Você está na página 1de 108

Manual de

condutas
em Oncologia

Prefcio

Prefcio

Editores
Editor:
Prof. Dr. Paulo Marcelo G. Hoff

Co-Editor:
Prof. Dr. Gionanni Guido Cerri
Prof. Dr. Dalton de Alencar Fisher Chamone

Editores associados:
Dra. Suilane Coelho Ribeiro Oliveira
Dra. Juliana Pereira

Colaboradores
Alessandro Igor Cavalcante Leal
Ana Cristina Malacarne Mencarini
Ana Hoff
Antnio Carlos Barcellos Bassani
Antnio Cavaleiro de Macedo Lima Filho
Ariel Galapo Kann
Caio Augusto Dantas Pereira
Camila Linardi
Carlos Dzik
Carlos Henrique Andrade Teixeira
Cid Ricardo Abreu Buarque de Gusmo
Cilmara Polido Garcia
Cludia Bitti
Cristiane Santos de Mesquita
Daniel Fernandes Saragiotto
Daniel Steinbaum
Daniela Jafet Bevilacqua Heinemann-Cohn
Daniela Ribeiro Nebuloni
Edson Abdala
Elias Abdo Filho
Elvira Velloso
Fabiano Hahn Souza
Fernanda Cunha Capareli Azevedo
Flavia Xavier
Gilberto de Castro Junior
Gracia Aparecida Martinez
Guareide Carelli
Guilherme Luiz Stelko Pereira
Helano Carioca Freitas
Isabel Aparecida Dimambro Capuchinho
Jorge Sabbaga
Juliana Pereira
Laryssa Almeida Borges de Barros
Laura Testa
Ligia Camera Pierrotti
Marcela Cavalcante
Marcelo Bellesso
Maria Aparecida Azevedo Koike Folgueira
Maria Del Pilar Estevez Diz
Mariangela Correa
Max Senna Mano
Olavo Feher

Pedro Enrique Dorlhiac Lhaccer


Rafael Aron Schmerling
Renata de Oliveira Costa
Rodrigo Bovolin de Medeiros
Rodrigo Santa Cruz Guindalini
Samantha Cabral Severino da Silva
Suilane Coelho Ribeiro Oliveira
Tereza Takagaki Yae
Valria Bucheri
Vanessa Petry Helena
Veridiana Pires de Camargo
Williams Fernades Barra
Yracema Liandra Matos Machado

Sumrio
I. Cncer Gastrointestinal: -----------------------------------------------------------------1. Cncer colorretal -------------------------------------------------------------------------------2. Cncer do canal anal ----------------------------------------------------------------------------3. Cncer de Estmago ----------------------------------------------------------------------------4. Cncer de Esfago ------------------------------------------------------------------------------5. Carcinoma hepatocelular ----------------------------------------------------------------------6. Carcinoma de vescula biliar e colangiocarcinoma ----------------------------------------7. Cncer do pncreas excrino ------------------------------------------------------------------

10
10
14
16
19
21
23
24

II. Cncer de Mama: --------------------------------------------------------------------------1. Mama. Tratamento adjuvante ------------------------------------------------------------------2. Mama. Tratamento neoadjuvante -------------------------------------------------------------3. Mama. Doena Metasttica ---------------------------------------------------------------------

26
27
30
31

III. Cncer de Cabea e Pescoo: --------------------------------------------------------- 34


IV. Cncer Geniturinrio: -------------------------------------------------------------------1. Cncer de Prstata / Doena Localizada -----------------------------------------------------1. Cncer de Prstata / Doena Matasttica -----------------------------------------------------2. Cncer de testculo -----------------------------------------------------------------------------3. Carcinoma de Clulas renais ------------------------------------------------------------------4. Cncer de Bexiga --------------------------------------------------------------------------------5. Carcinoma epidermide do Pnis -------------------------------------------------------------

39
39
41
42
46
48
50

V. Tumores Endcrinos: ---------------------------------------------------------------------1. Tumores neuroendcrinos ---------------------------------------------------------------------2. Tumores da tireide -----------------------------------------------------------------------------3. Carcinoma do crtex adrenal ------------------------------------------------------------------

52
52
54
57

VI. Cncer Ginecolgico: -------------------------------------------------------------------1. Cncer do colo uterino ------------------------------------------------------------------------2. Cncer da vagina --------------------------------------------------------------------------------3. Cncer da vulva ----------------------------------------------------------------------------------4. Sarcoma uterino ---------------------------------------------------------------------------------5. Cncer do endomtrio -------------------------------------------------------------------------6. Cncer de ovrio --------------------------------------------------------------------------------6.1. CA epitelial do ovrio ------------------------------------------------------------------------6.2. Tumores do cordo sexual -------------------------------------------------------------------6.3. Tumor de Clulas germinativas do ovrio ------------------------------------------------7. Neoplasia trofoblstica gestacional ------------------------------------------------------------

59
59
63
65
67
71
73
73
77
79
80

VII. Cncer de Pulmo: ---------------------------------------------------------------------- 82

1. Cncer de pulmo no - pequenas clulas ---------------------------------------------------2. Cncer de pequenas clulas do pulmo ------------------------------------------------------

82
85

VIII.Timoma / Carcinoma tmico: --------------------------------------------------------

88

IX. Mesotelioma: -------------------------------------------------------------------------------

89

X. Melanoma: -----------------------------------------------------------------------------------

91

XI.Tumores do Sistema Nervoso Central: --------------------------------------------

94

XII. Sarcomas: ---------------------------------------------------------------------------------1. Sarcomas de partes moles --------------------------------------------------------------------2. Tumor estromal gastro-intestinal (GIST) ---------------------------------------------------3. Rabdomiossarcoma -----------------------------------------------------------------------------4. Sarcomas sseos --------------------------------------------------------------------------------5. Sarcoma de Ewing/PNET ----------------------------------------------------------------------6. Tumor desmide --------------------------------------------------------------------------------7. Sarcoma de Kaposi ------------------------------------------------------------------------------

99
99
101
102
104
106
107
108

XIII. Neoplasias Hematolgicas: --------------------------------------------------------1. Linfoma no-Hodgkin --------------------------------------------------------------------------2. Linfoma de Hodgkin ----------------------------------------------------------------------------3. Mieloma mltiplo -------------------------------------------------------------------------------4. Leucemia Mielide Aguda ---------------------------------------------------------------------5. Leucemia Linfide Aguda -----------------------------------------------------------------------

111
111
146
148
152
161

;,93UROD[LDQiXVHDVHY{PLWRVUHODFLRQDGRVjTXLPLRWHUDSLD 182
XV. Complicaes relacionadas ao cncer e / ou ao tratamento: ------------1. Sndrome de veia cava superior --------------------------------------------------------------2. Carcinomatose menngea ---------------------------------------------------------------------3. Sndrome de compresso medular ----------------------------------------------------------4. Sndrome de lise tumoral ---------------------------------------------------------------------5. Hipercalcemia -----------------------------------------------------------------------------------6. Mucosite ------------------------------------------------------------------------------------------7. Diarria -------------------------------------------------------------------------------------------8. Neutropenia febril -------------------------------------------------------------------------------

185
185
187
189
191
193
196
199
201

XVl. Manejo da dor no paciente oncolgico: ----------------------------------------- 207

Obstruo intestinal
Perfurao intestinal
Tumores T4 (estdio IIB)
Histologia: anel de sinete, aneuplides ou pouco diferenciados
Invaso angio-linftica ou peri-neural
Menos de 12 linfonodos avaliados

1. Cncer Gastrointestinal
1. Cncer colorretal
CID C18(clon)
C19(juno retossigmoidiana)
C20(reto)

* Presena de instabilidade microsatlite contraindica adjuvncia(se disponvel)


1 Opo - Esquema QUASAR:

,([DPHVGH(VWDGLDPHQWR

Recomenda-se para o estadiamento dos tumores colorretais os seguintes exames:


Raio-X de trax
8OWUDVVRPRXWRPRJUDDGHDEG{PHQWRWDOHSHOYH SUHIHUtYHO
Dosagem de CEA e exames laboratoriais
Colonoscopia
Toque retal
5HVVRQkQFLDGHSHOYH RXXOWUDVVRPHQGRVFySLFR HWRPRJUDDGHWyUD[SDUDWXPRUHV

de reto

Leucovorin

50 mg

EV

Semanal

5-FU

370 mg/m2

EV

Semanal

Por 24 semanas seguidas

Lancet 370:2020-29, 2007

IV. Quimioterapia Adjuvante (Estdio III / Dukes C)


A) Opes na ausncia de disponibilidade de bomba de infuso:

II.Estadiamento

O estadiamento do cncer colorretal proposto pela AJCC (American Joint Committee


on Cancer) 2002 baseado no TNM:
TX: tumor no-avalivel
Tis: carcinoma in situ
T1:WXPRULQOWUDDVXEPXFRVD
T2:WXPRULQOWUDDPXVFXODUSUySULD
T3:WXPRULQOWUDDWpDVXEVHURVDRXJRUGXUDSHULUUHWDO
T4: tumor invade outros rgos ou estruturas e/ou perfura o peritnio visceral
N0: sem metstases linfonodais
N1: metstases em 1 a 3 linfonodos regionais
N2: metstases em 4 ou mais linfonodos regionais
M0: sem metstases a distncia
M1: metstases a distncia
Estdio

1 Opo: esquema FLOXPRGLFDGR


2[DOLSODWLQD

85 mg/m2

EV em 2h

Semanas 1, 3, 5

Leucovorin

20 mg/m2

EV bolus

Semanas 1, 2, 3, 4, 5, 6

5-FU

500 mg/m2

EV bolus

Semanas 1, 2, 3, 4, 5, 6

Intervalo de 8 semanas, 3 ciclos

JCO 25:2198-204, 2007

B) Opes com a disponibilidade de bomba de infuso:

1 Opo: esquema mFOLFOX6:


2[DOLSODWLQD

85 mg/m2

EV em 2h

D1

Leucovorin

400 mg/m2

EV em 2h

D1

5-FU

400 mg/m2

EV bolus

D1

5-FU

2400 mg/m2

EV em 46h

Iniciando no D1

Tis

N0

M0

T1-2

N0

M0

llA

T3

N0

M0

llB

T4

N0

M0

lllA

T1-2

Nl

M0

lllB

T3-4

Nl

M0

lllC

Qualquer T

N2

M0

lV

Qualquer T

Qualquer N

M1

Intervalo de 14 dias, 12 ciclos

NEJM 350:2343-51, 2004.

* Para pacientes com impossibilidade ou contra-indicao ao uso de oxaliplatina e para pacientes


acima dos 75 anos de idade considerar esquema Quasar ou monoterapia com capecitabina.

V. Quimioterapia Paliativa (Estdio IV ou recidiva)


A) Opes na ausncia de disponibilidade de bomba de infuso:

III. Quimioterapia adjuvante (Estdio II / Dukes B)


* Considerar a presena dos seguintes fatores de risco:

| 10 |

| 11 |

Esquema FLOXPRGLFDGR
2[DOLSODWLQD

85 mg/m2

EV em 2h

Semanas 1, 3, 5

Leucovorin

20 mg/m2

EV bolus

Semanas 1, 2, 3, 4, 5, 6

5-FU

500 mg/m2

EV bolus

Semanas 1, 2, 3, 4, 5, 6

Intervalo de 8 semanas

rapia de manuteno (esquema do estudo OPTIMOX). A oxaliplatina dever ser reintroduzida quando houver progresso da doena. (JCO 24:394-400, 2006 e JCO 18S:4013, 2007)
C) Opes aps a falha com oxaliplatina e irinotecano*:

Mitomicina

12 mg/m2

EV

D1

Intervalo de 6 semanas

Esquema IFLPRGLFDGR
Irinotecano

100 mg/m2

EV em 90min

D1 e D8

Leucovorin

20 mg/m2

EV bolus

D1 e D8

5-FU

500 mg/m2

EV bolus

D1 e D8

Intervalo de 21 dias

ProcASCO, 16:283a, 1997.

* Somente para pacientes com bom performance-status


Obs: Para pacientes que j utilizaram previamente o 5-FU e falharam, no h respaldo na literatura mdica para o uso de Capecitabina, devido baixa taxa de resposta (JCO 22:2078-93, 2004)

NEJM 343:905-14, 2000. / JCO 25:4779-86, 2007

D) Primeira linha em pacientes com baixo performance-status


B) Opes com a disponibilidade de bomba de infuso:

FULV semanal:

Irinotecano monodroga *:
Irinotecano

350 mg/m2

EV em 90min

Intervalo de 21 dias

D1

Leucovorin

20 mg/m2

EV

Semanal

5-FU

500 mg/m2

EV

Semanal

Lancet 352:1407-12, 1998.

JCO 14:2274-79, 1996.

* Indicado para pacientes que j utilizaram FLOX em 1 linha.


Capecitabina:
Esquema mFOLFOX6:

Capecitabina

2[DOLSODWLQD

85 mg/m2

EV em 2h

D1

Leucovorin

400 mg/m2

EV em 2h

D1

5-FU

400 mg/m2

EV bolus

D1

5-FU

2400 mg/m2

EV em 46h

Iniciando no D1

Intervalo de 14 dias

JCO 22:229-37, 2004.

Esquema FOLFIRI:

VO

D1 a D14

JCO 19:2282-292, 2001. / JCO 19:4097-106, 2001.

E)2So}HVGHTXLPLRWHUDSLDSDUDSDFLHQWHVFRPGHFLrQFLDGH'3'RXRXWUDFRQWUDLQGLFDomRSDUDXVRGHXRURSLULPLGLQDV
$GHFLrQFLDGH'3'FDUDFWHUL]DVHSRUXPDPDLRUWR[LFLGDGHFRPRXVRGDVXRURSLULPLdinas (como o 5-FU e capecitabina). Clinicamente observa-se complicaes graves ou pouco
usuais como alopecia, pneumonite, diarria intensa, mucosite e pancitopenia. Nestes casos
pode-se discutir o uso de raltitrexed.

Irinotecano

180 mg/m2

EV em 2h

D1

Leucovorin

400 mg/m2

EV em 2h

D1

5DOWLWUH[HG

5-FU

400 mg/m2

EV bolus

D1

5DOWLWUH[HG

5-FU

2400 mg/m2

EV em 46h

Iniciando no D1

Intervalo de 14 dias

1g/m2 (12/12h) / (dose total 2g/m2/dia)

Intervalo de 3 semanas

3 mg/m2

EV

A cada 3 semanas

D1
Ann Oncol 7:961-65, 1996.

JCO 22:229-37, 2004.

5DOWLWUH[HG2[DOLSODWLQD

Obs. 1: Aps a progresso de doena metasttica com o uso, em primeira linha, de um dos
esquemas baseados em oxaliplatina ou irinotecano, deve-se empregar, sempre que possvel, na
segunda linha o outro esquema no utilizado previamente, em razo de ganho de sobrevida
na literatura.

5DOWLWUH[HG

3 mg/m2

EV

2[DOLSODWLQD

100 mg/m2

EV

A cada 3 semanas

D1
Ann Oncol 13:716-20, 2002.

Obs. 2: Considerar nos esquemas baseados em oxaliplatina, a interrupo desta droga aps
12 semanas de tratamento, utilizando-se ento apenas o 5-FU e Leucovorin como quimiote-

| 12 |

D1

| 13 |

II.Estadiamento

5DOWLWUH[HG,ULQRWHFDQR
5DOWLWUH[HG

3 mg/m2

EV

D1

Irinotecano

350 mg/m2

EV

D1
Oncology 68:58-63, 2005.

VI. Quimioterapia Neo-adjuvante ou Adjuvante (Tumores


de reto Estdio II/III)
&RQFRPLWkQFLDj57FRP)8/9
Leucovorin

3 mg/m2

EV bolus

D1 a D5

5-FU

350 mg/m2

EV bolus

D1 a D5

Semanas 1 e 5 da RT

NEJM 355:1114-23, 2006.

