Você está na página 1de 133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

TIROIDES

Tiroides.01deenero201424(1):88168.

PMCID:PMC3887458

doi:10.1089/thy.2013.0109

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroidea
EconomayAccinenroedoresymodeloscelulares
InformedelGrupodeTrabajodelaAsociacinAmericanadeTiroidesEnfoquesyEstrategiaspara
InvestigarlahormonatiroideaEconomayAccin
AntonioC.Bianco, *, 1,deGrantAnderson, 2DouglasForrest, 3ValerieAnneGalton, 4BalzsGereben, 5BrianW.Kim, 1
PeterA.Kopp, 6XiaoHuiLiao, 7MaraJessObregn, 8RobinP.Peeters, 9SamuelRefetoff, 7DavidS.Sharlin, 10S.
WarnerSimnides, 11RoyE.Weiss, 7yGrahamR.Williams 12
1
DivisindeEndocrinologa,DiabetesyMetabolismodelaUniversidaddelaEscuelaMillerdeMedicinadeMiami,Miami,Florida.
2
DepartamentodePrcticadeFarmaciayCienciasFarmacuticasdelaFacultaddeFarmaciadelaUniversidaddeMinnesotaDuluth,Duluth,Minnesota.
3
LaboratoriodeEndocrinologayBiologadelreceptor,elInstitutoNacionaldeDiabetesyEnfermedadesDigestivasydelRin,InstitutosNacionalesde
Textooriginal
Salud,Bethesda,Maryland.
4
American Thyroid Association Guide to Investigating Thyroid
DepartamentodeFisiologayNeurobiologadelaEscueladeMedicinadeDartmouth,Lebanon,NewHampshire.
5
HormoneEconomyandActioninRodentandCellModels
DepartamentodeEndocrinologadeNeurobiologadelInstitutodeMedicinaExperimentaldelaAcademiaHngaradeCiencias,Budapest,Hungra.
6
DivisindeEndocrinologa,MetabolismoyMedicinaMolecular,yelCentrodeMedicinaGenticadelaFacultaddeMedicinaFeinbergdelaUniversidad
Sugiereunatraduccinmejor
Northwestern,deChicago,Illinois.
7
SeccindeAdultosyPeditricaEndocrinologa,DiabetesyMetabolismodelaUniversidaddeChicago,Chicago,Illinois.
8
InstitutodeInvestigacionesBiomdicas(IIB),espaolConsejoSuperiordeInvestigacionesCientficas(CSIC)ylaUniversidadAutnomadeMadrid,
Madrid,Espaa.
9
DivisindeEndocrinologa,DepartamentodeMedicinaInterna,CentroMdicoErasmus,Rotterdam,PasesBajos.
10
DepartamentodeCienciasBiolgicas,UniversidaddelEstadodeMinnesota,Mankato,Minnesota.
11
LaboratoriodeFisiologa,InstitutodeInvestigacionesCardiovasculares,VUUniversityMedicalCenter,Amsterdam,PasesBajos.
12
DepartamentodeMedicinadelImperialCollegedeLondres,HammersmithCampus,Londres,ReinoUnido.
Autorcorrespondiente.
Correspondenciadedireccionespara:,AntonioC.Bianco,MD,PhD,delaDivisindeEndocrinologa,DiabetesyMetabolismo,UniversidaddelaEscuela
MillerdeMedicinadeMiami,suite816DominionTowers,1400NW10thAve.,Miami,FL33136,Email:Email:abianco@deiodinase.org
DerechosdeAutor2014,AmericanThyroidAssociation
EsteartculohasidocitadoporotrosartculosenPMC.

Abstracto

Ira:

Antecedentes:Unconocimientoprofundodelosprincipiosfundamentalesqueregulanlahomeostasisdelahormona
tiroideaescrticaparaeldesarrollodenuevosenfoquesdediagnsticoytratamientoparalospacientescon
enfermedaddelatiroides.
Resumen:prcticasclnicasimportantesenusohoyendaparaeltratamientodelospacientesconhipotiroidismo,
hipertiroidismo,ocncerdetiroidessonelresultadodelosdescubrimientosdelaboratoriorealizadosporlos
cientficosqueinvestiganlosaspectosmsbsicosdelaestructuradelatiroidesylabiologamolecular.Eneste
documento,unpaneldeexpertosconvocadoporlaAsociacinAmericanadelaTiroideshaceunaseriede
recomendacionesrelacionadasconelestudiodelaeconomadelahormonatiroideaylaaccin.Estas
recomendacionesestndestinadasapromoverlanormalizacindeldiseodelestudio,quedebeasuvezaumentarla
comparabilidadylareproducibilidaddelosresultadosexperimentales.
Conclusiones:Seesperaquelaadhesinaestasrecomendacionesdelosinvestigadoresenelcampofacilitarel
avancehaciaunamejorcomprensindelaglndulatiroidesylahormonatiroideaprocesosdependientes.
INTRODUCCIN
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

Ira:
1/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

OVERLOSLTIMOS150AOS,losinvestigadoresutilizanmodelosexperimentalesdeclulasanimalesylacultura
basados
enhaberlogradodescubrimientosemblemticosquehandadoformaanuestracomprensindelafisiologa

delatiroidesylaenfermedad.Apartirdelaidentificacindelestimuladortiroideodeaccinprolongadaparael
descubrimientodefrmacosantitiroideos,losestudiosdeinvestigacinbsicahanproporcionadolosfundamentos
sobrelosquesebasannuestrasherramientasdediagnsticoyteraputicosclnicos.Decenasdemilesde
publicacionesindexadasenPubMed(www.pubmed.gov)clulasdecaractersticasoanimalespequeoshicieron
hipotiroidismootirotxica.Lasgrandessimilitudesenmltiplesaspectosdelafisiologatiroideaentrehumanosy
roedorespequeoshanfacilitadolarpidatraduccindeloshallazgosexperimentalesalmbitoclnico.Almismo
tiempo,existendiferenciasentreespeciesfundamentalesydebensercuidadosamenteencuentasilosresultados
experimentalessontenerrelevanciaclnica.
Mientrasqueciertastcnicasexperimentaleshansidoampliamenteaceptadoyadaptadodespusdesuusoenlos
documentosgeneradosporloslaboratoriosinfluyentes,faltadeestandarizacin,sinduda,hapromovidola
heterogeneidaddelosresultados.Debidoaqueciertasvariablesexperimentalespuedentenernivelesumbrales
biolgicosdesconocidos,faltadenormalizacinpuedeconduciratenerresultadosmuydiscordantesendiferentes
estudiosqueexaminanelmismotema.
Parahacerfrenteaestafaltadeestandarizacin,laAsociacinAmericanadelaTiroides(ATA)convocaunpanel
deespecialistasenelcampodelainvestigacinbsicadelatiroidesparadefinirestrategiasdeconsensoyenfoques
paralosestudiosdelatiroidesenroedoresyenmodeloscelulares.Estegrupodetrabajoseencargaderevisarla
literaturaprimeroparadeterminarquprcticasexperimentalespodranbeneficiarsedelanormalizacinylasegunda
paraidentificarlasvariablesexperimentalescrticosqueexigenconsideracincuandolosestudiosdelatiroidesse
estndiseando.Lasconclusionesdelgrupodetrabajosepresentanenestedocumentocomo"GuadelaAsociacin
AmericanadeTiroidesdeInvestigacindelahormonatiroideaEconomayAccinenroedoresymodelos
celulares."Las70recomendacionesysuscomentariosqueacompaanaexaminartemasquevandesde"hacerque
lasclulashipotiroidismo"a"cmoparaestudiarelhuesotirotxica."Mientrasquelejosdeserexhaustiva,estas
recomendacionessetocanenciertosaspectosfundamentalesdelainvestigacindelatiroidespertinentesparatodos
losinvestigadoresenelcampo.
Cadarecomendacinenestaguapromueveunenfoqueexperimentalenparticularsobrelabasedecriteriosque
incluyenlaprevalenciadelenfoque,contcnicasampliamenteusadasserdadoprioridad,yenparticularsielenfoque
sehademostradoqueconducenaresultadosreproduciblesenlosestudiosrealizadosporinvestigadores
independientes.Debidoaquelascomparacionescientficasdecabezaacabezadelosmtodosexperimentaleseneste
camposonprcticamenteinexistentes,estasrecomendacionesnopuedenserclasificadosenfuncindelafuerzadela
evidenciaenlamodadelasguasclnicasdehecho,todosecalificaroncomo"laopinindeexpertos."Almismo
tiempo,adiferenciadelasguasclnicas,elobjetivoprincipaldeestasrecomendacionesysucomentariosacompaa
noesidentificarlamejorprcticanicaensmisma,sinoparaanimaralosinvestigadoresaelegirestndarenfoques
porejemplo,evitandolasdosisomtodosdeadministracindelahormonatiroideadetratamientoalazar,queslo
serviranparalimitarlacomparacinconestudiosanteriores.
Lanaturalezaprcticadelasrecomendacionesdebeserfcilmenteevidentesparaellector.Estedocumentopretende
servirdereferenciaparalosinvestigadores,ayudndolesatomardecisionesdediseoqueevitenpeligrosconocidos
altiempoqueaumentalanormalizacinenelcampo.Comopartedeesteenfoqueprctico,elcrditodereferenciase
daamenudoalosmanuscritosenlosquelosdetallestcnicossonmsclaramenteoexhaustivamenteexplicado,en
lugardelaprimerapublicacindeutilizarunatcnica.Adems,sehizohincapienlosenfoquescontemporneos,en
lugardelasestrategiashistricos,detalmaneraqueeldocumentoilustraloqueestactualmentedisponibleparael
estudiocontemporneodelahomeostasisdelahormonatiroidea,elmetabolismo,ylaaccin.Eslaposicindela
ATAquesedebenrealizarestudiosconanimalesdeacuerdocontodaslasnormasticasaplicablesylosprotocolos
deinvestigacinaprobadosporcomitsdeanimalesinstitucionaleslocales.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

2/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

MTODOSDEDESARROLLODELASRECOMENDACIONES

Ira:

Administracin

ElConsejoEjecutivoATAseleccionaaunpresidenteparadirigirelequipodetrabajo,yesteindividuo(ACB)
identificalosotros14miembrosdelgrupoespecialenconsultaconlajuntadirectivadeATA.Lamembresaenel
panelsebasenlaexperienciaylasaportacionesanterioresalcampodelatiroides.Losmiembrosdelpanel
declaradositenancualquierposibleconflictodeinteresesenelcursodelasdeliberaciones.Lafinanciacindela
guasederivadelaATAyporlotantoelgrupodetrabajofuncionsinapoyocomercial.
Elaborarundocumentotil,elgrupodetrabajodesarrolladoporprimeravezunalistadelostemasqueseranms
tilesylaspreguntasmsimportantesqueloscientficosquetrabajanenelcampodelatiroidespuedenplantearenla
planificacindeunexperimentoointerpretacindelosdatosexperimentales.Cadaunodelos10temassedistribuy
aunescritorprimariaqueutilizasuconocimientodelamateria,ascomounabsquedasistemticaenPubMedy
GoogleAcadmicoparalasreferenciasprimarias,opinionesyotrosmaterialesadisposicindelpblicoantesde
diciembrede2012,paradesarrollarunconjuntoderecomendaciones.Todoslosproyectosfueronrevisados
y

editadosporlasilladecoherenciaydevueltosalosautoresprincipalesdelarevisinenalgunoscasosmltiples
iteracionessellevaronacabohastaquesefinalizlarecomendacin.Unanteproyectodecadarecomendacinfue
revisadoporloscolaboradoressecundarioyterciariodentrodelgrupoquepreparentonceslascrticasadicionales.
Estosfueronabordadasporelescritorprimariayenviadosdevueltaalasilla.Todoslosproyectossefusionaronyse
publicarnenladireccinwebprotegidodisponiblesloparalosmiembrosdelgrupodetrabajoyoficinaATA.Este
documentoqueddisponibleparasurevisinperidicaporpartedelgrupodetrabajoengeneral,concrticasy
sugerenciasenviadasdenuevoalasillaqueactualizaeldocumento.Enunospocoscasos,elpresidentepidia
expertosexternospararevisarcrticamentelasrecomendacionesespecficasdadassusconocimientosenunrea
enfocada.Suscomentariosysugerenciasfueronluegotrabajaroneneldocumentomaestro,ylosaportesson
reconocidosalfinaldeesteartculo.
Elpanelestuvodeacuerdoenquelasrecomendacionessebasanenelconsensodelpanel.Deliberacionesdelequipo
detrabajosellevaronacaboprincipalmenteatravsdelacomunicacinelectrnica.Tambinhubounaseriede
reunionesdelosautoresylasllamadasdeconferenciatelefnica.
Presentacin,AprobacinyRatificacindelasRecomendaciones

LaestructuradenuestrasrecomendacionessepresentaenlaTabla1.Lasrecomendacionesespecficassepresentan
enelcuerpoprincipaldeltextoy,enmuchoscasos,desglosados
ensubtemasidentificadosporletras.Losnmerosde

pginaylatecladelalocalidadsepuedenutilizarparanavegarrpidamentealostemasyrecomendaciones
especficas.
TABLA 1.
ORGANIZACIN DE LASRECOMENDACIONESDEL GRUPO DE TRABAJO

Antesdelapresentacininicialdeestasdirectrices,quefueronaprobadasporlajuntadirectivaycomitejecutivode
laATAyposteriormenteenviadasalosmiembrosdelaATAaprincipiosde2013paracomentariosysugerencias.
Estaretroalimentacinfueconsideradoenlaelaboracinulteriordeldocumentoquefuepresentadoparasu
publicacin.Conposterioridadaldocumentoqueestsiendoaceptadoparasupublicacinenlatiroides,quefue
aprobadoporlajuntadirectivaycomitejecutivodelaATA.
EldocumentofinalfueaprobadooficialmenteporlaAcademiaAmericanadeOtorrinolaringologaCirugade
CabezayCuello(AAOHNS),laAsociacinAmericanadeCirujanosEndocrinos(AAES),elColegioAmericano
deMedicinaNuclear(ACNM),AsiayOceanaAsociacintiroides(AOTA),SociedadBritnicadeMedicina
Nuclear(BNMS),ThyroidAssociationBritnica(BTA),EuropeanThyroidAssociation(ETA),laAsociacin
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

3/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

InternacionaldeCirujanosEndocrinos(IAES),ItalianoSociedaddeEndocrinologa(SIE),JapntiroidesAssociation
(JTA),SociedadCoreanadecabezayNeckSurgery(KSHNS),AmricaSociedadAmericanadelaTiroides
(LATS),SociedadCoreanadeMedicinaNuclear(KSNM)ylaSociedaddeEndocrinologa(TES).
RESULTADOS

Ira:

[A]Laevaluacindelaglndulatiroides
Visindeconjunto Estudiosdelafuncindeestructuraderelacindelaglndulatiroides,ascomolosestudiosdela

cinticadeyodurodetiroidesydeformacindeimgenesseempleantradicionalmenteparaevaluarlaglndula
tiroides.Caracterizacinestructuralesimportanteparaevaluarloscambiosfuncionalestalescomohipoe
hipertiroidismoyparaevaluarlatransformacindeclulasdetiroidesenunfenotipomaligno(13).Almismo
tiempo,elestudiodelaformacindeimgenestiroideaeconomayyodurodetiroidessonrelevantesnosloparalos
estudiosdelasntesisdelahormonatiroidea,sinotambinparalacomprensindelosefectosdelastoxinas
ambientales,talescomoelpercloratootiocianatoenlaeconomadelatiroides(47).
[A.1]relacionesestructurafuncin
Fondo Mientrasquelatiroideshumanaconsisteenunaizquierdayunlbuloderechoqueestnconectadosporun

istmo,roedorestienendoslbulostiroideosindependientes.Laglndulatiroidesestdivididaportabiquesdetejido
conectivoenlbulos,cadaunodeellosquecontienede20a40folculos,launidadfuncionalbsicadelaglndula
tiroides.Elfolculoesunarondaoestructurahuecoalargadorevestidoporunasolacapadeclulasfoliculares
cbicasoaplanadaspolarizadasquesellenaconcoloidequecontienetiroglobulina.Estrodeadoporunamembrana
basalyunaredcapilarricaconaltoflujodesangre(8).Losfolculosnormalmentevarandetamaoconsiderable,y
lamorfologadeclulasfolicularesesgeneralmentemontono.Laalturadelasclulasvaradeacuerdoconelestado
funcionaldelaglndula.
RECOMENDACIN1a
Morfometradelosfolculostiroideossepuedeutilizarcomounndicedelaactividadtiroidea.
Comentario Todalaglndulasiempredebeserdiseccionadomientrasqueestunidoalatrqueaeinmediatamentese

fijaronconformalinaal10%tamponadaneutraparaanlisishistolgicoeinmunohistoqumico.Hematoxilinay
eosina(H&E)tincinesampliamenteutilizadoparaevaluarlostirocitos,mientrasquelatincincidoperidicode
Schifftietiroglobulinaconavidezyseadaptabienaresaltarelcontenidodeprotenafolicularylaestructura
folicular(Fig.1)(8).Lasmodificacionesestructuralesreflejanloscambiosenlaactividadsecretoraqueresultande
ladeficienciadeyodo(9),exposicinalfrocrnica(10),otratamientoconfrmacosantitiroideos(11).Algunos
parmetrosdelasclulasfolicularescomolaalturasepuedenmedirconmicroscopadeluzusandounacuadrculade
micrmetroocular(porejemplo,enunaratade1mesdeedad,laalturadelasclulasepitelialessetratade10 micras)
(12).Unepitelioplanoeshipoactivo,mientrasqueunepiteliomayorseobservaenlasglndulasenelquese
estimulalatirotropina(TSH)ylava(10).Elusodeanlisisdeimagensemiautomticacomputarizadoesms
objetivoyampliamenteutilizado(13).Dichoanlisismorfomtricosdebecentrarseenunadelasseccionescentrales
delatiroides(13)queesrepresentativadetodoellbulo(14).Losdatosobtenidossereducenenmodelos
matemticospredefinidosqueasumenlosfolculostiroideostienenunaformaesfricaylasclulasfolicularesson
octgonosconunabasecuadrada.Estareduccindedatosseobtienenlossiguientesparmetros:media
circunferenciadelfolculosuperficieyvolumenvolumentotaldeepitelioydecoloidenmerodencleosde
clulasepitelialesvisiblesencadafolculoylaaltura,reasuperficial,yelvolumendelasclulasepitelialesde
tiroides,quepuedeserutilizadoparaestimarelestadofuncionaldelaglndulatiroides.As,elndicedeactivacin,
expresadaporlarelacindevolumendevolumen/coloideepitelial,aumentaamedidaquelatiroidessevuelvems
activo,loquereflejaunaumentoenelvolumenepitelialyunadisminucinenelvolumendecoloide(13).Medicin
delvolumentotaldeclulasencultivosdetirocitosprimariasolneascelularescultivadasinvitrosepuederealizar
utilizandomicroscopaconfocaldeescaneolserdespusdelasclulassecarganconoctadecilrodaminaB(15,16
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

4/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

).
FIG.1.
Estructuramicroscpicadelaglndulatiroidesderatn.(A)conhematoxilina
yeosina(H&E)tincin.(B)cidoperidicodeSchiff(PAS)detincin.Los
ratonesfueronsacrificados,ylatiroidesdiseccionaron,fijaronenformalina
tamponada,yembebidosenparafina.Seccionesdelatiroides...

RECOMENDACIN1b
Laautorradiografasepuedeutilizarparacuantificarlaactividadglobaldelosfolculostiroideosypara
determinarlaubicacindeyodurodentrodelosfolculos.
Comentario Clulasfolicularestiroideasconcentranyodurodeacuerdoconsuactividad.Aunquelaactividaddelos

milesdeclulasfolicularesdebesersimilardentrodeunaglndulatiroidesdado,hayunagranvariacinentrelas
clulasdentrodelamismafolculoyentrefolculos.Asautorradiografaofreceunavisinnicadelaactividadde
lasclulasfolicularestiroideasindividuales.
125

Iseinyectaporvaintravenosa,tpicamentede48a72horasantesdematarelanimal.Glndulastiroidesse
disecaronyseprocesaronparalaautorradiografautilizandotcnicasestndar(17,18).Organificacindeyoduro
puedeserbloqueadaporeltratamientodelosanimalesconmetimazol(MMI).Experimentosconautorradiografa
humano,roedor,yeltejidobociofelinotambinsehanrealizadodespusdexenotrasplantesdetejidotiroideoen
ratonesdesnudos.Fragmentosimplantadosubcutneamentesemantienenenratonesreceptoresdurantevarias
semanasantesdesuposterioranlisis(19).
1cRECOMENDACIN
Ladistribucinultraestructuraldeyodurodentrodelosfolculosdelatiroidessepuededefinirconla
espectrometrademasasdeionessecundarios(SIMS).
Comentario SIMSesunatcnicautilizadaparaanalizarlacomposicindelaspelculasdelgadasporpulverizacin

catdicalasuperficiedelamuestraconunhazdeionesprimariocentradoyrecogeryanalizarexpulsadoiones
secundarios(Fig.2).Lasrelacionesdemasa/cargadeestosionessecundariossemidenconunespectrmetrode
masasparadeterminarlacomposicinelemental,isotpicoomoleculardelasuperficieaunaprofundidadde12 nm.
SIMSeslatcnicadeanlisisdesuperficiemssensible,conlmitesdedeteccinelementalesquevandesdepartes
pormillndepartespormilmillones.Esespecialmenteadecuadoparaelestudiodeladistribucindeionestrazaa
nivelultraestructural(20).
FIG.2.
MicroscopaelectrnicadetransmisindetiroidesMouse.Lbulostiroideos
sefijaronenglutaraldehdoal2,5%en0,1 Mtampncacodilatodurante1,5
horas,despusdelafijadaen1%detetrxidodeosmiodurante1hora,yse
embebieronenresinaLX112(LaddInvestigacinIndustries,Burlington,...
Imgenesinicosmuestranqueladistribucinanticipadadeyodoesheterogneadeunfolculoaotro,deuntirocito
aotrodentrodelamismafolculo,yqueestadistribucinvaracomounafuncindetiempo(21).Entiroides
normaleslonatural127Iistoposeencuentrapredominantementeenlaaberturafolicular.Laidentificacindelumina
desprovistade127Iy/olademostracindecantidadessignificativasde127Ienelcitoplasmadelasclulas
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

5/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

epitelialesoenlamembranaapicalindicaundeteriorodelavadeyodacin.Paradefinirladistribucin
ultraestructuraldeyodurousandoSIMS,lbulostiroideosseprocesanenformasimilaracomoparamicroscopa
electrnica,incluyendolafijacinconglutaraldehdoypreparacindedelgadassecciones(20).
1dRECOMENDACIN
Lamicroscopaconfocalenconjuncincontcnicasdeinmunohistoqumica(IHC)puedeutilizarseparadoso
tresdimensiones(2Do3D)dereconstruccindeimagenparaestudiarlaexpresindeprotenasenlos
folculostiroideos,laredcapilarquerodea,yelestroma.
Comentario Losanticuerpossondisponiblescontralamayoradelasprotenasclaveenlabiologatirocito(22,23).

Porlotanto,lastcnicasdeIHCestndarseutilizancomnmenteenestudiosdetiroides(Figs.3y4)(24,25).La
visualizacinpuedeserrealizadoconmicroscopadeluzconvencional,microscopadeinmunofluorescencia,o
microscopaconfocalparaunamayorresolucinyreconstruccindelaimagenen2Do3D(26).Protenasy
procesosdelasuperficiecelularseinvestiganmejormediantemicroscopaelectrnicadebarrido(10).
FIG.3.
Ladeteccindetiroglobulinaytiroglobulinayodadaenlatiroidesratnpor
inmunohistoqumica.(A)Latiroglobulinasedetectenseccionesdeparafina
utilizandoanticuerpopoliclonaldeconejoantitiroglobulina(Dako)diluido
1/1500yseincubarondurantelanoche....

FIG.4.
Deteccindeladobleoxidasa(DUOX)ytiroperoxidasaenlatiroidesratn
porinmunohistoqumica.(A)DUOXsedetectenlasseccionescongeladas
conanticuerpopoliclonaldeconejodiluido1/3000yseincubarondurantela
noche.Lapositividadseobservenelpoloapical...
Laactividadperoxidasaendgenaesmuyaltaenlasclulastiroideasysedetectamediantelareaccindesecciones
detejidofijadasconsustrato3,3'diaminobencidinapretratamientoconperxidodehidrgenoantesdelaincubacin
conelanticuerpoprimarioeliminalaactividaddelaperoxidasaendgenaquepuedainterferirenlosestudiosdeIHC.
Elusodeprotenasfluorescentesetiquetadodebeserevitadosilaautofluorescenciaesunproblema(talcomose
evalumediantelavisualizacindeseccionesdetejidoconunmicroscopiodefluorescenciaantesdecualquier
incubacindelanticuerpo).EstudiosdedistribucinsubcelularBellassepuedenhacerconIHCymicroscopa
confocalmicroscopaelectrnicadetincininmunopermiteladeteccindeantgenosamuyaltaresolucinenlos
estudiosdedistribucinsubcelular(Fig.5)(20,27).
FIG.5.
Ladeteccindetiroglobulinaenlatiroidesratnpormicroscopaelectrnica
inmunooro.Despusdellavadoconalbminatamponadaconfosfatosolucin
salinadesuerobovino(PBSBSA1%),ultrafinasecciones(0,1 micras)se
incubarondurantelanocheconunconejo...
[A.2]cinticadeyodurodetiroides
Fondo Lasntesisdelahormonatiroidea,sutetrayodadoformatiroxina(T4),y3,3',5triyodotironina(T3)

requiereunaglndulatiroidesnormalmentedesarrollado,unaingestaadecuadadeyodo,yunaseriedepasos
bioqumicosreguladosenclulasfolicularestiroideas,queformanlosfolculostiroideosesfricas,launidadfuncional
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

6/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

delaglndulatiroides(28).Enlasclulasepitelialesdetiroides,elcotransportadoryodurodesodio(NIS)mediaen
lacaptacindeyoduroenlasclulasfolicularestiroideas(29),ysuexpresinestpolarizado(esdecir,queslose
expresaenlamembranabasolateral).Enlamembranabasolateraldelostirocitos,Na+/K+ATPasageneraun
gradientedesodioquepermiteNISparamediarinhibirseperclorato,Na+dependientedelacaptacindeyodo(30).
Elyodurosetranslocaalamembranaapicalyalcanzaellumenfoliculartravsdelamembranaapical.Sibienseha
supuestoqueelyodurosemueveatravsdelamembranaapicalprincipalmentedebidoalagradienteelectroqumico,
losestudiosenlaseccindecongeladosdemostraronqueseacumulaprimeroenelcitoplasmayslomstardeenel
lumen,yyodurodeeflujoapicalseacelerarpidamenteenlasclulaspolarizadasdespusexposicinaTSH(31).
Losestudioselectrofisiolgicosusandoinvertidasvesculasdemembranadeplasmasugirieronlaexistenciadedos
canalesapicalesdeyoduro,perosuidentidadmolecularnosehadeterminado(32).Elaninmultifuncional
intercambiadordependrin(SLC26A4/PDS),quetieneafinidadporanionestalescomoyoduro,cloruro,bicarbonato
ysecreequerepresentanunadeestasentidades(33,34).TantoNISyexpresinylaactividadSLC26A4se
incrementanporlaTSH(30,33).Mientrasquelacaptacindeyodotrminopuedeserutilizadoampliamentepara
invitroeinvivoenfoques,interpretacindedatosdebetenerencuentalasdiferenciascrticasentrelosdosajustes,
conelanteriorreflejalacaptacindeyodocelularyelltimoprincipalmentelaconcentracindeyodoorganifieden
elcoloide.
RECOMENDACIN2a
Basolateralabsorcindeyodurodeeflujocelularyapicaldeyoduropuedenserestudiadosenmonocapasde
clulaspolarizadascultivadasenmembranaspermeablessemiqueformanunsistemadedoscmaras,oen
modelosdeclulasnopolarizadostalescomolaslneasdeclulasdetiroidesFRTL5oderataPCCL3.
Comentario Medicindelaabsorcindeyoduroydeflujodesalidaenlasclulasnopolarizadosesrelativamente

sencillo.Elestablecimientodesistemasdeclulaspolarizadasrequiereelaislamientodeclulasprimariaso
transfeccinotransduccindeclulasheterlogaspolarizadasyladocumentacindelaformacindemonocapa
intacta,quesontediosoyconsumemuchotiempo(31).Paralosensayosdecaptacindeyoduro,lasclulasse
incubaronenunasolucindeabsorcinquecontienetpicamente105MNa125Iporunperododetiempo
deseado.OrganificacinpuedeserbloqueadaporeltratamientodelasclulasconMMI.Elcontenidodeyoduro
intracelularsedeterminamediantelamedicindeyoduroderadiomarcadoenloslisados
celularesusandoun

contadorgammadespusdelalisiscelular.Losresultadosseexpresancomocuentasporminutoporpocilloo,
idealmente,pormicrogramodeADN.Lacantidadgravimtricadeyodurointracelularmenteacumulada(ADNpmol
/mg)tambinsepuedecalcularsobrelabasedelaactividadespecficadeltrazador.Losmtodosalternativosquese
hanutilizadoincluyenelusodeinactivadoresdehaluro.Unproblemaconesteenfoqueesqueestosinactivadoresno
sonespecficosparayoduro,perotambinreaccionanconotroshaluros.Ladisponibilidaddeunaumentodeprotena
fluorescenteamarilla(EYFP)modificadoH148Q/I152Lconaltaafinidadporelyodurohapermitidoelseguimiento
deafluenciayyodurodeeflujoconrelativamentebuenaprecisinyunaltogradodecorrelacinconlasmediciones
directasdeyoduroderadiomarcado(3537).Alternativamente,laespectrometrademasassehautilizadopara
estudiarlaabsorcindepercloratoenFRTL5clulas,quetambinestmediadaporNIS(38).
UnnmerodemodeloscelularesyconfiguracionesestndisponiblesparaestudiareltransporteNISmediadapor
yodurode(46,31,33,3941),incluyendomltipleslneascelularesheterlogasqueexpresantransitoriamente
NIS(29,42).TalesestudiossontilesparalacaracterizacindelafuncindeNISylasactividadesdeorigen
naturaloprotenasmutantesartificiales(29,42).Porejemplo,sontilesparamedirelestadodeequilibrioyla
velocidadinicialyodurodeabsorcin,ascomolosparmetroscinticosdetransportedeyoduromediadaporNIS.
Lacaptacindeyodurotambinhasidoestudiadoenlneascelularesdecncertransfectadasotransducidascon
construccionesenlasqueelADNcdeNISestbajoelcontroldepromotoresespecficosdetejidoconelobjetivode
promoverlacaptacinde131Iyparainducirlamuertecelularatravsdesuemisinbeta(43,44).Paralos
estudiosqueevaluaronelefectodelaTSH,elmediousadoparacultivarclulastiroideassecambiaalosmediosde
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

7/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

TSHprivadoparavariosdasyluegopresentadoalasdiferentescondicionesexperimentales.
2bRECOMENDACIN
Yodurodeeflujodetirocitossepuedeevaluarenlneasdeclulastiroideasdepercloratotratados.
Comentario Paraestudiaryodurodeeflujoinvitro,lasclulassecargancon125Idurante12horasyposteriormente

tratadosconpercloratoelfindebloquearlacaptacindeyodurodeporNIS.Elflujodesalidapuedeentoncesser
estudiadoporlarecogidadelossobrenadantesenunoomltiplespuntosdetiempo(5).Elcontenidointracelularde
yodurotambindebedeterminarseenunoomltiplespuntosdetiempo.Otraestrategiaesutilizarunsistemadedos
cmaras,enlaqueelflujodesalidadeyoduroenlamembranaapicalsepuedemedirporrecogiendoelsobrenadante
enunoomltiplespuntosdetiempo(31,40).Medicindeyodurodirectamenteconelectrodosselectivosdeiones
enlossobrenadantesdelisados
celularesoesproblemticodebidoaqueestassondasnosonespecficosparayoduro

ytambinreconocenotroshaluros,talescomocloruro.
FlujodesalidadeyoduroradiactivoporelSLC26A4canaldeaniones(pendrin)ocualquierotrocanaldeaniones
tambinpuedeserestudiadoenmltipleslneascelularesheterlogasqueexpresantransitoriamenteNISquepermite
lacaptacindeyodoinicial(3,40).Estopuedeserdocumentadoporlamedicindelcontenidodeyoduro
intracelularenlasclulascoexpresindeNISyelcanaldeinteresesconlacomparacindirectadelasclulasque
sloexpresanNIS.Unsistemamodeloqueesadecuadoparatalesexperimentoseslalneacelularderincanino
MadinDarbypolarizado(40).Latransfeccindeestasclulasesmuyineficienteyestopuederequerirel
establecimientodelneascelularesqueexpresandeformaestableotransduccinviralconvectoresapropiados.Por
otraparte,eleflujosepuedeseguirusandoEYFPH148Q/I152Lcomounindicadordelaconcentracindeyoduro
intracelular(3537).
RECOMENDACIN3a
Cinticadelaglndulatiroidesyodurodeabsorcinsepuedenestudiaratravsdelaadministracinde
yoduroradiactivo.Lospuntosdedatossepuedenobtenerinvivoodespusdelareseccinenbloquedela
trqueaylatiroides.
Comentario Tiroidescaptacindeyoduroradioactivo(RAIU)yotrosaspectosdelacinticadeyodopuedenser
125

estudiadosenroedoresutilizandodiferentesistoposdeyodo,mscomnmente I,queseinyectaporva
intraperitoneal(210 Ci125I).Laglndulatiroidesestestudiposteriormenteendiferentespuntosdetiempo,yasea
conunasondagamma(utilizado,porejemplo,paralaidentificacindetejidoparatiroideoencirugamnimamente
invasiva)bajoanestesia(45,46)opostmortemdiseccionadoconlatrqueaenbloquebajounmicroscopioyse
procesaronpararadiometradurante1minutoenuncontadorgamma.Losresultadossepuedenexpresarcomouna
funcinde125Ienelsuero(47)ocomoporcentajedeladosisinyectadatotal(46).TiroidesRAIUalcanzaun
mximoaaproximadamente4horasdespusdelaadministracinde125Iymesetasenalrededorde12horas(48).
Estossonlospuntosdetiempoaproximadosquepuedenvariarsegnlaespecieylacepadelroedorbajo
investigacin.Momentodela125deinyeccinquepuedesercoordinadoconlainyeccindeTSHbovina(bTSH
10 mU)paraevaluartiroideaRAIUlainducidaporTSH.EnalgunoscontextosestilparasuprimirlaTSH
endgenaporelpretratamientodelosanimalesconT3durante4dasantesdelaadministracinderadioistopos(
48).EstominimizarlaposibilidaddequeTSHendgeno,quepuedeserdiferenteentredosgruposdeanimales,
estinterfiriendoconlarespuestaabTSH.Enparticular,unestudiocomparativoenratasyratonesutilizando
tirotropinahumanarecombinante(rhTSH)indicaqueesmuchomsimportanteparatratarpreviamenteconT3y
suprimirlaTSHendgenaenratasqueenlosratones(49).
3bRECOMENDACIN
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

8/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Tiroidesyoduroorganificacinsepuedecuantificaratravsdelapruebadedescargadeperclorato.
Comentario Lapruebadepercloratopermitelacuantificacindelacantidaddeyodurodequenormalmenteseuneala

tiroglobulina(50).LapruebasebasaenelhechodequeelyodurosetransportaalasclulastiroideasporNIS,
luegoseliberaenellumenfoliculardondeserpidamenteunidocovalentementearesiduosdetirosilodela
tiroglobulina(organificacin).LosanionestalescomopercloratoinhibenNIS,ycualquieryodurodeintratiroideoque
nohasidoincorporadoalatiroglobulinaseliberarpidamenteeneltorrentesanguneoenlamembranabasolateraly
nopuedensertransportadosdenuevoentirocitos.Enlapruebadepercloratoestndar,losrecuentostiroideasse
midenaintervalosfrecuentesdespusdelaadministracindeyodoradiactivoconelfindedeterminarlaabsorcinen
laglndulatiroides.Despusdedocumentarlaabsorcin,percloratoseadministraporvaintravenosao
intraperitoneal,ylacantidaddeyodoradiactivointratiroideosemideaintervalosfrecuentes.Encondiciones
normalesdeorganificacinyoduro,nohayunadisminucinsignificativaenelrecuentodeintratiroideos.En
contraste,unaprdidade10%indicaundefectoorganificacin,quepuedeserparcial(10%90%)ocompleta(>
90%).
Enratones,percloratodesodio(NaClO4)seinyectaporvaintraperitoneal1horadespusdelainyeccinde125I
porvaintraperitoneal,ylosanimalessematan1horamstarde(47).Laradiactividadquequedaenlaglndula
tiroidesdelosanimalestratadosconpercloratosecomparaconel125Icaptacinmedidoenlasglndulasdelos
ratonesdecontrolquenofueronexpuestosalapersecucinyoduroinducidaperclorato.Unidaaprotenas125I(es
decir,eltotaldelashormonastiroideasradiactivounidosaprotenasdetransportedesuero)sedeterminaentodaslas
muestrasdesangredespusdecidotricloroactico(TCA)precipitacin(47).Otroshansidocapacesderastrearla
captacindeyodoyladescargaenratonesutilizandodirectamentesondasgamma(45).Elpercloratodepotasio
(KClO4)sehautilizadoenratas618horasdespusdelainyeccinde125Iysemuestraparareducirel125I
tiroides/ratiodesangrecuandoseinhibelaperoxidasatiroidea(51,
52).124tomografaportomografadeemisin

depositronesI/computarizado(PET/CT)sehautilizadoparaevaluarlaabsorcinraravezyladescargadeyoduro
entiroidesderoedoresinvivo(53).
3cRECOMENDACIN
Cinticadelasecrecintiroideapuedenserestudiadosinvitroutilizandolareseccinenbloquedelatrquea
ylatiroides.
Comentario EstaestrategiaseutilizaparaevaluarinvitrolasecrecintiroideainducidaporTSH,loqueminimizala

interferenciadeotrosenvivofactores(20).Losratonesrecibenunainyeccinintraperitonealdeaproximadamente
30 Cide125Iy24horasdespusdelatrqueaylaglndulatiroidesseeliminanenbloqueyseincubdurante3
horasenunmediodebicarbonatodeKrebsRingerquecontienen0,5 gdealbminadesuerobovino/L(BSA),8
mMglucosay104MNaClO4paraevitarlarecirculacindeyoduro.Radiomarcadohormonatiroideasecretadain
vitroseextraeconbutanol(54).Lasecrecinseexpresacomounporcentajedelaradiactividadtotaleneltejidoal
iniciodelaincubacin.Hayunainduccindeaproximadamente10vecesenlasecrecintiroideaconlaadicinde5
mU/mldeTSH(20).
[A.3]imgenestiroides
Fondo Imgenesdelatiroidesenroedorespequeoshaseguidolastcnicasdesarrolladasparalossereshumanos,

comolaexploracinconistoposdeyodo,microPET,CT,yultrasonidodealtafrecuencia(HFUs).Sinembargo,el
tamaodelaglndulaminutossigueplanteandounretoimportanteparalaobtencindeimgenesdealtaresolucin
dealtacalidad,quehasidoparcialmentesuperadoporlanuevatecnologareciente.
RECOMENDACIN4a
Imagenfuncionaldelaglndulatiroidessepuederealizarutilizandoistoposradiactivosyyodurode
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

9/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

adquisicindeimgenesenunacmaragammaoatravsdemicroPETCT.
Comentario 123Iy131Isepuedeutilizarjuntoconunacmaragammadeimgenesplanas,ascomolatomografa
131

poremisindefotones(SPECT)estudios. Itieneunavidamedialarga(8das),perosualtaenergaproduce
imgenesdemalacalidad.Encontraste,labajaenergaemisor123Iesideal,produciendogammagrafastilescon
unadosisbajaabsorbidalasprincipaleslimitacionessonelresultadodesucortavidamedia(13horas).La
gammagrafadetiroidesenratasanestesiadastambinsepuederealizar124horasdespusdeunainyeccin
intraperitonealde10 Ci125IusandoSPECT(46).Imagingsemejorasustancialmentemediantelacolocacinde
losanimalesenunadietabajaenyodo(LID)duranteaproximadamente3semanasantesdelosestudios(46).Esto
mejoralaRAIUtiroides4horasdesdealrededorde3,5%a27%yhacequelagammagrafadetiroides,entodoslos
tiemposdeadquisicin,msbrillanteymsdetallada(46).SPECTenratonesutilizando99mTco123Tambinhe
sidoinformado(55,56).
EstudiosdePETdelatiroidesusando124meproducenbuenacalidaddeimagen,conunavidamediarazonable(4
das).LasensibilidaddelaPETesmayorqueladeunacmaradecentelleo,ascomoelcontrasteylaresolucin
espacial(53).Paraimgenesdetiroidesprecisaenratas,lacombinacindemicroPETymicrotomografaaxial
computarizadacon124esnecesarioI(Fig.6)(57).Ratasadultasanestesiadasoratonesseinyectanatravsdela
venadelacolacon20a540 CideNa124IyescaneadosenelmicroPETdurante40minutosa24,48,y72horas
despusdelainyeccinbajoanestesia.Losdatosdeimagenresultantessenormalizaronalaactividadadministrada
entrminosdelporcentajedeladosisinyectadaporgramodetejidos(Fig.6B).Regiones2Dextradas
manualmentedeintersovolmenes3Ddeinterssepuedenutilizarparadeterminarelreayelvolumentiroideo.
Porejemplo,elvolumendelatiroidesdeunadulto400500 gratavaraentre35y70 l(57).Ademsdela
glndulatiroidesens,esteenfoquetambinsehautilizadoparametstasisdeimagendecncerdetiroidesenratones
(58).
FIG.6.
Imgenesdelatiroidesusando124Iyoduroinvivo.(A)biodistribucinde
124Iyoduroenlatiroidesderatonesmodificadosgenticamenteenlosquela
captacindeyododelatiroidessesuprimeporinduccindeuntransgn1
semanadespusdesupresinsealiviaylacaptacindeyodosenormaliza....
RECOMENDACIN4b
MicroImagingmorfolgicadelaglndulatiroidessepuederealizarporHFU.
Comentario HFUs(20100 MHz)esunametodologadeformacindeimgenesqueseextiendelainvivola

visualizacindelaresolucinmicroscpica(delordende100 micrasFig.7)(59,60).Laglndulatiroidesdeun
ratnpuedeserexaminadausandounsistemadeMicroImagingquetieneunasolasondaelementodelafrecuencia
centralyunrangodinmicode52 dB.HFUsserealizabajoanestesiageneral(porejemplo,1,5%2%deisoflurano
vaporizadoenoxgeno)enunescenariocalentado.Furseretiradelazonadeinters(cuelloylaaltatrax)para
obteneruncontactodirectodelgeldeultrasonidoalapieldelanimal,reduciendoalmnimolaatenuacinde
ultrasonido.Formacindeimgenesentiemporealsepuederealizarconunavelocidadde20 Hz(correspondientea
unaresolucintemporalde50milisegundos)elcentrodelatiroidesderatnsecolocaalrededorde6 mmdelazona
focaldeltransductor.Elestudio,queincluyemedicionesyadquisicindeimgenesprecisas,repetiblesydealta
calidad,sepuedecompletarenunos30minutosenlasmanosdeunoperadorbienentrenadoycapacitado(61).
FIG.7.
Ecografadealtafrecuencia(HFU)delatiroidesratn.(A)imagen
representativadelatiroidesderatnusandoHFUsysucorrelacinanatmica
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

10/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

con(B)imgenestransversaleshistolgicasdelasregionessubhyoidy
traqueales.Estructurasvisiblesincluyen:1,...
Elvolumendecadalbulosepuedecalcularutilizandolafrmulaovoide(anchuraxprofundidadxlongitudx/6)(
61).ElvolumendelatiroidesdeunadultoratnC57BL/6oscilaentre2,1y4,9 l.En6npropil2tiouracilo
(PTU)tratadaconratonesnobociodifusoconvolmenesqueoscilanentre4,1y8,8 l.Losndulostiroideospueden
serdetectadosatravsdeestametodologa,as,conelndulodetectablemspequeoquepresentaundimetrode
0,46 mm.Caractersticassugestivosdemalignidadtambinpuedenidentificarsecomohipoecogenicidadrelacincon
eltejidonormaladyacente,losmrgenesmaldefinidos,microcalcificacionesinterna,formasirregulares,yla
extensinextraglandular(61).Estodeberasertilenlacaracterizacinfenotpicademodelosderatndecncerde
tiroides.
[B]Laevaluacindecirculacinydeltejidonivelesdehormonasdelatiroides
Visindeconjunto "Estadodelatiroides"deunorganismoeslasumadetodosloseventosdesealizacindela

hormonatiroideaydependetantodelosnivelescirculantesdelahormonatiroideaydefactoreslocalesqueinfluyen
enlaconcentracinnucleardehormonatiroideaentejidosespecficos.Latirotoxicosiseselsndromeclnico
asociadoconelexcesodehormonatiroidea,mientrasqueelhipotiroidismodedeficienciadelahormonatiroidea.Al
mismotiempo,lostejidosindividualespodrandicequetieneelestadodeltiroidesespecfica,esdecir,hipotiroidismo
otirotxica,relativamenteindependientedelosnivelessricosdehormonatiroideaestoesdebidoalasactividades
desyodasasespecficosdetejidoy/omecanismosdetransporte(Fig.8).Porejemplo,laisquemiaylahipoxia
hacenqueelcerebroyelcoraznparaponersemuyhipotiroidismoenunanimaldeotramaneraeutiroideodebidoa
lainduccindetipoIIIdeiodinasa(D3)expresin(6265).Almismotiempo,eltejidoadiposo(BAT)presenta
marrnlocalizadosaumentodelahormonatiroideadesealizacinpocodespusderoedoressemuevenalfro
debidoalainduccinagudadetipoIIdeiodinasa(D2)expresin(66).
FIG.8.
Suministroyelmetabolismodelashormonastiroideasafectannegativamente
ypositivamenteT3genesregulatedenelcerebro.Paraconstruirestafigura,
losautoresutilizaronlapolimerasadetranscriptasainversacuantitativa
reaccinindividualcadenadedatos(RTqPCR)deT3regulated...
Unaformacomndeevaluarelestadodeltiroidesdeunorganismo,elestadodeltiroidesakasistmica,esmediante
lamedicindelosnivelessricosdelahormonatiroidea(T4yT3)yTSH,asrevertirT3tambinsepuedemedir,
peroporlogeneralsereservaparasituacionesespecialesparaconfirmaranormalidadesenelmetabolismodela
hormonatiroidea.Estadodelatiroidesespecficadetejidosepuedecaracterizarmediantelamedicindirectadelos
nivelesdehormonastiroideastejido.Porlogeneral,lamedicindelaexpresindeT3responsivegenes(vasela
seccinI)y/oT3responsiveparmetrosbiolgicos(vaselaSeccinJ)estambinpartedeltrabajoparadefinir
elestadodeltiroides.
Aligualqueconlosensayosclnicosdesarrolladosparalospacientes,unnmerodeinmunoensayosparalaT4,T3
yTSHhansidodesarrolladosespecficamenteparalosroedores,quetienenencuentalasdiferenciasdetiposy
capacidaddeyodotironinasueroprotenasyespecificidaddeespeciedelamolculadeTSHvinculante.Engeneral,
estosensayosfuncionanbienypresentanlasuficienteprecisinparaevaluarlafuncindelatiroidesyelestadodel
tiroidessistmicaenroedores.Encircunstanciasexperimentalesodefectosgenticosespecficos,losnivelessricos
yodotironinanosiempresonrepresentativasdelahormonatiroideadesealizacineneltejidooelnivelcelular.En
estoscasos,elestadodeltiroidespuededeterminarsemediantelamedicindeT3concentracioneseneltejidoo
clulasespecficasmediantelaadaptacindelosinmunoensayosdesarrolladosparalasmedicionesdesuero.
[B.1]Suero
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

11/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Fondo Losnivelesdehormonastiroideasensueropuedenvariarsustancialmenteenfuncindelsexo,laedad,yla

cepadelroedorydebensercontabilizadoseneldiseodelestudio.Losniveleselevados(comosedefineentrelos
rangosnormalesajustados)suelenindicarhipertiroidismo,mientrasquedisminuyeronlosnivelessricosson
indicativosdehipotiroidismo.Ladeficienciadeyodo,alteracionesenelmetabolismodelahormonatiroidea,as
comolasensibilidaddelhipotlamoylahipfisisalahormonatiroideapuedealterarlarelacinrecprocacuantitativa
entresuerodeT4,T3,yTSHcomoesamenudoelcasoenlosmodelosderesistenciaalaTSHuhormona
tiroidea.
Losinmunoensayosfuerondesarrolladoshacedcadasyhanservidocomopiedraangularparamediryodotironinas
sueroyTSH.Sinembargo,estosensayosoriginaleshansidosustituidosengranmedidaporlosinmunoensayosms
recientes(porejemplo,enzimadeensayodeinmunoabsorcinligado[ELISA],ensayoradiomtricoinmune
[IRMA])estndisponiblescomercialmente,todosloscuales.Elusodekitsdisponiblesenelmercadoparamedir
yodotironinassueroenroedoresnoessencilladebidoaquemuchosdeestoskitssedesarrollanparaelsuerohumano
yhacenusodeunamatrizartificialparaimitarprotenasdeuninhumanosconmayorafinidadycapacidadquelos
delosratonesoratas.Estoskitsutilizan"agentesdedesplazamiento"paradesplazarelyodotironinasdelaglobulina
fijadoradetiroxinahumana(TBG,porejemplo,8anilinonaftalencidosulfnico,difenilhidantona,cidosaliclico)
queseutilizaconfrecuenciaenexceso(paraelratn).Aesterespecto,interfierenmsconT3aT4,yenparticular
cuandoelsueroT3valoressonbajos.Estoslosepuedecorregirapropiadamenteparamedianteelusodesuerode
ratniodothyroninedeficientecomoenblancoylaconstruccindeunacurvaestndarquecalibrarelensayopor
ejemplo,suerodeemparejadogencuadro8(Pax8)knockout(KO)losratonesnotratadosconT4oT3duranteal
menos2meses(67).LaslimitacionestcnicastambinrequierenlautilizacindesueroderatnTSHenblancoy
deficienteparalapreparacindeunacurvaestndarconTSHdesueroderatn,noTSHhipofisaria,comoestndar(
68).Lquidoespectrometrademasas/cromatografatndemtambinseestconvirtiendoendisponible,aunquesu
aplicabilidadparalosroedoreseslimitadaporquelosvolmenesdesuerorequeridossontodavademasiadogrande.
RECOMENDACIN5a
SricatotalT4yT3concentracionespuedensermedidosporradioinmunoensayo(RIA),ounaseriedeotros
inmunoensayostalescomoELISAoIRMA,siemprequelascurvasdecalibracinsepreparanconsuerode
roedoresdespojadodelahormonatiroidea.
Comentario Curvasestndartpicassepreparanenelrangode2,5a240 ng/mLparaT4y0,16 ng/mLparaT3.

Estosensayossepuedendesarrollarenlacasamediantelamodificacindekitsparausohumanoobtenidoapartirde
mltiplesfuentescomerciales.RIAshechasencasatienenunamayorsensibilidadconlasmedicionesenelrangode
0,053 ng/mL(67).Ensayosclnicosdesarrolladosparalospacientespuedenserutilizadossiempreycuandola
curvaestndarderoedoresesparalelaalacurvaestndarproporcionadoenelkityunfactordecorreccinadecuado
aplicadolacurvaestndarderoedoressedebeutilizarparacalcularlosresultados(67).Comercialmentedisponibles
kitsdiseadosparalamedicindesueroderatnT3yT4en10 muestrasmulsehandesarrolladoyutilizadocon
resultadosaceptables(69).
5bRECOMENDACIN
LosensayosparamedirTcirculantes4yT3serealizanmejorutilizandosueroenvezdeplasma,yaquela
formacindefibrinaafectapipeteo,yaditivostalescomolaheparinapuedeinterferirdirectamenteconla
determinacindehormonas.
Comentario Muestrasdesangrefrecuentespuedenserobtenidosduranteelcursodeunexperimentosiselimitaa

aproximadamente10%delvolumentotaldecada24semanasy1%cada24horas.Serumsepuedealmacenara20
Cduranteperodosdetiempolargos.Elusodelaanestesiapuedetenerefectosvariablesenlosnivelesdehormona
tiroidea,ycadainvestigadordebeevaluarlosefectospotencialesensusistemaconlaanestesiaqueestnutilizando.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

12/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

SueroT3yT4exhibenmnimasvariacionescircadianasalolargodelosciclosdedaynocheestospodranser
tomadosencuentaenfuncindelmomentodelarecogidademuestras.Lasmuestrasdesueroconaspectolechosode
lactantespresasodesuscraspuedendarresultadoserrneosdebidoasualtocontenidodelpidos.Enestoscasosla
extraccindelsueroylaeliminacindeloslpidosusandocloroformoesrecomendable(67).
5cRECOMENDACIN
Lasdeterminacionesdelosndicesyodotironinagratuitas(FT4IyFT3I)enelsuerosepuedenlograr
mediantelamedicindelaconcentracindehormonatotalensueroylacapacidaddeuninyodotironina
sueroutilizandounodelosmtodosderesinaocarbn.
Comentario Laexistenciadeprotenasenelsueroqueseunendeformareversiblelahormonatiroideaestablecedos

piscinascirculantesdeT4yT3(esdecir,unidoaprotenaylibre).Laprotenasdeuninprincipalcirculantedealta
afinidaddelahormonatiroideadifierenenroedoresysereshumanos,contranstiretinasiendolaprincipalprotenaen
laratayTBGenlossereshumanos.Eslahormonatiroidealibreenelplasmaqueestenequilibrioconlostejidosy
afectaalasealizacindelahormonatiroidea.Lamedicindelahormonalibreporprocedimientosdistintosde
dilisisdeequilibriopuededarresultadoserrneos,aunquemicrofiltracindelasmuestrassehautilizadocon
resultadosconfiables(70,71).Equilibriodedilisisdesuerocontrazadormarcadoyodotironinaenbolsasde
dilisissehautilizadoparamedirlaTlibre4yT3enlarata.Elmtodonoseutilizaparalosratones,debidoal
requisitodemsde1 mldesueroparalamedicinportriplicadoporqueamenudoseproducenfugas.Elusode
suerodiluidoyaplicarlacorreccinnoesaconsejable.Slo100 ldesueroserequierecuandoseutilizala
microfiltracindelasmuestras(70).
Alternativamente,unaestimacindelaFT4IoFT3Isepuedenobtenerusandounvolumenrelativamentepequeo
desueromedianteelusodelaresinaocarbnmtodos(72).Elsuerosediluyeensolucinsalinatamponadacon
fosfato(PBS,pH7,4)quecontena[125I]T3o[125I]T4.Lasmuestrassedejaronequilibrarymezclan
posteriormenteconunasolucindecarbnvegetalactivado0,0125%.Seobtienengrnulosdecarbnydespusse
contaronenuncounter.Lascondicionesdebenseroptimizadosdetalmaneraqueaproximadamenteel20%30%
deltrazadorseuneacarbnenlossuerosdelosanimalesdecontroleutiroideo.UnaestimacindelaTlibre4oT3
(FT4IoFT3I)sepuedecalcularmultiplicandoeltotaldeT4oT3concentracinsricadelaT4oT3captacin
decarbn.
5dRECOMENDACIN
DilucindeistoposdeespectrometrademasasentndemsepuedeutilizarparamedirT4yT3enmuestras
biolgicas.
Comentario Losinmunoensayosparalamedicindelahormonatiroideapuedensufrirdemalaespecificidad.Como

alternativa,lamedicinsimultneadeT4yT3sepuedelograrmedianteelusodeistoposdedilucin
espectrometrademasastndemdentrodeunasolacarrera(67,73).Elmtodorequiere100 ldesueroyimplicala
adicindepatrninterno,precipitacindeprotenasconmetanolylainyeccinenunacolumnaC18.T4yT3se
eluyenposteriormenteusandoungradientedemetanol.Estemtodoespreciso,especficoypreciso(coeficientede
variacinde3,5%9,0%).Unapreocupacineselvolumendemuestranecesarioparaladeterminacindela
hormonalibre,quetodavaesrelativamentegrandeparaaplicacionesqueimplicanratones,exceptoenelsangrado
terminal.Metodologasimilaraplicandocromatografalquidaespectrometrademasasentndemsehadesarrollado
paralamedicindeiodothyronamines,unayodotironinadescarboxiladopresenteenunacantidaddefluidos
biolgicos(74).
RECOMENDACIN6a
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

13/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

RatayratnTSHensuerosepuedenmedirusandokitsdeensayoTSHderatacomercialmentedisponibles.
Alternativamente,RIAsespeciesespecficassepuedenrealizarutilizandolosreactivosdelProgramaNacional
dePptidosyhormonal,elInstitutoNacionaldeDiabetesyEnfermedadesDigestivasyRenales(Bethesda,
MD).
Comentario Engeneral,losacuerdosdeintegracinregionaldeTSHsonmssensiblesqueAMIR.Ensayos

comercialesnoproporcionanespeciesreferenciacruzadaespecficay,porlotanto,lascurvasdecalibracinson
raramenteparalelosalosvaloresobtenidoscondilucindelamuestrareal.Sinembargo,reactivoscomercialesse
puedenadaptarparamedicionesespecficasyprecisasdeTSHcomosedescribeacontinuacin.
CurvasestndardeTSHdebenconstruirseutilizandoespeciesespecficasdecirculacin(suero,nopituitaria)
estndardeTSH,diluidoensueroTSHdeficienteobtenidoapartirdelamismaespecie.EstndardeTSHsricase
obtienedeanimalesprestadoshipotiroidismo(vaselaSeccinE.1).ElcontenidodeTSHestcalibradocontraun
estndarbTSHenunbioensayo.SueroTSHdeficientesepreparahaciendoroedorestirotxicos(tratamientocon20
mgdelevotiroxina[LT4]/100 gdepesocorporal[BW]/dadurante1semana).Nonparallelismmuestraconlas
curvasdecalibracinsedebealasdiferenciasentreespeciesydereactividadcruzadaconsubunidadesdeTSHlibres
yotrasglicoprotenaspituitariasenextractosdepituitaria.ElusodelalactoperoxidasaparaetiquetarTSHcon125I
mejoralaestabilidaddelaTSHmarcadaylasensibilidaddelensayodeTSHhastatirotxicarangos(68).Medicin
delaconcentracindeTSHenlosextractosdelaglndulapituitariasepuedehacer,sinembargo,utilizandoel
mismoensayoaunadilucinde1:500a1:2000entampndeensayo.Lacurvaestndartambinsepuedeconstruir
usandotampn,enlugardesueroderoedoresTSHdeficiente,comodiluyente.EjecucindelosRIAsen
desequilibrio(adicindeltrazadorisotpicoduranteuntiempomscortodespusdelaincubacindelanticuerpo
TSHconlasmuestras)mejoralasensibilidaddelensayo.SinohaymedicinfiableTSHdesueroderata/ratnest
disponible,losnivelesdemRNATSHenlaglndulapituitariapuedenserutilizadoscomounaindicacindela
produccindeTSH(75).
6bRECOMENDACIN
ActividadbiolgicadeTSHpuedeserestudiadoporestandarizadoinvitroensayos,ascomoinvivoensayos.
Comentario ActividadbiolgicadeTSHesmoduladaporunnmerodefactoresincluyendosuestructura,

glicosilacinoramificacindehidratosdecarbono,ascomoporelreceptordeTSH.Laactividadbiolgicadela
molculadeTSHpuedeserdeterminadoporuninvitrobioensayousandoclulasdeovariodehmsterchinoque
expresanestablementeelreceptordeTSH(68,76).Elsubclncl213deJP2626esparticularmentesensibleabajos
nivelesdeTSH.Acercade50000clulassesembraronentubosdeensayoindividualesyseincubaroncon20 lde
suero,seguidodeextraccinconcAMP0,1 MHClylamedicinporRIA(77).Losespaciosenblancose
procesancomoyasehadescritoconsueroTSHagotadoobtenidoapartirdeT4tratadaconratones.laproduccin
decAMPesunafuncindelacantidaddeTSHendgenafuecontenidaenlamuestradeplasma(68).Dividiendo
elcAMPgeneradoinvitroporlosvaloresdeTSHenlamuestradeplasmaproporcionaunndicedelaactividad
biolgicadeTSH.Porsupuesto,estopuedevariardeacuerdoconlasmutacionesenlamolculadeTSHogradoy
tipodeglicosilacinoramificacindehidratosdecarbono.Sinembargo,estoscambiosnosiemprepuedenmostrar
diferenciasbiolgicasutilizandoinvitropruebas.Laalteracinenlaglicosilacindeprotenasolaestructuraterciaria
(hidratosdecarbonoderamificacin)delresiduodeazcar,alteralavidamediadeTSHinvivoyafectaasu
bioactividad.Sinembargo,estopuedenosersiempredemuestrainvitrobioensayo.Enalgunoscasossepuede
demostrarmedianteisoelectroenfoque,siunacantidadsuficientedeTSHpuedeserconcentradoydesarrolladopor
transferenciaWesternoporConcanavalinaAcromatografa(78).Otromtodoconsisteenpurificarporafinidadla
TSHestprobando,inyectarporvaintravenosaenratonesoratasconsupresindeTSH(tratadoscondosisaltade
T3),yseguirsuvidamediaporRIA,oseguirlaactividadbiolgicadeTSHmediantelamedicindeT4secrecin
enelsuero.DisminucindelabioactividadTSHtambinpuedesercausadapordefectosenelreceptordeTSHoel
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

14/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

nmerodereceptoresdeTSHexpresados
enlasuperficiedelaclulafolicular(porejemplo,TTF1heterocigotos

ratonesKO)reduce.Estopuedeserconfirmadoporlarespuestaquemuestraintactaenuninvitrobioensayojunto
conalteracinenlarespuestadelanimalainyectarTSHautntica(79).
RECOMENDACIN7
Hormonaliberadoradetirotropina(TRH)TSHinducidaporlasecrecindelaspruebassepuedeutilizarpara
evaluarlacapacidaddelaglndulapituitariaparasecretarTSH.Thyroidalpruebassecrecininducidapor
TSHsepuedeutilizarparaevaluarlacapacidaddelaglndulatiroidesparaproducirysecretarlahormona
tiroidea.
Comentario ElejeTRHTSHpuedenserinterrogadosyaseaenlapituitariaonivelglandulartiroideamediante

pruebasdinmicasespecficas.LapruebadeestimulacinconTRHserealizaconunainyeccinintravenosao
intraperitonealdeTRH(5,0 g/kgBW).Serecogesangre30minutosdespusparalamedicindeTSHensueroy2
horasmstardeparalamedicindesuerodeT3,queindicalacapacidadderespuestaalaTSHtiroideainducida
porTRH.ElaumentoprevistodelaTSHsricaesdetriple,mientrasqueunaelevacindeaproximadamenteel50%
enelsueroT3seespera(80).
LapruebadeestimulacinconTSHserealizaconunainyeccinintravenosaointraperitonealdebTSH(2250 mU/
100 gBW).Doshorasmstarde,serecogesangreparalamedicindesuerodeT3,conunaelevacinesperadade
aproximadamente40%encomparacinconlosnivelesdereferencia(7981).Unenfoquealternativoespara
pretratarratonesdurante4dasconT3(1 g/d)conelfindesuprimirlaTSHendgenayluegoadministrarbTSH
(2,10,o30 mU)enlamaanadelquintoda.Enestecaso,larespuestatiroideaseevalaenfuncindelaelevacin
inducidaporTSHensuerodeT43horasmstarde,queesaproximadamente1 g/dl(81)otresvecesenlalnea
debase(82).Unenfoquesimilarsepuedeutilizarenratas,yelTinducidaporTSH4respuestavarabastante
sustancialmentedeacuerdoconlacepaderata.Todavaenratas,inducidaporlaTSHT4mesetasrespuestaauna
dosisbTSHdeaproximadamente100 mU,conunaumentodealrededorde2 g/dlporencimadelalneadebase(
79).EsdedestacarqueunaevaluacincomparativadelacapacidadderespuestadelatiroidesarhTSHenratasy
ratonesindicapobreonularespuestaenratasquenofueronpreviamenteconT3(49).
[B.2]Tissue
Fondo MientraselplasmaconstituyelamayorpiscinaextratiroideadeT4,aproximadamentedosterciosdetodoslos

T3seencuentraenelespaciointracelulareinicialaaccindelahormonatiroideamediantelauninareceptores
nuclearesdehormonastiroideas(TR).LaintensidaddelasealizacindependedelnmerodeTRsocupadosen
cualquierdadoT3responsivetejido.Debidoaqueloscompartimientosextracelulareseintracelularesestnen
comunicacinylahormonatiroideamolculasdetrnsitodentroyfueradelasclulasatravsdelosdiferentes
transportadoresdemembrana,enlamayoradelostejidosdemedicindelaconcentracinsricadelahormona
tiroideaproporcionaunaestimacindelaintracelularT3concentracin.Sinembargo,unainterrupcindelsistema
detransportepodraimpedirellibreaccesodeT3alcompartimientointracelular.Adems,elmetabolismo
intracelulardelahormonatiroidea,tantolaactivacincomolainactivacin,podraafectaralasealizacindela
hormonatiroideadeunamaneraquenosepuedepredecirapartirdetomademuestrasdelcompartimentodeplasma.
Porlotanto,losnivelessricosdeT3noreflejannecesariamentelacantidaddeT3entodoslostejidosola
intensidaddelasealizacindelahormonatiroidea.LamedicindirectadeltejidoT3contenidoproporcionaesta
informacinadicional.
RECOMENDACIN8
ContenidodetejidodeT3yT4puedemedirseporinmunoensayosdespusdelaextraccindetejido.
Comentario Extraccindesangreapartirdetejidosporperfusinesimportanteparticularmenteparatejidosmuy
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

15/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

vascularizados.Despusdeobtenerlamuestradesangre,losratonessesometieronaperfusinconheparinaque
contienePBSatravsdeunaagujaquesecolocaenelventrculoizquierdo(VI)delcoraznseguidoporuncorte
abiertalavenacava.Lostejidosserecogenacontinuacin,secongelaroninmediatamenteenhielosecoyse
almacenarona80C.Yodotironinasseextraendetejidosutilizandometanolcloroformo(1:2).Lacantidadde
tejidoqueseextraedependedelestadodelahormonatiroideadelanimalylaabundanciadelahormonaenuntejido
especfico.Amododeejemplo,50 mgdecerebroy15 mgdehgadodeunratneutiroideogeneralmentedarn
resultadossatisfactorios,perolacantidaddebeseraumentadoenmuestrasderatonesoratasconhipotiroidismo.T
radiactivo3oT4,debeaadirseacadamuestraparadeterminarlaeficienciadelaextraccinunamezclade[125I]
T3y[131I]T4sepuedeutilizarcuandoambashormonassonobjetodeestudio.Dependiendodelprocedimientode
extraccin,cloroformodebeeliminarse,yaquecontienelpidosyotrassustanciasqueinterfierenenlosacuerdosde
integracinregional.Estoimplicaretroextraccinenclorurodecalcio,laconcentracindelosextractos,yla
evaporacin(83).Unavezquesehacompletadolaextraccin,sedisuelveelextractoseco,preferiblementeen
tampnosueroderoedoresconcarbnvegetal,yT3contenidomedidoporelinmunoensayoespecfico,siguiendo
lasrecomendacionesdadas.ARIAaltamentesensibleesdecisivaparaobtenerresultadosfiablesenmuestras
pequeasoenmuestrasdeanimaleshipotiroideos.ParaladeterminacindetejidoT4contenido,ensayos
comercialesnosonlosuficientementesensiblesyaltamentesensibleT4RIAentampndebenutilizarse(83).
Todoslosensayosdebenincluirtubosenblanco/decontrolapropiadas,quecontienetodoslosreactivosexcepto
paralamuestradetejido,paraserutilizadoparacomprobarelfondodelensayo.Validacindelensayotambin
incluyelademostracindeparalelismoentreunacurvadetejido(conmltiplespuntosprogresivamentemayores
cantidadesdeextractodetejido)ylacurvaestndarporencimadelrangodeinters.
[B.3]FuentesdetejidoT 3ylasaturacinTR
Fondo T3presenteenlostejidosextratiroideapuedederivarsededosfuentesdistintas:plasmaT3yT3generado

localmenteapartirdeT4(84,85).ElltimomecanismoseencuentratpicamenteenlostejidosqueexpresanD2
talescomoelcerebro,pituitaria,yBAT.LasestimacionessugierenquealmenoslamitaddelaT3presentesenlos
tejidosD2expresanesproducidolocalmentedesdedesyodacindeT4(8689).MsrecientementeexpresinD2
sehaencontradoenungrannmerodetejidosyclulas(9098),loqueilustralaimportanciadedefinirsu
contribucinalasealizacindelahormonatiroideaespecficosdetejido.Ladeterminacindelasfuentesde
intracelularT3esfactibleporqueplasmaT3seequilibrarpidamenteconlamayoradelostejidos(peronotodos).
Enelpuntodetiempodeequilibrio(Tm)sepuedeutilizarelplasmaT3laconcentracinylaproporcinnuclear/
plasmadetrazadorT3paraestimarlacantidaddeTnuclear3quesederivadeplasma.Unaestrategiasimilarpuede
aplicarseentoncesparaT4,devolviendoelTnuclear3quesederivadelaconversinlocaldelaT4aT3.
RECOMENDACIN9a
LacontribucindeplasmaT3altejidoT3sepuedecuantificarmediantetcnicasdetejidodeetiquetadoque
entraeninyeccionesintravenosasnicasobombaimpulsadaporlainfusincrnicadetrazador
radiomarcadoT3.
Comentario Losestudioshansidoestandarizadosenratas,peropodranenteoraseraplicadoenratones,as,a

condicindequelaslimitacionesdebidoaeltamaodelcuerpoylaanestesiasonsuperados.Lostejidospuedenser
estudiadoscomountodoofraccionarparaaislarlafraccinnuclearquecontieneTR(66,8689).Despusdela
administracinde[125I]T3,Tmsedefinecomoeltiempoenelquelacantidaddetrazador[125I]T3queentraen
eltejidoocompartimentonuclearesigualalacantidadde[125I]T3quesaledelmismocompartimiento.Tmse
alcanzaenhorasdelainyeccinintravenosaopocosdasdelarranquedelabomba.EnlaTm,el[125I]T3
proporcindetejidodeplasma/ylaconcentracinplasmticadeT3seutilizanparacalculareltejidoT3
concentracin.Clculossimilaresseutilizanentrazadoresradiomarcadoscasosseinfundenatravsdebombas(99,
100).Estosmtodossehannormalizadocon125IT3deseparacinporcromatografaenpapeldescendente.Hay
buenacuerdodequelacromatografalquidadealtorendimiento(HPLC)ycromatografalquidadeunrendimiento
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

16/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

ultra(UPLC)sonexcelentesmtodosparasepararyodotironinasetiquetadosyenteorapodraserutilizadotambin.
9bRECOMENDACIN
TRmximacapacidaddeuninenuntejidosepuedeestimaratravsdeanlisisdesaturacinconT3yla
reduccindedatosmedianteelmtododeScatchard.
Comentario Laadministracincombinadadetrazador[125I]T3concantidadescrecientesdeTfro3satura

progresivamentelaaltaafinidadT3sitiosdeunin(TR)(8689,101).Enestecaso,losncleosseaslanyse
procesaronpara[125I]T3contenido.ElplasmaT3ylarelacindeconcentracindeplasma/nuclearenlaTmse
obtienenentoncesparacadadosisdeTfra3quefueinyectada.LosresultadosseexpresanpormiligramodeADN,
yelanlisisdeScatcharddelosdatospermiteelclculodelamximacapacidaddeTRylaafinidaddeunin
relativaencualquiertejidodado.ElplasmaT3Tfrentenuclear3curvahacequeseaposiblecalcularlasaturacinde
TRencualquierniveldadodeT3,incluyendolosnivelesplasmticosfisiolgicos.
9c
RECOMENDACIN

