWGXKUGOCQUCPGCOGPVQ
FQ UKUVGOC XKIGPVG UKORNKSWGO C VKRQNQIKC FG CVQU PQTOCVKXQU G RTQRKEKGO Q
CORNQCEGUUQCQFKTGKVQXKIGPVGEQPEQTTGORCTCCKPVGTCQGPVTG4GEGKVC(GFGTCN
FQ$TCUKNGEQPVTKDWKPVGQHGTGEGOEQPFKGURCTCCVKXKFCFGFGEQPVTQNGTGHQTCOC
KOCIGOKPUVKVWEKQPCNFGKFQPGKFCFGPCGZGEWQFCUCVKXKFCFGUPCNUVKECUCNOFG
responderem ao reclame de transparncia e publicidade prprios do nosso tempo.
0QTOCU UQDTG RTQFWQ FG CVQU PQTOCVKXQU PGEGUUKVCO UGT XGKEWNCFCU RQT CVQU
normativos de maior hierarquia que lhes garanta um prazo de vigncia maior com
QOFGETKCTWOCEWNVWTCQTICPK\CEKQPCNFGDQCNGIKUNCQ#GFKQFGWOCVQ
PKEQSWGEQPVGORNCUUGCUCGUUWIGTKFCUPQKVGOCPVGTKQTEQOKPEKFPEKCUQDTG
todos os rgos com competncia normativa na RFB, garantiria maior uniformidade
VKRQNIKECGHCEKNKVCTKCCGZVTCQFGKPHQTOCGUPQUDCPEQUFGFCFQUFGKPHQTOCGU
jurdicas.
Urge o saneamento no sistema da RFB, ocorrido pela ltima vez no ano 2000, com a
CQKPKEKCNFGTGXQICQGZRTGUUCFGVQFQUQUCVQUKORNKEKVCOGPVGTGXQICFQUECFWEQU
QDLGVQFGFGEKUQFGPKVKXCFGKPEQPUVKVWEKQPCNKFCFGQWOGUOQKPEQORCVXGKUEQO
QUEQOCPFQUFC.GKFG#EGUUQ+PHQTOCQ#TGRWDNKECQCPWCNFCNGIKUNCQ
vigente uma boa prtica internacional a ser seguida.
# TGEQPUVTWQ FCU HQPVGU FQ FKTGKVQ UQDTG VGOCU FC EQORGVPEKC FC 4($ UGTKC
HCEKNKVCFCGQVKOK\CFCEQOCKPVGITCQFQ5KLWVCQ.GZ/.

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

243

Fabiana de Menezes Soares

REFERNCIAS
$4#5+.1TFGOFG5GTXKQ15%QUKVPFGFGQWVWDTQFG
AAAAAA1TFGOFG5GTXKQ15%QUKVPFGFGOCTQFG
______. Portaria SRF 001, de 2 de janeiro de 2001.
______. Portaria MF n. 203, de 14 de maio de 2012 (publicada no DOU de 17 de
OCKQFGEQOGEEKCFKHGTKFCRCTCFGLWNJQFG 
______. Secretaria da Receita Federal do Brasil. Manual de redao e elaborao
de atos administrativos da Receita Federal do Brasil %QQTFGPCQ &QTKXCN
Padovan. 1. ed. Braslia: Secretaria da Receita Federal do Brasil, 2011. 215 p.
CANADA. Federal regulations manual&TCHVKPICPF#FXKUQT[5GTXKEGU)TQWR
ISBN 0-662-26392-8 . Cat. n. BT22-57/1998E Revised version (Part 2 in 2003,
Appendix B to Part 2 in 2011, and Part 4 in 2008, 2010 and 2011).
______. Statutes Repeal Act -S.C. 2008, c. 20.
AAAAAA5VCVWVQT[5VTWOGPVU#EV45%%5
______. Loi sur le textes rglamentaires LRC, 1985, Ch.S22.
&'..';,GCP&CPKGN2CTCRGPUCTCNGK+PVTQFWQCWORTQEGFKOGPVQOGVFKEQ
Cadernos da Escola do Legislativo, Belo Horizonte, v. 7, n. 12, p. 101-143, jan./
jun. 2004.
&'4<+ /KUCDGN #DTGW /CEJCFQ # FQWVTKPC FCU EQPVTKDWKGU G QU FKTGKVQU G
garantias fundamentais dos contribuintes. Caderno de Direito Comparado, v. 1,
p. 7-32, 2007.
&7#46'&CXKF4GRGPUCTCQTICPK\CQGCSWCNKFCFGFQQTFGPCOGPVQLWTFKEQ
FCUPQTOCUUGEWPFTKCUKPVGTXGPQPQTOCVKXCGUVTWVWTCNLegislao Cadernos
de Cincia de Legislao, INA, Oeiras, Portugal, n. 53, p. 35-46, out./dez. 2010.
FREIRE, Joo Pedro. Linguagem clara e legstica. Legislao Cadernos de Cincia
de Legislao, INA, Oeiras, Portugal, n. 53, p. 19-34, out./dez. 2010.
GUASTINI, Riccardo. Das fontes s normas6TCFWQFG'FUQP$KPK5Q2CWNQ
Editora Quartier Latin, 2005.
/'0')7+0(GTPCPFQ$QTCVQ$7)#4+0/CWTKEKQ5O papel das instituies
nos incentivos para a gesto pblica. Braslia: Ncleo de Estudos e Pesquisas do
Senado Federal nov. 2012 (Texto para discusso, n. 118). Disponvel em: <www.
senado.gov.br/conleg/nepsf1.html>. ISSN 1983-0645.
MORAND, Charles-Albert. lments de lgistique formelle et materielle.
Lgistique Formelle et Materielle. Aix-en-Provence: Presses Universitaires DAixMarseille-PUAM, 1999. p. 45.
41$+05109KNNKCO#EGUUKDKNKV[QH'WTQRGCP7PKQP.GIKUNCVKQP. Legislao
244

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

Cadernos de Cincia de Legislao, INA, Oeiras, Portugal, n. 53, p. 47-69, out./


dez. 2010.
SOARES, Fabiana de Menezes. A legstica aplicada defesa agropecuria: diagnstico
e prognstico de um sistema normativo complexo. In: BATISTA JUNIOR, Onofre
#NXGU%#56415GTIKQ2GUUQCFG2CWNC
%QQTF Tendncias e perspectivas do
direito administrativo: uma viso da escola mineira. Belo Horizonte: Frum, 2012.
p. 383-410. ISBN 978-85-7700-576-5.
AAAAAA 1 RCRGN FC NGIUVKEC PQU RTQEGUUQU FG KPVGITCQ
#NEC  Q ECUQ $TCUKN
Canad em sede de planejamento legislativo. Legislao Cadernos de Cincia
de Legislao, INA, Oeiras, Portugal, n. 40, p.5-27, abr./jun. 2005.
AAAAAA&GEQFKECVKQPCPFNGIKUCEVKQP+P/#&'4.W\KWU6#8#4'5/CTVC
(Org.). Quality of legislation: principles and instruments. Baden: Nomos,
)GTOCP[PXR$TQUEJKGTV5+5$0

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

245

Fabiana de Menezes Soares

ANEXOS LEGISLAO

246

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

247

Fabiana de Menezes Soares

248

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

249

Fabiana de Menezes Soares

250

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

251

Fabiana de Menezes Soares

252

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Simplificao e elaborao da legislao tributria infralegal: notas sobre o acesso


ao direito vigente e a gesto da elaborao legislativa pelo Executivo

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

253

Fabiana de Menezes Soares

Fluxo de elaborao de atos de contedo normativo: Instruo


O OBJETO DO ATO
DETERMINA O RGO
ESPECFICO QUE
IMPULSIONA O
PROCEDIMENTO DE
ELABORAO

COORDENAO
REFERENTE DIVISO
DE ORIGEM DO IMPULSO

DIVISO DE
SISTEMATIZAO E
DISSEMINAO DE
NORMAS: DISIS

COORDENAO GERAL
DE TRIBUTAO: COSIT

SECRETRIO
DA RECEITA FEDERAL

PUBLICAO
(GABINETE RFB)

Fluxo de elaborao de atos de contedo normativo: Portaria


Impulso para registrar
originado pelas autoridades
competentes para edio e
ou interessadas (Ministro,
Secretrio, Subsecretrio
Coordenadores)

Coordenaes

Coordenao Geral

Secretrio

Subsecretaria

Disis

Ministro

254

Cad. Fin. Pbl., Braslia, n. 12, p. 219-254, dez. 2012

Transao tributria e interesse pblico


Daniela Figueiredo Oliveira Frana
Ferreira
Procuradora da Fazenda Nacional
Especialista em Direito Tributrio pela Escola de
#FOKPKUVTCQ(C\GPFTKC
'UCH