7[ tumor primrio no pode ser avaliado


T0: sem evidencia de tumor primrio
T1: Tumor menor ou igual 2 cm na maior dimenso
T2: Tumor maior que 2 cm e menor que 5 cm na maior dimenso
T3: Tumor maior que 5 cm na maior dimenso
T4: Tumor de qualquer tamanho que invada rgos adjacentes: vagina, uretra, bexiga (envolYLPHQWRGDPXVFXODWXUDHVQFWHULDQDSDUHGHUHWDOSHOHSHULUHWDOWHFLGRVXEFXWDQHRQmRp
FODVVLFDGDFRPR7 
1[ linfonodo regional no pode ser avaliado
N1: metstase em linfonodo periretal
N2: metstases em linfonodo unilateral ilaco interno e ou inguinal
N3: metstases em linfonodo periretal e inguinal e ou iliaco interno bilateral e ou inguinal
bilateral
0[ presena de metstases no pode ser avaliada
M0: sem metstase distncia
M1: metstase distancia

&RQFRPLWkQFLDj57FRP&DSHFLWDELQD
Capecitabina

825 mg/m2 12/12h


(dose total 1650 mg/m2)

Estadio
VO

5 dias/sem, durante toda


a radioterapia

Int J Radiat Oncol Biol Phys 63:346-53, 2005. / Ann Oncol 17:246-51, 2006. / Neth J Med 66:71-6, 2008. /
Oncology 73:169-76, 2008.

* Nota: aps a cirurgia considerar QT adjuvante (vide esquemas acima) por mais 4 meses

VII. Seguimento
Recomenda-se:
Histria e exame fsico a cada 3 meses nos primeiros 2 anos e a cada 6 meses do terceiro
ao quinto ano
CEA a cada 3 meses nos primeiros 2 anos, e semestral at o quinto ano
5DLR[GHWyUD[ WRPRJUDDGHWyUD[SDUDUHWR WRPRJUDDGHDEGRPHHSHOYHVHPHVWUDO
nos primeiros 2 anos e anual nos 3 anos seguintes
Colonoscopia 1 ano aps a cirurgia inicial e a seguir a depender dos achados

1. Cncer Gastrointestinal
2. Cncer do canal anal
CID C21

,([DPHVGHHVWDGLDPHQWR
Exame fsico com palpao da regio inguinal auxiliado pelos seguintes exames comple-

mentares: raio-x ou TC de trax, TC ou RNM de abdome e pelve.


5HFRPHQGDVHSXQomRDVSLUDWLYDFRPDJXOKDQDGHOLQIRQRGRVLQJXLQDLVVXVSHLWRVSDUD
FRQUPDomRKLVWROyJLFD

Estadio l

Tis

N0

M0

Estadio 0

Tl

N0

M0

T2

N0

M0

T3

N0

M0

T1

N1

M0

T2

N1

M0

T3

N1

M0

T4

N0

M0

T4

N1

M0

qq T

N2

M0

qq T

N3

M0

qq T

qq N

M1

Estadio ll

Estadio lllA

Estadio lllB
Estadio lV

,,,4XLPLRWHUDSLDFRQFRPLWDQWHjUDGLRWHUDSLD
Esquema NIGRO PRGLFDGR
Mitomicina

15 mg/m2

EV

D1 (somente semana 1)

5-FU

1000 mg/m2

EV em 24h

D1 a D4 e D29 a D32
Concomitante a Radioterapia
JCO 15:2040-49, 1997

# Em casos especiais 5-FU pode ser substitudo por capecitabina na dose de 825mg/m2
12/12hs de segunda a sexta durante a radioterapia.

IV.Aps falha ao tratamento inicial

pT1pN2M0

II

pT2pN1M0

1 Opo - QT (combinada ou no RT)

pT2pN2M0

Cisplatina

100 mg/m2

EV

D1 a D5

5-FU

1000 mg/m2

EV em 24h

D1 a D4

Ciclos de 21dias
Cisplatina

IIIA

pT4pN0M0

Am J Clin Oncol 16:536, 1993.

100 mg/m2

EV

pT3pN1M0

IIIB

pT3pN2M0
pT4pN1-2M0

D1

IV

Ciclos de 21dia / Cancer Treat Rep 69:891, 1985.

qqTpN3M0
qqTqqNM1

V.Seguimento

pTis: carcinoma in situ

Somente biopsiar leses com sinais de crescimento.


Exame fsico e anuscopia a cada 6-8 semanas at regresso completa da leso.
Seguimento trimestral nos primeiros 2 anos, semestral do terceiro ao quinto ano. Aps

completar cinco anos , seguimento anual.


6ROLFLWDUWRPRJUDDVVHVLQWRPDVVXJHVWLYRVGHUHFLGLYDRXSURJUHVVmRFOtQLFD FRQVLGHUDU
seguir com imagens casos com linfonodos positivos inicialmente)

1. Cncer Gastrointestinal
&kQFHUGH(VW{PDJR

pT1:WXPRULQOWUDDOkPLQDSUySULDRXDVXEPXFRVD
pT2a:WXPRULQOWUDDPXVFXODUSUySULD
pT2b:WXPRULQOWUDDWpDVXEVHURVD
pT3: tumor penetra a serosa(peritnio visceral), mas no invade estruturas adjacentes
pT4: tumor invade estruturas adjacentes
pN0: sem metstases linfonodais
pN1: metstases em um a seis linfonodos regionais
pN2: metstases em sete a 15 linfonodos regionais
pN3: metstases em > 15 linfonodos regionais
M0: sem metstases a distncia
M1: metstases a distncia

III. Doena Localmente Avanada


Estgio II a IV (exceto M1)
Pacientes N0 com menos de 16 linfonodos dissecados

,([DPHVGH(VWDGLDPHQWR
Exame Fsico completo
Endoscopia Digestiva Alta com bipsia
Teste para H. Pylori
Hemograma completo, enzimas hepticas, creatinina
Marcadores tumorais(CEA,CA19.9)
5DGLRJUDDGH7yUD[
7RPRJUDDGH$EGRPHFRPFRQWUDVWHV(9H92

A) Pacientes submetidos gastrectomia:


Quimio-Radioterapia segundo o INT-0116
Fase 1
Leucovorin

20 mg/m2 bolus

D1-5

5-FU

425 mg/m2 bolus

D1-5

Fase2: RT iniciada no D28. Dose 45Gy em 5 semanas


Leucovorin 20mg/m2 bolus
5-FU 400mg/m2 bolus

II. Estadiamento
Estdio
0

pTispN0M0

D1-4 na semana 1 da RT
D1-3 na semana 5 da RT

IA

pT1pN0M0

Fase3: 1 ms aps a concluso da radioterapia:

IB

pT1pN1M0
pT2pN0M0

Leucovorin

20 mg/m2

D1-5

5-FU

425 mg/m2

D1-5 por 2 ciclos a cada 28 dias


N Engl J Med 345:725-30, 2001

B) Pacientes ainda no operados

Endoscopia digestiva alta anual


Exames laboratoriais ou de imagem de acordo com sintomatologia

Quimioterapia Neo-Adjuvante por 3 ciclos, seguida de cirurgia, seguida de 3 ciclos de


quimioterapia adjuvante

1. Cncer Gastrointestinal

ECX (ECF adaptado para evitar infusor)


Epirrubicina

50mg/m2 IV

D1

Cisplatina

60mg/m2 IV

D1

Capecitabina

625mg/m2 VO

2x/dia contnuo

&kQFHUGH(V{IDJR
CID C15

N Engl J Med 355:11, 2006 / N Engl J Med 358:36-46, 2008

,([DPHVGHHVWDGLDPHQWR
IV. Quimioterapia Paliativa

EDA
7RPRJUDDGHWyUD[HDEGRPHVXSHULRU 3(7&7VHGLVSRQtYHO
Broncoscopia (para tumores ao mesmo nvel ou acima da carina)
Exames laboratoriais (hemograma, funo heptica e renal)

1 linha CDDP / CPT-11


Cisplatina

30mg/m2

D1, D8

Irinotecano

60 mg/m2

D1, D8

A cada 3 semanas

0RGLFDGRGH&DQFHU)HE  

II.Estadiamento
Estdio

1 linha alternativa CF*


Cisplatina

80mg/m2

D1

5FU

100 mg/m2/d

D1-5, infusional em 24h

* Demanda infusor cronogramado ou internao

TisN0M0

T1N0M0

IlA

/DQFHW&DQFHU

94(3):641-6, 2002 / J Gastrointest Surg. 6(2):212-23, 2002

IIB

2 linha
3DFOLWD[HO

175mg/m2

3DFOLWD[HO

80mg/m2

cada 3 semanas
OU
semanal

III

Leucovorin

20mg/m2 bolus

D1-5

5FU

425mg/m2 bolus

D1-5

A cada 4 semanas

N Engl J Med 345:725-30, 2001

V.Seguimento de pacientes com diagnstico de adenocarcinoma gstrico


EC I a III
Histria e exame fsico a cada 6 meses

T3N0M0
T1N1M0
T2N1M0
T3N1M0
T4qqNM0

IVA

qqTqqNM1a

IVB

qqTqqNM1b

Gastric Cancer. 5(2):90-5, 2002

2a linha (alternativa)

T2N0M0

TNM:
TX: Tumor primrio no pode ser avaliado
T0: Sem evidncia de tumor primrio
Tis: Carcinoma in situ
T1: Tumor invade a lmina prpria ou submucosa
T2: Tumor invade a muscular prpria
T3: Tumor invade a adventcia
T4: Tumor invade estruturas adjacentes
NX: Linfonodos regionais no podem ser avaliados
N1: Ausncia de linfonodos regionais
N2: Metstases em linfonodos regionais
MX: Metstases distncia no podem ser avaliadas
M0: Ausncia de metstases distncia
M1: Metstase distncia

7XPRUHVGRHV{IDJRLQIHULRU
M1a: Metstases em linfonodos do tronco celaco
M1b: Outras metstases distncia

1 linha

7XPRUHVGRHV{IDJRPpGLR
M1a: no aplicvel
M1b: Outras metstases distncia

Cisplatina

30 mg/m2

Irinotecano

60 mg/m2

D1, D8 - cada 3 semanas


D1, D8 - cada 3 semanas
0RGLFDGRGH-&OLQ2QFRO

1 linha (alternativa)*

7XPRUHVGRHV{IDJRVXSHULRU
M1a: Metstases em linfonodos cervicais
M1b: Outras metstases distncia

Cisplatina

80-100mg/m2

D1

5-FU

1000mg/m2/d

D1-5, infusional em 24h

*Demanda infusor cronogramado ou internao

Eur J Surg 164(11):849-57, 1998

2 linha

III.Tratamento

Cisplatina

(V{IDJR6XSHULRU FHUYLFDO (VWiJLRV,D,9$


Quimio e Radioterapia Concomitantes

80mg/m2

semanal
-1DWO&DQFHU,QVW  

(V{IDJR0pGLR(VWiJLRV,,H,,,
Quimio e Radioterapia Concomitantes

V.Seguimento de pacientes tratados com inteno curativa

'HQLWLYD pacientes inoperveis


Neoadjuvante pacientes operveis

Consulta e exame fsico a cada 3 meses nos primeiros dois anos


Solicitao de exames dirigidos pelos sintomas
7RPRJUDDVGHWyUD[HDEGRPH('$DQXDOPHQWH

(V{IDJR'LVWDO(VWiJLRV,,H,,,
(tumores da transio esfago-gstrica, vide Cncer de Estmago)
Quimio e Radioterapia Concomitantes
'HQLWLYD pacientes inoperveis
Neoadjuvante pacientes operveis

1. Cncer Gastrointestinal
5. Carcinoma hepatocelular

Quimio-Radioterapia

CID C22

Cisplatina

30mg/m2 IV

Semanal (Semanas 1 a 6)

3DFOLWD[HO

60mg/m2 IV

Semanal (Semanas 1 a 6)
J Clin Oncol 22(1):45-52, 2004

1 linha (alternativa)*
Cisplatina

75 mg/m2

D1

5-FU

1000mg/m2/d

D1-4, infusional em 24h

Repetir os ciclos nas Semanas 1, 5, 8 e 11


* Demanda infusor ou internao / Jama 281(17):1623-7,1999

,([DPHVGHHVWDGLDPHQWR
Hemograma, funo heptica e renal
Alfa-fetoprotena
Sorologias para hepatite B e C
TC e RM de abdome/US de abdome

Observaes: Pacientes com leses com alta suspeita clnica para carcinoma hepatocelular, candidatos a resseco cirrgica podem ser encaminhados a cirugia sem bipsia
pr-operatria.

* Pacientes sem performance para QT/RT devem ser tratados com Radioterapia exclusiva

Em pacientes cirrticos com massa heptica suspeita para CA hepatocelular, maior que 2
FPDOIDIHWRSURWHtQDVXSHULRUDQJPOHLPDJHPUDGLROyJLFDFRPSDWtYHOSRGHPVHU
tratados sem bipsia.

IV.Quimioterapia Paliativa

II.Estadiamento (conforme AJCC,2002)

| 20 |

| 21 |

7[Tumor primrio no avalivel


T0: sem evidncia de tumor primrio
T1: tumor solitrio sem invaso vascular
T2: tumor solitrio com invaso vascular ou mltiplos tumores nenhum maior que 5 cm
T3: mltiplos tumores maiores que 5 cm ou tumor envolvendo ramo principal da veia
porta ou veia heptica
T4: tumor com invaso direta de rgos adjacentes ou perfurao do peritnio visceral
1[ Linfonodos regionais no avaliados
N0: ausncia de metstase em linfonodos regionais
N1: presena de metstase em linfonodos regionais
0[ metstases a distncia no avaliadas
M1: metstases a distncia

1. Cncer Gastrointestinal
6. Carcinoma de vescula biliar e Colangiocarcinoma
CID C23(vescula biliar)
C24(vias biliares extra-hepticas)

,([DPHVSDUDHVWDGLDPHQWR

T1N0M0

Exame fsico
5DGLRJUDDGHWyUD[
Enzimas canaliculares, funo e enzimas hepticas, Ca 19-9 e CEA
7RPRJUDDVGHDEGRPHHSHOYHRXSUHIHUHQFLDOPHQWHUHVVRQkQFLDGHDEG{PHFRP

II

T2N0M0

estudo das vias biliares

IllA

T3N0M0

Estdio

IIlB

T4N1M0

IIIC

qqTN1M0

IV

qqTqqNM1

III.Tratamento em Estadios iniciais:

Cirurgia / Radioablao/ Transplante

IV.Tratamento em Estadios intermedirios:


Quimioembolizao

II. Estadiamento

7[ Tumor primrio no avalivel


T0: sem evidncia de tumor primrio
T1a:WXPRULQOWUDDOkPLQDSUySULD
T1b:7XPRULQOWUDDFDPDGDPXVFXODU
T2:7XPRULQOWUDDWpDVHURVDVHPXOWUDSDVVDOD
T3: Tumor perfura a serosa e ou rgo adjacente
T4: Tumor invade veia porta principal ou artria heptica ou invade mltiplos
orgos extra hepticos Nx: Linfonodos regionais no avaliados
N0: ausncia de metstase em linfonodos regionais
N1: presena de metstase em linfonodos regionais
0[ metstases a distncia no avaliadas
M1: metstases a distncia

V.Tratamento em Estdios avanados

Estdio

(Doena extra-heptica ou no candidatos a tratamento cirrgico, trombose de veia porta):


1 Opo: Sorafenibe 400 mg vo 12/12 h (Pacientes com Child-Pugh A,
ECOG 0 ou 1).
2 Opo: 'R[RUUXELFLQDPJP a cada 3 semanas
(J Natl Cancer Inst 97:1532,2005)

* Importante: correo da dose em pacientes ictricos.