TcnicasdeetiquetadoDual,con[131I]T3y[125I]T4sepuedeutilizarparadeterminarlascontribuciones
relativasdeplasmaT3frenteproducidoslocalmenteT3atravsdeT4desyodacinaltejidoT3
concentracin.
Comentario Laadministracinde[125I]T4ylaposteriormedicindeplasmaytejido[125I]T3permitela

cuantificacindelaproduccinlocaldeT3enlostejidosensuconjuntooTRquecontienelafraccinnuclear(86
89).Aunquerelativamentegrandesactividadesde[125I]T4seutilizan,lascantidadesde[125I]T3producidosen
elTmsonmnimosenlosanimaleseutiroideos.As,tantoelplasmayeltejido(nuclear)[125I]T3debera
concentrarseusandounanticuerpoantiT3columnadeafinidadantesdelaseparacinporcromatografa.AlTm,la
relacindeplasma/tejidode[125I]T3/[125I]T4yelsueroT4concentracinseutilizanparacalcularla
produccinlocaldeT3.Losvaloresde[125I]T3semultiplicanpor2debidoaqueslohayun125Ienelanillo
fenlico(exterior)de[125I]T4ydesyodacinocurrealazarentrelasposiciones3'y5'.Lascorrecciones
pertinentessedebenusarcuandoeltrazadorcontieneyodoradiactivoentantofenlico(exteriores)ytyrosilanillos
(interior).Paratenerencuenta(ycondescuento)porlacontribucindeplasma[125I]T3(quesaledelostejidos)a
lostejidos[125I]T3,laadministracinde[125I]T4escoordinadaconlaadministracinde[131I]T3.Debidoa
quelaTm(T4)yTm(T3)sondiferentes,laadministracindelosdostrazadoresdeberprogramarseparaquetanto
Tmcoincidensentiempolosanimalesmueren.
[C]EvaluacindetiroidesHormonadeTransporteenclulas
Visindeconjunto Basndoseenlaestructuralipoflicadelashormonastiroideas,sepensdurantemuchotiempoque

lahormonatiroideaentraenlaclulaatravsdedifusinpasiva.Sinembargo,haquedadoclaroquelashormonas
tiroideassontransportadosatravsdelamembranaplasmticaatravsdeltransportemediadoporportador,
proporcionandolaclulaconunaherramientaimportantepararegularladisponibilidadintracelulardelahormona
tiroidea.Eltransportemediadoporportadordelashormonastiroideassevefacilitadaporinteraccionesespecficas
sustratodeltransportadoryconducidopredominantementeporgradientesdeconcentraciny,paraalgunos
transportadores,atravsdelacotransportedeotrasmolculas.Portadoresdesolutosconocidosparaeltransportede
hormonastiroideasincluyentransportadoresmonocarboxilato(MCT),Na+/taurocolatopolipptidocotransporte,
lostransportadoresdeanionesorgnicos(OAT),transportadoresdeaminocidos(porejemplo,detipoL
transportadoresdeaminocidos)yanionestransportarpolipptidosorgnicos(OATPs)(102106).Laimportancia
delostransportadoresdelahormonatiroideaseilustraporelhechodequelasmutacionesenretrasopsicomotor
causaMCT8humanaynivelesalteradosdeyodotironina(107,108).ConlaexcepcindeOATP1C1(T4y3,3',
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

17/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

5'triyodotironina[rT3]sloeltransporte),lamayoradelostransportadoresdelahormonatiroideatransportartanto
T4yT3.EsimportantedarsecuentadequelosmiembrosdelafamiliaMCT,talescomoMCT8yMCT10,facilitan
noslolacaptacincelular,sinotambinelflujodesalidadeyodotironinas(109).Elpapelfisiolgicodelos
transportadoresesnoslodependedesusafinidadesrelativasparalashormonastiroideas,perotambindependede
lospatronesdeexpresinentejidosyespecficosdelaclula.Unfactordeconfusinenlasburlasacaboelpapel
funcionaldetransportadoresespecficoseslaposibleexpresindediferentestransportadoresenlasuperficiedeun
tipodeclulaindividual(porejemplo,hepatocitosyneuronas).Enestoscasoslaabundanciarelativadeunmiembro
delafamiliaespecficaprobablementedeterminarlajerarquadelasfuncionesdetransporteparauntipoespecficode
clula.Finalmente,lostransportadoresdelahormonadelatiroidesvariosnotransportanlashormonastiroideas
exclusivamente.Porejemplo,losOATPstransportarunaampliavariedaddeambosendobiticosyxenobiticosy
poseenmltiplessitiosdeuninasustrato(110,111).Estacomplejidadenlaexpresinyfuncinrevelaalgunosde
losretosasociadosconelestudiodetransportedelahormonatiroidea,tantoinvivoeinvitroquedebeser
consideradoporelexperimentador.
[C.1]transportehormonatiroideainvitro
Fondo Eninvitroestudiossongeneralmenteconsideradosparalacaracterizacinbioqumicadelostransportadores

individuales,elestudiodelosefectosdelasmutacionesespecficassobrelafuncindeltransportador,yla
elucidacindelafuncindelostransportadoresespecficosexpresaentiposdeclulasindividuales.Una
consideracinprincipaleslagarantadequeelexperimentoestdiseadoycontroladoparaprobarlafuncindelos
transportadoresespecficosfrentealaaccincolectivademltiplestransportadoresexpresadasenlamismaclula
correctamente.Losestudioscinticosrequierenlaconsideracindeposiblesfactoresdeconfusincomolagaranta
delalocalizacindelamembranaplasmticadelostransportistasexpresado,transportesustratobidireccional,la
eleccindeltipodeclulaexperimental,ytpicofrentecinticaatpicos.
RECOMENDACIN10bis
Yodotironinatransporteenlasclulassepuedeestudiarenlasclulasqueexpresantransitoriamentedetipo
salvajeotransportadoresdelahormonatiroideamutantes.
Comentario Laevaluacindelafuncionalidaddeclonadodetiposalvajeotransportadoresdelahormonatiroidea

mutantesseconsiguefcilmentemediantelarealizacindeexperimentosdeabsorcin(110,112).Loscontroles
apropiadosincluyencomparacinconlasclulastransfectadasconelvectorvacoylainhibicindelaabsorcinde
lahormonatiroideamarcadoporlacoincubacinconunexcesodehormonafro.Elltimocontrolescrticapara
asegurarquelaclulaasociadacaptacindehormonatiroideaobservadoesunprocesosaturableynoest
simplementeasociadaconuninnoespecficadehormonamarcadaalaclula.Paralosensayosdetransporteen
general,lacaptacinseiniciaconlaadicindesustratomarcadoalasclulasyterminaenpuntosespecficosde
tiempoconlavadosrpidoscontampndetransportefro.Estasetapasdelavadosonesenciales,yaque
yodotironinastiendenaadherirsealasparedescelulares.Sedebeprestaratencinalaseleccindememoria
intermediadetransporte(porejemplo,tampnKrebsHenseleit,mediano/F12deEaglemodificadoporDulbecco,o
PBSregularcon/osinBSA).Esimportantedarsecuentadequediferentestamponesdetransportepuedencontener
grandescantidadesdeaminocidos,quetambinpuedensertransportadosporciertostransportadoresyporlotanto
influyenenlosresultadosdelosexperimentosdeabsorcin.BSAsepuedeaadiralmedioparamantener
yodotironinasensolucinyevitarlaadsorcinalosplsticos.Sinembargo,disminuyendolaconcentracin
yodotironinalibretambinpuedelimitarladisponibilidaddesustrato.
Memoriasintermediasdetransportecontienenpreferiblementenosueroenabsoluto,yaqueelsueroinclusoresina
despojadodeintercambioinicotodavapuedecontenerbajosnivelesdehormonastiroideasqueinterfierenconel
ensayodecaptacin.Comoconsecuencia,lasmedicionescinticas(porejemplo,lasconstantesdetransporte,las
velocidadesmxima)nosepuededeterminar.Lacaptacinsecalculaapartirdelaproporcinderadiactividad
asociadaconellisadocelularencomparacinconlaradiactividadtotalasociadaconeltampndetransporte
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

18/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

isotpico.Laradiactividaddefondoenlasclulastransfectadasconelvectorvacoserestadetodaslasmuestras.La
captacinsecalculaapartirdelaproporcinderadiactividadasociadaconellisadocelularencomparacinconla
radiactividadtotalasociadaconeltampndetransporteisotpicayexpresadoenunidadesdepicomolesporminuto(
113,114).
Diferentesresultadossepuedenobtenerendiferentestiposdeclulas,dependiendodelosnivelesdeexpresin
endgenosdelostransportadoresdelahormonatiroideay/uotrosfactoresnecesariosparaeltransportedela
hormonatiroidea.Alestudiarlafuncindelostransportadoresdemutantes,puedesertilcompararlosresultadosen
clulasconnivelesdeexpresinendgenosdealtaversusbaja.
Transportadoresdehormonatiroideaexhibentransportebidireccional.Paraalgunostransportadorestalescomoel
OATPs,secreequeunsustratoantiportadoasernecesariaparaeltransportedelahormonatiroideaatravsdela
membranaplasmticaysedebeconsideraralelegirunamemoriaintermediadetransporte.Laacumulacinde
hormonastiroideastransportaenlaclulaesnecesariaparaevaluarlaactividaddetransporteypuedepresentarun
problemaparaalgunostransportadoresbidireccionalesporqueelsustratodeeflujopuederpidamentelashormonas
tiroideasdelaclula.Cotransfeccinconlahormonatiroideaintracelularprotenasdeunintalescomomucrystallin
proporcionaunmtodoparaasegurarlaacumulacindelahormonatransportado(109,115,116).Una
advertencia,sinembargo,esqueelusodetalesmtodosseoponeaestudioscinticosposterioresdebidoaqueel
transportedelahormonaprobablementenuncaalcanzarelestadodeequilibrio.
Paraestudiarlasconsecuenciasdelasobreexpresindeuntransportadorespecficodelahormonatiroideadela
disponibilidadintracelulardelahormonadelatiroides,lasclulaspuedensercotransfectadasconundeiodinasa
yodotironinayposteriormenteanalizadosparaelmetabolismo(114).Alternativamente,Xenopusovocitospueden
serutilizadosparaestudiosdetransporte(118).
10bRECOMENDACIN
Ladeterminacindelaespecificidadporelsustratoylascaractersticascinticasparalostransportadoresde
lahormonatiroidearequiereuncompromisodeprobarvariossustratosenunaampliagamade
concentraciones.
Comentario Laespecificidaddesustratodelostransportadores(putativo)delahormonatiroideapuedeserinvestigada

porincubacindelasclulascondiferentesligandosradiactivosputativo,incluyendolasdiferentesyodotironinasT4
,T3,Rt3,y3,3'diyodotironina(T2),ascomoanlogosdelahormonatiroideacidotalcomo3,5,3'
triyodotiroactico(tiratricol,tambinconocidocomoTRIAC)y/ovariosaminocidos,talescomoLeu,Phe,Tyr,y
Trp.EspecificidaddetransporteTHsepuedemedirmedianteladeterminacindelacaptacindeyodotironinas
radiomarcadosenlapresenciadecompetidoresputativo,incluyendolosderivadosdeyodotironinamarcadoscomoD
yLyodotironinas,tiratricol,cidotetraiodotiroactico(tetrac),yaminocidos.
Caracterizacindelosparmetroscinticosdeclonadodetiposalvajeymutantestransportadoresdelahormona
tiroidearequieredeterminarprimeroelcursodeltiempodeafluenciadesustratoenlasclulastransfectadas.Apartir
deestosdatosdeunpuntodetiemposeidentificacuandolacaptacindesustratoestcercademximos,peroel
transporteannohaalcanzadoelestadodeequilibrio.Todoslosestudioscinticosadicionalessellevaronacaboa
continuacin,mediantelamedicindelaacumulacindesustratoenlasclulastransfectadasydecontroleneste
puntodetiempoidentificado.
Paraelanlisisdemutantestransportadorseradeesperarquelosmutantespuedenposeeractividadescinticas
alteradas.Porlotanto,paraeltiempodeestudioelinvestigadordebeevaluarlaabsorcinenmltiplespuntosde
tiempoeneltranscursode120minutos.LosmutantessepuedensometeraanlisisdelacinticadeMichaelis
Mentenparacuantificarloscambiospotencialesenlacinticadetransportedelahormonatiroidea.
Paralosestudioscinticosposteriores,unpuntodetiempodebeserelegidoantesdeestadoestacionariocuandose
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

19/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

observandiferenciasmximasentretransportadorexpresadofrentealacaptacinvectorvaco.Enestepuntode
tiempo,sepuedemedirlaabsorcinutilizandomltiplesdiferentesconcentracionesdesustratoqueabarcanelrango
dinmicodedeteccinparacadasustrato.Dadoqueestosgrandesexperimentossondifcilesderealizar,muchos
investigadoresoptanporlimitarelnmerodepuntosdedatosrecogidos,laaceptacindeunaestimacinmenos
precisadelacinticadetransporte.Notablemente,saturabilityyvaloresdeKmaparentespuedenestarinfluenciadas
porlaunindeyodotironinasaprotenastalescomoBSAenelmedio.
EvaluacindelafuncinOATPesanmsdifcil,yaqueestostransportadoresposeenmltiplessitiosdeuninde
sustratoyporlotantopresentanunacinticadetransporteatpicas(110,119).Paraevaluaradecuadamentecintica
detransporteOATPrenendatoscinticoscomolosdescritosanteriormenteyutilizarotrosmtodosparaanalizarlos
datos(110,120122).Estoscinticadetransportenopuedenserdeterminadosparalostransportistasconalta
capacidaddeflujodesalida,talescomoMCT8yMCT10,quepuedenrequerircotransfeccinconprotenasde
uninintracelulares(vaseladiscusinanterior).
10cRECOMENDACIN
Evaluareltransportedelahormonatiroideaencultivosdeclulasdisociadasprimariainvitrosloesdevalor
limitadosiseutilizancultivosdeclulasmixtas.
Comentario Unaprecaucincuandosetrabajaconclulasprimariasesposibleunarpidabajaregulacindela

expresindeltransportador(123).Seguimientodelaexpresindeltransportadormediantetransferenciao
inmunocitoqumicaoccidentalatravsdeltiempoenlaculturatanto,esfundamental.Adems,lapresenciadeuna
poblacindeclulasmixtasexigelaidentificacindetiposdeclulasqueexpresantransportadoresespecficos(124
).Sinembargo,lafaltadeespecificidaddelosanticuerpospuedeplantearproblemassignificativosparael
seguimientodelaexpresindedeterminadosmiembrosdelasgrandesfamiliasdeltransportadorconmltiples
miembrosestrechamenterelacionados.
RECOMENDACIN11
Laconfirmacindelacorrectalocalizacindelamembranadeplasmaesnecesarioparaestudiosqueutilizan
lasclulasqueexpresantransitoriamentelostransportadoresdelahormonatiroidea.
Comentario Asegurarquelostransportadoresevaluadosestnlocalizadosenlamembranaplasmticaesde

importanciaclaveparalainvitroestudios.CuandolosanticuerposadecuadosestndisponiblesanlisisdeWestern
primerosedeberealizarparaasegurarlaexpresindeprotenaseguidoporinmunocitoqumicafluorescentepara
evaluarlalocalizacinsubcelulardeprotenas.Alestudiarlasclulastransfectadas,esimportanteparaestudiarlas
clulasconbajosnivelesdeexpresinendgenadeltransportadordeinters.Porejemplo,lasclulasJEG3sonun
excelentemodeloparaestudiarlamembranaplasmticalocalizacindeMCT8mutadooMCT10debidoasusbajos
nivelesdeexpresinendgenadeMCT8y/oMCT10.Paraelanlisisbioqumico,transportadoresclonadoseptopo
deetiquetadoproporcionanunadianaantignicapreparadatantoparaWesternblotyanlisisinmunocitoqumico.
Localizacinsubcelularsedeterminapreferiblementepormicroscopaconfocalporquemicroscopafluorescente
tpicadecampoamplionodistinguirfcilmenteentrelasuperficiecelularyetiquetadointracelular.Apropiadamente
protenaexpresadoselocalizaprincipalmenteenlamembranaplasmticaconlatincinintracelularlimitado.Este
anlisisescrucialparaunaevaluacinadecuadademutantesgenticoscomolafaltadetransporteobservadoenin
vitroensayospodraserdebidoaunafaltadefuncindetransporteounaincapacidadparaeltrficocorrectamentela
protenaalamembranaplasmtica.Enambossupuestos,elensayodetransportedemostraraunaprdidadela
funcindeltransportador,aunquelaexplicacinbioqumicaparaesteresultadoseramuydiferente.Tengaencuenta
queestosestudiospuedenserdifcilesderealizarenlasclulastransfectadastransitoriamente,debidoaunaeficacia
relativamentebajadelatransfeccin.Paratalesestudios,elusodeclulastransfectadasdeformaestablepuedeser
mstil.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

20/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

[C.2]transportedehormonatiroideaenvivo
Fondo Invivoestudiodeltransportedelahormonatiroideaseconsideraparadilucidarlosrolesfisiolgicosy

fisiopatolgicosdetransportadoresespecficosyparadeterminarlacinticadelaafluenciadetejidoyflujodesalida
delashormonastiroideas.Losestudioscinticosrequierenunaconsideracindeposiblesfactoresdeconfusintales
comometabolismodeprimerpasodelahormonadeltrazadorinyectado,lapresenciademltiplesmiembrosdela
familiatransportadordelahormonatiroideaenunnicotejidooinclusotipodeclula,ycambioseneldesarrolloen
lospatronesdelaexpresindeltransportador.Consecuenciasdetransportedelahormonatiroideadefectuosoenla
sealizacindelahormonatiroideasepuedenanalizarusandoanlisisdelgenomadeancho(SeccinI.3)enel
materialdelpacientetalescomolosfibroblastos(125),mientrasqueconsecuenciasparadiferentesparmetros
biolgicossistmicospuedenseranalizadosusandodiferentesmodelosderatnknockout[verSeccionesI.5yJ
verHeueryVisser(126)paraunarevisin].
RECOMENDACIN12a
Porinvivoestudios,eltransportedelahormonatiroideanetotpicamenterepresentalasumadeunaseriede
diferentesactividadestransportadoras.Evaluacindelacontribucindeuntransportadordadoaltransporte
netorequiereelexamendetodoslostransportadoresexpresados
eneltejido.

Comentario Envivomedidasdetransportedelahormonatiroideaestnconfundidosporlaexpresindemltiples

transportadoresdehormonatiroideaenlamayoradelostejidos.Unaconsideracinclaveesdeterminarlosperfiles
deexpresindeltransportadorynivelesendeterminadostiposdeclulasentejidosespecficos.Desdelaafinidadde
T4yT3essimilarenlamayoradelostransportistas,lacontribucindeuntransportadorindividuogeneralmente
siguesusnivelesdeexpresin.Diseoexperimentaldeberatenerlaposibilidaddetantoinflujohormonalyflujode
salidaenconsideracin[verHeueryVisser(126)paraunarevisin].Consecuenciasdeltransportedelahormona
tiroideadefectuosoparalasealizacindelahormonatiroideapuedenseranalizadosutilizandoelanlisisdel
genomadeancho(verseccinI.3)dematerialdelospacientestalescomolosfibroblastos(125)odiferentestejidos
delosratonesknockout(127).
12bRECOMENDACIN
Elmetabolismodelashormonastiroideasevaluadosdebeserconsideradacuandosemideeltransportein
vivo.
Comentario Lashormonastiroideassonsometidosametabolismoinvivoincluyendodesyodacinyelmetabolismo

conjugativo.Esimportantedestacarquetalesimpactosmetabolismodeldestinodeltransportedelashormonasy
cuandolashormonastiroideassemetabolizansonsustratostrazadoresradiomarcados,interpretacindelosresultados
obtenidosesdifcil.Elcontrolsobreelmetabolismosepuedeejercersilasestrategiasindividualesdepasoseutilizan
comolacanalizacindirectadelosbuquesquellevaalostejidosdiana,seguidodeinfusincontinuadetampnde
transportedefinidoysustrato.Talesestrategiaslimitanelmetabolismodelsustratoylaprdidaalostejidosperifricos
ypermitenlamedicindirectadetransportedelahormonatiroideaeneltejidoevaluado.Comounejemplo,selogra
mejormedidadeltransportedelahormonatiroideaatravsdelabarrerasangrecerebrousandoelinsitumtodode
perfusincerebral(128).Estametodologapermitemedicionescinticasexactastalescomolastasasdetransportey
afinidadesdetransporteysepuederealizarenneonatalalosanimalesadultos.Comparacindelacinticade
transportedetiposalvajeytransportadorespecficoanimalesnulospermitiraladeterminacindelascontribuciones
especficasdelostransportistasindividualesenvivo.
[D]Laevaluacindelahormonatiroideadesyodacin
Visindeconjunto ElyodotironinacirculanteesT4.Sinembargo,T4puedeserconvertidoenlostejidosaT3,la

principalhormonadetiroidesqueseunealosreceptoresnucleareseiniciaunaaccindelahormonatiroidea(129).
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

21/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Enlostejidosextratiroidea,laconcentracindeT3enloscompartimentosintracelularesynuclearessedeterminaen
parteporlastasasdeT4aT3conversinyT3yT4degradacinenlaclula(84,130132).
LaformacinyladegradacindeT3enlostejidosdependenprincipalmentedelasactividadesdetresselenoenzimas
integraldelamembranaquecontienetiorredoxinaplegablesdeaproximadamente60 kDa(dmero)quecatalizanla
eliminacinselectivadeyododeyodotironinas(132135).EldesyodasadetipoI(D1)ylasenzimasD2estn
activandoenzimasquecatalizanelanilloexterioro5'desyodacin(5'd)deT4aT3.D3esunaenzimaquecataliza
lainactivacinanillointerioro5desyodacin(5D)deambosT4yT3ensusderivadosrelativamenteinactivos,rT3
yT2,respectivamente.ElD1tambinpuedeinactivarlashormonastiroideas,catalizandoladesyodacinanillo
interiordeconjugadosyodotironinasulfatados(130132).NivelesdeactividaddeD1,D2,yD3puedenser
estudiadosenpreparacionesdeclulascultivadas(136,137),rodajasdetejido(138,139),yhomogeneizadosde
tejido(140,141).
[D.1]deidentificacin,expresinycuantificacindedeiodinasas
Fondo Lapresenciadelosdeiodinasaspuedeseridentificadoenuntejidodadoysusnivelesdeactividadcuantific

usandoensayosbienestablecidosparalaactividadenzimticaypropiedadescinticas.EnloscasosdeD1yD3,
contenidodetejidodelaprotenadeiodinasase
puedeevaluarmediantetcnicasinmunohistoqumicasutilizando

antisueros/anticuerposdisponibles(142).Losnivelesdeexpresindelostresgenesdesyodasaspueden
determinarseusandomuestrasdeARNpreparadasapartirdetejidodeintersmediantereaccinencadenadela
polimerasadetranscriptasainversacuantitativaestndar(RTqPCR)tcnicas(127).
Ensayodelosnivelesdeactividaddeiodinasay/olacinticadereaccindelaenzimaenlaspreparacionesde
clulas/tejidosrotosrequierelapresenciadecompuestosquecontienengrupossulfhidrilolibrestalescomo
ditiotreitol(DTT).EnsayodelosnivelesdeactividadD1,D2,D3ysellevanacabogeneralmenteutilizando
yodotironinasradiactivoscomosustratosseguidodecuantificacindelosproductosradiactivosgeneradosporunidad
detiempo.Alternativamente,enelcasodelaD1yD2,losnivelesdeactividadsepuedendeterminarusandono
radiactivoT4ylacuantificacindelaT3generadaporRIA.
13aRECOMENDACIN
Deiodinasaactividadesysusperfilescinticosylaspropiedadesintrnsecas(porejemplo,Vmax,Km,la
actividadmediadevida,lasensibilidadacofactoresy/oinhibidores)sepuedendeterminarenpreparaciones
declulasotejidos.
Comentario Existenvariosprotocolosparaensayosdesyodasas,ytodosellossonaceptablessiemprequesesigan

ciertosrequisitos.Engeneral,laliberacindeyodurodetrazadorradiactivoogeneracindeunproductoespecfico
deiodinasasonloscriteriosdevaloracinexperimentalesmedidos.Siempreesmejorutilizaryodotironinas
radiomarcadosconlamsaltaactividadespecficadisponible.Inclusocuandosealmacenanenlaoscuridada4C,
haydesyodacinyodotironinaespontnea.Porlotanto,afindeminimizarlosnivelesdefondo,trazadoresdebenser
purificadosenSephadexLH50almenos24horasantesdelensayo.Todoslosensayosdebencontenercontrolesde
fondoenlosquenohaydesyodacinsustratodeiodinasamediada.Idealmente,duplicadosdelasmuestrasseejecutan
enparaleloentubosquecontenanungranexcesodesustratoqueoutcompeteslayodotironinaradiomarcado.
ElsustratopreferidoparaD1esrT3tomandolarelacinVmax/Kmcomounamedida
delaeficiencia,rT3realizatantocomo700vecesmejorqueT4comounsustratoparaD1.Adems,adiferenciade
T4,rT3esunsustratorelativamentepobreparaD3yporlotantoeselmejorsustratoconelcualensayarD1enlos
tejidosquetambincontienenactividadD3.Almismotiempo,laactividadD1tambinsepuededeterminarusandoT
4comosustrato.Eltampndereaccinvaraunpocoentreloslaboratorios,perolamayorasellevanacaboenun
PBSo2amino21,3propanodiolhidroximetilhidrocloruro(TrisHCl)tampnquecontenacido
etilendiaminotetraactico(EDTA12 mM),sacarosa(0,250,3 M),yDTT(1050 mM).Laconcentracinde
sustratoes0,12 mM.Lacantidaddetejidopresentedebeajustarseparaasegurarunporcentajedesyodacin
EnsayoparalaactividadD1.

http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

22/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

relativamentebaja(<30%)conelfindeevitarunaalteracinsignificativadelacinticadelaenzima.Con
preparacionesdeclulasrotas,eltiempodeincubacindebeserde1horaomenos.Cuandodeiodinasaactividadse
estudiaencortesdetejidooclulasenteras,eltejidooclulasdebenserhomogeneizadosenhieloensumediode
incubacinantesdelanlisisdelosproductos,yaqueyodotironinastiendenaadherirsealasparedescelulares.
Losproductosyodadossepuedencuantificardevariasmaneras.Posiblementeelmtodomssimpleeshacerpasarla
mezcladereaccinatravsdeunacolumnadeBioradAG50WX8(H+)deresinaempapadaencidoacticoal
10%.Losyodotironinassonadsorbidosenlaresina,yelyoduroinorgnicopasaatravsysepuedencuantificar
directamente.Otroshanutilizadoprecipitacindesuerodecaballo(portador)conTCAparasepararelyodurolibre(
143).Cualquieradeestosmtodosrequiereladeterminacindequecantidadesequimolaresde125Iy[125I]T3(o
[125I]T2si[125I]rT3seutilizacomounsustrato)seproducen,enparticularsielniveldeactividaddelaenzima
esbajaosinodeiodinativevasestnpresentes.Estoselogramediantelaseparacindela[125I]iodothyroninesy
125
Iporcromatografaenpapeldescendente,HPLC,oUPLC.Paraelclculodelaactividad5'd,elporcentajede
productogeneradosemultiplicapor2debidoalasactividadesespecficasdelosproductosetiquetadossonslola
mitadqueeldelsustrato.ActividadD1seexpresageneralmentecomopicomolesofemtomolesdeproductopor
unidaddetiempopormiligramodeprotena(144147).
EsteensayosellevaacabocomosedescribeparaelensayoD1conlassiguientes
modificaciones:elsustratopreferidoesT4(0,52 nM)ysiseutilizantejidosquetambincontienenactividadD1,1
mMPTUestincluidoenelmediodeincubacin.SiD3estpresente,debesersaturadomediantelaadicindeun
excesoapropiadodeT3(146149).
EnsayoparalaactividadD2.

ElsustratopreferidoparaD3esT3(0,52 nM),ypuestoqueT3esunsustratomuy
pobreparaD1yD2,quepuedeserutilizadoconxitoparalaactividadD3ensayoenlostejidosquecontienen
tambinD1y/oactividadD2.LaadicindeEDTAaltampndeensayonoesnecesario.Enesteensayo,yaquelos
sustratosradiactivosestnetiquetadosenelanilloexteriorsolamente,elyodurogeneradanosepuededetectar,ypor
lotantolacuantificacindelareaccinrequierelaseparacindelaT2productodesdeelsustratodeT3porHPLCo
cromatografaenpapeldescendente.DadoqueelT2generadoestambinunbuensustratoparalaD3,esimportante
paradiluirlapreparacindelaenzimadetalmaneraqueelporcentajedesyodacinesrelativamentebaja(<20%)yT
2eselnicocompuestodetectableproducida(147,150152).
EnsayoparalaactividadD3.

13bRECOMENDACIN
Estudiosdedeiodinasaactividadenpreparacionesdeclulasotejidosquecontienenmsdeundeiodinasason
factiblesperolasdisposicionesespecialesdebenserconsideradosdemaneraquecadaactividaddeiodinasase
midedeformaindependiente.
Comentario Muchasvecesnosloelsustratodeundeiodinasadado,sinotambinelproductodesyodacinpuede

servircomosustratoparaotradeiodinasacoexpresadaenlamismaclulaotejido.Porlotanto,paraobservarla
actividaddeundeiodinasaespecficarequiereelusodeinhibidoresdelaenzimaespecficaydiferentestiposde
sustratoy/oconcentraciones(Fig.9)(153156).Porejemplo,lamedicindelaactividadD1anilloexterioren
presenciadeD2esposiblesiT4oRT3seutilizanensuD1Km(esdecir,aproximadamente1 mMy0,5 mM,
respectivamente),quesaturaD2.MedicindelaactividadanillointeriorD1enpresenciadeD3esposiblesiT3oT
3sulfato(T3S)seutilizaensuD1Km(esdecir,aproximadamente5 mM),quesaturaD3.D1esinhibidade
maneraeficienteenpresenciade1 mMPTU,queslotieneunefectomnimosobrelaactividadD2.Estoeliminala
actividadD1decualquieractividadD2oD3,quenosevenafectadosporlaPTU.
FIG.9.
Estrategiasparamedirlaactividaddeiodinasaindividualizadaenlapresencia
deotrosdeiodinasas.(A)DosestrategiasparaevaluarlaactividaddetipoII
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

23/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

deiodinasa(D2)enpresenciadedesyodasadetipoI(D1porejemplo,enla
tiroideshumana):(i)utilizar1 mM6npropil2tiouracilo...
NohayinhibidoresespecficossonconocidosporD2oD3.Sinembargo,tantoD2yD3actividadespuedenser
eliminadosmediantelaadicindeunexcesorelativodesusustratopreferido(esdecir,T4oT3,respectivamente),
lasaturacindelaenzimayoutcompetingeltrazadorradioactivo.Porejemplo,lamedicindelaactividadD2en
presenciadeD3esposiblemedianteelusorT3oT4comosustratoylaadicinde1001000 nMT3enlamezcla
dereaccin.AdicindelaT3saturaelexcesodesitiosdeunindeD3peronointerfiereconlaactividadD2.Sin
embargo,seprefiereunreactivodealtapureza,yaque,aaltasconcentraciones,inclusopequeascantidadesdeun
contaminanteyodotironinainterfieraconelensayo.
RECOMENDACIN14bis
LaVmaxdecualquieradelosdeiodinasasmedidosencondicionesptimasdesustratoycofactor
disponibilidadsepuedeutilizarcomounsustitutoparalacantidaddeenzimafuncionalpresenteenunaclula
otejidoencualquiermomentodado.
Comentario MientrasD1yD3seexpresanennivelesquepuedensermedidosporWesternBlotoimmunocyto/

histoqumicautilizandoantisueroscomercialmentedisponible(65,157,158),labajaexpresincombinadadeD2
conlafaltadedisponibilidaddeafinidadsuficientementealtaantisuerosD2hadeterioradocuantificacindeprotena
D2(159).Dehecho,noexisteunconsensoencuantoalavalidezdeantisueroantiD2/anticuerposparala
medicindelaprotenaendgenaLosresultadosdebenserevaluadossobreunabasedecasoporcaso.Sinembargo,
unaestimacindelosnivelesdeprotenaD2puedeobtenersedeformafiablemediantelamedicindeD2Vmax,
quereflejalacantidadmximadeenzimaactivaenunaclulaotejido.D1yD3puedenserevaluadosyaseaatravs
VmaxoWesternblot.Losnivelesdeprotenadelostresdeiodinasaspuedencuantificarsedespusdelmarcajedelas
clulasqueexpresancondesyodasas75Se,inmunoprecipitacin,ylaresolucinmedianteelectroforesisengelde
sodiododecilsulfatopoliacrilamida,peroestollevavariassemanasporensayodeD2(93).Notaquelaalteracin
biolgicadeKm(porejemplo,lasmutacionesdeaminocidos)podraalterarlarelacinentreVmaxylosnivelesde
protena.
14bRECOMENDACIN
Laexpresindelosgenesdesyodasaspuedeserdeterminadaenclulasotejidosmediantelamedicindelos
respectivosnivelesdemRNA.
Comentario MedirlosnivelesD1mRNAessencillo,ydadasuexquisitacapacidadderespuestaaT3,constituyeun

marcadorsensibledelestadotiroideoperifricaenroedores(72).D2esungendependientedecAMPysusniveles
demRNApuedeserreguladohastavariasvecesdurantelaestimulacinsimpticadeBAT(161).Almismotiempo,
D2exhibeunafuerteregulacinpostraduccionalatravsdelaubiquitinacinyladegradacinproteasomalpor
diferentescomponentesdelretculoendoplsmico(162165).Porlotanto,losnivelesdemRNAnoreflejan
necesariamentelaexpresindeprotenaoactividaddelaenzima(162,166,167).ElDio3genesintrones,ylos
controlesadecuadosporlotantoserequierendadoqueinclusolacontaminacindeADNmnimapodraafectarlos
resultadosdeRTqPCR.D3tieneunavidamediarelativamentelarga,yporlotantounaltoniveldeactividadD3
puedepersistirinclusodespusdeunaelevacinenD3mRNAsehadisipado(168,169).Ensituhibridacines
particularmentetilenelcerebrodebidoalacomplejidaddelospatronesdeexpresindeD2yD3(170172)(ver
seccionesI.2yJ.1deconsideracionestcnicas).
[D.2]desyodacinenclulasintactas
Fondo Desyodacinpuedeserestudiadoenclulasvivasintactas.Esencialmente,laslneascelularesestablecidaso
125

cultivosprimariosexpresan5'dy/oactividad5Destnexpuestosalaapropiada[
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

I]substrate(comosediscuti
24/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

anteriormente)ylosproductosradiomarcadosdeterminadosenlosmediosdecomunicaciny/oenlacelda
sonicadoscomoyasedescribi.
RECOMENDACIN15
T4yT3metabolismoatravsdedesyodacinpuedenmedirseenclulasvivasconlaventajadequelos
estudiosserealizanconcofactorfisiolgico.
Comentario Lasclulasseincubaroncon[125I]T4o[125I]T3enpresenciademediosquecontienen0,1%1,0%

deBSAconadicindeT4y/oT3paraproducirunaconcentracinfisiolgicadelahormonalibreenelbajo
picomolarrango(Tabla2).Metabolitosenlosmediosdecomunicacinoenlasclulasseseparanporcromatografa
lquidaopapel(comoyasehadescrito).Eltiempodereaccinesnormalmentede24horasomenos.Mediosde
cultivosincolorsedebenutilizardebidoalainterferenciaconelensayo.Laconcentracindeseadadelsustratose
consiguemediantelaincubacindelasclulasenmediolibredesueroquecontienen0,1%deBSAeincluyendola
concentracinapropiadadeTnoradiactivo4y/oT3.Tiempodecursossepuedenestablecermedianteelmuestreo
delosmediosdecomunicacin,seguidodecuantificacindelosproductosdescritasanteriormente.Losresultadosse
expresaroncomopicomolesofemtomolesdeproductoporunidaddetiempocorreccinparaelnmerodeclulasse
puedelograrmedianteelrecuentodeclulasomedianteladeterminacindelcontenidodeADNodeprotenas.Los
estudiosenclulasquecontienenmsdeundeiodinasasonfactiblesydebenincluircontrolesapropiadosenlosque
unadelasvasdeiodinativeestsaturadoconunexcesodesustratonomarcado(136,137,152).
TABLA 2.
LASFRACCIONESLIBRESDE T4Y T3(x100Y EXPRESADO EN PORCENTAJE )DE
LOSTIPOSCOMUNESDE MEDIOSQUE CONTIENEN DIFERENTESPORCENTAJESDE
ALBMINA DE SUERO BOVINO /SUERO

Sistemasdecocultivoconmsdeuntipodeclulasehandesarrolladoenelqueeltransportedelahormonatiroidea,
elmetabolismo,ylaaccinsepuedeestudiardeformasimultnea(esdecir,D2expresindeclulasdeglioma
humanoH4yD3queexpresanclulasdeneuroblastomaSKNAShumanosFig.10)(173).Talsistemahasido
utilizadoparademostrarquelasealizacinparacrinaporderivadodeclulasglialesT3activalaexpresingnica
neuronal.
FIG.10.
Invitromodelizacindedesyodacinhormonatiroideayeltransporteenel
cerebro.(A)RepresentacinesquemticadelSistemaTranswellenelqueuna
piezadeinsercinsecolocaenunaplacadeseispocillosylasclulas(D2
expresindeclulasglialesH4)sesiembranenelinteriordelinserto...
[D.3]desyodacinenrganosperfundidos
Fondo Anilloexteriorydesyodacinanillointeriorsepuedenestudiarenrganosperfundidoscomoelrinyel

hgado.rganosEsencialmente,recincosechadasqueexpresan5'dy/oactividades5Dsonperfundidoscon
solucionestamponadasquecontienenBSAyradiomarcadoosustratosyodotironinafros.Elperfundidoserecogeen
eltiempoyseanalizaparaproductosdesyodacinutilizandoinmunoensayosoHPLC.Esteenfoqueesventajoso
porquepermiteelestudiodelasvasdedeiodinativeespecficosdetejidobajocondicionesfisiolgicaso
fisiopatolgicasdefinidos.
RECOMENDACIN16bis
T4aT3conversinylaexcrecinurinariayodotironinasepuedeestudiarenlaspreparacionesdeperfundido
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

25/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

derataderinohgado.
Comentario EnlaspreparacionesdelosrionesperfundidosconT4entampnquecontieneBSAhayunaumento

revestimientoenT3produccinconelaumentoenelperfundidoFT4concentracinquedeterminaeltejidoT4
absorcin.FT4nivelessepuedenajustarmedianteelaumentooladisminucindelaconcentracindeTtotalde4o
laconcentracindeBSA.LaadicindePTUdisminuyerenalT3produccinenun60%sinafectareltejidoT4
captacin,queilustralapresenciadeD1.EnestecontextonohayrenalnetarT3produccindeT4,yla
degradacinyexcrecinurinariadeT3soninsignificantes(174176).
Similaralrin,elhgadodelarataperfundidoextraefcilmenteT4demediodeperfusinylaconvierteaT3.
ProduccindeT3esunafuncindeltamaodelhgado,lacaptacindeT4,yelniveldeexpresinD1.Produccin
deT3,peronoT4captacin,sedisminuyeporPTU(177,178).
16bRECOMENDACIN
Placentariodesyodacinanillointeriorsepuedeestudiarinsituutilizandounsistemadeperfusindeconejillo
deindias.
Comentario ConsiderandoquelasactividadesdelaplacentaD2yD3sepuedenmedirendispersionesdeclulasode

tejidossonicados(179182),insitupreparacionespuedenusarseparaestudiarlavaD3placentaria(183,184).En
unconejillodeindiasembarazadasanestesiado,laplacentaseexponequirrgicamenteyunasolaarteriaumbilicaly
lavenaumbilicalsecanul,mientrasqueseretiraelfeto.Elladofetaldelaplacentaesperfundidoatravsdela
arteriaumbilicalconunasolucintamponadaquecontieneBSAy[125I]T3.Fraccionesefluentesplacentase
recogenaintervalosdetiempo(hasta2horas)delacnuladelavenaumbilical.Elcontenidodeltampnde
perfusinylasdiversasfraccionesefluentesseseparanacontinuacinyseanalizaronporHPLCporsucontenido
yodotironina(183).EnestaconfiguracindesyodacinanilloexteriordeT4orT3esmnima(184),posiblemente
debidoalaplacentadesyodacinanilloexterioresmayorenlazonainmediatamenteadyacentealapareddeltero(
185),distantedelladofetaldelrgano.
[D.4]desyodacinenanimalesenteros
Fondo Elestudiodelasvasdedesyodacinentodoelanimalesdifcil,puestoqueunoesttratandocontres

deiodinasas,cadaunodeloscualespuededeiodinatenosloT4y/oT3,sinotambinlosproductosdeestas
reacciones.Ademsnohayagentesconocidosqueinhibenselectivamenteycompletamentedeiodinasasindividuales.
Porlotanto,hastaquelosratonesdeficientesenunoomsdelosdeiodinasasllegaronaestardisponibles,eramuy
difcilparainvestigarelpapeldelosdeiodinasasindividualesinvivo.
RECOMENDACIN17
Desyodacincorporaltotalpuedeserestudiadoenanimalesvivosdespusdelaadministracinde
yodotironinasradiomarcados(porejemplo,[125I]T4o[125I]T3).Yodotironinassepuedeninyectarde
formaagudaoalargoplazoatravsdeunaminibomba.Esteenfoquepermitealosestudiosquesellevana
cabobajocondicionesfisiolgicascontroladas.Informacinadicionalsepuedeobtenermediantela
administracindemsdeunayodotironinamarcadascondiferentesistoposdeyodo.
Comentario DesyodacinTotalanillofenlicocuerpopuedeserfcilmenteevaluadaenlosroedorestrasla
administracindeunadosisnicade[125I]T4o[125I]T3.Losroedoressecolocanenjaulasindividualesque

permitenlarecogidaseparadadeorinayheces.Despusdeunperodoadecuadodetiempo(42a72horas)la
fraccindelaradiactividadinyectadaseexcretaenlaorinasepuededeterminar,ylagranmayoradeestasernyodo
inorgnico(186).Esteprotocolosepuedeutilizarparaevaluarlosefectosdediferentescondicionestalescomoel
ayuno,laexposicinalfro,hiperohipotiroidismo,ylaausenciadeunoomsdelosdeiodinasasendesyodacin
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

26/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

total.Estetipodeestudiosepuedellevaracaboutilizandounnivelrelativamentebajodelaradiactividad.Sin
embargo,laobtencindecualquierinformacinfiablesobrelamagnituddeT4conversinaT3oRT3poreste
mtodosecomplicaporelhechodequeamboscompuestosseborrandesueroaunritmomsrpidoqueT4ens.
Partedelainformacinrelativaalosproductosetiquetadosformadosapartirde[125I]T4o[125I]T3puede
obtenerseutilizandoanimalesimplantadosconminibombasosmticasquecontienenlashormonasmarcadas.Una
vezquelaexcrecindiariadelaradiactividadenlaorinaylashecessehaceconstante,loqueindicaquelosanimales
hanalcanzadoelequilibrioisotpico,losanimalespuedensersacrificados.Elsuero,tejidos,orinayhecespuedenser
obtenidosylaidentidaddesuscompuestosmarcadosdeterminan,despusdesuextraccinylaseparacinpor
HPLCocromatografa.Estudiosparalelosutilizandoratonesdeficientesenunoomsdelosdeiodinasasarrojarluz
sobrelaimportanciarelativadelasdiferentesvasmetablicas.Variosprocedimientosdeextraccinsehanpublicado
ysedebetenercuidadoparadeterminarycorregirlaeficienciadeextraccin(83,187).
Losresultadosdeestosestudiosdeberninterpretarseconcuidadoyposibilidadesalternativasconsideradas.Por
ejemplo,esbienestablecidoquetantoT4yT3sepuedenconjugarconsulfatoinvivo,yestosconjugadosson
excelentessustratosparalaactividaddeiodinatinganillointeriordelaD1.Lashormonastiroideastambinestn
conjugadosconcidoglucurnicoylamayoradelaT4enelrinestpresentecomoT4glucurnido,quenose
detectaenunRIA(137).Adems,unafraccinsignificativadelosmetabolitosgeneradosapartirdeT4yT3,
incluyendolosconjugadosglucurnidos,seencuentranenlabilis,elcontenidointestinalyheces.
[D.5]vasnodesyodacindelmetabolismodelahormonatiroidea
Fondo Sustanciassinnutrientesquelleganalsistemagastrointestinalsontambinconocidoscomocompuestos

xenobiticosyseidentificanenelhgadoatravsdereceptoresespecficosporejemplo,elreceptordepregnanoX
(PXR)yreceptoresandrostaneconstitutiva(CAR).Launinaestosreceptoresdedeteccindexenobiticos,PXRy
/oCAR,inducelaexpresindeenzimasmetablicasincluyendolaFaseI(lafamiliadeenzimascitocromoP450)y
lafaseII(porejemplo,sulfotransferasas,glucuronosiltransferasas,ytransferasasdeglutatinS).Estasvasmodificar
molculasdexenobiticosmediantelaintroduccindegruposreactivosopolaresensusmolculasparaaumentarsu
solubilidadenagua,facilitandodeestemodosueliminacin.LasvasdeFaseIIincluyenglucuronidacin,
metilacin,sulfatacin,acetilacin,conjugacindeglutatin,ylaconjugacindeaminocidos.
Quizsdebidoalaltocontenidodeyodo,lasyodotironinastambinsonmetabolizadosporpartedelaFaseIIvases
decir,laconjugacindelgrupohidroxilofenlicoconcidoglucurnicoosulfatode(188).Dehecho,unaporcin
relativamentepequeadelaproduccindiariadehormonatiroideaseprocesaatravsdeestasvas,peropuedeser
muchomssiestasvasmetablicassoninducidosporcompuestosxenobiticostalescomoelsistemanervioso
central(CNS)actuandodrogas(porejemplo,fenobarbital,benzodiazepinas),bloqueadoresdeloscanalesdecalcio
(porejemplo,nicardipina,bepridil),esteroides(porejemplo,espironolactona),retinoides,hidrocarburosclorados(por
ejemplo,clordano,dicholorodiphenyltrichloroetano,tetraclorodibenzopdioxinaylosbifenilospolihalogenados
talescomobifenilospolicloradosybifenilopolibromado,entreotros)(189).
YodotironinassulfatadosnoseunenalosTRysulfatacinmedialadesyodacinrpidaeirreversiblede
yodotironinasporD1.Porlotanto,lasconcentracionesdeyodotironinassulfatadosensuerosonnormalmentebajos.
DesyodacinInneranillo(inactivacin)deT4yT3porD1sefacilitanotablementedespusdesulfatacin,mientras
quedesyodacinanilloexteriordeT4sebloqueadespusdelasulfatacin.Comoeradeesperar,lasexposiciones
ratnD1KOmarcadoaumentoenlaexcrecinfecalde[125I]iodothyroninesdurantelas48 hdespusdela
inyeccinde[125I]T4o[125I]T3,mientrasquelaexcrecinurinariade[125I]yoduroseredujonotablemente(
186).Notablemente,D2yD3nosoncapacesdedeiodinatingyodotironinassulfatados.Losnivelesenplasmayla
excrecinbiliardesulfatosyodotironinaseincrementanenlasangrefetalyelcable,enfermedadesnotiroideas
(NTI),elayunoyporlainhibicindelaactividadD1conPTUocidoiopanoico(190).Enestascondiciones,T3
SpuedefuncionarcomounreservoriodelahormonainactivadelaqueTactiva3puedeserrecuperadoporlaaccin
delassulfatasasdetejidoysulfatasasbacterianasenelintestino(188).
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

27/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Glucurnidosyodotironinaseexcretanrpidamenteenlabilis.Sinembargo,estonoesunavairreversibledela
eliminacindelahormona.Despusdelahidrlisisdelosglucurnidosdeglucuronidasasbacterianasenel
intestino,partedelasyodotironinasliberadassonreabsorbidos,resultandoenuncicloenterohepticode
yodotironinas(188).Sinembargo,aproximadamenteel20%deTdiaria4produccinapareceenlasheces,
probablementeatravsdelaexcrecinbiliardeconjugadosglucurnidos.Laglucuronidacinescatalizadaporla
UDPglucuroniltransferasas(UGT)queutilizancidoUDPglucurnico(UDPGA)comocofactor.UGTsse
localizanenelretculoendoplsmicopredominantementedehgado,elrinyelintestino.LamayoradeUGTson
miembrosdelaUGT1AyfamiliasUGT2B(191).
Engeneral,larelacinentrelasactividadesenzimticasdetejidoparalasdiferentesyodotironinasylaexpresinde
isoenzimasindividualesapenasseconoce,especialmenteparalossulfotransfereases(resultados).Muchosresultados
deexposicionessuperpuestasespecificidadesdesustrato.Adems,mltiplesresultadosenelmismotejidopueden
estarinvolucradosenlasulfoconjugacindelosmismosyodotironinas,resultandoenlaredundanciaclaro[vaseWu
etal.(192)paraunavisingeneral].Comoconsecuencia,laspropiedadesbioqumicasdelostejidosactividad
SULTreflejanelefectocompuestodediferentesisoenzimas.Expresindeprotenasonivelesdelasdiferentes
isoenzimaspuedenserestudiadosmedianteRTqPCRy/oWesternBlot,perononecesariamentereflejanlas
actividadesgeneralessulfoconjugacintejido(192,193).
18aRECOMENDACIN
Actividadessulfotransferasaysuspropiedadesintrnsecassepuedendeterminarenpreparacionesdeclulaso
tejidosusando3'fosfoadenosina5'fosfosulfato(PAPS)comoeldonadordesulfato.
Comentario YodotironinasulfatacinescatalizadaporresultadosutilizandoSAFPcomodonantedesulfato.Enlos

sereshumanos,resultadosmuestranespecificidadporelsustratodesuperposicin.Enlossereshumanos,quepueden
subdividirseendiferentesfamilias,SULT1,SULT2,SULT4ySULT6.TodoslosmiembrosdelafamiliaSULT1
humana(esdecir,hSULT1A1,1A2,1A3,1B1,1C2,1C4y1E1)catalizanlasulfatacindeyodotironinas(194
).hSULT1A13,1B1,y1C4ytambinenzimasnativasenelhgadotienenunapreferenciadesustratopara3,3'
diyodotironina(T2),queescatalizadamuchomsrpidoqueT3yrT3,mientrasqueT4sulfatacines
insignificante.hSULT1E1prefiereigualmenteT2yrT3sobreT3yT4,peroeslanicaconocidaRESULTAR
hastaahoratenersignificativoT4actividadsulfotransferase(194).Comoconsecuencia,T2seutilizageneralmente
paraestudiarlasactividadesdesulfotransferasaenlostejidoshomogeneizadosbajodiferentescondiciones.Diferentes
resultadoshumanostambinsehandemostradoparacatalizarlasulfatacindeiodothyronamines(195).
Hayvariosprotocolosaceptablesparaensayossulfotransferasa.Lomejoresusar
yodotironinasradiomarcadosconlamsaltaactividadyensayosespecficosdisponiblesdebencontenercontrolesde
fondoylasmuestrasseejecutanenparaleloentubossinPAPS.DebidoavaloresrelativamentealtosKm,puedeser
difcildedejarfueradecompetencialayodotironinaradiomarcadoporungranexcesodesustrato.SULTactividad
puedeseranalizadamedianteincubacinde0,1 mM[125I]iodothyroninedeintersdurante30minutoscon
homogeneizadodetejido,citosol,oSULTrecombinanteenpresenciaoausencia(enblanco)de50 mMPAPSen
tampnPBSEDTA(194).Lareaccinsedetuvomediantelaadicinde0,1 MHClylosproductosseparadospor
filtracinenSephadexLH20minicolumnasenyoduro,yodotironinassulfatados,yyodotironinasnosulfatados(196
).
Ensayodeactividadsulfotransferasa.

18bRECOMENDACIN
Actividadesdeglucuronidacinyodotironinasedeterminanenpreparacionesdeclulasotejidosutilizando
microsomalUDPGAcomouncofactor.
Comentario LaglucuronidacindeT4yT3escatalizadapordiferentesmiembrosdelafamiliaUGT1A(197).Por
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

28/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

logeneral,estoimplicalaglucuronidacindelgrupohidroxilo,peroUGT1A3humanotambincatalizala
glucuronidacindelgrupocarboxilodelacadenalateral,conlaformacindelosllamadosglucurnidosdeacilo.
Curiosamente,TetracyTRIACsonmuchomsrpidamenteaglucuronidacinenelhgadohumanodeT4yT3,y
estoseproducepredominantementeporglucuronidacindeacilo(198).Glucurnidosacilosoncompuestos
reactivosquepuedenformarcomplejoscovalentesconprotenas.Sedesconocesiestoesunarutaimportanteparala
formacindecomplejosprotenayodotironinacovalentes.
Hayvariosprotocolosaceptablesparaensayosglucuroniltransferasa.
Yodotironinasradiomarcadosconlamsaltaactividadespecficadisponiblesdebenutilizarseylosensayosdeben
contenercontrolesdeantecedentes.Laactividaddeglucuronidacinyodotironinasepuedeanalizarmediantela
incubacinde1 Mdela[125iodothyronineI]deintersdurante60minutosconmicrosomasenTrisHClque
contieneclorurodemagnesio(pH7,8)tampn,enpresenciaoausencia(enblanco)de5 mMUDPGA(197,199).
Cuandoseanalizanlosmicrosomasdetejido,1 mMPTUsepuedeaadiralamezcladereaccinparaevitar
desyodacinyodotironinasinafectarasuglucuronidacin.Lareaccinsedetuvomediantelaadicindeetanoly
glucurnidoformacinenfriadoconhieloseanalizaenelsobrenadanteporcromatografaenSephadexLH20
minicolumnascomoyasehadescrito.
Ensayodeactividaddeglucuronidacin.

[E]ReemplazoInducirelhipotiroidismoylahormonatiroidea
Visindeconjunto Elhipotiroidismoesunestadopatolgicoenelquelasealizacindelahormonatiroidease

disminuyesistmicamenteolocalmenteenunoomstejidos.ComoresultadodelagotamientodeTnuclear3,no
haymodificacinenlaexpresindeT3responsivegenes,ladisminucindelosefectosbiolgicosdelahormona
tiroidea.LainduccindehipotiroidismohasidoutilizadotradicionalmenteparadefinirycaracterizarT3procesos
responsive,unenfoquequepuedeserutilizadoenanimalesoenclulascultivadas.Enroedoresestoselograporla
disminucindelosnivelessricosdeT3yenclulascultivadasmediantelareduccindelalibreT3concentracin
enelmedio,pordebajodelosnivelesfisiolgicos.Alternativamente,losantagonistasdeTRsehandesarrolladoy
utilizadoenlasclulas.
[E.1]Elhipotiroidismoenanimales
Fondo SueroT3concentracionesenroedoressepuedereducirquirrgicamentemediantetiroidectomatotalo
131

mdicamentealtratamientoconfrmacosantitiroideoso I.Adems,hayunaseriedecepasderoedoresenlos
quegenesclaveenlapituitariahipotalmicatiroides(HPT)ejeexhibenmutacionesespontneasohansido
modificadosgenticamente,enltimainstancia,interrumpiendolasntesisdelahormonatiroideay/osecrecin.El
enfoqueexperimentalparaellogrodehipotiroidismodebetenerencuentalaedaddelosanimales(esdecir,prenatal,
postnataltemprano,despusdeldestete).Porltimo,lainterrupciny/olainduccindeladeiodinasas
transportadoresdelahormonatiroideapuedenresultarenhipotiroidismoespecficadetejido.
RECOMENDACIN19
Lagananciadepesodebesermonitoreadadurantelainduccindehipotiroidismo.Paraunareferencia
cruzadaentrelosexperimentos,unamesetaobservadaenelaumentodepesocorporalsedebetomarpara
definirunestadodehipotiroidismosistmica.T3actividadesdeexpresindegenesyenzimasresponsive,en
particularD1expresinhepticaoactividad,puedenutilizarsecomomedidasadicionalesdeestadodela
tiroides.
Comentario UnagotaenelsueroT4yunaelevacindelaTSHensuerosonlosprimerosindiciosdeuntrastornoen

lafuncindelejeHPT.PorlogeneralsenecesitamstiempoparareducirelsueroT3.DadoqueT3eslahormona
tiroideabiolgicamenteactivo,enteora,unestadodehipotiroidismosistmicapodraconsiderarsedeexistirdespus
delasconcentracionessricasdeT3handescendidopordebajodelrangonormal.Sinembargo,dadoquelacadaen
elsueroT3podranoreflejartejidoT3concentracinenlospuntosdetiempotempranos,lamayoradelosestudios
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

29/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

definenhipotiroidismosistmicadeexistircuandoseobservaunefectobiolgicodependientedehormonasdela
tiroidesimportanteesdecir,lasmesetasgananciadepesocorporal,oelniveldeexpresindeunT3responsivegen
olaactividaddeunaT3enzimaresponsivesereduce.Mientrasqueenlosestudiosenhumanos,TSHseraun
parmetroidealparadefinirelestadodelatiroides,enlosroedoresdatosnormativosfaltanparapermitirla
comparacincruzadaestudioutilizandoTSHcomomarcadorprimariodelestadotiroideo.
Debidoaquelosroedoressiguencreciendodurantetodalavidayporlasecrecindelahormonadelcrecimientoes
exquisitamentesensibleaT3enratas,elcrecimiento,segnlaevaluacindelagananciadepesocorporal,esun
marcadormuysensibledelaaccindelahormonadelatiroidesenratas(200,201).Unaproximadode100 grata
dejaponerenpesoaproximadamente3semanasdespusdelatiroidectomatotalenestepuntodeltiempo,los
nivelesdehormonastiroideassehanreducidoenun75%yelcontenidodelahormonadecrecimientohipofisariaes
casiindetectable(201).Unaausenciadecrecimientode2semanassehapropuestocomoelestndardeoroparala
definicindeunestadodehipotiroidismosistmicagrave(202)perodosmscortosdetiempo(porejemplo,5das
demesetacrecimientodocumentado)debenseraceptablestambin.Notablemente,detencindelcrecimientolineal
(comosedeterminaporlalongituddelacola),queesmuysensiblealahormonatiroidea,seraunindicador
excelenteydeaplicacinmsgeneraldehipotiroidismo,aunquelosdatospublicadosquedocumentan
especficamenteestesecarece.Estndisponiblesparalosratonesmenosdatos,enelquelahormonadelcrecimiento
esmenosT3sensible,porloqueunamesetaenlagananciadepesocorporalnoesunindicadorfiablede
hipotiroidismo.
Unenfoquemolecularparadefinirestadosintermediosdehipotiroidismosistmicaimplicaralaevaluacindela
expresindeT3responsivegenesolaactividaddeT3responsiveenzimastalescomonivelescardiacosdemRNA
delacadenapesadademiosina(MHC)isoformasohepticadeshidrogenasaglicerofosfato(GPD)actividado
actividadD1.SibiencualquierT3tejidoresponsivepodraexaminarse,tradicionalmenteelhgadohasidoelrgano
deeleccinparaevaluarelhipotiroidismosistmicadadosuelevadonmerodeTRybiendefinidasT3responsive
vas.ActividadD1hgadoseconsideraelndicegenticomssensibledelestadotiroideosistmicayporlotanto
puedeayudarenlacaracterizacindeestadosmuysutilesdeinterrupcinenlahormonatiroideadesealizacin(72
)(verSeccionesD.1yI.2).
20aRECOMENDACIN
Hipotiroidismosistmicapuedeserinducidaporlatiroidectomatotalquirrgicaenratasadultasoratones.
Hipotiroidismosistmicoseconsigueporlogeneralentre5y8semanasdespusdelaciruga.Ratas
tiroidectomizadosHemidesarrollanunaformalevedehipotiroidismosistmica.
Comentario Totalquirrgicaohemitiroidectomaenroedoresesunprocedimientoampliamenteutilizadodadalafcil

accesoalaglndulatiroides(Fig.11)(203).Engeneral,cuandoserealizatiroidectomatotalenun100 grataoun
20 gderatn,seconservanlasglndulasparatiroides.Dadoquelashabilidadesquirrgicasylaanatoma
paratiroideapuedenvariar,algunosinvestigadoresasumenqueelprocedimientodarlugarahipoparatiroidismo
posquirrgico,yporlotantoofreceralosanimalesconunasolucinde2%4%delactatodecalcioendextrosaal
5%adlibitumcomolanicafuentedefluidodurantealmenos10dasdespusdelaciruga.
FIG.11.
Ladiseccindelaglndulatiroidesderoedores.(A)delaincisinquirrgica,
(B)aislarlasglndulassalivales,(C)disociarlosmsculos,(D)liberarla
trquea,(E)laseccindelosmsculoslaterales,(F)deslizarunaagujadebajo
latrquea,revelandolaglndulatiroides....
RatasyratonesThyroparathyroidectomizedtambinsepuedenadquirirdeproveedorescomerciales.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

30/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

20bRECOMENDACIN
Hipotiroidismosistmicapuedeserinducidaporlatiroidectomaqumicacausadaporlaadministracinde
frmacosantitiroideos.Elmarcodetiempodeaparicindehipotiroidismoesvariableydependedeltipode
frmacoyrgimenutilizado.
Comentario LainhibicinqumicadelaglndulatiroidespuedeserinducidamediantelaadministracindeMMI,

PTU,KClO4,oNaClO4.Estosmedicamentossepuedenadministraratravsdeinyeccionesintraperitoneales
diarias(porejemplo,laPTU12 mg/100 gdepesocorporal,MMI15 mg/100 gdepesocorporal(204)),aade
alacomida(porejemplo,0,02%0,15%PTUo0,01%MMIoKClO41,25%(205))oelaguadebebida(0,01%
0,1%MMI,0,01%0,1%PTU,o0,1%1%KClO4oNaClO4).Unescolloimportantedeestaestrategiaesque
todosestosfrmacosantitiroideostienenunsaboramargoy,cuandoseaadealaguapotable,elconsumodebeser
monitoreado.Dehecho,PTUesunestmuloamargocomnmenteutilizadoenlosestudiosdelafisiologadelgusto(
206).Empricamente,sehaencontradoqueKClO4esmenosaceptablequeNaClO4.Debidoalasensibilidaddel
gustovaraentrelosratonesendogmicos,elconsumodeaguaseveafectadadeformavariable,yenalgunascepas
sepuedeproducirunadeshidratacinsignificativa.Almismotiempo,elconsumodedrogastambinpuedevariar
debidoalasratasylosratonespuedendejardebeberlquidosamargosypuedenresistirlafaltatotaldeaguadurante
variosdasantesdequeaparezcahiperosmolalidad(207).Lasacarosapuedeaadirsealaguaparapreveniresto,
perolasrespuestassonvariable(208).Porlotanto,sielaguapotableeselmtododeentregaelegido,elpeso
corporalyelconsumodelabebidadebensercontroladoscuidadosamenteylasconcentracionesdedrogasajustarn
debidamente.UnaconsideracinmenorenroedoresesqueeltratamientoconPTUoMMIelevalaconcentracinde
calcitoninaensueroy,conelusoprolongado,lasclulasCsemuestranhiperplasiafisiolgicaoreactiva.Estonoest
relacionadoconelestadodehipotiroidismosistmicalacausaesdesconocida.
SerumT3nivelescaerndebajodelonormaldentrode1015dasdependiendodelaconcentracindelfrmacoyla
vautilizada.Comounejemplo,hubounaumentode20vecesenTSHensueroenratastratadasduranteunmximo
de3semanascon0,05%MMIenagua(potable209).Eltratamientocon0,1%PTUenagua,quetambininhibela
conversinperifricadeTpotable4aT3,resultenunareduccinmsrpidaenelsueroT3yelaumentodeTSH
ensueroqueenlasratastratadascon0,1%MMI.Sinembargo,estasdiferenciasyanoseobservarondespusde3
semanasdetratamiento(209).UnestadodehipotiroidismosepuedelograrmsrpidamentesiPTUoMMIse
combinancon1%KClO4enelaguapotable,unpotenteinhibidordeNIS(210,211).Sinembargo,su
combinacintambinenmagnificarelefectoqueestasdrogastienensobreelconsumodeagua.
Unaalternativarazonableesusar0,15%PTUquecontienegrnulosdecomidabajaenyodo,queestdisponible
comercialmenteysehautilizadoconxito(212).Sehainformadodequeunestadosistmicodelhipotiroidismose
puedelogrardespusde4semanasenestadietaunenfoquemsrpidoincluyelacombinacindeagua0,01%
MMI,queesunaconcentracinquenopareceinterferirconelconsumodeagua.Enexperimentosalargoplazo
(meses),elcrecimientocompensatoriotiroidesTSHimpulsadapuedeelevarelsueroT4denuevoanivelescasi
normales,inclusomientrasquelosanimalesestnenladietaPTUbajaenyodo.Porlotanto,esimportante
documentarunestadodehipotiroidismosistmicadurantetodoelexperimento.
20cRECOMENDACIN
Hipotiroidismosistmicapuedeserinducidaporlaablacindeyoduroradiactivodelaglndula.Enlos
animalesadultosliberacindehormonatiroideasereducenotablementedespusde1semanade131
administracinI.Elcrecimientoenlosanimalesrecinnacidosmesetasdespusde34semanasde131me
administracin.
Comentario Laadministracinintraperitonealde131Iensolucinresultaenhipotiroidismotransitorioopermanenteen

ratasadultas(250 gBW),dependiendodeladosisutilizada(213).Unprocesodegenerativoprogresivotiroidease
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

131

31/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

observadespusdelaadministracinde300o525 Ci131I,perolaregeneracinseproducedespusdevarios
meseslaregeneracinnosevecuando875 Ciseutiliza(213).Otrostejidospuedenserdaadosporlaradiacin:
sehaobservadofibrosisdelasglndulasparatiroidesal525o875 Cide131seutilizayo.Nopuedehaberdao
traquealyefectosrenalestransitorios(213).Nosehaobservadodaosenelhgado(213).Elindicadormetablico
tempranodedisminucindelafuncinglandularesunagotaenlaprotenaunida131I,queseobservalas24horas
despusdelainyeccinde875 Cide131I(214).Esteenfoquetambineseficazenratasrecinnacidasdespusde
laadministracinintraperitonealde80 Cide131I(215).Enun2025 gratn,laablacindirectasepuedelograr
con200 Cide131I(216).
20dRECOMENDACIN
Unestadodehipotiroidismosistmicasepuedeconseguirdeformarpidayeficazmenteporelusode
enfoquescombinados.
Comentario Cualquiercombinacindedietabajaenyodo,medicamentosantitiroideos,cirugayyodoradiactivose
podrautilizardeformarpidayeficazparalograrunestadodehipotiroidismosistmicagrave.Tpicamente,131Ies

precedidaporunadietabajaenyodo.Alternativamente,latiroidectomaquirrgicatambinpuedeserseguidopor
unadietabajaenyododurante2semanas,seguidoporlaablacinderestoscon131Iladosisablacinposquirrgica
de200a250 gderatapuedeser~80 Ci(217)pararatones,2550 Cihasidoutilizadoconxito.
RECOMENDACIN21
Hipotiroidismosecundariopuedeserinducidaenratasporlahipofisectomaquirrgica.
Comentario Hipofisectomaquirrgicaenroedoresrequierehabilidadyexperiencia.Elenfoqueparafarngeopara

extirparlaglndulapituitariaenroedoressehautilizadotradicionalmente(218,219).Esteenfoquesehasustituido
engranmedidaporelenfoquetransauricular(220,221).Esteprocedimientodejasordosanimalenunooambos
odos,loqueafectarasurendimientoenciertaspruebasdecomportamiento.Tpicamente,unanestesiados50300 g
derataseinmovilizaenuninstrumentohipofisectomaHoffmanReiter,quepermitelacolocacinestereotcticadela
puntadeunaagujadeaspiracinprximoalaglndulapituitaria,queseaspiracontinuacin.Elanimalseretira
entoncesdelinstrumentoyproporcionaloscuidadospostoperatorios.Laintegridaddelahipofisectomaseconfirma
porlaausenciadeaumentodepesoduranteunperodode4semanasdespusdelaciruga.Cuidadoperioperatorio
deestosanimalesesfundamental:losanimaleshipofisectomizadostienendificultadespararegularlatemperatura
corporalyporlotantorequierencondicionesambientalesconstantesunasalamscaliente(temperaturaentre72F
y76F)esideal.Esteprocedimientoaumentaladiuresisyasjaulasconcamadecontactosedebecambiarcon
frecuencia.Dadasufragilidadmetablica,losexperimentossellevanacabotpicadespusdelasprimera6a10das
delpostoperatorio.Todoslosanimaleshipofisectomizadassemantienenenelaguapotablequecontieneelectrolitos
adecuadosy5%deglucosa,adlibitum.Suplementosdeaguacomienzaneldadelacirugaydebencontinuar
durante14das.Paraproduciranimalesqueexhibenhipotiroidismosecundarioselectiva,animales
hipofisectomizadassontratadoscondosisdiariasdereemplazodelahormonadelcrecimiento,hormonaluteinizante,
hormonaestimulantedelfolculo,prolactina,testosteronapropionato,benzoatodeestradiol17,cortisonaovehculo
medianteinyeccionessubcutneas(222).
RECOMENDACIN22bis
ElhomeoboxNkx21(Nkx2.1T/ebp,TTF1)KOratnesunmodelodedisgenesiatiroidea.
Comentario ElNkx2.1ratnKOseprestaparaestudiosdedesarrollodelaglndulatiroidesfetal,ascomopara

estudiosenlosquenoexistelasecrecintiroideafetal.Tiroidesespecficaprotenadeuninalpotenciador(T/ebp)
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

32/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

/Nkx2.1tiroidesratnnulldegeneranpordaembrionario(E)12a13porapoptosis,mientrasqueT/ebp/Nkx2.1
ratonesheterogyzgouspresentanhipotiroidismoconnivelesdeTSHelevados.ElfactordetranscripcinNkx2.1(T
/EBP,TTF1)regulatiroidesespecficalatranscripcindegenes,perotambinesimportanteparaeldesarrollodela
pituitaria,pulmn,ylasregionesdelcerebroventrales(223).ElhomocigotosNkx2.1ratnKOnoesadecuadopara
losestudiospostnatales,yaqueestosanimalesmuerenalnacerdebidoapulmonesprofundamentehipoplasia,un
hipotlamopresentangravescarencias,ylaausenciadeglndulastiroidesypituitaria.Porotrolado,Nkx2.1ratones
heterozygous,semostraexhibirhipotiroidismoconnivelesdeTSHelevadosytienenundefectoneurolgico,
aunqueparecenestarsanosysonfrtiles.Estefenotipotiroidessedebealareduccindeexpresindelreceptorde
TSHdebidoaT/ebphaploinsuficiencia.
22bRECOMENDACIN
ElPax8ratnKO,elreceptordeTSHKOratnyelratnhomocigotoparaelgenautosmicorecesivo
hipotiroidismo(hyt)presentanhipotiroidismocongnitogravedeaparicinfetal.
Comentario DadoqueelPax8genregulalatranscripcindetiroidesespecfica,suinactivacinresultaenunapequea

glndulatiroidesquecarecedelaformacindelfolculo(224).Pax8ratonesKOtienensueroindetectableT4yT3
niveles,elaumentodelamortalidadpostnatal,yretrasodelcrecimiento.EncontrasteconlaNkx2.1KO,elPax8KO
ratnsobrevivenacimientoperomueredespusdeldestete.TratamientopostnatalconT4oT3,rescataraestos
animales.Laretiradadeltratamientodurantelavidaadultaproduceunanimalgravementehipotiroidismoquepuede
sobrevivirdurante6mesesoms.
Eldefectomolecularenelhytratnesunpuntodemutacindeinactivacinenelgenquecodificaelreceptorde
TSH(TSHR).NeonatalesHYT/hytratoneshanreducidoelsueroT4quevandesde1/5a1/6delanormalidad,as
comoretrasadosignificativamenteeldesarrollosomticoyconductual.Elhyt/hytratnofreceunmodeloidealpara
explorarelefectodelaseverahipotiroidismoprimarioheredadoenelteroyenelperodoneonatalprecoz(225,
226).ElratnKOTSHResprofundamentehipotiroidismosinhormonatiroideadetectableenelsueroyTSHsrica
elevada,exhibiendoretrasoenelcrecimientoydesarrollo,ascomoinfertilidadsinosuplementadoconT4(227).
22cRECOMENDACIN
Elratnconunamutacinsinsentidoeneloxidasa2dual(DUOX2gen)yelCogratn(bociocongnito)son
modelosmenosgravesdehipotiroidismocongnito.
Comentario LosratonesconunamutacinenelDUOX2exhibicingendeunaformamslevedehipotiroidismo

congnito.ElDUOX2genestimplicadoenlageneracindeH2O2paralaperoxidasatiroidea,laenzimaque
catalizalaorganificacindeyodoenlatiroglobulinaparalasntesisdelahormonatiroidea.Unvalinaalasustitucin
deglicina(V674G)enDUOX2explicaladishormonognesistiroides(228).ElmutanteDUOX2homocigotos
desarrollahastalaedadadulta,peroexhibeenanismoysufrededeficienciaauditiva.SerumT4nivelesson10%de
losnivelesdetiposalvajeyestnasociadosconunaelevacindeaproximadamente100vecesenlaTSHensueroy
unpituitariaanteriordisplsico.Estemodeloderatndehipotiroidismocongnitopuedesermsgraveporla
orientacinsimultneadeDUOXA1yDUOXA2,quesonfactoresdemaduracinespecficasnecesariasparala
orientacindelasenzimasDUOXfuncionalesalasuperficiecelular.Machosyhembrashomocigotospresentan
bocioyelhipotiroidismocongnitoconindetectableTsuero4ylosnivelesdeTSHde500a2.500vecesms
elevados,respectivamente(45).
Elengranajedelratnexhibeunamutacinautosmicarecesivaquesehaasignadoalagentiroglobulina(230,231
).Jvenesadultosdentadasratonesmuestrantasareducidadecrecimiento,anemialeve,bajaTsuero4yT3,yTSH
sricaelevada.Tiroidesderatonesmutantessonhipertrofiado,deficienteencoloide,acumularmenosdeyodo
(parcialmentesusceptiblesaladescargadeperclorato),ytienenunamarcadadeficienciaenelcontenidodela
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