Resumo
O ordenamento jurdico brasileiro elenca, no artigo
156 do Cdigo Tributrio Nacional, a transao
como forma de extino do crdito tributrio.
Todavia, at pouco tempo, tal instituto foi relegado
a segundo plano, com baixo grau de utilizao. Foi
apenas na ltima dcada que alguns estados membros
e municpios da Federao comearam a enxergar
a transao como uma maneira alternativa para
a soluo das controvrsias tributrias, as quais
frequentemente se arrastam por longos anos tanto
nos tribunais administrativos como nos judiciais.
No mbito federal, a Unio tambm comea a ver
com bons olhos o instituto da transao. prova
disso o encaminhamento de Anteprojeto de Lei
Geral de Transao Tributria ao Poder Legislativo
em abril de 2008, que faz parte de um conjunto de
medidas que visa a implementar formas de soluo
de controvrsias consensuais e implica uma mudana
de paradigma na relao entre Fisco e contribuinte.
Tal iniciativa inovadora, todavia, encontra
opositores, que normalmente apontam a supremacia
e a indisponibilidade do interesse pblico, que tem
reflexos na indisponibilidade do crdito tributrio,
bem como a mitigada discricionariedade conferida
administrao qual compete cobrar o tributo
mediante atividade plenamente vinculada, como
empecilhos para a consolidao de um modelo de
resoluo de controvrsias baseado no consenso.
Neste estudo busca-se esclarecer que, por vezes,
a consecuo de um interesse pblico primrio
depende do sacrifcio de um interesse pblico
secundrio, isto , diante de diversos interesses
pblicos, por vezes conflitantes, faz-se mister eleger
um que melhor atender ao bem comum, ainda que,
momentaneamente, outros tenham de ser preteridos.
Nesse contexto, conclui-se que a transao tributria
uma alternativa vivel para lidar com os problemas
relacionados s controvrsias fiscais e plenamente
consentnea com o ordenamento jurdico brasileiro.
Os benefcios inerentes a esse instituto, tal como a
transparncia, a celeridade, a desburocratizao e a
eficincia nas relaes entre o Fisco e o contribuinte,
com reflexos diretos na qualidade do servio pblico
prestado, parecem superar em muito eventual perda
de arrecadao.

Palavras-chave
Transao tributria. Interesse pblico.

Abstract
The Brazilian judicial mandate lists, on the article
156 of the National Tax Code, the transaction as
a form of extinction of the tax credit. However,
until not long ago, such institute was relegated
to the background, with low level of use. Only in
the past decade some states and municipalities of
the Federation began to see the transaction as an
alternative form of solution to tax controversies, that
often drag themselves through many years not only in
administrative courts but also in regular ones. In the
federal field, the State also begins to see the institute of
transaction with good eyes. A good proof of that is the
handling of the Tax Transaction General Law Draft
to the Legislative Power, on April 2008, that is part of
a group of measures that aims to implement solution
forms of consensual controversies, and it involves a
paradigm change in the relation between the Tax
Authorities and the taxpayers. Such innovative
initiative, however, meets opponents, that normally
point out to the supremacy and to the public interest
unavailability, which reflects on the tax credit
unavailability, as well as the mitigated discretion
given to the Administration, which should charge
the tax through fully bounded activity, with obstacles
to the consolidation of the resolution model of the
controversies based on the consensus. This study seeks
to clarify that the attainment of the primary public
interest depends on the sacrifice of the secondary
public interest. In other words, before various public
interests, conflicting at times, it is necessary to select
one of them that will better serve the common good,
even if other interests have to momentarily be put
aside. In this context, this study concludes that the tax
transaction is a viable alternative to handle problems
related to the tax controversies and fully consistent
with the Brazilian judicial mandate. The inherent
benefits of this institute, such as transparency,
celerity, debureaucracy and efficiency between the
Tax Authorities and the taxpayers, with direct
impacts on the quality of the public service provided,
seem to well overcome the loss of tax revenue.

Keywords
Tax transaction. Public interest.

Cad. Fin. Pbl., Braslia, n. 12, p. 255-281, dez. 2012

255

Daniela Figueiredo Oliveira Frana Ferreira

1 INTRODUO
1OQFGNQCVWCNFGCFOKPKUVTCQUECNFUKPCKUFGKPECRCEKFCFGRCTCTGUQNXGTQU
FGUCQUSWGNJGUQUWDOGVKFQU#ETGUEGPVGFGOCPFCFCGUVTWVWTCEQPVGPEKQUC
seja no mbito judicial seja no administrativo, j ultrapassou a capacidade que os
TIQUTGURQPUXGKURQTFGEKFKTQUNKVIKQUVTKDWVTKQUVOFGRTOCVCKUEQPKVQU
FGHQTOCENGTGGGEKGPVG
So elucidativos, nesse sentido, dados divulgados recentemente pelo Conselho
0CEKQPCNFG,WUVKCQUSWCKUFQEQPVCFGSWGCUGZGEWGUUECKUTGRTGUGPVCO
UQ\KPJCUFQVQVCNFGECUQURGPFGPVGUFCRTKOGKTCKPUVPEKCFC,WUVKC'UVCFWCN
o que corresponde a quase 21 milhes de processos, tendo esses uma taxa de
EQPIGUVKQPCOGPVQFGQSWGUKIPKECSWGFGECFCEGOGZGEWGUUECKUGO
VTCOKVCQCRGPCUQKVQUQDCKZCFCUPQOGUOQCPQ
%105'.*10#%+10#.
DE JUSTIA, 2011, p. 59).
0QODKVQCFOKPKUVTCVKXQEWORTGFGUVCECTCUKPHQTOCGUEQPUVCPVGUPQTGNCVTKQ
de gesto do Conselho Administrativo de Recursos Fiscais (Carf), segundo o qual o
nmero de processos aguardando julgamento em 31 de dezembro de 2009 girava em
torno de 65 mil, tendo sido decididos naquele ano 14.260 casos. Ainda de acordo com
VCNFQEWOGPVQRCTCQCPQFGQWZQFGGPVTCFCGURGTCFQGTCFGOKNPQXQU
processos (CONSELHO ADMINISTRATIVO DE RECURSOS FISCAIS, 2009).
Os nmeros so alarmantes. O quadro institucional delineado exige a busca imediata
FGOCPGKTCUCNVGTPCVKXCUFGTGUQNWQFGEQPVTQXTUKCUUECKU0GUUGEQPVGZVQGZUWTIG
CIWTCFCVTCPUCQVTKDWVTKCKPUVKVWVQLWTFKEQLRTGXKUVQPQCTVFQ%FKIQ
6TKDWVTKQ0CEKQPCNEQOQHQTOCFGGZVKPQFQETFKVQVTKDWVTKQOCUXKUVQEQO
FGUEQPCPCRQTFKXGTUQUGUVWFKQUQUSWGCRQPVCOCKPFKURQPKDKNKFCFGFQETFKVQ
VTKDWVTKQGCRQWECFKUETKEKQPCTKGFCFGEQPHGTKFCCFOKPKUVTCQUECNEQOQDKEGU
EQPUQNKFCQFCVTCPUCQVTKDWVTKCPQPQUUQUKUVGOCLWTFKEQ
0GUVGVTCDCNJQDWUECUGGZRNQTCTQVGOCFCVTCPUCQVTKDWVTKCCPCNKUCPFQUGWU
NKOKVGUGUWCURQUUKDKNKFCFGUEQOGURGEKCNFGUVCSWGRCTCCTGNCQGZKUVGPVGGPVTGGUUG
KPUVKVWVQGQKPVGTGUUGRDNKEQ8KUCUGGOUWOCCEJCOCTCCVGPQRCTCWOCIWTC
jurdica at o momento pouco utilizada em nosso pas, mas com grande potencial
FG OQFKECT RCTCFKIOCU GO GURGEKCN C HQTOC FG TGNCEKQPCOGPVQ GPVTG (KUEQ G
contribuinte, e reduzir a litigiosidade tributria. Pretende-se, pois, demonstrar que
HQTOCUEQPUGPUWCKUFGTGUQNWQFGEQPKVQUVCNEQOQCVTCPUCQVTKDWVTKCRQFGO
UGT WO ECOKPJQ KPVGTGUUCPVG RCTC CWOGPVCT Q ITCW FG GEKPEKC CFOKPKUVTCVKXC
GFCTRQRWNCQWOCTGURQUVCOCKUUCVKUHCVTKCUEQPVGPFCUUECKU

2 CONSIDERAES INICIAIS SOBRE A RELAO EXISTENTE


ENTRE TRANSAO TRIBUTRIA E INTERESSE PBLICO
# DWUEC FG HQTOCU EQPUGPUWCKU RCTC C UQNWQ FG EQPVTQXTUKCU VTKDWVTKCU 
WOC VGPFPEKC OWPFKCN 1 OQFGNQ VTCFKEKQPCN DCUGCFQ PC EQPEGRQ FG WO
256