* Sem indicao de teraputica neoadjuvante e adjuvante.

quinto ano.
Alfafetoprotena a cada 3 meses nos primeiros 3 anos, e semestral at o quinto ano.
5DLR[RXWRPRJUDDGHWyUD[WRPRJUDDDEG{PHQVHPHVWUDOQRVSULPHLURVDQRVH
anual nos 3 anos seguintes.
&LQWLORJUDDyVVHDVHVLQWRPDVRVWHRDUWLFXODUHV

| 22 |

TisN0M0
T1N0M0

IB

T2N0M0

IIA

T3N0M0

IIB

T1-T3N1M0

VI.Seguimento (doena no metasttico)


Exame clnico a cada 3 meses nos primeiros 3 anos e a cada 6 meses do terceiro ao

0
IA

Ill

T4qqNM0

IV

qqTqqNM1

II.Tratamento:
&DQGLGDWRVjFLUXUJLDFXUDWLYD
Cirurgia
Adjuvncia
O tratamento adjuvante, embora controverso, indicado para pacientes com tumores pe-

| 23 |

riampulares com fatores de alto risco de recidiva como linfonodos positivos ou resseco R1:
Radioterapia com
5-FU 350 mg/m2 + leucovorin 20mg/m2 / D1 a D5 na primeira e ltima semana
da radioterapia
( Int J Radiot Oncol Biol Phys 2007 68:178-182)

1mRFDQGLGDWRVjFLUXUJLD
Quimioterapia paliativa com:
1 Linha
Gencitabina 1g/m2 D1 e D8 + Cisplatina 30mg/m2 D1 e D8/21d ou
Monoterapia com gencitabina em casos selecionados
'LJ'LV6FL)HE    -&OLQ2QFROVVXSSODEVWU

2 Linha:
5-FU 425mg/m2 + leucovorin 20mg/m2 / 1x/semana

III. Seguimento

7[ Tumor primrio no avalivel


T0: sem evidncia de tumor primrio
T1: Tumor limitado ao pncreas menor ou igual a 2cm
T2: Tumor limitado ao pncreas maior que 2cm
T3: Tumor se estende diretamente a duodeno, ducto biliar ou tecido peri-pancretico.
T4: Tumor se estende diretamente a qualquer 1 dos seguintes: estmago, bao, clon,
grandes vasos adjacentes.
1[ sem avaliao
N0: ausncia de metstase em linfonodos regionais
N1: presena de metstase em linfonodos regionais
M0: Ausncia de metstases a distncia
M1: Presena de metstases a distncia

III.Tratamento
&DQGLGDWRVjFLUXUJLDFXUDWLYD
Cirurgia
Quimioterapia adjuvante
(pacientes com ECOG 0-1 e com at no mximo 6 semanas aps cirurgia):
1 linha (alternativa)*

Os pacientes tratados com inteno curativa so seguidos com exame clnico e laborat-

rial a cada 3 meses nos dois primeiros anos e semestralmente at o quinto ano.
TC de abdome 6 meses aps cirurgia e anual at o quinto ano

Leucovorin

20mg/m2 bolus

D1-5

5-FU

425mg/m2 bolus

D1-5

A cada 4 semanas

1. Cncer Gastrointestinal
&DUFLQRPDGRSkQFUHDVH[yFULQR

-&2VVXSSODEVWU/%$

1a opo
Gencitabina 1g/m2 D1, D8 e D15 /28 dias por 6 ciclos.
(JAMA 297:267,2007)

1mRFDQGLGDWRVjFLUXUJLD
Quimioterapia paliativa com:

CID C25

1 Linha
Gencitabina

,([DPHVSDUDHVWDGLDPHQWR
Exame fsico
5DGLRJUDDGHWyUD[
7RPRJUDDVGHDEGRPHHSHOYH
CA19-9 e CEA
Hemograma, funo heptica e renal

1g/m2

2 Linha:
5-FU 425mg/m2

O exame anatomopatolgico imprescindvel para o diagnstico, uma vez que cerca de


10% dos casos so de outras histologias que no adenocarcinomas, com prognstico e
tratamento diferenciados

D1,D8 e D15

a cada 28 dias.

leucovorin 20mg/m2

IV.Seguimento
Os pacientes tratados com inteno curativa so seguidos com exame fsico e laboratrio
(incluindo Ca 19-9 nos paciente com elevao prvia do marcador):
a cada 3 meses nos primeiros dois anos.
semestralmente at o quinto ano.

II. Estadiamento

| 24 |

1x/semana

| 25 |

N3a metstase para linfonodos da cadeia infraclavicular ipsilateral, com ou


sem envolvimento da cadeia axilar
N3b metstase clinicamente aparente na cadeia mamria interna ipsilateral, na presena
de metstase clinicamente positiva na regio axilar
N3c metstase na cadeia supraclavicular ipsilateral, com ou sem envolvimento das cadeias
axilar ou mamria interna
M0 ausncia de metstase
M1 presena de metstase a distncia

1l. Cncer de Mama


CID C50

,([DPHVGHHVWDGLDPHQWR
Cirurgia primeiro:
Estdio clnico I: Raio-x de Trax , hemograma, creatinina, transaminases e bilirrubina

srica
(VWDGLRFOtQLFR,,5DLR[GH7RUD[XOWUDVRPGHDEGRPHVXSHULRUFLQWLORJUDDyVVHD
hemograma, creatinina, transaminases e bilirrubina srica
(VWDGLRFOtQLFR,,,7RPRJUDDGH7RUD[$EGRPHVXSHULRU&LQWLORJUDDyVVHDKHPRJUDPD
creatinina, transaminases e bilirrubina srica

l1. Cncer de Mama


1.Tratamento adjuvante

Neoadjuvncia
7RPRJUDDGHWyUD[DEGRPHHSHOYHFLQWLORJUDDyVVHDKHPRJUDPDFUHDWLQLQDWUDQVDPL-

Triplo Negativo (TN)

nases e bilirrubina srica

DEFINIO
1.$XVrQFLDGHVXSHUH[SUHVVmRRXDPSOLFDomRGRJHQH+(5
2. RE <10%
3. RPg <10%

II.Estadiamento
Estdio

Tis

N0

M0

l
IIA
IIB

T1

N0

M0

T0-1

N1

M0

T2

N0

M0

T2

N1

M0

T3

N0

M0

T0-2

N2

M0

T3

N1-2

M0

IIIB

T4

N0-2

M0

IIIC

qualquer T

N3

M0

IV

qualquer T

qualquer N

M1

IIlA

Tis: tumor in situ

TRATAMENTO ADJUVANTE

Indicao
/)1QHJDWLYR77%
LFN positivo: todos
Quimioterapia
LN- (T1b): FAC x 6 (CMF x6 ou TC x4 podem ser considerados)
LN+ ou LN- ( partir de T1c): AC - T (esquema Geicam adaptado)
Protocolos (p/ CMF e TC, ver em hormnio-responsivo)
FAC:
Medicamento

Dose

5-Fluorouracil

500 mg/m

'R[RUUXELFLQD

50 mg/m

Ciclofosfamida

500 mg/m

Repetir a cada 21 dias x 6 ciclos

T1 2cm
(T1mic FP7D!FPHFP7E!FPHFP7F!FPH2cm)
T2 > 2cm e 5cm
T3 > 5cm
T4 qualquer tamanho,com extenso direta para a parede torcica(T4a),pele(T4b) ou
DPEDV 7F  7G FkQFHULQDPDWyULR
N1 metstase para linfonodos axilares ipsilaterais mveis
N2aPHWiVWDVHSDUDOLQIRQRGRVD[LODUHVLSVLODWHUDLV[RVHQWUHHOHVRXDRXWUDVHVWUXWXUDV
N2b metstase clinicamente aparente apenas em linfonodos da cadeia mamria interna
ipsilateral, na ausncia de metstase clinicamente aparente na cadeia axilar

| 26 |

AC-T
Medicamento

Dose

'R[RUUXELFLQD

60 mg/m

Ciclofosfamida

600 mg/m

Repetir a cada 21 dias x 4 ciclos

3DFOLWD[HO

600 mg/m

* Administrar semanalmente por 8 semanas consecutivas

| 27 |

Her-2 positivo (HER-2)

DEFINIO

5(LQGHSHQGHQWHGRVWDWXVGR53J

DEFINIO

6XSHUH[SUHVVmR ,+4 RXDPSOLFDomR ),6+!FySLDV>UHODomRFySLDVJHQH+HU


&(3@ RX ! FySLDV >QD DXVrQFLD GH FRUUHomR SDUD R Q~PHUR GH FySLDV GR &(3@  GR
gene HER-21

TRATAMENTO ADJUVANTE

TRATAMENTO ADJUVANTE

PR-MENOPAUSA

Indicao
1./)1QHJDWLYR77E
2. LFN positivo: todos

Determinar o status da menopausa antes de decidir o tratamento.

HORMONIOTERAPIA(HT) ISOLADA

Tratamento recomendado:
Trastuzumabe + Quimioterapia (o trastuzumabe ser acrescentado quimioterapia somente
SDUDWXPRUHV7FFRQIRUPHFULWpULRVLQWHUQDFLRQDOPHQWHDFHLWRV3DFLHQWHVFRPWXPRUHV
T1bN0 podem receber quimioterapia somente: FAC x6 (na ausncia de contra-indicaes)
ou, alternativamente, TC x4 ou CMF x6
(VTXHPDVGHTXLPLRWHUDSLDWUDVWX]XPDEH
AC - TH
TCH= 6 ciclos de Trastuzumabe + 6 ciclos Carboplatina + Docetaxel (Opo para pacientes com risco cardiovascular aumentado e/ou outra contra-indicao absoluta ou relativa
ao uso de antracclicos)

QT seguida de HT
LFN NEGATIVO se:
- Idade < 40 anos
- T entre 1 e 2 cm com GH 2 ou 3
ou Ki-67 >15% e/ou IVL +
- T > 2 cm
- RE positivo e RPg negativo
Todos LFN POSITIVO

LFN NEGATIVO e todos abaixo:


,GDGHDQRV
- T entre 1 e 2 cm com GH I
- RE e RPg positivos
- Sem invaso angio-linftica (IVL)
Protocolos:
Hormonioterapia
Medicamento

Dose

Protocolos

7DPR[LIHQR

AC - TH

$GPLQLVWUDUSRUDQRV5HVXOWDGRVGHHVWXGRVFOtQLFRVQRVSUy[LPRVDQRVGHQLUmRDGXUDomR
adequada.

Medicamento

Dose

20 mg/dia

'R[RUUXELFLQD

60 mg/m

Ciclofosfamida

600 mg/m

Quimioterapia
LN-: FAC, como acima (alternativa: CMF x6 ou TC x4)
LN+: AC - T (esquema Geicam adaptado, como em triplo negativo)

3DFOLWD[HO

80 mg/m *

PS-MENOPAUSA

Trastuzumabe

8 mg/kg - SEGUIDO DE 6 MG/KG CADA 2

Repetir a cada 21 dias x 4 ciclos

VHPDQDOPHQWHSRUVHPDQDV 1mRKiGDGRVGHVHJXUDQoDHHFiFLDGRHVTXHPD
*(,&$0 PJP[ HPDVVRFLDomRFRPRWUDVWX]XPDEH
SRUDQRLQLFLDUMXQWRFRPDSULPHLUDLQIXVmRGHSDFOLWD[HO

TCH
Medicamento

Dose

Trastuzumabe

8 mg/kg(1 dose dose de ataque)


6 mg/kg cada 21 dias (doses subsequentes)

Carboplatina

AUC de 6,0

'RFHWD[HO

75 mg/m

$GPLQLVWUDUFRQFRPLWDQWHDFDGDGLDV[FLFORV
Trastuzumab com durao de 1 ano

+RUP{QLR5HVSRQVLYR 5+

| 28 |

HORMONIOTERAPIA(HT) ISOLADA
LFN NEGATIVO e:
- GH 1 e 2
- RE positivo

QT seguida de HT
LFN NEGATIVO se:
- T > 1 cm e GH 3 OU KI-67>15%
LFN POSITIVO se:
- GH 2 ou 3
- RE positivo e RPg negativo
- Ki-67>15%

LFN POSITIVO e:
- GH 1
- RE e RPg positivos
Protocolo
Hormonioterapia
Medicamento

Dose

7DPR[LIHQRSRUDQRV

20 mg/dia

Inibidor da Aromatase
(aps TAM por 2-3 anos)

Anastrozol (1 mg/d) ou Exemestano (25 mg/d)


ou Letrozol (2,5 mg/d)

| 29 |

Quimioterapia

LN-: FAC, como acima (alternativa: CMF x6 ou TC x4)


LN+: AC - T (esquema GEICAM adaptado, como em triplo negativo)
CMF D1 & D8 (esquema cada 21 dias pode ser considerado, em casos excepcionais)
Medicamento

Dose

5-Fluorouracil

600 mg/m D1 & D8

0HWKRWUH[DWH

40 mg/m D1 & D8

Ciclofosfamida

600 mg/m2 D1 & D8

Repetir a cada 28 dias x 6 ciclos

Hormonioterapia
Sempre em adjuvncia, como protocolo adjuvncia.
Ocasionalmente, uma HT com IA pode ser considerada na neoadjuvncia, em pacientes
com tumores ricos em receptores hormonais e no candidatas cirurgia. A durao ideal
desconhecida, variando de 4 12 meses em funo de diversos fatores.

1l. Cncer de Mama


3.Tratamento metasttico
EC IV ou recidiva de doena

TC &RQVLGHUDUXVRGHIDWRUGHFUHVFLPHQWRRXDQWLELRWLFRWHUDSLDFRPRSUROD[LDSULPiria da neutropenia febril)


Medicamento

Dose

'RFHWD[HO

75 mg/m D1

Ciclofosfamida

600 mg/m2 D1

Repetir a cada 21 dias x 6 ciclos

1l. Cncer de Mama


2.Tratamento neoadjuvante
6HJXLUSURWRFRORHVSHFtFRGHVHQYROYLGRHPFRQMXQWRFRPDPDVWRORJLD3DUWLFXODUPHQWH
todos os casos devem ser discutidos com a mastologia antes do incio do tratamento.
Quimioterapia
3RUGHQLomRWRGRVHVWHVSDFLHQWHVWrPGRHQoDORFRUHJLRQDOPHQWHDYDQoDGDGHYHQGR
ser considerados alto risco. Alm disso, a resposta ao tratamento particularmente crtica
neste contexto. O tratamento recomendado AC - T (esquema GEICAM adaptado, como
acima) para todas as pacientes Her2 negativas.
Para as pacientes Her2 positivas, caso o uso de trastuzumabe venha a ser aprovado na
neo-adjuvncia, esta possibilidade deve ser considerada. Caso no esteja disponvel na neoadjuvncia pode-se considerar as seguintes opes:
Cirurgia imediata seguido de QT-trastuzumabe (ver adjuvncia)
AC x4 (ocasionalmente X6, se doena ainda inopervel aps 4 ciclos), seguido de cirurgia
e paclitaxel x12 + trastuzumabe por 1 ano no ps-operatrio
Para eventuais pacientes que j tenham recebido toda a QT (antraciclinas e taxanos)
no pr-operatrio, administrar trastuzumabe monoterapia por 1 ano conforme esquema
HERA
Radioterapia
3RUGHQLomRSDUDWRGDVDVSDFLHQWHVDSyVWUDWDPHQWRQHRDGMXYDQWH

| 30 |

7XPRUKRUP{QLRUHVSRQVLYR Hormonioterapia
3UpPHQRSDXVD
A1. Pacientes no expostas previamente terapia anti-estrognica ou tratadas
h mais de 1 ano, sem crise visceral:
ablao ovariana* + tamoxifeno (TAM) 20 mg/dia, at progresso de doena**
ou tamoxifeno monoterapia
 RPpWRGRSUHIHULGR PDLVFXVWRHFD] QRQRVVRPHLRpDRRIRUHFWRPLD 

cirrgica
** Meta-anlise: combinao TAM e supresso ovariana (anlogo LHRH, aLHRH) reduz em
22% no risco de morte e em 30% o risco de progresso em relao a aLHRH
(Klijn et al., JCO 19: 343, 2001)

A2. Pacientes com terapia prvia com TAM h menos de 1 ano ou como primeira linha p/ doena metasttica:
DEODomRRYDULDQD RXDEODomRRYDULDQD ,QLELGRUHVSHFtFRGDDURPDWDVH DQDVWUR]RO
1mg/d ou letrozol 2,5mg/d ou exemestano 25mg/d)
RPpWRGRSUHIHULGR PDLVFXVWRHFD] QRQRVVRPHLRpDRRIRUHFWRPLDFLU~UJLFD
Ps-menopausa
B1. Pacientes no expostas previamente a terapia anti-estrognica ou tratadas
h mais de 1 ano:
,QLELGRUHVSHFtFR (no esteroidal) da aromatase (IA):
Anastrozol 1mg: 1cp/dia, at progresso
Letrozol 2,5mg: 1cp/dia, at progresso ou
TAM 20 mg/dia, at progresso:
B2. Pacientes com terapia prvia com TAM h menos de 1 ano:
Inibidor de aromatase (no esteroidal):
Anastrozol 1mg: 1cp/dia, at progresso
Letrozol 2,5mg: 1cp/dia, at progresso
B3. Pacientes com terapia prvia com IA:
7DPR[LIHQR (1 escolha) ou

| 31 |

Inativador esteroidal da aromatase


([HPHVWDQR 25 mg: 1cp VO 1x/dia, at progresso

B4. Aps progresso de doena com os tratamentos prvios:


([HPHVWDQR
Megestrol acetato 40mg VO 4 vezes ao dia E
Fulvestranto 250mg IM a cada ms**
DOWHUQDWLYDPDLVFXVWRHFD]
** exige discusso com o grupo e posteriormente aprovao do diretor clnico
Quimioterapia segundo indicaes para tumor hormnio resistente
7XPRUKRUP{QLRUHVLVWHQWHRXGRHQoDUDSLGDPHQWHSURJUHVVLYR
ou Doena visceral predominante
Quimioterapia
A quimioterapia paliativa aumenta a sobrevida de pacientes com doena metasttica.
No h evidncias claras se a quimioterapia combinada superior mono-quimioterapia
(droga nica) seqencial.
O tratamento contnuo no se associa a benefcio claro e a opo de 6 ciclos seguido
de interrupo e reincio somente quando houver progresso da doena, aceitvel (Muss
et al., N Engl J Med 325:1342, 1991).
Se no se observar resposta a trs diferentes esquemas, oferecer terapia de suporte.
Deve-se considerar a extenso da doena, a presena de co-morbidades, a qualidade de
vida das pacientes ao se indicar o tratamento.