33/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

tiroglobulina(230).
22dRECOMENDACIN
ElratnKOTRHesunmodelodehipotiroidismoterciario,enelquelainterrupcinenlafuncintiroideaes
sloleve.
Comentario LosratonesKOTRHsonviablesyfrtilesyexhibeneldesarrollonormal(80).Sinembargo,tienenuna

marcadadisminucinensuerodeT4(aproximadamente60%
delosvaloresdecontrol),laelevacindelnivelde

TSHensuero,yhadisminuidolaactividadbiolgicadeTSH.Lapituitariaanteriorhadisminuidoclulasinmunes
positivodeTSH,quesecorrigedereemplazohormonalTRH,peronodelatiroides.ElratnKOTRHexhibeun
ligeroretrasoenelcrecimientopor4semanasdeedadquesenormalizaalas8semanasdeedadoportratamiento
conT4(80).DebidoalpapeldesempeadoporTRHenlosislotespancreticos,losratonesKOTRHtambin
presentanhiperglucemia,queseacompaadelasecrecindeinsulinaalteradaenrespuestaalaglucosa.
23aRECOMENDACIN
Formasyporclulasespecficasdetejidodehipotiroidismorelacionadocondeiodinasaactividadessepueden
estudiarinvivoatravsdelainterrupcindelavaD2olainduccindelavaD3.
Comentario LaactividaddelosdeiodinasaspuedemodificarT3nivelesdeunamaneraespecficadelaclulasin

afectaralosnivelescirculantesdelahormonatiroidea(84).UnainterrupcinenlavaD2sehademostradoque
disminuyelaT3produccinlocalmenteyperturbarlahormonatiroideasealizacinenlasclulasqueexpresanD2(
92,173,232234).Estoseilustraporlareduccindeaproximadamenteel50%enT3contenidoenelcerebroD2
KO(187).InhibidoresD2sepuedenutilizar,peroconprecaucindebidoalosefectosfueradelameta.Por
ejemplo,lainhibicindeD2hasidoidentificadocomolacausasubyacentedelaTSHensueroelevadaasociadacon
eltratamientoconamiodarona(235),perotambininhibelaamiodaronaD1ypuedetenersuspropiosefectosTR
tambin.Existenpreocupacionessimilaresconcidoiopanoico,utilizadoparainhibirD2yperturbarlasealizacin
delahormonatiroideaenBAT(236,237).ElusodelosanimalesKOD2constituyeelmejormodeloparaestudiar
elhipotiroidismolocalizadadebidoalainterrupcindelavadeD2.
LostejidosqueexpresanD3handisminuidosealizacindelahormonatiroideacomoresultadodelarpidaT3
inactivacinaT2yporlotantoconstituyenunmodelodehipotiroidismolocalizada(62,63,238,239).Esto
puedeserexageradaduranteD3reactivacindurantelaenfermedad,isquemia,hipoxiaoqueconduceala
interrupcinlocalizadaenlasealizacindelahormonatiroideaendiferentestejidostalescomoelmiocardioyel
cerebro(6265,238,241).
23bRECOMENDACIN
HipotiroidismoCellyespecficadetejidorelacionadaconyodotironinatransportepuedeserestudiadoenvivo
atravsdelainterrupcindediversossistemasdetransporte.
Comentario InactivacindemutacionesenelgenquecodificaMCT8interrumpenT3transporteatravsdela

membranaplasmticaydisminuyendesealizacin(hormonatiroidea107,108).DadoqueD2seexpresaenlas
clulasglialesyTRprincipalmenteenlasneuronas,secreequelainactivacindelamutacinMCT8promover
hipotiroidismoneuronalmediantelainterrupcindelosefectosparacrinosdeglahechasT3enunmomentocrtico
paraeldesarrollodelsistemanerviosocentral.Dehecho,laexistenciadeestemecanismoparacrinoseverificen
cocultivosdeclulasglialesylaslneascelularesneuronales(173).Laevidenciaclnicaapoyandoestemecanismo
seobtuvoporprimeravezenpacientesconfenotiponeurolgicogravequepresentaelsndromedeAllanHerndon
Dudley(107,108).
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

34/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

[E.2]Reemplazodehormonatiroidesenlosanimales
Fondo LarelacinmolardeT4aT3entiroidesderataes8:1(242)yelestimadoT4/T3proporcinenla

secrecintiroideaesde5:1(1000 pmol/ddeT4a190 pmol/ddeT3),loqueindicaunapequeacontribucin


detiroidesT4aT3conversinaldiarioT3produccinenlarata(132).Porlotanto,laprohormonaT4esla
yodotironinasecretadaimportanteenratasyodosuficiente.MientrastodoT4essecretadaporlaglndulatiroides,
alrededordel60%detodoslosdasT3esatravsdelaproduccindedesyodacinperifricadeT4,yel40%
restantesecretadadirectamentedelaglndulatiroides.Enparticular,laglndulatiroideshumanacontribuyeconslo
un20%deldiarioT3deproduccin(132).
Enteora,elreemplazodelahormonatiroideaenlosroedorespodraajustarsealosprotocolosaplicadosenlosseres
humanosesdecir,reemplazodehormonatiroideadepartidabasadoenTSHpesoymonitoreosueroyT4.Sin
embargo,enratasLT4monoterapianopuedenormalizarsimultneamentesueroT3,T4yTSH,presumiblemente
debidoalamayortiroideaT3produccinenroedores(243,244).As,paranormalizarT3yTSH,elsueroT4
debesersuperioralanormalenratas,ylomismoseaplicaaltejidoT3yT4contenido.Histricamente,los
investigadoreshanutilizadoelTdiaria4tasadeproduccin,aproximadamente10 ng/gBW,comounadosisde
reemplazoenLT4monoterapiaenratasporqueestadosisessuficienteparanormalizarlatasadecrecimiento(200).
Sinembargo,sisedeseanormalizacindeTSHensuero,unadosismsalta(aproximadamente20 serequiereng/g
BW).MientrasqueunenfoquesimilarparaLT4detratamientosehautilizadoenratoneshipotiroideos(esdecir,
dosisdetratamientoequivalentealatasadeproduccindiaria)datosnormativosfaltanparadeterminarsilaspruebas
delafuncintiroideaensueroytejidoT3yT4nivelesrespondendemanerasimilarcomoenratas.
24aRECOMENDACIN
ElTdiariamente4dosisdereemplazoenratasadultaspreviamenteprestadoshipotiroidismodebeaproximar
latasadeproduccindiariasilatasadecrecimientosemantienecomolavariableprincipalquedefineel
estadoeutiroideo.LasdosismsaltasdeLT4debenserutilizadossilaTSHsricaessernormalizados.Siotro
tiroidespuntosfinalessensiblesalashormonassehandeconsiderar,laapropiadaT4dedosificacindebe
determinarseempricamenteenunabasedecasoporcaso.
Comentario Engeneral,lanormalizacindesuerodeT3oparmetrosbiolgicostalescomoelcrecimiento,la

expresindeunaT3genresponsive,olaactividaddeunaT3responsiveenzimaenelhgadosonparmetros
aceptablescuandoseconsiderareemplazodehormonatiroideaenrataspreviamenteprestadoshipotiroidismo.
Entregadiariade~8 ng/gBWaratasadultaspreviamentehipotiroidismomostradahasidomostradospara
normalizarsueroT3niveles,tasadecrecimientoylaactividaddehgadoGPD,unndicemuysensibledelestado
tiroideosistmicaenratas(202).
Porrazonesprcticas,laadministracindeT4eselmtodoutilizadomsfrecuentementepararestaurarel
eutiroidismo(200,202,245,246).Sinembargo,acausadelasecrecintiroideadirectasustancialdeT3en
roedores,elidealrgimendereemplazodehormonatiroideacontaraconunamezcladeT4yT3.Algunosestudios
hanestablecidoladosificacinptimaparalaterapiadecombinacinenroedores(244).CuandoT4seutilizasolo
paraelreemplazo,tejidoT3contenidopuedevariaratravsdeungrannmerodetejidosdebidoalpapel
desempeadoporlosdeiodinasascomofuentelocaldetejidoT3(atravsdelaconversindeT4)(243,244).
LadiariacalculadaT3deproduccinesdeaproximadamente2,7 ng/gdepesocorporal(132).Enparticular,una
dosisligeramentemenordeT3,2,0 ng/gBW,sehademostradopararestaurarelcrecimientoylaactividadde
GPDhgadoenratasconhipotiroidismopreviamenteprestados(202).Sinembargo,laadministracindeT3pors
solanoessuficientepararestablecereleutiroidismoentodoslostejidos,particularmenteenaquellosconuna
contribucinsignificativadelavaD2(243,244).

http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

35/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

24bRECOMENDACIN
Seprefierelavaparenteralparaentregarhormonatiroideapararoedoresporejemplo,intraperitoneal,
subcutnea,obombasosmticasimplantadassubcutneamenteogrnulos.
Comentario T4yT3solucionessepreparanen40 mMdehidrxidodesodioysediluyeronensolucinsalinapara

inyeccin.Alabrigodelaluz,lassolucionesmadrepuedenseralmacenadasa20Cduranteunassemanas.Las
inyeccionesdiariasevitanpreocupacionessobreadmisinvariablesilahormonaseadministraenlosalimentosoel
agua(vasemsadelante).Sinembargo,debetenerseencuentaquelasinyeccionesproducenunpico
supraphysiologicalrpidaensistmicosT4oT3niveles.MtodosdeentregaalternativosparalaT4oT3
administracintalescomobombassubcutneosopelletspuedenserpreferiblessisedeseantasasrelativamente
constantesdelaentrega.T4yT3sepuedenmezclarconaguaoalimentos,peroestosmtodosllevanlavariabilidad
intrnsecadealimentosoaguadeconsumoquepuedenimpedirsuusoenalgunosexperimentos.Laduracindel
tratamientopuedeabarcarvariosdas,semanasomeses.Preferiblemente,lasdosisdebenserdivididasalda(cada12
horas),dadalarelativamentecortavidamediadeT3yT4enroedores(2y8horas,respectivamente).Lasmuestras
desangreparamedirlosnivelesdehormonatiroideadebetenerencuentalacronologadelaltimainyeccin.
24cRECOMENDACIN
RegmenesapropiadosparalaedaddeT4dereemplazodebenserutilizadospararatonesrecinnacidoscon
hipotiroidismo.
Comentario Enlosmodelosdehipotiroidismocongnitooneonatal,T4sustitucindebeiniciarsedesdeelnacimiento

(da0)ycontinuadiarioatravsdealmenos10dasdespusdelparto,unperodocrticodelatiroidesdependiente
dehormonaseneldesarrolloenratones(247).SueroT4nivelesenratonesseveramentehipotiroidismopuedeser
restauradoalosnivelesdecontroldelamismaedadatravsdeinyeccionessubcutneasdeT4enlosdas05(4 ng
/g),68(5.8 ng/g)y10.9(9,1 ng/g)paraelratn(248251).Lasinyeccionessepuedenrealizarutilizandoun
0,5 mljeringaconunaagujatratadoconsolucinsalinadecalibre30.
24dRECOMENDACIN
Clulasmadreembrionariasderatnpuedenserconducidosadiferenciarseenclulasfolicularestiroideas
funcionalesinvitro,larestauracindeeutiroidismosistmicacuandosetrasplantanenratoneshipotiroideos.
Comentario LasobreexpresintransitoriadelosfactoresdetranscripcinNKX21(anteriormentellamadoTTF1)y

Pax8dirigealasclulasmadreembrionariasderatnparadiferenciarseenclulasfolicularesdetiroides.Cuandose
trataconTSHestasclulasseorganizanenestructurasfoliculares3Dyactivangenestiroidesfuncionalincluyendo
NIS,TSH,tiroglobulinaytiroperoxidasagenes(252,253).Estosinvitrofolculosderivadosmuestranactividad
organificacinyoduroycuandoinjertadoinvivoenratonesathyroidsoncapacesderestaurarlosnivelessricosde
hormonatiroideaypromovidolarecuperacinsintomticaposterior(252).
[E.3]Elhipotiroidismoenclulascultivadas
Fondo Elmediodecultivocontienegeneralmentedesueroanimal,ylasclulasascultivadasestnexpuestosa

yodotironinaconcentracionesquedependendelafuentedelsuero.Porejemplo,sisuerobovinofetal(FBS)seutiliza
paraapoyarelcrecimientocelular,elambienteT3yT4concentracionesenelmedioreflejarnlosnivelesde
hormonatiroideadelosternerosutilizadosparaproducirelsuero.Histricamente,suerotomadasdeanimalesodelos
animalestratadosconfrmacosantitiroideostiroidectomizadossehanutilizadoparagenerarlosmediosde
comunicacinhipotiroidismo(254).Debidoalafaltadedisponibilidadcomercialdetalessuero,decapadoqumico
havueltomscomn,yaseaconcarbnvegetal,resinasAG1X8deintercambioaninico,oambos(255,256).
Dependiendodeltipodeclulaenestudio,elusodemedioslibresdesuerotambinpuedeserunaopcin,aunquela
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

36/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

mayoradelasclulassepropaganmejorenmediosquecontienensuero.
25aRECOMENDACIN
Lasclulasencultivosepuedenhacerhipotiroidismousandomediossuplementadoscon(i)elsuerocon
carbnvegetal,(ii)desuerodespojadoderesina,(iii)sueroobtenidodeanimaleshipotiroideos,o(iv)mediono
suplementadoconsuero.
Comentario Elusodelosmediosdecomunicacin"definidos"parainducirhipotiroidismotieneunaseriede

advertencias.Mientrasquemuchosinformesindican">99%"deT3yT4seeliminanatravsdeprotocolos
estndardeagotamiento,existeciertavariabilidadenelgradodeT3yT4remocinalcanzadoporlosdiversos
procedimientos.Estavariabilidadpuedesurgirtantodefactoresrelacionadosconeltipodesueroydelmtodode
extraccin(257,258).Adems,losmtodosdecapantesqumicosactualesnopermitenelagotamientodela
hormonadelatiroidessinozonotambinotrosfactorescirculantes.Muchaspequeasmolculastalescomofactores
decrecimientouhormonas(incluyendoesteroidessexuales,esteroidessuprarrenales,ylavitaminaD)tambin
puedenserremovidosdurantelaextraccin,yporlotantoloscambiosbiolgicosobservadoconeltiemponose
puedendescribircomoquerepresentaaisladohipotiroidismo(257).Diseoexperimentaldebecomparargruposcon
hormonatiroideareemplazado(frentealvehculosustituido)parapermitirlaatribucinespecficadelosresultadosa
ladeficienciadelahormonatiroidea.SiunagotamientomsaisladadeT3yT4esnecesario,lapreparacinde
sueroanimalhipotiroidismohasidodemostradoserpotencialmenterentable,apesardeunaaparienciainicialde
impracticabilidad(254).
Elusodesueroagotadosehademostradoqueinducehipotiroidismocelular,evaluadaporelniveldeexpresindeT
3responsivegenes,entanpococomo24horas(259).Enteora,eltiemponecesarioparaalcanzarelhipotiroidismo
podraacortarsecambiandoconfrecuencialosmediosdecomunicacin(porejemplo,cadapocashorasenlugarde
diaria)EstoaceleraraelagotamientodeintracelularesT3tiendas.Delmismomodo,eltiempodecultivoprolongado
enT3Ty4seradeesperaragotadasmediosparainducirunestadomsprofundodehipotiroidismocelular.
Independientementedelenfoque,elgradodehipotiroidismoparacadacondicinexperimentalsedeterminamediante
lamedicindelaT3responsivepuntosfinales(porejemplo,laexpresindeT3responsivegenesoT3responsive
enzimas)parafacilitarlacomparacinentreensayos.
25bRECOMENDACIN
LasclulasencultivosepuedenhacerhipotiroidismousandounantagonistadeTR.
Comentario NH3esunantagonistadeTRqueinhibefuertementelaactivacintranscripcionalporT3(260265).El

tratamientoconestecompuestosehademostradoquebloqueanlahormonatiroideaprocesosdependientestales
comoespontneaXenopuslaevisrenacuajometamorfosis.Enteora,estefrmacopodraserutilizadoparainducir
hipotiroidismoenotrosvertebrados,peroestoannosehaestablecidoexperimentalmente.
[F]ElaumentodelahormonatiroideadeSealizacin
Visindeconjunto Clsicamente,tirotoxicosisseconsideracomounestadofisiopatolgicoenelquelasealizacinde

lahormonatiroideaseincrementasistmicamente(esdecir,alolargodetodoslostejidosdelorganismo)como
resultadodelaumentodelaT3deuninconsusreceptoresnucleares.Experimentalmente,tirotoxicosissistmica
puedesermodeladainvivoatravsdeltratamientodelosanimalesconlahormonatiroidea.Invitro,lasclulas
puedensertratadasconlosmediossuplementadosconhormonatiroideaporencimadelasconcentraciones
observadasenlasangre.Sinembargo,enesteltimocaso,losefectosdeladiafonaentrelostejidostirotoxicosis(es
decir,losefectosinteractivos,indirectomediadoatravsdesegundosmensajeros,estnausentes)elestadode
"tirotoxicosisdirecta"creadoes,pues,distintadelatirotoxicosissistmica."Aumentoespecficadetejidoenla
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

37/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

sealizacindelahormonatiroidea"esunconceptomsreciente,quesurgecomoresultadodelaactividad
deiodinasalocalqueaumentarnuclearT3concentracindeciertostejidossinalterarnecesariamentelaconcentracin
dehormonadelatiroidesplasma(66).
[F.1]tirotoxicosisenanimales
Fondo Administracindelahormonatiroideaaunroedordeotromodoeutiroideoconduceatirotoxicosissistmica,

laintensidaddeloscualesestdirectamenterelacionadaconlamagnituddelaelevacinensuerodeT3
concentracin.Unnmerodeenfoquessehanutilizadoparalogrartirotoxicosissistmica,incluyendolainyeccin
intraperitonealdelahormonatiroidea,ademsdeChowoaguapotable,ypelletsubcutneooinsercinminibomba.
26aRECOMENDACIN
Tirotoxicosissistmicaagudapuedeserinducidaporlaadministracinparenteral(intraperitonealo
intravenosa)de1,0 gT3/gBW,unadosissaturantedeTRT3.Efectosgenmicossepuedenvertanpronto
como60minutosyefectosfisiolgicosapartirdeaproximadamente6horas.
26bRECOMENDACIN
AlargoplazotirotoxicosissistmicapuedeserinducidaporeltratamientocrnicoconT3oT4sobredas,
semanasomeses.Lasvasdeadministracinincluyenparenteralolasuplementacindealimentosoagua.
Paralosestudioscrnicos,lasdosisTRsaturacindebenserevitadosdebidoalacaquexiaylamuerte.Para
permitirlacomparacinentrelosestudios,T3dosisdebenadministrarsecomomltiplosdeldiarioT3oT4
dosisdereemplazo.
Comentario LavidamediadeT3enroedoresdespusdelainyeccinsehamedidoenaproximadamente4horas,y

paraT4alrededorde11horas(132).Dadasestascortasvidasmedias,enlosexperimentosyaseaagudaocrnica,
elmuestreoparalamedicindeT3oT4nivelessricosdebentenerencuentalacronologadelaltimainyeccin,
enparticular,paraT3.Ademsdemltiplesinyeccionessedebenconsiderarsilosefectosbiolgicossevanamedir
despusdehaberpasadovariasvidasmedias.DespusdemltiplesinyeccionescondosisclsicosdeT3(100 mg/
100 gBW),elintensoestadodetirotoxicosisprovocaprdidadepesocorporalyaumentalamortalidad,detal
maneraqueladuracindeltratamientoexperimentalnodebeextendersemsallde45das.LasdosistpicasdeT4
oT3bientoleradoenexperimentosalargoplazo(23meses)sonde10a25veceslatasadeproduccindiaria.Si
bienlosmtodosdeadministracindefrmacosporlosalimentosyalaguaestnsujetosalaalimentacindela
variabilidad,estopuedenosercrticoparalosestudiosdetirotoxicosiscrnicaporejemplo,ladietaderoedoresen
polvoquecontiene3 mgdeT4y1 mgdeT3porkilogramohasidoutilizadoconxitoparainducirtirotoxicosis
crnica(205).Sedebeconsideraralosmtodosmsconsistentes,comolasbombassubcutneosopellets(243,
244).
Dependiendodelcriteriodevaloracinaserestudiado,laeleccindeyodotironinaesimportante,yaqueT4se
convierteenT3atravsdeD1yD2.PacientesGravesvecespuedenexhibirunaT3formapredominantedela
tirotoxicosis,mientrasquelospacientesconcncerdetiroidessongeneralmentetratadoscondosisfarmacolgicasde
T4paralograrlasupresindeTSH.Dichoesto,enlosestudiosnosecentraenlasfuncionesdelosdeiodinasas,T3
seprefiere,yaquenorequiereactivacinadicionalyporlotantoeliminalosdeiodinasasactivadorascomouna
variable.
Clsicamente,grandesdosisdeT3sehanutilizadoenlosexperimentosconroedores,diseadosparasaturarelT
nuclear3receptoresrpidamenteyporlotantomaximizarloseventosfenotpicasestudiadascomopuntosfinales,
mientrasqueminimizaeltiempoexperimentalyporlotantoelcosto.Porejemplo,unadosistpicaparalasrataso
ratonessera100 g/100 gBW,produciendocambiosgenmicosyfisiolgicasmensurablesdentrodeunaspocas
horas(266).CabesealarquelasdosisdeT3clsicamenteutilizadosparaexperimentosconroedoresson
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

38/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

claramenteenelrangofarmacolgicaysonmuchomsaltaquelagamafisiopatolgicovistoenlanaturaleza.
Algunosautoressepreguntansitalesdosisaltaspuedenproducirartefactosfueradeobjetivooexcesivamente
aumentarlosefectosnogenmicosdeT3.
RECOMENDACIN27
InvivoactivacindelavaD2oinactivacindelavaD3puedeserutilizadoparaestudiaraumentopor
clulasyespecficadetejidoenlasealizacindelahormonatiroidea.
Comentario D2activacininducidaporcAMPinBATllevaaunarpidasaturacindeTRcongeneradalocalmente

T3ylainduccindeT3responsivegenesylaactividaddeT3responsiveenzimas,sinafectaralosniveles
circulantesdelahormonatiroidea(66,86,233,237,267269,271).Estotambinseobservenmodelos
animalesdelaexpresintransgnicaDio2enelcorazn(273,274).Encambio,D3inactivacinresultaen
aumentolocalizadoenlasealizacindelahormonatiroideacomoseevidenciaenelratnKOD3(64,239,275
279).
[F.2]tirotoxicosisenclulascultivadas
Fondo Paralosexperimentosbasados
enelcultivodeclulas,tipodeclulasespecficasdetejidoespecficooms

propiamentetirotoxicosispuedesermodeladamediantelaadicindeT3almedio.Lasconcentracionesdehormona
tiroideaMediumpuedendeterminarsedirectamente,peroenlamayoradecasosseestimaconbaseenlosvalores
publicadosparalasfraccioneslibresenunsuerodado.
28aRECOMENDACIN
TirotoxicosisagudasepuedelograrenuncultivocelularmediantelaadicindeT3enlosmedios.Lafraccin
libredeT3multiplicadoporlaconcentracintotaldeT3daunaestimacindelaconcentracindehormona
libre.Sifraccioneslibresnosedeterminandirectamente,lasestimacionesdeconcentracindehormonalibre
sepuedenhacersobrelabasedelosvalorespublicadosdelasfraccioneslibres.
Comentario Silasconcentracionesexactasdehormonastiroideasenmediosdecultivocelulardebenserconocidas,

entoncesserequeriranmedidasdirectas.Enlamayoradecasos,sinembargo,secreequeestimacionesaproximadas
sersuficiente(Tabla2).Cabedestacarquelashormonastiroideasseadhierenarecipientesdeplstico,porloquees
importanteaadirunaprotenavehculoadecuadoconelfindemodelarlasfraccionesdehormonatiroideauniday
libreenuncultivocelular.SueroograsoStrippedseutilizannormalmentelibredecidoBSA,conT3(y/oT4)
sustituidolasmismasadvertenciasacercadelaprdidadeotrashormonastodavaseaplicancuandoseutilizaeste
enfoqueexperimental.
Pocosestudioshaninformadodemedicinbasadoenladilisisdeequilibriodelasfraccioneslibresensuero
despojado,perounestudioencontrqueparaFBSessimilaralagamaestimadadeFBSsinpelar(0,4%4%paraT
3)(281).BSAconcidosgrasospuedetenerT3,porlotantograsoBSAlibredecidosedebeutilizar(282).
TambinhayquesealarquelamayoradelasformasdisponiblesenelmercadodeT4tienenalmenosrastroT3
contaminacinquedebeserconsiderado.EsimportantedestacarquerecordarquelafraccinlibredeT3(oT4)
aumentaamedidaqueelporcentajedesueroenlosmediosdecomunicacindisminuye.Porlotanto,la
concentracindehormonalibresemantienerelativamenteconstanteamedidaqueelporcentajedesuerodisminuye.
Comoenelcasodelosroedores,ladosificacinfarmacolgicadelaT3sehautilizadohistricamente,conaltas
concentracionesdiseadosparalograrlasaturacindelosreceptoresnuclearesrpidamente.Porejemplo,100 nM
totaldeT3en0,5%BSAdaraunestimadodeTlibre3concentracindealrededorde3.500 horasparala
comparacin,lalibreT3concentracindesuerohumanoeutiroideoestaramscercade38 pM(alrededorde1000
vecesmenor).NoseesperaqueinclusolospacientesseveramentetirotxicosparalogrartalesaltaTlibre3
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

39/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

concentraciones,sloalcanzandovaloresdeaproximadamente20 horas(283),otanaltocomo35 horas,enelcaso


deunaingestinaccidentaldeunadosismasivadeLT4(284).Algunosinvestigadoreshansugeridoqueladosis
farmacolgicapuedemejorarartificialmentefueradeobjetivoefectosnogenmicosyhipotticasdeT3Sistosno
sonunapreocupacin,ladosispuedesermaximizadaparaelefecto.Idealmente,T3sedebenutilizardosisqueestn
dentroocercadelrangofisiolgico.
28bRECOMENDACIN
Mientrasquelainduccindelatirotoxicosisencultivoscelulares,laposiblepresenciadedeiodinasasdebeser
consideradoparacadatipodeclulaqueseestudia.
Comentario Conocerlasactividadesdesyodasasdeunalneacelularparticular,puedeserimportante

experimentalmente.Amenosquelosefectosdeladesyodacinsondeparticularinters,tirotoxicosisdebeser
inducidamediantelaadicindeT3solamente,NotT4.EstoesporqueD1activaT4(laconversinat3
),detal

maneraquelasclulastratadasconT4tendrnTmediosvariablede3concentracionesdependiendodelnivelde
actividadD1yelvolumendemediosdecomunicacinyfrecuenciadecambiosdelosmediosdecomunicacin.Se
esperaqueesteefectoseamsintensaenlasclulasD2expresin,dadasumuchomayoreficienciacataltica.En
contraste,laactividadD3reduciralaconcentracindelosmediosdeT3(laconversinat2),aumentandoel
requisitodedosificacinparasostenertirotoxicosis.
[F.3]Elusodeanlogosdelahormonadelatiroides
Fondo LaexistenciadedosisoformasTR(esdecir,TRyTR)indicaquelasdiferentesvasdesealizacin(y

quizsconjuntosdeefectosbiolgicos)sonaguasabajodecadaunadeestasmolculas.Estosevereforzadoporla
observacindequeladistribucindeisoformasTResheterogneaentrelosdiferentestejidos/clulas(285,286).
Porejemplo,elhuesoesuntejidopredominantementeTRmientrasqueelhgadoesuntejidopredominantemente
TRAs,elfundamentoparaeldesarrollodemolculasqueexhibenespecificidadTRisoforma.
Dosadvertenciasdebenserconsideradosdurantelaseleccindelaconcentracinyladosisdeestasmolculas:
(I)Losdatosfarmacocinticos:TRselectividaddependedelaconcentracindeligandoylaabsorcin
selectivadetejido.Porejemplo,laeprotiromaparecetenerslounaselectividadmodestaparaTRinvitro,
sinembargo,susefectosprofundosparareducirloslpidosyelcolesterolresultadodedisponibilidad
selectivaenelhgado,posiblementedebidoalaabsorcinselectiva.Nohayinformacinsobrela
selectividadtransportadorparadiferentesligandososiestosligandosutilizanlosmismosodiferentesen
comparacinconlostransportadoresdeT3yT4.Elusodedosisrelativamentealtasoconcentracionesde
mediosdealtaminimizaoeliminalaselectividadTR.Hayestudiosfarmacocinticoscompletosactualmente
ningunaoslolimitadoparalamayoradeanlogos,porloqueesdifcildefinirlaconcentracinyladosis
enexperimentoscomparativosconT3uotrosanlogos.
(Ii)transportedelligandoenlaclulayclulancleo:losmecanismosqueconducenalacaptacincelulary
concentracinnucleardelosanlogosnohansidodefinidos.Porlotanto,inclusocuandoseutilizan
concentracionesequimolaresdelosmediosdecomunicacindosdetalesmolculasdesuconcentracinen
elncleo,alrededordelaTR,podraserdiferente.Estopodramejoraroeliminarcualquierventajabiolgica
deselectividadTR
expuestoinvitro.

RECOMENDACIN29
Sealizacindelahormonadetiroidespuedeseractivadoinvivoyinvitroporanlogosdelahormona
tiroidea,algunasdelascualestienenselectividaddetejidooselectividadparaisoformasTR(esdecir,TR1,
TR1,TR2).UnnmerodeTRaltamenteselectivoanlogosdelostejidosdianaqueexhibenpredominiode
TR(porejemplo,hgadoylaglndulapituitaria).Lautilizacindedosisequimolaresyconcentracionesde
diferentesanlogosyT3serecomiendacomopuntodepartidaenlosestudioscomparativos.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

40/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Comentario cido3,5Diiodothyropropionic(DITPA)esunanlogodelahormonatiroideadecidocarboxlicoque

seuneTRyTRconafinidadescasiidnticos(287).LosestudiosenratasyconejosindicanqueDITPAtiene
efectosinotrpicospositivos,perocronotrpicomnimoyefectosmetablicosfueradelsistemacardiovascular(287,
288).Suusocombinadoconcaptoprilmejoraelrendimientoventricularyreduccindelapresindiastlicafinalen
elmodelodepostinfartoderatadeinsuficienciacardiaca(289).Efectosadicionalesincluyenatenuacindela
respuestainflamatoriaagudaylareduccindeltamaodelinfartodemiocardio(290),ylamejoradelpotencialde
perfusinmximadelmiocardiohipertrofiadosobrevivirauninfartodemiocardio(291).Sinembargo,otros
estudiosinformaronefectossecundarios(292,293)onoobtuvieronresultadospositivosconDITPAenentornos
similares(294,295).
Tiratricolesunanlogodelahormonatiroideacidoacticoqueexhibealrededorde3,5vecesmayorinvitro
afinidadporTRy1,5vecesmayorafinidadporTRcomparacinconT3,conunaselectividadaproximadamente
tresvecesparaTR(296,297).Sinembargo,slohayselectividadTRmoderadaenestudiosdecultivocelular(
298).Enratas,tiratricolhademostradotenerefectosantidepresivos(299),efectostermognicosenlaBAT(300,
301),yciertogradodeespecificidadderganosdebidoasumejoradahgadoyefectosesquelticosylareduccin
deefectoscardacos(302).Elusodetiratricolenunaseriedeentornos,incluyendopacientesconhipersecrecin
TSHylospacientesathyrotic,reduccinTSHsrica(303305)ylosnivelesdecolesterolsricobajossinafectarel
ritmocardaco,perolosmarcadoresbioqumicoselevadosderecambioseo(306,307).
UnanuevageneracindeagonistasTRaltamenteselectivostienemuchamenosafinidadporTRconservando
afinidadporTR(308).LasmolculasenlafamiliaGC(esdecir,GC1yGC24)soncompuestosnoniodinated
quefuerondiseadossobrelabasedelosdatosexperimentalesobtenidosparalaestructuraTR(309).Elusode
estasmolculashasugeridolaposibleexistenciadeuna"ventanateraputica"atravsdelcualpredominantemente
TRmediadaporefectosbiolgicos(porejemplo,reducirelcolesterolsricoylaaceleracindelgastodeenerga)se
puedenactivarconrelativamentepocaactivacinvasTRdependientes(310316).Sinembargo,esinciertosila
especificidaddetejidoinvivosedebealaselectividadparalauninTRoconcentracineneltejidodeestas
molculasoambos.Porejemplo,elagonistaselectivoTRGC1seconcentrapreferentementeenelhgadoenlugar
decorazn,msculoesqueltico,oenelcerebro(310).LafamiliaKBdemolculas(esdecir,KB141yKB2115)
sehautilizadoconxitoenanimales(317320)yenpacienteshipercolesterolmicosmantenidoconestatinaspara
reducirelcolesterolsricoanmssinafectarelcoraznyloshuesos(321,322).Enestospacienteshubo
alteracionesslomnimosenpruebasdefuncintiroidea.Sinembargo,losestudiosclnicosconestasmolculas
fueronsuspendidasdebidoalcartlagoindeseablesefectossecundariosobservadosenlosperros(323).
LaestructurageneralKBseutilizposteriormentecomounandamioparadisearunafamiliadecompuestos
(hidrocarburos)indanoderivadosquepresentanactividadtiromimticopotenteyselectivo(324).KTA439,un
derivadodeindanorepresentante,muestralamismaaltaselectividadTRhumanoenunensayodeunincomo
KB2115ymayorselectividaddehgadoenunmodeloderataalimentadosconcolesterol(324).
Unaestrategiaalternativaparaobtenerselectividaddeltejidoesusarmolculasqueseconcentranentejidos
especficosenvirtuddesometersealaactivacinlocal,talescomolaactivacindelcitocromoP450deun
profrmacoqueesunagonistadeTRquecontienefosfonato.EstamolculapresentaunamayoractivacindeTRen
elhgadoconrelacinalostejidosextrahepticosyunndiceteraputicomejorado(319).MB07811sufredeprimer
pasodeextraccinhepticaylaescisin,generandoelagonistaMB07344TRquedistribuyemalenlamayorade
tejidosyseeliminarpidamenteenlabilis(319).MB07811reduceelcolesterolensueroenhipercolesterolmicos
ratas,conejos,monosysereshumanosmsalldeloqueselogrconestatinassolas(325),essuperioraun
agonistaTRselectivoenelmodeloderatnobesoinducidaporladieta(319),yreducelaesteatosishepticaen
ratasyratonesmodelos(326).
AnlogosselectivosparaTRTambinsehandesarrollado(327)yhademostradosereficazenlapromocindela
neurognesisTRdependienteenX.laevis(328).Sinembargo,TRselectividadseperdicuandoelmismo
compuestoseensayenratas,conlaactivacindelatiroidesCO23genessensiblesahormonasenelhgadoyel
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

41/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

corazn(329).
[G]DeficienciadeYodoytransferenciamaternofetaldelahormonatiroidea
Visindeconjunto Elyodoeselconstituyenteprincipaldelahormonatiroidea.Enpocaspalabras,laformamsactiva

delahormonatiroidea,T3,puedeservistocomotrestomosdeyodounidosaunandamiofenoxifenilo.El
posicionamientoespacialnicadelostomosdeyodoconfiereunaaltaafinidadporelTR,unregulador
transcripcionaldependientedeligando.Esnotablequelosvertebradosevolucionadoparatenerunelemento
ambientalescaso,yodo,juegaunpapeltanimportanteenlaembriognesis,elcrecimiento,elmetabolismo,la
cognicinylaadaptacinalosestadosdeenfermedad.Elmareslaprincipalfuentedeyodoytalvezelpapel
biolgicoimportantedesempeadoporelyodoreflejalaideadequelavidacomenzaexistiryevolucionadoenel
ocano.Nubesquecontienenyodoseformansobrelosocanosysopladashaciaelinterior,conlalluviadepositar
yodosobrelatierra.Dependiendodeltipodesuelo,elyodosemantienedurantealgntiempoorpidamentelava
losrosydevueltaalosocanos.Enconsecuencia,elcontenidodeyododelasplantas,cultivosyanimalesenuna
regingeogrficaespecficadependedelcontenidodeyodoenelsuelo.Alrededorde1,5millonesdepersonasviven
enreasgeogrficasdeinsuficienciadeyodo,loquerequierealgntipodesuplementosdeyodoparaprevenirlas
consecuenciasdelhipotiroidismoperinatal.
ElyoduroseabsorbeenelintestinodelgadoyvidamenteabsorbidaporlatiroidesatravsdeNISlocalizadaenla
membranabasallateraldetodostirocitos.Unavezdentrodelasclulas,yodurodifundehaciaellumenrelativamente
cargadospositivamentedelfolculotiroideo,quesaledelatirocitoatravsdecanalesPendrinsituadosenla
membranaapical.Adyacentealasmicrovellosidadesdelamembranaapical,elyoduroseoxidayconjugadocon
residuosdetirosinaespecficosenlamolculadetiroglobulina,unprocesocatalizadoporlaperoxidasatiroidea.
Posteriormente,lasmolculasdetiroglobulinayodadossonreabsorbidosatravsdepinocitosisysedigirieronenlos
lisosomas,laliberacindeT4,T3,ypequeascantidadesdetiroglobulina,ascomootrasmolculasyodadosenla
circulacin.
Ladeficienciadeyodopuedesuponerunagraveamenazaparalacapacidadtiroideaparasintetizarhormonas
tiroideas.Engeneralseaceptaqueladisponibilidadlimitadadeyodoactacomounapresinevolutivaquefavorece
eldesarrollodemecanismosdecompensacin,queminimizanelimpactodeladeficienciadeyodoenlaeconomade
latiroides.Descifrandoestosmecanismosescrticonosloparanuestracomprensindelafuncindelaglndula
tiroidesylaeconomadelahormonatiroidea,perotambinparaformularestrategiasquesepuedenutilizarparatratar
yprevenirlasconsecuenciasirreversiblesdehipotiroidismofetalyneonatalresultantedeladeficienciadeyodo.La
condicinmsgraveeselcretinismoneurolgicodebidoaladeficienciagravedeyodoyhipotiroxinemiadurantela
primeramitaddelembarazoqueresultaendaocerebralirreversible(330).As,losmodelosexperimentalesdela
deficienciadeyodohansidoampliamenteutilizadosparaanalizarlosmecanismosadaptativosdesarrolladosen
modelosanimalesyelimpactodelosdiferentesgradosdedeficienciadeyodoenlaeconomadelatiroides.
[G.1]Ladeficienciadeyodoenlosroedores
Fondo Lasprincipalesconsecuenciasdeladeficienciadeyodosonelbocio,hipotiroxinemia(242),elaumentodela

expresindeNIS(331),elaumentodemonoyodotirosina(MIT)/diyodotirosina(DIT)yT3/T4relacionesdentro
delatiroglobulina(332,333),Tpreferencial3sntesisysecrecinporlatiroides(242,332),elaumentodelas
actividadesdeD1yD2enlatiroidesylaactividadD2enBAT(334,335),bajaT4enelplasmaylostejidos(71,
336,337),yunaconcentracindeTSHqueesligeramentemselevada,juntoconunanormalodisminuy
ligeramenteT3nivelensueroyvariostejidos(71).LacaptacintisulardeT4yT3aumenta.Sloalgunosdelos
criteriosdevaloracindelaaccindelahormonatiroideasevenafectados,peroenmenorgradoqueenel
hipotiroidismomanifiesto(71,338).Ladietadepiensoalimentadoalosroedoresenlasinstalacionesdeanimales
acreditadoscontienesuficienteyodo(0,41 mg/g)parapermitirunaingestanormaldiariadeyodo(~510 g/d)yla
funcintiroidea.Dosestrategiassepuedenutilizar,deformaindependienteoencombinacin,parapromoverla
deficienciadeyodo:(i)laalimentacinconunadietabajaenyodo(<0,02 mg/g)quereducelaingestadeyodo(a
0,20,4 g/d)o(ii)eltratamientoconfrmacosqueinhibenlaabsorcindeyodoNISyastiroidea.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

42/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

30aRECOMENDACIN
Unestadodedeficienciadeyodosepuedelograrmediantelaalimentacindelosroedoresconunatapa(que
contiene<0,02 mgdeyodo/g).Gradosmslevesdeladeficienciadeyodosepuedelograrcondietasmenos
restrictivas.Efectossobrelaeconomadelatiroidessepuedenveryaalos10das,peroparalamayorade
losparmetrosdeefectosclarosrequierenporlomenos1mesdeLID.
30bRECOMENDACIN
Ladeficienciadeyodoenlosanimalespuedeserdocumentadamedianteelcontroldelaexcrecinurinariade
yodo,loquedeberaseraproximadamentede5a10vecesmenorenlosanimalesLID.
30cRECOMENDACIN
DeficienciadeyodointratiroideosepuedelograratravsdelainhibicindelaNIStraslaadministracinde
1%KClO4enelaguapotable.Tiendasdeyodotiroideaspuedenagotarseen1semanautilizandoeste
enfoque.Tratamientosmslargosconducirahipotiroidismosistmico,quedebesertenidoencuenta.Debido
KClO4esamargo,advertenciasseaplicanaestaestrategiacomosediscutianteriormente(vasela
Recomendacin19b).
31aRECOMENDACIN
Elimpactodeladeficienciadeyodoenlaglndulatiroidesenspuedenserevaluadosmediantelamedicin
detamaodelaglndula(almenosundobleaumentodebeservisto)ehistolgicamente,contapaquellevaa
gradosvariablesdehiperplasiaehipertrofia.Lacantidaddecoloideenlosfolculossereduce,ylasclulas
epitelialesquerecubrenlosespaciosfolicularesestrechadasconstandeclulascolumnaresenlugardeclulas
cbicasnormales.
31bRECOMENDACIN
Elimpactodeladeficienciadeyodoenlaeconomadelatiroidessepuedecontrolarmediantelamedicinde
suerodeT4,ylaT3/T4enrelacintiroglobulina.ElevacindeTSHnoesunhallazgotemprano.Del
mismomodo,elsueroT3seconservahastaladeficienciadeyodoesgrave.
Comentario LIDestdisponiblecomercialmentedediferentesproveedores,perocomprobarelcontenidodeyododela

dietaesmuyrecomendableyaquenoesraroencontrarmayorqueelcontenidodeyodoreportado.Detipo
Remingtondietahasidoutilizadoconxitodietassintticasquecontienencasenauotrasprotenasquesonuna
fuentedeyododebeserevitado.Enlasinstalacionesdeanimalesacreditados,roedoresbebenaguadestilada
desionizada,quenocontienecantidadessignificativasdeyodo.
Entodoslosentornos,losanimalesdecontrolsedebensuministrartambinLIDperobebenaguaquecontieneKIad
libitumparaproporcionaraproximadamente510 mgdeyodo/da.LacombinacindeLIDyKClO4resultadosen
ladeficienciagravedeyodo,unareduccinenelsueroT3,yelhipotiroidismomanifiesto.CuandoKClO4se
empleadebeserutilizadoenporcentajesbajos(0.005%)paraevitarlacontaminacinambientalindeseable(71,
339).
RECOMENDACIN32
Deficienciadeyodogestacionaloneonatalsepuedelograrmediantelaalimentacindepresasconlatapa.
Dadalacortaduracindelagestacinenlosroedores,laspresasdebensertratadospreviamentecontapa
paraqueselograhipotiroxinemiaantesdeliniciodelembarazo.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

43/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Comentario EstaestrategiaconduceaunaprofundahipotiroidismofetalporquelatransferenciamaternadeT4se

disminuyenotablemente,yT4eslanicafuentedeT3paraelcerebrofetal(340,341).Despusdelnacimiento,la
madreT4seconcentraenlalecheydadoaloscachorrosantesdeldestete,loqueresultaenlamejoradesu
hipotiroidismo(341).
Deficienciagravedeyodoantesydurantelagestacinenlosresultadosdeunmodeloderatadecretinismo
neurolgico(330)conalteracionescerebralessimilaresalosdescritosenlaspoblacionesafectadashumanos(342
344).TeniendoencuentaquesealimentandeLIDpuedepotencialmentedisminuirlafertilidad,particularmentesiel
estadodeladeficienciadeyodoeslosuficientementegravecomoparareducirelsueroT3,LIDsolapodrano
actuarconlasuficienterapidezparacrearunestadodedeficienciadeyodoenelfeto.Enestecaso,KClO4osu
combinacinconLIDpuedenserutilizadosconxitoparapromoverladeficienciadeyodofetal.
[G.2]Latransferenciaplacentariadelahormonatiroidea
Fondo Losplacentafuncionacomounainterfazentrelascirculacionesmaternayfetal,loquepermiteelintercambio

denutrientes,gasesymuchosotrostiposdemolculas.Lashormonastiroideasnoslosonmetabolizadosporclulas
delaplacentaatravsdeD2yD3,perotambinhayunflujonetodelashormonastiroideasdetransporteparael
feto,loqueaseguralapresenciadeT4yT3enlacirculacinfetalantesdelatiroidesfetalestcompletamente
desarrollado.Hormonastiroideastransportepuedeserestudiadoenlaratamediantelainhibicindelatiroidesfetal
conMMIdadoalamadre.Enestaconfiguracin,losdiferentesnivelestantodeT4yT3seencuentranentejidos
fetales.
RECOMENDACIN33
Latransferenciaplacentariadelashormonastiroideasdelamadrealfetopuedeserestudiadoenlaspresas
embarazadasMMItratadasysustituidashormonatiroideamediantelamedicindeT4yT3contenidosenlos
tejidosfetales.
Comentario Presasembarazadasreciben0,02%MMIenelaguapotable,apartirdelda14delagestacin.MMI

atraviesalaplacentaysehademostradoparainhibirlafuncintiroideafetalypromoverhipotiroidismofetalgrave
conTSHsricaelevadaynivelesbajosdehormonastiroideasenlasangreylostejidos.Lasmadressontratadoscon
lahormonatiroidea(T4,T3,oambos)y,encualquiermomentoduranteelembarazooinmediatamentedespusde
laentrega,losfetossedisecanysangre/tejidosobtenidosparalaextraccinyladeterminacindeT4yT3
contenidos(345,346).Administracindetrazador[125I]T4apresasembarazadasysudeteccinenlostejidos
fetalestambinsehautilizadoparaestudiarlatransferenciaplacentariadelahormonatiroidea(347).
[H]Modelosdeenfermedadnotiroidea
Visindeconjunto Economatiroidesestnotablementeafectadaporlaenfermedad,elayuno,uotrasimportantes

condicionesqueamenazanlavida.EstoseconocecomosndromedeNTI,elsndromedeleutiroideoenfermo,o
bajoT3sndrome(348).NTIpuedeservistocomopartedelarespuestadefaseagudaaenfermedadolesin,un
mecanismodedefensapredominantementemediadaporcitoquinas(349).Unnmerodemodelosanimalesy
celularessehandesarrolladoparaestudiarlapatognesisylasconsecuenciasfisiopatolgicasdeNTI,incluyendoel
ayuno,lesinoenfermedad,ylipopolisacrido(LPS)delaadministracin.
Engeneral,duranteNTIhayunasupresindenivelesmltiplesdelejeHPTyladisminucindelasecrecintiroidea
(350).Unacadaenlosnivelessricosdeleptinajuegaunpapelcentralenloscambiosinducidosporelayunoenla
economadelatiroidestravsdelasupresinmediadaTRHneuropptidoY(351),conlaadministracindeleptina
restaurarelestadoinducidoporelayunodehipotiroidismocentral(352).Tambinhaygrandesmodificacionesen
lasvasmetablicasdelahormonatiroidea,comoaceleradoinactivacinextratiroideadelahormonatiroideaatravs
desyodacin(353),laglucuronidacinysulfatacin(351)todavanoestclarosiextratiroideaT3produccinse
disminuir(354).Sinembargo,esbienaceptadoqueelhipotiroidismocentraleslaprincipalfuerzaimpulsoradelos
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

44/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

cambiosenlosnivelescirculantesdelahormonatiroideaylaeconomadelatiroidesrelacionadosconelayunooel
hambre.TambinesimportanteentenderqueloscambiosenlaeconomadelatiroidesduranteNTIpuedensermuy
diferentesenlaagudafrenteaunafasemscrnica(355).Ladefinicindeestosmecanismosylasconsecuencias
fisiopatolgicasdeestoscambiosesfundamentalparanuestracomprensindelaNTI,queafectaalamayoradelos
pacientesingresados
encualquierhospitalgeneral.

RECOMENDACIN34
ElayunoseutilizaampliamentecomounmodelodeNTIparaestudiarsuimpactoenlaproduccindela
hormonatiroidea,elmetabolismo,ylaaccin.
Comentario Elayunopromuevehipotiroidismocentral,lareduccindelosnivelessricosdelahormonatiroideasin

unacorrespondienteelevacindeTSHsrica.Losratonesylasrataspuedenestarenayunasporperodosdehoraso
das,dependiendodelasnormasyprotocolosestablecidosporelcomitdeanimalesinstitucionallocal.Porlo
general,lasratasadultasyanoestnenayunasde23dasylosratonesadultos1da.Enratas,elayunoseasocia
conunacadadeaproximadamenteel50%75%ensuerodeT4yT3quetienelugarenlasprimeras48horas(356
).Enratones,lacadaenelsueroT3esdeaproximadamente50%ysellevaacabopor36horasdeayuno(357).El
ayunotambinconduceaunareduccinenelhgadoD1yaumentodelasactividadesD3(358,359).Sin
embargo,lareduccinenelsueroT3observadaenlarataenayunasesprincipalmentesecundariaaunareduccin
enlasecrecintiroidea(360).
35aRECOMENDACIN
Insultoscorporalimportanteoenfermedadgraveenroedorestalescomocirugaextensa,quemaduras,dolor
inflamatorio,infeccinbacteriana,oinmovilizacinprolongadapuedenserutilizadoscomomodelosanimales
deNTI.
Comentario UngrannmerodemodelosanimalessehandesarrolladoparaestudiarNTI(361370).Esencialmente,

eltipoyelalcancedelalesincorporalquedesencadenaNTIenratas,ratones,conejosydeterminalamagnitudde
lasalteracionesenlaeconomadelatiroides.Estosmodelosanimalesdiferentespresentancaractersticasnicasen
cuantoalalneadetiempodelacadaenelsueroT4y/oT3concentraciones.
Sehandesarrolladodiferentesmodeloscelularesparaestudiarlasmodificacionesenlaexpresindeiodinaseyla
accindelahormonatiroideaduranteelNTI.Bsicamente,losdiferentestiposdeclulasqueexpresandesyodasas
estnexpuestosalascitoquinasproinflamatorias(porejemplo,lainterleucina1)yluegoevaluadosparala
expresindelosdiferentescomponentesdelahormonatiroideadesealizacintalescomoTR,TR,ylaactividad
deiodinasa(361).
35bRECOMENDACIN
LaadministracindeLPSbacterianosepuedeutilizarparapromoverelhipotiroidismocentral,similarala
observadaduranteNTI,conlareduccindeTRHhipotalmicayunacadaenlosnivelessricosdehormona
tiroidea.
Comentario LaadministracinintraperitonealdeLPSaratas(371373)oratones(173)sehautilizadoampliamente

parapromoverelhipotiroidismocentralyNTI(374).Apesardelacadaenlosnivelesdehormonastiroideasen
suero,tantolaexpresinTRHenelncleoparaventricularyTSHsricaseredujoenratastratadasconLPS,se
asemejaalsndromedelenfermoeutiroideo(371,373).EstoscambiosinducidaporLPSseasocianconuna
elevacinentanycytesquepuedeserclaveparalareduccinenlaexpresinTRHatravsdelainhibicinpor
retroalimentacin(373,374)esteefectosepierdeenlosratonesKOD2(173).LPSlotesvaraneneficienciase
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

45/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

recomiendautilizarunacepapreviamentedemostradosereficazporejemplo,O127:B8Escherichiacolicepainvivo
enratasyratones(372374.)Invitro,eltratamientoconLPSaumentalaactividadD2enelmesoteliomahumana
(MSTO211H)clulas(375)yenastrocitosderataencultivo(376).
[I]LaevaluacindelahormonatiroideaSealizacinentejidosynivelescelulares
Visindeconjunto TRsmediarrespuestasbiolgicasalahormonatiroideamedianteelcontroldelaexpresingnica(

377,378).TRsonreceptoresnuclearesyseunenelementosderespuestaespecficosdeADNenregiones
reguladorasgenmicas(elementospotenciadores)degenesdiana(379381).ElTRunidoalADNpuedemodificar
laactividaddeloscomplejosderemodelacindelacromatina,laARNpolimerasaII,ylamaquinariatranscripcional
basalparaactivarosuprimirlaexpresindeungendiana.Larespuestatranscripcionalessensiblealaconcentracin
deligando(T3)yaladuracindelaexposicinaT3.Estopuedeserestudiadoenanimalesoenmodeloscelulares
usualmentemedianteelcontrastedeexpresindeunT3genresponsiveentreelhipotiroidismoytirotoxicosis(ver
lasseccionesEyF).
LastresisoformasTRcannicasTR1,TR1yTR2enmamferosposeenpropiedadesdetransactivacinmuy
similaresenmuchos,peronotodosloselementosderespuestainvitro.Estasisoformasmedianambasfunciones
biolgicassuperpuestasydistintasenratonesinvivo(286,382,383)quereflejalospatronesespecficosdela
cluladeexpresin,lasdiferenciasenlosnivelesdeexpresinisoforma,ylasposibleslimitacionesestructurales
isoformaespecficaenelreconocimientoobjetivogenointeraccincofactor(Tabla3)(385389).
TABLA 3.
T 3 GENESDE RECEPTORESY GENERAL PATRONESDE EXPRESIN DE TEJIDO DEL
RECEPTORDE ISOFORMAS

ElanlisisdelaT3genesderespuestaestilparahacerfrenteadiferentestiposdepreguntasdeinvestigacin.T3
genesderespuestasonmarcadorestiles,opuntosfinalesdelatranscripcin,delestadodelashormonasdela
tiroidesdeuntejidoenmodelosanimalesoenlneasdecultivocelularinvitro.Losanlisispuedenserrelativamente
simple,conunenfoqueenunospocosgenesdianaconocidaquerepresentandemanerafiableelestadodelostejidos
enrespuestaaT3.AgranescalaExploratorio("todoelgenoma")pantallasdelaspoblacionesdeARNmsepueden
utilizarparabuscarnuevaT3responsegenes.Anivelmolecular,ungendianaespecficopuedeserinvestigadoen
profundidadparadilucidarlosmecanismossubyacentesdelatranscripcinT3accin,loqueimplicaelanlisisdel
elementodeADNqueseuneelTRyelanlisisfuncionaldeestoselementosusandoensayosdetranscripcin,porlo
generalenelcultivocelularheterlogasistemas.Enltimainstancia,larelevanciafisiolgicadeunelementodeeste
tiporequerirainvivobasadaenlaevidencia,porejemplo,enelanlisisdegenesreporterostransgnicosquellevael
promotory/opotenciadorelementosdelgendiana.
[I.1]Laexpresindegenescomounmarcadordelahormona
tiroidea
Fondo T3genesdianapuedeserpositivaonegativamenteregulado.Pantallasdeexploracindelneascelulareso

tejidosindicanque,enpromedio,aproximadamenteel50%delaT3responsivegenesIndicaraumentodelos
nivelesdeARNmylapantalla50%disminucindelosnivelesenrespuestaaT3(127,390394).Paralamayora
deestosgenes,quesiguesiendodesconocidoquerespondendirectamenteyqueindirectamenteaT3,yaqueen
muchostejidosrelativamentepocosgenessehandefinidocomoobjetivosdirectosporcriteriosrigurososque
incluyenlaidentificacindelossitiosfuncionalesdeunindeTRenelgen.LosnivelesdemRNAmedidostambin
representanelresultadonetodeotrasvariablestalescomolaetapadedesarrollodeltejidoylamezcladetiposde
clulasenlamuestra(395a397).Noobstante,inclusocuandosetienenencuentaestaslimitaciones,elnivelde
mRNAdelosgenesseleccionadosproporcionaunindicadortildelaestadodelarespuestadeltejido.Mtodos
independientestalescomoanlisisdetransferenciaWesternseutilizanparacorroborarlosdatosaniveldeprotenas,
yinsituanlisisdehibridacinpuedendefinirmsprecisamentelostiposdeclulasenlasqueseproducencambios
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

46/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

enlaexpresingnica.Cualquiermtodoutilizadoparaconfirmarlosdatosdeexpresingnicarequiereanlisis
controladosadecuadamente.Porejemplo,enelanlisisdetransferenciaWestern,laevidenciadelaespecificidadyla
sensibilidaddelanticuerpoutilizadoesesencial.Tambin,comocontrolcualitativoparalacantidadylaintegridadde
lamuestradeprotenacargada,labandaespecficadeprotenadetectadapuedesercomparadoconuncontrolinterno
(referencia)protenatalcomolaactinaolaARNpolimerasaII,siestasmismasprotenasnovaransustancialmente
enrespuestaaalteradoT3estestudiandooTRestadoeneltejido(82,398).Siesnecesario,labandaespecfica
protenadetectadatambinpuedesercuantificadaenrelacinalabandadeprotenadecontrolinterno.
RECOMENDACIN36
ParalaevaluacingeneraldelasituacindeltejidoenrespuestaaT3,elanlisisdelosgenesderespuesta
representativosconocidosproporcionadatosinformativos.
Comentario LossiguientessonejemplosdegenesT3genesderespuestaysirvencomomarcadorestilesdetejidoT3

estado:(i)elhgado:Me1,THRSP,DI1,GPD2,Cyp27ayFasn(390)(Ii)elcerebro:NRGN,MBP,Hr,y
Trh(ncleoparaventricularsolamente)(400,401)(Iii)delcorazn:MYH6,MYH7yAtp22(402)y(iv)BAT:
UCP1(403).DeterminacindelosnivelesdemRNAdelosgenesseleccionadossellevaacabopormtodos
directostalescomoelanlisisdetransferenciadeNorthern(Fig.12)oporanlisisindirectosbasados
enla

amplificacindeADNcmedianteRTqPCRsisetomanprecaucionesparadeterminarlaespecificidadylavalidez
cuantitativadelensayodePCR(404).Sinembargo,debetenerseencuentaque,aunqueestosgenespuedenser
tiles,losindicadoresrepresentativosdeT3estadodeuntejido,diferentesgenesenelmismotejidopuedereflejar
unaseriedemecanismosdirectosoindirectosderespuesta.OtrosfactoresqueinfluyenenlarespuestadeunARNm
dadoaT3enuntejidoespecfico.Porejemplo,Me1essensibleatiroideaestadoenelhgado,peronoenelcerebro.
Adems,Me1enelhgadosloestreguladaporlahormonatiroideatrasdapostnatal15(405).Tales
consideracionesespecficasytemporalesdetejidodebentenerseencuentaalahoradedisearexperimentosque
cuantificanARNm.
FIG.12.
DI1(tipo1deiodinasa)esunrepresentantedeT3genresponsiveenel
hgado.ElanlisisNorthernblotmostrandoDI1nivelesdemRNAen
respuestaaladietanormal(ND),hipotiroidismo(LID,dietabajaenyodoy
agentesantitiroideos),yelhipertiroidismo(0.5 T3...

[I.2]PCRanlisisdelosnivelesdeexpresindeARNm
Fondo PCRanlisisdelosnivelesdemRNAdeT3responsivegenessiguelosmtodosestndar.PCRes

extremadamentesensibleytieneelpotencialparagenerarsealesostensiblementepositivosdemuypocasmolculas
demRNA.Porlotanto,esimportanteparallevaracaboreaccionesdecontrolnegativoquecarecendemoldesde
ADNc.ParaladeteccinvlidadeARNmtranscritoapartirdegenesintrnmenos,latranscripcininversase
debe

tambinacaboenausenciadelaenzimatranscriptasainversa(controlmenosRT)paraexcluirfalsospositivos
ampliconesgeneradosapartirdeunaplantilladeADNgenmicocontaminante.Dadasestaslimitaciones,los
resultadosdebenserapoyadosdeformaindependienteconlosensayosmsdirectos,comoNorthernblot,Western
blot,oinsituanlisisdehibridacin.
RECOMENDACIN37
UnmtodoactualdeeleccinparaelestudiodelaexpresindeT3responsivegenesesRTqPCR,que
proporcionaunacuantificacinprecisadelosnivelesdeARNm,sisevalidaadecuadamente.Sedebetener
cuidadoparaasegurarquelosgenesdecontrolinterno(esdecir,genesdereferencia)nosonellosmismosT3
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

47/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

sensibleenelsistemaenestudio.
Comentario SedebetenercuidadoparaasegurarsedequelacalidaddelARNdeentradaeslaadecuada.PoorRNA

calidadpuedelimitarlaeficaciadelatranscriptasainversaylosrendimientosdeADNc(406).
Engeneral,lasnormasestndardediseodecebadoresseaplicanaRTqPCRexceptoquedebelimitarsea50200
tamaodeamplificacin pbconuntamaodeamplificacinpreferidoalrededorde100 pbparamaximizarla
eficiencia(407).Cuandoseaposible,primerparesdebeabarcarunionesexnexnencDNAparaevitarla
amplificacindeADNgenmicopotencialmentecontaminantes.Sitioswebdediseodecebadores(porejemplo,
Primer3,http://frodo.wi.mit.eduowww.ncbi.nlm.nih.gov/tools/primerblast)ybasesdedatosdeconjuntosdeprimer
validados(porejemplo,http://pga.mgh.harvard.edu/PrimerBank)sondelibreacceso.
DosmtodosdedeteccincomunesenRTqPCRutilizanelADNSYBRGreenensayosdetinteo5'nucleasa(es
decir,lasondaTaqMan)(unindelaFig.13).Enelestadonounido,lafluorescenciaSYBResinsignificante,pero
traslauninaADNdedoblehebraaumentasufluorescencia.Elensayode5'nucleasase
aprovechadelaactividad

intrnsecade5'exonucleasademuchosTaqpolimerasasparadegradarunasondadeoligonucletidoligadoala
transferenciadeenergaderesonanciadefluorescenciadiseadosparahibridarsedentrodelamplicn.Lasondade
escisinseparaelfluorforo3'extintordesdeelfluorforo5'reportero.AtiemporealPCRmquinamidela
acumulacindeproductofluorescentereporteroliberado.Elensayode5'nucleasaofreceposiblementemayor
especificidadsobreladeteccindeverdeSYBR,yaqueevitalascomplicacionespotencialesconlaformacinde
dmerodecebadores(408).Paravalidarelensayotambinesnecesarioparaconfirmareltamaodelabandade
PCRy/olapresenciadeunsolopicoenlacurvadedisociacin(Fig.13C).
FIG.13.
UnejemplodelusodeRTqPCRparaanalizarunaT3genresponsive.Las
grficasdeamplificacinqPCRindicanelcambioenelniveldeARNmpara
laT3responsivegenOPN1LW/MW(rojo/verdeopsina)enlalnea
celularderetinoblastomaWERIhumanodespusdeltratamientoconel
aumento...
LacuantificacindeARNmporRTqPCRporlogeneralrequierelanormalizacinaungendereferenciadecontrol
interno.Sedebetenercuidadoenlaseleccindegenesdereferenciaparalainvestigacindelatiroidesdebidoaque
variosinformeshanindicadoquelosgenesdereferenciacomnmenteutilizados(porejemplo,Actb,Gapdh)son
algosensiblesalahormonadelatiroidesenalgunostejidosespecficos(409412).LosgenesRn18SyPpia
(cyclophillinA)parecenadecuadosparavariostejidos,incluyendoelcerebro,lahipfisisyelhgado(351,413).
LaabundanciadeunARNmdianasecalculaporcualquieradecuantificacinrelativaoabsoluta(406,414).En
cuantificacinrelativa,elumbralcrticoPCR(Ct)deunamuestradeARNdeensayo(porejemplo,setratconT3)
secomparaconunamuestradereferencia(esdecir,elcontroldelvehculo).Dosmtodosdecuantificacinrelativa
sonampliamenteutilizados:Ctmtodoyelmtododelacurvaestndarrelativa.
ElCtmtododenormalizacinhaceusodeungendereferencia,talcomounmantenimientodelacasa(Actb,
Gapdh)uotrasformasadecuadasdegendereferencia,queseexpresademanerasimilarentodaslasmuestrascon
unavariacinmnima.ElCtsecalculacomosigue:

http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

48/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

dondeCteselnmerodecicloPCRenelqueelreporterodefluorescenciaesmayorquelasealdefondo(414).
Enelmtododelacurvaestndarrelativa,ADNcapartirdeunamuestraindependienteseutilizaparacrearuna
curvaestndarrelativautilizandolamasaconocidadeARNdeentradacontraelcualmuestrasdesconocidas,tales
comomuestrasdereferenciaydeprueba,puedensercuantificados.ParacontrolarlavariacinpotencialenARNde
entradaRT,lasmasascalculadospuedensernormalizadosporlamasacalculadadeuncontrolendgeno(408).
Enlacuantificacinabsoluta,elCtparaelARNmdeungendadosemontaenelCtpartirdeunacurvaestndar
generadautilizandodilucionesseriadasdelasmuestrasquecontienencantidadesconocidasdelgendiana(esdecir,
ADNdeplsmidooinvitroARNtranscrito)(406).
LaabundanciadeunARNmtambinpuedeserdeterminadaporelllamadosemicuantitativa,odepuntofinalRT
PCR,enelqueampliconessevisualizaronporelectroforesisengeldeagarosadespusdeunnmeropredefinido,
arbitrariodeciclosdePCR(404).AunquearbitrariapuntofinalRTPCRpuededetectarcambiosobviosenla
expresingnica,quesufredebajaprecisin,yamenudoimplicalavisualizacindelosproductosdePCRenlafase
demesetadelareaccin,cuandolosdatosnoreflejanconexactitudlacantidaddemRNAdepartidainicialel
material(407).
[I.3]elanlisisdetodoelgenomadelatiroidesARNmsensiblea
hormonas
Fondo Microarraysoanlisisdetodoelgenomadeotrosmtodos,comolasecuenciacindeprximageneracinde

poblacionesdeARNexpresadas(esdecir,secuenciasdeARN[RNAseq]),generangrandesconjuntosdedatosque
exigenmayorinvestigacincomputacionalparaextraerdatossignificativosdegenesrelevantes.Tpicamente,miles
desecuenciasdeARNmmuestranalgngradodecambioenlosniveles.SerequiereSeguimientoanlisisporotros
mtodosparadeterminarsilosgenescandidatossonblancosdirectosdeT3accin.
38aRECOMENDACIN
MicroarrayuotrosmtodosdecribadodetodoelgenomadelospatronesdeexpresindeARNmsepueden
utilizarparaelanlisisagranescaladeloscambiosdeexpresingnicaenrespuestaalasmanipulacionesde
lasvasdesealizacindelahormonatiroidea.Transcripcionescandidatosdeintersdebernser
corroboradospormtodosindependientes,comoRTqPCR,Westernblot,oenelanlisisdehibridacinin
situ.
Comentario MuchosestudiossehanpublicadoconelanlisisdemicroarraysdeuntejidooclulalneadespusdeT3

tratamientodeunorganismointactooclulascultivadas.Lastcnicasespecficasparaelanlisisdeexpresindetodo
elgenomaestnevolucionandorpidamente,yexistenvariossistemasdemicroarraysymineradedatosdepaquetes
desoftwareysepuedeutilizarsilodeseas.Lamayoradelasplataformasdesoftwaredeanlisispostarraypermiten
lamanipulacindelosparmetrosdeexigenciaqueestablecenunumbralparalosgenescambiadodemanera
significativa,comoelplieguedecambio,tasadefalsodescubrimiento(paracorregirparacomparacionesmltiples),y
pvalor.Engeneral,almenostresrplicasbiolgicasporgrupodetratamiento(porejemplo,T3exposicin)ygrupo
control(porejemplo,vehculos)sonnecesariosparalasdiferencias"estadsticamentesignificativos"paraser
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

49/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

detectadosisetomalasignificacinestadsticaenelsentidodeunpvalor<0,05,latasadefalsodescubrimientode
<0,05,ydoblecambio>2(417).Dadalaaltaprobabilidaddequelasdiferenciasdefalsospositivos,losresultados
delosestudiosdemicroarraysmejordebenservistoscomo"losdatosparagenerarhiptesis"enlanaturaleza,ylos
cambiosenlastranscripcionesclavesdebenserconfirmadosporPCRyotrosmtodos.
38bRECOMENDACIN
RNAsequtilizalatecnologadesecuenciacindeprofundidadypuedeproporcionarunamedicinmsprecisa
demRNAylosnivelesdemRNAdelaisoformavarianteencomparacinconmicroarrayscomolosdatos
derivadosdeRNAseqnoestsesgadaporanlisisutilizandogenesysondaspredeterminados.
Comentario RNAseqrequieremayoranlisisbioinformticodelasecuencialee(418).Lainclusindetiposde

clulasextraasenunamuestradetejidodebeserminimizada,comovariacionescualitativasentremuestras
aumentarn"ruido"experimentalyreducirlaresolucindeanlisis.Muestreodetejidopuedeserrefinadoutilizando
microdiseccinporlserparaaislarpiezasdefinidasdetejidodeseccioneshistolgicasofluorescenciadeclulas
activadasporlaclasificacinparaaislarpoblacionesdeclulasenriquecidasbasadoenmarcadoresdeclulas
especficas(419,420).LoscambiosobservadosenlospatronesdeexpresindeARNmpodranrepresentar
alteracinindirectaenpoblacionesdeclulasmixtasenlostejidos(421,422).Unalneacelularencultivo,aunque
nounamuestrafisiolgica,puedeproporcionarunapoblacindeclulasmshomogneaparaciertosanlisis.
[I.4]Mecanismosderegulacindegenesdelahormonatiroidea
Fondo ElTRseuneaelementosdeADNconocidascomoT3elementosderespuesta(T3alquileres)(423).En

general,TRseunelaT3REcomounhomodmerooheterodmeroconlosreceptoresderetinoidesX(RXRs).Estos
complejosdereceptoresatraencorepresoresocoactivadoresdependiendodesielTRseencuentraenunaT3
boundestadoonounido(424426).LosanlisisdelasinteraccionesdeADNTRamenudoutilizandosenfoques
generales:(i)larespuestadelatranscripcin("transactivacin")ensayos,tpicamenteenlasclulastransfectadasen
cultivo,y(ii)ensayosparainvestigarTRuninaADNenloselementosderespuestadeADNaislado(movilidad
electroforticacambiodeensayo[EMSA])oenelADNgenmicoenunestadodelacromatina(cromatina
inmunoprecipitacin[CHIP]).
RECOMENDACIN39
LaregulacindeungendianaporTRpuedeinvestigarseenclulasdecultivodetejidoscotransfectadascon
unplsmidodegeninformador,msunplsmidoqueexpresaTR.Latransactivacindelreporteroseevala
enrespuestaaTaadido3adosisvariablesenunrangofisiolgicoysepuedeprobarendiferenteslneasde
clulasyaquelasrespuestaspuedenestarinfluidosporfactoresespecficosdelaclulahusped.
Comentario ElcandidatoT3REopotenciadordelaregindelgendianaconsupromotornaturalounpromotor

artificialseligaungenindicadorfcilmentedetectable,porlogenerallaluciferasadelucirnaga.Laactividadde
luciferasageneraluz,quesedetectausandounluminmetro(427).Promotordemenosylosreporterosdeluciferasa
potenciadormenosseutilizancomocontrolesparaexcluirlaposibilidadderespuestasespuriasprocedentesde
"secuenciasdesigilo"fortuitamentepresentesenelgendelaluciferasaoesqueletodelvector(428).
Laeficaciadetransfeccinseevalumediantecotransfeccindeunplsmidoreporterodecontrolinternoporlo
generalconRenillaluciferasadirigidoporunpromotorconstitutivamenteactivo.Lalecturaespecficadeunensayo
deindicadorsenormalizacomolaactividaddelaluciferasadelucirnaga(gendeprueba)sobrelaactividadde
luciferasadeRenilla(gendecontrolinterno).Esimperativoestablecerquelosreporterosdecontrolinternono
respondenalascondicionesexperimentalesyaqueestopuededistorsionarindebidamentelarelacindelectura(429
).
Sedebeconsiderarquesielvectorreporteroeslacromatinadeformacinonodelacromatinadeformacin.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