Cad. Fin. Pbl., Braslia, n. 12, p. 255-281, dez. 2012

Transao tributria e interesse pblico

Estado-imprio que, de forma autoritria, dita as regras e no d abertura para o


GUVCDGNGEKOGPVQFGFKNQIQGPVTGCFOKPKUVTCQUECNGEQPVTKDWKPVGFUKPCKUFG
incapacidade para lidar com a complexidade e a multiplicidade de problemas que
TQPFCOCUQEKGFCFGCVWCNGGPEQPVTCOTGGZQUPQFKTGKVQVTKDWVTKQ
0GUUGEQPVGZVQQKPUVKVWVQFCVTCPUCQVTKDWVTKCGZUWTIGEQOQWOCCNVGTPCVKXC
RCTCCUQNWQFGEQPVTQXTUKCUUECKU6TCVCUGFGEQPVTCVQRQTOGKQFQSWCNC
CFOKPKUVTCQVTKDWVTKCGQEQPVTKDWKPVGEQPEQTFCOGOEQPENWKTWONKVIKQGO
EWTUQQWRTGXKPGOQKPEKQFGWOEQPKVQGPVTGCODQURQTOGKQFGEQPEGUUGU
mtuas (ROSEMBUJ, 2000, p. 10).
Coloma (2005, p. 140-141), doutrinadora espanhola, ao tratar do conceito de
VTCPUCQVTKDWVTKCGZVTCKUGWUGNGOGPVQUECTCEVGTK\CFQTGU
1U GNGOGPVQU GUUGPEKCKU SWG ECTCEVGTK\CO C VTCPUCQ RQFGTKCO UGT
sistematizados em torno dos trs aspectos seguintes, a saber: em primeiro lugar,
PCVTCPUCQJWOCTGNCQLWTFKECKPEGTVCUWUEGVXGNFGRTQXQECTNKVIKQUQW
ao menos incerta subjetivamente para as partes, mesmo quando, objetivamente,
PQJCLCHWPFCOGPVQRCTCCFXKFC'OUGIWPFQNWICTGZKUVGCKPVGPQFCU
RCTVGUFGUWDUVKVWKTCTGNCQFWXKFQUCRQTWOCTGNCQEGTVCGKPEQPVGUVXGN
Finalmente, ocorrem as concesses recprocas por parte dos interessados, de
OQFQSWGHCCOEGTVQUCETKHEKQFGOCPGKTCFGPKVKXCGPQRTQXKUTKC

#VTCPUCQVTKDWVTKCRTGUUWRGRQKUCKPVGPQFGCODCUCURCTVGUEQPVTKDWKPVG
GCFOKPKUVTCQVTKDWVTKCFGTGCNK\CTGOEQPEGUUGUTGERTQECUEQOQQDLGVKXQFG
EGNGDTCTCEQTFQSWGRQPJCOUEQPVGPFCUUECKU
0Q QTFGPCOGPVQ LWTFKEQ DTCUKNGKTQ C VTCPUCQ VTKDWVTKC GUV RTGXKUVC
GZRTGUUCOGPVGEQOQHQTOCFGGZVKPQFQETFKVQVTKDWVTKQPQCTVKIQ+++
da Lei n. 5.172/1966, estando seus contornos delineados no artigo 171 do citado
diploma legal, que assim dispe:
#TV#NGKRQFGHCEWNVCTPCUEQPFKGUSWGGUVCDGNGCCQUUWLGKVQUCVKXQ
GRCUUKXQFCQDTKICQVTKDWVTKCEGNGDTCTVTCPUCQSWGOGFKCPVGEQPEGUUGU
OVWCU KORQTVG GO FGVGTOKPCQ1 FQ NKVIKQ G EQPUGSWGPVG GZVKPQ FG
crdito tributrio.
Pargrafo nico. A lei indicar a autoridade competente para autorizar
CVTCPUCQGOECFCECUQ
$4#5+..GKP 

Registre-se que, apesar de estar previsto h longa data no ordenamento brasileiro,


CJKUVTKCTGXGNCSWGCVTCPUCQVTKDWVTKCPQHQKOWKVQWVKNK\CFCGOPQUUQRCU
Observa-se que apenas a partir da ltima dcada que alguns estados-membros
G OWPKERKQU EQOGCTCO C UG KPVGTGUUCT RQT GUUC IWTC LWTFKEC SWG KORQTVC
 'OTGNCQCQVGTOQFGVGTOKPCQEQPUVCPVGPQCTVFQ%60EWORTGTGIKUVTCTSWGJGUVWFKQUQUSWG
GPVGPFGOVGTJCXKFQGTTQPCGUEQNJCFCGZRTGUUQRGNQNGIKUNCFQTSWGFGXGTKCVGTWUCFQCRCNCXTCVGTOKPCQ
PGUUGUGPVKFQGPVTGQWVTQU)QFQ[
R 1WVTQUCWVQTGUVQFCXKCGPVGPFGOSWGQVGTOQHQKWVKNK\CFQ
CFGSWCFCOGPVGEQOQUGPVKFQFGFGEKUQQWTGUQNWQQSWGCHKTOC&EQOQ
R 

Cad. Fin. Pbl., Braslia, n. 12, p. 255-281, dez. 2012

257

Daniela Figueiredo Oliveira Frana Ferreira

GZVKPQFQETFKVQVTKDWVTKQ0QODKVQHGFGTCNRGTEGDGUGSWGQKPUVKVWVQCV
JQLGHQKRQWEQGZRNQTCFQCRGUCTFGCNIWOCUVGPVCVKXCUPQRCUUCFQFGWVKNK\CQFC
VTCPUCQVTKDWVTKCRCTCRTOCNKVIKQUUECKUVCNEQOQCCWVQTK\CQEQPHGTKFC
a procuradores da Repblica para transigir com o sujeito passivo com o objetivo
FGGPEGTTCTCUECWUCUUECKUCLWK\CFCUGRGPFGPVGUFGLWNICOGPVQ2
'UUGSWCFTQGPVTGVCPVQGOSWGUGEQPHGTKCRQWECKORQTVPEKCVTCPUCQVTKDWVTKC
EQOGCCUGOQFKECT#PGEGUUKFCFGFGUGDWUECTOCPGKTCUCNVGTPCVKXCUFGUQNWQ
de controvrsias tributrias, em virtude do esgotamento do modelo tradicional, fez
EQOSWGCCFOKPKUVTCQUECNDTCUKNGKTCRCUUCUUGCXGTEQODQPUQNJQUQKPUVKVWVQ
FC VTCPUCQ VTKDWVTKC CV GPVQ TGNGICFQ C UGIWPFQ RNCPQ 'UUC OWFCPC FG
perspectiva pode ser constatada pelo surgimento de diversas iniciativas legislativas
RCTCTGIWNCOGPVCTQKPUVKVWVQFCVTCPUCQVTKDWVTKCPQURNCPQUOWPKEKRCN3 estadual4
e federal.
'O TGNCQ C GUVG NVKOQ RNCPQ ECDG NGODTCT Q #PVGRTQLGVQ FG .GK )GTCN FG
6TCPUCQ6TKDWVTKCGPECOKPJCFQRGNQ2QFGT'ZGEWVKXQCQ%QPITGUUQ0CEKQPCN
(PL n. 5.082/2009)5GOFGCDTKNFGEWLCOQXKOGPVCQTGCEGPFGWCFKUEWUUQ
UQDTGCXKCDKNKFCFGFCWVKNK\CQFQKPUVKVWVQFCVTCPUCQVTKDWVTKCPQQTFGPCOGPVQ
jurdico brasileiro, bem como sobre seus limites e suas possibilidades.
 #.GKPFGSWGTGIWNCXCQ/KPKUVTKQ2DNKEQQSWCNFGVKPJCEQORGVPEKCRCTCEQDTCPC
FCFXKFCCVKXCFC7PKQRGTOKVKCSWGQURTQEWTCFQTGUFC4GRDNKECFGXKFCOGPVGCWVQTK\CFQURCTCCVWCQ
no caso concreto, pudessem transigir com o contribuinte no intuito de encerrar as causas fiscais ajuizadas e
RGPFGPVGUFGLWNICOGPVQ#RTQRUKVQEQPHKTCUGCTGFCQFQCTVFCCPVKIC.GK1TIPKECFQ/KPKUVTKQ
Pblico: Art. 23. Salvo quando autorizados pelo Procurador Geral, os rgos do Ministrio Pblico da Unio
PQRQFGOVTCPUKIKTEQORTQOGVGTUGEQPHGUUCTFGUKUVKTQWHC\GTEQORQUKGU2CTITCHQPKEQ5GORTGSWG
julgarem conveniente, devero representar confidencialmente ao Procurador-Geral para que este, opinando
CTGURGKVQQDVGPJCFQRQFGTEQORGVGPVGCPGEGUUTKCCWVQTK\CQRCTCVTCPUKIKTEQPHGUUCTFGUKUVKTQWHC\GT
EQORQUKGU
 0Q RNCPQ OWPKEKRCN ECDG TGIKUVTCT CU KPKEKCVKXCU FG VTCPUCQ VTKDWVTKC RTGUGPVGU GO %CORKPCU
.GK P
13.449, de 23/10/2008, regulamentada pelo Decreto n. 16.452, de 04/11/2008), Belo Horizonte (Lei n. 8.725,
de 30/12/2003, regulamentada pelo Decreto n. 12.926, de 05/11/2007) e Curitiba (Lei Complementar
n. 68, de 1o/07/2008).
4 A ttulo exemplificativo destacam-se, no plano estadual, as experincias de Pernambuco (Lei Complementar
n. 105, de 20/12/2007, regulamentada pelo Decreto n. 32.549, de 28/10/2008) e do Rio Grande do Sul
(Lei n. 11.475, de 28/04/2000).
 6TCVCUGFGTGXKUQFCNGIKUNCQTGHGTGPVGEQDTCPCFQETFKVQVTKDWVTKQEQOQQDLGVKXQFGTCEKQPCNK\CQFQU
RTQEGFKOGPVQUGOODKVQLWFKEKCNGCFOKPKUVTCVKXQEWLQGURTKVQTGUKFGPCDWUECFGUQNWQFGEQPVTQXTUKCUFG
HQTOCEQPUGPUWCNQSWGKORNKECWOCOWFCPCFGRCTCFKIOCPCTGNCQGPVTG(KUEQGEQPVTKDWKPVG1TGHGTKFQ
RTQLGVQFGNGKRTQRGSWCVTQOQFCNKFCFGUFGVTCPUCQVTKDWVTKCCUCDGTC VTCPUCQGORTQEGUUQLWFKEKCN
D VTCPUCQPCKPUQNXPEKCEKXKNPCTGEWRGTCQLWFKEKCNGPCHCNPEKCE VTCPUCQRQTTGEWRGTCQVTKDWVTKCG
F VTCPUCQCFOKPKUVTCVKXCRQTCFGUQ
CTV 'OSWCNSWGTFCUOQFCNKFCFGUC(C\GPFC0CEKQPCNRQFGTGO
LW\QFGEQPXGPKPEKCGQRQTVWPKFCFGQDUGTXCFQUQUNKOKVGURTGXKUVQUPQRTRTKQRTQLGVQEGNGDTCTVTCPUCQ
sempre que motivadamente entender que atende ao interesse pblico (art. 1ohPKEQ 4GUUCNVGUGCURGEVQ
relevante referente ao alcance: o artigo 6oFQRTQLGVQFGNGKGUVCDGNGEGSWGGORTKPERKQCVTCPUCQURQFG
abranger multas, de mora e de ofcio, juros de mora, encargos de sucumbncia, demais encargos de natureza
RGEWPKTKCXCNQTGUQHGTGEKFQUEQOQICTCPVKCQWGOUKVWCGUGOSWGCKPVGTRTGVCQFCNGIKUNCQUGLCEQPHNKVWQUC
QWNKVKIKQUC2GTEGDGUGRQTVCPVQSWGGOTGITCPQJCXGTGURCQRCTCPGIQEKCQCEGTECFQOQPVCPVGFQ
tributo devido, como expressamente previsto no artigo 7o+FQRTQLGVQFGNGK#GZEGQHKECRQTEQPVCFQU
ECUQUSWGGPXQNXCOFKUEWUUQGOVQTPQFGEQPEGKVQKPFGVGTOKPCFQFQFKTGKVQQWKFGPVKHKECQGTGNGXPEKCFG
HCVQEWLQTGUWNVCFQUGLCCTGFWQFGRCTVGFQETFKVQVTKDWVTKQ
CTVoho). De acordo com o projeto de
NGKCVTCPUCQCRGTHGKQCUGGGZVKPIWGQETFKVQVTKDWVTKQCRUQEWORTKOGPVQKPVGITCNFCUQDTKICGUGFCU
EQPFKGURCEVWCFCUPCUENWUWNCUFQTGURGEVKXQVGTOQ
CTVho, I).