Quimioterapia I

A) Pacientes no tratados previamente com antraciclina e sem contra-indicaes para seu

uso (cardiopatia)

'R[RUXELFLQD

60 mg/m2 EV

Ciclofosfamida

600 mg/m2 EV a cada 3 semanas, mximo de 6 ciclos


(dose mxima doxorrubicina: 360 mg/m2)

$ $QWUDFLFOLQDH7D[DQR
Pode ser opo para pacientes com doena visceral rapidamente progressiva, quando o
objetivo resposta mxima, pois paciente pode ter deteriorao do quadro clnico, que no
permita tratamento adicional.
60 mg/m2 EV

3DFOLWD[HO

175 mg/m2 EV 3h

600mg/m2

EV

d1

0HWRWUH[DWH

40mg/m2

EV

d1

5-Fluorouracil

600mg/m2

EV

d1

Intervalo 21 dias, mximo de 6 ciclos

& 3DFLHQWHVSUHYLDPHQWHH[SRVWRVDDQWUDFLFOLQD
3DFOLWD[HO 175mg/m2 EV 3hs D1 / Intervalo 21 dias, mximo de 6 ciclos ou
3DFOLWD[HOVHPDQDO 80 mg/m2 D1+d8+d15 q28d ou
'RFHWD[HO 75 mg/m2 cada 21 dias, mximo de 6 ciclos
Paclitaxel (175 mg/m2) + gencitabina (1250 mg/m2 D1+D8) cada 21 dias : alternativa

para pacientes com doena visceral rapidamente progressiva e/ou altamente sintomtica
Carboplatina (AUC=2) + paclitaxel (80mg/m2) ambos D1+D8+D15 cada 28 dias: alternativa
para pacientes com doena visceral rapidamente progressiva e/ou altamente sintomtica
* no h provas que seja mais ativo que o paclitaxel semanal ou docetaxel monoterapia,
ambos j mostrados superiores ao paclitaxel q3s que foi o comparador neste estudo de
fase III, devendo o uso deste esquema ser considerado excepcional.

Quimioterapia II
A) Progresso de doena aps antraciclina
Taxano, como acima
% 3URJUHVVmRGHGRHQoDDSyVWD[DQRHPSDFLHQWHVSUHYLDPHQWHVH[SRVWRVD
antraciclina
1. Capecitabina 2,5g/m2/d VO (2,0g/m2/d, em pacientes >65a ou com nefropatia) dividido 12/12h, D1 a D14, Intervalo 21d ou
2. Vinorelbina 20-25mg/m2 EV D1 e D8, cada 21 dias
Pode ser indicada para pacientes idosas (>60a) e/ou na presena de comorbidades

A1) AC

'R[RUXELFLQD

Ciclofosfamida

' 3URJUHVVmRDSyVRXPDLVHVTXHPDVGHTXLPLRWHUDSLD HERPHVWDGRJHUDO


D1
&LVSODWLQD9,125(/%,1$ 
Cisplatina 30 mg/m2 D1 e D8
Vinorelbina 25 mg/m2 D1 e D8, a cada 21 dias ou
&LVSODWLQD*HPFLWDELQD
Cisplatina 30 mg/m2 D1 e D8
Gemcitabina 750 mg/m2 D1 e D8, a cada 21 dias ou
Cisplatina monoterapia 75 mg/m2 cada 21 dias

cada 3 semanas, mximo de 6 ciclos

* 1 opo, por ser mais custo-efetivo


% 3DFLHQWHVFRPFRQWUDLQGLFDomRSDUDXVRGHDQWUDFLFOLQDRXEDL[R.36
CMF(EV)
5HFLGLYDGHGRHQoD+(5 
Priorizar estudo clnico.

| 32 |

| 33 |

Caso contrrio seguir protocolo acima(doena metasttica).


Agentes direcionados contra o HER-2, tais como trastuzumabe ou lapatinibe podem ser
adicionados, se estiverem disponveis

II.Estadiamento
Tumor primrio

T1
Doena sistmica ssea
Pamidronato 90 mg EV em 2 horas ou zoledronato* 4mg EV em 15 minutos, a cada 28 dias
* avaliar funo renal antes de cada ciclo, e adaptar dose em funo do clearance de creatinina se necessrio
Observaes
Raramente h indicao de continuidade do tratamento com inibidor da ostelise aps 2
anos de tratamento ininterrupto
Aps 6 meses de tratamento, j possvel questionar-se quanto necessidade da continuidade (levando-se tambm em conta efeitos adversos recentemente descritos, dosecumulativa dependentes, como osteonecrose de mandbula)
Aps 6 meses, considerar tambm reduo ou espaamento das doses (ex. cada 6 ou 8
semanas)

IV.Seguimento

Cavidade oral

Orofaringe

FP

Nasofaringe

Tumor
restrito
nasofaringe

([DPHFOtQLFRHPDPRJUDDDQXDO
Exames laboratoriais e de imagem conforme necessidade

9,QGLFDo}HVGHH[DPHVHVSHFLDLV

ECOCARDIOGRAMA TRANSTORCICO
Sempre: antes do Trastuzumabe, assim como 12 e 24 semanas aps inicio do tratamento
Antes de antraciclinas : somente se fatores de risco cardio-vasculares e/ou sintomas

suspeitos
Densitometria ssea: solicitar antes de iniciar tratamento adjuvante com inibidor da
aromatase, e posteriormente cada 2 anos ou conforme indicado
Ultra-som trans-vaginal, para pacientes usando tamoxifeno: no est indicada. Fazer somente exame ginecolgico de rotina (conforme recomendao do NCCN).

l1l. Cncer de Cabea e Pescoo

7RPRJUDDFRPSXWDGRUL]DGDGHIDFHHSHVFRoR RX501 510pHVVHQFLDO

no caso de tumores da nasofaringe


([DPHEURVFySLFRQDVRIDULQJRODULQJRVFRSLDH('$
5DGLRJUDDRXWRPRJUDDGHWyUD[
/DERUDWyULRLQFOXLUSHUOWLUHRLGLDQR

| 34 |

!FPFP

> 4 cm

!FPFP

> 4 cm

T4a

T4b

Invaso
Invaso espao
musculatura mastigatrio, lminas
profunda da
pterigideas, base
lngua, seio
crnio, cartida
maxilar, pele
interna
Invaso laringe, musculatura profunda
da lngua, m.
pterigideo
medial, palato
duro, mandbula

Invaso m. pterigideo lateral,


lminas pterigideas,
nasofaringe (paredes
laterias), base de crnio, cartida interna

T2a: invaso orofaringe ou cavidade


Invaso ssea Invaso do crnio, nervos cranianos,
nasal sem extenso
ou de seios
fossa infratemporal, hipofaringe,
parafarngea
paranasais
rbita, espao mastigatrio
T2b: extenso parafarngea

Fixao CCVV
Tumor
ou extenso Invaso franca
FRQQDGRD Invaso estruturas para ps-crici- da cartilagem Invaso do espao
este substio, adjacentes ou da
de, paraglote, tireide ou pr-vertebral, mediasmobilidade
JORWHVHP[DomR pr-epiglote ou dos tecidos tino ou envolvimento
normal
laringe
eroso mnima extra-larncarotdeo
CCVV
da cartilagem
geos
tireide
7XPRUpFRQnado laringe,
Invaso franca
FRP[DomR
da cartilagem Invaso do espao
das CCVV
tireide ou pr-vertebral, mediasou invaso
dos tecidos tino ou envolvimento
paragltica ou
extra-larncarotdeo
eroso mnima
geos
da cartilagem
tireide

Laringe
Glote

Tumor
restrito a
Extenso supra- ou
uma (T1a) ou
sub-gltica ou alteduas (T1b)
rao da mobilidade
CCVV, com
das CCVV
mobilidade
conservada

Laringe
Subglote

Tumor
FRQQDGRj
7XPRUpFRQExtenso para CCVV
subglote com
nado laringe, Invaso ou destruio da cartilagem
com mobilidade normobilidade
FRP[DomR
tireide
mal ou diminuda
normal das
das CCVV
CCVV

CID10

,([DPHVQHFHVViULRVSDUDRWUDWDPHQWR

T3

Invaso cartiTumor em mais de


lagem cricide,
Tumor
uma rea da hipocartilagem ti- Invaso do espao
restrito a
> 4 cm, com
faringe, ou j com
reide, hiide, pr-vertebral, mediasHipofaringe uma rea da
[DomRKHPLODextenso local, sem
glndula tirei- tino ou envolvimento
hipofaringe e
ringe
[DomRKHPLODULQJH!
de, esfago,
carotdeo
FP
FPFP
partes moles
do pescoo

Laringe
Supraglote

C01 cavidade oral


C10 - orofaringe
C11 nasofaringe
C12 hipofaringe
C32 laringe

FP

T2

| 35 |

CCVV: cordas vocais


Linfonodos cervicais (loco-regionais)
N0: ausncia de comprometimento linfonodal
N1

N2a

(VTXHPD
Radioterapia radical 70 Gy stio primrio e 50 Gy em drenagens, divididos em 7 semanas, 2
Gy/dia, 5 vezes/semana
N2b

N2c

N3

Cavidade oral,
Linfonodo
Mltiplos
Linfonodos
Linfonodo ipsilateral
Linfonodos >
orofaringe, hipofaipsilateral > 3 linfonodos ipsila- ELODWHUDLV
FP
6 cm
ringe, laringe
HFP
WHUDLVFP
6 cm

Nasofaringe

Linfonodos unilaterais ou na linha


/LQIRQRGRVELODWHUDLVFPDFLPDGDIRVVD
PpGLDFPDFLPD
supraclavicular
da fossa supraclavicular

N3a: linfonodos
> 6 cm
N3b: acometimento da fossa
supraclavicular

$GHOVWHLQHWDO-&OLQ2QFRO  3LJQRQHWDO/DQFHW  %RXUKLVHW


DO-&OLQ2QFRO 6XSSO 

II. Em pacientes com performance status reduzido (ECOG-OS superior a 1) ou


FRPGLVIXQo}HVRUJkQLFDVTXHFRQWUDLQGLTXHPDTXLPLRWHUDSLDRHPSUHJRGD
UDGLRWHUDSLDLVRODGDpMXVWLFiYHO
%RXUKLVHWDO/DQFHW

,,,1RVSDFLHQWHVFRPJUDQGHVYROXPHVWXPRUDLVHGLFXOGDGHVSDUDLQLFLDUD
UDGLRWHUDSLDRHPSUHJRGHTXLPLRWHUDSLDQHRDGMXYDQWHpDFHLWiYHO

0HWiVWDVHVjGLVWkQFLD
M0: ausncia de metstases a distncia
M1: presena de metstases a distncia

(VTXHPD
3DFOLWD[HO 175 mg/m2 d1
Cisplatina 75 mg/m2 d1
cada 3 semanas


Estadiamento TNM
Cavidade oral, orofaringe, hipofaringe, laringe:
M0:
N0

Quimioterapia:
cisplatina 100 mg/m2 IV dias 1, 22 e 43

T1

T2

T3

T4a

T4b

II

III

IVa

IVb

N1

III

III

III

IVa

IVb

N2

IV

IV

IVa

IVa

IVb

N3

Ivb

IVb

IVb

IVb

IVb

M1: IVc
Nasofaringe:
M0:
T1

T2a

T2b

T3

T4

N0

IIA

IIB

III

IVA

N1

IIB

IIB

IIB

III

IVA

N2

III

III

III

III

IVA

N3

IVB

IVb

IVB

IVB

IVB

M1: IVC

*LEVRQ0.HWDO-&OLQ2QFRO  

Doena metasttica, ou recidivada, no passvel de tratamento com inteno curativa

I. QUIMIOTERAPIA
(VTXHPDV
5-FU 1000 mg/m2/d d1-d4
Cisplatina 75 mg/m2 d1
cada 3 semanas


)RUDVWLHUHHWDO-&OLQ2QFRO  

5-FU 1000 mg/m2/d d1- d4


Carboplatina 300 mg/m2 d1
cada 4 semanas



)RUDVWLHUHHWDO-&OLQ2QFRO  

3DFOLWD[HO 175 mg/m2 d1


Cisplatina 75 mg/m2 d1
cada 3 semanas


*LEVRQ0.HWDO-&OLQ2QFRO  

0HWRWUH[DWR 40 mg/m2/semana IM ou EV
Forastiere et al.