50/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Plsmidosestndaro"ADNdesnudo"comoreporteropGL4menudocedendatostilesenlasclulastransfectadas
transitoriamente.Alternativamente,losvectoresquellevanunorigendereplicacinepisomal,talescomopREP4,
puedenformarlacromatinaenlasclulastransfectadastransitoriamente.AlgunoselementosderespuestadeDNA
requierenunvectordeformacindelacromatinaparamostrarlaactividad(430).
Laubicacindelpromotordeungendianadeintersdadadebeserverificada.Notodoslosgenesrepresentadosen
lasbasesdedatosdelgenomarepresentanuna'estructuradelosgenes,loquerequierelacartografaexperimentalde
5'5precisadelosARNmdediferentestejidos.Losexonesmsaguasarribadeungen(traducidoonotraducida)
puedenseridentificadosporensayosdeproteccindeARNasao5'amplificacinrpidadeextremosdeADNcde
anlisis(431,432).Lafuncindeunpromotordepresuncindebedemostrarseusandoensayosdeluciferasaen
clulastransfectadasotransgenesreporteroenunmodeloanimal.Lapreconcepcindebeevitarsequelos
potenciadorespertinentesresidensloaguasarribadelpromotordeungendiana.Muchospotenciadoresresiden
dentrodeintronesoaguasabajodelgen(433).
40aRECOMENDACIN
EMSApuededemostrarlaunindirectadelaTRaunelementodeADNproporcionandoasevidenciadeque
ungenesunblancodirectodeTR.EMSAsebasaenlaobservacindequeelADNunidoaprotenamigraa
unritmomslentoqueelADNnounidocuandosesometeaelectroforesis.ElelementodeADN(lasonda)es
generalmentemarcadoradiactivamenteparapermitirladeteccinsensibledeprotenas:loscomplejosde
sondasdeADN.
Comentario SitiosdeunindeTRestntpicamenterelacionadosconelmotivodeconsensoparaunsitiodeuninal

receptornuclear,5'AGGTCA3'y,amenudoseproducenenlasconfiguracionesderepeticindimrica(423,434
).SondasptimasEMSAsonoligonucletidosdedoblecadenacorta(~2030 pb).Sondasmslargas(osondas
degradados)puedenaumentarlauninnoespecfica,queaparece,sealesuntadascomoindistintosdespusde
EMSA.Sondasmarcadosenelextremoradiactivamenteofrecenunagransensibilidadypermitenladeteccindelos
complejosdeprotenasdeADNutilizandounapelculaderayosXophosphorimaging.Alternativamente,lassondas
puedenmarcarsenonradioactively(porejemplo,conbiotina),seguidoporladeteccinsecundariaconestreptavidina
ysustratosenzimticossimilaresalosutilizadosparaelWesternBlot(435).
ExtractosdeclulasnuclearesoenterosdetejidooclulalneadeintersproporcionanunafuentedeprotenadeTR.
Loslisados
declulascultivadastransfectadasconunplsmidoqueexpresaTRsonotrafuentecomndeprotena

TR(381).Alternativamente,laprotenadeTRsepuedegenerarusandounlibredeclulasinvitroenelsistemade
traduccin(436,437).
LaespecificidaddelainteraccinsondadeADNTRseconfirmapordospruebasdecontrolestndar:(i)elusode
unanticuerpoantiTRquesupershiftsointerrumpelabandaretardada(uncontrolnegativoparalelousandoun
anticuerponoespecficanodebeperturbarelTRespecficaADNcomplejosonda),y(ii)laespecificidaddelaTR
uninalasondadeADNmarcadadebenserconfirmadosporlacompetenciaenlapresenciadeunexcesodesonda
deoligonucletidonomarcado"fro".Haydostiposdesondadeoligonucletidocompetidorseutilizanenlas
muestrasparalelas:lasondadetiposalvajeylasondaquecontienemutacionespuntualesdentrodelsitiodeuninde
TRpropuesto.Seesperaunareduccindosisdependienteenlaintensidaddelasealdebandadesplazadoalutilizar
lasondadetiposalvajefroperonosondamutante(436).Tpicamente,seaadecadacompetidorfroendosotres
dosis,loquerepresentaunagamadeaproximadamentede2a100veceselexcesosobrelasondamarcada.
40bRECOMENDACIN
ChIPsepuedeutilizarparaindicarquelosasociadosTRconungendianaensucontextonaturalenel
genomaenuntejidoolneacelular.ElrequisitomsimportanteparaCHIPesunanticuerpoespecficodealta
calidadparalainmunoprecipitacin,conlaespecificidadquesedeterminarmedianteexperimentosde
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

51/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

control.
Comentario Chipseutilizaparaprobarlaunindefactoresdetranscripcindegenesdianaconocidosoparala

exploracindesitiosdeuninpreviamenteindefinidos.UnresultadopositivoindicaChIPunaasociacinconuna
regindeADNdelacromatinaperonodiferenciaentrelaunindirectaalADNeindirectadeuninauncomplejo
deotrosfactoresqueseunenalADN.
Actualmente,haypocaevidenciadequelosanticuerposdisponiblescontraTRgeneranresultadosdechip
consistentementereproduciblesparalostejidosdemamferos,aunquealgunosdatosdechipshansidoreportados
paralaslneascelularesytejidosdeanfibios(438442).Lasdificultadesenlageneracindedatoschipentejidos
naturalespuedenserunaconsecuenciadelaconcentracinrelativamentebajadeTRenlostejidosdemamferosen
comparacinconotrostiposdefactoresdetranscripcinmsabundantementeexpresado.
Lascondicionesptimasparalareticulacinylacromatinasonicandodebenestablecerseempricamentepara
cualquiertejidoocluladelalnea(443).UncontrolnegativoparaelchiputilizapurificadanoespecficaIgG,
sueropreinmune,oanticuerposcontraprotenasextraasquenoestnpresenteseneltejido.FragmentosdeADN
genmicoaisladodechipseidentificanporPCRutilizandounaseriedeconjuntosdecebadoresqueabarcanla
regingenmicadeinters,ascomolasregionesnegativasdeelgenoregionesgenmicasdistantes(444).Todos
loscontrolesnegativospuedengenerarunasealdefondoydebeserprobadoempricamente.
40cRECOMENDACIN
Lasaplicacionesmsavanzadasdechip,exigiendotcnicarigurosayanlisiscomputacional,implicanla
combinacindechipconmicroarrays(chipchip)osecuenciacindeprximageneracinparaidentificarsitios
deunindetodoelgenomaparaunfactornuclear.
[I.5]LosmodelosderatnparaindicarlahormonatiroideayTR
sealizacinenlostejidos
Fondo NumerosascepasKOyratonesknockinobtenidospormanipulacingenticahanproducidounagrancantidad

deinformacinsobrelasfuncionesfisiolgicasdeisoformasTRinvivo.Lamanipulacingenticatambinseha
utilizadoparagenerarmodelosqueproducenideassobredndeycundoT3oprotenasespecficasTRestn
presentesenlostejidosinvivo.Haymargenparaunmayordesarrollodeestetipodeenfoques,paradilucidaranivel
celular,labasedelaT3accionesenvivo.
DebetenerseencuentaquelafaltadereceptorenratonesKOpuedeproducirciertasdiferenciasenelfenotipoen
comparacinconlafaltadelahormona.Porejemplo,losratonesquecarecendetodoslosT3receptores(TR1,
TR1,TR2)muestranmltiplesfenotiposdetejido,peronosontanpequeootanretrasados
comoratonescon

hipotiroidismosevero,congnita(75).Puedehabervariasexplicacionesparaestasdiferencias.Unaexplicacinque
hasidoapoyadaporelestudiodelcerebeloinvivo,esqueenelhipotiroidismo,laTRejercecrnicadesregulacin
independientedeligandodelaexpresingnicaparaproducirunresultadomsgravequelaausenciadeunTR.En
ausenciadeTR,estadesregulacinindependientedeligandodelaexpresingnicanopodraocurrirdetalmanera
queelfenotipoesmenosgrave(445).Sinembargo,pocostejidosypocosgenesdianahansidoestudiadosen
detalleparaindicarcmosepuedeaplicarampliamenteestaexplicacin.Enresumen,lasupresindelasisoformas
TRproporcionainformacinprecisasobrelasfuncionesespecficasdetejidodeisoformasTR.Sinembargo,los
fenotiposnosiempresereflejanenlosmodelosdehipotiroidismo.Porelcontrario,losfenotiposconhipotiroidismo
nosereflejenplenamenteenlosmodelosTRdeficiente.
41aRECOMENDACIN
RatnconcepasKOobjetivoomutacionesknockinenlasendgenasthrAythrBgenesproporcionarmodelos
paraestudiarlasfuncionesdeTRenvivo.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

52/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Comentario NumerosasmutacionesenlosthrAythrBgenes(tambinconocidoscomoNr1a1yNr1a2,

respectivamente)sehanderivado,peroslosedaunabrevemencindefenotiposaqu.Paracomentariosms
detalladossobrethrAythrBmutaciones,loslectorespuedenconsultarenotrolugar(286,382,383)ylapgina
webdelGenomaInformticaMouse(www.informatics.jax.org).OtrorecursotileslalneaNuclearReceptor
SignalingAtlas(www.nursa.org).
ElgeninicialdirigidoestudiosestableciqueThrbeselprincipalresponsabledelaregulacindelejeHPT(446,
447),eldesarrollodelossistemasvisualesyauditivosdecolor(448,449),ylamayoradeT3accionesenel
hgado(390,393,450).ElThragenesprincipalmenteresponsabledeladeterminacindefuncionestermognicos
ycardiacas(386,451)ylamaduracindelintestino(452),hueso(453),yciertostejidoscerebrales(445,454).
EncontrasteconlosmodelosKO,knockinmutacionesenlasecuenciadecodificacindelosThraothrBgeneshan
generadomodelosderatnqueexpresanTR1dominantenegativoylasprotenasTRconpocaoninguna
respuestaaT3(456).Estasmutacionescreanmodelosdelocalizadahipotiroidismo"restringidodetejidos"
selectivosparatejidosenlosqueTR1oTReslapredominanteT3isoformadelreceptorexpres.
41bRECOMENDACIN
LosratonesdesprovistosdeconocidosT3receptores(TR1,TR1,yTR2)puedeserutilizadoparamodelar
laausenciacompletadelasealizacinmediadaporTR.
Comentario LosratonesquecarecenespecficamenteTR1,TR1yTRsonviablesperotienendefectoscelularesy

funcionalesenmltiplessistemasderganos,loqueindicaqueenmuchostejidos,TR1yTRisoformassirven,
funcionescomunesadicionalesquenoeranevidentesenlosmodelosconmutacionesdelgenreceptorindividual(75
,457).
41cRECOMENDACIN
CodificacincambiosdesecuenciaintroducidosenambosthrBythrAgeneshanproporcionadomodelosde
ratnparalossndromeshumanosderesistenciaalahormonatiroidea.
Comentario Elsndromehumanodelaresistenciaalahormonatiroideaesgeneralmentecausadapormutaciones

heterocigotasdecodificacinenelTHRBgenquegeneranprotenasdominantesnegativasconpocaoninguna
respuestaaT3(458).Recientemente,lasmutacionessimilaresenelserhumanoTHRAgeneshansidoidentificados
quegeneranprotenasTR1negativasdominantes(459,460).LosthrByThramodelosderatnknockinexhiben
unagamadefenotiposselectivadetejidosyofrecenlaoportunidaddeinvestigarlosdefectoscelularesymoleculares
quesubyacenalossntomasdelaenfermedadentejidosespecficos(456,461465).
41dRECOMENDACIN
ReporteroratonestransgnicosqueexpresanunaT3responsiveprotenaquimricaproporcionanunainvivo
modeloquepermitelamonitorizacindelapresenciadeT3endiversostejidos.
Comentario TradicionalmentehasidodifcildedetectarT3anivelcelularenlostejidosnaturales,especialmenteen

poblacionesdeclulasespecializadas.RIArealizadosenhomogeneizadosdetejidosnoproporcionaninformacin
sobrequtiposdeclulascontienenT3.LatransgnicoFINDT3modeloderatnofrecelaventajadeladeteccin
deT3enregioneslocalizadasdentrodelostejidoscomplejos(278,467).Estosratonesexpresanunaprotena
quimricaqueconsisteenunalevaduraGal4ADNdedominiofusionadoaundominiodeuninaligandodeunin
TR1.LaexpresindelreporteronorequiereTRendgeno.LapresenciadeT3sedetectavisualmenteensecciones
detejidoenbasealaactivacinporlaprotenaquimricadeunpromotorfusionadoaunGal4sensibleLacZgen
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

53/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

reportero(Fig.14).
FIG.14.
T3desealizacinrepresentadoporlatincindegalactosidasa(azul)enlas
seccionescerebralescoronalesendapostnatal5ratonesquellevanelFINDT
3transgnreportero.(A,D)FINDT3reporteroendetiposalvaje(/FINDT3
ratonesWT)(B,E)FINDT3reporteroenratonesquecarecen...
EsteenfoquepuedeserutilizadoparadetectarT3actividadenvariostejidos,perolosinformes,halimitadola
sensibilidadenciertasregionesdelcerebro(278).Elusodebetagalcomolalecturaenratonestransgnicos,T3de
sealizacinestabaausenteenelembrintempranoyluegosedetectaalrededordeE11.5E12.5endiferente
primordios(esdecir,CNS,intestino,etc.).Dadoqueenestetiempo,lafuncintiroideafetalenelratnsiguesiendo
inactivo,yestassealestempranaspuedereflejarmaternaT4oT3actividad.TTemprana3desealizacinse
observenelcerebro(esdecir,losprimordiosdienceflica,bulboraqudeo)yrganosdelossentidos(primordios
vescicletica,epitelioolfativo,laretina),mientrasqueenlasetapastardas(E15.5E17.5)expresindebetagalfue
localizadaenotraprimordios(esdecir,enloshuesos,nerviosfolicularesdelasvibrisas,ascomoenelpequeo
primordiosdelgado,sinotambinenelbulboraqudeo)(468).
41eRECOMENDACIN
InsercionesespecficasenlasendgenasThraythrBgenesgeneranprotenasTRfusionadosaetiquetasde
protenasquesepuedenutilizarparacontrolarlaexpresindeisoformasTRenpoblacionesespecficasde
clulasinvivo.
Comentario LaetiquetafundidopermiteladeteccindeTRisoformaexpresinporinmunohistoqumica(IHC)o

inmunofluorescenciaenseccionesdetejidoodemontajeenenterospreparadosyofrecelaposibilidaddedeteccin
enlaresolucindeunasolaclula.THRA1GFPratonesllevanlaprotenaverdefluorescente(GFP)fusionadaen
marcoaelCterminaldelaprotenaintactaTR1(469).LadeteccindelaprotenaTR1GFPhasidoreportada
enlostejidoscerebralesespecficasytiposdeclulas.LacZinsertaenelThrbgenpermiteladeteccindeisoformas
TR(430,449,457)yhapuestodemanifiestolaexpresinTR2enpoblacionescelularesrestringidasenla
cclea,laglndulapituitariayconos.
[J]EvaluacindelahormonatiroideadeSealizacinporCaminodelosparmetrosbiolgicossistmicos
Visindeconjunto Lashormonastiroideasejercendiversasaccionesenprcticamentetodoslostejidosduranteel

desarrollo,lainfancia,laadolescenciaylaedadadultaenreastalescomoelcrecimiento,lacognicin,la
homeostasisesquelticomuscular,lafuncincardiocirculatorio,lahomeostasisdelaenergayelmetabolismo
intermediario.Esesencialadoptarunenfoqueanimalcompletamentefisiolgicoparalainvestigacindelaaccinde
lahormonatiroideaenvivo.Pornecesidad,estorequiereestudioslongitudinalesdeT3responsiveparmetros
biolgicosy/omarcadoresbioqumicos.
Losestudiossecentrangeneralmenteenlatransicindehipotiroidismoaeutiroidismoytirotoxicosis.Dosestrategias
complementariaspuedenseradoptados:(i)recopilarmedicionesbiolgicassecuencialesdelosmismosanimalesenel
momentobasalylosintervalosduranteelperododeestudio,o(ii)controldeejecucinylosgruposexperimentales
enmedicionesbiolgicasparalelasyrecogerenlospuntosdetiempoespecficosEstemodelotienelaventajadeque
losanimalespuedensermatadosendiferentespuntostemporalesylostejidosrecogidosparalosanlisisestructurales
obioqumicos.
Engeneralsellevanacaboestosestudiosenlascepasderatasoratonescomunes.Modelosanimalesmsavanzados
incluyenmodificadosgenticamenteratonesenlosquelasealizacindelahormonatiroideasehainterrumpidoo
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

54/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

modificadosporcualquieradelosgenesglobaloespecficadetejidodiana.Contalesmodelosderatnquees
importanteparaasegurarexperimentosestndiseadosparaevitarlainfluenciadeconfusindemezclade
antecedentesgenticossiesposible.Idealmente,lascepasmutantesdebenbackcrossedhastahomogeneidadsobreun
fondoadecuado,talcomoC57BL/6.Siestonoesrealista(porejemplo,siCREcruceylneasfloxeddediferentes
orgenesgenticos),compaerosdecamadadebencompararseyclculosdepotenciaadecuadosrealizan.Hombresy
mujerespuedennecesitarserestudiadoporseparado,porquelasrespuestasalashormonastiroideaspuedenser
dimorfismosexual.
T3parmetrosbiolgicosdependientestambinpuedenserestudiadosutilizandoexvivo,talescomopreparaciones
declulasrecinaisladas,cultivosdeclulasprimariasolneascelularesestablecidas.Engeneral,talesinvitro
sistemastienenpobrecapacidadderespuestaaT3,conslounospocosestnbiencaracterizados.Sinembargo,los
modelosbasados
enclulashansidoinvaluablesenladeconstruccinylacomprensindelosmecanismos

molecularesquesubyacenaloscomplejosefectosbiolgicosdelaT3.
[J.1]Sistemanerviosocentral
Fondo Seobservanmayoradelosefectosdelahormonatiroideaenelcerebroduranteeldesarrollo.Endmicas

resultadoscretinismoneurolgicodeladeficienciadeyododelamadreylahipotiroxinemiamaternaconsiguiente,en
elquecirculaT4nivelessonbajosparalaetapadelembarazo.Hipotiroxinemiamaternacausaladeficienciadela
hormonatiroideaneurolgicodelfetoendesarrollopuederesultarenretardomental,diplejaespstica,sordomudez,
yentrecerrarlosojosantelaausenciadesignosgeneralesdehipotiroidismo.Apesardequeelcretinismoendmico
puedesermitigadoporlasuplementacindeyodoparaprevenirohipotiroxinemiamaternaprimertrimestrecorrecta,
ladeficienciadeyodosiguesiendolacausamscomnderetrasomentalprevenible.Porotrolado,lascaractersticas
neurolgicasdehipotiroidismoneonatalpuedensermenosprofunda,yaquedependendelagravedadde
hipotiroidismo.Lasanomalassonengranmedidapreveniblesmediantelasustitucininmediatadelahormona
tiroidea,aunquedficitsenlamemoriayelcoeficienteintelectualpuedenpersistir.Sinembargo,losrecinnacidos
notratadostienenretrasoenelcrecimientoylascaractersticasgeneralesdelhipotiroidismoconretrasomental,
temblor,espasticidad,yhablaydefectosdelenguaje.Lasdiferenciasentreelcretinismoendmicoyelhipotiroidismo
congnitoilustranqueelmomentodelaaccindelahormonatiroideaesfundamentalparaeldesarrolloneurolgico(
470,471).
Hipotiroidismodesarrollotambincausaundeteriorosensorial,incluyendosorderapermanente,queenmodelosde
roedoressehademostradoquelaparticipacindeformidadenlamembranatectorialodointernoydeterioroenla
maduracindelepiteliosensorial(247).Tambinhayunfenotipovisualyaquelahormonatiroideaafectael
desarrollodelavisindelcolor.Enlosadultos,losactosdelahormonatiroideaenelestadodenimo,el
comportamientoylafuncincognitiva,ysofisticadaspruebashansidovalidadasparainvestigarlosefectosdelas
hormonastiroideasenlosfenotiposdecomportamientoenratones.Lahormonatiroideatambinafectalafuerza
muscularylafatiga,ascomoelmotorylossistemasdecerebelosos.Laspersonasconhipotiroidismosonlentosy
fatigadocondebilidadmuscularyreflejoslentosrelajante,mientrasqueenlatirotoxicosishaytemblores,prdidade
masamuscular,hiperreflexiayfatiga.
Elcerebroadultotambinessensiblealahormonatiroidea.Unaevaluacindecribadodeobservacinestandarizada
delcomportamientoylafuncinenlosroedoressehadescrito(SHIRPA)quepermiteaunneurolgicagenerale
integral(msculoylaneuronamotorainferior,espinocerebelosa,sensorialylafuncinautonmica)y
neuropsiquitrico(actividad,elaprendizaje,laexcitacin,elmiedo,agresin,alimentacin,irritabilidad,etc.)anlisis
arealizarunainvestigacinpreviaamsdetalladadelosparmetrosanormalesyvasneurolgicas(472).Una
evaluacinSHIRPAmodificadoyestandarizadohasidoadoptadoporelConsorcioInternacionalFenotipificacin
Mousecomopartedelapantallafenotipoinicialcaracterizacinprimariaderatonesmutantesgeneradosporel
ConsorcioInternacionalKnockoutMouse(473,474).Esteenfoqueestsiendoadoptadoparaincluirelanlisis
fenotipodetodoslossistemasfisiolgicosyfacilitarlanormalizacinylaeventualgeneracinderepositorios
completosygrandesdedatosdelfenotipo.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

55/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

RECOMENDACIN42
Modelosderoedoressepuedenutilizarparaestudiarcmolahormonatiroideaafectaeldesarrollodel
cerebroylafuncin.Lacorrelacinentreeltiempodeiniciodelafuncintiroideafetalylaedadcronolgica
esdiferenteenroedoresqueenlossereshumanoslaetapadedesarrolloneurobiolgicoenlugardelaedad
cronolgicadelanimaldebeserconsiderado.
Comentario Elhipotiroidismocongnitopromueveprofundodeteriorodeldesarrolloyfuncindelcerebro.Por

ejemplo,losproblemascognitivosselectivosypersistentessepuedenobservarenlosniosquenacieroncon
hipotiroidismocongnito.Imagensofisticada,comolaresonanciamagntica(RM),hademostradoquelosniosy
adolescentesconhipotiroidismocongnitohanreducidoeltamaodelhipocampoylospatronesdecrecimientodel
hipocampoanormalesrelacinasuspares.Msimportantean,losvolmenesdelhipocamporeducidopredicenel
rendimientodememoriapobres(475).
Modelosderoedoresdehipotiroidismocongnitosehanestudiadoextensamente,dadoquelamayoradelos
componentesanatmicosyfuncionalesdelcerebrodelosmamferossonsimilaresentreelhombreyotrasespeciesde
mamferos(476).Sinembargo,enmuchosaspectos,noconstituyenunmodeloanimalidealparaelestudiodela
economafetaltiroideadelamadredurantelagestacin.Lasprincipalesdiferenciasserelacionanconlaaparicinde
lafuncintiroideafetalyelcalendariodeeventosdeldesarrolloneurolgicoenrelacinconelnacimiento.La
cuestinescuntoespeciesvaranenrelacinalhombreconformealamedidadelaaceleracindelcrecimientodel
cerebroqueespostnatal(476).Aesterespecto,lashormonastiroideasnoinfluyeneneventosmuytempranastales
comolainduccinneuralyelestablecimientodelapolaridadduranteeldesarrollodelcerebro.Ensulugar,modulan
losprocesosposteriores,incluyendolaneurognesisylaproliferacindelasdendritas,lamielinizacin,yla
formacindesinapsis.Elmomentodeiniciodelaaccindelahormonatiroideaenelcerebroendesarrolloescrucial
yporlotantofisiolgicamenteimportante.Alternativamente,lasovejassehanutilizadoampliamentecomoun
modeloanimal.Lacobayaesdeinterspotencial,asporquesuinuteromaduracindetiroidesesmuchoms
cercanoaldelahumana(477).
Muchosestudiosenroedoreshancentradoenelcerebeloderataporquesudesarrolloneurobiolgicoes
predominantementepostnatalyporlotantomsfcilmenteexpuestaalamanipulacinexperimental(476).Sin
embargo,otrasregiones,incluyendolacortezacerebral,losgangliosbasales,elcerebeloyelhipocampotambinse
hanestudiadoutilizandoenfoqueshistolgicasestndar.Estastcnicastambinsehanadaptadoparaestudiarla
mdulaespinalylasracesnerviosasdorsalesyventrales(478).Porejemplo,lasneuronasdeclulasdePurkinjey
desuorganizacinespacialsonesencialesparalafuncindelcerebelo.Seformanjustoantesdelnacimientoenla
rataysunmeronoseafectanporelhipotiroidismoalnacer,perosumigracinymaduracinsedeteriora
severamente(476).Elefectodeladeficienciadelahormonatiroideaenlamaduracindelacortezacerebelarde
ratatodavapuedeobservarsielhipotiroidismoseinducehastalasegundasemanapostnatal(476).Delmismo
modo,lamayoraneurognesiscerebroanteriorderatasecompletaenelnacimiento.Sinembargo,elanlisis
estructuralindicaquehayunamarcadahipoplasiadelneuropil(476).Porlotanto,parececlaroquelahormona
tiroideaafectaalamaduracindelcerebrodirectaatravsdelosefectosespecficossobreladiferenciacincelular.
Lahormonatiroideaseralentizaladivisincelular,mientrasqueconcomitantementeestimulareliniciodela
diferenciacincelular.
RECOMENDACIN43
DadaladiversidadfuncionalylacomplejidadestructuraldelosestudiosdelsistemanerviosocentraldeT3
responsivegenesenelcerebrosehanmejoradoengranmedidasiseestudiaatravsdeinsituhibridacino
IHC.
Comentario Anlisisdemicroarrays,transferenciaNorthern,RTqPCR,lasecuenciacindeARNdeprxima
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

56/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

generacin,yensituhibridacintodossehanutilizadoparaestudiarT3regulatedlaexpresindegenesenel
cerebro(392,401,479).ProtocolosparainsituhibridacinyIHCsehandescrito(445,480484).Estospueden
realizarseenseccionesincluidasenparafinaofijocongeladostejidosilapreservacindelaarquitecturahistolgica
detalladaesdeimportanciasignificativa(485).Sinembargo,lainclusinenparafinainterfiereconlacalidaddel
ARN,porlotantounamejorrelacinsealruidoyelanlisisdelaexpresingnicaseobtienenusandotejido
congeladofijo.Porejemplo,insitulahibridacinsehautilizadoparadefinirTRHcomonegativamenteT3gen
regulatedenelhipotlamo(486489)yparaestudiarlaexpresingyruscorteza/dentadodelRC3/neurogranina,
queestreguladapositivamenteporT3(396).
Alutilizarmtodoscuantitativos,ladiseccincuidadosamuestraesnecesariodebidoalanaturalezaaltamente
compartimentadadelcerebro.Enalgunoscasos,seagruparonserequierenmuestrasapartirde510ratonespara
obtenersuficienteARNparatalesestudios(485).Unaformamsadecuadadelaobtencindemuestrasdecerebro
esatravsdelserdemicrodiseccindecaptura,quepermiteelaislamientoexactadetiposespecficosdeclulas
incrustadasenunmicroambientedeltejidoheterogneo.Lasermicrodiseccindecapturatrabajabajovisualizacin
microscpicadirectamicromanipuladorasistidaylasmuestrasobtenidasacontinuacin,puedeserprocesadoparael
aislamientodeARN(491).
Unanlisisdemicroarraysderatnhipotiroidismocortezacerebralidentific316genesreguladospositivamentey
318genesreguladosnegativamenteporT3(127).LacapacidadderespuestadesubconjuntosdeestosgenesaT3
fueconfirmadaporRTqPCRenunmodeloderatngravementehipotiroidismoespecficadelcerebro,elratndoble
MCT8/D2KO(127)yenelcerebroderatonessistmicamentetirotoxicosisoratonesKOD3(492).Atravsdel
estudiodehipotiroidismosistmicaotirotoxicosis,T3genesregulatedtambinhansidoidentificadosenregiones
especficasdelcerebro(porejemplo,cerebelo,corteza,elhipocampo).Enelcerebeloendesarrollo,hipotiroidismo
sistmicadiolugaralaexpresinalteradade2.940genes,deloscuales1.357fueronhastareguladasy1.583
reguladoshaciaabajosegnlaevaluacindeanlisisdemicroarrays(493).Sinembargo,elnmerodegenes
cerebelososdirectamentereguladaporT3esprobablequeseamuchomspequeacomoseevidenciaencultivos
primariosdeclulasneuronalesdelcerebeloestudiadosatravsdelahibridacindemicroarraysdeARN(494).En
cualquierpantalla,criteriosestadsticosrigurososdeberanutilizarseparareducirelnmerodecandidatosT3
regulatedgenesparanuevosanlisisconfirmatorios.
ExpresindelaprotenadelcerebroseanalizanormalmentemediantetransferenciadeWesternoIHCdecerebros
adherenciadeperfundido(postfijadurantelanochea4Cycryoprotecteden30%desacarosa).IHCesadecuado
paralosenfoquescuantitativosslosielsistemadedeteccinsemantieneinsaturadoNoserecomiendala
cuantificacindeprotenasypptidosporestemtodosecretadas.Losestudiossepuedenrealizarenseccionesde
criostatodelibreflotacindelasregionesespecficasdelcerebro(478).Elenfoquefueutilizadoparaestudiarlos
efectosdehipotiroidismocongnitoenlaexpresindelaprotenaasociadaamicrotbulos2enelcerebelodelarata
(495)ylaexpresindelostransportadoresdelahormonatiroideaenlacclea(496).Adems,IHCtambinse
utilizparaestudiarlaregulacindereelinyDAB1porlahormonatiroideaendiferentesregionescerebrales(497),
mientrasqueWesternBlotyinsitudehibridacinseutilizparaestudiartenascinC(498).Estastcnicastienen
ventajasydesventajasdistintas.Porlotanto,inmunocitoqumicaproporcionalacapacidaddeidentificarconprecisin
dondeenelSNCelantgenoseencuentraenlasclulasindividualesoenelnivelsubcelularenelncleoo
citoplasmaoanmsprecisasiseusamicroscopaelectrnica.Tambinproporcionaunexcelentemtodopara
verificarlaprdidaoreexpresindeunantgenoenparticularenmodelosderatonestransgnicosodespusdela
manipulacinanatmicacomolesioningelectrolticootranseccin.Debidoaqueelcontenidodeunantgenoen
cualquierclulaparticularsepuedeverafectadoporlavelocidaddesntesis,eltransporte,ladegradacin,yla
secrecin,insituhistoqumicadehibridacintiendeaserunenfoquemuchomejorcuantitativadeIHC.
Alternativamente,lastcnicasdemicrodilisisespecializadassepuedenutilizarparamedirlasconcentracionesde
protenasecretada.ElanlisisdeWesterntambinpuedeserobjetodealgunasdelasmismaspreocupacionescon
respectoalacuantificacincomoinmunocitoqumica,perotienelaventajadesercapazdeidentificareltamaodel
antgeno(s)seridentificado.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

57/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

44aRECOMENDACIN
Dficitsauditivosfuncionalesresultantesdeladeficienciadelahormonadelatiroidespuedenserestudiados
mediantelamedicindelasrespuestasevocadasauditivasdeltroncocerebralparadeterminarlosumbralesde
laintensidaddelestmulo.
Comentario Anlisisdelaanatomadelodomedioimplicalainspeccinhistolgicadelhuesecillodedeformidades(

499).EvaluacindelaosificacinrequieretincinconazulalcinyVanGiesonparavisualizarelcartlagoy
formacindehueso.Anatomacoclearseexaminaenlasseccionesdelodointerno.Muestrasincluidasenplsticode
metacrilatodeparaformaldehdo/coclearrendimientotejidoglutaraldehidofijobuenaconservacindelaestructura
celular3alassecciones4micrasdeespesorsepuedeteirconazuldetoluidina(448,501)otionina(499,502)
ohematoxilinaacuosa(277).
Unmediorelativamenterpido,noinvasivoparaevaluarlafuncinauditivaeslamedicindelarespuestaauditiva
deltroncocerebralevocada(277,448,501,502).Investigacindeotrascaractersticasdelafuncincoclearola
funcindelnerviococlearpuedeincluirladeterminacindelpotencialendococlear,potencialdeaccincompuesto,y
otrosparmetrosfisiolgicos(277).
44bRECOMENDACIN
Losdficitsdelafuncinvisualqueresultandeladeficienciadelahormonatiroideasepuedenestudiar
midiendolasrespuestasevocadosvisualesenelectrorretinogramasparadeterminarlasensibilidaddelongitud
deondaylosumbralesdeintensidaddeluz.
Comentario Elanlisishistolgicodelaretinasellevaacaboen2 micrasseccionesobtenidasapartirdemuestras

incluidasenplsticodemetacrilato.Elejedorsoventraldelgloboestmarcado.Ensitueinmunohistoqumicade
hibridacinseusanparaevaluarlaexpresindelosgenesdianacandidatosytpicamenteserealizanen1016 micras
cryosectionsparaformaldehdofijo(279,398,503,504).Losanlisisdeexpresindelaprotenasepuederealizar
enextractosproteicospreparadosapartirderetinadiseccionadoparainvestigardiversasprotenasopsinayrodopsina
medianteWesternblotylosestudiosinmunohistoqumicos(279,398,503,504,506).
Funcionesdeconoyfotorreceptorasvarillapuedenserevaluadosporanlisisdelaelectrorretinograma,quese
registratpicamenteenratonesadultosjvenes.Dadaslasfuncionescrticasdelahormonatiroideaendiferentestipos
deconos,esimportanteanalizarfotpicasrespuestadelosconosdeluz(adaptado)enrespuestaalongitudesdeonda
deluzespecficasquesonselectivosparalasdiferentespoblacionesdecono,esdecir,losquetienensensibilidad
mximaamediolargo(M,o"verde"~520 nm)ycorto(S,o"azul"~367 nm)longitudesdeondadelaluz.
Escotpica(adaptadaalaoscuridad)lasrespuestasdelabarratambinsedebendeterminar(279,398).
RECOMENDACIN45
Efectosdelahormonatiroideaenloscanalesinicosdelasneuronasylaconduccinnerviosapuedenser
investigadosporelanlisisdepatchclampograbacindemicroelectrodos.
Comentario Elanlisisdetalladodelafuncinneuronalrequieredetcnicasespecializadasrealizanmejoren

colaboracinconlaboratoriosdeneurocienciaestablecidos.Porejemplo,elanlisisdepatchclampdeneuronas
enterasencortesdetejidoodegrabacinmicroelectrododecortesdetejidosehanutilizadoparaestudiarlosefectos
delashormonastiroideassobrelafuncindelaneurona(478).Grabacionesdeclulasenteraspatchclampdelas
neuronasindividualespuedenrealizarseutilizandoinstrumentosespecializadosen300 micrasrodajasdecerebro
parasagitalobtenidosderatones.Lasneuronassonvisualizadosporinfrarrojosdiferencialmicroscopadecontraste
deinterferenciaparapermitirlaseleccindelasclulasagrabarse(478).Procedimientosdegrabacinavanzadas
puedenmedirloscambiosinducidosporelhipotiroidismo,enlapotenciacinalargoplazoenlaspoblacionesde
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

58/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

neuronasdelhipocampo,unmecanismocelulardelaplasticidadsinpticaquesecreequeestinvolucradoenla
memoria(507a510).
46aRECOMENDACIN
Pruebasneurolgicasestandarizadaspuedenutilizarseparainvestigarcmolahormonatiroideaafectael
controlneuromuscularentantomotorylosnivelesdelcerebelo.Serecomiendaelusodemtodos
complementarios.
Comentario Protocolosdeensayoencampoabiertosehanutilizadoparacuantificarlaactividadlocomotoradela

distanciarecorridaylavelocidadduranteunperododefinido(187,483,511)conelfindeinvestigartantolos
aspectosdecomportamientoyresistenciadelafuncinneuromuscularenrespuestaaalteracionesenelestadodel
tiroides.Motorylafuncinmuscularpuedenserinvestigadosmediantepruebasestandarizadasdelafuerza,
incluyendolafuerzadeagarresedeterminausandounmedidorautomticodelafuerzadeagarre,unmedidorde
tensindetraccinelectrnico,ounapruebadesuspensindelacuerda(478).Acelerarlaspruebasrotaroddel
equilibrioylacoordinacinmotoraserealizamedianteladeterminacindeltiempodeunratnindividualescapazde
permanecerenlabarradurantesurotacindespusdeunperododeformacindeterminadoantesdelaprueba(187
,483).Vigapielapruebautilizandounaseriedevigaselevadosdediferentesanchurassepuedeutilizarpara
determinarelequilibriomediantelamedicindedeslizamientoyeltiempodepieparacruzarlalongituddelaviga(
478).Alternativamente,seutilizanpruebasposteverticalparainvestigaragilidadyequilibriomediantela
determinacindeltiemponecesarioparaqueunratnparainvertiryejecutaralabasedeunpostecuandosecoloca
cercadelapartesuperior(187).Anlisisdelahuelladelamarchapuedeserevaluadaenratonesentrenadospara
caminaralolargodeunpapeldefiltroconlospiespintadascondiferentescoloresdepinturasnotxicasaplicadasa
miembrosanterioresyposteriores.Determinacindelalongituddelazancada,delanteraytraseraanchuradelabase,
ladistanciainterstep,elusodetaln,yelngulodelapatatraserasepuedeutilizarparaevaluarelequilibrioyla
coordinacin(478).
46bRECOMENDACIN
Estadodenimo,laconducta,elaprendizajeylamemoriasonsensiblesalahormonatiroideaypuedenser
investigadosmediantepruebasdecomportamientoestablecidas.Serecomiendaelusodemtodos
complementarios.
Comentario Caractersticasdedepresinsoninvestigadosporlaspruebasdelaindefensinaprendida.Enesta

situacin,unsistemadeaprendizajeoperante,quecomprendeunacmaradeacondicionamientoconungeneradorde
shock,permiteelanlisisdelcomportamiento"evitacinactiva"aldiscriminarlaevitacindeescape(511).Afinde
investigarlaansiedadsedebeutilizarunsistemade"evitacinpasiva".Unaluz/cajaoscuraseempleapara
determinareltiempodepermanenciaenlaluzcontralaoscuridadduranteunperododetiempototaldefinido(511
513).Unlaberintoelevadoenformadesigno,queconsisteendosbrazosabiertosopuestosydosbrazoscerrados
opuestos,sepuedeutilizarcomounaevaluacinalternativa.Enestasituacin,eltiempodepermanenciaenel
comportamientoexploratorioenlosbrazosabiertosfrentealtiempocomportamientononexploratoryenlosbrazos
cerradossedetermina(187,483).Sobresaltorespuestascomootrosindicadoresdeansiedadeinquietudtambin
puedenserinvestigados(511).
Parainvestigarlosefectosdelestadodelatiroidesalteradosobreelaprendizajeyparamedirlosefectossobrela
memoriadereconocimiento,losestudiosenuncampoabiertoconobjetosfamiliaresylosnuevossepuedenemplear
entareasnovedosasdereconocimientodeobjetos(187,483).Laspruebasdecampoabiertotambinsepuede
utilizarparainvestigarlascaractersticasdeladepresinporqueevalalatendenciadelosratonesparaexplorar
abiertamenteopermanecercongeladoenlosbordesdelcampooparapresentarelcomportamientodecra.Las
pruebasadicionalesparainvestigarelaprendizajeylamemoriaimplicanelusodeunlaberintodeaguadeMorris
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

59/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

llenodeaguaopacayquecontieneunapequeaplataformasituadaenuncuadrantejustodebajodelasuperficiedel
agua.Elratnsecolocaenlapequeaplataformadurante10segundosyluegosecolocaenelagua.Eltiempo
necesarioparaencontrarytreparalaplataformaseregistra.Latareaserepiteendassecuencialesparainvestigarel
aprendizajeylamemoria.Lapruebadereferenciavisiblereplicaelexperimentoexceptoquelaplataformaes
claramentevisible(187).Lapruebadeescapedeaguainvestigalapercepcinvisualmediantelacolocacindeuna
escaleradeescapevisibleenelladodelaembarcacinylagrabacineltiemponecesarioparasubiralaescalera(
187).
RECOMENDACIN47
Losefectoshipotalmicosdelahormonatiroideaenlosparmetrosdecomportamientoymetablicaspueden
serestudiadosdirectamentedespusdeintracerebroventricular(ICV)laadministracindeT3.
Comentario Lahormonatiroideapresentaunaseriedeefectosqueestnmediadasdirectamenteenelhipotlamobasal

medial.UnejemploeselaumentodelaingestadealimentosquesiguerpidamentelaadministracindeT3
directamenteenelncleoventromedial(514516).UnenfoquerelacionadoesimplantarT3cristales
estereotxicamenteenreashipotalmicasdiscretos.Estemtodohasidoutilizadoparadefinirelpapeldirecto
desempeadoporT3enelmecanismoderetroalimentacinnegativaTRH(487,488)yparaestudiarlaregulacin
mediadaporfotoperiododebalancedeenergaestacionalyreproduccinenelhmstersiberiano(517).Adems,el
papeldirectodesempeadoporunnmerodeneuropptidosenelejeHPTsehaestudiadoutilizandolarutaICV
porejemplo,AMHS,neuropptidoY,ylaprotenarelacionadaconagouti(518522).
48aRECOMENDACIN
ModelosdeclulascerebralesquerespondenalahormonatiroideainvitrosepuedenutilizarparamodelarT
3efectosenelSNC.
Comentario LoscultivosprimariosdeneuronasdelhipocampoylneascelularesneuronalesrespondenaT3invitro.

Enlasneuronascultivadas,laexposicinaT3aumentasignificativamenteeltamaoylalongituddelasneuritas,as
comolaactividaddelaacetilcolinesterasa(523).Adems,T3afectadirectamenteeldesarrollodeprocesos
dendrticosdeclulasdePurkinjedelcerebelocultivadastravsdelaactivacindeTR1(524).T3tambinpuede
mejorarladiferenciacinneuronalinducidaporeltratamientoconcidoretinoicodeclulasmadreembrionarias(
525).LasclulasglialessontambinsensiblesaT3(526).Porejemplo,laactividaddelamaduracindeclulas
glutaminasintetasamarcadoraumentosenastrocitoscerebelosascultivadasenrespuestaaT3(527).Enparticular,
loscambioshormonalesevocadadelatiroidesenlafuncinneuronalamenudoimplicanaccionesglialesmediada(
526).Porejemplo,lahormonatiroideahastaregulalacorrientedesodioactivadosporvoltajeenlasneuronasdel
hipocampocultivadaspostnatalesatravsdeT3secrecindependientedelfactordecrecimientodefibroblastos
bsicoapartirdeastrocitosdehipocampo(528).LosoligodendrocitossontambinsensiblesaT3yla
mielinizacinesprobablementelamejorcaracterizadaT3mediadaefectosobrelafuncindelasclulasgliales(529
),conT3estimulandobsicademielinaexpresindegenesdeprotenasencultivosdeoligodendrocitos(530).
Clulascerebralescultivadasamenudoexhibenactividaddeiodinasasustancial,D2y/oD3,yporlotantoeltipoy
laconcentracindelahormonatiroideaaplicadosenlosgruposdetratamientodebenserconsideradasy
experimentosplanificadosenconsecuencia.Cambiosenlosmediosfrecuentespuedensernecesariosparagarantizar
laconcentracinyodotironinaestabledurantetodoelexperimento.Aadiendocantidadestrazadorasderadiomarcado
T4oT3conelposterioranlisisdelosmetabolitosenlosmediosdecomunicacinindicasutasametablica(173).
Enlosmodelosdecocultivo,T3producidoporD2enlasclulasdegliomaH4afectaalaexpresindegenesen
clulasdeneuroblastomaSKNAS(vecina173).Enestesistema,lasconcentracionesdeT4tanbajascomo20 pM
evocadosT3mediadaporlaexpresindegenesenlasclulasneuronales.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

60/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

48bRECOMENDACIN
ModelosclulapituitariarespondenalahormonatiroideainvitroysepuedenutilizarparaestudiarT3efectos
enlaglndulapituitariaanterior.
Comentario Lneasdeclulaspituitariassontpicamentesensiblesalahormonatiroideadebidoalaaltaexpresinde

TRenlaglndula(101).LalneacelularsomatotrophGH1fueunodelosprimerosmodeloscelularesmostrados
pararesponderalosnivelesfisiolgicosdelahormonatiroideamonitorizadaporelcrecimientocelularylautilizacin
deglucosa(531).EnlalneacelularsomatotrophGH3,laexposicinaT3aumentalaexpresindelahormonade
crecimientodeunamaneramediadaporTR2(532),mientrasqueenclulassecretorasdeGHGC,T3disminuye
losnivelesdemRNAD2(143).LalneacelulartirotrpicosderivadosTT1tambinrespondealosniveles
fisiolgicosdeT3disminuyendoTSHyexpresinD2(259,533).
[J.2]coraznyelsistemacardiovascular
Fondo Desarrollodelcoraznylatransicindeunfetalalprogramadeexpresindegenescardiacosadultosesen

granmedidadependientedelahormonatiroidea(534).Elcoraznsiguesiendounodelosprincipalesrganosdiana
delahormonatiroideaenlavidaadultayefectoscardiovascularesestnentrelasmanifestacionesclnicasms
pronunciadosdehipotiroidismoytirotoxicosisenelhombre(535).Corazonesroedoressonigualmentesensibles,y
prcticamentetodoslosaspectosdelabiologacardacaseveafectadaporlahormonatiroidea,incluyendo
electrofisiologa,lahomeostasisdeiones,lacontraccin,elmetabolismodelaenerga,ylasealizacinadrenrgica(
402).Lasumadeestosefectosesevidenteenelaumentodelafrecuenciacardacaylastasasdecontracciny
relajacinenlatransicindebajaalosestadosaltotiroideshormonal.Juntoconlareduccindelaresistencia
perifricainducidaporlahormonatiroidea,estoresultaenlasalidacardiacamsaltarequeridaporelorganismo
hipermetablico.Crecimientoventriculartambinesestimuladaporlahormonatiroidea,casieldobledelpesodel
coraznenlatransicindehipotiroidismoatirotoxicosis.Sinembargo,lahormonatiroideatienepocoefectodirecto
sobreelcrecimientodeloscardiomiocitosylahipertrofiaventricularescasiensutotalidadenrespuestaalaumento
delacargadetrabajocardiacainducidaporlahormonatiroidea(537).Porlotanto,apesardelasconsecuencias
funcionalesdelosnivelesdehormonastiroideasalteradassonrelativamentesencillosybiendocumentado,separar
losefectosdirectosdelossecundariospuedenserunreto.Estoseaplicainclusoaaquellosgenescardiacosquehan
sidoidentificadoscomoblancosdirectosdeT3,yaqueenmuchoscasossontranscripcionalmentecoregulatedpor
factoresqueellosmismosestninfluidosporelestadodelatiroides(porejemplo,atravsdevasdetransduccinde
sealesdependientesdelacarga).
LacomprensindelosmecanismosdeaccindelahormonadelatiroidesenelcoraznylaevaluacindeT
cardaca3actividadesrelevante,enparticulardadalasospechadepapeldelaalteracindelasealizacindela
hormonadelatiroidescardiacaenlaprogresindelaenfermedadcardacayelpotencialusoteraputicodela
hormonatiroidea.Estoestrelacionadoconlosnivelesdelahormonadelatiroidessricosbajosobservadosenla
insuficienciacardaca(esdecir,elsndromeNTI),ascomoaloscambiosenelmetabolismocardiacohormona
tiroideaTRylaexpresinendiversasformasdeenfermedadesdelcorazn.Lasrecomendacionesdeestaseccin
describenlosenfoquesymtodosqueseutilizanparadeterminarelefectodelestadodelatiroidesenparmetros
cardacos.Estasmetodologasseutilizantambinparaevaluarelpapeldelasealizacindelahormonadelatiroides
cardacaenratonesmodificadosgenticamente,talescomoTRmodelosknockout(451),yenmodelosde
remodelacincardiacapatolgicaeinsuficienciacardiaca.ModelosparalaremodelacindelVIincluyenelmodelo
deratasespontneamentehipertensas(539)induccinquirrgicadeinfartodemiocardioporligaduratransitoriao
permanentedelaarteriacoronariadescendente(238,540)LVsobrecargadepresinporbandasquirrgicadela
aorta(constriccinarticatransversal)(541544)yisoproterenolinducidaporlahipertrofiadelVIenelcontexto
delmodeloD3rondaratn(64).Participacindelasealizacindelahormonadelatiroidesenelventrculo
derecho(RV)remodelacinsehaestudiadoenlaratausandoelmodelodehipertensinarterialpulmonarinducida
porunasolainyeccindemonocrotaline(62,63).LosmtodosparainducirlaremodelacindelVIseutilizanen
ratasyratones,peromonocrotalinenosepuedenutilizarparainducirlaremodelacinRVenratones.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

61/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

RECOMENDACIN49
Losefectosdelahormonatiroideasobrelafuncincardacaylamorfologasepuedenevaluardeformano
invasivaporecografaoresonanciamagntica.
Comentario Losmtodosnoinvasivosseutilizanparaestudiarlosefectosdelahormonatiroideasobrelafuncin

cardacaylamorfologa(540,545,546).Estosmtodossonidealesparalosanlisislongitudinalesdeanimales
individuales.Laecocardiografaeselmsampliamenteutilizadoquepermiteevaluar,deunaseriedeparmetros
funcionalesdelcorazn(frecuenciacardaca,elvolumensistlico,elgastocardiaco,fraccindeacortamiento,
fraccindeeyeccin),ascomolosvolmenesventricularesygrosordelaparedduranteelciclocardaco(540,546
).Serequierendispositivosdeultrasonidosconunaaltaresolucinespacialytemporalalaimagendelcoraznde
ratnconprecisindebidoasupequeotamaoyaltastasasdecorazn(esdecir,>400 bpm).Conunmanejo
adecuado,esposibleanalizaranimalesdespiertos,perolaecocardiografaserealizanormalmenteenanimales
ligeramentesedadosutilizandoisofluranootribromoetanolcomoanestsicos.Estoscompuestostienenefectos
cardiodepresormnimos,adiferenciadeotrosanestsicosdeusocomn.Mantenimientodelatemperaturacorporal
duranteelprocedimientoesesencial.
CiertosaspectosdelafuncincardacafetalpuedenevaluarsemedianteecografaDopplerespectralguiadapor
Dopplercolor(534).EstatcnicaespecializadasehautilizadoenratonesTRmutanteparaestudiarlosefectosdela
interrupcindeT3deaccineneldesarrollocardiacofuncionaleneltero(534).
Cuandolaresolucindelaecocardiografaesinsuficienteparadetectarlosefectos,laRMofrecedelineacin
superioresdelasestructurasalolargodelciclocardacoconaltaresolucintemporal(546,547).Lasmismas
consideracionesconrespectoalaanestesiaycontroldetemperaturasonvlidosparaelanlisisdeultrasonido.
Coleccindeimgenessedesencadenaporelelectrocardiograma(ECG)yelprocesamientodeimgenesadquiridas
permitelareconstruccindelcoraznatravsdeunciclocompleto.Apartirdeestosdatos,parmetroscardacos
funcionalesyestructuralessepuedencalcularconmayorexactitud.
50aRECOMENDACIN
Anlisisdelosefectosdelahormonatiroideasobrelafrecuenciacardiacaylapresinarterialrequiereun
anlisislongitudinalenanimalesconlibertaddemovimiento.
Comentario Serequieredetelemetraparamonitorizarloscambiosenlosparmetrosvitalesconprecisinsinla

interferenciadeestrs.Estemtodohasidoutilizadoenelanlisisdetratamientodelatiroideshormonaderatas
despusdeinfartodemiocardio(540),enratonesdetiposalvaje(548),yenratonestransgnicosquellevan
mutacionesTR(451,549).Lafrecuenciacardaca,ECG,latemperaturacorporal,lapresinsanguneaarterial(
550),ylaactividadfsicaseregistransimultneamenteporsondasconectadasauntransmisorimplantadoenla
cavidadperitonealconunreceptordetelemetrasituadodebajodelajaula.Telemetracontinualecturaesposiblepara
unmximode3meses.Lostemasclavesonelcostoylashabilidadesnecesariasparallevaracabolaimplantacin
quirrgica.Unserviciotelmetropreimplantacinestdisponibledeproveedores,incluyendoTheJackson
Laboratories(http://jaxmice.jax.org/preconditioned/surgical/telemetry.html)yCharlesRiver(
www.criver.com/productsservices/basicresearch//deldispositivodeimplantesroedordelaciruga).
50bRECOMENDACIN
LosefectosdelahormonatiroideasobrelafuncincontrctilLVpuedenserevaluadosporinvivola
grabacindelaspresionesLV.
Comentario Losparmetroshemodinmicossedeterminanenexperimentosdeterminalesenratonesanestesiadosy

ventilados(238,551)oratas(540)porelavancedeuntransductordepresindemicropuntaouncatterde
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

62/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

presinvolumencombinadoatravsdelaarteriacartidacomnderechaenlaaortaascendenteyposteriormenteen
laLV.Lastasasdepositivosynegativosdedesarrollodelapresinylaspresionessistlicaydiastlicafinalpueden
serutilizadoscomoindicadoressensiblesdelatiroidescambiosdependientesdehormonasenlaexpresindelas
protenascontrctilesyprotenasimplicadasenlahomeostasisdelcalciointracelular.
51aRECOMENDACIN
Anlisisdelosefectosdelahormonatiroideasobrelafuncincontrctilcardiacarequiereexvivo
experimentosusandocorazonesintactasaisladasopreparacionesdetejido.
Comentario Lapreparacindecoraznperfundido(mtododeLangendorff)seutilizaparaanalizarunaampliagama

deparmetrosdelafuncincardiaca,conlaventajadesercapazdecontrolarlascondicionesexperimentales(por
ejemplo,lafrecuenciadelestmulo,laperfusincoronaria,elvolumenventricular,ylapresin).UnglobodePVC
llenodelquidoseinsertaenlacavidadLVyunidoaunsistemadeadquisicindesensordepresinydatos,loque
permitelagrabacinylamanipulacindelaspresionesyvolmenesdelVI.Elmtodosepuedeaplicarparaevaluar
losefectoscardacosdelahormonatiroideaentantorata(552554)ymodelosderatn(555,556).Unaventaja
adicionaldeestemodelodecoraznesquepermiteelanlisisdelosefectosimportantesdelahormonatiroideaenel
metabolismodesustratocardiacoylafuncinmitocondrial(552,556,557).cidosgrasosetiquetadosyglucosa
se
utilizanparaanalizaroxidativoyelmetabolismoglucolticomediantetcnicasestndar(3sustratosHetiquetados)

(552)oporespectroscopadeRMN(13sustratosCetiquetados)(556).Estopuedecomplementarseconanlisis
deltejidoposteriordelasenzimasmetablicasclaveylafuncinrespiratoriadelasmitocondriasaisladas(552,556
).
Unanlisismsdetalladodelosefectosdelahormonatiroideaencontrctilylaspropiedadesmecnicasdeltejido
cardiacoselograutilizandoaisladotrabculas(558,559)omsculospapilares(560).Fuerzayacortando
velocidadesdelosmsculosestimuladoselctricamenteseregistranutilizandounmedidordedeformacin.
Preparacionespapilarestambinsehanutilizadopararegistrarelefectodelahormonatiroideaenlaspropiedades
electrofisiolgicas(porejemplo,elacortamientodeladuracinpotencialdeaccin)(561).Serequieren
preparacionesfinasy/otemperaturasreducidasparaevitarlahipoxiatisulardelaspreparacionessuperfuseddurante
laestimulacinrepetitivatalescomolahoradedeterminarlasrelacionesdefuerzafrecuencia.Porestaraznse
prefierenpequeatrabculas,queseobtienenmsfcilmentedelaRVquedelaLV.
Preparacionesauricularesderechosquecontienenelnodosinoauricularsepuedenutilizarparalagrabacindela
fuerzaisomtricaylafrecuenciadelatidoespontneo.EstosehahechoparaevaluarelefectodeunamutacinTR1
enelcontrolautnomodelafrecuenciacardacaenratones(549).
51bRECOMENDACIN
LosefectosdelahormonatiroideaencardacaCa2+homeostasispuedenserevaluadosenlosmsculos
papilaresotrabculas,ascomoenloscardiomiocitosindividualesaisladas.
Comentario Losefectosinotrpicosylusitrpicospositivosdelahormonatiroideadetectadausandotrabculaso

msculospapilaresreflejancambiosenlaexpresindeisoformasdemiosinadecadenapesada,ascomocambiosen
laexpresindelasprotenasdemanejodecalcio.EstosltimosincluyenlarianodinaCa2+canal,elretculo
sarcoplsmico/endoplasmticoCa2+ATPasa(SERCA2aoAtp2a2)ysufosfolambanprotenareguladora(536).
ElefectosobreellatidoalatidointracelularesdeCa2+flujossepuedeevaluarenlosmsculospapilarestrabculaso
usandoCa2+indicadores(560,562,563).Fura2eselindicadorfluorescentemsutilizadoquepermitela
determinacindelibresintracelularesdeCa2+concentracionesporunenfoquededoblelongituddeonda.Sin
embargo,lagrabacindeCa2+transitoriosconresolucindetiempodemilisegundosrequiereunapticadealta
velocidadsofisticados.Montajesdedicadosestndisponiblesparaelanlisiscombinadodelaspropiedades
2+

http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

63/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

contrctilesyCa2+fundentes(563).
ElmismoenfoqueexperimentalsepuedeutilizarparaanalizarlosefectosdelahormonatiroideasobreelCa2+
homeostasisenloscardiomiocitosindividuales,estimuladoselctricamenteaisladasderatn(564)ocorazonesde
rata(565,566).Elanlisisdelasclulascultivadasindividualestieneventajasobvias,peroelrendimientodelos
cardiomiocitosviables,enformadebastoncillosesvariable.Esespecialmentebajaenelcasodeloscorazonescon
hipotiroidismo,creandoelriesgodesesgodeseleccin.
52aRECOMENDACIN
Larespuestadeltejidocardacoalahormonatiroideasepuedeevaluarusandomtodoshistolgicosyporlos
estudiosdetiroidesexpresingnicasensibleahormonas.
Comentario Elpesodetodoelcoraznoindividualesventrculosdeberdeterminarse,preferentementecomouna

relacinalalongituddelatibia,yaqueelpesocorporalpuedevariarconsiderablementeenfuncindelasituacinde
latiroides.TincinH&Edeseccionesdeparafinaseutilizatpicamenteparalamedicindeloscardiomiocitosrea
deseccintransversal(238,567).Cabesealarquesehandesarrolladolascondicionesdefijacindetejido
cardacopuedeafectaralamorfologadeloscardiomiocitosymtodosadicionalesparadeterminarconprecisin
miocitosreadeseccintransversalascomolalongitud(539).TincindeTricrmicodeMassondelassecciones
seusaparaevaluarlafibrosisencombinacinconlamorfologadeloscardiomiocitos(542),ylafraccinde
volumendecolgenopuedesercuantificadamediantetincinrojopicrosirioymicroscopadeluzpolarizada(568).
LaexpresindeT3genesdiana,incluyendoHCN2,KCNE1,Kcnb1,KCNA1,Kcnq1,Thra,Thrb(534),
Atp2a2,MYH6,MYH7(62,238),yNPPA(238),sellevaacabomedianteRTqPCRenARNmextradotanto
detodocoraznodesdecmarasoregionesindividuales(verseccinI.2deconsideracionestcnicas).Expresinde
lasprincipalesisoformasdemiosinacardiacapesados
cadenaMHCyMHC(esdecir,MYH6yMYH7,

respectivamente)sepuededeterminarenhomogeneizadosdetejidoportransferenciaWesternutilizandoanticuerpos
policlonalesdisponiblesenelmercado(238)omonoclonal(542)anticuerpos.IHCdeT3responsivegenesrara
vezsehaceenelsupuestodequetodosloscardiomiocitosrespondendemanerasimilaralahormonatiroideaoel
estrs.Sinembargo,estudiosrecienteshandemostradounaheterogeneidadinesperadadeexpresinreguladade
MYH7(569,570),yestodebesertenidoencuentaalevaluarlosefectosdelaT3.
Tambinesimportantedarsecuentadequeningunaprotenacardacaestreguladaexclusivamenteporlahormona
tiroidea.LaeficaciadelaT3tratamientopuedeserevidenteapartirdeloscambiosenlaexpresindelosgenes
mencionadosanteriormente,enparticularloscambiosrecprocosenMYH6yMYH7expresin,peroloscambiosen
laexpresindeestosgenesensituacionespatolgicasnoimplicanecesariamenteTalterada3desealizacin.Por
ejemplo,muchasdelasrutasdetransduccindesealesimplicadasenlaremodelacinventricularylainsuficiencia
cardiacapatolgicatambinconvergenenlaT3responsivegenes,conefectosopuestosalosdeT3.Como
resultado,elfenotipodelacorazninsuficienteparecealadeuncoraznhipotiroidismo,almenosparaunnmero
deprotenas(535).Sinembargo,laevaluacindetejidoT3niveles(63,238)(vaselaseccinB.2,
Recomendacin8)ylosnivelesdeTRS(571),o,idealmente,ladeterminacindeT3transcripcindependiente(
63,238)esnecesarioparaestablecercambiosenTcardiaca3desealizacin.
52bRECOMENDACIN
MiocardioContratanteocupacodificacindeADNplsmidoT3genesindicadoresresponsive,permitiendoT
cardiomiocitosespecfica3actividaddetranscripcindependientedequesedetermineenvivo.
Comentario LoscardiomiocitosenelcoraznpalpitantetienenlacapacidadnicaparacaptarADNplsmidose

inyectaenlaparedventricular.Elmecanismodeabsorcinesdesconocido,perodebidoaquenootrasclulas
presentesenelmiocardiosetransfectan,laregulacindeloscardiomiocitosespecficodegenesinformadores
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

64/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

fluorescentespuedeserestudiadainvivo.Lasmismasconsideracionessealadasparainvitroanlisisdegenes
indicadoresseaplicanconrespectoalanormalizacinyelcontroldelosefectosfueradelametadelahormona
tiroideauotrasintervenciones(vaselaseccinI).Sinembargo,elanlisisdeT3transcripcinregulatedno
requierecotransfeccindeunplsmidoqueexpresaTR.DurantelacirugatoracotomalaparedlibredelVI(ratn)
oLVy/oRV(rata)seinyectaconunpequeovolumendesolucindeplsmido(Fig.15).Porlogeneral,varios
milesdecardiomiocitossontransfectadas,ylaexpresintieneunaduracindevariassemanas.Anlisisdelreportero
ylaexpresindeluciferasanormalizacin(generalmentelucirnagayRenillaluciferasa)serealizaentejido
homogeneizado.EstametodologasehautilizadoparainvestigarlaT3regulacindependientedelaMYH7promotor
(572)yparaevaluarlaT3transcripcionaldependientedeactividadenmodelosderatayratndeinsuficiencia
cardaca(63,238).DebidoaqueenesteltimoenfoqueunpromotormnimoquecontienesolamenteunT3RE
comocisactuandoelementoseutiliza,seproduceelresultadonetodetodoslosfactorespotencialmentecontribuira
laTalterada3desealizacinenelcardiomiocito(porejemplo,laabsorcindelahormonadelatiroides,el
metabolismo,ylaexpresindelosTRycofactores).
FIG.15.
Invivotransfeccindecardiomiocitosderatamedianteinyeccindirectade
ADN.ElanimalseanestesiaconunamezcladeN2O(0,2 L/min),O2(0,2
L/min),yelsevoflurano(2%3%),yelcoraznseexponeatravsdeuna
toracotomaderechalateral....
RECOMENDACIN53
Loscultivosprimariosdecardiomiocitosderatayratn,ascomolalneacelularH9c2,sepuedenutilizar
paraestudiarlosefectosdelahormonatiroidea.
Comentario LoscultivosprimariosderataadultaocardiomiocitosseobtienenporLangendorffperfusindelcorazn

aisladoconunasolucindecolgenoquedigieren.Enformadebarra,loscardiomiocitosviablesseseparande
permeabilizada,redondeadocardiomiocitosyotrasclulasyplateado.Elrendimientodeloscardiomiocitosviables
vara,peropuedesertanaltacomo80%.Estodependeprincipalmentedelacalidaddelapreparacindecolagenasa
utilizado,yvarioslotesdelaenzimapuedenecesitarserprobado.Aunqueloscultivosprimariospuedendurarmsde
1semana,loscardiomiocitoscomienzanadedifferentiategradualmentedesdeelmomentodeaislamiento.En
consecuencia,losanlisisdelosefectosdeestadodelatiroidesalteradoenlosparmetroscelulares,talescomola
grabacindepotencialesdeaccin(573)yCa2+transitorios(564566),ascomoinvitroefectosdelahormona
tiroidea(574),serealizantpicamenteenculturasrecinpreparados.
Debidoalaslimitacionesdeloscultivosprimariosparaadultos,lamayoradelosestudiossobrelosefectosdela
hormonatiroideaencardiomiocitosinvitroserealizanusandorataprimarianeonatal(541,575577)oelratn(
578)culturas.Unoalascrasdetresdasdeedad,seutilizanyclulassecolocandespusdeladigestincon
colagenasadeventrculospicados.CultivosprimariosNeonatalesmuestrancontraccionesespontneasyculturasy
sncronospuedenmantenersepormsde1semana.Lainteraccindelahormonatiroideaylaactividadcontrctil
puedeseranalizado,yaseamediantelainhibicindelascontraccionesespontneas(576)oporlaestimulacin
elctricadelasclulas(575).LalneacelularH9c2,derivadoderatatejidodelcoraznembrionario,seutilizacomo
unaalternativaacultivosdecardiomiocitosprimariosydiversosaspectosdelaaccindelahormonadelatiroidesy
elmetabolismosehanestudiadoenH9c2clulas(579581).Aunqueestalneacelularsehaconservadounnmero
decaractersticasdecardiomiocitos,exhibemuchasdelaspropiedadesclavedemsculoesqueltico.Enparticular,
losmioblastosH9c2sernfcilmentefundirparaformarmiotubosmultinucleadosyresponderalaestimulacindela
acetilcolina.Porlotanto,debetenercuidadoalextrapolarlosdatosaloscardiomiocitosnormales.
RECOMENDACIN54
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

65/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Losefectosdelahormonatiroideasobrelafuncinvascularsepuedeevaluarmedianteelanlisisdeanillos
arterialesyclulasmusculareslisasvascularescultivadas.
Comentario Elmecanismodelareduccindependientedehormonatiroideaenlaresistenciavascularsistmicaes

investigadaporexvivodeterminacindelaspropiedadesvasomotoresdelasarteriasderata.Anillosvascularesse
preparanapartiraortasexplantadasoarteriasderesistenciaderatashipotiroideo,eutiroideootirotxicosyse
montaronenunmyograph(582585).Larespuestacontrctilaagentesvasodilatadoresovasoconstrictoresse
registra,loquepermiteladiferenciacinentreloscambiosenlosefectosmediadaporelendotelioyloscambios
intrnsecosalasclulasdelmsculolisovascular(CMLV).LoscultivosprimariosdeCMLVseutilizanparaestudiar
losefectosrpidosdelahormonatiroideaenlasCMLVderelajacin(586)ydelosprocesosdetransduccinde
sealesimplicados(587).
[J.3]metabolismointermediarioylahomeostasisenergtica
Fondo Todoslosprincipalesrganosytejidosmetablicamenterelevantes(porejemplo,elcerebro,eltejidoadiposo,

elhgadoyelmsculoesqueltico)sonelblancodelahormonatiroidea.Enlamayoradelostejidos,lahormona
tiroideaactivamltiplesvasmetablicas,loquellevaaunarotacinmsrpidaATP(descomposicinylasntesis
deATP)yelconsumodeoxgenoacelerada(588,589).Latransferenciadeenergaesunprocesoinherentemente
termodinmicamenteineficienteesdecir,elcaloresunsubproductoobligatoriacuandolaenergasetransfiere(i)de
laoxidacindesustratosenATPy(ii)apartirdeATPeneltrabajobiolgico.Porlotanto,laaceleracindela
rotacinATPconducealaproduccindecalor(termognesis),queeslavaaceptadaporelcuallahormonatiroidea
activalatermognesis.Especficamente,lahormonatiroideaacelerafacturacindeunnmerodeciclosinicosode
sustratorequieredeATPincluyendoNa/KATPasa,CaATPasa,lalipognesisylaliplisis,yelciclodeCory(
590).Tantolatasametablicabasal(esdecir,laenergagastaparamantenerlavidaenunestadodereposo)yel
gastodeenergadeadaptacin(porejemplo,enfroinducido)estnreguladosporlahormonatiroidea.Laactivacin
directadelatranscripcindelgenUCP1enlaMTDeselmecanismosubyacenteporelcuallahormonatiroidea
aceleralatermognesisinducidaporelfro(267,269,592)noesttanclaroquelahormonatiroideajuegaun
papelenelgastodeenergadeadaptacininducidaporladieta(211,593).Ademsdeestasaccionesdirectasenla
homeostasisenergtica,lahormonatiroideatambinactaenelSNC(porejemplo,hipotlamo)queinfluyenenlas
principalesvashomeostticosporejemplo,laactividadsimptica,elapetitoylaingestadealimentos(594,595).
As,losestudiosdelosefectosmetablicosdelahormonatiroidestambinpuedenrequeriruncontrolestrictodelos
alimentosylaingestadelquidos,laactividadmotora,larespiracinylafrecuenciacardiaca.
55aRECOMENDACIN
TirotoxicosisSistmicoyelhipotiroidismopuedensermodeladosenrataspuntosfinalesexperimentalesa
considerarincluyenelconsumodeoxgeno(VO2),cocienterespiratorio(RQ),elcomportamientode
alimentacin,consumodealimentosyagua,yelmovimiento/actividad.
Comentario Hayunaaceleracindeaproximadamentecuatrovecesenlatasadegastodeenergadurantelatransicin

dehipotiroidismoatirotoxicosisenratas(596,597).VO2sereducea~50%unavezqueselograel
hipotiroidismosistmica(597).LaadministracindelahormonatiroideaacelerarpidamenteVO2enratas
eutiroideosohipotiroidismo,concambiossignificativosobservadostanprontocomo18a24horasdela
administracin(597,598).UnacadasignificativaenRQde~10%seobservadentrodelos2dasdela
administracindelahormonatiroideapararatas(599).LaadministracindeT3arataseutiroideostambinresulta
enunaaceleracinrpidaenVO2(~60%),quecomienzaalas24horasymesetasalos7das(600).
Elcosteenergticodevidaparaelratnesaproximadamentedosvecesmayorqueeldelarata(601).Porlotanto,
existendiferenciassustancialesentrelosratonesyratasconrespectoasucapacidadderespuestametablicaala
hormonatiroidea.RatoneshipotiroideosnomuestranunadisminucinenelVO2atemperaturaambiente,slo
despusdelaaclimatacinalatermoneutralidad(211).Sinembargo,elgastototaldeenergadiariasereduceenel
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

66/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

ratnhipotiroidismoaclimatadoalatemperaturaambiente,unparmetroquetieneencuentaelVO2yelRQ.El
gastoenergticototaldiariosostenidoenelratnhipotiroidismosedebeaunamayorestimulacinsimpticadeBAT
(211,602).Estoindicaquelareduccinenlasealizacindelahormonatiroideaescompensadaporunaumento
delaactividadsimptica,elmantenimientodeVO2atemperaturaambiente(211).
Lacalorimetraindirectasepuedeestudiarmsde30a120minutos,conresultadosconfiables(597,598,603,604
).Elestrspuedeserunfactorimportanteenestosestudiosacortoplazoysedebetenercuidadoparaevitaro,al
menos,elcontroldeesavariable.Enalgunoslugareslosanimalessonanestesiadosparaminimizarlosmovimientosy
elestrs(597),perolosagentesanestsicospuedeninterferirconlatermorregulacinylahomeostasisenergtica.
Unametodologadelestadodelatcnicaconsisteenlaadmisindelosratonesaunsistemadecontrolcontinuo
integradoquepuedealbergaralosanimalesdurantedasosemanasatemperaturacontrolada(Fig.16)(232).Esto
minimizalosefectosdelestrsademsdepermitirlaadquisicindelosperfilesdedatos24horas.Otraventaja
importanteeslaobtencindepuntosdedatosduranteelda(quereflejanlatasametablicabasal)ynoche(que
incluyenlaaceleracindelatasametablicacausadaporlaalimentacin).
FIG.16.
ElusodelSistemadeMonitoreoIntegraldeAnimalesdeLaboratoriopara
realizarlacalorimetraindirectacontinuaenratones.(A)Dosjaulas
metablicasindependientesqueestnconectadosaunacomputadoraparala
grabacinyanlisisdedatos(B)VO2duranteunperododetiempode24
horas...
Idealmente,VO2seexpresacomounafuncindelamasacorporalmagradeterminadoenoalrededordelmomento
delacalorimetraindirecta.Lagrasaylamasacorporalmagrasepuedenmedirporanlisisdecomposicindela
canaldestructivooportcnicasdeimagennoinvasivasmsrecientes,incluyendolaabsorciometradeenergadual
derayosXoresonanciamagnticacuantitativa.Estosmtodoshansidocomparadosypuedenproducirresultados
diferentes,indicandoademslaimportanciadeuncuidadosodiseoexperimentalyelusodemtodos
complementariosparaelanlisisdelosfenotiposmetablicos(606,607).
Latemperaturacentralenlosroedoressepuedemediratravsdeunasondatrmicarectalconectadoaun
termmetrodigital(608).Sinembargo,elestadodelatecnologamsavanzadaimplicaimplantarquirrgicamente
radiotransmisoresenlacavidadabdominalparacontrolarlatemperaturacentral(609,610).Laadministracinde
frmacosantitiroideosaratasresultadosenlareduccinrpidadelatemperaturadelncleoqueesevidentedespus
de3dasdetratamientoporelfinaldelaprimerasemanadetratamiento,hayunareduccindeaproximadamente0,5
Cenlatemperaturacentralquesemantienedurantetodoeldaylanoche(609).Almismotiempo,lasratas
tratadasconhormonatiroideapor1semanaexhibenunaumentodealrededorde1Cenlatemperaturadelncleo
comoseevaluconunasondarectal(611).
55bRECOMENDACIN
Losefectosdelhipotiroidismosistmicaotirotoxicosisenuntejidoparticularpuedenserestudiadosatravsde
tejidoodeaislamientodeclulasdeanimalestratadosadecuadamente.
Comentario LahormonatiroideaesbienconocidoporinfluirenlatasametablicadelosorganismosintactosSin

embargo,ladistribucindelefectoentrelosdiversostejidosnoesttanbienentendido.Elhgadosehaestablecido
claramentecomounimportantemediadordelosefectosmetablicosdelahormonatiroideasobrelabasedeunaserie
deestudiosqueutilizanhepatocitosaisladosderatasconhipotiroidismoohipertiroidismo(inducida
experimentalmente612),revisadoporHarperyBrand(613).Elconsumodeoxgenodeloshepatocitosse
correlacionpositivamenteconelestadohormonaldelatiroidesdelosanimalesanlisisdelarespiracinindicaque
lafugadeprotonesmitocondrialbasaltambinsecorrelacionapositivamenteconelconsumodeoxgeno(614).Al
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

67/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

mismotiempo,otrosmecanismoscelularesdifierenensurespuestaahipotiroidismoytirotoxicosis:hipotiroideosen
lasclulas,disminuyeelconsumodeoxgenonomitocondriales,mientrasqueenlasclulastirotoxicosisreacciones
queimplicanrotacindeATPseincrementan(613).Cabesealarquedebidoaqueloshepatocitossehicieron
hipotiroidismootirotxicainvivo(mientrastodavapartedeunhgadointactoenunanimaltratado
farmacolgicamente),estosefectossobrelarespiracinnopuedenserasumidasestardirectamenterelacionadocon
losefectosdeT3enhepatocitos,peropuedenincluirefectoshepticoscausados
porsegundosmensajerosderivados

defuentesextrahepticos,talescomoelsistemanerviososimptico(SNS).
Histricamente,elgastodeenergadelasclulasaisladassehacuantificadomidiendoelconsumodeoxgenousando
unelectrododeClarkoaparatosimilar(234).Alternativamente,elconsumodeoxgenoylaacidificacindelos
mediosdecomunicacinsepuedenmedirdeformanodestructivaen24oformatode96pocillosutilizando
instrumentosmodernosbasados
ensensoresdeestadoslidodefluorforo/pticas(Fig.17)(615,616).