258

Cad. Fin. Pbl., Braslia, n. 12, p. 255-281, dez. 2012

Transao tributria e interesse pblico

0QUGRQFGQNXKFCTSWGJPCFQWVTKPCRVTKCXQ\GUSWGUGQRGOEQPUQNKFCQFQ
KPUVKVWVQFCVTCPUCQEQOQHQTOCFGGZVKPQFQETFKVQVTKDWVTKQRQTEQPUKFGT
la incompatvel com o ordenamento jurdico brasileiro. o caso de Jardim, que
EQPUKFGTCUGTKPEQPUVKVWEKQPCNQCTVKIQFQ%601CWVQTKFGPVKECWOEQPKVQ
entre a norma insculpida no art. 3o da Lei n. 5.172/1966, que prescreve ser o tributo
WOCRTGUVCQRGEWPKTKCEQDTCFCOGFKCPVGCVKXKFCFGCFOKPKUVTCVKXCRNGPCOGPVG
XKPEWNCFC G Q CTVKIQ  FQ OGUOQ FKRNQOC NGICN SWG CFOKVG C VTCPUCQ 'NG
defende, em suma, a tese da indisponibilidade do crdito tributrio, que provm
FGWOCQDTKICQex lege (JARDIM, 1998, p. 402).%QPTCUG
6GOQUSWGCVTCPUCQCIWTCUGCDUQNWVCOGPVGKPEQORCVXGNEQOQTGIKOG
LWTFKEQVTKDWVTKQRQTSWCPVQQURNCPQUFQPCUEKOGPVQGZKUVPEKCGGZVKPQ
FQUVTKDWVQUUQUWDOGVKFQUGFKQFGCVQUCFOKPKUVTCVKXQUFCECVGIQTKCFQU
vinculados, os quais, pela prpria ndole, no se compaginam com a liberdade
KPGTGPVGCQKPUVKVWVQFCVTCPUCQEWLQFGUGPJQEQPEGRVWCNEQOQXKOQUFG
ver, pressupe um acordo de vontades, em que o sujeito passivo ativo e sujeito
passivo decidem abrir mo de certos direitos com o desgnio de pr termo a
WOCFGOCPFC&GXGTCUQCVQXKPEWNCFQKORG#FOKPKUVTCQCCFQQFG
WOPKEQEQORQTVCOGPVQRQUUXGNFKCPVGFGWOCUKVWCQRTGIWTCFCGO
termos objetivos, segundo preleciona Celso Antnio Bandeira de Mello, donde
VQTPCUGKPEQPEKNKXGNEQOCVTCPUCQ
,#4&+/R 

No mesmo sentido manifesta-se Lima, que considera ser juridicamente invivel


SWGCFOKPKUVTCQUECNGEQPVTKDWKPVGRQPJCOOCNKVIKQURQTOGKQFCEGNGDTCQ
FG CEQTFQU SWG GPXQNXCO EQPEGUUGU OVWCU VCN EQOQ QEQTTG PC VTCPUCQ
1CWVQTGPVGPFGSWGVCNRTQRQUVCFGUQNWQFGEQPVTQXTUKCURTGXKUVCPQUCTVKIQU
156, III, e 171, do CTN, esbarra no princpio da indisponibilidade do interesse
RDNKEQSWGPQODKVQUECNGPEQPVTCTGGZQUPQRQUVWNCFQFCKPFKURQPKDKNKFCFG
FQETFKVQVTKDWVTKQ8GLCUGQSWGQGUVWFKQUQRGPUCCEGTECFQKPUVKVWVQFCVTCPUCQ
tributria:
# VTCPUCQ PQ FKTGKVQ VTKDWVTKQ VGO EQOQ QDLGVKXQ VGTOKPCT Q NKVIKQ
Tambm de ver no haver qualquer viabilidade de concesses mtuas, em
face da prevalncia do princpio da indisponibilidade do interesse pblico.
O crdito tributrio no est sujeito a renncia parcial ou total pelos agentes
responsveis pelo recebimento, por no se revestir de direito patrimonial de
carter privado, diga-se aqui, um dos elementos essenciais e inafastveis na
IWTCFCVTCPUCQ
.+/#R 

E, guisa de concluso, o autor complementa:


&GRQKUFCCPNKUGFGVCNJCFCUQDTGCVTCPUCQGUVCDGNGEGPFQEQPHTQPVQUPC
aplicabilidade do instituto dentro do Direito Civil e do Direito Tributrio,
chegamos concluso de serem as normas contidas nos arts. 156, III, e 171,
FQ%60PQGEC\GUPQOWPFQLWTFKEQVTKDWVTKQRQTUGTGOKPCFGSWCFCU
e imprprias para aplicabilidade neste tipo de Direito, em face da prevalncia
da indisponibilidade do interesse pblico, bem como por no residirem no
Cad. Fin. Pbl., Braslia, n. 12, p. 255-281, dez. 2012

259

Daniela Figueiredo Oliveira Frana Ferreira

Direito Tributrio os elementos essenciais e as caractersticas existentes no


Direito Civil (LIMA, 2003, p. 11).