III.Tratamento

Estadios I, II, III, IVa: cirurgia (resseco do tumor primrio, esvaziamento cervical) seguida
ou no de (quimio-)radioterapia adjuvante (ver abaixo as indicaes de quimioradioterapia
adjuvante)
Doena localmente avanada, irressecvel
Stio primrio: Cavidade oral, orofaringe, hipofaringe, laringe
Estdio: IVb

Preservao da laringe (T2 a T4a e N0 a N2)

I. QUIMIORRADIOTERAPIA CONCOMITANTE
(VTXHPD
Radioterapia radical 70 Gy stio primrio e 50 Gy em drenagens, divididos em 7 semanas, 2
Gy/dia, 5 vezes/semana

I. QUIMIORRADIOTERAPIA CONCOMITANTE

| 36 |

-&OLQ2QFRO  

| 37 |

IV. Seguimento

Quimioterapia:
cisplatina 100 mg/m2 IV dias 1, 22 e 43
)RUDVWLHUHHWDO1(QJO-0HG

Cncer da nasofaringe

Estadio I,IIA: RT isolada


Tratamento da doena sem evidncia de metstases distncia (IIb-IVB)
I. QUIMIORRADIOTERAPIA CONCOMITANTE, SEGUIDA POR QUIMIOTERAPIA ADJUVANTE
Radioterapia radical 70 Gy stio primrio e 50 Gy em drenagens, divididos em 7 semanas, 2
Gy/dia, 5 vezes/semana

Consultas peridicas a cada 3-4 meses por 3 anos, semestral por 2 anos e annual a seguir.
Acompanhar funo tireoideana no caso de RT cervical.
5DGLRJUDDGHWyUD[DQXDO
([DPHEURVFySLFRLPDJHP &7510 DFDGDPHVHVQRVSULPHLURVDQRVHDQXDOSRU

2 anos, ou a critrio clnico.

lV. Cncer Genitourinrio


1. Prstata
CID C61

Quimioterapia:
cisplatina 100 mg/m2 IV dias 1, 22 e 43

DOENA LOCALIZADA

QUIMIOTERAPIA ADJUVANTE: X 3 ciclos de 28 dias


Cisplatina 80 mg/m2 d1
5-FU 1000 mg/m2/d d1-d4
$O6DUUDIHWDO-&OLQ2QFRO

Doena metasttica
1 opo ciclos de 28 dias
Cisplatina 80 mg/m2 d1
5-FU 1000 mg/m2/d d1-d4

,([DPHVGH(VWDGLDPHQWR

Hemograma, PSA, Fosfatase alcalina e coagulograma


&LQWLORJUDDVVHDQRVFDVRVGH
PSA > 20ng/ml
Gleason > 8
T3 e T4
Sintomticos e/ou FA elevada
7&3pOYLFDRX510QRVFDVRVGH
T3 ou T4
T1-T2 com alto risco (ver a seguir)

2 opo ciclos de 21 dias


Cisplatina 80 mg/m2 d1
Gemcitabina 1000 mg/m2 d1 e d8
0RGLFDGRGH<DRHWDO+HDG1HFN  

Tratamento adjuvante da doena de alto risco


Stio primrio: Cavidade oral, orofaringe, hipofaringe, laringe
Estdios: III - IVa
'HQLomRGHDOWRULVFR/1!H[WUDYDVDPHQWRH[WUDFDSVXODUGDGRHQoDQRGDOPDUJHQV
comprometidas ou exguas
I. QUIMIORRADIOTERAPIA ADJUVANTE
(VTXHPD
Radioterapia radical 60 Gy stio primrio e 50 Gy em drenagens, divididos em 6 semanas, 2
Gy/dia, 5 vezes/semana
Quimioterapia: cisplatina 100 mg/m2 IV dias 1, 22 e 43
&RRSHUHWDO1(QJO-0HG
%HUQLHUHWDO1(QJO-0HG

| 38 |

II. Estadiamento

T1: tumor no palpvel clinicamente e no visvel por imagem


T1a: achado histolgico incidental em 5% do tecido ressecado
T1b: achado histolgico incidental em > 5% do tecido ressecado
T1c:WXPRULGHQWLFDGRDWUDYpVGHELySVLDSRUDJXOKD
T2:WXPRUFRQQDGRjSUyVWDWD
T2a: tumor envolve metade de um lobo ou menos
T2b: tumor envolve mais da metade de um lobo, mas no ambos os lobos
T2c: tumor envolve ambos os lobos
T3: tumor se estende alm da cpsula prosttica
T3a: extenso extracapsular(unilateral ou bilateral)
T3b: tumor invade a vescula seminal
T4:WXPRU[RRXFRPLQYDVmRGHHVWUXWXUDDGMDFHQWHEH[LJDUHWRSDUHGHSpOYLFDP~VFXlos elevadores
N1: metstase para linfonodos regionais
M1: metstase a distncia
M1a: metstase em linfonodos no regionais
M1b: metstase ssea
M1c: outros locais de metstase
G1: bem diferenciado
G2: moderadamente diferenciado e moderado para pobremente diferenciado
G3: pobremente diferenciado

| 39 |

Estadiamento patolgico:
pT2:FRQQDGRDSUyVWDWD
pT2a: envolvimento de metade de um lobo ou menos
pT2b: envolvimento de mais da metade de um lobo , mas no ambos os lobos
pT2c: envolvimento bilateral
pT3: extenso extraprosttica
pT3b: invaso de bexiga,vescula seminal , reto
Estdio
l

T1aN0M0G1
T1aN0M0G2,3-4

Il

T1b-2N0M0qqG

IIl

T3N0M0qqG

IV.Tratamento Adjuvante ps-Prostatectomia radical


Linfonodo POSITIVO

Discutir orquiectomia radical ou anlogo de LHRH adjuvante


Linfonodo NEGATIVOLQGHSHQGHQWHGR*OHDVRQRXGHLQOWUDomRGDYHVtFXODVHPLQDO
Tratamento adjuvante: No est indicado.
Estadio patolgico T3b ou margem positiva
RT adjuvante

* Elevao do PSA Ps-Prostatectomia Radical:


Elevao acima de 0,2 ng/ml em trs medidas consecutivas separadas por pelo menos
duas semanas de intervalo entre cada medida do PSA.
Tratamento: RT de acordo com o nomograma de Stephenson e cols.
Anlogo de LHRH intermitente adjuvante ou orquiectomia.
-&OLQ2QFRO

T4N0M0qqG
IV

qqTN1M0qqG
qqTqqNM1qqG

V. Seguimento

Exame fsico e PSA a cada 3 meses


&LQWLORJUDDyVVHDHWRPRJUDDVVHVLQWRPDVVXJHVWLYRVGHUHFLGLYD

III.Tratamento Adjuvante ps-Radioterapia


'HDFRUGRFRPDHVWUDWLFDomRGHULVFR
5LVFR%DL[R77D(*OHDVRQ(36$QJPO
Tratamento Adjuvante: NENHUM
Risco Intermedirio: T2b-T2c OU Gleason 7 OU PSA 10-20 ng/ml

Tratamento Adjuvante: Anlogo de LHRH por 6 meses. Iniciar 2 meses antes do primeiro
dia da RT. Pacientes com co-morbidade cardiovascular no recebero tratamento adjuvante

lV. Cncer Genitourinrio


1. Prstata

Risco Elevado: T3a OU Gleason 8-10 OU PSA > 20ng/ml.

Tratamento Adjuvante: Anlogo de LH-RH por 2 anos. Iniciar no primeiro dia da radioterapia.
Risco Muito Elevado: T3b-T4.

Tratamento Adjuvante: Discutir orquiectomia radical OU tratamento de Radioterapia e


Anlogo de LH-RH a exemplo do grupo de risco elevado.
JAMA 2008, 299(3): 289
JAMA 2004, 292(7): 821
1HZ(QJO-0HG  

DOENA MATASTTICA
,'RHQoDKRUP{QLRVHQVtYHO
Hormonioterapia de primeira linha
2UTXLHFWRPLDELODWHUDO

* Elevao do PSA Ps-Radioterapia


'HQLomRDXPHQWRGR36$!QJPO2836$!DFLPDGRQDGLURXDXPHQWRVFRQVHFX-

tivos > 0,5ng/ml acima do nadir aps a radioterapia.


Tratamento: discutir orquiectomia radical nos pacientes que tinham alto risco na doena

inicial OU que tenham tempo de duplicao do PSA < 3 meses, ou ainda que tenham PSA >
10 quando da consulta inicial da recidiva ps-RT.
,QW-5DGLDW2QFRO%LRO3K\V

| 40 |

,,'RHQoDUHVLVWHQWHjFDVWUDomR
Hormonioterapia de segunda linha
DES VO 1 mg/dia + Marevan comprimido de 2 a 6 feira ou
Bicalutamida VO 50 mg/dia (alternativa) ou
Flutamida VO 250 mg 3x/dia ou
Prednisona VO 10 mg/dia
1(QJO-0HG  
%U-8URO  
(XU8URO  
-8URO  

| 41 |

,,,'RHQoDKRUP{QLRUHIUDWiULD
Quimioterapia
Primeira Linha:
'RFHWD[HO 75 mg/m2 a cada 21 dias + Prednisona 5mg 12/12 horas ou
0LWR[DQWURQH 12mg/m2 + Prednisona 5mg 12/12 horas (alternativa em baixo status funcional)
Segunda Linha
Ciclofosfamida 100mg/dia VO por 21 dias a cada 28 dias
1(QJO-0HG  
1(QJO-0HG  
-8URO  

Bisfosfonatos:
Indicados na doena hormnio-refratria e comprometimento sseo extenso
Zoledronato 4 mg EV (intervalo mnimo de aplicao de 28 dias).
Intervalo de aplicao a critrio do mdico conforme sintomas da doena ssea e extenso do comprometimento esqueltico.

lV. Cncer Genitourinrio


2.Testculo

Patolgico
S1[ linfonodos regionais no avaliveis
pN0: sem evidncia de tumor em linfonodos
pN1: metstase em conglomerado linfonodal 2cm no maior dimetro e 5 linfonodos
positivos, nenhum > 2cm no maior dimetro
pN2:PHWiVWDVHHPFRQJORPHUDGROLQIRQRGDO!FPPDVQmR!FPQRPDLRUGLkPHWURRX
!OLQIRQRGRVSRVLWLYRVQHQKXP!FPRXHYLGrQFLDGHH[WHQVmRH[WUDQRGDOGRWXPRU
pN3: metstase em conglomerado linfonodal>5cm no maior dimetro
Metstase a distncia
0[ metstase a distncia no avalivel
M0: sem metstase a distncia
M1: metstase a distncia
M1a: metstase pulmonar ou linfonodal no-regional
M1b: metstase a distncia em outros stios que no pulmo ou linfonodos no regionais
0DUFDGRUHV6pULFRV
DHL

HCG

fetoprotena

S1

<1,5 x N

<5000

<1000

S2

1,5-10 x N

5000-50000

1000-10000

S3

>10x N

>50000

>10000

N: Limite superior da normalidade

CID C62
Estadio

,([DPHVGH(VWDGLDPHQWR

1.Marcadores sricos: DHL, Aalfa-fetoprotena e beta-HCG


2.TC trax, abdome e pelve
3.RNM de crnio se clinicamente indicada ou recidiva de coriocarcinoma

II. Estadiamento
Tumor primrio
S7[ tumor primrio no avalivel
pT0: sem evidncia de tumor primrio
pT1: tumor limitado ao testculo e epiddimo sem invaso vascular/linftica. Tumor pode
invadir a tnica albugnea, mas no a tnica vaginal
pT2: tumor limitado ao testculo e epiddimo com invaso vascular/linftica ou tumor com
extenso atravs da tnica albugnea com envolvimento da tnica vaginal
pT3: tumor invade o cordo espermtico com ou sem invaso vascular/linftica
pT4: tumor invade o escroto com ou sem invaso vascular/linftica
Linfonodos regionais - Clnico
1[ Linfonodos regionais no avaliveis
N0: sem metstase em linfonodos regionais
N1: metstase em conglomerado linfonodal FPQDPDLRUGLPHQVmRRXP~OWLSORVOLQIRnodos, nenhum >2cm
N2: metstase em conglomerado linfonodal>2cm , porm no maior que 5cm no maior
GLkPHWURRXP~OWLSORVOLQIRQRGRVTXDOTXHUPDVVD!FPPDVQmR!FPQRPDLRUGLkPHWUR
N3: metstase em conglomerado linfonodal > 5cm no maior dimetro

| 42 |

IA

pT1

N0

M0

S0

IB

pT2
pT3
pT4

N0
N0
N0

M0
M0
M0

S0
S0
S0

IS

qqpT/Tx

N0

M0

S1-3

IIA

qqpT/Tx
qqpT/Tx

N1
N1

M0
M0

S0
S1

IIB

qqpT/Tx
qqpT/Tx

N2
N2

M0
M0

S0
S1

IIC

qqpT/Tx
qqpT/Tx

N3
N3

M0
M0

S0
S1

IIIA

qqpT/Tx
qqpT/Tx

qqN
qqN

M1a
M1a

S0
S1

IIIB

qqpT/Tx
qqpT/Tx

N1-3
qqN

M0
M1a

S2
S2

IIIC

qqpT/Tx
qqpT/Tx
qqpT/Tx

N1-3
qqN
qqN

M0
M1a
M1b

S3
S3
qqS

Estadio I

Estadio II

Estadio III

| 43 |

(VWUDWLFDomRGHULVFRGDGRHQoDDYDQoDGD ,*&&&* 

Obs2.:SDFLHQWHVVXEPHWLGRVjOLQIDGHQHFWRPLDUHWURSHULWRQHDOHFRQUPDomRGHHVWDGLR

patolgico II totalmente ressecado so candidatos BEP x2 adjuvante ou observao vigilante.


5LVFREDL[R
Seminoma:TXDOTXHUQtYHOGHPDUFDGRUDXVrQFLDGHPHWiVWDVHYLVFHUDOQmRSXOPRQDU
qq. localizao
No-seminoma:$)3QJP/+&*P8P/'+/[OLPLWHVXSHULRUPHWiVWDVHYLVFHUDOQmRSXOPRQDUDXVHQWHVtWLRSULPiULRJRQDGDORXUHWURSHULWRQHDO
Risco intermedirio:
Seminoma: metstase visceral no-pulmonar.
No-seminoma:$)3DQJP/+&*DP8P/'+/D
[OLPLWHVXSHULRUPHWiVWDVHYLVFHUDOQmRSXOPRQDUDXVHQWHVtWLRSULPiULRJRQDGDORX
retroperitoneal.
Risco alto:
Seminoma: no h.
No-seminoma:$)3!QJP/+&*!P8P/'+/![OLPLWHVXSHULRUPHWiVWDVHYLVFHUDOQmRSXOPRQDU RVVRVItJDGRFpUHEUR VtWLRSULPiULRPHGLDVWLQDO
J Clin Oncol 15:594, 1997

V. Recidiva tumoral

Recorrncia aps remisso com esquema BEP: TIP x 4


Persistncia de doena ps-BEP ou recidiva precoce: TIP x2 seguido de QT alta dose com

carboplatina e etoposdeo + transplante de clulas-tronco


Tumor refratrio: no h padro - casos selecionados TIP x 2 seguido de QT alta dose +
transplante clulas-tronco
4.B Persistncia ou aumento de leso sem elevao de marcadores: considerar cirurgia aps
trmino da QT pela possibilidade de teratoma maduro

VI. Opes de tratamento paliativo


Irinotecano 100 a 150 mg/m EV nos D1 e D15 + cisplatina 20 mg/m/dia EV do D1 ao

D5, a cada 4 semanas.


Cancer 95:1879, 2002

III.Conduta em doena estadio clnico I

'HQLomR7&VHPDUFDGRUHVQRUPDLVDSyVRUTXLHFWRPLD
Conduta depende da presena de fatores de risco anatomopatolgicos.

No-Seminoma:
Ausncia de predomnio de carcinoma embrionrio (< 50% na pea cirrgica) E ausncia
de invaso vascular/linftica -16% de risco de metstase oculta em retroperitnio:
Observao vigilante: TC abdome e RX de Trax a cada 3 meses no primeiro ano, a cada
4 meses no segundo ano e a cada 6 meses do 3 ao 5 ano
Predomnio de carcinoma embrionrio (> 50% na pea cirrgica) OU invaso vascular/linftica 30% a 60% de risco de metstase oculta em retroperitnio:
Linfadenectomia retroperitoneal ou
BEP x 1 a 2 aceitvel.
Obs.: REVHUYDomRYLJLODQWHQRVSDFLHQWHVFRQiYHLVHPRWLYDGRVFRPDSHQDVXPDGDVYDULiveis de risco aceitvel.
J Clin Oncol 18:358, 2000

Seminoma:
Tumor < 3 cm e ausncia de invaso de rete testis.
Observao vigilante
Tumor > 3 cm OU invaso de rete testis
Observao vigilante (nos pacientes motivados) ou
Carboplatina AUC 7, dose nica ou RT para-artica 20 Gy (opo)
umor > 3 cm E invaso de rete testis
Carboplatina AUC 7, dose nica ou RT para-artica 20 Gy (opo)

IV. Conduta na doena estadio clnico/patolgico II ou III

Gencitabina 1.000 mg/m EV nos D1 e D8 + oxaliplatina 130 mg/m EV no D1 a cada 21 dias.


J Clin Oncol 22:108, 2004
3DFOLWD[HO 110 mg/m EV + gencitabina 1.000 mg/m EV nos D1, D8 e D15 a cada 28 dias.
J Clin Oncol 25:513, 2007.

VII. Protocolos de Quimioterapia :


BEP
Cisplatina 20mg/m2 D1 a D5
Etoposide 100mg/m2 D1 a D5
Bleomicina 30 UI D2, D9 e D16
Ciclos a cada 21 dias

EP
Cisplatina 20mg/m2 D1 a D5
Etoposide 100mg/m2 D1 a D5
Ciclos a cada 21dias

TIP
Paclitaxel 250mg/m2 infuso contnua por 24 horas D1
Ifosfamida 1200mg/m2 D2 a D6 + mesna na mesma concentrao
Cisplatina 20mg/m2 D2 a D6
8VRGHOJUDVWLPPFJGLDSRUGLDVDSDUWLUGR'
Ciclos a cada 21 dias
New Engl J Med 337:242, 1997
J Clin Oncol 8:16, 1990
J Clin Oncol 14:1106, 1996
Annals of Oncology 15:1377, 2004
J Clin Oncol 23:9290, 2005

Risco Baixo: BEP x 3 (alternativa EP x 4)


Risco Intermedirio ou Alto: BEP x 4
Obs1.: pacientes com marcadores elevados aps orquiectomia (respeitando meia-vida dos

marcadores) e sem evidncia radiolgica de doena so submetidos BEP x 3.

| 44 |

| 45 |

J Clin Oncol 16:1287, 1998


J Clin Oncool 18:2413, 2000
J Clin Oncol 19:81, 2001

Estdio

VIII. Seguimento

Alfa-fetoprotena, DHL e beta-HCG a cada 2 meses nos primeiros 6 meses, a cada 3

T1N0M0

Il

T2N0M0
T1-2N1M0

IIl

meses no 1 ano e a cada 6 meses no 2 ano.