FIG.17.
MedicindeO2consumoylatasadeacidificacindelmedioenlasclulas
cultivadas.AnlisisdeflujoextracelularserealizautilizandoanalizadoresXF
(SeahorseBioscience,Billerica,MA).Lasclulassecultivanenmonocapade
24oformatode96pocillos.Elconsumodeoxgeno...
55cRECOMENDACIN
Paraaislarlosefectosdirectosdelahormonatiroideaenelgastodeenergacelularylasvasmetablicasen
undeterminadotipodeclulas,invitroestudiosdebenrealizarseconeltratamientoconhormonatiroideade
lasclulascultivadas.
Comentario Estudiosenlosqueclulascultivadasestnexpuestosadiferentesconcentracionesdelashormonas

tiroideasenelmedioexcluyenlaposibilidaddesegundosmensajerosderivadosdeotrostejidos,yporlotantopuede
revelarefectos"directos"delahormonatiroideaenuntipodecluladado.Porejemplo,elanlisisdelaexpresin
gnicadeclulasdecarcinomahepatocelular(HepG2)expuestosaconcentracionesfarmacolgicasdeT3ha
demostradocambiosenlosgenesmetablicamenterelevantes(617).Alternativamente,cultivosdehepatocitos
primariosderatasoratonespuedenserutilizadosparaestosestudiosdebidoaquerepresentanexcelentesmodelosde
efectosdelashormonastiroideassobreelhgado(618,619).Adems,laactividadD3sehademostradoquese
correlacionainversamenteconelconsumodeoxgenoenlasclulascultivadas,sugiriendounefectodirectodelaT3
enelgastodeenerga(aunqueT3concentracionesnofueronmedidosenelcompartimientointracelular)(63).
55dRECOMENDACIN
EstudiosqueutilizanmitocondriasaisladassepuedenutilizarparainvestigarlosefectosdeT3sobrela
biologamitocondrial.
Comentario Losefectosdelasistmica,alteracinfarmacolgicadelestadotiroideoenratasenlasmitocondrias

hepticassehaninvestigadotrassuaislamientodelosanimalestratadosfugadeprotonesmitocondrialylacadena
respiratoriafueronidentificadoscomositiosimportantesdeT3decontrol(620,621).Mientrasquetalesestudios
presentanventajasenquelasmitocondriaspuedensidointerrogados,apartedeotrosmecanismoscelulares,el
fenotiporespiratorioesdiferentedelaobservadaenclulasaisladasporqueelcontextofisiolgicosepierdePor
ejemplo,elaumentodelasreaccionesqueconsumenATPinducidasportirotoxicosisnosevedadalafaltadevas
queconsumenATPextramitocondriales(613).
56aRECOMENDACIN
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

68/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Lacapacidadderespuestaagudaycrnicaalaexposicinalfro(4C5C)sepuedeutilizarparaestudiar
losefectostermognicosdelahormonatiroidea.
Comentario Defenderlatemperaturacentraldurantelaexposicinalfrodependedeunaseriedemecanismosde

adaptacinensumayorainiciadosporelSNS.Sinembargo,debidoamodificacionesenelsistemadetransduccin
desealesadrenrgico,animaleshipotiroideosrespondenmuchomenosalascatecolaminas,ylocontrarioseobserva
enanimalestirotoxicosis(622624).Porlotanto,roedoreshipotiroideospresentanhipotermiaprofundaysucumben
encuestindehorascuandoseexponealfro(4C5C)(625,626).Alas2horasdehabersidomovidoalfro
todoslosroedoresexhibenundescensotransitoriodelatemperaturarectal(alrededorde1C),peroserecuperana
losvaloresbasalesde4horasdeexposicinalfrocontinua(610).Enratasyratoneshipotiroideos,temperatura
rectalsiguedisminuyendo,yparaevitarlamuertedelosanimalesdelexperimentodebeserinterrumpidoen
temperaturasdelncleodealrededorde30C.
56bRECOMENDACIN
TermognesisBATestreguladapositivamenteporlahormonatiroideaypuedeserestudiadoenla
almohadillaBATinterescapular(IBAT)durantelainfusinconagonistasadrenrgicosenratasoratones.
Comentario BATesunsitioimportantedelatermognesisysehautilizadoampliamentecomounmodelopara

estudiarlasealizacindelahormonatiroideaysusinergiaconelSNS.LaproduccindecalorenelBATseinicia
porlaestimulacindelSNS.Porlotanto,laevaluacinfinaldelatermognesisBATdebeincluirlamedicindela
temperaturaBATenrespuestaalaestimulacinadrenrgica.Estosepuedeobtenermediantelamedicindela
respuestatrmicadeIBATalaestimulacinconunagonistaadrenrgico(porejemplo,norepinefrina)deunamanera
dosisydependientedeltiempo(627).Laconfiguracinincluyelacolocacinquirrgicadeunpequeotermistor
bajolaIBAT(Fig.18).Debidoaltamaocorporalpequeo,losratonesdebenmantenerseenunacamatrmica
ajustadoa30Centodomomento(311).Lasvenasyugularesofemoralessecanularonyconectadoaunabomba
yseutilizancomopuertosparalainfusindelfrmaco.Unsegundotermistordebeserinsertadoenelrectopara
controlarlatemperaturadelncleo.respuestatrmicaIbatpuedeobservarapocosminutosdeliniciodelainfusin.
ElaumentodelatemperaturadeIBATesnormalmentede1C2Cenlaprimerahora,ypuedealcanzarhasta4
C,dependiendodesilosanimalessealimentaronpreviamenteunadietaaltaengrasaocrnicamenteexpuestosalfro
(593).Latemperaturacentraldebeaumentarmenosmarcadayenlosltimostiemposcomounaindicacindeque
elMTDseestcalentandoelcuerpoynoalrevs.Estaconfiguracinpermitelaevaluacindirectadelosefectosde
lahormonatiroideaenelMTD,sinpasarporlosefectosindirectos.Porejemplo,elhipotiroidismoIBATesslo
mnimamentesensibleaunainfusinconnorepinefrina(627,629).
FIG.18.
Estudiodeladeltejidoadiposomarrn(IBAT)interescapularrespuesta
trmicaalanorepinefrina(NE)deinfusin.(A,B)Unarata(oratn)es
anestesiado,ylaalmohadilladeIBATseexponeatravsdeunaincisin
quirrgica.UntermistorsecolocadebajodelaalmohadilladeIBATy
asegurado...
57aRECOMENDACIN
Estudiosdelosefectosmetablicosdelahormonatiroideapuedennecesitarserrealizadobajocondicionesde
termoneutralidadesdecir,latemperaturaambientealaquelatemperaturacentralesmantenidaporla
termognesisobligatoria(termognesisproducidaporlosanimalesensutasametablicabasal).
Comentario Temperaturaambiente(21C)esunestrstrmicosignificativoparapequeosroedores,especialmente
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

69/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

losratones.Porlotanto,inclusoenlosanimalesaclimatadosatemperaturaambiente,losefectosmetablicosdela
hormonatiroideaestninfluenciadosporunsinergismosignificativaconlaactividadsimptica.Laaclimatacina30
Cminimizalaactividadsimpticayporlotantolainterferenciaenelmetabolismo.Efectosmssimpticosobreel
metabolismosereducenalmnimodentrodelasprimeras2448horasdeaclimatacina30C(232).Sinembargo,
puedetardarhastavariassemanasparauncierresimpticocompletaabajoylosinvestigadorespuedendeber
determinarexperimentalmenteenfuncindelosparmetrosaestudiar(232,608).Estoesparticularmente
importantesilosestudiosimplicananimaleshipotiroideosotirotoxicosisdadoquelaactividaddelSNSse
correlacionainversamenteconelestadodeltiroides(630,631)seincrementduranteelhipotiroidismoy
minimizadodurantetirotoxicosis(632,633).
57bRECOMENDACIN
Elusodelaobesidadinducidaporladietacomounmodeloparaestudiarelefectotermognicodelahormona
tiroideadebetenerencuentalatiroidesadicionallasvariablesdependientesdehormonasporejemplo,la
secrecindehormonadecrecimientoyelcrecimientolineal,elapetito,laactividadsimpticaylatemperatura
ambiente.
Comentario BATestambinunsitioprincipaldelatermognesisinducidaporladietaenpequeosroedores,que

puedeseractivadoporlaalimentacinconunadietaaltaengrasa(634).Sinembargo,encontradelatermognesis
inducidaporfro,elpapeldesempeadoporlahormonatiroideaenlatermognesisinducidaporladietaesmenos
clara.Ratasoratoneshipotiroideosnosonobesoscuandosemantienenenunadietadepienso(211,593),pero
cuandosecolocanenunadietaaltaengrasas,larespuestaesdiferenteentrelasratasylosratonesydependedela
temperaturadelmedioambiente(211,593).Atemperaturaambiente,lasratasconhipotiroidismocolocadosenuna
dietaaltaengrasassevuelventanobesoscomoratascontroleutiroideos(593),mientrasquelosratonesestn
protegidoscontralaobesidadinducidaporladieta(211).Sloentermoneutralidadhacenlosratonescon
hipotiroidismosevuelvenobesoscuandosecolocaenunadietaaltaengrasa(211).Paraestostiposdeestudios,se
prefierendietasdisponiblescomercialmenteparalaconsistenciaypuedencontenerde20%a50%degrasa.Tales
dietascontienenaproximadamente4,73 kcal/genlaque45%delaenergasederivadelagrasaysepuede
compararconlasrespuestasenratonesalimentadosconunadietaestndarqueconstade3,85 kcal/genlaque10%
delaenergasederivadelagrasa(608).Engeneral,losanimalesestnexpuestosadiferentesregmenesdietticos
duranteperodosquevaranentre30y60das.
RECOMENDACIN58
Tiroidesprocesosmetablicosdependientesdehormonaseneltejidoadiposopuedenserinvestigadosen
preparacionesdetejidos,enlosadipocitosblancosomarronesrecinaisladas,yenlosadipocitosblancoso
marronesdiferenciadosinvitro.
Comentario Elanlisisestructuralobioqumicadelasalmohadillasdegrasaenratonesoratasconhipotiroidismoo

tirotoxicosisconstituyeunenfoquebsicoparaestudiarlosefectosdelahormonatiroideaeneltejidoadiposo.La
hormonatiroideaafectaelpesodelosdepsitosdelaalmohadilladegrasaespecficos(porejemplo,epiddimo,
inguinal,yinterescapular)(635),quesiempredebeserexpresadocomounafuncindelpesocorporaltotalola
longitudfemoral(464).Lipognesisesestimuladaporlahormonatiroideaenlostejidosadiposoblancoymarrn(
237,268,637).Almismotiempo,lahormonatiroideatambinpromuevelaliplisismediantelaamplificacindela
vadesealizacinadrenrgica.Elsaldonetodeestasvasantagnicasesunareduccindelaadiposidad,
alcanzando~50%en6das(600).Aunqueunointuitivamenteespeculanqueenlosanimaleshipotiroideosdebe
haberunaumentodelaadiposidad,lagrasacorporalenratasconhipotiroidismonoseveafectado(593),mientras
queseredujoenratoneshipotiroideos(211).
EneltejidoadiposoyBAThormonatiroideablancoestimulalalipognesisylaliplisissloenBAThaceT3
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

70/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

estimularlatermognesis.UCP1laexpresingnica(ARNmyprotena)eselmarcadorcrticoparalatermognesis
BAT,yesmuysensiblealahormonatiroidea(267,269,592,638).Existenotrasvassensiblesalashormonas
tiroideaseneltejidoadiposoquesepuedeevaluarmidiendolaVmaxdeenzimasdeltipodelimitacinclave(268,
269,640).LosejemplosincluyenlosensayosdeactividaddelaacetilCoAcarboxilasamedianteunensayode
NADHacoplada(237),malonilCoAdescarboxilasaactividadutilizandounensayodeacetiltransferasaligado
carnitina(641),ylaactividaddeGPDenpreparacionesmitocondriasusandounaLglicerofosfatocomo
sustrato(464),aunquelosinvestigadoresdebenserconscientesdequelaactividaddeGPDpuedenoser
dependientedelahormonatiroideaentodaslasespeciesdemamferos.Lipognesisesparticularmentesensibleala
hormonatiroideaysepuedeevaluarmediantelamedicindenovolasntesisdecidosgrasosenlosdepsitosdela
almohadilladegrasadespusdelainyeccinintraperitonealointravenosade3H2Oseguidodeextraccinde
lpidosendiferentespuntosdetiempo(600,642).
Adipocitosblancosomarronesaisladospreparadosapartirdeladigestinconcolagenasadealmohadillasdegrasa
especficospuedenestudiarseensuspensinduranteslounashoras,yaquelasincubacionesprolongadassonpoco
estables(237,622,643).Unaventajadeesteenfoqueesqueelmetabolismocelularpuedeserestudiadoen
condicionesdefinidasdeladisponibilidaddesustratoporejemplo,/altodeglucosabaja,cidosgrasos,ycarnitina(
644).Losresultadosobtenidosreflejanelestadodeestasclulasinmediatamenteantesdesercosechadas.Vas
metablicasespecficassepuedenestudiarmidiendolaVmaxdelasenzimaslimitantesdelavelocidadclavebajo
condicionesbasalesyenrespuestaalosagentesdeprovocacincomolanoradrenalina,laforskolina(activadordela
adenilatociclasa),dibutirilAMPc(unanlogodecAMPfosfodiesterasaresistente),terbutalina(2selectivoagonista
adrenrgico),ydobutamina(1selectivoagonistaadrenrgico)(464).Ejemplosincluyenlamedicindelatasade
gastodeenerga(VO2),lipognesis,lipolisis,obetaoxidacin,todaslasvassensiblesalashormonastiroideas(
237).Lipognesistambinpuedeestudiarsedespusdeunimpulsocon3H2Oyextraccindelpidos(237).La
liplisistambinseestudiamidiendolaliberacindeglicerolcatecolaminasestimulada(645647).
Adipocitosaisladoshanlimitadoinvitrolacapacidadderespuestaalahormonatiroidea(237,648,649).En
contraste,loscultivosprimariosdeadipocitosblancosomarronessonsensiblesalahormonatiroideayporlotanto
constituyenunaalternativaventajosasistema(69,651).Obviamentecultivosprimariosdeadipocitosnoreflejarel
estadometablicodeunanimal,perotienenlaventajadegenerarclulasquesonestablesyporlotantoadecuado
paraexperimentosprolongados.Adipocitosmadurosseobtienendespusdepreadipocitosblancosomarronesson
empujadosinvitrohacialadiferenciacinporlaexposicinadiferentescctelesyestrategiasduranteunperodode8
a12das(652).Lneasdepreadipocitosblancosomarronestambinsehanestablecidoyutilizadoconxito(653
).
59aRECOMENDACIN
Lainduccinsimultneadelalipognesisylaoxidacindecidosgrasossonimportantesefectosdela
hormonatiroideaenelhgado.Elestudiodelaexpresindelasenzimaslimitantesdelavelocidadclave,as
comolaestimacindelastasasdeambosdeestosprocesosenmodelosanimalesycelularessepuedeutilizar
paramedirlaextensindelasealizacindelahormonatiroideaenelhgado.
Comentario ConlasegundadensidadmsaltadeTRenelcuerpo,elhgadoesmuysensiblealahormonatiroidea(

654).Dieciochoprotenassensiblesahormonastiroideasseidentificaronhacevariosaosenelanlisisdeunensayo
detraslacindemRNAhepticodeeutiroideoyhipotiroideo(655).Aligualqueconeltejidograso,lahormona
tiroideaestimulalalipognesisenelhgadomediantelaactivacindelaexpresindelasenzimasclaveimplicadasen
lasntesisdecidosgrasos(596),talescomolaenzimamlica(656),glucosa6Pdeshidrogenasa(ambasenzimas
generarNADPH),lasintasadecidosgrasos,ylaacetilCoAcarboxilasa(657659).Almismotiempo,lahormona
tiroideaacelerarpidamentelaoxidacindecidosgrasosenelhgado(660).Hayunareduccinde
aproximadamentecincovecesenlaoxidacindecidosgrasosenloshepatocitosaisladosderatashipotiroideos.En
contraste,laadministracindelahormonatiroideaarataseutiroideosaceleralatasadeoxidacindecidosgrasos(
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

71/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

661).EstoexplicaenpartelareduccindeRQvistodurantelatransicinentreelhipotiroidismoyelhipertiroidismo
(599).Sinembargo,elresultadonetodelaaccindelahormonatiroideaentriglicridosdelhgadotiendeaser
neutrodadoslosefectoscombinadossobrelaliplisis,lipognesis,ylaoxidacindecidosgrasos(211).
59bRECOMENDACIN
Losnivelesdecolesterolensueroycontenidodecolesteroldelhgadopuedenusarsecomomarcadores
biolgicosdelosefectosmetablicosdelahormonatiroideaenelhgado.
Comentario Ratasconhipotiroidismosuelenteneraltoelcolesterolplasmticocontriglicridosnormales,reducidoo

ligeramenteelevadas(662a665).Lahipercolesterolemiaescausadaengranparteporunaumentoenla
concentracindecolesterolenlipoprotenasdebajadensidad(LDL)queresultadeladisminucindecatabolismo
mediadoporreceptordelalipoprotena,principalmenteenelhgado.Estoseintensificaporlaalimentacindelos
roedoresconunadietaaltaencolesterol.Unmodeloampliamenteutilizadoeslaalimentacindeunadietaaltaen
grasa,talescomo10%deaceitedemazquecontiene2%decolesterol(dietadecolesterol)o10%deaceitedemaz,
2%decolesterol,ycidoclico0,5%(dietacidoclico).Ratasconhipotiroidismomantienenentalesdietas
exhibicinmarcadahipercolesterolemia(665)ylasecrecinhepticadesteresdecolesterolyapoErica
lipoprotenasdemuybajadensidadyelcolesterolLDL(666,667).Encontraste,lasratastirotxicoshanreducido
losnivelesdecolesterolenasociacinconlareduccindevolumendenegociosLDL.Laadministracindela
hormonatiroideaafectaelmetabolismodelcolesteroltanprontocomo1semanadespusdeltratamiento(668).Esto
hafomentadounconsiderableintersenelpotencialdeanlogosdelahormonatiroideaeneltratamientode
trastornoshiperlipidmicos(310,315,669,670).
[J.4]Elmsculoesqueltico
Fondo Laspropiedadescontrctilesymetablicasdelosmsculosesquelticosestndeterminadasporlas

propiedadesdelosdiferentestiposdefibrasquecomponenelmsculo.Gruposdefibrasinervadasporunasola
neuronamotorformanunaunidaddemotor.Eltipodeinervacinylahormonatiroideasonlosprincipales
moduladoresdelfenotipodelasfibrasmusculares,tantoduranteeldesarrolloyeneladulto(671).Lainteraccin
dinmicaentreestosmoduladores,juntoconelorigendeldesarrollodelasfibras,losresultadosendiversosfenotipos
quevandesdelacontraccinlenta,fibrasoxidativas(TipoI)decontraccinrpida,fibrasglicolticas(tipoIIb)(671
).LasfibrasmuscularesesquelticasseidentificantpicamenteporelprincipaltipodeMHCqueseexpresaesdecir,
MHCI,IIa,IIx/d,yIIb(tengaencuentaqueMHCIesidnticaaMHCcardaco,peroquelasotrasisoformas
MHCnoseexpresanenelcorazn).Estasisoformashanaumentandolastasasderotacincatalticos,conMHCIIb
siendocincovecesmsrpidoqueelMHCI,ydeterminarengranmedidaelritmodecontraccin.Mltiples
isoformastambinexistenparaotrasprotenasclavequeconformanlafibramuscular,talescomolascadenasligeras
delamiosina(MLC)yelretculosarcoplsmico/endoplasmticoCa2+ATPasasSERCA2a(Atp2A2)y
SERCA1a(Atp2A1).EstasisoformasSERCAsonresponsablesdelarecaptacindecitoslicadeCa2+,la
determinacindeltipoderelajacin,yporlogeneralseasocianconlenta(SERCA2a)ofibrasrpidas(SERCA1a)(
672).Apartedelasobviasdiferenciasenladensidadmitocondrialentreprincipalmenteoxidativoyfibras
glucolticas,marcadasdiferenciascualitativastambinexistenenlacomposicinylafuncindelasmitocondriasen
estasfibras(673).
Lacomposicinenfibrasdediferentesmsculosenelcuerpovaraconsiderablemente,haciendocoincidirsustareas
especficas.Desarrollodelascaractersticaslentasdependedelainervacindelasneuronasmotoraslentas,mientras
queeldesarrollodecaractersticasrpidasesmuchomenosdependientedelaentradadelosnervios(674).La
expresindelfenotiporpidoes,sinembargo,coreguladaporlahormonatiroidea(671,674).Porejemplo,la
expresinpostnataldeSERCA1aescompletamentedependientedelahormonatiroidea(675,676)ylatransicin
defetoaadultosisoformasrpidasMHCseretrasaenelhipotiroidismo(677679).Enelanimaladultoesta
capacidadderespuestademsculosrpidosdisminuyeengranmedida,encontrasteconralentizarmsculos,queson
altamentesensiblesacambiosenelestadodelatiroides.Larazndeestoesque,engeneral,lahormonatiroidease
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

72/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

oponeelefectodetipolentoinervacinesdecir,queestimulalaexpresindelascaractersticasrpidas,mientrasque
suprimecaractersticaslento,yaumentalacapacidadglobaldegeneracindeATPdelmsculo.Lasfibras
muscularesrpidassonenergticamentemenoseficienteyelaumentodelainducidaporlahormonatiroidea
velocidadseasociaconunamayorrotacindeenergayproduccindecalorconcomitante.Debidoalamasatotal
delmsculoesqueltico,estosefectosdelahormonatiroideatienenunimpactosobreelmetabolismodesustratode
todoelcuerpoylatermognesis(671).
Labasedelaplasticidadmusculareslaregulacinbastantecoordinadadelaexpresindelosgenesqueregulanlas
propiedadescontrctilesymetabolismodelaenergaenrespuestaaloscambiosenlassealesexternas,comoeluso
oestadodelatiroides.Aunquelosefectosglobalesdelahormonatiroideasobrelafisiologadelmsculoson
relativamentesencillos,losefectossobrelaexpresingnicaaniveldelasfibrasmuscularesindividualesson
complejasypuedenserdiametralmenteopuestas,dependiendodelcontexto(676,680).Porejemplo,laexpresin
deMHCIIaestfuertementeestimuladoporlahormonatiroideaenlosmsculospredominantementelentos,pero
igualmentefuertementereprimidaenlosmsculosrpidamente(674,680).Adems,laexpresindeambos
SERCA1aySERCA2aesttranscripcionalmenteestimuladaporT3.Sinembargo,entirotxicamsculolentola
expresindeSERCA2aseapagaenlamayoradelasfibrasysesustituyeporSERCA1a(676),peroalmismo
tiemposoncoexpresadoenaltosnivelesenotrasfibras.Estoreflejaprincipalmentelasdiferenciassutilesenlas
distintasunidadesmotorasquecomponenelmsculo.Enconsecuencia,elanlisisdemsculoenterodelaexpresin
gnicanopuedeproporcionarunaimagenprecisadelosefectosdelahormonatiroidea,sobretodocuandosetrabaja
conlosmsculosdeltipodefibramixtos.Portanto,estosestudiosdeberanincluiranlisisdeseccionesdetejidopara
determinarlosefectosenfibrasindividuales.
Enlosmamferosmsgrandes,todoslosmsculosesquelticoscontienenunamezclavariabledefibrasrpidasy
lentas.Sinembargo,enlosroedoresalgunosmsculosdelasextremidadestraserassecomponenprincipalmentede
tipoIydetipolentointermediosfibrasIIA,comoelsleodecontraccinlenta(SOL)muscular,oescribirrpidoIIB
fibras,talescomoeldecontraccinrpidaextensordigitorumlongus(EDL)muscular(681,682).Por
consiguiente,estosmsculosseutilizanamenudocomomodelosparaestudiarlosefectosdelahormonatiroideaen
laspropiedadesmusculareslentasyrpidas.
RECOMENDACIN60
Losefectosdelahormonatiroideaenelmetabolismoycontrctilespropiedadesenergticasdelmsculo
puedenserevaluadosporelanlisisdelospreparativosdelasextremidadestraserasperfundidos.
Comentario EnelmodelodemsculobombadeperfundidounasolaextremidadposteriordelarataseperfundiTras

elcateterismodelaarteriafemoralylavena(683).Lacontraccindeungrupodemsculosodeunsolomsculo
seactivayaseaporestimulacindelnervioqueinervaomedianteelusodeelectrodoscolocadosenelmsculo.
ParmetrosdecontraccinseregistranusandountransductordefuerzaconectadaaltendndeAquiles.Controldela
velocidadylacomposicindelmediodeperfusinpermitelamanipulacindesustratoyelsuministrodeoxgeno.
Anlisisdelaperfusinvenosaproduceinformacinsobrelarespuestametablicadurantediferentesprotocolosde
estmuloypermiteelclculodelaeficienciadecontraccin.Distribucindelflujosanguneoatravsdelosdiversos
msculosperfundidossepuededeterminarusandomicroesferasradiomarcadas,ylosanlisishistoqumicosy
bioqumicospuedencomplementarlosanlisisdelafuncindelmsculo(684).Aunquehayalgunaslimitaciones,
enparticularlaausenciadeunaregulacinvasomotoranormal(683),estemodeloquemejorseaproximaalainvivo
situacindelosmsculosesquelticosactivosysehautilizadoparaestudiarlasconsecuenciasfuncionalesy
metablicasdetirotoxicosis(685)yelhipotiroidismo(684,686).Estametodologahastaahoranohasidodescrita
pormodelosderatn.
RECOMENDACIN61
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

73/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Lainteraccinentrelahormonadelatiroidesylaactividadneuromuscularenlaregulacindelas
propiedadesdelmsculopuedeserestudiadainvivoporlaestimulacinelctricadirectadelosmsculos.
Comentario DecontraccinlentamsculoscomoelmsculoSOLsuelenseractivadoporlasneuronasmotoras

generandolargostrenesdeimpulsosdebajafrecuencia,mientrasquelosmsculosdecontraccinrpidaseactivan
deformaintermitenteporbrevesrfagasdeimpulsosdealtafrecuencia.Losefectoscontrapuestosdelahormona
tiroideaydetipolentoinervacinsobrelaexpresingnicadelmsculo(674)sepuedenestudiarmediantela
imposicindeunpatrndeestimulacindebajafrecuenciacrnicaencontraccinrpidamsculosdelas
extremidadestraseras.Enestemodelo,elnervioperoneodelaextremidadposteriorseestimulacontinuamenteinvivo
a10 Hzparaunmximode20dasatravsdeelectrodosimplantados.Laexpresindegenesyeltipodefibra
composicindecontraccinrpidatibialanteriorylosmsculosEDLdelaextremidadposteriorestimuladoy
contralateralpuedensercomparados.Estemtodohasidoutilizadoparaevaluarlosefectoscombinadosdela
hormonatiroideaydetipolentoinervacinenlaexpresindefactoresmiognicasreguladoras(687)ylasisoformas
deMHC(688).
RECOMENDACIN62
Losefectosdelahormonatiroideaenlaspropiedadescontrctilespuedenserevaluadosporexvivoanlisisde
losmsculosintactosyfibrasmuscularesaisladas.
Comentario Elanlisisdetalladodelaspropiedadescontrctilesderatayratnmsculosesquelticosrequiereexvivo

anlisis.ElmsculodecontraccinlentaSOLtpicamentesehautilizadoenestudiosqueimplicanlahormona
tiroidea(689692)debidoalamayorcapacidadderespuestaencomparacinconeldecontraccinrpidaEDL(
693).Aunquelaspropiedadescontrctilessepuedengrabarconelmsculoizquierdainsitu,elanlisisdemsculos
aisladosenunacmaradeestimulacinpermiteunamayorflexibilidadexperimental(690).LosmsculosEDLy
Solsonrelativamentedelgadasysuperfusionproporcionasuministrosuficientedeoxgenoysustratos,aunquelas
temperaturasreducidas(21C30C)puedesernecesariaparaprevenirlahipoxiadurantelaestimulacin
prolongada.Msculoscontralateralessemantienenenmediodesuperfusinoxigenadaparaservircomocontrolesen
losanlisisbioqumicossubsiguientes.Losparmetrostpicosanalizadosincluyencontraccinylarespuesta
contrctiltetnica,relacionesfuerzafrecuencia,lapotenciacinpostrestodeldesarrollodelafuerza,ylasrespuestas
derecuperacindelafatiga.Equiposysoftwarededicadoyaestdisponibleparaestetipodeanlisis(694).
Aunquetcnicamentedifcil,lasfibrasmuscularesindividualespuedenaislarsedelosmsculosesquelticostales
comoelSOLylosmsculosEDL(692,695)yeldiafragma(696).Enesteltimo,lahormonatiroideatambin
induceuncambioenelfenotipodetipofibradelentaarpida(697)yexvivoanlisisdelaspropiedadescontrctiles
deestemsculorequierefibrasindividualesohacesdefibras(698).Fibrasaisladassonqumicamentepiely
montadosentreuntransductordefuerzayunmotor,loquepermitelamedicindelascontraccionesisomtricase
isotnicas.Lacontraccinolarelajacinseconsigueporinmersindelasfibrasensolucionesquecontienen
concentracionesaltasobajasdecalcio,respectivamente.Anlisisdeunasolafibraposteriordelacomposicinde
protenascontrctilespermiteunaevaluacindetalladadelosefectosdelahormonatiroideaenelfenotipodelafibra
ylaspropiedadescontrctiles(692).
RECOMENDACIN63
Larespuestadeltejidodelmsculoesquelticoalahormonatiroideasepuedeevaluarmedianteelanlisisde
ensayosdeexpresindegenesyenzimas.
Comentario AnlisisdelaexpresingnicamuscularserealizaporRTqPCR(92,699,700)(verlaSeccinI.2,

Recomendacin35paraconsideracionestcnicas)ymedianteelanlisisdelosnivelesdeprotenautilizando
electroforesisengeldepoliacrilamida,seguidoporcuantificacindebandasteidasoWesternblotensucaso.Las
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

74/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

isoformasdeMHC,ascomolasisoformasdeMLC,sepuedensepararporelectroforesisengeldealtaresolucin.
Latincinconplatayanlisisdensitomtricoposteriorpermiteladeterminacinprecisadelosnivelesdeexpresin
relativosdelosdiferentesisoformasenmuestrastanpequeascomofibrasindividuales(679,692,699,701,702).
LosanticuerposparaelanlisisdeWesternestndisponiblesparaungrannmerodeprotenasdelmsculo
esquelticocodificadasporgenesqueestndirectamenteoindirectamentereguladaporlahormonatiroidea,
incluyendoMyoD,miogenina,isoformasdeMHC,SERCA1a,SERCA2a,mioglobina,PGC1,RYR,yNa+K+
ATPasasubunidades(92,691,701,703,704).
Elretculosarcoplsmico(SR)esresponsabledehastaun50%delconsumodeenergaenelmsculoactivo.El
efectodelahormonatiroideaenestaactividadATPasapuedeserevaluadaespectrofotomtricamenteen
homogeneizadosdemsculosenterosofibrasindividuales(701,705).FragmentosdemembranadeRSen
homogeneizadosmuscularesvuelvenasellarenvesculasqueconservanlacapacidaddeabsorberyalmacenarCa2+
.Usodecondicionesdeensayoqueestimulanselectivamenteestacapacidad,esposibledeterminarelCaATPasa
junto2+tasaabsorcinymximoCa2+capacidadAlmacenamiento(675,704,705).Elltimoproporcionauna
estimacindelgradodeproliferacindelaredmembranaSR,queesenpartedependientedelestadodelatiroides.
LosCa2+ATPasayCa2+absorcinensayosdeterminanlasactividadestotalesdeSERCA,peronopermitenla
discriminacinentrelosSERCA1aySERCA2aisoformas.
Ensayosestndarseutilizanparadeterminarlasactividadesdelasenzimasimplicadasenelmetabolismodeenerga
aerbicayanaerbica,talescomoelcitocromocoxidasa,citratosintasa,succinatodeshidrogenasa,lactato
deshidrogenasa,ylacreatinaquinasa(675,703).Lasmitocondriassepuedenaislarporcentrifugacindiferencial
paralamedicindelafrecuenciarespiratoria,elpotencialdemembranayotrosensayosenzimticos(706,707).
RECOMENDACIN64
Evaluacindelosefectosdelahormonatiroideasobrelacomposicindeltipodefibrademsculoesqueltico
requiereunanlisishistoqumicodeseccionesdetejido.
Comentario TiposdefibrasmuscularesesquelticassedistinguenprincipalmentesobrelabasedelaisoformadeMHC

expresadoesdecir,ellentoMHCIyrpidoMHCIIa,IIx/d,oIIbisoformas.Losanticuerposdiscriminarentre
estasisoformassehandescrito(708)yaunquealgunosserecomiendaprecaucincuandoseutilizaanticuerpos
comercialesactualmentedisponibles(709),elanlisisdeinmunofluorescenciamulticolorsehadescritoparala
evaluacinsimultneadelaexpresindetodaslasisoformasdeMHCenlaratayelmsculoesquelticoderatn
usandoestosanticuerpos(710).Mstpicamente,unmtodohistoqumicoparalaexpresindelaATPasa
miofibrilaresampliamenteutilizadoquedistingueentreIfibrastipoI(MHCI),fibrastipoIIB(MHCIIb),yfibras
intermedias(MHCIIa,MHCIIx/d)(684,692,700,702,711).Losmsculossesujetanensuaproximadainsitu
longitudysecongelaronenNlquido2cooledfrenoisopentano.Seriedecryosectionssecortandespusdevarios
anlisishistoqumicos.Cabesealarquenotodaslasfibrasseextiendennecesariamentelalongituddelmsculo.Este
esporejemploelcasoenelmsculoSOL,quedebeserseccionadopreferentementeenelpuntomotorparaincluir
todaslasfibras(682,702).
AnlisisadicionalesdepreocupacinlaexpresingnicadefibraespecficalaexpresinyactividaddelaSRCa2+
ATPasaenzimas.CrioseccionesenseriesepuedenutilizarparacorrelacionarlatipificacinfibraabasedeMHCcon
inmunohistoqumicadeSERCA1aySERCA2a(676,682),ascomoconmRNAsisoformaespecficainsitude
hibridacin(676).DiferenciasdefibraespecficaenSRtotaldeCa2+ATPasaactividadtambinsepueden
determinarhistoqumicamente(676).Losefectosdeltratamientodelatiroidesdelahormonasobrecaractersticasde
lafibrasondinmicosy,enalgunoscasos,sontransitoriosduranteunperododevariosdas(676).Estodebe
tenerseencuentaalestudiarlosanimalestratadosdurantemenosde14das.
RECOMENDACIN65
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

75/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Loscultivosprimariosdeclulasdemsculoesqueltico,ascomodiversaslneascelularespuedenser
utilizadosparaestudiarlaexpresindegendelahormonadelatiroidesreguladoysuinteraccinconla
actividadcontrctil.
Comentario Loscultivosprimariosdemioblastosdemsculosepuedeobtenerderataoderatnmsculos

esquelticosneonatales(92,712715).Dependiendodelacomposicindelmediodecultivo,losmioblastosse
puedenmantenerenunestadoproliferativo,opuedenserinducidasafundirseyformarmiotuboscontratantes
espontneamente.Lainteraccindehormonastiroideasylaactividadcontrctilenlaspropiedadesdemiotubos
puedeserestudiadoporlascontraccionesqueinhiben(715)oporestimulacinelctricadirectadelosmiotubosen
cultivo(712).Aunqueloscultivosprimariosproporcionanunmodeloverstilparaestudiardiferentesaspectosdela
regulacindegenesmsculo,debetenerseencuentaquemiotubosnosedesarrollancompletamentecaractersticas
fenotpicasadultos.
ElC2C12deratn(704,716718)ylaL6derata(704,717,719721)laslneascelularesdemioblastosse
utilizancomoalternativasdecultivosprimariosenlosestudiosdelaaccindelahormonadelatiroides.Lastcnicas
estndarparalatransfeccindeclulaspuedenutilizarseparaanalizarlaregulacindelaexpresingnica(vasela
SeccinI.4).LossubclonesdelalneacelularL6conpropiedadesligeramentediferenteshansidoaisladospor
variosgrupos(704,721).Enparticular,elL6AMsubcln(721)muestraunamayorrespuestaalahormona
tiroideaencomparacinconlalneacelularoriginalL6.Similaracultivosprimarios,cultivosdemioblastos
confluentesdeambaslneascelularespuedenserinducidasaformarmiotubos,perosloC2C12miotubospuedenser
inducidasacontratarporlaestimulacinelctrica.SehandesarrolladomtodosparaestimularmiotubosC2C12
crnicaointermitenteduranteunmximode4dasutilizandoelectrodosdeestmulointegradosenplacasdecultivo
estndar(718,723).Estatcnicapermiteunanlisismsdetalladodelainteraccinentrelahormonadelatiroides
ylaactividadcontrctilenlaexpresingnicadelmsculo(718).
[J.5]Esqueleto
Fondo Laresistenciaseaenadultosestdeterminadaporlaadquisicindelamasaseaymineralduranteel

crecimientoylaposteriortasadeprdidaseadurantelaedadadulta.Estadoeutiroideonormalesesencialparael
desarrollodelesqueleto,elcrecimientoylamineralizacinyesunfactordeterminantedelamasaseamxima.T3
tambinregulalaremodelacinseaenlosadultos,ylacondicindelatiroidesesundeterminanteimportantedela
tasadeprdidasea(724).Elhipotiroidismoprovocaunestadodedisminucindelrecambioseo,quesise
prolongapuededarlugaralaacumulacindemasaseaymineral.Porelcontrario,tirotoxicosisaceleraelrecambio
seoylaprdidaresultanteenlaosteoporosis.
RECOMENDACIN66
Efectoshormonastiroideassobreelcrecimientolinealpostnatalylamaduracinseasedeterminanmejorex
vivomedianteelusodemuestrasdelosanimalesrecolectadosenedadesdefinidas.
Comentario Losratonesdebensergenotipoeidentificadosaedadespostnatalesjvenesmientrasquepreservasucola

demaneraquelavelocidaddecrecimientolinealpuededeterminarsepormedicinsemanaldelongituddelacola
entrepostnataldaP7aP70.LavelocidadmximadecrecimientoseproduceentreP14yP42enratones,yla
comparacindelascurvasdecrecimientoproporcionaunaindicacinprecisaderetrasoeneldesarrollo.RatonesP1
neonatalesylasextremidadesdelosanimalesdeedadescomprendidasentreP21yP42debenteirsederojode
alizarina(hueso)yazulalcin(cartlago)parainvestigareldesarrollodelesqueletointrauterinoyelprogresodela
formacinseaposnatal.reasdemedicindelasdimensionesdelcrneo,lasfontanelasysuturasproporcionanuna
evaluacindelaosificacinmembranosamedidasdelongitudyelcrecimientoseoplacahistomorfometrason
indicadoresprecisosysensiblesdelaprogresindelaosificacinendocondral(725731).
RECOMENDACIN67
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

76/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Larespuestaestructuralylamineralizacindelhuesoadultoaalteracionesenelestadodelatiroidesola
interrupcindelaaccindelahormonatiroideasepuedeevaluarusandolastcnicasdeimagen
complementariosadiferentesnivelesderesolucin.
Comentario Anlisisdelesqueletoenratonesrequierelarecoleccindemuestrasdehuesoexvivo.Noesposible

determinarconprecisinlosparmetrosestructuralesinvivodebidoalasmodalidadesdeimagennotienensuficiente
resolucinparadiscriminarcaractersticasdehuesotrabecularconprecisinymuchomsinformacinsepuede
obtenerdeexvivomuestrasutilizandoenfoquesymtodoscomplementarios(Fig.19).Contenidomineraldelhueso,
lalongituddelhueso,yhuesocorticalmedicionessedeterminanenloshuesoslargosyvrtebrasdelosadultosde
edadescomprendidas12semanasenadelanteporFaxitronpuntodeproyeccindigitalmicrorradiografaderayosX(
725).Lamicroarquitecturaseaylosparmetrosvolumtricosdeformacindeimgenesrequierensofisticadosy
puedenserobtenidosporaltaresolucinmicroCT(hastaunaresolucinmximanominalde0,52 micras).Los
volmenesdehuesocorticalytrabecularcomoproporcionesdevolumendetejido,elespesortrabecular,separacin
trabecular,yelnmerotrabecularsepuedendeterminar.Talesparmetrosenelratnestnenloslmitesde
resolucinespacialpormicroCT.Elanlisisdetalladodelamicroarquitecturaseayladensidaddemicro
mineralizacinpuedeseranalizadousandoespecialistavolverelectrnmicroscopaelectrnicadebarridodispersa
(BSESEM)tcnicas(725727,729731).Losefectosdelestadotiroideoalteradolosparmetrosdecrecimiento
linealyhuesoestructuralsonsignificativosydeterminarfcilmenteelusodeestosmtodos,aunqueserequieren
equiposespecializadosydeanlisisdedatosmtodos.
FIG.19.
Esquemaparalarecogidademuestrasdehueso,lafijacindeltejido,y
mtodosdeanlisis.Elusodeestegrficosepuedemaximizarlainformacin
obtenidafenotipodelosratonesjuvenilesyadultos.qBSESEM,
retrodispersadadeelectronesmicroscopadebarridodeelectrones
cuantitativa....
RECOMENDACIN68
Latiroidescambiosinducidosporlashormonasenlaestructuraseaylamineralizacinsereflejanpor
anormalidadesfuncionales,quepuedenserinvestigadospordeterminacindelaspropiedadesbiomecnicas
bajocarga.
Comentario Lafuerzadehuesosedeterminautilizandoelequipodecargamecnicaadecuada(Fig.20).Ensayosde

flexindetrespuntosdestructivasserealizanenloshuesoslargosdelosratonesadultosparadeterminarlasvariables
biomecnicasdelhuesocorticaldelascurvasdedesplazamientodecarga,incluyendolarigidez,lacargamxima,la
cargadelafractura,ylasenergasdisipadasamximacargayfractura.Resistenciaalacompresindelhueso
trabecularsepuededeterminardemanerasimilarenlasvrtebras.Medicionesdereadeseccintransversalse
obtienenapartirFaxitronymicroCTyutilizandatosconlosdatosbiomecnicosparacalculartensinderotura,la
tensindefluencia,ylosparmetrosdemdulo(725).Estudiosmsdetalladosyespecializadosdelaspropiedades
delmaterialdehuesoenvariasescalasderesolucinsepuedenobtenerutilizandotcnicasyequiposaltamente
sofisticadosencolaboracinconlaingenierayotroslaboratoriosespecializados(732734).Talesmediciones
proporcionanunadeterminacinprecisadelaresistenciaseajuntoconlaevaluacindesuspropiedadesdelmaterial
(fragilidadodeductilidad)quesevenafectadossignificativamente,porejemplo,porlaprdidademasaseayel
contenidomineralenlatirotoxicosis.

http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

77/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

FIG.20.
AparatodebastidordecargaInstron5534paratrespuntosdepruebadecurvaturadestructivode
laresistenciasea.Montajespersonalizadosincorporansoportesredondeadosypasadoresde
cargaqueminimizanlasfuerzasdecorteydecorte,permitiendoasalosparmetros
biomecnicosdelaresistenciaseaa...
69aRECOMENDACIN
Respuestasmetablicasyloscambiosenlaresorcinseaylaformacinenrespuestaalacondicindela
tiroidesalteradopuedenevaluarseindirectamentepormedicindelosparmetrosdesuero.
Comentario Elanlisisbioqumicodelmetabolismomineralyelrecambioseodebeincluirlamedicindesuerode
Ca2+,Mg2+,PO43 ,yfosfatasaalcalina,quesepuededeterminarutilizandoautoanalizadoresestndar.Adems

dedeterminacindelacondicindelatiroides,otrashormonasqueafectanelhuesosepuedeensayarusando
ensayoscomerciales,incluyendolacorticosterona,lavitaminaD,hormonaparatiroidea,yelfactor1decrecimiento
similaralainsulina.Adems,lahormonagonadotropinasexoyestadopuedendeterminarsesiesnecesario(735).
Anlisisindirectoderecambioseopuedeobtenersemediantelamedicindelaresorcinseaylosmarcadoresde
formacinutilizandokitsdisponiblescomercialmente(725).CterminalreticuladatelopptidodecolgenotipoIyla
fosfatasacidaresistentealtartrato(TRACP)5BsonmedidosporELISAyensayodelaactividaddelaenzima
inmunofijoenfaseslidacomoindicadoresderesorcinsea.Nterminaldelpropptidodeprocolgenodetipo1y
laosteocalcinatambinsemidiporELISAyIRMAcomomarcadoresdeformacinsea.Evaluacinde
marcadoresderecambioseoidealmentedeberealizarseidealmenteenlamaanaenanimalesenayunasparamitigar
losefectosdiurnosydietticasdeconfusinsobreelrecambioseo.Roedoresmayorestienenbajosnivelesde
recambioseoenelestadobasalyladeterminacinnosepuedenrealizardeformafiabledespusdecercade12a
16semanasdeedadcomolosnivelesdemarcadoresestarncercadeloslmitesdedeteccin.Esimportanteteneren
cuentaquehaydiferenciasporsexoylacepaespecficadelamasaseayelvolumendenegociosyelcuidadoenel
diseoexperimentaldebeseradoptadasparagarantizarcamadasecomparanenloposible.Sinembargo,lamedicin
derecambioseoutilizandomarcadoresseossustitutosesunmtodoestablecidoenelcampoqueproporciona
informacinadicionalpararespaldarlosdatosdeimagenylahistologa.
69bRECOMENDACIN
Losefectosdelahormonatiroideaenelrecambioseopodranimplicarefectossobrelaresorcin
osteoclsticadelhueso,laformacinseaosteoblstica,ounacombinacindeambos.Elanlisisbioqumico
delosmarcadoresderecambioseoenrespuestaalahormonatiroideaproporcionaunaevaluacincrudo
indirectadeestosparmetros,peroestotambindebeserinvestigadodirectamenteeneltejidoseo.
Comentario Elhipotiroidismoprovocalareduccindelrecambioseoqueafectantantoalaformacinyresorcin

sea.Tirotoxicosisaceleraambosparmetrosconunmayorefectoenlaresorcinseaqueresultaenlaprdidade
hueso.Parainvestigarycuantificarlabasecelularparaelrecambioseoalterado,serequierenmedicionesdinmicas
delahistologa.Losratonesrecibendosinyeccionesintraperitonealesdelacalcenafluorocromo(15 mg/kgen
solucinsalinacon2%debicarbonatodesodio)aproximadamente7y4dasantesdelsacrificio,aunqueelintervalo
deprecisinpuedeservariadaydebeserdeterminadaempricamentedependiendodelanlisisdisponiblelocalmente
tcnicas.Parmetroshistomorfometraseadinmicodebendeterminarsedeacuerdoconelsistemaestndarde
nomenclatura(736).LaresorcinseaseinvestigenlasseccionesdehuesoteidasparaTRACP,ynmerode
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

78/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

osteoclastosylasuperficiedeterminadapormicroscopadeluzynormalizadoalasuperficieseatotal.Superficiesde
resorcinseacorticalytrabecularenvivotambinsepuedendeterminarusandotcnicasespecializadasBSESEM(
725,727,729),aunquetalesmtodosnosonrutinariamenteoampliamentedisponibles.Laformacindehuesose
cuantifiquenendoblehuesocalcenamarcadoporhistomorfometraylosndicesdeformacindehuesonorma
determinautilizandoImageJ(http://rsbweb.nih.gov/ij)deacuerdoconlaAmericanSocietyforBoneandMineral
Investigacinsistemaestndardenomenclatura(736).Mtodosalternativosdealtaresolucinusandomicroscopa
confocalsepuedenrealizarenlaboratoriosespecializados(725,737).Estudiosdeexpresingnicasepuede
realizarenlasseccionesdescalcificadasparafinadehuesoycartlago(insituhibridacinyIHC),utilizandoARN
extradodemuestrasdetejido(deexpresindeARNmydeperfiles)yenlosextractosdetejidoesqueltico
(expresindeprotenasyensayosdeactividadenzimtica)(726,727,729731,738740).
70aRECOMENDACIN
Losmecanismosdeaccindelahormonatiroideaenelcartlagosepuedenestudiarencultivosdecondrocitos
preparadosapartirdelasextremidadesocajastorcicasderatonesneonatales.
Comentario Elhuesoesunrganocomplejoylasrespuestascelularesalahormonatiroideapuedeserdeterminadapor

invivoenlosestudiosytejidos.UnacomprensinmsprofundadelosmecanismosmolecularesdelaT3acciny
lasvasdesealizacinimplicadasenlamediacindeT3respuestasenlinajesdeclulasseassepuedeobtener
medianteelestudiodelosefectosdelahormonatiroideaencultivoscelularesprimariosdeclulasesquelticas.
Condrocitosprimariosseprepararonapartirderatonesrecinnacidos(741,742)ylaproliferacin,la
diferenciacin(colgenoXmRNAexpresin,actividaddelafosfatasaalcalina,latincindeazulalcin),apoptosis,
ylasrespuestasdelaexpresingnica(Ihh,PTHrP,Sox9porRTqPCR)aT3tratamientodeterminadespusde7,
14y28das.CabesealarqueloscondrocitossondifcilesdeestudiarinvitrodebidoaquetiendenaDEdiferenciar
yadquirirunfenotiposimilarafibroblastosencultivoenmonocapadespusdeunospocosdas.Estonosuponeun
problemaparalosestudiosdeexpresingnicasilainvestigacinderespuestasagudasaT3eltratamientoselimita
alanlisisdelasclulascultivadasrecientementeenlasprimeras48horas.Sinembargo,enestudiosparainvestigar
losefectosdelahormonatiroideaenlacondrognesisylaproliferacincelularduranteperodosdetiempo,comoya
sehaindicado,loscultivos3Ddebenrealizarseensuspensindeagarosamslargosparaevitarlatendenciaala
desdiferenciacindeloscondrocitoscuandosecultivanduranteperodosprolongadosenmonocapas(653).
70bRECOMENDACIN
Cultivosdeosteoblastospuedenemplearseparainvestigarlosmecanismosdeaccindelahormonatiroidea
sobreladiferenciacincelular,ascomoenlosensayosdemineralizacinseafuncionalesinvitro.Tales
cultivossepreparannormalmentepordigestinconcolagenasadecalotasobtenidosderatonesneonatales
utilizandotcnicasestndar.
Comentario LososteoblastosexpresanTRy,aligualqueloscondrocitos,responderdirectamentealasaccionesdeT3

.OsteoblastosdecalotaprimariosseprepararonapartirdecachorrosP4ylaproliferacin,ladiferenciacin
(osteocalcinaymRNAosterixexpresin,actividaddelafosfatasaalcalina,ensayosdemineralizacindecolorrojoy
devonKossadealizarina),ylaexpresingnica(Runx2,OPG,receptoractivadordelfactornuclearkappaB
ligando[RANKL]porRTqPCR)lasrespuestasestndeterminadasporlogeneraldespusde7,14y28das(738
740,743).
70cRECOMENDACIN
Losefectosdelahormonatiroideaenlaosteoclastognesisylafuncinsepuedendeterminarencultivosde
osteoclastospreparadosapartirde6semanasdeedad,loshuesoslargosderatn.Losprotocolosutilizados
incluyeneltratamientodeclulasdemdulaseaextradasconelfactorestimulantedecoloniasdemonocitos
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

79/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

yRANKLparainducirlaformacindeosteoclastosinvitro.
Comentario LamdulaseaesaisladodeloshuesoslargosdelosratonesP42ycultivosprimariostratadosconel

factorestimulantedecoloniasdemonocitosyRANKLparainducirlaformacindeosteoclastosinvitro(725,729,
740).Nmerodeosteoclastos(despusdetincinTRAP)yladiferenciacincelular(actividadTRAP,receptorde
calcitonina,lacatepsinaKexpresindeARNm)sedeterminandespusdelosdas0,3,6y9das.Actividaddelos
osteoclastostambinsepuededeterminarmedianteelensayoderesorcindeladentinausandotcnicasestndar
empleadaspreviamenteenlosestudiosdeT3accin(725,729).Elmecanismodeaccindelahormonatiroideaen
funcindelososteoclastosActualmentenoestclaro,ynosesabesilaprincipalrespuestaparaaumentarlaresorcin
seaosteoclsticarepresentaunefectodirectodelaT3enosteoclastososilarespuestaesunefectosecundario
mediadoatravsdelasaccionesdeT3enlososteoblastos,clulasestromalesdemdulasea,uotrosfactores.
Abreviaturasutilizadas

Ira:

2D bidimensional
3D tridimensional
5'd 5'desyodacin
5D 5desyodacin
ATA AsociacinAmericanadelaTiroides
MURCILAGO tejidoadiposomarrn
BSA albminadesuerobovino
BSESEM microscopaelectrnicadebarridodeelectronesretrodispersados
bTSH TSHbovina
BW pesocorporal
CAR androstanereceptorconstitutiva
Chip inmunoprecipitacindelacromatina
SNC sistemanerviosocentral
Connecticut Latomografacomputarizada
Connecticut umbralcrtico
D1 tipoIdesyodasa
D2 tipoIIdeiodinasa
D3 TipoIIIdeiodinasa
DITPA cido3,5diiodothyropropionic
TDT ditiotreitol
DUOX2 dualoxidasa2
ECG electrocardiograma
EDL extensorlargodelosdedos
EDTA cidoetilendiaminotetraactico
ELISA ensayoinmunoenzimtico
EMSA ensayosdedesplazamientodeelectromovilidad
EYFP protenaamarillafluorescentemejorada
FBS suerobovinofetal
FT3I Tlibre3ndice
FT4I Tgratis4ndice
GFP protenaverdefluorescente
GPD glicerofosfatodeshidrogenasa
H&E hematoxilinayeosina
HFUs ultrasonidodealtafrecuencia
HPLC cromatografalquidadealtaresolucin
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

80/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

HPT ejehipotlamohipfisistiroides
Ibat BATinterescapular
ICV intracerebroventricular
IHC inmunohistoqumica
IRMA ensayoradiomtricoinmune
KClO4 percloratodepotasio
KO knockear
LDL lipoprotenadebajadensidad
TAPA dietabajaenyodo
LPS lipopolisacrido
LT4 levotiroxina
LV ventrculoizquierdo(ventricular)
MCT monocarboxilatotransportador
MHC cadenapesadadelamiosina
MLC cadenaligeradelamiosina
MMI metimazol
MRI imgenesporresonanciamagntica
NaClO4 percloratodesodio
NIS yodosymportersodio
NTI enfermedadnotiroidea
OATP polipptidotransportadordeanionesorgnicos
SAFP 3'fosfoadenosina5'fosfosulfato
PBS bufferfosfatosalino
PCR reaccinencadenadelapolimerasa
PET Latomografaporemisindepositrones
PTU 6npropil2tiouracilo
PXR receptordepregnanoX
RAIU lacaptacindeyodoradiactivo
RANKL receptoractivadordelfactornuclearkappaBligando
rhTSH TSHhumanarecombinante
RIA radioinmunoensayo
RNAseq LassecuenciasdeARN
RQ cocienterespiratorio
rT3 3,3',5'triyodotironina
RTqPCR latranscriptasainversaPCRcuantitativa
RV ventrculoderecho(ventrculo)
SR retculosarcoplsmico
SERCA1y2 sarcoplsmico/endoplasmticoCaretculo++ATPasa1y2
SIMS espectrometrademasasdeionessecundarios
SLC26A4/PDS pendrin
SNS sistemanerviososimptico
SOL sleo
SPECT latomografacomputarizadaporemisindefotones
SR retculosarcoplsmico
SULT sulfotranferase
T2 3,3'diyodotironina
T3 3,3',5triyodotironina
T3RE T3elementosensible
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

81/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

T3S T3sulfato
T4 tiroxina
TBG globulinafijadoradetiroxina
TCA cidotricloroactico
T/ebp protenadeuninapotenciadorespecficasdelatiroides
Tetrac cidotetraiodotiroactico
Tm puntodetiempodeequilibrio
TR receptordelahormonatiroidea
TRACP tartratoresistentealafosfatasacida
TRH hormonaliberadoradetirotropina
TRIAC tiratricol(cido3,5,3triyodotiroactico)
TrisHCl 2amino2hidroximetil1,3propanodiolclorhidratode
TSH tirotropina
TSHR ReceptordeTSH
UDPGA cidoUDPglucurnico
UGT UDPglucoroniltransferasa
UPLC cromatografalquidadeultraalta
VO2 elconsumodeoxgeno
CMLV clulasdemsculolisovascular
Notasalpie
*
Presidentetodoslosdemsautoressemuestranenordenalfabtico.