%QPUVCVCUGEQODCUGPCUVTCPUETKGUCPVGTKQTOGPVGEQNCEKQPCFCUSWGQURTKPEKRCKU
GORGEKNJQUCRQPVCFQURQTCSWGNGUSWGUGKPUWTIGOEQPVTCCVTCPUCQVTKDWVTKCUQC
CWUPEKCFGFKUETKEKQPCTKGFCFGFCCFOKPKUVTCQSWGGZKIGCEQDTCPCFGVTKDWVQRQT
HQTCFGPQTOCNGICNGCEQPUGSWGPVGKPFKURQPKDKNKFCFGFQETFKVQVTKDWVTKQSWG
encontra suas premissas na indisponibilidade e na supremacia do interesse pblico.
0QRTZKOQVRKEQFGUVGVTCDCNJQDWUECTUGVGEGTCNIWOCUEQPUKFGTCGUUQDTGGUUGU
RQPVQUPQTOCNOGPVGXKUVQUEQOQDCTTGKTCUKORNCPVCQFQOQFGNQFGVTCPUCQ
tributria no ordenamento brasileiro, analisando-os perante as regras e os princpios
vigentes no nosso sistema jurdico.
Para tanto, passar-se- a examinar o conceito de interesse pblico e seus
FGUFQDTCOGPVQU RCTC CRU CPCNKUCT CU KORNKECGU GZKUVGPVGU GPVTG Q EQPVGFQ
KPGTGPVGCGUUCFGPKQGQKPUVKVWVQFCVTCPUCQVTKDWVTKCSWGVQECVGOCUEQOQ
a indisponibilidade do crdito tributrio, a discricionariedade administrativa e o
RTKPERKQEQPUVKVWEKQPCNFCGEKPEKC

3 CONCEITO DE INTERESSE PBLICO


Moreira Neto (2005, p. 9) constata que a convivncia numa sociedade civilizada
UGTKCKORQUUXGNECUQPQJQWXGUUGWOOPKOQFGUGIWTCPCSWCPVQCQTGURGKVQG
RTQVGQFGEGTVQPENGQHWPFCOGPVCNFGKPVGTGUUGU0GUUGEQPVGZVQQ'UVCFQ
EQOQQTICPK\CQLWURQNVKECFCUQEKGFCFGFGENCTCRQTOGKQFGNGKSWCKUUQGUUGU
KPVGTGUUGUSWGOGTGEGORTQVGQLWTFKECKPVGTGUUGUGUVGUSWGRQFGOUGTRDNKEQU
ou privados.
Bandeira de Mello, todavia, adverte que nem sempre fcil distinguir essas categorias
GGUVCDGNGEGTNJGUQUEQPVQTPQU'PCVGPVCVKXCFGGNCDQTCTWOCFGPKQFGKPVGTGUUG
pblico, pondera:
Ao se pensar em interesse pblico, pensa-se, habitualmente, em uma categoria
contraposta de interesse privado, individual, isto , ao interesse pessoal de
cada um. Acerta-se em dizer que se constitui no interesse do todo, ou seja,
do prprio conjunto social, assim como acerta-se tambm em sublinhar que
no se confunde com a somatria dos interesses individuais, peculiares de
cada qual. Dizer isto, entretanto, dizer muito pouco para compreender-se
verdadeiramente o que interesse pblico.
&GXGTCU PC OGFKFC GO SWG UG EC EQO C PQQ CNVCPVQ QDUEWTC FG SWG
transcende os interesses prprios de cada um, sem se aprofundar a compostura
deste interesse to amplo, acentua-se um falso antagonismo entre o interesse
FCURCTVGUGQKPVGTGUUGFQVQFQRTQRKEKCPFQUGCGTTPGCUWRQUKQFGSWG
se trata de um interesse a se stante, autnomo, desvinculado dos interesses de
cada uma das partes que compem o todo.
260

Cad. Fin. Pbl., Braslia, n. 12, p. 255-281, dez. 2012

Transao tributria e interesse pblico

Em TKIQTQPGEGUUTKQCENCTCTUGQSWGGUVEQPVKFQPCCTOCQFGSWG
interesse pblico o interesse do todo, do prprio corpo social, para precartarse contra o erro de atribuir-lhe o status de algo que existe por si mesmo, dotado
de consistncia autnoma, ou seja, como realidade independente e estranha a
qualquer interesse das partes. O indispensvel, em suma, prevenir-se contra o
GTTQFGEQPUEKGPVGQWKPEQPUEKGPVGOGPVGRTQOQXGTWOCUGRCTCQCDUQNWVC
entre ambos, ao invs de acentuar, como se deveria, que o interesse pblico,
QWUGLCQKPVGTGUUGFQVQFQHWPQSWCNKECFCFQUKPVGTGUUGUFCURCTVGU
WOCURGEVQWOCHQTOCGURGEECFGUWCOCPKHGUVCQ
[...]
1SWGECXKUXGNEQOQHTWVQFGUVCUEQPUKFGTCGUSWGGZKUVGFGWONCFQ
o interesse individual, particular, atinente s convenincias de cada um no
que concerne aos assuntos de sua vida particular interesse, este, que o da
pessoa ou grupo de pessoas singularmente consideradas , e que, de par com
isto, existe tambm o interesse igualmente pessoal destas mesmas pessoas ou
grupos, mas que comparecem enquanto partcipes de uma coletividade maior
na qual esto inseridos, tal como nela estiveram os que os precederam e nela
GUVCTQQUSWGXKTQCUWEGFNQUPCUIGTCGUHWVWTCU
Pois bem, este ltimo interesse o que nomeamos de interesse do todo ou
interesse pblico. No , portanto, de forma alguma, um interesse constitudo
autonomamente, dissociado do interesse das partes e, pois, passvel de ser
tomado como categoria jurdica que possa ser erigida irrelatamente aos
KPVGTGUUGUKPFKXKFWCKURQKUGOOFGEQPVCUGNGPCFCOCKUSWGWOCHCEGVC
dos interesses dos indivduos: aquela que se manifesta enquanto estes
inevitavelmente membros de um corpo social comparecem em tal qualidade.
Ento, dito interesse, o pblico e esta j uma primeira concluso , s se
LWUVKECPCOGFKFCGOSWGUGEQPUVKVWKGOXGEWNQFGTGCNK\CQFQUKPVGTGUUGU
das partes que o integram no presente e das que o integraro no futuro. Logo,
destes que, em ltima instncia, promanam os interesses chamados pblicos.
Donde, o interesse pblico deve ser conceituado como o interesse resultante
do conjunto dos interesses que os indivduos pessoalmente tm quando
considerados em sua qualidade de membros da Sociedade e pelo simples fato
de o serem (BANDEIRA DE MELLO, 2010, p. 59-61).

/QTGKTC0GVQ
R RQTUWCXG\CRCTVKTFQGUHQTQFGVTCCTWOEQPEGKVQ
IGTCNRCTCKPVGTGUUGRDNKEQCUUKOQFGPG
1 KPVGTGUUG RDNKEQ NGICNOGPVG FGPKFQ EQOQ CSWGNG SWG  RQUVQ UQD C
TGURQPUCDKNKFCFGFQ'UVCFQGEQOQPCNKFCFGFGUWCCQPQQWVTQUGPQ
em sntese, o interesse geral da sociedade, ou, preferindo-se, o bem comum,
SWG GO UWC CEGRQ OGVCLWTFKEC UGT KPURKTCFQTC FC CQ RQNVKEC SWG Q
FGPKTFKUETKOKPCFCOGPVGPQ&KTGKVQRCTCECFCUQEKGFCFGGRCTCECFCVGORQ

O interesse pblico revela-se, pois, como o interesse da coletividade, resultante do


conjunto de interesses que os cidados individualmente tm quando considerados
membros da sociedade, e que merece ser perseguido como objetivo, bem como
protegido pelo Estado.
Cad. Fin. Pbl., Braslia, n. 12, p. 255-281, dez. 2012