TC trax, abdome e pelve a cada 3 meses no 1 ano, a cada 6 meses no 2 ano, e aps, se
clinicamente indicado.

T3a-cN0-1M0
T4N0-1M0

IV

qqTN2M0
qqTqqNM1

lV. Cncer Genitourinrio


&DUFLQRPDGH&pOXODV5HQDLV

,,,(VWUDWLFDomRGHULVFRHPGRHQoDDYDQoDGD FULWpULRV
de Motzer):
Hb < 12 mg/dL
Clcio srico corrigido > 10 mg/dL
DHL 1,5 x limite superior
KPS < 80%
Intervalo entre nefrectomia e tratamento < 1 ano
Prognstico bom:QHQKXPIDWRUGHULVFRVREUHYLGDPHGLDQDPHVHV
Prognstico intermedirio: IDWRUHVGHULVFRVREUHYLGDPHGLDQDPHVHV
Prognstico desfavorvel:!IDWRUHVGHULVFRVREUHYLGDPHGLDQDPHVHV

CID C64

9DULDQWHGH&pOXODV&ODUDV
,([DPHVGHHVWDGLDPHQWR

Hemograma, funo renal, DHL, clcio srico, fosfatase alcalina


TC de trax, abdome e pelve
&LQWLORJUDDyVVHDVHGRUyVVHDRXIRVIDWDVHDOFDOLQDHOHYDGD
RNM ou TC de crnio contrastada se sintomas ou candidato ao uso de sunitinibe

0RW]HUHWDO-&OLQ2QFRO
%XNRNRZVNLHWDO&OLQ&DQ5HVVV

IV.Tratamento Adjuvante:
II. Estadiamento(AJCC 2002)

No recomendado.

T1a- tumor FPHFRQQDGRDRULP


T1b-tumor > 4cm e FPFRQQDGRDRULP
T2-WXPRU!FPHFRQQDGRDRULP
T3a- tumor invade a supra-renal ou a gordura perirenal ou a gordura do seio renal, mas
no ultrapassa a fscia de Gerota
T3b- o tumor se estende para dentro da veia renal ou seus ramos segmentares ou veia
cava inferior abaixo do diafragma
T3c- o tumor se estende para dentro da veia cava acima do diafragma ou invade a parede
da veia cava
T4- o tumor ultrapassa a fscia de Gerota
1[ os linfonodos regionais no podem ser avaliados
N0- ausncia de metstase em linfonodos regionais
N1- metstase em um nico linfonodo regional
N2- metstase em mais de um linfodono regional
M0- ausncia de metstase a distncia
M1- metstase a distncia

V.Tratamento da doena avanada:


Sunitinibe 50mg/dia VO por 4 semanas a cada 6 semanas.

Se toxicidades no-manejveis mudar para 37,5 mg VO ao dia contnuo


Interferon-Alfa na dose inicial de 3 milhes UI 3x por semana com elevao da dose

at 9 milhes de unidades 3 vezes por semana (alternativa).


Obs.: paciente com prognstico bom assintomticos podem ser acompanhados por longos
prodos.
Obs2:UHFRPHQGDPRVQHIUHFWRPLDHPGRHQoDPHWDVWiWLFDVHPSUHTXHSRVVtYHOUHVVHFomR
de metstase nica tambm deve ser considerada.
New Engl J Med 356: 115, 2007
&RFKUDQH'DWDEDVH6\VW5HY-DQ  &'

2XWUDVKLVWRORJLDVQmRFpOXODVFODUDVGRHQoDDYDQoDGD
Variante papilfero puro:

| 46 |

| 47 |

No h padro
Opo: Gencitabina monoterapia 1000mg/m2 nos D1, D8 e D15 a cada 28 dias.
-,PPXQRWKHUDS\  

Ductos coletores (ducto de Bellini):


Cisplatina 70mg/m2 no D1 e Gencitabina 1000mg/m2 D1 e D8
&DQFHU  

1.Variante Sarcomatide:
'R[RUUXELFLQD 50mg/m2 D1 e Gencitabina 1000mg/m2 nos D1 e D8 a cada 21 a 28 dias
&DQFHU

lV. Cncer Genitourinrio


%H[LJD

N1: metstase em um nico linfonodo, com 2cm ou menos em sua maior dimenso
N2: metstase em um nico linfonodo, com mais de 2cm at 5cm em sua maior dimenso, ou
em mltiplos linfonodos, nenhum com mais de 5 cm em sua maior dimenso
N3: metstase em linfonodo com mais de 5cm em sua maior dimenso
0[presena de metstase a distancia no avalivel
M0: ausncia de metstase
M1: presena de metstase a distncia
Estdio
0a

TaN0M0

0is

TisN0M0

T1N0M0

II

T2a-bN0M0
T2a-bN0M0

III

T4aN0M0
T4bN0M0

IV

qqTN1-3M0
qqTqqNM1

CID C67

Doena localizada

,([DPHVGH(VWDGLDPHQWR

Hemograma, funo renal, fosfatase alcalina


Cistoscopia
TC de abdome e pelve
5DLR[RXWRPRJUDDGHWyUD[
&LQWLORJUDDyVVHDVHVLQWRPDVRX)$HOHYDGD

III. Cncer urotelial localizado de alto risco

II. Estadiamento

Quimioterapia neoadjuvante (padro de tratamento):


Esquema M-VAC a cada 28 dias x 3 ciclos pr-op (altamente txico, apenas pacientes com
bom status funcional e sem comorbidades):
0HWRWUH[DWH
30mg/m2 no D1, D15 e D21
Vimblastina
3mg/m2 no D2, D15 e D21
Cisplatina
70mg/m2 no D2
'R[RUUXELFLQD 30mg/m2 no D2

'HQLomRSUHVHQoDGHXPGRVVHJXLQWHVIDWRUHVGHULVFR
Linfonodo positivo
Invaso camada muscular (>T2b)
Invaso vascular

7[ Tumor primrio no pode ser avaliado


T0: no h evidncia de tumor primrio
Ta: carcinoma papilfero no invasivo
Tis: carcinoma in situ: tumor plano
T1: tumor que invade o tecido conjuntivo sub-epitelial
T2: tumor que invade msculo
T2a:WXPRUTXHLQYDGHDPXVFXODWXUDVXSHUFLDO PHWDGHLQWHUQD
T2b: tumor que invade a musculatura profunda(metade externa)
T3: tumor que invade tecido perivesical
T3a: microscopicamente
T3b: macroscopicamente
T4: tumor que invade qualquer uma das seguintes estruturas: prstata, tero, vagina, parede
plvica ou parede abdominal
T4a: tumor que invade prstata, tero ou vagina
T4b: tumor que invade parede plvica ou parede abdominal
1[ linfonodos regionais no podem ser avaliados
N0: ausncia de metstase em linfonodo regional

| 48 |

N Engl J Med 349:859,2003


Lancet 354: 533, 1999
Eur Urol 48: 202, 2005

Obs1.: pacientes com baixo PS ou comorbidades so candidatos a tratamento cirrgico


exclusivo
Tratamento Adjuvante: consideramos M-VAC adjuvante (3-4 ciclos) em pacientes sem
comorbidades e bom status funcional com doena de alto risco aps cirurgia (linfonodos
comprometidos).

| 49 |

IV. Cncer urotelial metasttico


Quimioterapia de 1 linha:
Cisplatina 70mg/m2 no D1 +
Gencitabina 1000mg/m2 no D1 e D8 (padro)
J Clin Oncol 18:3068,2000

Quimioterapia de 2 linha:
3DFOLWD[HO 175mg/m2 a cada 21 dias.

T1: tumor que invade o tecido conjuntivo subepitelial


T2: tumor que invade o corpo esponjoso ou cavernoso
T3: tumor que invade a uretra ou a prstata
T4: tumor que invade outras estruturas adjacentes
1[ linfonodos regionais no avaliveis
N0: ausncia de metstas em linfonodos regionais
N1: PHWiVWDVHHPXP~QLFROLQIRQRGRLQJXLQDOVXSHUFLDO
N2: PHWiVWDVHHPOLQIRQRGRVLQJXLQDLVVXSHUFLDVP~OWLSORVRXELODWHUDLV
N3: metstase em linfonodo(s) inguinal(ais) profundos ou plvicos(s), uni ou bilaterais
0[ metstase no pode ser avaliada
M0: ausncia de metstase
M1: metstase a distncia

9'RHQoDORFDOL]DGDHPSDFLHQWHFRPEDL[RVWDWXVIXQFLRQDO
HFRPRUELGDGHVRXTXHGHFOLQDPFLVWHFWRPLD

Estdio
TisN0M0

Quimiorradioterapia concomitante:
Cisplatina 30 mg/m2 semanal durante toda a radioterapia.
J Clin Oncol 14:2901, 1996

TaN0M0

T1N0M0
T1N1M0

II

VI. Seguimento

Aps resseco transuretral, cistectomia parcial, RT ou QRT


Cistoscopia e citologia onctica urinria a cada 3 meses
Funo heptica, renal, fosfatase alcalina e raio-x de trax a cada 3 meses por 2 anos
&LQWLORJUDDyVVHDHWRPRJUDDVGHDEGRPHSHOYHVHFOLQLFDPHQWHLQGLFDGDV

T2N0-1M0
T1-2N2M0

III

T3N0-2M0
T4qqNM0

IV

qqTN3M0
qqTqqNM1

lV. Cncer Genitourinrio


5. Carcinoma Epidermide do Pnis

III. Carcinoma epidermide de pnis (linfonodo negativo ou positivo microscpico), operado


Tratamento adjuvante: no indicado.

CID C 60

IV. Carcinoma epidermide de pnis localmente avanado (linfonodos clnicamente comprometidos)

,([DPHVGHHVWDGLDPHQWR

Tratamento neoadjuvante:
(VTXHPD7,3
3DFOLWD[HO 175 mg/m2 no D1
Cisplatina 20 mg/m2 D1 a D3
Ifosfamida 1,2 g/m2, D1 a D3 a cada 3 semanas

Hemograma, funo renal, fosfatase alcalina


5DLR[RXWRPRJUDDGHWyUD[
7RPRJUDDRXUHVVRQkQFLD0DJQpWLFDGHSHOYH

-8URO  
Eur Urol 2007, 52(2): 488

II. Estadiamento

(VTXHPDDOWHUQDWLYR

Cisplatina 80mg/m2 no D1
Fluoruracil 1000mg/m2 nos D1 a D4

7[tumor primrio no pode ser avaliado


T0: no h evidncia de tumor primrio
Tis: carcinoma in situ
Ta: carcinoma verrucoso no invasivo

-8URO  

| 50 |

| 51 |

V. Carcinoma epidermide de pnis metasttico ou recidivado


Cisplatina 80mg/m2 no D1
Fluoruracil 1000mg/m2 nos D1 a D4
-8URO  

VI.Carcinoma epidermide de pnis progresso aps 1 linha:


3DFOLWD[HO monoterapia 175 mg/m2 a cada 21 dias
$QWLFDQFHUGUXJV$SU  

V. Octreoscan para tumores de baixo grau, se disponvel

III.Tratamento
1) Tumores ou carcinomas neuroendcrinos bem diferenciados
O tratamento depender das caractersticas de ressecabilidade, independente
da condio de assintomtico ou sintomtico. Assim:
Tumores localizados ressecveis
Cirurgia
Tumores metastticos ressecveis
Cirurgia

VI. Seguimento

Tumores irressecveis assintomticos


Sem evidncia de progresso, recomenda-se conduta expectante at sinais de progresso
de doena.

Exame fsico
Exames de imagem conforme sintomas

V. Tumores endcrinos
1. Neuroendcrinos
,&ODVVLFDomR
4XDQWRjRULJHPHPEULROyJLFD
I. Foregut (intestino proximal): brnquicos, gstricos, duodenais, pancreticos e de vescula biliar.
II. Midgut (intestino mdio): intestino delgado, apndice e clon ascendente.
III. Hindgut (intestino distal): clon transverso, descendente, sigmide e reto.
Quanto a histologia (OMS)
Tumor endcrino bem diferenciado (carcinide*)
Carcinoma neuroendcrino bem diferenciado
Carcinoma neuroendcrino pouco diferenciado (pequenas ou grandes clulas)
4XDQWRjVPDQLIHVWDo}HVFOtQLFDV
Funcionais: secreo de polipeptdeos ativos
No-funcionais: sem manifestaes clnicas relacionadas a hormnios ou neurotransmissores.

,,([DPHVGHHVWDGLDPHQWR
I.7RPRJUDDVGHWyUD[DEG{PHQHSHOYH
II. Dosagem urinria do cido 5-hidroxi-indolactico (5-HIAA) apenas se clnica sugestiva de
sndrome carcinide.
III. Dosagem srica de cromogranina A, se disponvel
IV.'RVDJHPGHSHSWtGHRVHVSHFtFRVTXDQGRFOLQLFDPHQWHMXVWLFiYHOVHGLVSRQtYHO

| 52 |

Tumores irressecveis sintomticos


Nos pacientes com tumores funcionais recomenda-se:
a) Iniciar tratamento com octreotida (anlogos de somatostatina) 100mcg SC 3x/dia, ajustando
a dose at controle dos sintomas por 2 semanas.
b) Manter com octreotida LAR 20mg IM 1x/ms.
c) Caso persistam os sintomas ou reapaream aps controle inicial:
,)1DOIDD806&[VHPDQD
ou
Escalonar dose octreotida LAR IM para 30 mg ou 40 mg mensal
OBS: Sintomticos como loperamida ou inibidores 5HT3 devem ser utilizados para controle
de sintomas.
Acta Oncol (1991) 30:503
Lancet (1998) 352: 799
NEJM (1999) 340:858

Ateno:
Nos pacientes com doena predominantemente heptica considerar como primeira opo
embolizao heptica ou citorreduo cirrgica, se possvel.
Se a doena predominantemente extra-heptica, o tratamento sistmico impera.
Tumores de ilhota pancretica so mais sensveis QT sistmica.
Opes:
1a.opo:
Capecitabina 2000 mg/m divididos em duas tomadas dirias por 14 dias associado
a 2[DOLSODWLQD 130 mg/m D1 a cada 21 dias.
2a.opo:
Dacarbazina 1000mg/m2 EV a cada 3 sem
Ann Oncol 12:1139,2001

3a.opo:
'R[RUUXELFLQD 60mg/m2 D1 - Cada 3 semanas
JCO (1984) 2: 1255-59

| 53 |

Os tumores neuroendcrinos no-pancreticos de baixo grau so menos responsivos QT.

(papilfero,folicular e clulas de Hrthle)

Considerar para estes:


Interferon-alfa 5MU SC 3x/semana isolada ou combinada com octreotida LAR IM
20mg/ms.