Ira:

AGRADECIMIENTOS

Ira:

ElgrupodetrabajodeseaagradeceralaSraBobbiSmith,DirectorEjecutivo,ATA,ylaSraAdoniaCoatesylaSra
SharleeneCano,miembrosdelpersonalATA,porsuasistenciaalgrupodetrabajo,suayudadeexpertos,ysu
apoyoSr.CezarBianchiparalaasistenciavaliosaconilustracionesylaSraYanettePericichyCristinaAndrade
(DivisindeEndocrinologadelaUniversidaddelaEscuelaMillerdeMedicinadeMiami)porsuayudala
preparacindeltexto.Elgrupodetrabajotambindeseaagradeceralossiguientescolegasqueaportaroncomentarios
interesantesy/omaterialdeapoyo:
SherineAbdalla,MD(DivisindeEndocrinologadelaUniversidaddeMiamiEscueladeMedicinaMiller)
AnitaBoelen,PhD(DepartamentodeEndocrinologa,CentroMdicoAcadmicodeAmsterdam,Pases
Bajos)
DeniseP.Carvalho,MD,PhD(CarlosChagasFilhoInstitutodeBiofsicadelaUniversidadFederaldeRo
deJaneiro,RodeJaneiro,Brasil)
OrsolyaDohan,MD,PhD(DepartamentodeEstudiosClnicosdelaFacultaddeCienciasdelaSalud
PrimerDepartamentodeMedicinaInternadelaFacultaddeMedicicnelaEscueladeMedicina
Semmelweis,Budapest,Hungra)
JamesFagin,MD(DivisindeEndocrinologa,CentrodeCncerMemorialSloanKettering,NuevaYork,
NY)
TatianaFonseca,PhD(DivisindeEndocrinologadelaUniversidaddeMiamiEscueladeMedicinaMiller)
RonaldKoenig,MD,PhD(DivisindeMetabolismo,EndocrinologayDiabetesdelaUniversidadde
Michigan,AnnArbor,MI)
VaniaNariz,MD,PhD(DepartamentodeAnatomaPatolgica,HospitalGeneraldeMassachusetts,
Boston,MA)
MiriamO.Ribeiro,PhD(DepartamentodeCienciasBiolgicasyCentrodeCienciasdelaSalud,
UniversidadPresbiterianaMackenzie,SoPaulo,Brasil)
ThomasScanlan,PhD(DepartamentodeFisiologayFarmacologadelaFacultaddeMedicinadela
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

82/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

OregonHealthandScienceUniversity,Portland,OR)
StevenJ.Soldin,PhD(DepartamentodeMedicinadeLaboratorio,InstitutoNacionaldeMedicina,
Washington,DC)
CintiaUeta,PhD(DepartamentodeAnatomadelaUniversidaddeSoPaulo,SoPaulo,Brasil)
EstaobrafuefinanciadaenparteporelprogramadeinvestigacinintramuraldelNIDDKenlosInstitutosNacionales
deSalud(DF),NIDDKotorga2R01DK5853808,1R01DK06505502,R01DK77148(ACB),R37DK015070(a
XHLySR)yR21HD07252602(aVAG),subvencinNICHDR03HD061901(aPAK),SAF201232491del
MINECOyS2010/BMD2423deCAM(aOMJ),FundacinEstadosUnidosIsraelBinacionalScience(aGA),la
FundacinNacionaldeCienciasdeHungra(OTKAK81226)yelSptimoProgramaMarcodelaComunidad
Europea(FP7/20072013)envirtuddeacuerdodesubvencinno.259772(BG),yelZonMwClnicadeBecas
Grant(90700412)yunZonMWTOPGrant(91.212.044)(RPP).
DECLARACINDEDIVULGACIN

Ira:

Divulgacindeinformacindurante2aosantesdediciembrede2012yelfuturoconocidoapartirdenoviembrede
2013:todoslosautoresdeclarannotenerconflictosfinancierosdeinteresessignificativosarevelar.
Referencias

Ira:

1.TodaS.,S.Aoki,UchihashiK.,MatsunobuA.,M.Yamamoto,OotaniA.,YamasakiF.,KoikeE.,SugiharaH.
2011.modelosdecultivoparaelestudiodelabiologadelatiroidesytrastornos.ISRNEndocrinol2011:.275782
[PMClibresartculo][PubMed]
2.RotmanPikielnyP.,HirschbergK.,MaruvadaP.,SuzukiK.,RoyauxIE.,VerdeED.,KohnLD.,Lippincott
SchwartzJ.,YenPM..2002Retencindependrinenelretculoendoplasmticoesunmecanismoimportanteparael
sndromePendred.HumMolGenet11:26252633[PubMed]
3.TaylorJP.,MetcalfeRA.,WatsonPF.,WeetmanAP.,TrembathRC..2002LasmutacionesdelgenPDS,
codificacinpendrin,estnasociadosconmislocalizationprotenaylaprdidadeflujodesalidadeyoduro:
implicacionesparaladisfuncintiroideaenelsndromePendred.JClinEndocrinolMetab87:17781784
[PubMed]
4.WeissSJ.,PhilpNJ.,AmbesiImpiombatoFS.,GrollmanEF..1984tirotropinaestimuladoeltransportedeyoduro
mediadaporlaadenosina3',5'monofosfatoydependientedelasntesisdeprotenas.Endocrinologa114:1099
1107[PubMed]
5.WeissSJ.,PhilpNJ.,GrollmanEF..1.984EfectodetirotropinaenyodurodeeflujoenclulasLRTF5mediadas
porCa2+.Endocrinologa114:11081113[PubMed]
6.WeissSJ.,PhilpNJ.,GrollmanEF..1984transportedeyodoenunalneacontinuadeclulascultivadasde
tiroidesderata.Endocrinologa114:10901098[PubMed]
7.DohanO.,PortulanoC.,BasquinC.,ReynaNeyraA.,AmzelLM.,CarrascoN.2007.ElNa+/Isymporter
(NIS)mediaeltransporteactivoelectroneutrodelpercloratodecontaminanteambiental.ProcNatlAcadSciEE.UU.
104:20.25020.255[ArtculolibrePMC][PubMed]
8.BiddingerP.2009.Anatomanormalylahistologaen:NikiforovY,editor,ThompsonL,editor,BiddingerP,
editor.(eds.)PatologaQuirrgicadeDiagnsticoyGenticaMoleculardelatiroides.LippincottWilliamsy
Wilkins,Philadelphia,pp110
.9PenelC.,RognoniJB,BastianiP.1987..autorregulacintiroides:impactoenlaestructuraylafuncindela
tiroidesenratas.AmJPhysiolEndocrinolMetab253:E165E172[PubMed]
10.H.Fujita1988.morfologafuncionaldelatiroides.IntRevCytol113:145185[PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

83/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

.11DelverdierM.,CabanieP.,RoomeN.,EnjalbertF.,VanHaverbekeG.1991.Anlisiscrticodelahistologade
tiroidesderatadespusdeltratamientocontiroxinaypropiltiouracilo.AnnRechVet22:373378[PubMed]
12.LeatherlandJF.,SonstegardRA..1980Estructuradelasglndulastiroidesysuprarrenalesenratasalimentadas
condietasdelosGrandesLagossalmncoho(Oncorhynchuskisutch).EnvironRes23:7786[PubMed]
.13KmiecZ.,KotlarzG.,SmiechowskaB.,MysliwskiA.1998.Elefectodelayunoyrealimentacinsobrela
estructurafolliculetiroidesylosnivelesdehormonasdelatiroidesenratasjvenesyviejas.ArcoGerontolGeriatr
26:161175[PubMed]
14.DenefJF,CordierAC,MesquitaM.,HaumontS.1979...Lainfluenciadelprocedimientodefijacin,unmedio
deinclusinyespesordelaseccindedatosmorfomtricosenlaglndulatiroides.Histoqumica63:163171
[PubMed]
15.AsmisLM.,KaempfJ.,VonGruenigenC.,KimuraET.,HEWagner.,StuderH.1996.Adquiridayresistencia
naturaldelasclulasfolicularesdelatiroidesalaaccininhibidoradelcrecimientodelfactordecrecimiento
transformantebeta1(TGFbeta1).JEndocrinol149:485496[PubMed]
.16CauviD.,PenelC.,NlendMC,VenotN.,AllasiaC.,ChabaudO.2000..Laregulacindelosvolmenesde
clulasdelatiroidesyeltransportedefluidos:efectosopuestosdeTSHyyoduroenlasclulascultivadas.AmJ
PhysiolEndocrinolMetab279:E546E553[PubMed]
.17..SchurchM.,PeterHJ,GerberH.,StuderH.1990folculosfrasenunbociomultinodularhumanosurgeen
partedeunabombadeyodurodefallaryenpartededeficienteorganificacinyodo.JClinEndocrinolMetab71:
12241229[PubMed]
.18H.Gerber,StuderH.,yvonGrnigenC.1985.efectosparadjicosdetirotropinaenladifusindela
tiroglobulinaenelcoloidedelosfolculostiroideosratadespusdeltratamientocontiroxinalargoplazo.
Endocrinologa116:303310[PubMed]
19.PedroHJ.,GerberH.,StuderH.,BeckerDV.,PetersonME.1987.Autonomadecrecimientoydelmetabolismo
deyodoenelbociofelinoshipertiroidismotrasplantadasenratonesdesnudos.JClinInvest80:491498
[PMClibresartculo][PubMed]
20.SenouM.,CostaMJ.,MassartC.,ThimmeschM.,KhalifaC.,PoncinS.,BoucqueyM.,GerardAC.,Audinot
JN.,DessyC.,J.Ruf,FeronO.,DevuystO.,GuiotY.,DumontJE.,VanSandeJ.,MuchosMC..2009Papeldela
caveolina1enelfenotipodelatiroides,lahomeostasiscelularylasntesisdehormonas:enelestudioinvivodela
caveolina1ratonesknockout.AmJPhysiolEndocrinolMetab297:E438E451[PubMed]
21.ElbastM.,WuTD.,GuiraudVITAUXF.,PetietA.,HindiE.,CampenC.,CroisyA.,GuerquinKernJL.,
ColasLinhartN.2008.[Cinticadeyodointracolloidaldentrodelatiroidesderatasrecinnacidas.Imaginera
directamedianteespectrometrademasasdeionessecundarios].CRBiol331:1322.(Enfrancs).[PubMed]
22.GerardAC.,PoncinS.,CaetanoB.,SonveauxP.,AudinotJN.,FeronO.,ColinIM.,SoncinF.2008.La
deficienciadeyodoinduceunestimulantedelatiroidesfasetempranadelahormonaindependientedemicrovascular
remodelacinenlatiroides.AmJPathol172:748760[ArtculolibrePMC][PubMed]
23.BurgiSavilleME.,H.Gerber,PeterHJ.,PaulssonM.,D.Aeschlimann,GlaserC.,KaempfJ.,RuchtiC.,
SidiropoulosI.,BurgiU.1997.Lospatronesdeexpresindelamatrizextracelularcomponenteseneltejidodela
tiroideshumanonormalnativaycultivadasyeneltejidodeadenomatxicohumana.tiroideas7:347356
[PubMed]
24.KimuraET,KoppP.,J.Zbaeren,AsmisLM,RuchtiC.,MacielRM,StuderH.1999....Laexpresindela
transformacindelfactordecrecimientobeta1,beta2ybeta3enbociomultinodularycarcinomastiroideos
diferenciados:unestudiocomparativo.tiroides9:119125[PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

84/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

25.WapnirIL.,vandeRijnM.,NowelsK.,AmentaPS.,WaltonK.,MontgomeryK.,GrecoRS.,DohanO.,
CarrascoN.2003.perfilinmunohistoqumicodelsodio/symporteryoduroentiroides,mamayotroscarcinomas
utilizandomicroarraysdetejidosdealtadensidadyseccionesconvencionales.JClinEndocrinolMetab88:1880
1888[PubMed]
26.ChenCR,ChazenbalkGD,WawrowskyKA,McLachlanSM,RapoportB.2006.....Laevidenciadequelas
clulastiroideashumanosexpresanreceptoresdetirotropinanoescindidas,decadenasencillaensusuperficie.
Endocrinologa147:3107a3113[PubMed]
27.BernierValentinF.,KostrouchZ.,RabilloudR.,MunariSilemY.,RoussetB.1990.vesculasrecubiertasde
clulastiroideasllevanmolculasdetiroglobulinayodados.Primeraindicacinparaunainternalizacindela
prohormonadelatiroidesatravsdeunmecanismodeendocitosismediadaporreceptor.JBiolChem265:17373
hasta17380[PubMed]
28.KoppP.2005.sntesisdelahormonatiroides:elmetabolismodelyododelatiroidesEn:BravermanL,editor,
UtigerR,editor.(eds.)WernerydeIngbarLatiroides:UnTextoFundamentalyClnica,novenaedicin.
Lippincott,Williams&Wilkins,Philadelphia,pp5276
.29.DaiG.,O.Levy,CarrascoN.1996Clonacinycaracterizacindeltransportadordeyodurodetiroides.
Naturaleza379:458460[PubMed]
30.DohanO.,DelaViejaA.,ParoderV.,RiedelC.,ArtaniM.,M.Reed,GinterCS,CarrascoN.2003..Elsodio/
symporteryoduro(NIS):caracterizacin,laregulacin,ylaimportanciamdica.EndocrRev24:4877[PubMed]
31.NilssonM.,BjrkmanU.,EkholmR.,EricsonLE.1990.transportedeyodoenlasclulasfolicularesdetiroides
decultivosprimarios:evidenciadeuncanaldeTSHreguladalamediacindeyodurodeeflujoselectivamentea
travsdeldominioapicaldelamembranaplasmtica.EurJCellBiol52:270281[PubMed]
.32GolsteinP.,AbramowM.,DumontJE,BeauwensR.1992..Elcanaldeyodurodelatiroides:unestudiode
vesculasdemembranaplasmtica.AmJPhysiol263:C590C597[PubMed]
.33...PesceL.,BizhanovaA.,CaraballoJC,WestphalW.,ButtiML,ComellasA.,KoppP.2012TSHregula
pendrinabundanciamembranayaumentaflujodesalidadeyoduroenlasclulastiroideas.Endocrinologa153:
512521[PMClibresartculo][PubMed]
34.ShcheynikovN.,YangD.,WangY.,ZengW.,KarniskiLP.,I.As,WallSM.,MuallemS.2008.Lasfunciones
detransportadordeSLC26A4comoelectroneutroCl/I/HCO3intercambiador:papeldeSLC26A4ySlc26a6en
lasecrecindeIyHCO3yenlaregulacindeCFTRenelconductoparotdeo.JPhysiol586:3813a3.824
[PMClibresartculo][PubMed]
35.DossenaS.,BizhanovaA.,NofzigerC.,BernardinelliE.,J.Ramsauer,KoppP.,PaulmichlM.2011.
Identificacindevariantesallicasdependrin(SLC26A4)conprdidaygananciadefuncin.CellPhysiolBiochem
28:467476[PMClibresartculo][PubMed]
36.DossenaS.,RodighieroS.,VezzoliV.,BazziniC.,SironiC.,G.Meyer,J.Furst,RitterM.,GaravagliaML.,
FugazzolaL.,PersaniL.,ZorowkaP.,StorelliC.,BeckPeccozP.,G.Botta,PaulmichlM.2006.mtodo
fluorimtricorpidoparamedirpendrin(SLC26A4)Cl/Itransporteactividad.CellPhysiolBiochem18:6774
[PubMed]
37.DossenaS.,RodighieroS.,VezzoliV.,NofzigerC.,SalvioniE.,BoccazziM.,GrabmayerE.,G.Botta,Meyer
G.,FugazzolaL.,BeckPeccozP.,PaulmichlM.2009.Caracterizacinfuncionaldetiposalvajeymutadopendrin
(SLC26A4),eltransportadordeanionesimplicadoenelsndromePendred.JMolEndocrinol43:93103
[PubMed]
38.N.Tran,ValentinBlasiniL.,BlountBC.,McCuistionCG.,FentonMS.,GinE.,A.Salem,HershmanJM..
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

85/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

2008estimulantedeltiroidesaumentalahormonatransporteactivodepercloratoenlasclulastiroideas.AmJ
PhysiolEndocrinolMetab294:E802E806[PubMed]
39.NilssonM.,BjrkmanU.,EkholmR.,EricsonLE..1992eflujopolarizadodeyoduroentirocitosporcinase
produceatravsdeuncanaldeyodurodecAMPreguladasenlamembranaplasmticaapical.ActaEndocrinol
(Copenh)126:6774[PubMed]
40.GillamMP,SidhayeA.,LeeEJ,RutishauserJ.,StephanWaeberC.,KoppP.2004...Caracterizacinfuncional
dependrinenunsistemacelularpolarizada:evidenciaparaapicalyodurodeeflujopendrinmediada.JBiolChem
279:13004hasta13010[PubMed]
41.ZuckierLS.,DohanO.,LiY.,ChangCJ.,CarrascoN.,DadachovaE.2004.Cinticadeabsorcinperrenatoy
biodistribucincomparativodeperrenato,pertecnetato,yyodurodetejidossymporterexpresanNaIenvivo.JNucl
Med45:500507[PubMed]
.42ReedTsurMD,DelaViejaA.,GinterCS,CarrascoN.2008...LacaracterizacinmoleculardeV59ENIS,a/
mutantesymporterINa+quecausacongnitadefectotransporteI.Endocrinologa149:3.077hasta3.084
[PMClibresartculo][PubMed]
43.ScholzIV.,CengicN.,BakerCH.,HarringtonKJ.,MaletzK.,BergertER.,VileR.,GokeB.,MorrisJC.,
SpitzwegC.2005.Laterapiaconyodoradiactivodecncerdecolondespusdetejidoyodurodesodioespecficode
transferenciadegenessymporter.GeneTher12:272280[PubMed]
44.SpitzwegC.,MorrisJC..2002Elsymporteryodurodesodio:susimplicacionesfisiopatolgicasyteraputicas.
EndocrinolClnica(Oxf)57:559574[PubMed]
.45...GrasbergerH.,DeDekenX.,MayoOB,RaadH.,M.Weiss,LiaoXH,RefetoffS.2012Losratones
deficientesendobleoxidasafactoresdemaduracinsonseveramentehipotiroidismo.MolEndocrinol26:481492
[PMClibresartculo][PubMed]
.46RocchiR.,KunavisarutT.,LadensonP.,CaturegliP.2006.captacintiroideadeyodoradiactivoyla
gammagrafaenratones.tiroidea16:705706[PubMed]
47.vandenHoveMF.,CroizetBergerK.,JouretF.,GugginoSE.,GugginoWB.,DevuystO.,CourtoyPJ..2006
Laprdidadelcanaldecloruro,CLC5,retrasayodurodeeflujoapicaleinduceunbocioeutiroideoenlaglndula
tiroidesratn.Endocrinologa147:12871296[PubMed]
48.ReinfelderJ.,MaschauerS.,FossCA.,NimmagaddaS.,FremontV.,WolfV.,WeintraubBD.,PomperMG.,
SzkudlinskiMW.,KuwertT.,PranteO.EfectosdelatiroideshumanarecombinanteEstimularsuperagonistas
hormonatiroideaenlacaptacinde18FFDGyradioiodide.tiroidea21:783792[PubMed]
49.ColzaniRM.,AlexS.,FangSL.,BravermanLE.,EmersonCH..1998Elefectodetirotropinahumana
recombinante(rhTSH)enfuncindelatiroidesenratonesyratas.tiroides8:797801[PubMed]
50.HilditchTE.,HortonPW.,McCrudenDC.,YoungRE.,AlexanderWD..1982Losdefectosenintratiroideo
unindeyodoylapruebadedescargadeperclorato.ActaEndocrinol(Copenh)100:237244[PubMed]
51.CKAtterwill.,P.Collins,BrownCG.,HarlandRF.1987.Lapruebadedescargadepercloratoparaexaminarla
funcindelatiroidesenratas.JMtodosPharmacol18:199203[PubMed]
.52CoelhoPalermoCunhaG.,vanRavenzwaayB.2007.Normalizacindelapruebadedescargadeperclorato
paralaspruebasdetoxicidaddelatiroidesenratas.RegulToxicolPharmacol48:270278[PubMed]
53.DingliD.,KempBJ.,O'ConnorMK.,MorrisJC.,RussellSJ.,LoweVJ..2006combinadaI124tomografapor
emisindepositrones/tomografacomputarizadadelaexpresindelgenNISenmodelosanimalesdetransfectadas
establementetransfectadasyeltumorporvaintravenosa.MolImagingBiol8:1623[PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

86/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

54.J.Unger,BoeynaemsJM,VanHerleA.,J.VanSande,RocmansP.,MockelJ.1979..Invitrolaliberacinde
yodononbutanolextrableenlatiroidesperro.Endocrinologa105:225231[PubMed]
55.FrankenPR.,J.Guglielmi,VanhoveC.,KoulibalyM.,DefriseM.,J.Darcourt,PourcherT.2010.Distribuciny
dinmicade(99m)lacaptacindeTcpertecnetatoenlatiroidesyotrosrganosevaluadosporemisindefotn
nicotomografacomputarizadaenratonesvivos.tiroidea20:519526[PubMed]
56.BrandtMP.,KloosRT.,ShenDH.,ZhangX.,LiuAA.,JhiangSM..2012Microemisindefotnnicode
adquisicindeimgenesdetomografaycuantificacindesymportermediadaporlaacumulacinderadionucleidos
deyodurodesodioenlatiroidesratnyglndulassalivales.tiroidea22:617624[PMClibresartculo][PubMed]
57.EmanuelssonM.2006.Desarrollodeunanimalinvivomodelodeimgenes/MICROCAT124ImicroPETde
latiroides[MStesis].CienciasClnicasRadiacinFsicaMdica.UniversidaddeLund,Lund,Suecia
58.ChakravartyD.,E.Santos,M.Ryder,KnaufJA.,LiaoXH.,WestBL.,BollagG.,KolesnickR.,THThin.,
RosenN.,ZanzonicoP.,LarsonSM.,RefetoffS.,GhosseinR.,FaginJA..2011molculaspequeasinhibidoresde
MAPKrestaurarincorporacindeyodoradioactivoenratndecncerdetiroidesconlaactivacindeBRAF
condicional.JClinInvest121:47004.711[ArtculolibrePMC][PubMed]
.59RenaultG.,BonninP.,MarchiolFournigaultC.,GregoireJM,SerrireS.,RichardB.,FradeliziD.2006..
[imgenesdeultrasonidodealtaresolucindelratn].JRadiol87:19371945.(Enfrancs).[PubMed]
60.FomentarFS.,ZhangMI.,ZhouYQ.,LiuG.,J.Mehi,CherinE.,HarasiewiczKA.,StarkoskiBG.,ZanL.,
KnapikDA.,AdamsonSL..2002UnnuevoinstrumentodeultrasonidoparaMicroImaginginvivodelosratones.
UltrasoundMedBiol28:11651172[PubMed]
61.ManciniM.,E.Vergara,SalvatoreG.,A.Greco,TronconeG.,A.Affuso,LiuzziR.,P.Salerno,Scottodi
SantoloM.,M.Santoro,BrunettiA.,SalvatoreM..2009MicroImagingecografamorfolgicadetiroidesenratones
vivos.Endocrinologa150:4.8104.815[PubMed]
62.WassenFW.,SchielAE.,KuiperGG.,KapteinE.,BakkerO.,VisserTJ.,SimnidesWS..2002Lainduccin
dedeiodinasehormonatiroideadegradantesenlahipertrofiacardiacaeinsuficiencia.Endocrinologa143:2812
2815[PubMed]
63.SimnidesWS.,MulcaheyMA.,RedoutEM.,A.Muller,ZuidwijkMJ.,VisserTJ.,WassenFW.,CrescenziA.,
daSilvaWS.,J.Harney,EngelFB.,ObregnMJ.,LarsenPR.,BiancoAC.,HuangSA..2008delfactorinducible
porhipoxiainducelainactivacinhormonatiroidealocaldurantelaenfermedadhipxicoisqumicaenratas.JClin
Invest118:975983[PMClibresartculo][PubMed]
64.UetaCB.,OskoueiBN.,OlivaresEL.,PintoJR.,CorreaMM.,SimovicG.,SimnidesWS.,HareJM.,Bianco
AC..2012Laausenciadelahormonatiroideainfartoinactivarresultadosdesyodasasenlamiocardiopatarestrictiva
enratones.MolEndocrinol26:809818[ArtculolibrePMC][PubMed]
65.JoS.,kalloI.,BardocziZ.,ArrojoEDR.,ZeoldA.,LipositsZ.,OlivaA.,LemmonVP.,BixbyJL.,GerebenB.,
BiancoAC..2012hipoxianeuronalinduceimportacinnuclearHsp40mediadadetipo3deiodinasecomoun
mecanismodeadaptacinparareducirelmetabolismocelular.JNeurosci32:8491a8500[PMClibresartculo]
[PubMed]
66.BiancoAC.,SilvaJE..1988Laexposicinalfroinducerpidamentelasaturacinvirtualdeltejidoadiposo
marrnTnuclear3receptores.AmJPhysiol255:E496E503[PubMed]
67.FerraraAM.,LiaoXH.,GilIbezP.,MarcinkowskiT.,J.Bernal,WeissRE.,DumitrescuAM.,RefetoffS.
2013.LoscambiosenelestadodelatiroidesduranteeldesarrolloperinatalderatonesmachosMCT8deficiente.
Endocrinologa154:25332541[PMClibresartculo][PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

87/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

.68PohlenzJ.,MaqueemA.,CuaK.,WeissRE,VanSandeJ.,RefetoffS.1999..Mejoraderadioinmunoensayo
paralamedidadetirotropinaratnenelsuero:cepadiferenciasenlaconcentracindetirotropinaytirotrpicos
sensibilidadalahormonatiroidea.Tiroides9:12651271[PubMed]
69.SalnJA.,RibichS.,ChristoffoleteMA.,SimovicG.,CorreaMedinaM.,PattiME.,BiancoAC..2010La
ausenciadelaactivacindelahormonatiroideaduranteeldesarrollosubyaceundefectopermanenteenla
termognesisadaptativa.Endocrinologa151:4.5734582[PMClibresartculo][PubMed]
70.R.Calvo,MorrealedeEscobarG.,EscobardelReyF.,ObregnMJ.1997.Maternalenfermedadnotiroideayla
hormonatiroideafetal,comoseestudiaenladiabetesmellitusmodeloderatainducidaporestreptozotocina.
Endocrinologa138:11591169[PubMed]
.71.PedrazaPE,ObregnMJ,EscobarMorrealeHF,EscobardelReyF.,MorrealedeEscobarG.2006...Los
mecanismosdeadaptacinaladeficienciadeyodoenratas:estadodelatiroidesesespecficadetejido.Surelevancia
paraelhombre.Endocrinologa147:20982108[PubMed]
72.ZavackiAM.,YingH.,
ChristoffoleteMA.,AertsG.,E.As,HarneyJW.,ChengSY.,LarsenPR.,BiancoAC.

.2005Tipo1yodotironinadeiodinaseesunmarcadorsensibledelestadotiroideoperifricaenelratn.
Endocrinologa146:15681575[PubMed]
73.SoukhovaN.,SoldinOP.,SoldinSJ.2004.IstopostndemdilucinmtododeespectrometrademasasparaT4
/T3.ClinChimActa343:185190[PMClibresartculo][PubMed]
74.PiehlS.,HebererT.,BalzsG.,ScanlanTS.,KohrleJ.2008.Desarrollodeunacromatografalquida/
espectrometrademasasentndemmtodovalidadoparaladistincindetironinaythyronamineismeros
constitucionalesyparalaidentificacindenuevosdeiodinasesustratos.RpidoCommunMisaSpectrom22:desde
3.286hasta3.296[PubMed]
75.GtheS.,WangZ.,NgL.,KindblomJM.,BarrosAC.,C.Ohlsson,VennstromB.,ForrestD.1999.Losratones
carentesdetodoslosconocidosreceptoresdelahormonatiroideasontrastornosviablesperoexhibicindeleje
hipfisistiroides,elcrecimientoylamaduracinsea.GenesDev13:13291341[ArtculolibrePMC]
[PubMed]
76.PerretJ.,LudgateM.,LibertF.,GerardC.,DumontJE.,VassartG.,M.Parmentier1990.Laexpresinestable
delreceptordeTSHhumanaenclulasCHOycaracterizacindeclonesqueexpresandiferencialmente.Biochem
BiophysResCommun171:10441050[PubMed]
77.BrookerG.,HarperJF.,TerasakiWL.,MoylanRD..1979RadioinmunoanlisisdeAMPcclicoyGMPcclico
.AdvnucletidoscclicosRes10:133[PubMed]
78.PersaniL.,C.Asteria,TonaccheraM.,P.Vitti,KrishnaV.,K.Chatterjee,BeckPeccozP.1994.Evidenciapara
lasecrecindelatirotropinaconunamejoradelabioactividadenlossndromesderesistenciaalahormonatiroidea.
JClinEndocrinolMetab78:10341039[PubMed]
79.MoellerLC.,M.Alonso,LiaoX.,brochaV.,A.Dumitrescu,VanSandeJ.,MontanelliL.,SkjeiS.,C.
Goodwin,GrasbergerH.,RefetoffS.,WeissRE..2007hipofisariotiroideoconsignayelreceptordetirotropina
expresinenratasconsomic.Endocrinologa148:4.727a4.733[PubMed]
80.YamadaM.,SagaY.,ShibusawaN.,HiratoJ.,M.Murakami,IwasakiT.,HashimotoK.,SatohT.,Wakabayashi
K.,TaketoMM.,MoriM.1997.hipotiroidismoterciarioyhiperglucemiaenratonesconalteracindirigidadelgen
delahormonaliberadoradetirotropina.ProcNatlAcadSciEE.UU.94:10.862hasta10.867
[PMClibresartculo][PubMed]
81.MoellerLC.,KimuraS.,T.Kusakabe,LiaoXH.,VanSandeJ.,RefetoffS.2003.Elhipotiroidismoenelfactor
detranscripcintiroideo1haploinsuficienciaescausadaporunaexpresinreducidadelreceptordelahormona
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

88/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

estimulantedelatiroides.MolEndocrinol17:22952302[PubMed]
82.AstapovaI.,VellaKR.,RamadossP.,HoltzKA.,RodwinBA.,LiaoXH.,WeissRE.,RosenbergMA.,
RosenzweigA.,HollenbergAN..2011Elcorepressorreceptornuclear(NCoR)controlalasensibilidaddela
hormonatiroideayelpuntodelejehipotlamohipfisistiroidesconjunto.MolEndocrinol25:212224
[PMClibresartculo][PubMed]
83.MorrealedeEscobarG.,R.Pastor,ObregnMJ.,EscobardelReyF.1985.Efectosdelhipotiroidismomaterno
enelpesoylatiroidescontenidohormonaldelostejidosembrionariosderata,antesydespusdeliniciodela
funcintiroideafetal.Endocrinologa117:18901900[PubMed]
84.GerebenB.,ZavackiAM.,RibichS.,KimBW.,HuangSA.,SimnidesWS.,ZeoldA.,BiancoAC..2008
Basescelularesymolecularesdelasealizacindelahormonatiroideadeiodinasereguladas.EndocrRev29:898
938[ArtculolibrePMC][PubMed]
85.LarsenPR.,SilvaJE.,KaplanMM..1981Lasrelacionesentrecirculanteylashormonastiroideasintracelulares:
implicacionesfisiolgicasyclnicas.EndocrRev2:87102[PubMed]
86.BiancoAC.,SilvaJE..1987Nuclear3,5,3'triyodotironina(T3)eneltejidoadiposomarrn:laocupacindel
receptorylasfuentesdeT3comosedeterminaportcnicasinvivo.Endocrinologa120:5562[PubMed]
87.SilvaJE.,DickTE.,LarsenPR..1978Lacontribucindemonodesyodacintiroxinatejidolocalalanuclear
3,5,3triyodotironinaenlapituitaria,elhgadoylosrionesderataseutiroideos.Endocrinologa103:11961207
[PubMed]
88.SilvaJE.,LarsenPR.1.978.Lascontribucionesdetriyodotironinaplasmaymonodesyodacintiroxinalocalpara
triyodotironinaalasaturacindelreceptortriyodotironinanuclearenlapituitaria,elhgadoylosrionesdelasratas
conhipotiroidismo.Otrapruebarelativasaturacindelosreceptoresdetriyodotironinanuclearhipofisariosyla
inhibicinagudadelatiroidesliberacindelahormonaestimulante.JClinInvest61:12471259
[PMClibresartculo][PubMed]
89.CrantzFR.,SilvaJE.,LarsenPR..1982Elanlisisdelasfuentesylacantidadde3,5,3triyodotironinaunido
especficamentealosreceptoresnuclearesdecortezacerebralderatayelcerebelo.Endocrinologa110:367375
[PubMed]
90.GouveiaCH.,ChristoffoleteMA.,ZaituneCR.,DoraJM.,HarneyJW.,MaiaAL.,BiancoAC..2005Tipo2
yodotironinaselenodeiodinaseseexpresaentodoelesqueletodelratnyenlalneacelularosteoblsticaderatn
MC3T3E1duranteladiferenciacin.Endocrinologa146:195200[PubMed]
91.SalvatoreD.,TuH.,HarneyJW.,LarsenPR..1996Tipo2yodotironinadeiodinaseesaltamenteexpresadoenla
tiroideshumana.JClinInvest98:962968[PMClibresartculo][PubMed]
92.DenticeM.,MarsiliA.,AmbrosioR.,GuardiolaO.,SibilioA.,PaikJH.,MinchiottiG.,DePinhoAR.,FenziG.,
LarsenPR.,SalvatoreD.2011.ElFoxO3/tipoesrequeridova2deiodinaseparamiogeniaratnnormalyla
regeneracinmuscular.JClinInvest120:40214030[PMClibresartculo][PubMed]
93.C.Curcio,BaquiMM.,SalvatoreD.,RihnBH.,S.Mohr,HarneyJW.,LarsenPR.,BiancoAC..2001Eltipo2
yodotironinadeiodinasahumanoesunaselenoprotenaaltamenteexpresadoenunalneacelulardemesotelioma.J
BiolChem276:30183hasta30187[PubMed]
.94HosoiY.,MurakamiM.,MizumaH.,OgiwaraT.,ImamuraM.,MoriM.1999.ExpresinyregulacindetipoII
yodotironinadeiodinasaenlasclulasdelmsculoesquelticohumanascultivadas.JClinEndocrinolMetab84:
32933300[PubMed]
95.MurakamiM.,ArakiO.,MorimuraT.,HosoiY.,MizumaH.,YamadaM.,KuriharaH.,IshiuchiS.,M.Tamura,
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

89/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

T.Sasaki,MoriM.2000.ExpresindetipodeiodinaseyodotironinaIIentumorescerebrales.JClinEndocrinol
Metab85:desde4403hasta4406[PubMed]
96.MurakamiM.,ArakiO.,HosoiY.,KamiyaY.,MorimuraT.,OgiwaraT.,MizumaH.,M.Mori2001.Expresin
yregulacindetipoIIdeiodinaseyodotironinaenlaglndulatiroideshumana.Endocrinologa142:29612967
[PubMed]
97.MaedaA.,ToyodaN.,YasuzawaAmanoS.,IwasakaT.,NishikawaM.2003.Tipo2expresindeiodinasaes
estimuladaporfactoresdecrecimientoenclulasmusculareslisasvasculareshumanas.MolCellEndocrinol200:
111117[PubMed]
98.WajnerSM.,dosSantosWagnerM.,MeloRC.,ParreiraGG.,ChiariniGarcaH.,BiancoAC.,FeketeC.,E.
Snchez,LechanRM.,MaiaAL..2007Tipo2yodotironinadeiodinasaesaltamenteexpresadoenclulas
germinalesdetestculoadultoderata.JEndocrinol194:4754[PubMed]
.99DiStefanoJJ,Maloneconocimientostradicionales,JangM.1982...cinticaintegralesdedistribucindetiroxina
yelmetabolismoensangreytejidospiscinasdelaratadesloseismuestrasdesangre:predominiodelasgrandes,
intercambiandolentamentegruposdetejidos.Endocrinologa111:108117[PubMed]
100.NguyenTT.,ChapaF.,DiStefanoJJtercero1.998.LamedicindirectadelascontribucionesdetipoIytipoII
5'deiodinasasatodoelcuerpoenestadoestacionario3,5,3triyodotironinaproduccindetiroxinaenlarata.
Endocrinologa139:46264633[PubMed]
101.OppenheimerJH.,SchwartzHL.,SurksMI.1974.diferenciasdetejidoenlaconcentracindelossitios
nuclearestriyodotironinadeuninenlarata:hgado,rin,hipfisis,elcorazn,elcerebro,elbazoylostestculos.
Endocrinologa95:897903[PubMed]
102.VisserWE.,FriesemaCE.,J.Jansen,VisserTJ..2007deltransportedelahormonatiroideaporlos
transportistasmonocarboxilato.BestPractResClinEndocrinolMetab21:223236[PubMed]
103.D.Braun,WirthEK,SchweizerU.2010..transportadoresdehormonatiroideaenelcerebro.RevNeurosci21
:173186[PubMed]
104.RefetoffS.,DumitrescuAM..2007sndromesdesensibilidadreducidaalahormonatiroidea:defectos
genticosenlosreceptoreshormonales,transportadorescelularesydesyodacin.BestPractResClinEndocrinol
Metab21:277305[PubMed]
105.VisserWE.,FriesemaCE.,VisserTJ..2011minireview:transportadoresdehormonastiroideas:losdatos
conocidosylasincgnitas.MolEndocrinol25:114[PubMed]
106.HeuerH.,VisserTJ.2009.minireview:importanciafisiopatolgicadelostransportadoresdelahormona
tiroidea.Endocrinologa150:10781083[PubMed]
107.FriesemaCE.,GruetersA.,BiebermannH.,krudeH.,vonMoersA.,M.Reeser,BarrettTG.,MancillaEE.,J.
Svensson,KesterMH.,KuiperGG.,BalkassmiS.,UitterlindenAG.,KoehrleJ.,RodienP.,HalestrapAP.,Visser
TJ..2004Asociacinentrelasmutacionesenuntransportadordehormonatiroideayseveroretrasopsicomotor
ligadaalcromosomaX.Lancet364:14351437[PubMed]
.108DumitrescuAM,LiaoXH,MejorTB,BrockmannK.,RefetoffS.2004....Unanovelasndromequecombina
alteracionestiroideasyneurolgicasseasociaconmutacionesenungendeltransportadormonocarboxilato.AmJ
HumGenet74:168175[PMClibresartculo][PubMed]
109.FriesemaCE.,J.Jansen,JachtenbergJW.,VisserWE.,KesterMH.,VisserTJ..2008lacaptacincelularde
vigenciaydeflujodesalidadelahormonatiroidesaltransportadormonocarboxilatohumano10.MolEndocrinol22
:13571369[PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

90/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

110.WestholmDE.,SaloDR.,VikenKJ.,RumbleyJN.,AndersonGW..2009Labarreratiroxinatransportador
polipptidotransportadordeanionesorgnicoshematoenceflica1c1pantallascinticadetransporteatpicas.
Endocrinologa150:5.153a5162[PubMed]
111.HagenbuchB.,GuiC.2008.transportadoresxenobiticosdelanintransportarpolipptidosorgnicoshumanos
(OATP)delafamilia.Xenobiotica38:778801[PubMed]
.112.KinneA.,S.Roth,BiebermannH.,KohrleJ.,GrutersA.,SchweizerU.2009translocacinsuperficialy
captacintriyodotironinadeprotenasMCT8mutantessondetipodependientedeclulas.JMolEndocrinol43:
263271[PubMed]
113.WestholmDE.,StenehjemDD.,RumbleyJN.,DrewesLR.,AndersonGW..2009Lainhibicincompetitiva
detransportedeanionesorgnicostiroxinapolipptidotransporte1c1mediadaporlaclasefenamatodelos
antiinflamatoriosnoesteroideos.Endocrinologa150:10251032[ArtculolibrePMC][PubMed]
114.FriesemaCE.,KuiperGG.,J.Jansen,VisserTJ.,KesterMH.2006.tiroidestransportedelahormonaporel
transportadormonocarboxilatohumano8ysupapellimitantedelavelocidadenelmetabolismointracelular.Mol
Endocrinol20:27612772[PubMed]
115.SuzukiS.,MoriJ.,HashizumeK.2007.mucristalina,un(3)laprotenadeunindependientedeNADPHT
enelcitosol.EndocrinolMetabTendencias18:286289[PubMed]
.116VisserNOSOTROS,WongWS,vanMullemAA,FriesemaCE,GeyerJ.,VisserTJ....Estudiodeltransporte
delahormonatiroideaporlostransportistasdelafamiliaSLC10.MolCellEndocrinol315:138145[PubMed]
117.[Suprimido.]
118.FriesemaCE.,S.Ganguly,AbdallaA.,ManningFoxJE.,HalestrapAP.,VisserTJ..2003Identificacinde
transportadormonocarboxilato8comountransportadorespecficodelahormonatiroidea.JBiolChem278:desde
40.128hasta40.135[PubMed]
119.SugiyamaD.,KusuharaH.,ShitaraY.,AbeT.,SugiyamaY.2002.Efectodela17betaestradiolD17beta
glucurnidoenelaninorgnicoratapolipptidodetransportede2mediadadetransportedifieredependiendo
sustratos.DrugMetabDispos30:220223[PubMed]
120.TracyTS.2003.cinticaenzimticaatpicos:suefectosobrelainvitroinvivoprediccionesfarmacocinticase
interaccionesmedicamentosas.CurrDrugMetab4:341346[PubMed]
121.HutzlerJM.,TracyTS..2002perfilesatpicoscinticosenreaccionesdelmetabolismodelfrmaco.Drug
MetabDispos30:355362[PubMed]
122.WestholmDE.,MaroldJD.,VikenKJ.,DuerstAH.,AndersonGW.,RumbleyJN..2010Evidenciade
conservacinevolutivadelafuncinentreelOatp1c1transportadordetiroxinaylosprincipalesmiembrosdela
superfamiliafacilitadora.Endocrinologa151:5.9415.951[PubMed]
123.ReginaA.,MorchoisneS.,BorsonND.,McCallAL.,DrewesLR.,RouxF.2001.Factor(s)liberadoporlos
astrocitosdeglucosaprivadosamejorarlaexpresindeltransportadordelaglucosaylaactividadenlasclulas
endotelialesdecerebroderata.BiochimBiophysActa1540:233242[PubMed]
124.D.Braun,KinneA.,BrauerUA.,SapinR.,KleinMO.,KohrleJ.,WirthEK.,SchweizerU.2011.tipo
expresinconcretadeldesarrolloycelulardelostransportadoresdelahormonatiroideaenelcerebroderatnyen
lasclulascerebralesprimarios.Gla59:463471[PubMed]
125.VisserWE.,SwagemakersSM.,OzgurZ.,SchotR.,VerheijenFW.,vanIjckenWF.,vanderSpekPJ.,Visser
TJ.2010.transcripcionaldeperfilesdefibroblastosdepacientesconmutacionesenMCT8yanlisiscomparativo
coneltranscriptomadelcerebrohumano.HumMolGenet19:4189a4200[PMClibresartculo][PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

91/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

126.HeuerH.,VisserTJ..2013Lasconsecuenciasfisiopatolgicasdedeficienciastransportadorasdehormonas
tiroideas:puntosdevistadelosmodelosderatn.BiochimBiophysActa1830:3974a3978[PubMed]
127.MorteB.,A.Ceballos,DiezD.,GrijotaMartnezC.,DumitrescuAM.,DiCosmoC.,GaltonVA.,RefetoffS.,
J.Bernal2010.reguladosporhormonastiroidesratngenesdelacortezacerebraldependendiferencialmenteenla
fuentedelahormona:unestudioenmonocarboxilatotransportador8yratonesdeiodinase2deficientes.
Endocrinologa151:23812387[ArtculolibrePMC][PubMed]
128.SmithQR.,AllenDD..2003Enlatcnicadeperfusincerebralsitu.MethodsMolMed89:209218
[PubMed]
129.OppenheimerJH.,KoernerD.,SchwartzHL.,SurksMI..1972sitiosdeunintriyodotironinanucleares
especficosenhgadoyrinderata.JClinEndocrinolMetab35:330333[PubMed]
130.LeonardJL.,VisserTJ.1986.Bioqumicadedesyodacin.En:HennemannG,editor.(Ed)hormonatiroidea
metabolismo.MarcelDekker,NuevaYork,pp189229
131.KaplanMM..1986influenciasreguladorassobreyodotironinadesyodacinenlostejidosanimalesen:
HennemannG,editor.(Ed)hormonatiroideametabolismo.MarcelDekker,NuevaYork,pp231253
132.BiancoAC.,SalvatoreD.,GerebenB.,BerryMJ.,LarsenPR..2002Bioqumica,biologacelularymolecular,
ylasfuncionesfisiolgicasdelosselenodeiodinasesyodotironina.EndocrRev23:3889[PubMed]
133.CallebautI.,CurcioMorelliC.,MornonJP.,GerebenB.,BuettnerC.,HuangS.,B.Castro,FonsecaTL.,
HarneyJW.,LarsenPR.,BiancoAC..2003Losselenodeiodinasesyodotironinasonprotenasdelafamilia
tiorredoxinavecescontienenunclanestructuraGHAcomoglucsidohidrolasa.JBiolChem278:36.887a
36.896[PubMed]
134.SagarGD.,GerebenB.,CallebautI.,MornonJP.,ZeldA.,CurcioMorelliC.,HarneyJW.,LuongoC.,
MulcaheyMA.,LarsenPR.,HuangSA.,BiancoAC.2.008.Lasfuncionesdesyodasashormonatiroideaque
inactivancomounhomodmero.MolEndocrinol22:13821393[PMClibresartculo][PubMed]
135.CurcioMorelliC.,GerebenB.,ZavackiAM.,KimBW.,HuangS.,HarneyJW.,LarsenPR.,BiancoAC..
2003Envivodimerizacindelostipos1,2y3yodotironinaselenodeiodinases.Endocrinologa144:937946
[PubMed]
136.LeonardJL.,LarsenPR..1985metabolismodelashormonasdelatiroidesencultivosprimariosdeclulasde
cerebroderatafetal.BrainRes327:113[PubMed]
137.vanderHeideSM.,VisserTJ.,VuelcaME.,KlarenPH..2002Elmetabolismodelashormonastiroideasen
fibroblastoscardacoscultivadasderatasrecinnacidas.JEndocrinol174:111119[PubMed]
138.AlbrightCE.,LarsonFC.,TustRH..1954Invitroconversindetiroxinaentriyodotironinaporrodajasde
rin.ProcSocExpBiolMed86:137140[PubMed]
139.AlbrightCE.,LarsonFC..1959ElmetabolismodelaLtiroxinaporlasrebanadasdetejidohumano.JClin
Invest38:18991903[PMClibresartculo][PubMed]
.140VisserTJ,ElTobeI.,DocterR.,HennemannG.1976..Localizacinsubcelulardeunaenzimadelhgadode
rataconversindetiroxinaentriyodotironinaylaposibleparticipacindegrupostiolesenciales.BiochemJ157:
479482[PMClibredelartculo][PubMed]
141.HarrisARC.,FangSL.,HinerfeldL.,BravermanLE.,VagenakisAG.1.979.Elpapeldelosgrupossulfhidrilo
enlainsuficienciaheptica3',lageneracinde3,5triyodotironinadetiroxinaenelhambre,roedorhipotiroidismo,
fetalyneonatal.JClinInvest63:516524[PMClibresartculo][PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

92/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

142.VerhoelstCH.,RoelensSA.,DarrasVM..2005Papeldeexpresinespaciotemporaldeyodotironina
deiodinaseprotenasenlaorganizacindeclulasdelcerebelo.BrainResBull67:196202[PubMed]
143.KimSW.,HarneyJW.,LarsenPR..1998Losestudiosdelaregulacinhormonaldetipo2cidoribonucleico
mensajerodeiodinase5'yodotironinaenlasclulastumoralesdelahipfisisconlareaccinencadenade
semicuantitativalapolimerasacontranscripcininversa.Endocrinologa139:4895a4905[PubMed]
144.SharifiJ.,StGermainDL.1.992.ElADNcparaeltipoIyodotironina5'deiodinasecodificaunaenzimaquese
manifiestatantoKmaltaybajaactividadKm.Evidenciadequeelhgadoyrinderatacontienenunanicaenzima
queconviertetiroxina3,5,3'atriyodotironina.JBiolChem267:1253912544[PubMed]
145.BerryMJ.,MaiaAL.,KiefferJD.,HarneyJW.,LarsenPR..1992Lasustitucindecistenaporselenocysteine

eneltipoIyodotironinadeiodinasereducelaeficienciacatalticadelaprotena,peromejorasutraduccin.
Endocrinologa131:18481852[PubMed]
146.KuiperGG.,KlootwijkW.,VisserTJ..2002Lasustitucindecistenaporunresiduodealaninaconservadoen
elcentrocatalticodetipoIIyodotironinadeiodinasaalteralainteraccinconlareduccindecofactor.
Endocrinologa143:11901198[PubMed]
147.KwakkelJ.,ChassandeO.,vanBeerenHC,volantesE.,WiersingaWM,BoelenA.2010...receptordela
hormonatiroidea{alpha}modulaloscambiosinducidosporlipopolisacridosenelmetabolismodelahormona
tiroideaperifrica.Endocrinologa151:19591969[PubMed]
148.LeonardJL.,MellenSA.,LarsenPR..1983Latiroxinaactividad5'deiodinaseeneltejidoadiposomarrn.
Endocrinologa112:11531155[PubMed]
149.GaltonVA.,E.Martnez,HernndezA.,StGermainEA.,BatesJM.,StGermainDL..2001Eltipo2
yodotironinadeiodinasase
expresaenelteroderatasyseindujoduranteelembarazo.Endocrinologa142:2123

2128[PubMed]
.150GaltonVA,HiebertA.1987..yodotironinahepticaactividadde5deiodinaseenrenacuajosdeRana
catesbeianaenlasdiferentesetapasdelciclodevida.Endocrinologa121:4247[PubMed]
151.GaltonVA.,E.Martnez,HernndezA.,StGermainEA.,BatesJM.,StGermainDL..1999teroderata
embarazadaexpresaaltosnivelesdeltipo3yodotironinadeiodinase.JClinInvest103:979987
[PMClibresartculo][PubMed]
152.KuiperGG.,KlootwijkW.,VisserTJ..2003Lasustitucindecistenaporselenocysteine
enelcentrocataltico

dedeiodinasetipoIIIyodotironinareducelaeficienciacatalticayalterasustratopreferencia.Endocrinologa144:
25052513[PubMed]
153.KalaanyNY.,GauthierKC.,ZavackiAM.,MammenPP.,KitazumeT.,PetersonJA.,HortonJD.,GarryDJ.,
BiancoAC.,MangelsdorfDJ..2005LXRsregulanelequilibrioentreelalmacenamientodegrasaylaoxidacin.
MetabCell1:231244[PubMed]
154.KoopdonkKoolJM.,deVijlderJJ.,VeenboerGJ.,RisStalpersC.,JHKok.,VulsmaT.,BoerK.,VisserTJ..
1996tipoIIytipoIIIactividaddeiodinaseenlaplacentahumanaenfuncindelaedadgestacional.JClin
EndocrinolMetab81:21542158[PubMed]
155.KesterMH.,ToussaintMJ.,PuntCA.,MatondoR.,AarnioAM.,DarrasVM.,VuelcaME.,deBruinA.,
VisserTJ..2009AmpliacindelainduccindelaexpresindetipoIIIdeiodinasedespusdelahepatectoma
parcialenelratnderegeneracinyelhgadodelarata.Endocrinologa150:540545[PubMed]
156.RichardK.,HumeR.,KapteinE.,SandersJP.,vanToorH.,DeHerderWW.,denHollanderJC.,Krenning
EP.,VisserTJ..1998Laontogeniadeyodotironinadeiodinasasenelhgadohumano.JClinEndocrinolMetab83:
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

93/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

28682874[PubMed]
157.kalloI.,MohcsikP.,VidaB.,ZeldA.,BardcziZ.,ZavackiAM.,FarkasE.,KdrA.,HrabovszkyE.,
ArrojoEDrigoR.,DongL.,BarnaL.,PalkovitsM.,BorsayBA.,HerczegL.,LechanRM.,BiancoAC.,Liposits
Z.,FeketeC.,GerebenB.2012.Unanuevavaregulalatiroidesdisponibilidaddelahormonaenlaratayneuronas
neurosecretorashipotalmicashumanos.PLoSOne7:.e37860[PMClibresartculo][PubMed]
158.ToyodaN.,BerryMJ.,HarneyJW.,LarsenPR..1.995anlisistopolgicodelaprotenademembrana,tipo1
yodotironinadeiodinase(D1).JBiolChem270:12310a12318[PubMed]
159.SteinsapirJ.,BiancoAC.,BuettnerC.,J.Harney,LarsenPR..2000Sustratoinducidaporlabajaregulacinde
humanotipo2deiodinase(HD2)estmediadaatravsdeladegradacinproteasomalyrequierelainteraccinconel
centroactivodelaenzima.Endocrinologa141:11271135[PubMed]
160.[Suprimido.]
161.CroteauW.,DaveyJC.,GaltonVA.,StGermainDL.1.996.LaclonacindelosmamferosdetipoII
yodotironinadeiodinase.Unselenoprotenaexpresayreguladaenelcerebrohumanoyderatayotrostejidos
diferencialmente.JClinInvest98:405417[PMClibresartculo][PubMed]
162.GerebenB.,C.Goncalves,HarneyJW.,LarsenPR.,BiancoAC..2000protelisisselectivadetipohumano2
deiodinase:unnuevomecanismoubiquitinaproteasomamediadaporlaregulacindelaactivacindelahormona.
MolEndocrinol14:16971708[PubMed]
163.KimBW.,ZavackiAM.,CurcioMorelliC.,DenticeM.,HarneyJW.,LarsenPR.,BiancoAC..2003
endoplasmticodegradacinretculoasociadodeltipo2yodotironinadeiodinasahumana(D2)estmediadaatravs
deunaasociacinentreUBC7demamferosydelaregincarboxilodeD2.MolEndocrinol17:26032612
[PubMed]
164.SagarGD.,GerebenB.,CallebautI.,MornonJP.,ZeldA.,daSilvaWS.,LuongoC.,DenticeM.,TenteSM.,
FreitasBC.,HarneyJW.,ZavackiAM.,BiancoAC..2007cambioconformacionaleneldmerodeiodinase
inducidaUbiquitinationesunaregulacindelaactividaddelaenzimainterruptor.MolCellBiol27:4.774a4.783
[ArtculolibrePMC][PubMed]
165.BoteroD.,GerebenB.,GoncalvesC.,DeJesusLA.,HarneyJW.,BiancoAC..2002Ubc6pyubc7pson
necesariosparaladegradacinretculoendoplasmticoasociadanormalyinducidoporelsustratodeltipo
selenoprotenahumano2yodotironinamonodeyodinasa.MolEndocrinol16:19992007[PubMed]
166.SteinsapirJ.,J.Harney,LarsenPR..1998Tipo2yodotironinadeiodinaseenlasclulastumoralesdela
hipfisisderataseinactivaenproteasomas.JClinInvest102:18951899[ArtculolibrePMC][PubMed]
167.DenticeM.,BandyopadhyayA.,B.Gereben,CallebautI.,ChristoffoleteMA.,KimBW.,NissimS.,Mornon
JP.,ZavackiAM.,ZeldA.,CapeloLP.,CurcioMorelliC.,R.Ribeiro,HarneyJW.,TabinCJ.,BiancoAC.2.005.
LaWSB1modulalaactivacindelahormonatiroideaylasecrecindePTHrPenlaplacadecrecimientoen
desarrolloerizoinduciblesubunidadubiquitinaligasa.NatCellBiol7:698705[artculoPMClibre][PubMed]
168.BaquiM.,D.Botero,GerebenB.,C.Curcio,HarneyJW.,SalvatoreD.,SorimachiK.,LarsenPR.,BiancoAC.
.2.003humanadetipo3yodotironinaselenodeiodinaseseencuentraenlamembranaplasmticaysesometeala
internalizacinrpidaaendosomas.JBiolChem278:12061211[PubMed]
169.HuangSA.,MulcaheyMA.,CrescenziA.,M.Chung,KimB.,BarnesCA.,KuijtW.,TuHM.,HarneyJW.,
LarsenPR..2005TGFBpromuevelainactivacindelashormonastiroideasextracelularatravsdelaestimulacin
delatranscripcindetipo3yodotironinadeiodinase.MolEndocrinol19:31263136[PubMed]
170.TuHM.,KimSW.,SalvatoreD.,BarthaT.,LegradiG.,LarsenPR.,RMchan..1997Distribucinregionalde
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

94/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

cidoribonucleicotipo2tiroxinadeiodinasemensajeroenelhipotlamoylahipfisisderataysuregulacinporla
hormonatiroidea.Endocrinologa138:3359a3368[PubMed]
171.TuHM.,LegradiG.,BarthaT.,SalvatoreD.,LechanRM.,LarsenPR.1999.expresinregionaldeltipo3
yodotironinadeiodinasacidoribonucleicomensajeroenelsistemanerviosocentraldelarataysuregulacinporla
hormonatiroidea.Endocrinologa140:784790[PubMed]
.172GuadaoFerrazA.,ObregonMJ,StGermainDL,BernalJ.1997...Eltipo2yodotironinadeiodinasase

expresaprincipalmenteenlasclulasglialesenelcerebroderataneonatal.ProcNatlAcadSciEE.UU.94:10391
10396[PMClibredelartculo][PubMed]
173.FreitasBC.,GerebenB.,CastilloM.,KalloI.,ZeoldA.,EgriP.,LipositsZ.,ZavackiAM.,MacielRM.,JoS.,
SingruP.,E.Snchez,LechanRM.,BiancoAC..2010sealizacinparacrinaportriyodotironinaderivadode
clulasglialesactivalaexpresingnicaneuronalenelcerebroderoedoresyclulashumanas.JClinInvest120:
22062217[PMCartculolibre][PubMed]
174.AdlkoferF.,RamsdenDB,WustemanMC,PeggDE,HoffenbergR.1977....Elmetabolismodelashormonas
tiroideasporelaisladoperfundidorindeconejo.HormMetabRes9:400403[PubMed]
175.FergusonDC.,JenningsAS..1983Reglamentodelaconversindetiroxinaentriyodotironinaenrinderata
perfundido.AmJPhysiol245:E220E229[PubMed]
176.FergusonDC.,HoenigH.,
JenningsAS..1985laproduccintriyodotironinaporelrinderataperfundidose

reduceporladiabetesmellitus,peronoporelayuno.Endocrinologa117:6470[PubMed]
177.JenningsAS.,FergusonDC.,UtigerRD..1979Reglamentodelaconversindetiroxinaentriyodotironinaen
elhgadoderataperfundido.JClinInvest64:16141623[PMClibresartculo][PubMed]
178.JenningsAS.,CrutchfieldFL.,DratmanMB..1984Efectodelhipotiroidismoyelhipertiroidismoenla
produccindetriyodotironinaenhgadoderataperfundido.Endocrinologa114:992997[PubMed]
179.HidalJT.,KaplanMM..1985Caractersticasdetiroxina5'desyodacinenclulasplacentariashumanas
cultivadas:laregulacinporyodotironinas.JClinInvest76:947955[PMClibresartculo][PubMed]
180.RotiE.,BravermanLE.,FangSL.,AlexS.,EmersonCH..1982ontognesisdelinteriordelaplacenta
deiodinasatiroxinaanilloylquidoamnitico3,3',5'triyodotironinaconcentracinenlarata.Endocrinologa111:
959963[PubMed]
181.RotiE.,FangSL.,BravermanLE.,EmersonCH..1982placentaderataesunsitioactivodedesyodacin
interiordelanillodelatiroxinay3,3',5triyodotironina.Endocrinologa110:3437[PubMed]
182.SchrodervanderElstJP.,vanderHeideD.,MorrealedeEscobarG.,ObregnMJ..1998yodotironina
deiodinaseactividadesenlostejidosfetalesderataenvariosnivelesdeladeficienciadeyodo:elpapeldelapielen
3,5,3triyodotironinaeconomaEndocrinologa139:22292234[PubMed]
183.CastroMI.,BravermanLE.,AlexS.,WuFQ,EmersonCH..1985desyodacinInneranillode3,5,3
triyodotironinaenlaplacentainsituperfundidodecobayo.JClinInvest76:19211926[ArtculolibrePMC]
[PubMed]
184.E.Cooper,GibbensM.,ThomasCR.,LowyC.,BurkeCW..1983Laconversindetiroxinaa3,3',5'
triyodotironinaenlaplacentadecuyes:losestudiosinvivo.Endocrinologa112:18081815[PubMed]
185.KaplanMM.,ShawEA..1984TipoIIyodotironina5'desyodacinporhumanosyderataplacentainvitro.J
ClinEndocrinolMetab59:253257[PubMed]
186.SchneiderMJ.,FieringSN.,tailandsB.,WuSY.,StGermainE.,ParlowAF.,StGermainDL.,GaltonVA.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

95/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

2006.interrupcindirigidadelgenselenodeiodinasetipo1(DIO1)resultaencambiosmarcadosenlatiroides
economadelahormonaenratones.Endocrinologa147:580589[PubMed]
187.GaltonVA.,MaderaET.,StGermainEA.,WithrowCA.,AldrichG.,StGermainGM.,ClarkAS.,StGermain
DL..2007homeostasisdelashormonasdelatiroidesylaaccinenelcerebroderoedoresdeiodinasedeficientetipo
2duranteeldesarrollo.Endocrinologa148:30803088[PubMed]
188.VisserTJ.1996.Caminosdelmetabolismodelahormonatiroidea.ActaMdicaAustriaca23:1016
[PubMed]
189.CurranPG.,DeGrootLJ.1.991.Elefectodelosfrmacosinductoresdelasenzimashepticasenlashormonas
tiroideasylaglndulatiroides.EndocrRev12:135150[PubMed]
190.PeetersRP.,KesterMH.,WoutersPJ.,KapteinE.,H.vanToor,VisserTJ.,VandenBergheG.2.005.El
aumentodelosnivelesdesulfatodetiroxinaenpacientesenestadocrticocomoconsecuenciadeuntipoheptica
disminuidaIdesyodasadeactividad.JClinEndocrinolMetab90:6460a6465[PubMed]
191.MackenziePI.,BockKW.,BurchellB.,GuillemetteC.,IkushiroS.,IyanagiT.,MinerosJO.,OwensIS.,
NebertDW.2005.actualizacinNomenclaturaparalosmamferosglycosyltransferaseUDP(UGT)superfamiliade
genes.PharmacogenetGenmica15:677685[PubMed]
192.WuSY.,VerdeWL.,HuangWS.,HaysMT.,ChopraIJ..2.005vasalternasdemetabolismodelahormona
tiroidea.tiroideas15:943958[PubMed]
193.StanleyEL.,HumeR.,CoughtrieMW..2005Expresindeperfilesdesulfotransferasascitoslicasfetales
humanosimplicadosenelmetabolismodeesteroidesylahormonadelatiroidesyenladesintoxicacin.MolCell
Endocrinol240:3242[PubMed]
194.KesterMH.,KapteinE.,RoestTJ.,vanDijkCH.,TibboelD.,MeinlW.,GlattH.,CoughtrieMW.,VisserTJ..
1999Caracterizacindesulfotransferasasyodotironinahumanos.JClinEndocrinolMetab84:13571364
[PubMed]
195.PietschCA.,ScanlanTS.,AndersonRJ..2007Thyronaminessonsustratosparasulfotransferasashgado
humano.Endocrinologa148:19211927[PubMed]
196.KapteinE.,vanHaasterenGA.,LinkelsE.,deGreefWJ.,VisserTJ..1997Caracterizacindelaactividad
sulfotransferasayodotironinaenhgadoderata.Endocrinologa138:5136a5.143[PubMed]
197.KatoY.,IkushiroS.,EmiY.,TamakiS.,SuzukiH.,SakakiT.,S.Yamada,DegawaM.2008.hepticosUDP
glucuronosiltransferasasresponsablesdelaglucuronidacindetiroxinaenlossereshumanos.DrugMetabDispos36
:5155[PubMed]
198.MorenoM.,KapteinE.,GogliaF.,VisserTJ..1994glucuronidacinrpidadetriycidotetraiodotiroacticoa
sterglucurnidosenelhgadohumanoyaglucurnidosterenhgadoderata.Endocrinologa135:10041009
[PubMed]
199.VisserTJ,KapteinE.,H.vanToor,vanRaaijJA,vandenBergKJ,JoeCT,vanEngelenJG,BrouwerA.
1993......Glucuronidacindehormonatiroideaenelhgadoderatas:efectosdelatratamientoinvivoconinductores
enzimticosmicrosomalesyencondicionesdeensayoinvitro.Endocrinologa133:21772186[PubMed]
200.FrumessRD.,LarsenPR..1975Correlacindetriyodotironinasuero(T3)ytiroxina(T4)conefectos
biolgicosdereemplazodehormonatiroideaenratastratadaspropylthiouracil.Metabolismo24:547554
[PubMed]
201.HervasF.,MorrealedeEscobarG.,EscobarDelReyF.1975.efectosrpidosdepequeasdosisnicasdeL
tiroxinaytriyodotironinaLtironinaenlahormonadelcrecimiento,queestudienlarataporradioimmunoassy.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

96/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Endocrinologa97:91101[PubMed]
202.LarsenPR.,FrumessRD..1977Comparacindelosefectosbiolgicosdelatiroxinaytriyodotironinaenla
rata.Endocrinologa100:980988[PubMed]
203.ClarkOH.,LambertWR.,CavalieriRR.,RapoportB.,HammondME.,IngbarSH..1976hipertrofia
compensatoriatiroidesdespushemitiroidectomaenratas.Endocrinologa99:988995[PubMed]
.204SahaSK,OhinataH.,OhnoT.,KuroshimaA.1998..Latermognesisylacomposicindecidosgrasosdel
tejidoadiposopardoenratasrendidohipertiroidismoyelhipotiroidismo,conespecialreferenciaacido
docosahexaenoico.JaponsJPhysiol48:355364[PubMed]
205.BranvoldDJ.,AllredDR.,BecksteadDJ.,KimHJ.,N.Fillmore,CondonBM.,BrownJD.,SudweeksSN.,
ThomsonDM.,WinderWW..2.008efectosdelahormonatiroideaenLKB1,MO25,fosfoAMPK,fosfatoCREB
yPGC1alfaenelmsculoderata.JApplPhysiol105:12181227[PubMed]
206.BoughterJD.,Jr,RaghowS.,NelsonTM.,MungerSD..2005PurascepasderatonesC57BL/6JyDBA/2J
varanensensibilidadaunsubconjuntodeestmulosamargo.BMCGenet6:.36[PMClibresartculo]
[PubMed]
207.ChatouiH.,ElHibaO.,ElgotA.,GamraniH.2012.LarataSCOcapacidadderespuestaalaprivacin
prolongadadelagua:implicacindelsistemadefibraylaserotoninadeReissner.CRBiol335:253260
[PubMed]
208.CawthorneC.,R.Swindell,StratfordIJ,buceoC.,WelmanA.2007..Comparacindedoxiciclinamtodosde
entregadeTetinduciblelaexpresingnicaenunmodelodexenoinjertosubcutneo.JBiomolTecnologa18:
120123[PMClibredelartculo][PubMed]
209.RondeelJMM.,DeGreefWJ.,KlootwijkW.,VisserTJ..1992Efectosdelhipotiroidismosobrelaliberacin
hipotalmicadelahormonaliberadoradetirotropinaenratas.Endocrinologa130:651656[PubMed]
210.SolsSJ.,VillalobosP.,A.Orozco,DelgadoG.,QuintanarStephanoA.,GarcaSolisP.,HernndezMontiel
HL.,RoblesOsorioL.,ValverdeRC..2010Lainhibicindeladeshalogenacinintratiroideoporyoduro.J
Endocrinol208:8996[PubMed]
211.UetaCB.,OlivaresEL.,BiancoAC..2011Lacapacidadderespuestaalahormonadelatiroidesyla
temperaturaambientesubyaceenlasdiferenciasentreeltejidoadiposomarrntermognesisyelmsculoesqueltico
enunmodeloderatndelaobesidadinducidaporladieta.Endocrinologa152:3.5713.581
[PMClibresartculo][PubMed]
212.PerelloM.,T.Friedman,PezEspinosaV.,ShenX.,StuartRC.,NillniEA..2006hormonastiroideasregulan
selectivamenteelprocesamientopostraduccionaldelahormonaliberadoradeprothyrotropinenelncleo
paraventriculardelhipotlamo.Endocrinologa147:27052716[PubMed]
213.GoldbergRC.,ChaikoffIL.,LindsayS.,FellerDD..1950cambioshistopatolgicosinducidosenlatiroides
normalyotrostejidosdelarataporlaradiacininternaconvariasdosisdeyodoradiactivo.Endocrinologa46:72
90[PubMed]
214.FellerDD.,ChaikoffIL.,TaurogA.,JonesHB..1949Loscambiosinducidosenelmetabolismodelyododela
rataporlaradiacininternadesutiroidesconI131.Endocrinologa45:464479[PubMed]
215.GoldbergRC.,ChaikoffIL..1949unprocedimientosimplificadoparalatiroidectomadelaratarecinnacida
sinparatiroidectomaconcomitante.Endocrinologa45:6470[PubMed]
216.KasugaY.,MatsubayashiS.,SakatsumeY.,AkasuF.,C.Jamieson,VolpeR.1991.Elefectodelos
xenotrasplantesdetejidotiroideohumanotrasradiactivoinducidoporyodoablacintiroideasobrelafuncintiroidea
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

97/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

enelratndesnudo.ClinInvestMed14:277281[PubMed]
217.SeoH.,WunderlichC.,VassartG.,RefetoffS.1981.respuestashormonadelcrecimientoparalahormona
tiroideaenlarataneonatal:laresistenciaylarespuestaanamnsica.JClinInvest67:569574
[PMClibresartculo][PubMed]
218.SmithPE..1930Hipofisectomayunaterapiadereemplazoenlarata.AmJAnatoma45:205273
.219RenaudS.,G.Picard1964.Unamesamejoradoparahipofisectomaenrata.CanJPhysiolPharmacol42:
870872[PubMed]
220.FalconiG.,RossiGL..1964Mtodoparalacolocacindeuninjertodehipfisisenlacpsulapituitaria
evacuadodelarataoelratnhipofisectomizada.Endocrinologa75:964967[PubMed]
221.SatoM.,YonedaS.1966.Unmtodoeficienteparalahipofisectomatransauricularenratas.ActaEndocrinol
(Copenh)51:4348[PubMed]
222.LeungGS.,M.Kawai,TaiJK.,J.Chen,BandieraSM.,Changconocimientostradicionales.2009.expresin
deldesarrolloylaregulacinendocrinadeCYP1B1entestculosderatas.DrugMetabDispos37:523528
[PubMed]
223.KimuraS.,HaraY.,T.Pineau,FernndezSalgueroP.,FoxCH.,Ward,JM.,FJGonzlez..1996ElT/ebp
nularatn:tiroidesespecficaprotenadeuninapotenciadoresesencialparalaorganognesisdelatiroides,
pulmn,cerebroanteriorventral,ylahipfisis.GenesDev10:6069[PubMed]
.224.MansouriA.,K.Chowdhury,P.Gruss1998clulasfolicularesdelaglndulatiroidesrequierenlafuncinde
genesPax8.NatGenet19:8790[PubMed]
225.AdamsPM.,SteinSA.,PalnitkarM.,AnthonyA.,GerrityL.,ShanklinDR.1989.Evaluacinycaracterizacin
delhipotiroidismoratnhyt/hyt.I:somticayestudiosdecomportamiento.Neuroendocrinologa49:138143
[PubMed]
226.SteinSA.,ShanklinDR.,KrulichL.,RothMG.,ChubbCM.,AdamsPM.1989.Evaluacinycaracterizacin
delahyt/hytratnhipotiroidismo.II.AnomalasdeTSHylaglndulatiroides.Neuroendocrinologa49:509519
[PubMed]
227.MarianosRC.,NgL.,BlairHC.,UngerP.,GravesPN.,DaviesTF..2002Definirlospasosdetirotropina
dependienteseindependientesdeldelasntesisdelahormonatiroideamedianteelusodereceptornullratones
tirotropina.ProcNatlAcadSciEE.UU.99:1577615781[ArtculolibrePMC][PubMed]
228.JohnsonKR.,MardenCC.,WardBaileyP.,GagnonLH.,BronsonRT.,DonahueLR..2007Elhipotiroidismo
congnito,enanismo,yladeficienciaauditivacausadaporunamutacinenelgendelratndualoxidasa2,DUOX2
.MolEndocrinol21:15931602[PubMed]
229.[Suprimido.]
230.BeamerWG.,MaltaisLJ.,DeBaetsMH.,EicherEM..1987heredadasbociocongnitoenratones.
Endocrinologa120:838840[PubMed]
.231TaylorBA,RoweL.1987..Lamutacinbociocongnitoestligadoalgendetiroglobulinaenelratn.Proc
NatlAcadSciEE.UU.84:19861990[PMClibresartculo][PubMed]
232.CastilloM.,HallJA.,CorreaMedinaM.,UetaC.,KangHW.,CohenDE.,BiancoAC..2011Interrupcinde
laactivacindelahormonatiroideaeneltipo2desyodasasratonesknockoutprovocalaobesidadconintoleranciaa
laglucosaylaesteatosishepticasloentermoneutralidad.Diabetes60:10821089[PMClibresartculo]
[PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

98/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

233.WatanabeM.,HoutenSM.,MatakiC.,ChristoffoleteMA.,KimBW.,SatoH.,MessaddeqN.,HarneyJW.,
EzakiO.,KodamaT.,SchoonjansK.,BiancoAC.,AuwerxJ.2006.Loscidosbiliaresinducenelgastodeenerga
mediantelapromocindelaactivacindelahormonatiroideaintracelular.Naturaleza439:484489[PubMed]
234.deJessLA.,CarvalhoSD.,RibeiroMO.,SchneiderM.,KimSW.,HarneyJW.,LarsenPR.,BiancoAC.
2.001.Eltipo2yodotironinadeiodinaseesesencialparalatermognesisadaptativaeneltejidoadiposomarrn.J
ClinInvest108:13791385[PMClibresartculo][PubMed]
235.RoseneML.,WittmannG.,ArrojoeDrigoR.,SingruPS.,LechanRM.,BiancoAC..2010Lainhibicinde
layodotironinadeiodinasetipo2subyacelaTSHplasmticaelevadaasociadaconeltratamientoconamiodarona.
Endocrinologa151:5.961a5970[PMClibresartculo][PubMed]
236.ReiterRJ.,KlausS.,EbbinghausC.,HeldmaierG.,RedlinU.,RicquierD.,VaughanMK.,SteinlechnerS.
1990.Lainhibicindela5'desyodacindetiroxinasuprimeelaumentoinducidoporelfroenmensajerotejido
adiposocidoribonucleicomarrnparaladisociacindeprotenasmitocondriales,sininfluirenlaactividaddela
lipoprotenalipasa.Endocrinologa126:25502554[PubMed]
237.BiancoAC.,CarvalhoSD.,CarvalhoCR.,RabeloR.,MoriscotAS..1998Latiroxina5'desyodacinmedia
lipognesisinducidapornorepinefrinaenlosadipocitosmarronesdispersas.Endocrinologa139:571578
[PubMed]
238.PolCJ.,A.Muller,ZuidwijkMJ.,vanDeelED.,KapteinE.,A.Saba,MarchiniM.,R.Zucchi,VisserTJ.,
PaulusWJ.,DunckerDJ.,SimnidesWS..2011laremodelacindelventrculoizquierdodespusdeuninfartode
miocardioseasociaconunacondicindehipotiroidismocardiomiocitosespecfica.Endocrinologa152:669679
[PubMed]
239.MedinaMC.,J.Molina,GadeaY.,fachadoA.,M.Murillo,SimovicG.,PileggiA.,HernndezA.,H.Edlund,
BiancoAC..2011EltipodehormonatiroideainactivacinIIIdeiodinaseseexpresaenelratnyclulasbeta
humanasysuinactivacinespecficaafectalasecrecindeinsulina.Endocrinologa152:37173.727
[ArtculolibrePMC][PubMed]
240.[Suprimido.]
241.ELOlivares.,MarassiMP.,FortunatoRS.,daSilvaAC.,CostaeSousaRH.,ArajoIG.,MattosCE.,Masuda
MO.,MulcaheyMA.,HuangSA.,BiancoAC.,CarvalhoDP..2007perturbacindelafuncintiroideayeltipo3
yodotironinainduccindeiodinasedespusdeuninfartodemiocardioenratasuntiempodeestudio.Endocrinologa
148:4.7864.792[PubMed]
242.AbramsGM.,LarsenPR..1973triyodotironinaytiroxinaenelsueroylaglndulatiroideaderatascon
deficienciadeyodo.JClinInvest52:25222531[PMClibresartculo][PubMed]
243.EscobarMorrealeHF.,ObregnMJ.,EscobardelReyF.,MorrealedeEscobarG.1.995.Laterapiade
reemplazoparaelhipotiroidismocontiroxinasolanoaseguraeutiroidismoentodoslostejidos,yaestudiadoenratas
tiroidectomizados.JClinInvest96:28282838[PMClibresartculo][PubMed]
244.EscobarMorrealeHF,EscobardelReyF.,ObregnMJ,MorrealedeEscobarG.1996...Sloeltratamiento
combinadocontiroxinaytriyodotironinaaseguraeutiroidismoentodoslostejidosdelaratatiroidectomizado.
Endocrinologa137:24902502[PubMed]
245.FrumessRD.,LarsenPR.1975.Elefectodelainhibicindelatriyodotironina(T3)laproduccindetiroxina
(T4)porelpropiltiouracilo(PTU)sobrelaactividadfisiolgicadeT4enratastiroidectomizados.En:HarlandWA,
editor,OrrJS,editor.(Editores)Tiroidesmetabolismohormonal.AcademicPress,Waltham,MA,pp125137
246.LarsenPR.,FrumessRD.1976.Comparacindelosefectosdelatriyodotironina(T3)ytiroxina(T4)ensuero
deTSHyhepticaglicerofosfatodeshidrogenasamitocondrial(alfaGPD)actividadesenratashipotiroideos
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

99/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

tiroidectomizados.En:RobbinsJ,editor,BravermanLE,editor.(Editores)TiroidesInvestigacin:Actasdela
SptimaConferenciaInternacionaldelatiroides,Boston,Massachusetts,June913,1975ExcerptaMedica,
Amsterdam,pp2124
247.DeolMS.1973.Unaaproximacinexperimentalalacomprensinyeltratamientodelossndromeshereditarios
consorderacongnitayelhipotiroidismo.JMedGenet10:235242[PMClibresartculo][PubMed]
248.HbertR.,LangloisJM.,DussaultJH..1.985defectospermanentesenlafuncinauditivaperifricarata
siguienteshipotiroidismoperinatal:determinacindeunperodocrtico.BrainRes23:161170[PubMed]
249.SprenklePM.,J.McGee,BertoniJM.,WalshEJ..2001Prevencindeladisfuncinauditivaenhipotiroidismo
TSHrratonesmutantesporeltratamientodetiroxinaduranteeldesarrollo.JAsocResOtolaryngol2:348361
[PMClibresartculo][PubMed]
250.SprenklePM.,J.McGee,BertoniJM.,WalshEJ..2001Desarrollodelasrespuestasauditivasdeltronco
cerebral(ABR)enTSHrratonesmutantesprocedandemadreseutiroideoehipotiroidismo.JAsocResOtolaryngol
2:330347[PMClibresartculo][PubMed]
251.SprenklePM.,J.McGee,BertoniJM.,WalshEJ..2001Consecuenciasdehipotiroidismoenfuncindel
sistemaauditivoenmutantes(HYT)ratonesTSHr.JAsocResOtolaryngol2:312329[PMClibresartculo]
[PubMed]
252.AntonicaF.,KasprzykDF.,OpitzR.,IacovinoM.,LiaoXH.,DumitrescuAM.,RefetoffS.,PeremansK.,
MantoM.,KybaM.,CostagliolaS.2012.Generacindefuncionaltiroidesapartirdeclulasmadreembrionarias.
Naturaleza491:6671[ArtculolibrePMC][PubMed]
253.MaR.,R.Latif,DaviesTF..2013laformacindelfolculotiroidesylaexpresindetiroglobulinaenlas
clulasmadremultipotentesendodrmico.tiroidea23:385391[ArtculolibrePMC][PubMed]
254.MoellerLC.,WardripC.,NiekraszM.,RefetoffS.,WeissRE..2009Comparacindesuerodeternera
tiroidectomizadosydespojadodesueroparaelestudiodelaaccindelahormonatiroideaenfibroblastosdepiel
humanainvitro.tiroides19:639644[artculolibrePMC][PubMed]
255.SamuelsHH.,StanleyF.,CasanovaJ.1979.ElagotamientodeL3,5,3'triyodotironinayLtiroxinaensuerode
terneraeutiroideoparasuusoenestudiosdecultivocelulardelaaccindelahormonatiroidea.Endocrinologa105
:8085[PubMed]
256.HollenbergAN.,MondenT.,MaduraJP.,LeeK.,WondisfordFE..1996funcindelaprotenacorepresor
nuclearenloselementosderespuestadelahormonatiroideaestreguladaporeldominioreceptorA/B.JBiol
Chem271:2851628520[PubMed]
257.CaoZ.,WestC.,NortonWenzelCS.,RejR.,DavisFB.,DavisPJ.2009.Efectosdelaresinaocarbndelea
eneltratamientodesuerobovinofetalysuerobovinodeternero.EndocrRes34:101108[PubMed]
258.MullerA.,ZuidwijkMJ,vanHardeveldC.1993..Efectosdelahormonatiroideaenelcrecimientoyla
diferenciacindelasclulasmuscularesL6.BAM3:5968
259.ChristoffoleteMA.,R.Ribeiro,SingruP.,C.Fekete,daSilvaWS.,GordonDF.,HuangSA.,CrescenziA.,
HarneyJW.,RidgwayCE.,LarsenPR.,RMchan.,BiancoAC..2.006expresinatpicadetipo2yodotironina
deiodinaseentirotrofosexplicaelmecanismoderetroalimentacinpituitariatirotropinatiroxinamediada.
Endocrinologa147:17351743[PubMed]
260.ShahV.,NguyenP.,NguyenNH.,TogashiM.,ScanlanTS.,BaxterJD.,WebbP.2008.accionescomplejasde
antagonistadelreceptordelahormonatiroideaNH3enlospromotoresdegenesendiferenteslneascelulares.Mol
EndocrinolCell296:6977[PMClibresartculo][PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