261

Daniela Figueiredo Oliveira Frana Ferreira

4 INTERESSE PBLICO PRIMRIO X INTERESSE PBLICO


SECUNDRIO
#QDUGTXCQFGSWGCECVGIQTKCKPVGTGUUGRDNKEQPGOUGORTGUGQRGCQKPVGTGUUG
privado, mas, ao contrrio, formada pelo conjunto de interesses dos indivduos
pessoalmente considerados como membros da sociedade, tal como ensina Bandeira
de Mello, nos conduz concluso de que o interesse do Estado nem sempre coincide
com o interesse pblico em essncia.
6CNKFGKCCNKUEQORCTVKNJCFCRQT,WUVGP(KNJQQSWCNCTOCSWGQGSWXQEQ
comum de confundir interesse pblico com interesse estatal gera um raciocnio
circular, a saber: o interesse pblico porque atribudo ao Estado, e atribudo
ao Estado por ser pblico. Como consequncia desse pensamento falacioso, terse-ia que todo interesse pblico seria estatal, e todo interesse estatal seria pblico.
6QFCXKCUWUVGPVCQCWVQTVCNEQPEGRQKPEQORCVXGNEQOC%QPUVKVWKQPQ
UGPFQRQUUXGNFGPKTKPVGTGUUGRDNKEQCRCTVKTFCKFGPVKFCFGFQUGWVKVWNCTUQD
pena de inverso lgica e axiolgica. Isso porque o Estado Democrtico de Direito
KPUVTWOGPVQFGTGCNK\CQFQUKPVGTGUUGURDNKEQUKUVQQKPVGTGUUGRDNKEQGZKUVG
antes do Estado, e, justamente por ser considerado importante para a sociedade,
tutelado pelo Estado, responsvel por zelar pelo interesse da coletividade (JUSTEN
FILHO, 2010, p. 122).
No mesmo sentido j esposado, Justen Filho adverte que o interesse pblico
substancial tambm no se confunde com o interesse do aparato administrativo,
apesar de o Estado, na qualidade de sujeito de direito, poder manifestar certas
convenincias ou preferncias, de forma parecida com o que ocorre com qualquer
sujeito privado (JUSTEN FILHO, 2010, p. 123).
O Estado, assim como os particulares, tambm constitui uma pessoa que existe
e convive no universo jurdico em concorrncia com todos os demais sujeitos de
FKTGKVQ#UUKOKPFGRGPFGPVGOGPVGFQHCVQFGUGTRQTFGPKQGPECTTGICFQFQU
interesses pblicos, o Estado pode ter, da mesma forma que as demais pessoas,
interesses que lhe so particulares, individuais, e que, tal como os interesses dessas,
concebidas em suas meras individualidades, se encarnam no Estado como pessoa
(BANDEIRA DE MELLO, 2010, p. 65).
Essas convenincias ou interesses particulares do Estado no podem ser considerados
KPVGTGUUGURDNKEQURTQRTKCOGPVGFKVQUGKUSWGPQTGGVGOQCPUGKQFCEQNGVKXKFCFG
&CUGTTGNGXCPVGCFKUVKPQGPVTGKPVGTGUUGRDNKEQRTKOTKQGKPVGTGUUGRDNKEQ
secundrio.
Entende-se por interesse pblico primrio aquele que se refere sociedade, isto ,
CSWGNGFGPKFQEQODCUGPCUPGEGUUKFCFGUPCUCURKTCGUPQUXCNQTGUPQUCPUGKQU
PCUVGPFPEKCUGPCUQRGUIGTCFQUGOCPKHGUVCFQUPWOCUQEKGFCFG
/14'+4#
NETO, 2005, p. 557). Por sua vez, entende-se por interesse pblico secundrio
262

Cad. Fin. Pbl., Braslia, n. 12, p. 255-281, dez. 2012

Transao tributria e interesse pblico

aquele que se refere ao prprio Estado, considerado pessoa moral qual se imputam
direitos e deveres (MOREIRA NETO, 2005, p. 9).
0CURCNCXTCUFG$CPFGKTCFG/GNNQ
/'..1R CFKHGTGPCGPVTGKPVGTGUUG
pblico primrio e interesse pblico secundrio pode ser assim divisada:
Interesse pblico ou primrio [...] o pertinente sociedade como um todo, e
s ele pode ser validamente objetivado, pois este o interesse que a lei consagra
e entrega compita do Estado como representante do corpo social. Interesse
secundrio aquele que atina to s ao aparelho estatal enquanto entidade
personalizada, e que por isso mesmo pode lhe ser referido e nele encarnar-se
pelo simples fato de ser pessoa, mas que s pode ser validamente perseguido
pelo Estado enquanto coincidente com o interesse pblico primrio.

4GIKUVTGUGSWGVCNFKUVKPQLGUVDGOEQPUQNKFCFCPCFQWVTKPCKVCNKCPCCVCNRQPVQ
que poucos autores daquele pas se preocupam em explic-la, limitando-se a fazer
OGPQCQUEQPEGKVQUFGKPVGTGUUGRDNKEQRTKOTKQGUGEWPFTKQEQPUKFGTCFQUFG
conhecimento geral. Esse, entretanto, no o caso de Renato Alessi, professor de
direito administrativo da Universidade de Bolonha, que com maestria explica a
FKHGTGPCGPVTGGUUGUFQKUKPUVKVWVQU
'UUGUKPVGTGUUGURDNKEQUEQNGVKXQUSWGFGXGOUGTUCVKUHGKVQURGNC#FOKPKUVTCQ
PQUQPQVGUGDGOUKORNGUOGPVGKPVGTGUUGUFC#FOKPKUVTCQGPVGPFKFC
como aparelho organizacional autnomo, mas sim aqueles que so chamados de
interesses coletivos primrios, formados pelo conjunto de interesses individuais
RTGXCNGPVGUGOWOCFGVGTOKPCFCQTICPK\CQLWTFKECFCEQNGVKXKFCFGRQT
outro lado, o interesse do aparelho estatal, se concebido como um interesse
desse aparato isoladamente considerado, seria simplesmente um dos interesses
secundrios que se fazem sentir na comunidade, s podendo ser realizado em
caso de coincidncia com o interesse coletivo primrio, e nos limites dessa
EQKPEKFPEKC # RGEWNKCTKFCFG FC RQUKQ LWTFKEC FC #FOKPKUVTCQ TGUKFG
LWUVCOGPVGPQHCVQFGGNCVGTEQOQHWPQCTGCNK\CQFQKPVGTGUUGEQNGVKXQ
pblico, primrio.
#KPFCSWGUGEQPEGDCWOKPVGTGUUGUGEWPFTKQFC#FOKPKUVTCQGPSWCPVQ
aparelho organizacional autnomo, este s pode ser realizado em vista de sua
coincidncia com o interesse primrio, pblico (ALESSI, 1974, p. 226-227).

#OFGFGOQPUVTCTCPGEGUUTKCRTGXCNPEKCFQKPVGTGUUGRDNKEQRTKOTKQUQDTGQ
KPVGTGUUGRDNKEQUGEWPFTKQ#NGUUKGZGORNKECCTGNCQFGUWDUKFKCTKGFCFGGZKUVGPVG
entre eles explicando que o Estado, considerando suas convenincias particulares,
poderia em tese ter interesse de aumentar ao mximo possvel os impostos com o
objetivo de aumentar sua prpria disponibilidade patrimonial. Todavia, anota que
o interesse pblico coletivo (primrio) exige que os cidados no sejam gravados
EQOWOCEQDTCPCFGVTKDWVQUFGUOGUWTCFCGKUSWGQKPVGTGUUGRDNKEQUWDUVCPEKCN
consiste em favorecer o bem-estar da sociedade (ALESSI, 1974, p. 227, nota 4).
Cad. Fin. Pbl., Braslia, n. 12, p. 255-281, dez. 2012

263

Daniela Figueiredo Oliveira Frana Ferreira

Tem-se, portanto, que a categoria interesse pblico pode ser subdividida em


FWCUCFGRGPFGTCSWGOUGTGTCQFKVQKPVGTGUUGUQEKGFCFGQWCQCRCTCVQGUVCVCN
1 KPVGTGUUG RDNKEQ RTKOTKQ VGO ECTVGT UWDUVCPEKCN G PCNUVKEQ 6TCVCUG FQ
interesse pblico propriamente dito, delineado com base nas necessidades, nas
CURKTCGUPQUXCNQTGUPQUCPUGKQUGPCUQRGUFCEQNGVKXKFCFGKPVGTGUUGGUUGSWG
o Estado deve buscar como objetivo, em face de seu papel de tutor dos interesses
da sociedade. O interesse pblico secundrio, por sua vez, tem carter adjetivo e
FGTKXCFQFGPKFQEQODCUGPCUPGEGUUKFCFGUQTICPK\CVKXCUGHWPEKQPCKUFQ'UVCFQ
Tem cunho instrumental, na medida em que s pode ser perseguido pelo Estado
SWCPFQPQEQNKFCEQOQKPVGTGUUGRDNKEQRTKOTKQGVGPFQEQOQONVKOQQ
alcance dos interesses da sociedade.
#VGPVQCQECTVGTPCNUVKEQGKPUVTWOGPVCNTGURGEVKXCOGPVGFQUKPVGTGUUGURDNKEQU
RTKOTKQ G UGEWPFTKQ /QTGKTC 0GVQ
 R   RTQRG C ECVGIQTK\CQ FC
CFOKPKUVTCQRDNKECEQOQKPVTQXGTUCGGZVTQXGTUC%QPTCUG
Para que o Estado possa servir adequadamente sociedade que o institui,
UGWUTIQUFGTGRTGUGPVCQFGPGORGNCCVTKDWKQFGEQORGVPEKCUSWCKU
KPVGTGUUGU FGXGTQ UGT RQT GNG UCVKUHGKVQU SWCNKECPFQQU EQOQ KPVGTGUUGU
pblicos, passando a ser, por isso, denominados de interesses pblicos
primrios, ou interesses pblicos materiais.
#U HWPGU FGUGORGPJCFCU RGNQ 'UVCFQ G UGWU FGNGICFQU RCTC C UCVKUHCQ
desses pblicos primrios, que se referem s necessidades da prpria sociedade,
ECTCEVGTK\COCUCVKXKFCFGUOFC#FOKPKUVTCQ2DNKECSWGRQTTGHGTKTGOUG
FKTGVCOGPVGCQUCFOKPKUVTCFQUEQPHQTOCOC#FOKPKUVTCQ2DNKECGZVGTPC
ou extroversa.
/CURCTCFGUGORGPJNCPGEGUUTKQSWGQ'UVCFQUCVKUHCCUGWURTRTKQU
KPVGTGUUGUKPUVKVWEKQPCKUTGHGTKFQUCUGWUCVQURGUUQCUDGPUGUGTXKQUQSWG
desdobra uma nova classe de interesses pblicos secundrios, ou interesses
pblicos instrumentais, ou derivados, caracterizando as atividades-meio da
#FOKPKUVTCQ2DNKECSWGRQTUGTGHGTKTGOIGUVQKPVGTPCFGUGWRGUUQCN
FG UGWU DGPU FG UGWU CVQU G FG UGWU UGTXKQU EQPHQTOCO C #FOKPKUVTCQ
Pblica interna, ou introversa.
&GUVCTVGGPSWCPVQCCFOKPKUVTCQRDNKECGZVTQXGTUCPCNUVKECCVTKDWFC
GURGEKECOGPVGCECFCGPVGRQNVKEQQDGFGEGPFQCWOCRCTVKNJCEQPUVKVWEKQPCN
C#FOKPKUVTCQ2DNKECKPVTQXGTUCKPUVTWOGPVCNCVTKDWFCIGPGTKECOGPVG
a todos eles.