,([DPHVGHHVWDGLDPHQWR

Eur J Cancer (1992) 28A:1647


Am J Gastroenterol (1999) 94:1381

2) TXPRURXFDUFLQRPDQHXURHQGyFULQRSRXFRGLIHUHQFLDGR SHTXHQDVFpOXODV
JUDQGHVFpOXODVRXDQDSOiVLFR
Tumores localizados ressecveis
Cirurgia
Tratamento adjuvante com:
Cisplatina 25mg/m2 EV D1-3 e
Etoposdeo 100mg/m2 EV D1-3

Exames gerais, funo tireoidiana


US tireoide
7&RX50GRSHVFRoRLQGLFDGDHPFDVRVGHGRHQoDORFDOPHQWHDYDQoDGDSDUDGHQLUD

extenso cirrgica. O uso de contraste iodado deve ser limitado aos casos em que este seja
imprescendvel. Caso o contraste iodado seja utilizado, postergar a iodoterapia (8-12 semanas
aps contraste).
TC trax sem contraste iodado na suspeita de metstases pulmonares
A dosagem de tireoglobulina srica s til aps a tiroidectomia

II.Estadiamento (conforme AJCC 2002)

Cada 3 semanas por 4 ciclos


Cancer (1991) 68:227
Digestion (2000) 62:73

ou
Cisplatina 30mg/m2 EV D1 e D8
Irinotecano 60mg/m2 EV (90 min) D1 e D8
Cada 3 semanas por 4 ciclos
Proc ASCO (2003) 22:375a, abstr 1508

/LPLWDGRVjJOkQGXOD7WXPRUFP7WXPRU!HFP7WXPRU!FP
([WHQVmRSDUDWHFLGRVDGMDFHQWHVT3: extenso mnima (partes moles ou musculo ester-

QRWLUHyLGHR 7DH[WHQVmRDOpPGDFiSVXOD7ELQYDVmRGDIiVFLDSUpYHUWHEUDORXHQJOREDPHQto de vasos.


N1a:OLQIRQRGRVGRQtYHO9, SUpWUDTXHDLVSDUDWUDTXHDLVHSUpODUtQJHRV 1EOLQIRQRGRV
cervicais ou mediastinais superiores unilaterais, contralaterais ou bilaterais.
M0: VHPPHWiVWDVHjGLVWkQFLD0PHWiWDVHjGLVWkQFLD

Tumores metastticos
Mesmos esquemas anteriores, de acordo com benefcio

Grupos (TNM):
,GDGHDQRV,TT7TT10,,TT7TT10
,GDGH!DQRV,710,,710,,,71071D0,9D7D107
D1E0,9%7ETT10,9&TT7TT10
Nota: Alto-risco (metstases distncia, invaso tumoral macroscpica, resseco incompleta),
risco-intermedirio (invaso microscpica peritiroidiana, metstases em LN cervicais, invaso
vascular, histologia agressiva), baixo-risco (sem metstase local ou distantes, resseco completa).

IV. Seguimento

III.Tratamento

Discutir RT adjuvante em pacientes ressecados com doena limitada.

Exame fsico
Paciente com doena metasttica indolente, assintomticos podem ser reavaliados com tomo-

JUDDVDFDGDVHPDQDVFRQVLGHUDUDXPHQWDURLQWHUYDORGDUHDOL]DomRGDVLPDJHQVFRQIRUPH
velocidade de progresso da doena

V. Tumores endcrinos
2.Tireoide

Cirrgico(tireoidectomia total , quase-total ou lobectomia ipsilateral a critrio do cirurgio)


Ablao com 131I
Pacientes com Estadio clnico III ou IV
Todos os pacientes com doena EC II, com idade inferior a 45 anos e alguns pacientes com
idade superior a 45 anos
Pacientes com EC I selecionados, especialmente aqueles com tumor >1,5cm,
doena multifocal, doena residual, metstase linfonodal, invaso vascular

CID C73

Supresso do TSH:
TSH < 0,1 um/L: alto risco e risco intermedirio
TSH 0,1 0,5 um/L: baixo risco

Carcinomas de Tiride Bem Diferenciados


Os carcinomas de tireoide bem diferenciado so originrios das clulas foliculares

Doena metasttica
Tratamento com radioiodo (131I) se presena de captao

| 54 |

| 55 |

Nos pacientes com doena metasttica sintomticos, que falharam a iodoterapia

Considerar estudo clnico, se disponvel


Nos pacientes com CMT recomenda-se monitoramento com exames de imagem

considerar quimioterapia paliativa com doxorrubicina ou cisplatina.


(Cancer 56:2155,1985)
Manter supresso do TSH mesmo na doena refratria iodoterapia.
Radioterapia externa: tratamento paliativo de doena localmente avanada (selecionados),

metstases sseas.

e marcadores tumorais (CEA e calcitonina)

Carcinoma Anaplsico da Tireoide


Carcinoma pobremente diferenciado, altamente agressivo
,([DPHVGHHVWDGLDPHQWR
Exames gerais, funo tireoidiana
86WLUHRLGH7&SHVFRoRWyUD[DEGRPHFLQWLORJUDDyVVHD

IV. Seguimento
Dosagem srica de tireoglobulina a cada 6-12 meses aps tratamento cirrgico
US de regio cervical a cada 6-12 meses no primeiro anos aps cirurgia, depois anualmente
7LUHRJOREXOLQDHFLQWLORJUDDGHFRUSRLQWHLURFRPLRGRHPSDFLHQWHVGHULVFRLQWHUPHGLiULRH

alto 6-12 meses aps a ablao com radioiodo


Nota:$SUHVHQoDGHDQWLFRUSRVDQWLWLUHRJOREXOLQDSRGHLQWHUULUQDGRVDJHPGDWLUHRJOREXOLQD
resultando em nveis falsamente baixos.

Carcinoma Medular da Tiride (CMT)


2ULJLQiULRGDFpOXODSDUDIROLFXODUSURGXWRUDGHFDOFLWRQLQD
,([DPHVGHHVWDGLDPHQWR
Exames gerais, funo tireoidiana, dosagem de calcitonina e CEA
US tireoide
Se calcitonina > 400 pg/mL, considerar rastreamento de doena metasttica (TC pescoo,
WyUD[7&RX501GHDEGRPHFLQWLORJUDDyVVHD 
Metanefrinas e/ou catecolaminas urinrias para excluir feocromocitoma.
Trinta % dos carcinomas medulares so hereditrios e associados sndrome
de neoplasia endcrina mltipla tipo 2 (MEN2)
Anlise mutacional do gene RET, se disponvel.

II.Estadiamento:
7RGRVRVFDVRVVmRFRQVLGHUDGRV77DOHVmRFRQQDGDjWLUHRLGHH7EOHVmRH[WUDWLreoidiana.
Grupos (TNM):
,9$7DTT10,9%7ETT10,9&TT7TT10
III.Tratamento
&LU~UJLFRWLURLGHFWRPLDWRWDOTXDQGROHVmRFRQQDGDjJOkQGXOD
Quimioterapia com/sem radioterapia aps tratamento cirrgico ou e com doena irresecvel:
'R[RUUXELFLQD 60mg/m2 e
Cisplatina 80mg/m2 D1 a cada 3 semanas + radioterapia hiperfracionada
(se possvel)
(Int J Radiat Oncol Biol Phys 60:1137, 2004.)

ou
'R[RUUXELFLQD 20mg/m2 semanal concomitante a radioterapia
(Cancer 74:1348,1994)
(Br J Cancer 86:1848,2002)
3DFOLWD[HO 90 mg/m2 durante 3 horas semanal combinado radioterapia.
A supresso do TSH e a iodoterapia no so utilizados no carcinoma anaplsico da tiroide

II. Estadiamento:
Semelhante ao carcinoma bem-diferenciado com exceo dos grupos TNM:
Grupos (TNM):
,710,,710,,,71071D0,9D7D107D1E0,9%
7ETT10,9&TT7TT10
III.Tratamento
Cirrgico: tiroidectomia total + esvaziamento do compartimento nvel VI. Esvaziamento cervical lateral se doena detectada por imagem ou bipsia positiva.
Se doena M1: considerar cirurgia menos agressiva com intuito de controle local com preservao da fala e deglutio.
Considerar radioterapia externa em pacientes de alto-risco em que interveno cirrgica
futura no mais uma opo
A supresso do TSH e a iodoterapia no so utilizados no carcinoma medular da tiroide
Doena metasttica
Observao clnica em casos de doena estvel
Doena progressiva:
DTIC 250 mg/m2 D1 a D5 + 5-FU inf. Continua 450 mg/m2/dia d1
a D5 (Ann Oncol 5: 763, 1994)

| 56 |

V. Tumores endcrinos
&DUFLQRPDGRFyUWH[GDVXSUDUHQDO
CID C74

,([DPHVGHHVWDGLDPHQWR
Exame fsico e histria clnica
Avaliao hormonal
Excluir hipercortisolismo, hiperandrogenismo:
Dosagem de ACTH e cortisol srico e cortisol livre na urina de 24hs
Dosagem de testosterona, androstenediona e sulfato de deidroepiandrosterona
O hiperaldosteronismo primrio raro nos casos de carcinoma da supra-renal. Consider-lo

nos casos de hipopotassemia. Dosagem de aldosterona e atividade plasmtica da renina.

| 57 |

II. Estadiamento

Vl. Cncer Ginecolgico

T1: 5cm
T2: >5cm
T3: invaso da gordura supra-renal
T4: invaso de rgos adjacentes
N0: Linfonodos negativos
N1: linfonodos positivos
M0: ausncia de metstase
M1: presena de metstase a distncia

1. Colo Uterino
CID C 53

,([DPHVSDUDHVWDGLDPHQWR
Estdio

T1N0M0

II

T2N0M0
T3N0M0

III

T1-2N1M0
T3N1M0

IV

T4N0-1M0

Para todas as pacientes:


Exame fsico, incluindo ginecolgico e retal
Raio-x de trax
Hemograma,funo renal,funo heptica e DHL
A partir do estadiamento clnico II:
RMN de abdome e pelve para estadiamento clnico I
&LVWRVFRSLDHUHWRVVLJPRLGRVFRSLDVHKRXYHUVXVSHLWDGHLQOWUDomRGHEH[LJDRXUHWR
respectivamente.

T1-4N0-1M1

III.Tratamento

II. Estadiamento

Estadio inicial:
Resseco cirrgica
Adjuvncia com Mitotano (mesmo para tumores no funcionantes) 1-5g/dia.
(N Engl J Md 356(23):2372-80, 2007).

T - Tumor Primrio
TNM

FIGO

Categorias

Estadio

Doena metasttica
Considerar mitotano para pacientes metastticos sintomticos em funo dos tumores serem
funcionantes. Iniciar o mitotano com baixas doses e aumentar progressivamente at 10 gramas/
dia de acordo com a tolerncia do paciente (2-10g/dia).
Se possvel considerar incluso em estudo clnico.
Pacientes com doena metasttica, jovens e com bom performance clnica podem receber
quimioterapia paliativa conforme esquema abaixo:

TX

Cisplatina 40mg/m2 - D1 e D9
'R[RUUXELFLQD 20mg/m2 - D1 e D8
Etoposdeo 100mg/m2 - D5 a D7
Mitotano at 4g/dia
A cada 28 dias
(Endocr Relat Cancer 12:657,2005)
(Cancer 83:2194,1998)

IV.Seguimento
Exame fsico, exames de imagem, dosagens hormonais
Dosagem do nvel de mitotano (> 14 mcg/mL), se possvel.
Como o mitotane suprime a funo adrenal, deve-se iniciar dexametasona 1-2 g/dia ou predni-

sona 5mg/dia juntamente com o mitotane.

| 58 |

Tumor primrio no pode ser avaliado

T0

Sem evidncia de tumor primrio

Tis

Carcinoma in situ (carcinoma pr-invasor)

T1

&DUFLQRPDGDFpUYLFHFRQQDGRDR~WHUR H[WHQVmRDRFRUSR
deve ser desprezada)

T1a

IA

Carcinoma invasor, diagnosticado somente pela microscopia.


Todas as leses visveis macroscopicamente mesmo com invaso
VXSHUFLDOVmR7E(VWDGLR,%

T1a1

IA1

Invaso estromal de at 3 mm em profundidade e 7 mm ou menos de extenso horizontal

T1a2

IA2

Invaso estromal maior que 3 mm e at 5 mm em profundidade


com uma extenso horizontal de 7mm ou menos

T1b

IB

Leso clinicamente visvel, limitada ao colo, ou leso microscpica


maior que T1a2/IA2

T1b1

IB1

Leso clinicamente visvel com 4cm ou menos em sua maior


dimenso

T1b2

IB2

Leso clinicamente visvel com mais de 4 cm em sua maior dimenso

T2

II

Tumor que invade alm do tero, mas no atinge a parede plvica


ou o tero inferior da vagina

| 59 |

Conizao para as que desejarem manter a fertilidade

T2a

IIA

Sem invaso do paramtrio

T2b

IIB

Com invaso do paramtrio

T3

III

Tumor que se estende parede plvica, compromete o tero


inferior da vagina, ou causa hidronefrose ou excluso renal

T3a

IIIA

Tumor que compromete o tero inferior da vagina, sem extenso


parede plvica

T3b

IIIB

Tumor que se estende parede plvica, ou causa hidronefrose ou


excluso renal

T4

IVA

Tumor que invade a mucosa vesical ou retal, ou que se estende


alm da plvis verdadeira

M1

IVB

Metstase distncia

(N Engl J Med 334:1030-8, 1996)


Histerectomia radical e linfadenectomia plvica se invaso maior que 3 mm ou invaso linftica

ou vascular.
(Gynecol oncol 36:314, 1989)

Estadios IA2 e IB1 microscpico, pequeno volume (<4 cm)


Primeira escolha:
Histerectomia radical e linfadenectomia plvica.
Quimioradioterapia adjuvante se linfonodos comprometidos ao antomo patolgico.

ou
4XLPLRUDGLRWHUDSLDGHQLWLYDFRP
Cisplatina 40 mg/m2 semanal iniciando no D1 da radioterapia por seis semanas

N: Linfonodos Regionais
NX: Os linfonodos regionais no podem ser avaliados
N0: Ausncia de metstase em linfonodo regional
N1: Metstase em linfonodo regional

(NEJM 340:1154-61, 1999)

Estadios IB1 macroscpico, IB2 e IIA < 4 cm


Histerectomia radical e linfadenectomia plvica e para artica

M: Metstase Distncia
MX: A presena de metstase distncia no pode ser avaliada
M0: Ausncia de metstase distncia
M1: Metstase distncia

Alternativa teraputica
4XLPLRUDGLRWHUDSLDGHQLWLYDUDGLRWHUDSLDH[WHUQDHEUDTXLWHUDSLDDVVRFLDGRD
Cisplatina 40 mg/m2 semanal iniciando no D1 da radioterapia por seis semanas

Dose total: mnimo de 200mg/m2

Grupamento por Estadios


Estadio 0

Tis

N0

M0

Estadio IA

T1a

N0

M0

Estadio IA1

T1a1

N0

M0

Estadio IA2

T1a2

N0

M0

Estadio IB

T1b

N0

M0

Estadio IB1

T1b1

N0

M0

Estadio IB2

T1b2

N0

M0

Estadio IIA

T2a

N0

M0

Estadio IIB

T2b

N0

M0

Estadio IIIA

T3a

N0

M0

T1, T2, T3a

N1

M0

T3b

Qualquer N

M0

Estadio IVA

T4

Qualquer N

M0

Estadio IVB

Qualquer T

Qualquer N

M1

Estadio IIIB

AJCC (2002). AJCC Manual de Estadiamento de Cncer. Sexta edio. Springer Verlag: New York.
8,&&  &ODVVLFDomR710GHWXPRUHVPDOLJQRV6H[WDHG-RKQ:LOH\ 6RQV1HZ<RUN

,,,7UDWDPHQWRVKLVWRORJLDGHFpOXODVHVFDPRVDV
Estadios IA1

N Engl J Med 340:1154-61, 1999


N Engl J Med 340(15):1137-43,1999
J Clin Oncol 23:8289, 2005
J Clin Oncol 20:966-72, 2002
Gynecol Oncol. 108(1):195-200,2008. Epub 2007 Oct 25.