100/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

261.GroverGJ.,C.Dunn,NguyenNH.,J.Boulet,DongG.,J.Domogauer,BarbounisP.,ScanlanTS.2007.perfil
farmacolgicodelosantagonistadelreceptordelahormonatiroideaNH3enratas.JPharmacolExpTher322:385
390[PubMed]
262.NguyenNH.,AprilettiJW.,CunhaLimaST.,WebbP.,BaxterJD.,ScanlanTS..2002Diseoracionaly
sntesisdeunantagonistadelahormonatiroideanovelaqueelreclutamientobloquescoactivador.JMedChem45:
3.310a3.320[PubMed]
263.LimW.,NguyenNH.,YangHY.,ScanlanTS.,FurlowJD..2002Unantagonistadelahormonatiroideaque
inhibelaaccindelahormonatiroideaenvivo.JBiolChem277:35664hasta35670[PubMed]
264.BaxterJD.,GoedeP.,AprilettiJW.,WestBL.,FengW.,MellstrmK.,FletterickRJ.,WagnerRL.,Kushner
PJ.,RibeiroRC.,WebbP.,ScanlanTS.,NilssonS.2002.diseoEstructurabasadaylasntesisdeunreceptordela
hormonatiroidea(TR)antagonista.Endocrinologa143:517524[PubMed]
265.YoshiharaHA.,AprilettiJW.,BaxterJD.,ScanlanTS..2001Unantagonistadiseadodelreceptordela
hormonatiroidea.BioorgMedChemLett11:28212825[PubMed]
266.SeeligS.,SaltoDB.,TowleHC.,LiawC.,MariashCN.,SchwartzHL.,OppenheimerJH..1.982efectos
paradjicosdecicloheximidaenlaultrarpidainduccindedossecuenciasdeARNmhepticoportriyodotironina
(T3).Endocrinologa110:671673[PubMed]
267.BiancoAC.,SilvaJE.1987.Serequierelaconversinintracelulardetiroxinaentriyodotironinaparalafuncin
termognicaptimadeltejidoadiposomarrn.JClinInvest79:295300[PMClibresartculo][PubMed]
268.BiancoAC.,SilvaJE..1987respuestaptimadeenzimasclaveyladisociacindeprotenasalfroenlosMTD
dependelocaldeT3generacin.AmJPhysiol253:E255E263[PubMed]
269.BiancoAC.,ShengXY.,SilvaJE..1988triyodotironinaamplificaestimulacinnorepinefrinade
desacoplamientodelatranscripcindegenesdeprotenasmedianteunmecanismoquenorequierelasntesisde
protenas.JBiolChem263:18.168a18175[PubMed]
270.[Suprimido.]
271.CarvalhoSD.,KimuraET.,BiancoAC.,SilvaJE.1.991.Elpapelcentraldetejidoadiposomarrntiroxina5'
deiodinaseenrespuestatiroideshormonadependientetermognicoalfro.Endocrinologa128:21492159
[PubMed]
272.[Suprimido.]
273.CarvalhoBiancoSD.,KimBW.,ZhangJX.,HarneyJW.,RibeiroRS.,GerebenB.,BiancoAC.,MendeU.,
LarsenPR..2004tirotoxicosisespecficacardiacacrnicaaumentaelinfartodebetaadrenrgicoderespuesta.Mol
Endocrinol18:18401849[PubMed]
274.TrivieriMG.,OuditGY.,SahR.,KerfantBG.,domH.,GramoliniAO.,PanY.,WickendenAD.,CroteauW.,
MorrealedeEscobarG.,PekhletskiR.,StGermainD.,MaclennanDH.,BackxPH..2006elevacionesespecficas
cardacoenlahormonatiroideaaumentanlacontractilidadyprevenirlapresininducidaporsobrecargadisfuncin
cardaca.ProcNatlAcadSciEE.UU.103:6.043a6.048[ArtculolibrePMC][PubMed]
275.HernndezA.,MartnezME,FieringS.,GaltonVA,StGermainD.2006...Tipo3deiodinaseesfundamental
paralamaduracinylafuncindelejetiroideo.JClinInvest116:476484[PMClibresartculo][PubMed]
276.HernndezA.,MartnezME.,LiaoXH.,VanSandeJ.,RefetoffS.,GaltonVA.,StGermainDL..2007Tipo3
desyodasasdeficienciadalugaraalteracionesfuncionalesenmltiplesnivelesdelejetiroideo.Endocrinologa148:
5.680a5687[PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

101/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

277.NgL.,A.Hernndez,lW.,RenT.,SrinivasM.,MaM.,GaltonVA.,StGermainDL.,ForrestD.2009.Un
papelprotectorparaeltipo3deiodinase,unatiroidesenzimahormonaqueinactivan,eneldesarrollococlearyla
funcinauditiva.Endocrinologa150:19521960[ArtculolibrePMC][PubMed]
278.HernndezA.,QuignodonL.,MartnezME.,FlamantF.,StGermainDL..2010deficienciadetipo3
deiodinasecausaalteracionesespacialesytemporalesenelcerebroT3desealizacinquesedisociadelosniveles
dehormonastiroideasensuero.Endocrinologa151:55505.558[ArtculolibrePMC][PubMed]
279.NgL.,LyubarskyA.,NikonovSS.,MaM.,SrinivasM.,KefasB.,StGermainDL.,HernndezA.,PughES.,
Jr,ForrestD.2010.Tipo3deiodinase,unaenzimadelahormonatiroideaqueinactivan,controlalasupervivenciay
lamaduracindelosconos.JNeurosci30:3347hasta3357[PMClibresartculo][PubMed]
280.[Suprimido.]
.281..MurataY.,CeccarelliP.,RefetoffS.,HorwitzAL,MatsuiN.1987hormonatiroidesinhibelasntesisde
fibronectinaporlosfibroblastosdepielhumanacultivadas.JClinEndocrinolMetab64:334339[PubMed]
282.MiuraM.,TanakaK.,KomatsuY.,M.Suda,YasodaA.,Y.Sakuma,OzasaA.,NakaoK.2002.Lashormonas
tiroideaspromuevenladiferenciacindecondrocitosenlasclulasATDC5ratnyestimulanlaosificacin
endocondralenfetaltibiasratnatravsyodotironinadeiodinasasenlaplacadecrecimiento.JBoneMinerRes17:
443454[PubMed]
283.AlJubouriMA.,InksterGD.,NeePA.,AndrewsFJ..2006Tirotoxicosispresentarparlisiscomo
hipopotasmicoehiperlactacidemiaenunhombreoriental.AnnClinBiochem43:323325[PubMed]
284.HoJ.,R.Jackson,JohnsonD.2011.levotiroxinaingestinmasivaenunpacientepeditrico:reportedeuncaso
ydiscusin.CJEM13:165168[PubMed]
285.BrentGA.2000.accionesespecficasdetejidodelahormonatiroidea:puntosdevistadelosmodelosanimales.
RevEndocrMetabDisord1:2733[PubMed]
.286.ForrestD.,VennstromB.2000Funcionesdelosreceptoresdehormonastiroideasenratones.tiroideas10:
4152[PubMed]
.287PennockGD,RayaTE,BahlJJ,GoldmanS.,MorkinE.1992....Losefectoscardacosdecido3,5
diiodothyropropionic,unanlogodelahormonatiroideaconselectividadinotrpico.JPharmacolExpTher263:
163169[PubMed]
288.MahaffeyKW.,RayaTE.,PennockGD.,MorkinE.,GoldmanS.1995.rendimientodelventrculoizquierdoy
laremodelacinenconejosdespusdeuninfartodemiocardio.Efectosdeunanlogodelahormonatiroidea.
Circulacin91:794801[PubMed]
289.PennockGD.,RayaTE.,BahlJJ.,GoldmanS.,MorkinE.1993.Lacombinacindeltratamientoconcaptopril
yelanlogodelahormonatiroideacido3,5diiodothyropropionic.Unnuevoenfoqueparamejorarelrendimiento
delventrculoizquierdoenlainsuficienciacardaca.Circulacin88:12891298[PubMed]
290.AbohashemAlyAA.,MengX.,LiJ.,SadariaMR.,AoL.,J.Wennergren,FullertonDA.,RaeburnCD..2011
DITPA,unanlogodelahormonatiroidea,reduceeltamaodelinfartoyatenalarespuestainflamatoriadespusde
laisquemiamiocrdica.JSurgRes171:379385[PubMed]
.291TomanekRJ,ZimmermanMB,SuvarnaPR,MorkinE.,PennockGD,GoldmanS.1998.....Unanlogodela
hormonatiroideaestimulalaangiognesisenelcoraznderatapostinfartado.JMolCellCardiol30:923932
[PubMed]
292.LadensonPW.,McCarrenM.,MorkinE.,EdsonRG.,ShihMC.,WarrenSR.,BarnhillJG.,ChurbyL.,
tailandsH.,O'BrienT.,AnandI.,WarnerA.,HattlerB.,M.Dunlap,EriksonJ.,GoldmanS.2010.Efectosdel
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

102/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

agentecidodiiodothyropropionictiromimticosobreelpesocorporal,ndicedemasacorporal,ylaslipoprotenas
sricas:estudiopilotoprospectivo,aleatorizadoycontrolado.JClinEndocrinolMetab95:13491354[PubMed]
293.GoldmanS.,McCarrenM.,MorkinE.,LadensonPW.,EdsonR.,WarrenS.,J.Ohm,tailandsH.,ChurbyL.,
J.Barnhill,O'BrienT.,AnandI.,WarnerA.,HattlerB.,M.Dunlap,EriksonJ.,ShihMC,LavoriP.2009..DITPA
(cido3,5diiodothyropropionic),unanlogodelahormonatiroideaparatratarlainsuficienciacardiaca:faseIIde
ensayosveteranosasuntosestudiocooperativo.Circulacin119:30933100[PubMed]
294.HadiNR.,AlamranFG.,HusseinAA.2011.Efectosdeanlogodelahormonatiroideayunavabloqueador
leucotrienosenlaisquemiarenal/reperfusinenratones.BMCNephrol12:.70[PMClibresartculo][PubMed]
295.TalukderMA.,YangF.,NishijimaY.,ChenCA.,XieL.,MahamudSD.,KalyanasundaramA.,BonaguraJD.,
PeriasamyM.,ZweierJL..2.011efectosperjudicialesdelahormonatiroideaDITPAanalgicoenelcorazndel
ratn:aumentodelamortalidadconinvivodeisquemiareperfusinmiocrdicaaguda.AmJPhysiolCoraznCirc
Physiol300:H702H711[PMClibresartculo][PubMed]
296.WagnerRL.,HuberBR.,ShiauAK.,KellyA.,CunhaLimaST.,ScanlanTS.,AprilettiJW.,BaxterJD.,West
BL.,FletterickRJ..2001selectividadhormonalenreceptoresdehormonastiroideas.MolEndocrinol15:398410
[PubMed]
297.SchuelerPA.,SchwartzHL.,EstrechoKA.,MariashCN.,OppenheimerJH..1990Launinde3,5,3'
triyodotironina(T3)ysusanlogosalosproductosdelatraduccininvitrodecerbAprotooncogenes:las
diferenciasenlaafinidaddelasformasyparaelanlogodecidoacticoyelfracasodeltestculohumanoy
rin2productosdeobligarT3.MolEndocrinol4:227234[PubMed]
298.MartnezL.,NascimentoAS.,NunesFM.,PhillipsK.,AparicioR.,DiasSM.,FigueiraAC.,LinJH.,Nguyen
P.,AprilettiJW.,NevesFA.,BaxterJD.,WebbP.,SkafMS,PolikarpovI2009..Ganandoselectividadligandode
losreceptoresdelahormonatiroideaatravsdelaentropa.ProcNatlAcadSciEE.UU.106:20717hasta20722
[ArtculolibrePMC][PubMed]
.299.MassolJ.,MartinP.,SoubrieP.,SimonP.1987triyodotiroacticoinversininducidaporelcidodela
indefensinaprendidaenratas.EurJPharmacol134:345348[PubMed]
300.MedinaGmezG.,A.Hernndez,CalvoRM.,MartinE.,ObregnMJ..2003accintermognicapotentedel
cidotriyodotiroacticoenadipocitosmarrones.CellMolLifeSci60:19571967[PubMed]
301.MedinaGmezG.,CalvoRM.,ObregnMJ.2008.efectotermognicodecidotriyodotiroacticoabajasdosis
eneltejidoadiposoderatasinefectossecundariosadversosenelejedelatiroides.AmJPhysiolEndocrinolMetab
294:E688697[PubMed]
302.LiangH.,
jugeAubryCE.,M.O'Connell,BurgerAG.1997.efectosespecficosderganosdecido3,5,3

triyodotiroacticoenratas.EurJEndocrinol137:537544[PubMed]
.303SalmelaPI,AnchoL.,JuustilaH.,RuokonenA.1988..Losefectosdelashormonastiroideas(T4,T3),
bromocriptinayTriacdesecrecininadecuadadeTSH.ClinEndocrinol(Oxf)28:497507[PubMed]
304.BeckPeccozP.,A.Sartorio,DeMediciC.,GrugniG.,F.Morabito,FagliaG.1988.efectosdisociadas
tiromimticosde3,5,3'triyodotiroacticocido(TRIAC)enlahipfisisynivelesdetejidosperifricos.JEndocrinol
Invest11:113118[PubMed]
305.MuellerGaertnerHW,SchneiderC.1988..cido3,5,3triyodotiroacticominimizalapituitariatirotropina
secrecinenlospacientesentratamientolevotiroxinadespusdelaterapiaablativaporcarcinomadiferenciadode
tiroides.ClinEndocrinol(Oxf)28:345351[PubMed]
306.ShermanSI.,LadensonPW.1992.efectosespecficosderganosdetiratricol:unanlogodelahormona
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

103/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

tiroideaconelhgado,nopituitaria,efectossuperagonistas.JClinEndocrinolMetab75:901905[PubMed]
307.ShermanSI.,RingelMD.,SmithMJ.,KopelenHA.,ZoghbiWA.,LadensonPW..1997Aumentadaefectos
hepticosytiromimticosesquelticodetiratricolencomparacinconlevotiroxina.JClinEndocrinolMetab82:
21532158[PubMed]
308.ChielliniG.,AprilettiJW.,alYoshiharaH.,BaxterJD.,RibeiroRC.,ScanlanTS.1998.Unligandoagonista
selectivodesubtipodealtaafinidadparaelreceptordelahormonatiroidea.ChemBiol5:299306[PubMed]
309.RibeiroRC.,AprilettiJW.,WagnerRL.,FengW.,KushnerPJ.,S.Nilsson,ScanlanTS.,WestBL.,Fletterick
RJ.,BaxterJD..1998derayosXcristalogrficosyfuncionalesestudiosdereceptordehormonatiroidea.JSteroid
BiochemMolBiol65:133141[PubMed]
310.TrostSU.,E.Swanson,GlossB.,WangIversonDB.,ZhangH.,
VolodarskyT.,GroverGJ.,BaxterJD.,

ChielliniG.,ScanlanTS.,DillmannWH.2.000.ElagonistadelahormonatiroideareceptorbetaselectivaGC1
afectadiferencialmentelpidosplasmticosylaactividadcardaca.Endocrinologa141:30573.064[PubMed]
311.RibeiroMO.,CarvalhoSD.,SchultzJJ.,ChielliniG.,ScanlanTS.,BiancoAC.,BrentGA..2001interaccin
hormonatiroideasimpticoylatermognesisadaptativasonreceptordehormonatiroideaisoformaespecfica.JClin
Invest108:97105[PMClibresartculo][PubMed]
312.FreitasFRS.,ZornT.,LabatteC.,ScanlanTS.,BrentGA.,MoriscotAS.,BiancoAC.,GouveiaCHA.2002.
Efectosdelabetadelreceptordelahormonatiroidea(TRb)compuestoselectivoGC1eneldesarrolloseoderatas
Wistar.En:74ReuninAnualdelaAmericanThyroidAssociationAmericanThyroidAssociation,LosAngeles,
CA
313.FreitasFR.,MoriscotAS.,JorgettiV.,SoaresAG.,PassarelliM.,ScanlanTS.,BrentGA.,BiancoAC.,
GouveiaCH.2003.ahorradosmasaseaenratastratadasconelcompuestoTRreceptordehormonatiroideabeta
selectivaGC1.AmJPhysiolEndocrinolMetab285:E1135E1141[PubMed]
314.J.Manzano,MorteB.,ScanlanTS,BernalJ.2003..EfectosdiferencialesdetriyodotironinayGC1beta
especficodelagonistadelreceptordelahormonatiroideasobregenesdianadelahormonatiroideaenelcerebro.
Endocrinologa144:5480hasta5487[PubMed]
315.GroverGJ.,EganDM.,SlephPG.,BeehlerBC.,ChielliniG.,NguyenNH.,BaxterJD.,ScanlanTS.2004.
EfectosdelahormonatiroideaagonistadelreceptordeGC1sobrelatasametablicayelcolesterolenratasy
primates:accionesselectivasenrelacincon3,5,3'triyodoLtironina.Endocrinologa145:16561661[PubMed]
316.MartnezdeMenaR.,ScanlanTS.,ObregnMJ.2.010.LaT3beta1receptorisoformaregulaUCP1y
deiodinaseD2enlosadipocitosderatamarrn.Endocrinologa151:5074a5.083[PubMed]
317.BryzgalovaG.,EffendicS.,A.Khan,RehnmarkS.,BarbounisP.,J.Boulet,DongG.,R.Singh,ShapsesS.,
MalmJ.,WebbP.,BaxterJD.,GroverGJ..2008antiobesidad,antidiabticaylpidosefectosdelreceptortiroideo
betaagonistaselectivodelsubtipoKB141bajando.JSteroidBiochemMolBiol111:262267[PubMed]
.318GroverGJ,MellstrmK.,MalmJ.2007..Potencialteraputicodelahormonatiroideareceptorbetaagonistas
selectivosparaeltratamientodelaobesidad,hiperlipidemiaydiabetes.CurrVascPharmacol5:141154
[PubMed]
319.ErionMD.,CableEE.,ItoBR.,JiangH.,
FujitakiJM.,FinnPD.,ZhangBH.,J.Hou,BoyerSH.,vanPoelje

PD.,LinemeyerDL..2007Targetingagonistasdereceptorbetadelahormonatiroideaenelhgadoreduceel
colesterolylostriglicridosymejoraelndiceteraputico.ProcNatlAcadSciEE.UU.104:15.49015.495
[artculolibrePMC][PubMed]
320.GroverGJ.,MellstrmK.VosotrosL.,J.Malm,LiYL.,BladhLG.,SlephPG.,SmithMA.,GeorgeR.,
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

104/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

VennstrmB.,MookhtiarK.,HorvathR.,SpeelmanJ.,D.Egan,BaxterJD..2003Selectivohormonatiroidea
activacindelosreceptoresbeta:unaestrategiaparalareduccindepeso,elcolesterolylalipoprotena(a)con
responsabilidadcardiovascularreducida.ProcNatlAcadSciEE.UU.100:10.067a10.072[ArtculolibrePMC]
[PubMed]
321.BerkenstamA.,J.Kristensen,MellstrmK.,CarlssonB.,J.Malm,RehnmarkS.,N.Garg,AnderssonCM.,
RudlingM.,F.Sjberg,AngelinB.,BaxterJD..2008ElKB2115compuestomimticodelahormonatiroidea
reduceelcolesterolLDLenplasmayestimulalasntesisdecidosbiliaressinefectoscardacosenlossereshumanos
.ProcNatlAcadSciEE.UU.105:663667[PMCartculolibre][PubMed]
322.LadensonPW.,KristensenJD.,RidgwayCE.,OlssonAG.,B.Carlsson,KleinI.,BaxterJD.,AngelinB.2010.
Elusodeleprotiromaanlogodelahormonatiroideaenladislipidemiatratadosconestatinas.NEnglJMed362:
906916[PubMed]
323.KaroBioAB.2012.KaroBioterminaelprogramaeprotiroma.Disponibleenlneaen:
www.karobio.com/investormedia/pressreleaser/pressrelease?pid=639535(visitadaOctober15,2013)
324.ShioharaH.,NakamuraT.,KikuchiN.,OzawaT.,NaganoR.,A.Matsuzawa,OhnotaH.,MiyamotoT.,
IchikawaK.,HashizumeK.2012.Descubrimientodenuevosderivadosdeindanocomoelhgadotiroidesselectivo
delreceptorbetadelahormona(TRbeta)agonistasparaeltratamientodeladislipidemia.BioorgMedChem20:
3622hasta3634[PubMed]
325.ItoBR.,ZhangBH.,CableEE.,SongX.,FujitakiJM.,MacKennaDA.,WilkerCE.,ChiB.,vanPoeljePD.,
LinemeyerDL.,ErionMD..2009laactivacindelreceptorbetadelahormonadelatiroidestieneaditivopara
reducirelcolesterolactividadencombinacinconatorvastatinaenconejos,perrosymonos.BrJPharmacol156:
454465[PMClibresartculo][PubMed]
326.CableEE.,FinnPD.,StebbinsJW.,J.Hou,ItoBR.,vanPoeljePD.,LinemeyerDL.,ErionMD..2009
Reduccindelaesteatosishepticaenratasyratonesdespusdetratamientoconunagonistadelreceptordela
hormonatiroideadirigidaalhgado.Hepatologa49:407417[PubMed]
327.OcasioCA.,ScanlanTS..2006Diseoycaracterizacindeunreceptoralfadehormonatiroidea(TRalpha)
agonistaespecficode.ACSChemBiol1:585593[PubMed]
328.DenverRJ.,HuF.,ScanlanTS.,FurlowJD.2.009.Lahormonatiroideareceptorsubtipoespecificidadparala
neurognesisdependientedehormonasenXenopuslaevis.DevBiol326:155168[PubMed]
329.GrijotaMartnezC.,SamarutE.,ScanlanTS.,MorteB.,J.Bernal2011.Invivolaactividaddelabetadel
receptordelahormonatiroideaylosagonistasalfaselectivaGC24yelCO2de3enhgadoderata,elcoraznyel
cerebro.Endocrinologa152:11361142[PMClibresartculo][PubMed]
330.MorrealedeEscobarG.,ObregnMJ,EscobardelReyF.2007..Ladeficienciadeyodoyeldesarrollodel
cerebroenlaprimeramitaddelembarazo.NutrSaludPblica10:15541570[PubMed]
331.SchrodervanderElstJP.,vanderHeideD.,KastelijnJ.,RoussetB.,ObregnMJ..2001Laexpresindel
sodio/symporteryoduroeshastareguladasenlatiroidesdefetosderatascondeficienciadeyodo.Endocrinologa
142:3.7363.741[PubMed]
332.RiescoG.,A.Taurog,LarsenPR..1976Lasvariacionesenlarespuestadelaglndulatiroidesdelarataa
diferentesdietasbajasenyodo:correlacinconelcontenidodeyododeladieta.Endocrinologa99:270280
[PubMed]
.333..RiescoG.,A.Taurog,LarsenPR,KrulichL.1977agudasycrnicasrespuestasaladeficienciadeyodoen
ratas.Endocrinologa100:303313[PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

105/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

334.PazosMouraCC.,MouraEG.,DorrisMM.,RehnmarkS.,L.Melndez,SilvaJE.,TaurogA.1991.Efectode
ladeficienciadeyodoylaexposicinalfroenlaactividad5'tiroxinadeiodinaseenvariosratatejidos.AmJ
Physiol260:E175E182[PubMed]
335.LavadoAutricR.,CalvoRM.,MartnezdeMenaR.,MorrealedeEscobarG.,ObregnMJ..2.013actividades
deiodinaseentiroidesytejidosdeyododeficientesratashembras.Endocrinologa154:529536[PubMed]
.336..P.Santisteban,ObregnMJ,RodrguezPeaA.,L.Lamas,EscobardelReyF.,MorrealedeEscobarG.
1.982sonratascondeficienciadeyodoeutiroideo?Endocrinologa110:17801789[PubMed]
337.ObregnMJ.,P.Santisteban,RodrguezPeaA.,A.Pascual,CartagenaP.,RuizMarcosA.,L.Lamas,
EscobardelReyF.,MorrealedeEscobarG.1984.hipotiroidismocerebralenratascondeficienciadeyodoenla
edadadulta.Endocrinologa115:614624[PubMed]
.338ObregnMJ,EscobardelReyF.,MorrealedeEscobarG.2005..Losefectosdeladeficienciadeyodoen
desyodacinhormonatiroidea.tiroidea15:917929[PubMed]
339.EscobardelReyF.,RuizdeOaC.,J.Bernal,ObregnMJ.,MorrealedeEscobarG.1989.deficiencia
Generalizadode3,5,3triyodoLtironina(T3)enlostejidosderatasenunabajaingestadeyodo,apesardeque
circulanTnormales3niveles.ActaEndocrinol(Copenh)120:490498[PubMed]
340.EscobardelReyF.,PastorR.,J.Mallol,MorrealedeEscobarG.1.986.Losefectosdeladeficienciadeyodo
maternaenlaLtiroxinaycontenidos3,5,3triyodoLtironinadeembrionesderatatejidosantesydespusdelinicio
delafuncintiroideafetal.Endocrinologa118:12591265[PubMed]
.341ObregnMJ,RuizdeOaC.,CalvoR.,EscobardelReyF.,MorrealedeEscobarG.1991..deiodinasas
yodotironinaanilloexterioryeconomadelahormonatiroidea:respuestasaladeficienciadeyodoenelfetoderatay
elrecinnacido.Endocrinologa129:26632673[PubMed]
342.MartnezGalnJR.,PedrazaP.,M.Santacana,EscobardelReyF.,MorrealedeEscobarG.,RuizMarcosA.
1997.Losprimerosefectosdeladeficienciadeyodoenlasclulasglialesradialesdelhipocampodelaratafeto.Un
modelodecretinismoneurolgico.JClinInvest99:27012709[ArtculolibrePMC][PubMed]
343.MartnezGalnJR.,PedrazaP.,M.Santacana,EscobardelReyF.,MorrealedeEscobarG.,RuizMarcosA.
1997.mielinainmunorreactividadprotenabsicaenlacpsulainternadelosneonatosderatasenunbajolaingesta
deyodooenmethylmercaptoimidazole(MMI).BrainResDevBrainRes101:249256[PubMed]
344.LavadoAutricR.,AusoE.,GarcaVelascoJV.,ArufeMdelC.,EscobardelReyF.,BerbelP.,Morrealede
EscobarG.2003.hipotiroxinemiamaternatempranaalterahistognesisylacortezacerebralcitoarquitecturadela
progenie.JClinInvest111:10731082[ArtculolibrePMC][PubMed]
345.MorrealedeEscobarG.,ObregnMJ,RuizdeOaC.,EscobardelReyF.1988..Latransferenciadetiroxina
delamadrealfetoderataacortoplazo:efectossobreelcerebro3,5,3triyodotironinadeficiencia.Endocrinologa
122:15211531[PubMed]
346.CalvoR.,ObregnMJ,RuizdeOaC.,EscobardelReyF.,MorrealedeEscobarG.1990..Elhipotiroidismo
congnitocomoestudiadoenratas:elpapelcrucialdelatiroxinamaterna(T4),peronode3,5,3'triyodotironina(T3)
enlaproteccindelcerebrofetal.JClinInvest86:889899[PMClibresartculo][PubMed]
347.MorrealedeEscobarG.,R.Calvo,ObregnMJ,EscobardelReyF.1990..Contribucindelatiroxinamaterna
alaspiscinasdetiroxinafetalesenratasnormalescercadeltrmino.Endocrinologa126:27652767[PubMed]
348.BoelenA.,J.Kwakkel,volantesE.2011.MsalldebajaT3plasma:elmetabolismodelahormonatiroidea
localdurantelainflamacinylainfeccin.EndocrRev32:670693[PubMed]
349.RocchiR.,H.Kimura,TzouSC.,SuzukiK.,RoseNR.,PincheraA.,LadensonPW.,CaturegliP.2007.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

106/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

receptorMyD88yFcvasdelosreceptoresTolllikedelosmastocitosmedianladisfuncionestiroideasobservadas
durantelaenfermedadnotiroidea.ProcNatlAcadSciEE.UU.104:6019a6024[PMClibresartculo]
[PubMed]
350.MebisL.,vandenBergheG.2.009.Elejehipotlamohipfisistiroidesenlaenfermedadcrtica.NethJMed
67:332340[PubMed]
351.VellaKR.,RamadossP.,LamFS.,HarrisJC.VosotrosDF.,SameEP.,O'NeillNF.,MaratosAviadorE.,
HollenbergAN..2011NPYyMC4Rsealizacinaregularlosnivelesdehormonatiroideaduranteelayunoa
travsdeambasvascentralesyperifricas.MetabCell14:780790[PMClibresartculo][PubMed]
352.AHIMARS.,PrabakaranD.,MantzorosC.,QuD.,LowellB.,MaratosAviadorE.,aviadordeJS..1996
Papeldelaleptinaenlarespuestaneuroendocrinaalayuno.Naturaleza382:250252[PubMed]
353.PeetersRP.,WoutersPJ.,KapteinE.,H.vanToor,VisserTJ.,VandenBergheG.2003.activacinreduciday
aumentodelainactivacindelahormonatiroideaenlostejidosdelospacientescrticamenteenfermos.JClin
EndocrinolMetab88:32023211[PubMed]
354.HuangSA.,BiancoAC..2008volviadespertarinterseneltipoIIIyodotironinadeiodinaseenenfermedades
ylesionescrtico.NatClinPractEndocrinolMetab4:148155[PMClibresartculo][PubMed]
355.MebisL.,DebaveyeY.,VisserTJ,vandenBergheG.2006..Loscambiosenelejedelatiroidesduranteel
cursodelaenfermedadcrtica.EndocrinolMetabClinNorthAm35:.807821,x[PubMed]
356.GoodmanMN.,LarsenPR.,KaplanMM.,AokiTT.,VRYoung.,RudermanNB.1.980.Elhambreenlarata.
II.Efectodelaedadylaobesidadenunahorrodeprotenasyelmetabolismodecombustible.AmJPhysiol239:
E277E286[PubMed]
357.WuSY.1.990.ElefectodelayunosobrelaactividadtiroideamonodeiodinatingT45'enratones.Acta
Endocrinol(Copenhague)122:175180[PubMed]
358.BoelenA.,vanBeerenM.,VosX.,SurovtsevaO.,BelegriE.,SaaltinkDJ.,VreugdenhilE.,KalsbeekA.,J.
Kwakkel,volantesE.2012.administracindeleptinarestauralafastingaumentoinducidodetipoheptico3de
expresindeiodinaseenratones.tiroidea22:192199[PubMed]
359.HarrisARC.,FangSL.,VagenakisAG.,BravermanLE..1978Efectodelainanicin,lasustitucinde
nutrientes,yelhipotiroidismoenTinvitroheptica4aT3deconversinenlarata.Metabolismo27:16801690
[PubMed]
360.KinlawWB.,SchwartzHL.,OppenheimerJH..1985triyodotironinasricadisminuidaenratasmuerende
hambresedebeprincipalmentealasecrecintiroideadisminuidadetiroxina.JClinInvest75:12381241
[PMClibresartculo][PubMed]
361.BoelenA.,J.Kwakkel,WiersingaWM,volantesE.2006..lainflamacinlocalcrnicaenratonesresultaen
disminucindelaTRHyeltipo3deiodinaseexpresindelARNmenelncleoparaventricularhipotalmico
independientementedelaingestadealimentosdisminuida.JEndocrinol191:707714[PubMed]
362.BoelenA.,J.Kwakkel,AlkemadeA.,RenckensR.,KapteinE.,G.Kuiper,WiersingaWM.,VisserTJ..2005
Lainduccindetipo3deiodinaseactividadenlasclulasinflamatoriasderatonesconinflamacinlocalcrnica.
Endocrinologa146:5.128hasta5134[PubMed]
363.BoelenA.,PlatvoetterSchiphorstMC.,WiersingaWM..1997inmunoneutralizacindelainterleucina1,
factordenecrosistumoral,interleucina6ointerfernnoimpidequeelsndromeeutiroideoenfermoinducidapor
LPSenratones.JEndocrinol153:115122[PubMed]
364.BoelenA.,MaasMA.,LowikCW.,PlatvoetMC.,WiersingaWM..1.996enfermedadinducidaenla
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

107/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

interleucina6(IL6)losratonesknockout:unpapelcausaldelaIL6eneldesarrollodelsndromede3,5,3
triyodotironinabaja.Endocrinologa137:5.2505.254[PubMed]
365.BoelenA.,PlatvoetterSchiphorstMC.,BakkerO.,WiersingaWM.1.995.Elpapeldelascitocinasenel
sndromedeleutiroideoenfermolipopolisacridoinducidaenratones.JEndocrinol146:475483[PubMed]
366.BiancoAC.,NunesMT.,InfiernoNS.,MacielRM..1987Elpapeldelosglucocorticoidesenlareduccin
inducidaporelestrsdeextratiroidea3,5,3triyodotironinageneracionesderatas.Endocrinologa120:10331038
[PubMed]
367.MebisL.,DebaveyeY.,EllgerB.,DerdeS.,VerversEJ.,LangoucheL.,DarrasVM.,volantesE.,VisserTJ.,
vandenBergheG.2.009.Loscambiosenelcomponentecentraldelejehipotlamohipfisistiroidesenunmodelo
deconejodelaenfermedadcrticaprolongada.CritCare13:.R147[PMClibresartculo][PubMed]
368.WeekersF.,VanHerckE.,CoopmansW.,MichalakiM.,BowersCY.,VeldhuisJD.,VandenBergheG.
2.002.Unanovelaenmodelodeconejovivodeenfermedadcrticahipercatablicorevelaunarespuesta
neuroendocrinaalestrsbifsica.Endocrinologa143:764774[PubMed]
369.DebaveyeY.,EllgerB.,MebisL.,DarrasVM,VandenBergheG.2008..Regulacindelaactividad
deiodinaseyodotironinatejidoenunmodelodeenfermedadcrticaprolongada.tiroidea18:551560[PubMed]
370.BoelenA.,J.Kwakkel,WielandCW,StGermainDL,volantesE.,HernndezA.2009...laeliminacinde
bacteriasconImpedimentosentipo3ratonesdeficientesdesyodasasinfectadosconStreptococcuspneumoniae.
Endocrinologa150:19841990[PMClibredelartculo][PubMed]
371.KondoK.,HarbuzMS.,A.Levy,LightmanSL..1997Lainhibicindelejehipotlamohipfisistiroidesen
respuestaalipopolisacridoesindependientedeloscambiosenloscorticosteroidescirculantes.
Neuroimmunomodulation4:188194[PubMed]
372.C.Fekete,SarkarS.,ChristoffoleteMA.,EmersonCH.,BiancoAC.,RMchan..2005lipopolisacrido
bacteriano(LPS)detipo2inducidaporyodotironinadeiodinasa(D2)deactivacinenelhipotlamomediobasal
(MBH)esindependientedelacadainducidaporLPSenlosnivelessricosdehormonatiroidea.BrainResearch
1056:9799[PubMed]
373.C.Fekete,GerebenB.,DoleschallM.,HarneyJW.,DoraJM.,BiancoAC.,SarkarS.,LipositsZ.,RandW.
EmersonC.,KacskovicsI.,LarsenPR.,LechanRM..2004lipopolisacridoinducetipo2yodotironinadeiodinase
enelhipotlamomediobasal:implicacionesparaelsndromedeenfermedadnotiroidea.Endocrinologa145:1649
1655[PubMed]
374.BoelenA.,J.Kwakkel,ThijssenTimmerDC.,AlkemadeA.,volantesE.,WiersingaWM.2.004.Loscambios
simultneosenloscomponentescentralesyperifricosdelejehipotlamohipfisistiroidesenlaenfermedadaguda
inducidaporlipopolisacridoenratones.JEndocrinol182:315323[PubMed]
375.ZeldA.,DoleschallM.,HaffnerMC.,CapeloLP.,MenyhertJ.,LipositsZ.,daSilvaWS.,BiancoAC.,
KacskovicsI.,C.Fekete,GerebenB.2006.CaracterizacindeelfactorkappaBderespuestanucleardelgenESD2
humana.Endocrinologa147:4419a4429[PubMed]
.376.LamirandA.,RamaugeM.,M.Pierre,CourtinF.2011lipopolisacridobacterianoinducetipo2deiodinaseen
astrocitosderataencultivo.JEndocrinol208:183192[PubMed]
377.SapJ.,MuozA.,DammK.,GoldbergY.,GhysdaelJ.,LeutzA.,BeugH.,
VennstrmB.1986.ElAcerb

protenaesunreceptordealtaafinidadparalatiroideshormona.Naturaleza324:635640[PubMed]
378.C.Weinberger,ThompsonCC.,OngES.,LeboR.,GruolDJ.,EvansRM..1986AElcerbgencodificaun
receptordelahormonatiroidea.Naturaleza324:641646[PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

108/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

379.BrentGA.,MooreDD.,LarsenPR..1991laregulacinhormonaldelatiroidesdelaexpresingnica.Annu
RevPhysiol53:1735[PubMed]
380.GlassCK.,FrancoR.,C.Weinberger,AlbertVR.,EvansRM.,RosenfeldMG..1987AAcerbsitiodeunin
enelgendelahormonadelcrecimientoderatamedialatransactivacinporlahormonatiroidea.Naturaleza329:
738741[PubMed]
381.SapJ.,A.Muoz,J.Schmitt,StunnenbergH.,
VennstrmB.1989.Larepresindelatranscripcinmediada

porunelementoderespuestaalahormonatiroideaporlaAverbproductooncognico.Naturaleza340:242244
[PubMed]
382.ChengSY..2000mltiplesmecanismosparalaregulacindelaactividadtranscripcionaldelosreceptoresdela
hormonatiroidea.RevEndocrMetabDisord1:918[PubMed]
.383.FlamantF.,GauthierK.,J.2007SamarutsealizacinLashormonastiroideasescadavezmscomplejo:las
tormentasvienen.MolEndocrinol21:321333[PubMed]
384.[Suprimido.]
385.ChanIH.,PrivalskyML..2.009actividadtranscripcionalespecficaisoformadelasuperposicindegenes
dianaquerespondenalahormonatiroideareceptoresalfa1ybeta1.MolEndocrinol23:17581775
[PMClibresartculo][PubMed]
386.GlossB.,S.Trost,BluhmW.,E.Swanson,ClarkR.,R.Winkfein,JanzenK.,GilesW.,ChassandeO.,
SamarutJ.,DillmannW.2001.decanalesinicoscardacosfuncindeexpresinycontrctilenratonescon
eliminacindelahormonatiroideareceptoralfaobeta.Endocrinologa142:544550[PubMed]
387.WanW.,FarboudB.,PrivalskyML..2005resistenciahipofisariaalahormonatiroideasndromeseasociacon
T3mutantesdelreceptorqueperjudicanselectivamentelafuncinisoformabeta2.MolEndocrinol19:15291542
[PubMed]
388.YangZ.,PrivalskyML.2001.laregulacintranscripcionalespecficaisoformadereceptoresdehormonas
tiroideas:lahormonaindependientedeactivacinoperaatravsdeunmododereceptordeesteroidesdela
interaccincoactivador.MolEndocrinol15:11701185[PubMed]
389.ZhuXG.,McPhieP.,LinKH.,ChengSY..1997Laactivacindiferencialdependientedehormonas
transcripcionaldeisoformasdelreceptordelahormonatiroideaestmediadaporinteraccindesusdominios.JBiol
Chem272:90489054[PubMed]
390.FloresMoralesA.,GullbergH.,
L.Fernndez,StahlbergN.,LeeNH,VennstromB.,NorstedtG.2002..Los

patronesdeexpresingnicahepticagobernadoporTRbeta.MolEndocrinol16:12571268[PubMed]
391.MuozA.,RodrguezPeaA.,PrezCastilloA.,B.Ferreiro,SutcliffeJG,BernalJ.1991..Losefectosdel
hipotiroidismoneonatalenlaexpresingnicadecerebroderata.MolEndocrinol5:273280[PubMed]
392.ThompsonCC..1.996genessensiblesalashormonastiroideaseneldesarrollodelcerebeloincluyenuna
novelasinaptotagminayunhomlogosinpelo.JNeurosci16:7832a7.840[PubMed]
393.YenPM.,FengX.,FlamantF.,ChenY.,WalkerRL.,WeissRE.,ChassandeO.,SamarutJ.,RefetoffS.,
MeltzerPS.2003.Efectosdeligandoydelahormonatiroideaisoformasdelreceptorenlosperfilesdeexpresinde
geneshepticosderatonesknockoutdereceptoresdelahormonatiroidea.EMBORep4:581587
[PMClibresartculo][PubMed]
394.BiglerJ.,EisenmanRN.1994.Aislamientodeungensensibleahormonasdelatiroidespor
inmunoprecipitacindecomplejosdeADNdelreceptordelahormonatiroidea.MolCellBiol14:76217632
[PMCartculolibre][PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

109/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

395.RoylandJE.,ParkerJS.,GilbertME..2008Unanlisisgenmicodehipotiroidismosubclnicoenelhipocampo
yelneocrtexdelcerebroderataendesarrollo.JNeuroendocrinol20:13191338[PubMed]
.396.GuadaoFerrazA.,EscmezMJ,MorteB.,VargiuP.,BernalJ.1997.transcripcionallainduccindelaRC3
/neurograninaporlahormonatiroidea:lasensibilidadneuronaldiferencialnosecorrelacionaconladistribucindel
receptordelahormonatiroideaenelcerebro.BrainResMolBrainRes49:3744[PubMed]
397.AndersonGW.,LarsonRJ.,OasDR.,SandhoferCR.,SchwartzHL.,MariashCN.,OppenheimerJH.1998.
ovoalbminadepollofactordetranscripcinpromotoraguasarriba(COUPTF)modulalaexpresindelgendela
protenadeclulasdePurkinje2.UnposiblepapeldeGOLPETFenlarepresindeaccinprematuradehormona
tiroideaenelcerebroendesarrollo.JBiolChem273:16.391a16.399[PubMed]
.398..NgL.,A.Lu,SwaroopA.,SharlinDS,SwaroopA.,ForrestD.2011Dosfactoresdetranscripcinpuede
dirigirtresresultadosfotorreceptorasdeclulasprecursorasdevarillaeneldesarrollodelaretinadelratn.J
Neurosci31:1111811125[PMClibresartculo][PubMed]
399.[Suprimido.]
400.DongH.,
YaukCL.,RowanCarrollA.,UstedSH.,ZoellerRT.,LambertI.,WadeMG..2009Identificacin

delosreceptoresdelahormonatiroideasitiosygenesdianadeuninutilizandochiponchipeneldesarrollode
cerebeloderatn.PLoSOne4:e4610.[PMClibresartculo][PubMed]
401.MorteB.,D.Diez,AusoE.,BelinchnMM.,GilIbezP.,GrijotaMartnezC.,D.Navarro,Morrealede
EscobarG.,BerbelP.,J.Bernal2010.tiroideslaregulacinhormonaldelaexpresingnicaenlaratafetalcorteza
cerebralendesarrollo:prominentepapeldela+/vadelaprotenaquinasaIVdependientedecalmodulinaCa2.
Endocrinologa151:810820[PubMed]
402.KahalyGJ.,DillmannWH..2005accindelahormonatiroideaenelcorazn.EndocrRev26:704728
[PubMed]
403.RibeiroMO.,BiancoSD.,KaneshigeM.,SchultzJJ.,ChengSY.,BiancoAC.,BrentGA..2010Expresinde
ladisociacindeprotenas1eneltejidoadiposomarrnratneslahormonatiroideareceptorbetaisoforma
especficaynecesariaparalatermognesisadaptativa.Endocrinologa151:432440[PMClibresartculo]
[PubMed]
404.WangAM.,DoyleMV.,MarkDF..1989LacuantificacindeARNmmediantelareaccinencadenadela
polimerasa.ProcNatlAcadSciEE.UU.86:9717a9721[artculolibrePMC][PubMed]
405.SoodA.,SchwartzHL.,OppenheimerJH..1996regulacinespecficadetejidodelaenzimamlicaporla
hormonatiroideaenlarataneonatal.BiochemBiophysResCommun222:287291[PubMed]
406.BustinSA.2000.CuantificacinabsolutadeARNmusandoensayosdereaccinencadenadelapolimerasade
transcripcininversaentiemporeal.JMolEndocrinol25:169193[PubMed]
407.D.Fraga,MeuliaT.,FensterS.2008.PCRentiemporealen:CavalcantiARO,editor,StoverN,editor.(eds)
CurrentProtocolsTcnicasdeLaboratorioesencial.JohnWileyandSons,NuevaYork,pp10.3.110.3.33
408.NolanT.,ManosRE.,BustinSA..2006LacuantificacindeARNmutilizandoentiemporealRTPCR.Nat
Protoc1:15591582[PubMed]
409.NessGC.,PendletonLC..1991Lahormonatiroideaaumentagliceraldehdo3fosfatodeshidrogenasa
expresingnicaenelhgadoderata.FEBSLett288:2122[PubMed]
410.PoddarR.,PaulS.,ChaudhuryS.,SarkarPK.1.996.Laregulacindelaactinaylatubulinaexpresinporla
hormonatiroideaduranteeldesarrollodelcerebrodelarata.BrainResMolBrainRes35:111118[PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

110/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

411.VisserWE.,HeemstraKA.,SwagemakersSM.,OzgurZ.,CorssmitEP.,BurggraafJ.,vanIjckenWF.,vander
SpekPJ.,SmitJW.,VisserTJ..2009nivelesdehormonatiroideafisiolgicosregulannumerosastranscripcionesdel
msculoesqueltico.JClinEndocrinolMetab94:desde3487hasta3496[PubMed]
412.DiezD.,GrijotaMartnezC.,AgrettiP.,DeMarcoG.,TonaccheraM.,PincheraA.,MorrealedeEscobarG.,J.
Bernal,MorteB.2008.accindelahormonatiroideaeneladultocerebro:perfilesdeexpresingnicadelosefectos
dedosisnicasymltiplesdetriyodoLtironinaenelcuerpoestriadoderata.Endocrinologa149:3989a4000
[PubMed]
413.ChiappiniF.,RamadossP.,VellaKR.,CunhaLL.VosotrosDF.,StuartRC.,NillniEA.,HollenbergAN.
2013.hormonaliberadoradetirotropina(TRH)expresinmiembrosdelafamiliaCREBycontrolCREMenel
hipotlamo.MolCellEndocrinol365:8494[PMClibresartculo][PubMed]
414.LivakKJ.,SchmittgenTD..2001Elanlisisdelosdatosrelativosdeexpresindegenesentiemporeal
medianteelmtodo2(DeltaDeltaC(T))PCRcuantitativay.Mtodos25:402408[PubMed]
415.NolanT.,ManosRE.,BustinSA..2006LacuantificacindeARNmutilizandoentiemporealRTPCR.Nat
Protoc1:15591582[PubMed]
416.[Suprimido.]
.417.GrewalA.,P.Lambert,StocktonJ.2007Elanlisisdedatosdeexpresin:unavisingeneral.CurrProtoc
BioinformticaCaptulo7:Unidad7.1[PubMed]
.418HawkinsRD,HonGC,RenB.2010...lagenmicadeprximageneracin:unenfoqueintegrador.NatRev
Genet11:476486[PMClibresartculo][PubMed]
419.EspinaV.,J.Milia,WuG.,VaqueroS.,LiottaLA..2006microdiseccindecapturaporlser.MethodsMol
Biol319:213229[PubMed]
420.GalbraithDW.,ElumalaiR.,GongFC..2004decitometradeflujoIntegrativaymicroarraysenfoquesparasu
usoenelperfiltranscripcional.MethodsMolBiol263:259280[PubMed]
421.SchoonoverCM.,SeibelMM.,JolsonDM.,MontnMJ.,RahmanRJ.,JonesSA.,MariashCN.,Anderson
GW..2004Lahormonatiroidearegulalaacumulacindeoligodendrocitoseneldesarrollodelcerebroderata
tractosdesustanciablanca.Endocrinologa145:5013hasta5020[PubMed]
422.SharlinDS.,TigheD.,GilbertME.,ZoellerRT..2008Elequilibrioentrelosoligodendrocitosyastrocitosenla
produccindegrandestractosdesustanciablancaserelacionalinealmentecontiroxinasricatotal.Endocrinologa
149:25272536[PubMed]
423.PhanTQ.,JowMM.,PrivalskyML.2010.elreconocimientodeADNporlahormonatiroideaylosreceptores
delcidoretinoico:3,4,5reglamodificada.EndocrinolMolCell319:8898[PMClibresartculo][PubMed]
424.ChenJD.,EvansRM..1995Uncorepresortranscripcionalqueinteractaconlosreceptoresnuclearesde
hormonas.Naturaleza377:454457[PubMed]
425.FondellJD.,GeH.,RoederRG.1996.Ligandoinduccindeunahormonatiroideacomplejocoactivador
receptortranscripcionalmenteactivo.ProcNatlAcadSciEE.UU.93:8.329a8.333[ArtculolibrePMC]
[PubMed]
426.HrleinAJ.,NaarAM.,HeinzelT.,J.Torchia,GlossB.,KurokawaR.,A.Ryan,KameiY.,M.Sderstrm,
VidrioCK.,RosenfeldMG..1995represinligandoindependienteporelreceptordelahormonatiroideamediada
porunreceptordecorepresornuclear.Naturaleza377:397404[PubMed]
.427GouldSJ,SubramaniS.1988..luciferasadelucirnagacomounaherramientaenlabiologamoleculary
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

111/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

celular.AnalBiochem175:513[PubMed]
428.ChanIH.,BorowskyAD.,PrivalskyML..2008UnanotadeadvertenciaencuantoalusodePBILy
luciferasa/vectorestransgnicosrelacionadosenelestudiodelaendocrinologadelatiroides.tiroidea18:665666
[PMClibresartculo][PubMed]
429.ShiferaAS.,HardinJA..2010FactoresdemodulacindelaexpresindeluciferasadeRenilladeplsmidosde
controlutilizadosenlosensayosdegenreporteroluciferasa.AnalBiochem396:167172[PMClibresartculo]
[PubMed]
.430.I.Jones,NgL.,LiuH.,ForrestD.2007Unaregindecontrolintrndiferencialmenteregulalaexpresinde
beta2delreceptordelahormonatiroideaenlacclea,lahipfisisylosconos.MolEndocrinol21:11081119
[PubMed]
431.SjbergM.,VennstrmB.,ForrestD.1992.receptoresdelahormonatiroideaeneldesarrollodelaretinade
pollo:laexpresindiferencialdelosARNmdelosreceptoresbetavariantealfayNterminales.Desarrollo114:39
47[PubMed]
432.MaderaWM.,DowdingJM.,HaugenBR.,brillanteTM.,GordonDF.,RidgwayCE..1994Caracterizacin
estructuralyfuncionaldellocusgenmicoquecodificaelreceptordelahormonatiroideabeta2murina.Mol
Endocrinol8:16051617[PubMed]
433.SapJ.,deMagistrisL.,StunnenbergH.,
VennstromB.1990.Unelementoimportanterespuestadelahormona

tiroideaeneltercerintrndelgendelahormonadelcrecimientoderata.EMBOJ.9:887896
[ArtculolibrePMC][PubMed]
434.UmesonoK.,MurakamiKK.,ThompsonCC.,EvansRM..1991repeticionesdirectascomoelementosde
respuestaselectivosparalahormonatiroidea,cidoretinoico,ylosreceptoresdelavitaminaD3.Cell65:1255
1266[PubMed]
435.HellmanLM.,FriedMG..2007Electroforticamovilidadcambiodeensayo(EMSA)paraladeteccinde
interaccionesprotenacidonucleico.NatProtoc2:18491861[ArtculolibrePMC][PubMed]
436.NgL.,D.Forrest,HaugenBR,MaderaWM,CurranT.1995...variantesNterminalesdelabetadelreceptorde
lahormonatiroidea:funcindiferencialylacontribucinpotencialalsndromedelaresistenciaalahormonatiroidea
.MolEndocrinol9:12021213[PubMed]
437.YenPM.,DarlingDS.,CarterRL.,ForgioneM.,UmedaPK.,ChinWW..1992triyodotironina(T3)disminuye
launinaADNporhomodmerosT3receptor,peronoalreceptordeheterodmerosdeprotenasauxiliares.JBiol
Chem267:35653568[PubMed]
438.BelakavadiM.,J.Saunders,WeislederN.,RaghavaPS.,FondellJD..2010Larepresindelaexpresinde
genescardiacosfosfolambanestmediadaporlahormonatiroideaconreceptores{alpha}1eimplicamodificaciones
delashistonascovalentedirigidos.Endocrinologa151:29462956[PMClibresartculo][PubMed]
439.ChiamoleraMI.,SidhayeAR.,MatsumotoS.,ElP.,HashimotoK.,OrtigaCarvalhoTM.,WondisfordFE..
2.012funcionesfundamentalmentedistintasisoformasdelreceptordelahormonatiroideaenunalneacelular
tirotrpicossondebidoaladiferenciadelauninalADN.MolEndocrinol26:926939[PMClibresartculo]
[PubMed]
440.BilesimoP.,JolivetP.,G.Alfama,BuisineN.,LeMevelS.,HavisE.,DemeneixBA.,SachsLM..2011
histonaespecficalisina4patronesdemetilacindefinencapacidadTR
vinculanteysediferencianTdirectos3

respuestas.MolEndocrinol25:225237[PubMed]
441.MatsuuraK.,FujimotoK.,FuL.,ShiYB..2012receptordelahormonatiroidealigandedinduce
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

112/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

modificacionesdeeliminacinyhistonanucleosomaparaactivarlatranscripcindurantelamuertecelularintestinal
delaslarvasyeldesarrollodeclulasmadreadultas.Endocrinologa153:961972[PMClibresartculo]
[PubMed]
442.HavisE.,LeMevelS.,MorvanDuboisG.,ShiDL.,ScanlanTS.,DemeneixBA.,SachsLM..2006receptor
delahormonatiroideaunligandedesesencialparaeldesarrollodelojoXenopuslaevis.EMBOJ.25:49434951
[ArtculolibrePMC][PubMed]
443.CareyMF.,PetersonCL.,SmaleST..2009inmunoprecipitacindecromatina(CHIP).ColdSpringHarb
Protoc2009:pdb.prot5279.[PubMed]
.444.WagschalA.,DelavalK.,PannetierM.,ArnaudP.,R.Feil2007basadoenelanlisisdePCRdelacromatina
inmunoprecipitada.ColdSpringHarbProtoc2007:.pdb.prot4768[PubMed]
.445.MorteB.,J.Manzano,ScanlanT.,VennstrmB.,J.Bernal2002Supresindelreceptoralfadehormona
tiroidea1evitaquelasalteracionesestructuralesdelcerebeloinducidaporhipotiroidismo.ProcNatlAcadSci
EE.UU.99:39853989[PMClibresartculo][PubMed]
446.AbelED.,AHIMARS.,BoersME.,ElmquistJK.,WondisfordFE.2001.papelcrticoparabeta2receptorde
hormonastiroideasenlaregulacindelasneuronasdelahormonaliberadoradetirotropinaparaventricular.JClin
Invest107:10171023[PMClibresartculo][PubMed]
447.ForrestD.,HanebuthE.,SmeyneRJ,EverdsN.,StewartCL,WehnerJM,CurranT.1996....laresistencia
recesivaalahormonatiroideaenratonesquecarecendelreceptorbetadelahormonatiroidea:pruebasparala
modulacinespecficadetejidodelafuncindelreceptor.EMBOJ.15:3006a3015[ArtculolibrePMC]
[PubMed]
.448..ForrestD.,ErwayLC,NgL.,R.Altschuler,CurranT.1996betareceptordelahormonatiroideaesesencial
paraeldesarrollodelafuncinauditiva.NatGenet13:354357[PubMed]
449.NgL.,HurleyJB.,DierksB.,SrinivasM.,C.Salto,VennstromB.,RehTA.,ForrestD.2001.Unreceptorde
lahormonatiroideaqueserequiereparaeldesarrollodelosconosverdes.NatGenet27:9498[PubMed]
.450..AmmaLL,CamposBarrosA.,WangZ.,VennstromB.,ForrestD.2001papelesespecficosdetejidos
diferenciadosparalahormonatiroideadereceptoresbetayalfa1enlaregulacindetipo1deexpresindeiodinase.
MolEndocrinol15:467475[PubMed]
451.WikstrmL.,C.Johansson,SaltoC.,C.Barlow,CamposBarrosA.,F.Baas,ForrestD.,ThornP.,Vennstrm
B.1998.ritmocardacoanormalylatemperaturacorporalenratonesquecarecendelatiroideshormonareceptoralfa
1.EMBOJ.17:455461[PMClibresartculo][PubMed]
452.FraichardA.,ChassandeO.,PlaterotiM.,RouxJP.,J.Trouillas,DehayC.,C.Legrand,GauthierK.,Kedinger
M.,MalavalL.,RoussetB.,SamarutJ.1997.ElgendelaalfaT3Rquecodificaunreceptordelahormonatiroidea
esesencialparaeldesarrolloylaproduccindelahormonatiroideaposnatal.EMBOJ.16:44124420
[PMClibresartculo][PubMed]
453.BassettJH.,WilliamsGR.2.009.LosfenotiposesquelticosderatonesmutantesTRalphayTRbeta.JMol
Endocrinol42:269282[PubMed]
454.GuadaoFerrazA.,BenavidesPiccioneR.,VeneroC.,LanchaC.,VennstrmB.,SandiC,DeFelipeJ.,J.
Bernal2003.Lafaltadetiroidesalfa1receptordelahormonaseasociaconalteracionesselectivasencircuitosde
comportamientoydelhipocampo.MolPsiquiatra8:3038[PubMed]
455.[Suprimido.]
456.VennstrmB.,MittagJ.,WallisK.2008.psicomotorasymetablicasgravesdaoscausados
porunreceptor

http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

113/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

alfadelahormonatiroideamutante1enratones:Puedenlospacientesconunamutacinsimilarsedetectayse
trata?ActaPaediatr97:16051610[PubMed]
457.GauthierK.,ChassandeO.,PlaterotiM.,RouxJP.,LegrandC.,DolorB.,RoussetB.,WeissR.,J.Trouillas,
SamarutJ.1999.DiferentesfuncionesparalosreceptoresdelahormonatiroideaTRalphayTRbetaenelcontrolde
laproduccindelahormonatiroideayeldesarrollopostnatal.EMBOJ.18:623631[ArtculolibrePMC]
[PubMed]
.458.RefetoffS.2003Resistenciaalahormonatiroideaconysinmutacionesdelgendelreceptor.Annales
d'endocrinologie64:2325
[PubMed]

459.BochukovaE.,SchoenmakersN.,M.Agostini,SchoenmakersE.,RajanayagamO.,KeoghJM.,HenningE.,J.
Reinemund,GeversE.,SarriM.,DownesK.,OffiahA.,AlbaneseA.,D.Halsall,SchwabeJW.,M.Bain,Lindley
K.,MuntoniF.,VarghaKhademF.,DattaniM.,FarooqiIS.,GurnellM.,ChatterjeeK.2012.Unamutacinenel
gendelreceptoralfadehormonatiroidea.NEnglJMed366:243249[PubMed]
460.vanMullemA.,vanHeerebeekR.,ChrysisD.,E.Visser,MediciM.,AndrikoulaM.,TsatsoulisA.,R.Peeters,
VisserTJ..2012fenotipoclnicoyTRalpha1mutante.NEnglJMed366:14511453[PubMed]
461.ChengSY.2005.mutacionesdelreceptordelahormonatiroideayenfermedad:msalldelaresistenciaala
hormonatiroidea.EndocrinolMetabTendencias16:176182[PubMed]
462.HashimotoK.,CurtyFH.,BorgesPP.,LeeCE.,AbelED.,ElmquistJK.,CohenRN.,WondisfordFE..2001
Unreceptordelahormonatiroideaunligandedcausaladisfuncinneurolgicagrave.ProcNatlAcadSciEE.UU.
98:desde3998hasta4003[ArtculolibrePMC][PubMed]
463.KaneshigeM.,KaneshigeK.,ZhuX.,DaceA.,GarrettL.,CarterTA.,KazlauskaiteR.,PankratzDG.,
WynshawBorisA.,RefetoffS.,B.Weintraub,WillinghamMC.,BarlowC.,ChengS.2000.Losratonesconuna
mutacinespecficaenlaexposicinretrasodelcrecimientogendelreceptorbetadelahormonatiroideayresistencia
alahormonatiroidea.ProcNatlAcadSciEE.UU.97:13209a13.214[artculolibrePMC][PubMed]
464.LiuAA.,SchultzJJ.,BrentGA..2003Unamutacindelgenreceptordehormonatiroideaalfa(P398H)est
asociadoconlaadiposidadvisceralydeficientesliplisisestimuladaporcatecolaminasenlosratones.JBiolChem
278:3891338920[PubMed]
465.OrtigaCarvalhoTM.,ShibusawaN.,NikrodhanondA.,OliveiraKJ.,MachadoDS.,LiaoXH.,CohenRN.,
RefetoffS.,WondisfordFE..2.005regulacinnegativadelosreceptoresdelahormonatiroidearequiereuna
superficiedeunincoactivadorintacta.JClinInvest115:25172523[PMClibresartculo][PubMed]
466.[Suprimido.]
467.QuignodonL.,C.Legrand,AllioliN.,GuadaoFerrazA.,J.Bernal,SamarutJ.,FlamantF.2004.sealizacin
delahormonatiroidesesmuyheterogneoduranteeldesarrollocerebralprenatalypostnatal.JMolEndocrinol33:
467476[PubMed]
468.NuceraC.,MuzziP.,TiveronC.,FarsettiA.,LaReginaF.,FoglioB.,ShihSC.,F.Moretti,DellaPietraL.,F.
Mancini,SacchiA.,TrimarchiF..,A.Vercelli,PontecorviA.2010hormonastiroideasmaternasson
transcripcionalmenteactivoduranteeldesarrolloembrionarioyfetal:resultadosdeunnuevomodeloderatn
transgnico.JCellMolMed14:24172435[ArtculolibrePMC][PubMed]
469.WallisK.,DudazyS.,vanHogerlindenM.,NordstromK.,MittagJ.,VennstromB.2010.Laprotenaalfa1
receptordelahormonatiroideaseexpresaenneuronasembrionariaspostmitticasypersisteenlamayoradelas
neuronasadultas.MolEndocrinol24:19041916[PubMed]
470.WilliamsGR..2.008accionesdelneurodesarrolloyneurofisiolgicosdelahormonatiroidea.J
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

114/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

Neuroendocrinol20:784794[PubMed]
.471..ZoellerRT,RovetJ.2004Momentodelaaccindelahormonatiroideaenelcerebroendesarrollo:
observacionesclnicasylosresultadosexperimentales.JNeuroendocrinol16:809818[PubMed]
472.RogersDC.,FisherEM.,BrownSD.,J.Peters,HunterAJ.,MartinJE..1997delComportamientoyanlisis
funcionaldefenotipodelratn:SHIRPA,unprotocolopropuestoparalaevaluacinintegralfenotipo.Mamm
Genoma8:711713[PubMed]
473.MarrnSD.,P.Chambon,ydeAngelisMH..2005Emperatriz:pantallasfenotipoestandarizadosparala
anotacinfuncionaldelgenomadelratn.NatGenet37:.1155[PubMed]
474.SkarnesWC.,B.Rosen,WestAP.,KoutsourakisM.,BushellW.,IyerV.,MujicaAO.,ThomasM.,J.Harrow,
CoxT.,JacksonD.,J.Severin,BiggsP.,J.Fu,NefedovM.,deJongPJ,StewartAF,BradleyA.2011...Unrecurso
condicionaleliminatoriasparaelestudiodetodoelgenomadelafuncindelosgenesdelratn.Naturaleza474:
337342[PMClibresartculo][PubMed]
475.WheelerSM.,WilloughbyKA.,McAndrewsMP.,RovetJF.2011.hipocampotamaoyfuncionamientodela
memoriaenlosniosyadolescentesconhipotiroidismocongnito.JClinEndocrinolMetab96:E14271434
[PubMed]
476.MorrealedeEscobarG.,RuizMarcosA.,EscobardelReyF.1983.Lashormonastiroideasyelcerebroen
desarrollo.En:DussaultJH,editor,WalkerP,editor.(Editores)hipotiroidismocongnito.MarcelDekker,Nueva
York,pp85126
477.CastroMI.,AlexS.,jovenAR.,BravermanLE.,EmersonCH..1986lasconcentracionesdehormonas
tiroideaslibresencobayasfetalesyadultasembarazadasynoembarazadasTotaly.Endocrinologa118:533537
[PubMed]
478.WallisK.,M.Sjgren,vanHogerlindenM.,G.Silberberg,FisahnA.,NordstrmK.,LarssonL.,Westerblad
H.,MorrealedeEscobarG.,ShupliakovO.,VennstrmB.2008.deficienciasdelaparatolocomotoryeldesarrollo
aberrantedeinterneuronasGABArgicassubtiposespecficoscausados
porunalfa1receptordehormonatiroidea

unliganded.JNeurosci28:19041915[PubMed]
479.C.Fekete,FreitasBC.,ZeldA.,WittmannG.,A.Kdr,LipositsZ.,ChristoffoleteMA.,SingruP.,Lechan
RM.,BiancoAC.,GerebenB.2007.LospatronesdeexpresindeWSB1yUSP33sonlabasedecontrolposterior
alatraduccindelasclulasespecficasdeltipo2deiodinaseenelcerebroderata.Endocrinologa148:4865a
4874[PubMed]
480.J.Bernal,GuadaoFerrazA.2002.Anlisisdegenesdependientesdehormonastiroideasenelcerebro
mediantehibridacininsitu.MethodsMolBiol202:7190[PubMed]
481.GuadaoFerrazA.,EscamezMJ.,RausellE.,BernalJ.1999.Expresindetipo2yodotironinadeiodinasaen
hipotiroidismocerebroderataindicaunpapelimportantedelahormonatiroideaeneldesarrollodelossistemas
sensorialesprimariosespecficos.JNeurosci19:34303439[PubMed]
482.iguezMA.,DeLeceaL.,GuadaoFerrazA.,B.Morte,GerendasyD.,SutcliffeJG.,J.Bernal1996.efectos
especficosdelacluladelahormonatiroideaenRC3/expresinneurograninaencerebroderata.Endocrinologa
137:10321041[PubMed]
483.VeneroC.,GuadaoFerrazA.,HerreroAI.,NordstromK.,J.Manzano,MorrealedeEscobarG.,J.Bernal,
VennstromB.2005.Laansiedad,deteriorodelamemoriayladisfuncinlocomotrizcausadaporunmutantealfa1
receptordelahormonatiroideasepuedemejorarporT3tratamiento.GenesDev19:21522163
[ArtculolibrePMC][PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

115/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

484.HrabovszkyE.,PetersenSL..2002aumentodelasconcentracionesdesondamarcadaconradioistopos
complementariaribonucleicocido,sulfatodedextrano,yditiotreitoleneltampndehibridacinpuedenmejorarlos
resultadosdelahistoqumicadehibridacininsitu.JHistochemCytochem50:13891400[PubMed]
485.CamposBarrosA.,AmmaLL,FarisJS,ShailamR.,KelleyMW,ForrestD.2000....Tipo2expresin
yodotironinadeiodinaseenlaccleaantesdeliniciodelaaudiencia.ProcNatlAcadSciEE.UU.97:12871292
[PMClibresartculo][PubMed]
486.LechanRM.,P.Wu,JacksonIMD.,WolfeH.,CoopermanS.,G.Mandel,GoodmanRH.1986.liberadorade
tirotropinaprecursordelahormona:lacaracterizacinenelcerebroderata.Ciencia231:159161[PubMed]
487.SegersonTP.,J.Kauer,WolfeHC.,MobtakerH.,WuP.,JacksonIM.,RMchan..1987hormonatiroidea
regulalabiosntesisdeTRHenelncleoparaventriculardelhipotlamoderata.Ciencia238:7880[PubMed]
488.DyessEM.,SegersonTP.,LipositsZ.,PaullWK.,KaplanMM.,P.Wu,JacksonIMD.,RMchan..1988
triyodotironinaejercelaregulacinespecficadelacluladirectadelaexpresindelgendelahormonaliberadorade
tirotropinaenelncleoparaventriculardelhipotlamo.Endocrinologa123:22912297[PubMed]
489.KakucskaI.,RandW.,LechanRM..1992Hormonaliberadoradetirotropina(TRH)laexpresindegenesen
elncleoparaventriculardelhipotlamoesdependientedelaregulacinporretroalimentacinportanto
triyodotironinaytiroxina.Endocrinologa130:28452850[PubMed]
490.[Suprimido.]
491.EspinaV.,WulfkuhleJD.,CalvertVS.,VanMeterA.,ZhouW.,CoukosG.,GehoDH.,PetricoinEFtercero,
LiottaLA..2006microdiseccinporlsercaptura.NatProtoc1:586603[PubMed]
492.HernndezA.,B.Morte,BelinchnMM,CeballosA.,J.Bernal2012..elpapelcrticodelostipos2y3
deiodinasasenlaregulacinnegativadelaexpresingnicaport3enlacortezacerebralderatn.Endocrinologa
153:29192928[PMClibresartculo][PubMed]
493.DongH.,
WadeM.,A.Williams,LeeA.,DouglasGR,YaukC.2005..unavisinmoleculardelosefectosdel

hipotiroidismoenelcerebeloendesarrollo.BiochemBiophysResCommun330:11821193[PubMed]
.494.ChatonnetF.,R.Guyot,PicouF.,BondessonM.,F.2012FlamantGenomaampliabsquedarevelala
existenciadeunnmerolimitadodereceptoralfagenesdianadelahormonatiroideaenlasneuronasdelcerebelo.
PLoSOne7:e30703.[PMClibresartculo][PubMed]
.495..SilvaJE,RudasP.1990Efectodehipotiroidismocongnitoenlaprotena2expresinasociadaalos
microtbulosenelcerebelodelarata.Endocrinologa126:12761282[PubMed]
.496SharlinDS,VisserTJ,ForrestD.2011...laexpresindeldesarrolloyespecficodelasclulasdelos
transportadoresdelahormonatiroideaenlaccleadelratn.Endocrinologa152:50535064
[ArtculolibrePMC][PubMed]
497.lvarezDoladoM.,M.Ruiz,DelRo,JA.,AlcntaraS.,BurgayaF.,SheldonM.,NakajimaK.,J.Bernal,
HowellBW.,CurranT.,SorianoE.,Muoz.A.1999LahormonatiroidearegulareelinyexpresinDAB1durante
eldesarrollocerebral.JNeurosci19:6.979a6.993[PubMed]
498.lvarezDoladoM.,GonzlezSanchoJM,BernalJ.,MuozA.1998..laexpresindeldesarrollodela
tenascinaCsevealteradoporelhipotiroidismoenelcerebroderata.Neurociencia84:309322[PubMed]
.499...CordasEA,NgL.,HernndezA.,KaneshigeM.,ChengSY,ForrestD.2012receptoresdehormonas
tiroideascontrolanlamaduracindedesarrollodelodomedioyeltamaodeloshuesososiculares.Endocrinologa
153:15481560[PMClibresartculo][PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