&GUVCSWGUGSWGVCNFKUVKPQGPVTGKPVGTGUUGRDNKEQRTKOTKQGUGEWPFTKQSWG
TGFWPFC PC FKHGTGPEKCQ GPVTG CFOKPKUVTCQ RDNKEC GZVTQXGTUC G KPVTQXGTUC
 TGNGXCPVG RCTC UG KFGPVKECT SWCKU QU KPVGTGUUGU PCKU C UGTGO DWUECFQU RGNQ
Estado: os interesses da sociedade, ainda que estejam em coliso com suas prprias
convenincias.

264

Cad. Fin. Pbl., Braslia, n. 12, p. 255-281, dez. 2012

Transao tributria e interesse pblico

4GIKUVTGUGCKPFCSWGCFKUVKPQGPVTGKPVGTGUUGRDNKEQRTKOTKQGUGEWPFTKQPQ
CRGPCUWOCOGTCEQPUVTWQFQWVTKPTKC#QTGXUVTCVCUGFGECVGIQTK\CQECFC
vez mais utilizada pelos tribunais ptrios para diferenciar os interesses da sociedade
GQUKPVGTGUUGUFQCRCTCVQGUVCVCNUGRCTCQGUUCPGEGUUTKCRCTCFGEKFKTEQPVTQXTUKCU
SWGGPXQNXCOEQPKVQUFGKPVGTGUUGURDNKEQUGPVGPFKFQUGUVGUGOUGWUKIPKECFQ
lato sensu.
#VVWNQGZGORNKECVKXQEKVCOUGCNIWPULWNICFQUGOCPCFQUFQ5WRGTKQT6TKDWPCN
FG,WUVKC
56, SWGVTCCTCOCFKHGTGPEKCQGPVTGQUKPVGTGUUGURDNKEQURTKOTKQU
que tm contedo material e se revestem a priori do atributo da indisponibilidade, e
os interesses pblicos secundrios, que tm contedo adjetivo e carter instrumental,
sendo, portanto, disponveis.
No REsp. 303.806,6C2TKOGKTC6WTOCFQ56,FGEKFKWSWGGOCQKPFGPK\CVTKC
RQTFCPQUOQTCKURTQOQXKFCGOHCEGFQ'UVCFQPQJPGEGUUKFCFGFGCVWCQFQ
Parquet, tendo em vista que o ressarcimento pecunirio pleiteado pelo particular
CHGVCQKPVGTGUUGFCCFOKPKUVTCQ
UGEWPFTKQ OCUPQQKPVGTGUUGRDNKEQRTKOTKQ
6 PROCESSUAL CIVIL. RECURSO ESPECIAL. INTERVENO DO MINISTRIO PBLICO EM
AO REPARATRIA DE DANOS MORAIS. DESNECESSIDADE.
 6TCVCPFQUGFGCQKPFGPK\CVTKCRQTFCPQUOQTCKURTQOQXKFCGOHCEGFQ'UVCFQRQTCDWUQFGCWVQTKFCFG
GOHCEGFGFGPPEKCRTQOQXKFCRGNQ/KPKUVTKQ2DNKEQPQUGKORGCCVWCQFQ2CTSWGVEQOQEWUVQU
legis, consoante jurisprudncia da E. Corte. (REsp. 327.288/DF, 4a T., Rel. Min. Cesar Asfor Rocha,
DJ  #)4'52 5% 4GN /KP (TCPEKUEQ (CNEQ DJ FG  #I4I PQ
REsp. 258.798, Rel. Min. Eliana Calmon, DJ FG  4'UR  4GN /KP ,QU &GNICFQ
DJ de 10/09/2001).
2. O artigo 82, inciso III, do CPC, dispe que compete ao Ministrio Pblico intervir: III em todas as demais
causas em que h interesse pblico, evidenciado pela natureza da lide ou qualidade da parte.
#GUEQTTGKVCGZGIGUGFCFKEQNGICNKORGCFKUVKPQLWUHKNQUHKECGPVTGQKPVGTGUUGRDNKEQRTKOTKQG
QKPVGTGUUGFCCFOKPKUVTCQEQIPQOKPCFQKPVGTGUUGRDNKEQUGEWPFTKQ.KGUFG%CTPGNWVVK4GPCVQ
Alessi, Celso Antnio Bandeira de Mello e Min. Eros Roberto Grau.
3. O Estado, quando atestada a sua responsabilidade, revela-se tendente ao adimplemento da correspectiva
KPFGPK\CQEQNQECUGPCRQUKQFGCVGPFKOGPVQCQKPVGTGUUGRDNKEQ#QTGXUSWCPFQXKUCCGXCFKTUGFG
sua responsabilidade no af de minimizar os seus prejuzos patrimoniais, persegue ntido interesse secundrio,
subjetivamente pertinente ao aparelho estatal em subtrair-se de despesas, engendrando locupletamento
custa do dano alheio.
4. Deveras, assente na doutrina e na jurisprudncia que indisponvel o interesse pblico, e no o interesse
FCCFOKPKUVTCQ0GUUCNVKOCJKRVGUGPQPGEGUUTKCCCVWCQFQ2CTSWGVPQOKUVGTFGEWUVQUNGIKU
mxime porque a entidade pblica empreende a sua defesa atravs de corpo prprio de profissionais da
CFXQECEKCFC7PKQ2TGEGFGPVGULWTKURTWFGPEKCKUSWGUGTGHQTCOPCOGFKFCGOSWGCCVWCQFQ/KPKUVTKQ
2DNKEQPQGZKIXGNGOXTKCUCGUOQXKFCUEQPVTCCCFOKPKUVTCQEQOQv.gUKQEQTTGTEQOCCQ
FGFGUCRTQRTKCQRTGXKUVCPQ&GETGVQ.GKP
.GKFG&GUCRTQRTKCQ 
5. In genereCUCGUSWGXKUCOCQTGUUCTEKOGPVQRGEWPKTKQEQPVOKPVGTGUUGUFKURQPXGKUFCURCTVGUPQ
PGEGUUKVCPFQRQTVCPVQFGWOTIQCHKUECNK\CTCDQCCRNKECQFCUNGKUGORTQNFCFGHGUCFCUQEKGFCFG
6. Hiptese em que revela-se evidente a ausncia de interesse pblico indisponvel, haja vista tratar-se de litgio
travado entre o Estado de Rondnia e INSS e o Procurador de Estado Beniamine Gegle de Oliveira Chaves,
QPFGUGSWGUVKQPCCTGRCTCQRQTFCPQUOQTCKUVGPFQGOXKUVCVGTUKFQKPLWUVCOGPVGFGPWPEKCFQRGNQETKOG
tipificado no art. 89, da Lei n. 8.666/93.
 #FGOCKUCUWRQUVCPWNKFCFGUQOGPVGRQFGUGTFGETGVCFCUGEQORTQXCFQQRTGLW\QRCTCQUHKPUFGLWUVKC
do processo, em razo do Princpio de que "no h nulidade sem prejuzo" ("pas ds nullits sans grief").
8. Recurso especial desprovido.
 
5WRGTKQT6TKDWPCNFG,WUVKC4GEWTUQ'URGEKCNP414GNCVQT/KPKUVTQ.WK\(WZTIQ,WNICFQT
2TKOGKTC6WTOC&CVCFQ,WNICOGPVQ&CVCFC2WDNKECQ(QPVGDJ 25/04/2005, p. 224).

Cad. Fin. Pbl., Braslia, n. 12, p. 255-281, dez. 2012

265

Daniela Figueiredo Oliveira Frana Ferreira

Por ocasio da anlise do REsp. 197.586,7QOGUOQTIQEQNGIKCFQTGCTOQWSWG


no se pode confundir interesse da Fazenda Pblica com interesse pblico, este
ltimo referente a toda a sociedade e no apenas ao Estado.
6GOUGRQTVCPVQSWGCFKHGTGPEKCQGPVTGKPVGTGUUGRDNKEQRTKOTKQGUGEWPFTKQ
tem sido bastante utilizada pela jurisprudncia para separar os interesses que se
referem sociedade em geral, que possuem a caracterstica da indisponibilidade, e
os interesses que se referem ao aparato estatal, que possuem carter instrumental,
sendo, portanto, disponveis.

5 INTERESSE PBLICO: UMA CATEGORIA PLURAL


8KUVQQSWGFGXGUGTGPVGPFKFQRQTKPVGTGUUGRDNKEQHC\UGOKUVGTEJCOCTCCVGPQ
para o fato de que no existe um nico interesse pblico. De fato, em uma sociedade
plural em que se observam diferentes anseios e necessidades, resta invivel pensar-se
GOKPVGTGUUGRDNKEQEQOQCNIQJQOQIPGQGFGUKORNGUKFGPVKECQ%QPHQTOG
nos alerta Cassese, no existe o interesse pblico, mas os interesses pblicos, no
plural (CASSESE, 1989, p. 238).
Acerca da impossibilidade de reconhecimento de um nico interesse pblico, Justen
Filho (2010, p. 126-127) leciona:
Uma crtica insupervel reside em que a teoria do interesse pblico pressupe
CGZKUVPEKCFGWOKPVGTGUUGRDNKEQPKEQQSWGTGRTGUGPVCCFGUPCVWTCQ
da realidade social e jurdica.
3WCPFQ UG CTOC SWG QU EQPKVQU FG KPVGTGUUG UG TGUQNXGO RQT XKC FC
RTGXCNPEKCFQKPVGTGUUGRDNKEQRTQFW\UGWOCUKORNKECQSWGKORGFGC
perfeita compreenso da realidade. Um simples exemplo permite compreender
o problema.
+OCIKPGUGSWGQCWOGPVQFQVTHGIQVQTPGPGEGUUTKCCFWRNKECQFGWOC
TQFQXKC1EQPIGUVKQPCOGPVQTQFQXKTKQRTQXQECCVTCUQUCEKFGPVGGRQNWKQ
KPGIXGNCGZKUVPEKCFGKPVGTGUUGRDNKEQGORTQOQXGTCFWRNKECQ
5WRQPJCUG PQ GPVCPVQ SWG C FWRNKECQ CECTTGVG C PGEGUUKFCFG FG
FGUOCVCOGPVQFGWOCTGCQTGUVCNFGRTGUGTXCQRGTOCPGPVGFGITCPFG
valor ecolgico. Ou que existam stios arqueolgicos de valor inestimvel que
UGTQFGUVTWFQUGOXKTVWFGFCFWRNKECQFCTQFQXKC1WSWGCFWRNKECQ
exija o deslocamento de grande quantidade de moradores de baixa renda,
remetendo-os ao constrangimento de total afastamento do ncleo urbano.
7




DESAPROPRIAO INDIRETA MINISTRIO PBLICO INTERVENO OBRIGATORIEDADE.


No se pode confundir interesse da Fazenda Pblica com interesse pblico. Interesse pblico o interesse geral
da sociedade, concernente a todos e no s ao Estado.
0CFGUCRTQRTKCQKPFKTGVCKPGZKUVGKPVGTGUUGRDNKEQSWGLWUVKHKSWGCKPVGTXGPQFQ2CTSWGV
Recurso improvido.

5WRGTKQT6TKDWPCNFG,WUVKC4GEWTUQ'URGEKCNP524GNCVQT/KPKUVTQ)CTEKC8KGKTCTIQ,WNICFQT
2TKOGKTC6WTOC&CVCFQ,WNICOGPVQ&CVCFC2WDNKECQ(QPVGDJ: 05/04/1999, p. 96).

266

Cad. Fin. Pbl., Braslia, n. 12, p. 255-281, dez. 2012

Transao tributria e interesse pblico

Seria inquestionvel a existncia de interesses pblicos potencialmente lesados


GOXKTVWFGFGUUCFWRNKECQ
1WUGLCCUUKVWCGUEQPETGVCUFGOQPUVTCOCGZKUVPEKCFGXTKQUKPVGTGUUGU
RDNKEQU KPENWUKXG GO EQPKVQ GPVTG UK .QIQ C FGEKUQ C UGT CFQVCFC PQ
RQFGTUGTHWPFCFCPCRWTCGUKORNGUKPXQECQFQKPVGTGUUGRDNKEQ'UVCTQ
GO EQPKVQ FKXGTUQU KPVGTGUUGU RDNKEQU VQFQU GO VGUG OGTGEGFQTGU FG
SWCNKECQFGUWRTGOQUGKPFKURQPXGKU
Qualquer que seja a teoria adotada acerca de interesse pblico, impossvel
CHKTOCT C EQPHKIWTCQ FG UKVWCGU UKORNGU G JQOQIPGCU 7OC FCU
ECTCEVGTUVKECUFQ'UVCFQEQPVGORQTPGQCHTCIOGPVCQFQUKPVGTGUUGUC
CTOCQEQPLWPVCFGRQUKGUUWDLGVKXCUEQPVTCRQUVCUGCXCTKCQFQUCTTCPLQU
GPVTGFKHGTGPVGUITWRQU0GUUGEQPVGZVQCWVKNK\CQFQEQPEGKVQFGKPVGTGUUG
pblico tem de fazer-se com cautela, diante da pluralidade e contraditoriedade
entre os interesses dos diferentes integrantes da sociedade.

1VTGEJQVTCPUETKVQRGGOVGTOQUENCTQUCFKEWNFCFGSWGUGCRTGUGPVCCQ'UVCFQ
FGRGTUGIWKTQKPVGTGUUGEQNGVKXQSWGCNOFCFKEWNFCFGPCVWTCNFGGUEQNJGTC
HQTOCFGDWUECTQDGOEQOWOQSWGRGTRCUUCRQTWOCQRQRQNVKECGZKUVGCKPFC
CFKEWNFCFGFGUGKFGPVKECTSWCNKPVGTGUUGRDNKEQOGTGEGRTGXCNGEGT+UUQRQTSWG
em uma sociedade heterognea, com diversas demandas, os interesses que, analisados
separadamente, poderiam ser considerados essenciais coletividade por vezes se
chocam. Exsurge, ento, a complicada tarefa de escolher qual desses interesses deve
UGTUCETKECFQCOFGSWGQQWVTQRQUUCUGTTGCNK\CFQVGPFQUGORTGEQOQRCPQ
de fundo a busca do bem comum.
'ZRQUVQ GUUG QDUVEWNQ SWG UG CRTGUGPVC CQ 'UVCFQ PC RGTUGEWQ FQ DGO FC
EQNGVKXKFCFGHC\UGOKUVGTXGTKECTEQOQUGTGUQNXGQGODCVGGPVTGCRNWTCNKFCFGFG
KPVGTGUUGUEQNGVKXQURQTXG\GUEQPKVCPVGUGPVTGUKGQRTKPERKQFCKPFKURQPKDKNKFCFG
do interesse pblico.

6 SUPREMACIA E INDISPONIBILIDADE
DO INTERESSE PBLICO
O direito pblico, no qual se inclui o direito tributrio, rege-se por princpios,
dentre os quais se destacam o da supremacia e o da indisponibilidade do interesse
pblico. O primeiro preceitua que, havendo embate entre o interesse pblico e o
particular, deve prevalecer o interesse pblico. O segundo, por sua vez, indica a
impossibilidade de o administrador, ao seu arbtrio, dispor do interesse coletivo.
Acerca do tema, Lopes Meirelles leciona:
Tambm chamado de princpio da supremacia do interesse pblico ou da
PCNKFCFGRDNKECEQOQPQOGFGKPVGTGUUGRDNKEQC.GKEQNQECQ
EQOQWOFQURTKPERKQUFGQDUGTXPEKCQDTKICVTKCRGNC#FOKPKUVTCQ2DNKEC
(cf. art. 2o, caput EQTTGURQPFGPFQCQCVGPFKOGPVQCPUFGKPVGTGUUGIGTCN
XGFCFCCTGPPEKCVQVCNQWRCTEKCNFGRQFGTGUQWEQORGVPEKCUCNXQCWVQTK\CQ
Cad. Fin. Pbl., Braslia, n. 12, p. 255-281, dez. 2012

267

Daniela Figueiredo Oliveira Frana Ferreira

em lei (art. 2o, pargrafo nico, II). O princpio do interesse pblico est
KPVKOCOGPVGNKICFQCQFCPCNKFCFG#RTKOC\KCFQKPVGTGUUGRDNKEQUQDTGQ
RTKXCFQKPGTGPVGCVWCQGUVCVCNGFQOKPCCPCOGFKFCGOSWGCGZKUVPEKC
FQ'UVCFQLWUVKECUGRGNCDWUECFQKPVGTGUUGIGTCN'OTC\QFGUUCKPGTPEKC
FGXGUGTQDUGTXCFQOGUOQSWCPFQCUCVKXKFCFGUQWUGTXKQURDNKEQUHQTGO
delegados aos particulares.
Dele decorre o princpio da indisponibilidade do interesse pblico, segundo
Q SWCN C #FOKPKUVTCQ 2DNKEC PQ RQFG FKURQT FGUUG KPVGTGUUG IGTCN PGO
renunciar a poderes que a lei lhe deu para tutela, mesmo porque ela no titular
do interesse pblico, cujo titular o Estado, que, por isso, mediante lei poder
autorizar a disponibilidade ou a renncia (LOPES MEIRELLES, 20