116/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

500.[Suprimido.]
501.InviernoH.,RttigerL.,M.Mller,KuhnS.,N.Brandt,ZimmermannU.,HirtB.,A.Bress,SausbierM.,A.
Conciencia,FlamantF.,TianY.,.ZuoJ.,M.Pfister,RuthP.,LwenheimH.,SamarutJ.,J.Engel,KnipperM.
2009SorderaenmutantesTRbetaescausadoporunamalformacindelamembranatectorial.JNeurosci29:2581
2587[PMClibredelartculo][PubMed]
502.GriffithAJ.,SzymkoYM.,KaneshigeM.,QuinezRE.,KaneshigeK.,HeintzKA.,MastroianniMA.,Kelley
MW.,ChengSY..2002dereboteenmodeloderatnparalaresistenciaalahormonatiroidea(RTH):unamutacin
RTHenelgendelreceptorbetadelahormonatiroideainterrumpemorfognesiscoclear.JAsocResOtolaryngol3:
279288[PMClibresartculo][PubMed]
503.AppleburyML.,FarhangfarF.,GlosmannM.,HashimotoK.,KageK.,RobbinsJT.,ShibusawaN.,
WondisfordFE.,ZhangH.2007.LaexpresintransitoriadereceptoresnuclearesdehormonastiroideasTRbeta2
estableceSopsinapatrndurantegnesisconofotorreceptor.DevDyn236:12031212[PubMed]
504.LuA.,NgL.,M.Ma,KefasB.,DaviesTF.,HernndezA.,ChanCC.,ForrestD.2009.expresindel
desarrolloretardadoylospatronesdeopsinasconosdelaretinaenratoneshipotiroideos.Endocrinologa150:
15361544[PMClibresartculo][PubMed]
505.[Suprimido.]
.506.GlaschkeA.,GlosmannM.,PeichlL.2010Cambiosdeldesarrollodelaexpresindeopsinaconoperono
morfologadelaretinaenelhipotiroidismoratnknockoutPax8.InvestOphthalmolVisSci51:17191727
[PubMed]
507.GilbertME.,SuiL.,WalkerMJ.,AndersonW.,ThomasS.,SmollerSN.,SchonJP.,PhaniS.,GoodmanJH..
2007insuficienciadelahormonatiroideaduranteeldesarrollodelcerebroreducelainmunorreactividad
parvalbminaylafuncininhibidoraenelhipocampo.Endocrinologa148:92102[PubMed]
.508..GilbertME,PaczkowskiC.2003propiltiouracilo(PTU)inducidaporhipotiroidismoenlarataendesarrollo
perjudicalatransmisinsinpticaylaplasticidadenelgirodentadodelhipocampoadulto.BrainResDevBrainRes
145:1929[PubMed]
509.SuiL.,GilbertME..2003preypostnatalhipotiroidismoinducidopropiltiouraciloperjudicalatransmisin
sinpticaylaplasticidadenelreaCA1delhipocampoderataneonatal.Endocrinologa144:4.1954.203
[PubMed]
510.GilbertME..2004LasalteracionesenlatransmisinsinpticaylaplasticidadenelreaCA1delhipocampo
adultosiguientehipotiroidismodesarrollo.BrainResDevBrainRes148:1118[PubMed]
511.PilhatschM.,InviernoC.,NordstromK.,VennstromB.,M.Bauer,JuckelG.2.010.Elaumentode
comportamientodepresivoenratonesportadoresdelaalfareceptordelahormonatiroideamutante1.BehavBrain
Res214:187192[PubMed]
512.MombereauC.,KaupmannK.,M.Gassmann,BettlerB.,vanderPuttenH.,CryanJF..2005ansiedadalterada
yelcomportamientorelacionadoconladepresinenratonesquecarecendeGABAB(2)subunidadesdelreceptor.
Neuroreport16:307310[PubMed]
513.ReifA.,A.Schmitt,FritzenS.,ChourbajiS.,BartschC.,UraniA.,WycisloM.,MssnerR.,C.Sommer,Gass
P.,LeschKP..2004Diferencialefectodelxidontricosintasaendotelial(NOSIII)enlaregulacindela
neurognesisycomportamientodelosadultos.EurJNeurosci20:885895[PubMed]
514.LpezM.,L.Varela,VzquezMJ.,RodrguezCuencaS.,GonzlezCR.,VelagapudiVR.,MorganDA.,
SchoenmakersE.,AgassandianK.,LageR.,MartnezdeMorentinPB.,TovarS.,R.Nogueiras,CarlingD.,Lelliott
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

117/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

C.,GallegoR.,OresicM.,ChatterjeeK.,SahaAK.,RahmouniK.,DiguezC.,VidalPuigA.2010.hipotalmico
AMPKymetabolismodeloscidosgrasosmediarlaregulacindelbalanceenergticodelatiroides.NatMed16:
10011008[PMClibresartculo][PubMed]
515.A.Coppola,LiuZW.,AndrewsZB.,ParadisE.,RoyMC.,FriedmanJM.,RicquierD.,RichardD.,Horvath
TL.,GaoXB.,DianoS.2007.Untermognicocentrocomomecanismoderegulacindelaalimentacin:una
interaccinentrencleoarqueadoT3yUCP2.MetabCell5:2133[PMClibresartculo][PubMed]
516.KongWM.,MartinNM.,SmithKL.,GardinerJV.,ConnoleyIP.,StephensDA.,DhilloWS.,GhateiMA.,
PequeaCJ.,BloomSR..2004triyodotironinaestimulalaingestadealimentosatravsdelncleoventromedialdel
hipotlamoindependientedeloscambiosenelgastodeenerga.Endocrinologa145:desde5252hasta5258
[PubMed]
517.BarrettP.,EblingFJ.,SchuhlerS.,D.Wilson,RossAW.,WarnerA.,JethwaP.,BoelenA.,VisserTJ.,Ozanne
DM.,ArcherZA.,MercerJG.,MorganPJ..2007hipotalmicasactosdelcatabolismodelahormonadelatiroides
comounguardinparaelcontrolestacionaldepesocorporalylareproduccin.Endocrinologa148:3608hasta
3617[PubMed]
518.C.Fekete,LegradiG.,MihalyE.,HuangQH.,TatroJB.,RandWM.,EmersonCH.,RMchan..2000
hormonaalfaestimulantedelosmelanocitosestcontenidaenlasterminalesnerviosasqueinervanliberadorade
tirotropinaneuronassintetizadorasdelahormonaenelncleoparaventricularhipotalmicoyevitalasupresin
inducidaporelayunodelaexpresindelgendelahormonaliberadoradeprothyrotropin.JNeurosci20:1550
1558[PubMed]
519.FeketeC.,J.Kelly,MihalyE.,SarkarS.,RandWM.,LegradiG.,EmersonCH.,RMchan..2001El
neuropptidoYtieneunaaccininhibitoriacentralsobreelejehipotlamohipfisistiroides.Endocrinologa142:
26062613[PubMed]
520.C.Fekete,SarkarS.,RandWM.,HarneyJW.,EmersonCH.,BiancoAC.,RMchan..2002relacionadacon
Agoutiprotena(AGRP)tieneunaaccininhibitoriacentralsobreelejehipotlamohipfisistiroides(HPT)
comparacionesentreelefectodeAGRPyneuropptidoYenlahomeostasisenergticayelejeHPT.
Endocrinologa143:3.8463.853[PubMed]
521.C.Fekete,SarkarS.,RandWM.,HarneyJW.,EmersonCH.,BiancoAC.,BeckSickingerA.,LechanRM..
2002ElneuropptidoY1eY5receptoresmedianlosefectosdelneuropptidoYenelejehipotlamohipfisis
tiroides.Endocrinologa143:45134519[PubMed]
522.C.Fekete,MarksDL.,SarkarS.,EmersonCH.,RandWM.,ConoRD.,RMchan..2.004Efectodelaprotena
Agoutirelacionadaconlaregulacindelejehipotlamohipfisistiroidesenlamelanocortina4receptorderatn
knockout.Endocrinologa145:4816a4821[PubMed]
523.GarzaR.,DussaultJH,PuymiratJ.1988..Influenciadelatriyodotironina(LT3)eneldesarrollomorfolgicoy
bioqumicodecerebrofetalneuronaspositivasparaacetilcolinesterasacultivadasenunmedioqumicamentedefinido
.BrainRes471:287297[PubMed]
524.HeuerH.,MasonCA..2003LahormonatiroideainduceeldesarrollodeclulasdePurkinjedelcerebelo
dendrticasatravsdelaalfa1receptordelahormonatiroidea.JNeurosci23:1060410612[PubMed]
525.LiuAA.,TachikiKH.,BrentGA..2002Ungenalfadelreceptordelahormonatiroideadirigidamutacin
dominantenegativo(P398H)afectaselectivamentelaexpresindegenesenclulasmadreembrionariasdiferenciadas
.Endocrinologa143:26642672[PubMed]
526.MohacsikP.,ZeoldA.,BiancoAC,GerebenB.2011..Lahormonatiroideaylaneuroglia:origenyeldestino.
JtiroidesRes2011:.215718[PMClibresartculo][PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

118/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

527.RuelJ.,DussaultJH..1985triyodotironinaaumentalaactividaddelasintetasadeglutaminaencultivos
primariosdecerebeloderata.BrainRes353:8388[PubMed]
528.NiederkinkhausV.,MarxR.,G.Hoffmann,DietzelID..2009hormonatiroidea(T3)inducidasobreregulacin
delacorrientedesodioactivadosporvoltajeenlasneuronasdelhipocampopostnatalescultivadasrequierela
secrecindefactoressolublesdelasclulasgliales.MolEndocrinol23:14941504[PMClibresartculo]
[PubMed]
.529EmeryB.Regulacindeladiferenciacindeoligodendrocitosylamielinizacin.Ciencia330:779782
[PubMed]
530.EstrechoKA.,CarlsonDJ.,SchwartzHL.,OppenheimerJH..1.997estimulacintransitoriadelamielina
expresinbsicagendelaprotenaenladiferenciacindeoligodendrocitoscultivadas:unmodeloparaeldesarrollo
cerebralinducidapor3,5,3triyodotironina.Endocrinologa138:635641[PubMed]
531.SamuelsHH,TsaiJS,CintrnR.1973...laaccindelahormonatiroidea:unsistemadecultivodeclulas
sensiblesaconcentracionesfisiolgicasdelashormonastiroideas.Ciencia181:12531256[PubMed]
532.LazarMA..1990butiratodesodioalteraselectivamentelaexpresindelgendelreceptordelahormona
tiroideaenGH3clulas.JBiolChem265:17474a17477[PubMed]
533.YustaB.,AlaridET.,GordonDF.,RidgwayCE.,MellonPL..1998Elgendelasubunidadbetadetirotropina
esreprimidaporlahormonatiroideaenunanovelalneacelularthyrotrope,clulasTderatnalphaT1.
Endocrinologa139:44764482[PubMed]
534.MaiW.,JanierMF.,AllioliN.,QuignodonL.,ChuzelT.,FlamantF.,SamarutJ.2004.receptordelahormona
tiroideaalfaesuninterruptormoleculardelafuncincardiacaentrelavidafetalypostnatal.ProcNatlAcadSci
EE.UU.101:1033210337[ArtculolibrePMC][PubMed]
535.I.Klein,OjamaaK.2001.Lahormonatiroideayelsistemacardiovascular.NEnglJMed344:501509
[PubMed]
536.[Suprimido.]
537.OjamaaK.,SamarelAM,KupferJM,HongC.,I.Klein1992...losefectosdelahormonatiroideaenexpresin
degenescardiacosindependientesdelcrecimientocardacoylasntesisdeprotenas.AmJPhysiolEndocrinol
Metab263:E534E540[PubMed]
538.[Suprimido.]
539.ThomasTA.,KuzmanJA.,AndersonBE.,AndersenSM.,SchlenkerEH.,MSHolder.,GerdesAM..2005
Lashormonastiroideasinducencambiosnicasypotencialmentebeneficiososenformamiocitoscardacosenratas
hipertensascercadelainsuficienciacardaca.AmJPhysiolCoraznCircPhysiol288:H2118H2122[PubMed]
540.HendersonKK.,DanziS.,PaulJT.,LeyaG.,KleinI.,SamarelAM..2009reemplazofisiolgicodeT3mejora
lafuncinventricularizquierdaenunmodeloanimaldeinsuficienciacardacacongestivainducidaporinfartode
miocardio.CircFallaCorazn2:243252[PubMed]
541.J.Surez,ScottBT.,SurezRamrezJA.,ChaviraCV.,DillmannWH..2010Lahormonatiroideainhibela
fosforilacindeERKenlapresininducidaporsobrecargahipertrofiadoscorazonesderatnatravsdeun
mecanismomediadoporreceptores.AmJPhysiolCellPhysiol299:c1524c1529[PMClibresartculo]
[PubMed]
542.E.vanRooij,SutherlandLB.,QiX.,RichardsonJA.,ColinaJ.,OlsonES..2007decontroldecrecimiento
cardiacoestrsdependienteylaexpresingnicaporunmicroARN.Ciencia316:575579[PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

119/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

543.MinakawaM.,TakeuchiK.,ItoK.,TsushimaT.,FukuiK.,TakayaS.,FukudaI.2003.Restauracindenivel
deprotenadelretculosarcoplsmicoporlahormonatiroideacontribuyealamejoraparcialdelafuncin
miocrdica,peronometabolismodelaglucosaenuncoraznfallatemprana.EurJSurgCardiothorac24:493501
[PubMed]
544.KinugawaK.,YonekuraK.,RibeiroRC.,EtoY.,T.Aoyagi,BaxterJD.,CamachoSA.,BristowMR.,Long
CS.,SimpsonPC..2001Reglamentodeisoformasdelreceptordelahormonatiroideaenlahipertrofiacardiaca
fisiolgicaypatolgica.CircRes89:591598[PubMed]
545.HartleyCJ.,TaffetGE.,ReddyAK.,EntmanML.,MichaelLH..2002fenotipificacinnoinvasiva
cardiovascularenratones.ILARJ43:147158[PubMed]
546.BorstO.,OchmannC.,SchonbergerT.,JacobyC.,StellosK.,SeizerP.,FlogelU.,LangF.,GawazM.2011.
Losmtodosempleadosparalainduccinyelanlisisdeinfartodemiocardioexperimentalenratones.CellPhysiol
Biochem28:112[PubMed]
547.RedoutEM.,vanderToornA.,ZuidwijkMJ.,vandeKolkCW.,VanEchteldCJ.,MustersRJ.,vanHardeveld
C.,PaulusWJ.,SimnidesWS..2010Tratamientoantioxidanteatenaarterialpulmonarinducidaporhipertensin
insuficienciacardaca.AmJPhysiolCoraznCircPhysiol298:H1038H1047[PubMed]
548.JohanssonC.,P.Thoren1997.Losefectosdelatriyodotironina(T3)sobrelafrecuenciacardiaca,la
temperaturayECGmedidacontelemetraenratonesenmovimientolibre.ActaPhysiolScand160:133138
[PubMed]
549.MittagJ.,DavisB.,VujovicM.,ArnerA.,B.Vennstrom2010.Lasadaptacionesdelsistemadecontroldela
frecuenciacardacanerviosoautnomobajolosefectodeunahormonatiroideadereceptoresalfa1mutante.
Endocrinologa151:23882395[PubMed]
550.VanVlietBN.,J.McGuire,ChafeL.,LeonardA.,A.Joshi,MontaniJP..2006Fenotipificacinelniveldela
presinarterialportelemetraenratones.ClinExpPharmacolPhysiol33:10071015[PubMed]
551.deWaardMC.,vanderVeldenJ.,BitoV.,OzdemirS.,BiesmansL.,BoontjeNM.,DekkersDH.,
SchoonderwoerdK.,SchuurbiersHC.,deCromR.,StienenGJ.,SipidoKR.,LamersJM.,DunckerDJ..2007la
prcticadeejerciciotempranonormalizalafuncinmyofilamentyatenaladisfuncindelabombadelventrculo
izquierdoenratonesconungraninfartodemiocardio.CircRes100:10791088[PubMed]
552.HeatherLC.,ColeMA.,AthertonHJ.,CoumansWA.,EvansRD.,TylerDJ.,GlatzJF.,LuikenJJ.,ClarkeK.
2010.activacindelaprotenaquinasaactivadaporelmonofosfatodeadenosina,latranslocacindeltransportador
desustrato,yelmetabolismoenlacontratacindecoraznderatahipertiroidismo.Endocrinologa151:422431
[PubMed]
553.PantosC.,MourouzisI.,SaranteasT.,ClavG.,LigeretH.,NoackFraissignesP.,RenardPY.,Massonneau
M.,PerimenisP.,SpanouD.,KostopanagiotouG.,CokkinosDV..2009Lahormonatiroideamejorala
recuperacindelafuncinpostischaemicaltiempoquelimitalaapoptosis:unnuevoenfoqueteraputicoparaapoyar
lahemodinmicaenlaconfiguracindelaisquemiareperfusin?BsicoResCardiol104:6977[PubMed]
554.BeekmanRE.,vanHardeveldC.,SimnidesWS..1989Enelmecanismodelareduccindelahormona
tiroideadelaestimulacinvelocidadderelajacinbetaadrenrgicosenelcoraznderata.BiochemJ259:229236
[PMClibresartculo][PubMed]
555.SutherlandFJ.,ShattockMJ.,BakerKE.,CochefnebreDJ..2003Ratnaisladocoraznperfundidos:
caractersticasyprecauciones.ClinExpPharmacolPhysiol30:867878[PubMed]
556.HyytiOM.,OlsonAK.,GeM.,NingXH.,BurokerNE.,ChungY.,JueT.,PortmanMA..2008
cardioselectivosreceptordelahormonatiroideadominantenegativo(Delta337T)modulaelmetabolismoycontrctil
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

120/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

delmiocardioeficiencia.AmJPhysiolEndocrinolMetab295:E420E427[PMClibresartculo][PubMed]
557.PortmanMA..2008laregulacinhormonaldelatiroidesenelmetabolismodelcorazn.tiroidea18:217225
[PubMed]
558.deTombePP.,termilesdeeurosExcmo..1991Lafaltadeefectodeisoproterenolenlavelocidadsincargade
acortamientodelsarcmeroenlaratatrabculascardiaca.CircRes68:382391[PubMed]
559.termilesdeeurosExcmo.,N.Deis,LandesbergA.,NguyenTT.,LivshitzL.,StuyversB.,ZhangML..2003
Fuerza,velocidaddeacortamientodelsarcmeroylaactividadATPasa.AdvExpMedBiol538:583602
discusin602.[PubMed]
560.BingOH.,LaHayaNL.,PerreaultCL.,ConradCH.,BrooksWW.,SenS.,JPMorgan..1.994efectosdela
hormonadelatiroidesenelcalciointracelularyrespuestasinotrpicosdemiocardioventricularrata.AmJPhysiol
CoraznCircPhysiol267:H1112H1121[PubMed]
561.DiMeoS.,VendittiP.,DeLeoT.1997.Efectodeyodotironinasenlaspropiedadeselectrofisiolgicasdelas
fibrasdelmsculopapilarderatas.HormonaMetabolismoInvestigacin29:225230[PubMed]
562.XuY.,MonaskyMM.,HiranandaniN.,HaizlipKM.,BillmanGE.,JanssenPM..2.011Efectodecontraccin
duracindelintervalodelafuncincontrctildecontraccionesposterioresenaisladorata,conejo,perroyel
miocardioencondicionesfisiolgicas.JApplPhysiol111:11591167[ArtculolibrePMC][PubMed]
563.SZCZESNACordaryD.,M.Jones,MooreJR.,J.Watt,KerrickWG.,Y.Xu,WangY.,WaggC.,Lopaschuk
GD..2007miosinadecadenaligerareguladoramutacinE22Kendisminucinintracelulardecalcioydelafuerza
transitorioscardacos.FASEBJ21:desde3974hasta3985[PubMed]
564.BelkeDD.,GlossB.,SwansonEA.,DillmannWH..2007adenoasociadoexpresinmediadaporvirusdelos
receptoresdelahormonatiroideaisoformasalfa1ybeta1mejoralafuncincontrctildelapresininducidapor
sobrecargahipertrofiacardiaca.Endocrinologa148:28702877[PubMed]
565.BeekmanRE.,vanHardeveldC.,SimnidesWS.1990.efectosestadotiroidesybetaagonistasenlas
concentracionesdecalciocitoslicoenindividualesmiocitoscardiacosderataactivadasporlaestimulacinelctrica
oKalto+despolarizacin.BiochemJ268:563569[PMClibresartculo][PubMed]
566.E.Holt,SjaastadI.,LundePK.,G.Christensen,SejerstedOM.1999.controldelahormonatiroideadela
contraccinyelCa(2+)ATPasa/complejofosfolambanenmiocitosventricularesderatasadultas.JMolCell
Cardiol31:645656[PubMed]
567.DesTombeAL.,VanBeekHarmsenBJ.,LeeDeGrootMB.,VanDerLaarseWJ..2002histoqumica
calibradoaplicaalsuministrodeoxgenoylademandaenelmiocardioderatahipertrofiado.MicroscRestecnologa
58:412420[PubMed]
568.WhittakerP.,KlonerAR.,BoughnerDR.,PickeringJG..1.994Evaluacincuantitativadelcolgeno
miocrdicocontincinrojapicrosiriusylaluzpolarizadacircularmente.BsicaResCardiol89:397410
[PubMed]
.569..PandyaK.,KimHS,SmithiesO.2006fibrosis,noTamaodecelda,delineabetamiosinadecadenapesada
reexpresindurantelahipertrofiacardiacayelenvejecimientonormalinvivo.ProcNatlAcadSciEE.UU.103:
1686416869[PMClibresartculo][PubMed]
570.LpezJE.,MyagmarBE.,SwigartPM.,MontgomeryMD.,HaynamS.,BigosM.,RodrigoMC.,SimpsonPC.
.2011delacadenapesadabetamiosinaesinducidaporsobrecargadepresinenunapequeasubpoblacinde
pequeoratnmiocitoscardacos.CircRes109:629638[PMClibresartculo][PubMed]
571.PantosC.,MourouzisI.,XinarisC.,KokkinosAD.,MarkakisK.,DimopoulosA.,M.Panagiotou,Saranteas
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

121/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

T.,KostopanagiotouG.,CokkinosDV.2007.Elcambiodehorariodependientesdelaexpresindelahormona
tiroideareceptoralfa1enelmiocardiotrasuninfartodemiocardioagudo:posiblesimplicacionesenlaremodelacin
cardaca.EurJEndocrinol156:415424[PubMed]
572.OjamaaK.,KlempererJD,MacGilvraySS,KleinI.,SamarelA.1996...Lahormonatiroideaylaregulacin
hemodinmicadebetamiosinapromotordecadenapesadaenelcorazn.Endocrinologa137:802808[PubMed]
.573SunZQ,OjamaaK.,CoetzeeWA,ArtmanM.,I.Klein2000...Losefectosdelahormonatiroideaenel
potencialdeaccinycorrientesrepolarizacinenmiocitosventricularesderata.AmJPhysiolEndocrinolMetab278
:E302E307[PubMed]
574.CampanaD.,McDermottBJ.2000.Contribucindelasntesisdenovodeprotenasparaelefectohipertrfico
deIGF1peronodelashormonastiroideasencardiomiocitosventricularesadultos.MolCellBiochem206:113
124[PubMed]
575.MullerA.,ZuidwijkMJ,SimnidesWS,vanHardeveldC.1997...LamodulacindelaexpresindeSERCA2
porlahormonatiroideaynorepinefrinaencardiocitos:papeldelacontractilidad.AmJPhysiolCoraznCircPhysiol
272:H1876H1885[PubMed]
576.VlasblomR.,A.Muller,MustersRJ.,ZuidwijkMJ.,VanHardeveldC.,PaulusWJ.,SimnidesWS..2004
detencincontrctilrevelalaestimulacindependientedecalciodeSERCA2alaexpresindeARNmenlos
cardiomiocitosventricularescultivadas.CardiovascRes63:537544[PubMed]
577.vanDijkOttensM.,VosIH.,CornelissenPW.,deBruinA.,VuelcaME..2010tiroidescardiacaexpresindel
factordecrecimientomecnicohormonainducidadependedevenceralaactividad.Endocrinologa151:830838
[PubMed]
.578.RiedelB.,JiaY.,DuJ.,AkermanS.,HuangX.2005hormonatiroidesinhibelaexpresinTnIesqueltica
lentaenlasclulasmiocrdicasTnInuloscardacos.CellTissue37:4751[PubMed]
579.vanderHeideSM.,JoostenBJ.,DragtBS.,VuelcaME.,KlarenPH.2007.Unpapelfisiolgicodehormonas
tiroideasglucurnidos:captacinpreferencialporH9c2(21)miotubos.MolCellEndocrinol264:109117
[PubMed]
580.PantosC.,XinarisC.,MourouzisI.,PerimenisP.,E.Politi,SpanouD.,CokkinosDV..2008Lahormona
tiroideareceptoralfa1:uncambioalasclulascardacas"metamorfosis"JPhysiolPharmacol59:253269
[PubMed]
581.MeischlC.,BuermansHP.,HazesT.,ZuidwijkMJ.,MustersRJ.,BoerC.,A.vanLingen,SimnidesWS.,
BlankensteinMA.,DupuyC.,PaulusWJ.,HackCE.,RisStalpersC.,RoosD.,NiessenHW..2008H9c2
cardiomioblastosproducenlahormonatiroidea.AmJPhysiolCellPhysiol294:C1227C1233[PubMed]
582.McAllisterRM.,GrossenburgVD.,DelpMD.,LaughlinMH.1998.Efectosdehipertiroidismoenlas
respuestascontrctilesyrelajacinvascular.AmJPhysiolEndocrinolMetab274:E946E953[PubMed]
583.VirdisA.,R.Colucci,FornaiM.,A.Polini,DaghiniE.,E.Duranti,GhisuN.,VersariD.,A.Dardano,
BlandizziC.,TaddeiS.,DelTaccaM..,MonzaniF.2009induciblexidontricosintasaestimplicadaenla
disfuncinendotelialdemesentricaspequeasarteriasderatasconhipotiroidismo.Endocrinologa150:10331042
[PubMed]
584.DengJ.,R.Zhao,ZhangZ.,J.Wang2010.Loscambiosenlareactividadvasculardeagranrataymedianas
arteriasinducidasporhipertiroidismo.ExpToxicolPathol62:317322[PubMed]
585.PappasM.,MourouzisK.,KarageorgiouH.,TesseromatisC.,MourouzisI.,KostopanagiotouG.,PantosC.,
CokkinosDV..2009Lahormonatiroideamodulalacapacidadderespuestadelaaortaderataalaestimulacin
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

122/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

alfa1adrenrgicos:unefectodebidoalaumentodelaactivacindelasealizacindebeta2adrenrgico.IntAngiol
28:474478[PubMed]
586.OjamaaK.,KlempererJD,KleinI.1996..Losefectosagudosdelahormonatiroideaenelmsculoliso
vascular.tiroides6:505512[PubMed]
587.CarrilloSepulvedaMA.,CeravoloGS.,FortesZB.,CarvalhoMH.,TostesRC.,LaurindoFR.,WebbRC.,
BarretoChavesML..2010LahormonatiroideaestimulalaproduccindeNOatravsdelaactivacindelava
PI3K/Aktenlosmiocitosvasculares.CardiovascRes85:560570[PMClibresartculo][PubMed]
588.BiancoAC.,MaiaAL.,daSilvaWS.,ChristoffoleteMA..2005deactivacinadaptativadelahormona
tiroideayelgastoenergtico.BiosciRep25:191208[PubMed]
589.SilvaJE..2006mecanismostermognicosysuregulacinhormonal.PhysiolRev86:435464[PubMed]
590.SestoftL.1980.Aspectosmetablicosdelefectocalorignicodelahormonatiroideaenlosmamferos.Clin
Endocrinol13:489506[PubMed]
591.[Suprimido.]
592.RabeloR.,SchifmanA.,A.Rubio,ShengX.,SilvaJE..1995Delimitacindesecuenciassensiblesalas
hormonastiroideasenunpromotordecrticaenelgendelaprotenadedesacoplamientorata.Endocrinologa136:
10031013[PubMed]
593.C.Curcio,LopesAM.,RibeiroMO.,FrancosoOA.,Jr,CarvalhoSD.,LimaFB.,BicudoJE.,BiancoAC..
1999Desarrollodelatermognesiscompensatoriaenrespuestaalasobrealimentacinenratasconhipotiroidismo.
Endocrinologa140:3.4383.443[PubMed]
594.HollenbergAN..2008Lafuncindelaneuronadelahormonaliberadoradetirotropina(TRH)comounsensor
metablico.tiroides18:131139[PubMed]
595.LechanRM,FeketeC.2006..LaneuronaTRH:unintegradorhipotalmicodelmetabolismoenergtico.Prog
BrainRes153:209235[PubMed]
596.FreakeHC.,SchwartzHL.,OppenheimerJH..1989Laregulacindelalipognesisporlahormonatiroideay
sucontribucinalatermognesis.Endocrinologa125:28682874[PubMed]
597.MyantNB,WitneyS.1967..Elcursodetiempodelefectodelashormonastiroideassobreelconsumode
oxgenobasalylaconcentracinplasmticadecidograsolibreenratas.JPhysiol190:221228
[PMCartculolibre][PubMed]
598.HimsworthRL..1960efectodelaadrenalinaylainsulinasobreelconsumodeoxgenodelasratascon
hipertiroidismo.Naturaleza185:694.[PubMed]
599.SmithDC.,BrownFC.1.952.Elefectodelextractodetiroidespecesloroenelmetabolismorespiratoriodela
ratablanca.BiolBull102:278286
600.OppenheimerJH.,SchwartzHL.,carrildeJT.,ThompsonMP.1991.Relacinfuncionaldeltiroidesinducida
porhormonaslipognesis,laliplisisylatermognesis.JClinInvest87:125132[PMClibresartculo]
[PubMed]
601.TaylorCR.,SchmidtNielsenK.,RaabJL..1970Escaladecosteenergticodecorrerconeltamaocorporal
enlosmamferos.AmJPhysiol219:11041107[PubMed]
602.ChristoffoleteMA.,LinardiCC.,deJessL.,EbinaKN.,CarvalhoSD.,RibeiroMO.,RabeloR.,C.Curcio,
MartinsL.,KimuraET.,BiancoAC..2004LosratonesconalteracindirigidadelgenDio2tienelasobreexpresin
inducidaporelfrodelaprotenadesacoplante1gen,peronoaumentanlalipognesisdeltejidoadiposomarrnyla
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

123/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

termognesisadaptativa.Diabetes53:577584[PubMed]
603.VillicevCM.,FreitasFR.,AokiMS.,C.Taffarel,ScanlanTS.,MoriscotAS.,RibeiroMO.,BiancoAC.,
GouveiaCH.2007.receptordelahormonatiroideaagonistabetaespecficaGC1aumentaelgastodeenergay
evitalaacumulacindegrasaenmasaenratas.JEndocrinol193:2129[PubMed]
604.MaclaganNF.,SheahanMM.1950.Lamedicindelconsumodeoxgenoenanimalespequeosmedianteun
mtododecircuitocerrado.JEndocrinol6:456462[PubMed]
605.[Suprimido.]
606.MillerCN.,KauffmanTG.,CooneyPT.,RamseurKR.,BrownLM..2010ComparacindeDEXAyQMR
paraevaluarlamasacorporalgrasaymagraenratasadultas.PhysiolBehav103:117121[ArtculolibrePMC]
[PubMed]
607.TschpMH.,SpeakmanJR.,ArchJR.,J.Auwerx,BrningJC.,L.Chan,EckelRH.,FareseRV.,Jr,Galgani
JE.,HamblyC.,HermanMA.,HorvathTL.,KahnBB.,KozmaSC.,MaratosAviadorE.,MllerTD.,Mnzberg
H.,
PflugerPT.,CiruelaL.,ReitmanML.,RahmouniK.,ShulmanGI.,ThomasG.,KahnCR.,RavussinE.2011.

Unaguaparaelanlisisdelmetabolismoenergticodelratn.MtodosNat9:5763[PMClibresartculo]
[PubMed]
608.SjgrenM.,AlkemadeA.,J.Mittag,NordstrmK.,A.Katz,RozellB.,WesterbladH.,A.Arner,Vennstrm
B.2007.hipermetabolismoenratonesprovocadaporlaaccincentraldeununligandedtiroidesalfa1receptordela
hormona.EMBOJ26:4.5354.545[PMClibresartculo][PubMed]
609.YangY.,GordonCJ..1997hipotermiareguladaenlaratahipotiroidismoinducidoporlaadministracinde
propiltiouracilo.AmJPhysiolRegulIntegrCompPhysiol272:R1390R1395[PubMed]
.610..GordonCJ,BeckerP.,PadnosB.2000Comparacindecaloryestrsporfroparaevaluarladisfuncin
termorreguladorenratasconhipotiroidismo.AmJPhysiolRegulIntegrCompPhysiol279:R2066R2071
[PubMed]
.611..KassonBG,GeorgeR.1983termorregulacinenratasconhipertiroidismo:mecanismosubyacentealafalta
derespuestaporhipotermiaalamorfinaenanimaleshipertiroideos.LifeSci33:18451852[PubMed]
612.HarperME.,BallantyneJS.,M.Leach,marcaMD..1993efectosdelashormonastiroideasenlafosforilacin
oxidativa.BiochemSocTrans21():785792[PubMed]
613.HarperME.,marcaMD..1995Elusodelanlisisdearribahaciaabajoelasticidadparaidentificarlossitiosde
tiroidestermognesisinducidaporlahormona.ProcSocExpBiolMed208:228237[PubMed]
614.HarperME.,marcaMD..1993Losaportescuantitativosdefugasdeprotonesmitocondrialyreacciones
recambiodeATPalastasasderespiracincambiadasdehepatocitosderatasdediferenteestadodelatiroides.J
BiolChem268:1485014860[PubMed]
.615..FerrickDA,NeilsonA.,BeesonC.2008Avancesenlamedicindelabioenergticacelularutilizandoflujo
extracelular.DrogasDiscovHoy13:268274[PubMed]
616.WuM.,A.Neilson,SwiftAL.,R.Moran,TamagnineJ.,ParslowD.,S.Armistead,LemireK.,OrrellJ.,J.
Teich,ChomiczS.,FerrickDA..2.007anlisismetablicomultiparmetrorevelaunaestrecharelacinentrela
funcinbioenergticamitocondrialatenuadayunamayordependenciadelagluclisisenclulastumoraleshumanas
.AmJPhysiolCellPhysiol292:C125C136[PubMed]
617.YuanC,LinJZ.,SieglaffDH.,AyersSD.,DenotoReynoldsF.,BaxterJD.,WebbP.2012.patronesde
regulacindegenesidnticosdeT3ytiroidesmoduladorselectivodelreceptordelahormonadelaGC1.
Endocrinologa153:501511[PMClibresartculo][PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

124/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

618.SukochevaOA.,CarpinteroDO..2006Losefectosantiapoptticosde3,5,3triyodotironinaenhepatocitosde
ratn.JEndocrinol191:447458[PubMed]
619.GiudettiAM.,LeoM.,GeelenMJ.,GnoniGV..2.005estimulacinacortoplazodelalipognesispor3,5L
diyodotironinaenhepatocitosderataencultivo.Endocrinologa146:3959hasta3966[PubMed]
620.HafnerRP.,BrownGC.,marcaMD..1990decontroldelatiroideshormonadeestado3respiracinen
mitocondriasaisladasdehgadoderata.BiochemJ265:731734[PMClibresartculo][PubMed]
621.HafnerRP.,NobesCD.,McGownAD.,marcaMD.1988.relacinalteradaentrelafuerzaprotonmotiveytasa
derespiracinenlanofosforilantesmitocondriashepticasaisladasderatasdediferentecondicinhormonatiroidea.
EurJBiochem178:511518[PubMed]
622.CarvalhoSD.,BiancoAC.,SilvaJE..1996Efectosdelhipotiroidismoenadiposoactividadadenililciclasa
tejidomarrn.Endocrinologa137:5519a5529[PubMed]
623.PachuckiJ.,J.Hopkins,PeetersR.,TuH.,CarvalhoSD.,KaulbachH.,AbelED.,WondisfordFE.,Ingwall
JS.,LarsenPR..2001Tipo2yodotironinadeiodinaseexpresindeltransgenenelcorazndelratnprovoca
tirotoxicosisespecficadelcorazn.Endocrinologa142:1320[PubMed]
624.KimB.,CarvalhoBiancoSD.,LarsenPR..2004Lahormonatiroideaylasealizacinadrenrgicosenel
corazn.ArqBrasEndocrinolMetabol48:171175[PubMed]
625.AnilloGC.1942.Laimportanciadelatiroidesenelmantenimientodeunaadecuadaproduccindecalor
durantelaexposicinalfro.AmJPhysiol137:582588
626.SellersEA.,UstedSS..1950Papeldelatiroidesenlasrespuestasmetablicasaunambientefro.AmJ
Physiol163:8191[PubMed]
627.RibeiroMO.,LebrunFL.,ChristoffoleteMA.,BrancoM.,A.Crescenzi,CarvalhoSD.,NegraoN.,Bianco
AC..2000EvidenciaderegulacinUCP1independientedelatermognesisinducidapornorepinefrinaenlagrasa
parda.AmJPhysiolEndocrinolMetab279:E314E322[PubMed]
628.[Suprimido.]
629.BrancoM.,M.Ribeiro,NegraoN.,BiancoAC..19993,5,3triyodotironinaestimulaactivamenteUCPenla
grasapardaenlaactividadsimpticamnimo.AmJPhysiolEndocrinolMetab276:E179E187[PubMed]
630.SilvaJE.2.000.LascatecolaminasyelsistemasimpatoadrenalenelhipotiroidismoEn:BravermanLE,editor,
UtigerRD,editor.(Editores)Werner&deIngbarLatiroides.UnTextoFundamentalyClnica,8edicin.
LippincottWilliams&Wilkins,Philadelphia,pp820823
631.SilvaJE.2.000.LascatecolaminasyelsistemasimpatoadrenalentirotoxicosisEn:BravermanLE,editor,
UtigerRD.(Editores)Werner&deIngbarLatiroides.UnTextoFundamentalyClnica,8edicin.Lippincott
Williams&Wilkins,Philadelphia,pp642651
632.LandsbergL.1977.catecolaminasyelhipertiroidismo.ClinEndocrinolMetab6:697718[PubMed]
.633.jovenJB,SavilleE.,LandsbergL.1982.Efectodelestadodelatiroidesennorepinefrina(NE)elvolumende
negocios,enlaratadeltejidoadiposomarrn(BAT):potencialimportanciadelahipfisis.ClinRes32:407
(Resumen)..
634.RothwellNJ.,StockMJ..1979Elpapeldetejidoadiposomarrnenlatermognesisinducidaporladieta.
Naturaleza281:3135[PubMed]
635.SyedMA.,ThompsonMP.,PachuckiJ.,BurmeisterLA.1999.Elefectodelahormonatiroideaeneltamaode
losdepsitosdegrasarepresentalamayorpartedeloscambiosenlosnivelesdeARNmydeleptinaensueroenla
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

125/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

rata.Thyroid9:503512[PubMed]
636.[Suprimido.]
637.FreakeHC.,LunaYK..2003hormonalylaregulacinnutricionaldelaenzimalipognicanivelesdemRNA
enlosadipocitosblancosymarronesprimariosderata.JNutrSciVitaminol(Tokio)49:4046[PubMed]
638.SilvaJE..1.988expresincompletadelgendelaprotenadedesacoplamientorequierelaconcurrenciadela
norepinefrinaylatriyodotironina.MolEndocrinol2:706713[PubMed]
639.[Suprimido.]
640.CarvalhoSD.,NegraoN.,BiancoAC.1993.Regulacinhormonaldelaenzimamlicoyglucosa6fosfatoen
eltejidoadiposomarrn.AmJPhysiolEndocrinolMetab264:E874E881[PubMed]
641.AntinozziPA.,SegallL.,PrentkiM.,McGarryJD.,NewgardCB.1998.perturbacinmolecularo
farmacolgicadelarelacinentrelaglucosayelmetabolismodeloslpidosessinefectosobrelasecrecinde
insulinaestimuladaporglucosa.UnareevaluacindelacadenalargadeacilCoAhiptesis.JBiolChem273:
desde16146hasta16154[PubMed]
642.SaggersonED.,McAllisterTW.,bahtHS.1988.lipognesisenlosadipocitosderatamarrn.Efectosdela
insulinaylanoradrenalina,lascontribucionesdelaglucosayellactatocomoprecursoresylascomparacionesconlos
adipocitosblancos.BiochemJ251:701709[PMClibresartculo][PubMed]
643.BachmanES.,DhillonH.,ZhangCY.,CintiS.,BiancoAC.,KobilkaBK.,LowellBB..2002betaAR
sealizacinrequeridaparalatermognesisinducidaporladietaylaresistenciaalaobesidad.Ciencia297:843845
[PubMed]
644.WangYX.,LeeCH.,TiepS.,YuRT.,JamnJ.,H.Kang,EvansRM..2003deltadelreceptordeperoxisoma
proliferadoractivadoactivaelmetabolismodegrasaparaprevenirlaobesidad.Cell113:159170[PubMed]
645.HellstrmL.,WahrenbergH.,
ReynisdttirS.,ArnerP.1997.adipocitoliplisisinducidaporcatecolaminasen

elhipertiroidismohumana.JClinEndocrinolMetab82:159166[PubMed]
646.LonnqvistF.,WahrenbergH.,
HellstromL.,ReynisdttirS.,ArnerP.1992.catecolaminaslipolticaresistencia

debidoaladisminucindelaexpresindebeta2adrenrgicosenlasclulasgrasas.JClinInvest90:21752186
[ArtculolibrePMC][PubMed]
647.WahrenbergH.,
LonnqvistF.,ArnerP.1989.Mecanismosquesubyacenalasdiferenciasregionalesenla

liplisiseneltejidoadiposohumano.JClinInvest84:458467[PMClibresartculo][PubMed]
648.BiancoAC.,KiefferJD.,SilvaJE..1992Laadenosina3',5'monofosfatoyelcontroldelahormonatiroidea
decidoribonucleicomensajerodisociacindeprotenasenlosadipocitosmarronesrecindispersos.
Endocrinologa130:26252633[PubMed]
649.RehnmarkS.,BiancoAC.,KiefferJD.,SilvaJE..1992deTranscripcinymecanismospostranscripcionalesde
desacoplamientorespuestaARNmprotenaalfro.AmJPhysiolEndocrinolMetab262:E58E67[PubMed]
650.[Suprimido.]
651.YingH.,
ArakiO.,FuruyaF.,KatoY.,ChengSY..2007adipognesisDeteriorocausadoporunreceptoralfa

1delahormonatiroideamutado.MolCellBiol27:23592371[PMClibresartculo][PubMed]
652.ObregnMJ..2008Lahormonatiroideayladiferenciacindelosadipocitos.tiroidea18:185195
[PubMed]
.653.BenitoM.,A.Porras,SantosE.1993Establecimientodelneascelularesdeadipocitosmarronespermanentes
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

126/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

obtenidosportransfeccincongranSV40Tantgenoygenesras.ExpCellRes209:248254[PubMed]
654.SurksMI.,OppenheimerJH.1977.LaconcentracindeLtiroxinaytriyodotironinaLuneespecficamentea
losreceptoresnuclearesenelhgadoyrinderata.LaevidenciacuantitativafavoreciendounimportantepapeldeT
3enlaaccindelahormonatiroidea.JClinInvest60:555562[PMClibresartculo][PubMed]
655.CarrFE.,SaltoDB.,OppenheimerJH..1984Distribucindeproductostraducidoshormonatiroideaque
respondenenpolisomashgadoderataypoblacionesribonucleoproteicospostribosomal.Endocrinologa115:
17371745[PubMed]
656.RuegamerWR.,NewmanGH.,RichertDA.,WesterfeldWW..1965Especificidaddelaalfaglicerofosfato
deshidrogenasaylarespuestadelaenzimamlicoatiroxina.Endocrinologa77:707715[PubMed]
657.MariashCN.,KaiserFE.,SchwartzHL.,TowleHC.,OppenheimerJH.1980.Sinergismodelahormona
tiroideayladietaaltaencarbohidratosenlainduccindeenzimaslipognicosenlarata.Mecanismosy
consecuencias.JClinInvest65:11261134[PMClibresartculo][PubMed]
658.TowleHC.,MariashCN.,OppenheimerJH..1980Cambiosenlosniveleshepticosdecidoribonucleico
mensajeroparalaenzimamlicodurantelainduccinporlahormonadelatiroidesoladieta.Bioqumica19:579
585[PubMed]
659.MariashCN.,KaiserFE.,OppenheimerJH..1980comparacindelarespuestacaractersticasdecuatro
enzimaslipognicasa3,5,3'triyodotironinaadministracin:evidenciadegradosvariablesdeamplificacindela
3,5,3'triyodotironinasealnuclear.Endocrinologa106:2227[PubMed]
.660StakkestadJA,BremerJ.1983..Lacarnitinapalmitoiltransferasaexterioryregulacindelmetabolismodelos
cidosgrasosenelhgadoderataendiferentesestadosdelatiroides.BiochimBiophysActa750:244252
[PubMed]
.661StakkestadJA,BremerJ.1982..Elmetabolismodeloscidosgrasosenhepatocitosaisladosderatastratadas
contriyodotironina.BiochimBiophysActa711:90100[PubMed]
662.HeimbergM.,OlubadewoJO.,WilcoxHG.1985.lipoprotenasyregulacindelmetabolismohepticode
cidosgrasosenlosestadosalteradosdelatiroidesdeplasma.EndocrRev6:590607[PubMed]
663.EngelkenSF.,EatonRP..1980tiroidesdisociacinentretriglicridosenplasmaylaregulacindelcolesterol
enlaratainducidoconhormonas.Endocrinologa107:208214[PubMed]
.664KeyesWG,HeimbergM.1979..Influenciadelacondicindelatiroidesenelmetabolismodeloslpidosenel
hgadoderataperfundido.JClinInvest64:182190[PMClibresartculo][PubMed]
.665ApostolopoulosJJ,HowlettGJ,FidgeN.1987...Efectosdelcolesteroldeladietayelhipotiroidismoenel
metabolismoderatasapolipoprotenaARNm.JLipidRes28:642648[PubMed]
666.DolphinPJ.,ForsythSJ..1983lipoprotenashepticasnacientesenratasconhipotiroidismo.JLipidRes24:
541551[PubMed]
667.DolphinPJ..1981Elsueroylipoprotenasnacienteshepticosenratasnormalesehipercolesterolmicos.J
LipidRes22:971989[PubMed]
668.JohanssonL.,RudlingM.,ScanlanTS.,LundasenT.,WebbP.,J.Baxter,AngelinB.,PariniP.2005.tiroidea
selectivomodulacindelreceptordeGC1reduceloslpidossricosyestimulamedidasdetransporteinversode
colesterolenratoneseutiroideos.ProcNatlAcadSciEE.UU.102:desde10.297hasta10.302
[PMClibresartculo][PubMed]
669.RibeiroMO..2008Efectosdelosanlogosdelahormonatiroideasobreelmetabolismolipdicoyla
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

127/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

termognesis.tiroides18:197203[PubMed]
670.AmorimBS.,UetaCB.,FreitasBC.,NassifRJ.,GouveiaCH.,ChristoffoleteMA.,MoriscotAS.,Lancelloti
CL.,LlimonaF.,BarbeiroHV.,deSouzaHP.,CatanoziS.,PassarelliM.,AokiMS.,BiancoAC.,RibeiroMO..
2009agonistaUnTRbetaselectivoconfiereresistenciaalaobesidadinducidaporladieta.JEndocrinol203:291
299[PMClibresartculo][PubMed]
.671SimnidesWS,vanHardeveldC.2008..Lahormonatiroideacomofactordeterminantedelfenotipo
metablicoycontrctildelmsculoesqueltico.tiroidea18:205216[PubMed]
.672.SimnidesWS,ThelenMH,vanderLindenCG,MullerA.,vanHardeveldC.2001...laexpresin
MecanismodehormonatiroideareguladadelosgenesSERCAenelmsculoesqueltico:implicacionesparala
termognesis.BiosciRep21:139154[PubMed]
673.JackmanMR.,WillisWT..1996CaractersticasdelasmitocondriasaisladasdetipoIytipomsculo
esquelticoIIb.AmJPhysiolCellPhysiol270:C673C678[PubMed]
674.PetteD.,StaronRS..1.997mamferostransicionestipodefibramuscularesqueltico.IntRevCytol170:143
223[PubMed]
.675..SimnidesWS,vanHardeveldC.1989ElDevelpmentpostnataldelretculosarcoplsmicoCa2+transporte
actividadenelmsculoesquelticodelarataescrticamentedependientedelahormonatiroidea.Endocrinologa
124:11451153[PubMed]
676.vanderLindenCG.,SimnidesWS.,A.Muller,vanderLaarseWJ.,VermeulenJL.,ZuidwijkMJ.,Moorman
AF.,vanHardeveldC.1996.regulacindefibraespecficodeCa(2+)ATPasaisoformaexpresinporlahormona
tiroideaenelmsculoesquelticoderata.AmJPhysiolCellPhysiol271:c1908C1919[PubMed]
677.ButlerBrowneGS.,HerlicoviezD.,WhalenRG.1984.Efectosdehipotiroidismoenlastransicionesde
isoenzimasdelamiosinaeneldesarrollodemsculoderata.FEBSLett166:7175[PubMed]
678.MahdaviV.,IzumoS.,NadalGinardB.1987.laregulacinhormonaldeldesarrolloydelamiosina
sarcomricafamiliadegenesdelacadenapesada.CircRes60:804814[PubMed]
679.d'AlbisA.,ChanoineC.,JanmotC.,MiraJC,CouteauxR.1990..Muscleespecficarespuestaalahormonade
latiroidesdelastransicionesdeisoformasdemiosinaduranteeldesarrollopostnataldelarata.EurJBiochem193:
155161[PubMed]
.680.IzumoS.,NadalGinardB.,MahdaviV.1986TodoslosmiembrosdelafamiliamultignicaMHCresponden
alahormonatiroideadeunamaneraaltamenteespecficadetejido.Ciencia231:597600[PubMed]
681.ArianoMA.,ArmstrongRB.,EdgertonVR..1.973poblacionesdefibrasmusculareslaspatastraserasdecinco
mamferos.JHistochemCytochem21:5155[PubMed]
.682LCWang,KernellD.2001..Tipodefibraregionalizacinenlosmsculosdelaspatastraserasmsbajasde
conejo,ratayratn:unestudiocomparativo.JAnat199:631643[PMClibresartculo][PubMed]
683.panaderoDJ.,HeppleRT.2005.Laversatilidaddelaratapreparacinextremidadposteriordelabomba
perfundido:ejemplosrelativosalafuncindelmsculoesquelticoyelmetabolismoenergtico.CanJApplPhysiol
30:576590[PubMed]
684.McAllisterRM.,OgilvieRW.,TerjungRL..1991Lasconsecuenciasfuncionalesymetablicasdela
remodelacindelmsculoesquelticoenelhipotiroidismo.AmJPhysiolEndocrinolMetab260:E272E279
[PubMed]
685.VuelcaME.,vanHardeveldC.,TermilesdeeurosExcmo.,KassenaarAA..1983desarrollodelafuerzayel
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

128/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

metabolismoenelmsculoesquelticoderatasperfundidoseutiroideoehipertiroidismo.HormMetabRes15:388
393[PubMed]
686.VuelcaME.,vanHardeveldC.,TermilesdeeurosExcmo.,KassenaarAA..1981desarrollodelafuerzayel
metabolismoenelmsculoesquelticoderataseutiroideoehipotiroidismo.ActaEndocrinol(Copenh)97:221225
[PubMed]
687.B.Kraus,PetteD.1997.CuantificacindeMyoD,miogenina,MRF4yId1porlatranscriptasainversa
reaccinencadenadelapolimerasaenratasmsculosefectosdelhipotiroidismoylaestimulacindebajafrecuencia
crnica.EurJBiochem247:98106[PubMed]
.688KirschbaumBJ,KucherHB,TerminA.,KellyAM,PetteD.1990....efectosantagnicosdecrnica
estimulacindebajafrecuenciaydelahormonatiroideaenlaexpresindelamiosinaenelmsculoderatade
contraccinrpida.JBiolChem265:1397413980[PubMed]
.689A.Montgomery1992.Elcursotemporaldeloscambiosinducidosporlatiroideshormonasenlaspropiedades
isotnicaseisomtricasdemsculosleoderata.PflugersArco421:350356[PubMed]
.690VuelcaME,SimnidesWS,LeijendekkerWJ,vanHardeveldC.1987....Lafatigabilidadylarecuperacindel
msculosleoderataenelhipertiroidismo.Metabolismo36:444450[PubMed]
691.JohanssonC.,J.Lannergren,LundePK,VennstromB.,P.Thoren,WesterbladH.2000..lafuerzaisomtricay
laresistenciaenelmsculosleodelahormonatiroideareceptoralfa(1)oratonesdeficientesenbeta.AmJ
PhysiolRegulIntegrCompPhysiol278:R598R603[PubMed]
692.LiX.,HughesSM,SalviatiG.,A.Teresi,LarssonL.1996..efectosdelahormonatiroideasobrela
contractilidadylacomposicindelamiosinadelmsculosleoyfibrasindividualesderatasjvenesyviejas.J
Physiol494():555567[PMClibresartculo][PubMed]
693.FittsRH.,BrimmerCJ.,TroupJP.,UnsworthBR..1984contrctilesyfatigapropiedadesdelmsculo
esquelticoderatatirotxica.MuscleNerve7:470477[PubMed]
694.OttenheijmCA.,HidalgoC.,RostK.,GotthardtM.,GranzierH.2009.contractilidadalteradadelmsculo
esquelticoenratonesdeficientesenlaregindelabandaMdelatitina.JMolBiol393:1026
[ArtculolibrePMC][PubMed]
695.NorenbergKM.,HerbAR.,DoddSL.,PowersSK..1996Losefectosdelhipotiroidismoenfibrasindividuales
delmsculosleoderata.CanJPhysiolPharmacol74:362367[PubMed]
696.vanHeesHW.,OttenheijmCA.,GranzierHL.,DekhuijzenPN.,HeunksLM..2010Lainsuficienciacardaca
disminuyelageneracindetensinpasivadelasfibrasdediafragmaderata.IntJCardiol141:275283[PubMed]
697.WahrmannJP.,FullaY.,RieuM.,A.Kahn,DinhXuanAT..2002Alteredexpresinisoformademiosinaen
losmsculosesquelticosderatasinducidasporunestadodetiroideshacambiado.ActaPhysiolScand176:233
243[PubMed]
698.YamadaT.,MishimaT.,SakamotoM.,SugiyamaM.,S.Matsunaga,WadaM.2007.oxidacinproteica
miofibrilarydisfuncincontrctilendiafragmaderatnhipertiroidismo.JApplPhysiol102:18501855
[PubMed]
699.AgbulutO.,NoirezP.,F.Beaumont,ButlerBrowneG.2003.isoformasdecadenapesadadelamiosinaenel
desarrollomuscularpostnataldelosratones.CellBiol95:399406[PubMed]
700.MiyabaraEH.,AokiMS.,SoaresAG.,SaltaoRM.,VilicevCM.,PassarelliM.,ScanlanTS.,GouveiaCH.,
MoriscotAS..2005hormonatiroideareceptorbetaagonistaselectivoGC24escatimatipomsculoesquelticoIaII
fibraturno.CellTissueRes321:233241[PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

129/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

701.YamadaT.,InashimaS.,S.Matsunaga,NaraI.,KajiharaH.,M.Wada2004.cursotemporaldiferentedelos
cambiosenelretculosarcoplsmicoyisoformasdelamiosinaenratamsculosleoenlaetapatempranadel
hipertiroidismo.ActaPhysiolScand180:7987[PubMed]
702.YuF.,GotheS.,WikstromL.,ForrestD.,VennstromB.,LarssonL.2000.Efectosdelahormonatiroideagen
delreceptordelainterrupcinenlaexpresindeisoformasdemiosinaenlosmsculosesquelticosderatones.Am
JPhysiolRegulIntegrCompPhysiol278:R1545R1554[PubMed]
703.dosSantosAR.,GiannoccoG.,NunesMT..2001Lahormonatiroideaestimulalaexpresindemioglobinaen
elsleoyextensorumdigitalislongusmsculosderatas:alteracionesconcomitantesenlasactividadesdelasenzimas
oxidativasciclodeKrebs.tiroidea11:545550[PubMed]
704.IrrcherI.,AdhihettyPJ.,T.Sheehan,JosAM.,HoodDA..2003PPARgammaexpresincoactivador1alfa
durantelahormonatiroideaycontrctilactividadinducidaadaptacionesmitocondriales.AmJPhysiolCellPhysiol
284:c1669c1677[PubMed]
.705SimnidesWS,vanHardeveldC.1990..UnensayopararetculosarcoplsmicoCa2(+)ATPasaactividaden
loshomogeneizadosdelmsculo.AnalBiochem191:321331[PubMed]
706.SilvestriE.,M.Moreno,A.Lombardi,RagniM.,deLangeP.,AlexsonSE.,LanniA.,GogliaF.2005.efectos
delahormonatiroideaenvasbioqumicassupuestosimplicadosenlaactivacinUCP3enlaratamitocondriasdel
msculoesqueltico.FEBSLett579:16391645[PubMed]
.707.VendittiP.,PucaA.,DiMeoS.2003EfectodeestadodelatiroidesenlatasaysitiosdeH2O2produccin
enratasmitocondriasdelmsculoesqueltico.ArcoBiochemBiophys411:121128[PubMed]
708.SchiaffinoS.,GorzaL.,SartoreS.,SagginL.,AusoniS.,M.Vianello,GundersenK.,LomoT.1989.Tres
cadenaspesadasdemiosinaeneltipo2fibrasdelmsculoesqueltico.JMuscleResCellMotil10:197205
[PubMed]
709.SmerduV.,SoukupT.2008.Demostracindeisoformasdecadenapesadadelamiosinaenratasyseres
humanos:laespecificidaddesieteanticuerposmonoclonalesdisponiblesutilizadaenlosmtodosde
inmunohistoqumicayimmunoblotting.EurJHistochem52:179190[PubMed]
710.BloembergD.,CuadrilteroJ.2012.Larpidadeterminacindelamiosinapesadacadenadeexpresin,enla
rata,elratnyelmsculoesquelticohumanoutilizandoelanlisisdeinmunofluorescenciamulticolor.PLoSOne7
:.e35273[PMClibresartculo][PubMed]
.711NunesMT,BiancoAC,MigalaA.,B.Agostini,HasselbachW.1985...Latiroxinatransformacininducidaen
elretculosarcoplsmicodelsleoconejoymsculospsoas.ZNaturforsch[C]40:726734[PubMed]
.712.NaumannK.,PetteD.1994Efectosdelaestimulacincrnicacondiferentespatronesdeimpulsosobrela
expresindeisoformasdemiosinaencultivosdemiotubosderata.Diferenciacin55:203211[PubMed]
713.GrozovskyR.,RibichS.,RoseneML.,MulcaheyMA.,HuangSA.,PattiME.,BiancoAC.,KimBW..2009
Tipo2deiodinaseexpresinesinducidaporlosagonistasdelreceptorgammaactivadosporproliferadoresde
peroxisomasenmiocitosesquelticos.Endocrinologa150:19761983[PMClibresartculo][PubMed]
714.RandoTA.,BlauHM.1994.purificacindemioblastosprincipaldelratn,caracterizacin,yeltrasplantepara
laterapiagnicamediadaporclulas.JCellBiol125:12751287[PMClibresartculo][PubMed]
.715....A.Muller,ThelenMH,ZuidwijkMJ,SimnidesWS,vanHardeveldC.1996ExpresindeMyoDen
miotubosencultivoprimarioesdependientedelaactividadcontrctil:correlacinconlaexpresindeunfenotipo
especficoretculosarcoplsmicoCa(2+)ATPasaisoforma.BiochemBiophysResCommun229:198204
[PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

130/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

716.MarsiliA.,D.Tang,HarneyJW.,P.Singh,ZavackiAM.,DenticeM.,D.Salvatore,LarsenPR..2011TipoII
deiodinaseyodotironinaofreceintracelular3,5,3triyodotironinaalmsculoesquelticoderatnnormalyla
regeneracin.AmJPhysiolEndocrinolMetab301:E818E824[PMClibresartculo][PubMed]
717.SultanKR.,HenkelB.,TerlouM.,HaagsmanHP.2.006.Lacuantificacindelaatrofiainducidaporla
hormonadegrandesmiotubosdeclulasC2C12yL6:miotubosC2C12atrofiainduciblesyatrofiaresistente.AmJ
PhysiolCellPhysiol290:C650C659[PubMed]
718.ThelenMH,SimnidesWS,vanHardeveldC.1997...LaestimulacinelctricademiotubosC2C12induce
contraccionesyreprimelatranscripcindetiroideshormonadependientedeltiporpidosarcoplsmicoretculoCa2
+ATPasagen.BiochemJ321():845848[PMClibresartculo][PubMed]
719.NagaseI.,YoshidaS.,CanasX.,Y.Irie,KimuraK.,YoshidaT.,SaitoM.1999.Sobreregulacindela
disociacindeprotenas3porlahormonatiroidea,ligandosdereceptoresactivadosporelproliferadorde
peroxisomasy9ciscidoretinoicoenmiotubosL6.FEBSLett461:319322[PubMed]
720.ThelenMH,SimnidesWS,MullerA.,vanHardeveldC.1998...dedilogotransversalentrelaregulacin
transcripcionaldelahormonatiroideaymiogenina:nuevosaspectosdelaexpresin+dependientedeCa2deltipo
rpidoretculosarcoplsmicoCa2+ATPasa.BiochemJ329():131136[PMClibresartculo][PubMed]
721.MullerA.,vanHardeveldC.,SimnidesWS,vanRijnJ.1991..LaelevacindelretculosarcoplsmicoCa2
(+)ATPasanivelesdehormonatiroideaenlalneadeclulasmuscularesL6espotenciadaporelfactorde
crecimientosimilaralainsulina1.BiochemJ275:3540[PMClibresartculo][PubMed]
722.[Suprimido.]
723.ConnorMK.,IrrcherI.,HoodDA..2001contrctilactivacintranscripcionalinducidaporlaactividadde
citocromoCimplicaSp1yesproporcionalalasntesisdeATPmitocondrialenlasclulasmuscularesC2C12.J
BiolChem276:1589815904[PubMed]
724.BassettJH.,WilliamsGR..2008papelcrticodelejehipotlamohipfisistiroidesenelhueso.Hueso43:
418426[PubMed]
725.BassettJH.,BoydeA.,HowellPG.,BassettRH.,GallifordTM.,ArchancoM.,EvansH.,LawsonMA.,
CroucherP.,StGermainDL.,GaltonVA.,WilliamsGR..2010laresistenciaseaylamineralizacinptima
requierelayodotironinadeiodinasetipo2enlososteoblastos.ProcNatlAcadSciEE.UU.107:76047609
[ArtculolibrePMC][PubMed]
726.BassettJH.,NordstromK.,BoydeA.,HowellPG.,KellyS.,VennstromB.,WilliamsGR..2007estadodela
tiroidesduranteeldesarrollodelesqueletodeterminalaestructuraseadeadultosylamineralizacin.Mol
Endocrinol21:18931904[PubMed]
727.BassettJH.,O'SheaPJ.,SriskantharajahS.,RabierB.,BoydeA.,HowellPG.,WeissRE.,RouxJP.,Malaval
L.,ClementLacroixP.,J.Samarut,ChassandeO.,WilliamsGR..2007excesodehormonatiroideaenlugardela
deficienciadetirotropinainducelaosteoporosisenelhipertiroidismo.MolEndocrinol21:10951107[PubMed]
728.BassettJH.,vanderSpekA.,GogakosA.,WilliamsGR.2012.deimagencuantitativaderayosXdeloshuesos
deroedoresporFaxitron.MethodsMolBiol816:499506[PubMed]
729.BassettJH.,WilliamsAJ.,E.Murphy,BoydeA.,HowellPG.,SwinhoeR.,ArchancoM.,F.Flamant,Samarut
J.,CostagliolaS.,VassartG.,WeissRE.,RefetoffS.,WilliamsGR.2.008.Lafaltadehormonastiroideasenlugarde
excesodetirotropinaprovocaeldesarrolloesquelticoanormalenelhipotiroidismo.MolEndocrinol22:501512
[PMClibresartculo][PubMed]
730.O'SheaPJ.,BassettJH.,SriskantharajahS.,YingH.,
ChengSY.,WilliamsGR..2005Contrastandofenotipos

http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

131/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

esquelticasenratonesconunamutacinidnticadirigidosaalfa1receptordelahormonatiroideaobeta.Mol
Endocrinol19:3045a3059[PubMed]
731.O'SheaPJ.,HarveyCB.,SuzukiH.,KaneshigeM.,KaneshigeK.,ChengSY.,WilliamsGR..2003Un
fenotipoesquelticotirotxicadelaformacinseaavanzadaenratonesconresistenciaalahormonatiroidea.Mol
Endocrinol17:14101424[PubMed]
732.EsapaCT.,HoughTA.,TestoriS.,JefeAR.,GraEA.,ChanCP.,EvansH.,BassettJH.,TylzanowskiP.,
McNallyEG.,AJCarr.,BoydeA.,HowellPG.,A.Clark,WilliamsGR.,BrownMA.,CroucherPI.,NesbitMA.,
BrownSD.,CoxRD.,CheesemanMT.,ThakkerRV.2012.Unmodeloderatnparaladisplasiacongnita
espondiloepifisiariaconartrosissecundariadebidoaunamutacinCol2a1.JBoneMinerRes27:413428
[PubMed]
733.KarunaratneA.,EsapaC.,J.Hiller,BoydeA.,CabezaR.,J.Bassett,TerrillN.,G.Williams,M.Brown,
CroucherP.,BrownSD.,CoxRD.,PeluqueraAH.,ThakkerRV.,GuptaHS..2012eldeteriorosignificativodela
calidadnanomecnicoocurreatravsdelamineralizacinextrafibrilarincompletaenloshuesosraquticos:evidencia
dedispersinderayosXdesincrotrninsituydeimagenelectrnicoderetrodispersin.JBoneMinerRes27:
876890[PubMed]
734.VanleeneM.,SaldanhaZ.,CloydKL.,JellG.,BouGhariosG.,BassettJH.,WilliamsGR.,FiskNM.,Oyen
ML.,StevensMM.,GuillotPV.,ShefelbineSJ..2011Eltrasplantedeclulasmadredelasangredelfetohumano
enelratnosteognesisimperfectaconduceaunamejoraenlaspropiedadesdeltejidodemltiplesescalas.Sangre
117:10531060[PubMed]
735.PeltoketoH.,L.Strauss,KarjalainenR.,M.Zhang,selloGW.,SegaloffDL.,PoutanenM.,HuhtaniemiTI..
2010LosratoneshembraqueexpresanmutantesconstitutivamenteactivosdelreceptordeFSHpresentanunfenotipo
deagotamientoprematurodelfolculoyelexcesodeestrgenos.Endocrinologa151:18721883
[ArtculolibrePMC][PubMed]
736.ParfittAM.,DreznerMK.,GloriosoFH.,KanisJA.,MallucheH.,MeunierPJ.,OttSM.,ReckerRR..1987
histomorfometrasea:estandarizacindelanomenclatura,smbolosyunidades.InformedelComitde
NomenclaturaASBMRHistomorfometra.JBoneMinerRes2:595610[PubMed]
737.DoubeM.,FirthCE,BoydeA.2007..Lasvariacionesenelcartlagocalcificadoarticularporsitioyelejercicio
enlos18mesesdeedad,equinocndilometacarpianodistal.Laosteoartritiscartlago15:12831292[PubMed]
738.BarnardJC.,WilliamsAJ.,RabierB.,ChassandeO.,SamarutJ.,ChengSY.,BassettJH.,WilliamsGR..2005
Lashormonastiroideasregulanelreceptordelfactordecrecimientodefibroblastosdesealizacindurantela
condrognesis.Endocrinologa146:5568a5580[PubMed]
739.StevensDA.,HarveyCB.,ScottAJ.,O'SheaPJ.,BarnardJC.,WilliamsAJ.,BradyG.,J.Samarut,Chassande
O.,WilliamsGR..2003hormonatiroideaactivaelfactordecrecimientodefibroblastosreceptor1enelhueso.Mol
Endocrinol17:17511766[PubMed]
740.WilliamsAJ.,RobsonH.,KesterMH.,vanLeeuwenJP.,ShaletSM.,VisserTJ.,WilliamsGR..2008
yodotironinaactividadesenzimticasdeiodinaseenhueso.seas43:126134[ArtculolibrePMC][PubMed]
.741...RabierB.,WilliamsAJ,malenaGerinF.,WilliamsGR,ChassandeO.2006tiroideshormonade
diferenciacinestimuladadecondrocitoscostillasprimariasinvitrorequierebetadelreceptordelahormonatiroidea.
JEndocrinol191:221228[PubMed]
742.H.Robson,SieblerT.,StevensDA.,ShaletSM.,WilliamsGR..2000Lahormonatiroideaactadirectamente
sobreloscondrocitosplacadecrecimientoparapromoverladiferenciacinhipertrficaeinhibirlaexpansinclonaly
laproliferacincelular.Endocrinologa141:3887a3897[PubMed]
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

132/133

20/1/2015

GuaAmericanThyroidAsociacinparaInvestigacindelahormonatiroideaEconomayAccinenroedoresymodeloscelulares

743.O'SheaPJ.,GuigonCJ.,WilliamsGR.,ChengSY.2007.Reglamentodelfactordecrecimientodefibroblastos
receptor1porlahormonatiroidea:laidentificacindeunelementoderespuestadelahormonatiroideaenel
promotormurinoFgfr1.Endocrinologa148:5.966a5.976[PubMed]
744.[Suprimido.]
745.CheronRG.,KaplanMM.,LarsenPR..1979influenciasfisiolgicosyfarmacolgicossobretiroxinaa3,5,3'
conversintriyodotironinaynuclear3,5,3triyodotironinavinculantedelapituitariaanteriorderata.JClinInvest64
:14021414[PMClibresartculo][PubMed]
746.DeJongM.,R.Docter,VanderHoekH.,KrenningE.,vanderHeideD.,QueroC.,PlaisierP.,R.Vos,
HennemannG.1994.DiferentesefectosdelaamiodaronaeneltransportedeT4yT3enelhgadoperfundido.Am
JPhysiolEndocrinolMetab266:E44E49[PubMed]
747.WassenFW.,MoeringsEP.,VanToorH.,DeVreyEA.,HennemannG.,VuelcaME..1996Efectosdela
interleucina1betasobrelasecrecindetirotropinaylaabsorcindelahormonatiroideaenlasclulasdelapituitaria
anteriorderatacultivadas.Endocrinologa137:15911598[PubMed]
748.WassenFW.,MoeringsEP.,vanToorH.,HennemannG.,VuelcaME..2000lacaptacindehormonatiroides
enlasclulasdelapituitariaanteriorderatacultivadas:efectosdelestadodeenergaylabilirrubina.JEndocrinol
165:599606[PubMed]
749.VuelcaME.,VisserTJ.,MoeringsEPCM,DocterR.,H.vanToor,TempelaarsAMP,DeJongM.,Krenning
EP.,HennemannG.1.994.Laabsorcindecidotriyodotiroacticoysuefectosobrelasecrecindetirotropinaen
cultivoslasclulasdelapituitariaanterior.Endocrinologa135:27002707[PubMed]
750.SatoK.,HanDC.,FujiiY.,TsushimaT.,ShizumeK.1987.Lahormonatiroideaestimulalaactividaddela
fosfatasaalcalinaenclulasosteoblsticasratacultivadas(ROS17/2.8)atravsde3,5,3triiodoLtironina
receptoresnucleares.Endocrinologa120:18731881[PubMed]
751.SatoY.,NakamuraR.,M.Satoh,FujishitaK.,S.Mori,IshidaS.,T.Yamaguchi,InoueK.,NagaoT.,OhnoY.
2005.objetivosdelahormonatiroidesMatrizgendelaprotenaGlaasociadoconcalcificacindelmsculoliso
vascular.CircRes97:550557[PubMed]
752.LiuY.,FuL.,ChenDG.,DeebSS..2007Identificacindenuevosgenesdianadelaretinadelahormona
tiroideaenlasclulasWerihumanosmedianteelanlisisdemicroarraysdeexpresin.VisinRes47:23142326
[PMClibresartculo][PubMed]
ArtculosdetiroidesseproporcionanaqucortesadeMaryAnnLiebert,Inc.

http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3887458/

133/133