Estadios IA, IB1, IIA < 4 cm, clulas escamosas, risco intermedirio
Uma ou mais alteraes: tumor < 4 cm, invaso estromal cervical profunda (tero medial ou
profundo), invaso do espao linfovascular
Quimioradioterapia como acima
(Gynecol Oncol 96: 721-8, 2005)

Estadios IA, IB1, IIA < 4 cm, clulas escamosas, alto risco
Uma ou mais alteraes: margens positivas ou coincidentes, linfonodos positivos, comprometimento microscpico dos paramtrios
-&2&RFKUDQH9HU
Quimioradioterapia como acima
1(-0*\QHFRO2QFRO 

Em pacientes com contraindicao para cisplatina:


Carboplatina AUC 2 EV semanal, incio no D1 da radioterapia por seis semanas
(Gynecol Oncol 89:499-503, 2003)

ou

| 60 |

| 61 |

Carboplatina 60 mg/m2 EV semanal, incio no D1 da radioterapia por seis semanas


(Am J Clin Oncol 19:317-21, 1996)
(N Engl J Med 340:1144,1999)

Vl. Cncer Ginecolgico


2.Vagina

Estadios IB2, IIA > 4 cm, localmente avanado clulas escamosas


Quimioradioterapia: radioterapia externa e braquiterapia associado a cisplatina 40 mg/m2

semanal iniciando no D1 da radioterapia por seis semanas Total mnimo de 200mg/m2


N Engl J Med 340:1154-61, 1999
N Engl J Med 340(15):1137-43,1999
J Clin Oncol 23:8289, 2005
J Clin Oncol 20:966-72, 2002

Se contraindicao para cisplatina, carboplatina como acima

CID C52

,([DPHVGHHVWDGLDPHQWR
Exame fsico e ginecolgico
Raio-x de trax
Hemograma, funo renal, fosfatase alcalina
7RPRJUDDRXUHVVRQkQFLDGHDEGRPHHSHOYH

Estadios IVB ou recidiva sistmica


Primeira linha para doena metasttica ou para aqueles que recidivam aps ter quimioradioterapia exclusiva
O tratamento da doena metasttica pode ser feito com quimioterapia exclusiva ou combinada
com radioterapia (para controle lgico e de sangramento).

II. Estadiamento
Categoria
TNM*

Estdio
FIGO*

'HQLo}HV
Tumor primrio

Cisplatina 50 mg/m2 EV D1 e
3DFOLWD[HO 135 mg/m2 EV 3 horas D1
Cada 21 dias, por 6 ciclos
JCO 22: 3113-9, 2004

TX

Tumor primrio no pode ser avaliado

T0

No h evidncia de tumor primrio

Tis

Carcinoma in situ

2 opo, em pacientes debilitados:

T1

7XPRUFRQQDGRjYDJLQD

Cisplatina 50mg/m2 EV em 1h por 6 ciclos ou


3DFOLWD[HO 80 mg/m2 EV , Semanal ou
Vinorelbina 25mg/m2 EV , Semanal ou

T2

II

Tumor invade tecidos paravaginais mas no se estende


parede plvica

T3

III

Tumor que se estende parede plvica

Carboplatina como acima, se contraindicao para cisplatina,

T4

IVA

J Clin Oncol 15:165, 1997


J Clin Oncol 3:1079, 1985

+LVWRORJLDVPHQRVIUHTXHQWHV
Adenocarcinoma: o tratamento clnico superponvel ao de clulas escamosas. No indicamos
DFRQL]DomRHPIXQomRGDPXOWLIRFDOLGDGHGDVOHV}HVHFRQVHTHQWHGLFXOGDGHQDDYDOLDomRGDV
margens.
Carcinomas neuroendcrinos: doena agressiva, no deve ser tratada com cirurgia exclusiva.
A quimioterapia adjuvante ou paliativa deve ser semelhante dos carcinomas neuroendcrinos
agressivos.

Linfonodos Regionais***
NX

Linfonodos regionais no podem ser avaliados

N0
N1

Ausncia de metstase em linfonodos regionais


IVB

MX

Metstases distncia no podem ser avaliadas

M0

Ausncia de metstases distncia


IVB

IV. Seguimento

| 62 |

Presena de metstase em linfonodos plvicos ou inguinais


Metstases distncia

M1

Exame fsico e ginecolgico trimestral nos 03 primeiros anos


Raio-x de trax e TC abdome e pelve a cada 6 meses.

Tumor invade a mucosa vesical ou retal, e/ou se estende alm


da plvis verdadeira. Nota: A presena de edema bolhoso no
pHYLGrQFLDVXFLHQWHSDUDFODVVLFDUXPWXPRUFRPR7

Presena de metstases distncia (inclui metstases para


linfonodos plvicos)

III.Tratamento
CEC, estdio I a II
Radioterapia +Braquiterapia ou Cirurgia exclusiva

| 63 |

Tratamento dos estdios I e II de cncer vaginal primrio com radioterapia externa e braquiterapia em altas doses pode produzir altas taxas de resposta controle local e sobrevida com
complicaes mnimas.
*\QHFRO2QFRO2FW  
Radiother Oncol 85:362370,(2007)
FIGO Annual Report,Vol. 26
Radiation Oncology 2008, 3:7

Estdio III e IVa


Radioterapia e braquiterapia com quimioterapia baseada em cisplatina 40mg/m2 por semana
durante a radioterapia por 6 semanas
FIGO Annual Report,Vol. 26
Int J Radiat Oncol Biol Phys.62(1):138-47,2005

(VWiGLR,9E VRPHQWHDTXHODVVHPFRPRUELGDGHVJUDYHVHERP36
1 linha
Cisplatina 50 mg/m2 a cada 3 ou 4 semanas
Gynecol Oncol 23:101-4, 1986

Recidiva local
Pode haver altas taxas de resposta utilizando braquiterapia em altas doses, trabalho retrospectivo e apresentou toxicidade tardia importante no grupo previamente irradiado.
Radiation Oncology 2008, 3:7

Vl. Cncer Ginecolgico


3.Vulva
CID C51

,([DPHVGHHVWDGLDPHQWR
Exame plvico, ginecolgico e retal
TC de abdmen e pelve
Raio-x de trax
Hemograma , funo heptica e renal
Linfonodo sentinela se possvel (JCO 18: 2811,2000)

II.Estadiamento
Categoria
TNM*

Estdio
FIGO*

Tumor primrio
TX

Tumor primrio no pode ser avaliado

T0

Adenocarcinoma de vagina (Bulky)

'HQLo}HV

No h evidncia de tumor primrio

Tis

Carcinoma in situ

T1

7XPRUFRQQDGRjYXOYDRXYXOYDHSHULW{QHRFPRXPHQRV
em sua maior dimenso

T1a

IA

7XPRUFRQQDGRjYXOYDRXYXOYDHSHULW{QHRFPRXPHQRVHP
sua maior dimenso e com invaso estromal no superior a 1 mm

T1b

IB

7XPRUFRQQDGRjYXOYDRXYXOYDHSHULW{QHRFPRXPHQRV
em sua maior dimenso e com invaso estromal superior a 1 mm

T2

II

7XPRUFRQQDGRjYXOYDRXYXOYDHSHULW{QHRPDLVTXHFPHPVXD
dimenso

IV. Seguimento

T3

III

Tumor de qualquer tamanho com disseminao por contigidade para uretra inferior e/ou vagina ou anus

Mensal por trs meses: inspeo da vagina


Trimestral por nove meses: inspeo local e vaginoscopia
Semestral por dois anos: inspeo local e vaginoscopia

T4

IVA

Quimioterapia neoadjuvante com:


Cisplatina 50 mg/m2 em nove semanas e
'R[RUUXELFLQD 50mg/m2 acada 21 dias
Seguido de histerectomia radical + Radioterapia para aquelas com fatores de risco detectados
cirurgia.
ou Radioterapia exclusiva para as inoperveis
*\QHFRO2QFRO  

T invade qualquer um dos seguintes: uretra superior, mucosa


YHVLFDOPXFRVDUHWDORX[DGRDRRVVRGDS~ELV
Linfonodos Regionais***

NX

Linfonodos regionais no podem ser avaliados

N0

Ausncia de metstase em linfonodos regionais

N1

III

N2

IV

Presena de metstase em linfonodos regionais unilaterais


Presena de metstase para linfonos regionais bilaterais
Metstases distncia

| 64 |

MX

Metstases distncia no podem ser avaliadas

M0

Ausncia de metstases distncia

| 65 |

M1

IVB

Presena de metstases distncia (inclui metstases para


linfonodos plvicos)

Vl. Cncer Ginecolgico


4. Sarcomas Uterinos

*Os estdios da FIGO tm por base os estadiamentos cirrgicos. Os estdios do TNM tm por base a
FODVVLFDomRFOtQLFDHRXSDWROyJLFD

(VWDFODVVLFDomRQmRVHDSOLFDSDUDRPHODQRPDGHYXOYD
CID C54

,([DPHVGHHVWDGLDPHQWR

III.Tratamento

Hemograma, funo renal , fosfatase alcalina


7RPRJUDDVGHDEGRPHSHOYHHWyUD[

EC IA
Resseco local com margens cirrgicas de 2cm.
EC IB e II
Tratamento cirrgico com exciso local radical do tumor ou vulvectomia , com margens
cirrgicas de 2cm e disseco dos linfonodos inguinais bilaterais. Caso linfonodo positivo,
radioterapia adjuvante
The Cochrane Library, Issue 4, 2007. Oxford: Update Software
2EVWHWULFVDQG*\QHFRORJ\
,QWHUQDWLRQDO-RXUQDORI5DGLDWLRQ2QFRORJ\%LRORJ\3K\VLFV
-RXUQDORI5DGLDWLRQ2QFRORJ\%LRORJ\3K\VLFV

EC III e IVA
Em pacientes com doena localmente avanada e linfonodos normais aos exames clnico
e de imagem, recomendamos quimioradioterapia neoadjuvante, com radioterapia direcionada ao tumor inicial, seguida de exciso do leito tumoral e linfonodos inguinais. Caso haja
linfonodos comprometidos, aps linfadenectomia (vistos no AP), tratamento adjuvante com
RT plvica e inguinal. Se linfonodos livres, apenas observao no ps operatrio.
The Cochrane Library, Issue 4, 2007. Oxford: Update Software.

1 opo:
Cisplatina 40 mg/m2 semanal concomitante radioterapia.
Alternativa: Em pacientes apresentando contra-indicao para o uso de cisplatina,
carboplatina AUC 2 semanal em concomitncia radioterapia.

II. Estadiamento
Estadio I
IA:WXPRUOLPLWDGRDRHQGRPpWULR
IB:LQYDVmRWXPRUDOPHWDGHGRPLRPpWULR
IC: invaso tumoral > metade do miomtrio.
Estadio II:WXPRUHQYROYHRFRUSRHDFpUYLFHXWHULQD
IIA:DSHQDVHQYROYLPHQWRHQGRFHUYLFDOJODQGXODU
IIB: envolvimento do estroma cervical.
Estadio III:WXPRUHVWHQGHVHDOpPGR~WHURSRUpPHVWiFRQQDGRjSHOYHYHUGDGHLUD
IIIA: LQYDVmRGDVHURVDHRXDQH[RVHRXFLWRORJLDSHULWRQHDOSRVLWLYD
IIIB:PHWiVWDVHVYDJLQDLV
IIIC: metstases para linfonodos plvicos e/ou para-articos.
IVA:LQYDVmRGDEH[LJDHRXPXFRVDLQWHVWLQDO
IVB: metstases distncia.
Categorias
TNM

Estdios
da FIGO

TX

Cncer de vulva (IVB)


Vide cncer de colo uterino EC IVB.

O tumor primrio no pode ser avaliado

T0

Cncer de vulva com recidiva locorregional em rea no irradiada


Radioquimioterapia ou radioterapia isolada para aquelas pacientes com comorbidades
importantes.
Cncer de vulva com recidiva locorregional em rea previamente irradiada
Avaliao da cirurgia para exenterao plvica
Gynecol Oncol 58:202,1995
The Cochrane Library, Issue 4, 2007. Oxford: Update Software

IV.Seguimento
Exame fsico trimestral nos primeiros dois anos, seguido de exame semestral do terceiro

ao quinto ano.
3K\VLFV

| 66 |

Tis

No h evidncia de tumor primrio


0

Carcinoma in situ (carcinoma pr-invasivo)

T1

7XPRUFRQQDGRDRFRUSRXWHULQR

T1a

IA

7XPRUFRQQDGRDRHQGRPpWULR

T1b

IB

Tumor que invade menos que a metade do miomtrio

T1c

IC

Tumor que invade a metade ou mais do miomtrio

T2

II

Tumor que invade o colo uterino, mas no se estende


alm do tero

T2a

IIA

Somente envolvimento endocervical glandular

T2b

IIB

Invaso cervical estromal

T3 e/ou N1

III

'LVVHPLQDomRORFDOHRXUHJLRQDOFRPRHVSHFLFDGRHP
T3a, T3b e N1, e IIIA, IIIB e IIIC da FIGO, abaixo:

| 67 |

T3a

IIIA

Tumor que compromete a serosa e/ou os anexos


(extenso direta ou metstase) e/ou presena de clulas
malignas em lquido asctico ou lavados peritoneais

T3b

IIIB

Comprometimento vaginal (extenso direta ou metstase)

N1

IIIC

Metstase para linfonodos plvicos e/ou para-articos

T4

IVA

Tumor que invade a mucosa vesical e/ou intestinal.

IVB

Metstase distncia (excluindo metstase para a vagina,


serosa plvica ou anexos)

M1

artica, seguido de quimioterapia. Radioterapia plvica para estdio II.


(XU-&DQFHU

(VTXHPDTXLPLRWHUiSLFR
Ifosfamida 1800mg/m2 D1 a D5
Mesna 1800mg/m2 D1 a D5
'R[RUUXELFLQD 25mg/m2 D1 e D2
*&6)SUROiWLFR, 300 mcg/SC/dia/5dias com intervalo de 21 dias, por 4 ciclos
$GDSWDGRGRHVWXGR*\QHFRO2QFRO
Gynecol Oncol 64:265, 1997

Estadio IVb e Tumores de Alto Grau (Sarcomas Indiferenciados)


1 linha:
Ifosfamida 1800mg/m2 EV D1 ao D5
Mesna 1800mg/m2 D1 a D5
'R[RUUXELFLQD 25mg/m2 EV D1 e D2
*&6)SUROiWLFR, 300 mcg/SC/dia/5dias com intervalo de 21 dias, por 4 ciclos

Tipos mais comuns de Sarcoma Uterino:


Carcinossarcoma (40%50%).
Leiomiossarcoma (30%).
Sarcoma do Estroma Endometrial (15%).

Adaptamos do estudo Gynecol Oncol 75:495, 1999


Gynecol Oncol 64:265, 1997

III.Tratamento
Sarcoma do Estroma Endometrial
(VWDGLDPHQWRSDWROyJLFR,H,,H7XPRUGH%DL[R*UDX
Histerectomia total + salpingo-ooforectomia bilateral + linfadenectomia plvica e para-artica

2 linha:
Gencitabina, 900 mg/m EV nos D1 e D8
'RFHWD[HO, 100 mg/m EV no D8
a cada 3 semanas, associados a G-CSF, 300 mcg SC do D9 ao D15
Gynecol Oncol 109:323, 2008

(Gynecol Oncol 96: 402,2005)

(VWiGLRSDWROyJLFR,,,,9$H7XPRUGH%DL[R*UDX
Histerectomia total + salpingo-ooforectomia bilateral + linfadenectomia plvica e paraartica, seguido de radioterapia plvica adjuvante, demonstrou diminuio das taxas de
recorrncia local, porm no evidenciou aumento na sobrevida global
(Int J Gynecol Cancer 13:4,2003).

3DFLHQWHVFRPFRPRUELGDGHVLPSRUWDQWHVHRXEDL[DSHUIRUPDQFH
'R[RUUXELFLQD 50 mg/m2 EV D1 a cada 21 dias
Cancer 52:626, 1983
Ifosfamida 1500mg/m2 EV D1 ao D5 a cada 21 dias

No existe estudo randomizado que corrobora o uso de adjuvncia.


(VWiGLR,9%H7XPRUHVGH%DL[R*UDX
1 linha
Acetato de megestrol VO 160mg/dia
Obstet Gynecol 64:173, 1984

2 linha
Letrozol VO 2,5mg/dia
Avaliar na recidiva a indicao de ooforectomia bilateral, se cirurgia ao diagnstico tiver
sido apenas histerectomia simples.
Obstet Gynecol 40:487,1972

Estadio Patolgico I e Tumores de Alto Grau (Sarcomas Indiferenciados)


Histerectomia total + salpingo-ooforectomia bilateral + linfadenectomia plvica e paraartica, seguida de radioterapia plvica.
Int J Radiat Oncol Biol Phys 44:47-52,1999
(XU-&DQFHU

Estdio Patolgico II-IVa e Tumores de Alto Grau (Sarcomas Indiferenciados)


Histerectomia total + salpingo-ooforectomia bilateral + linfadenectomia plvica e para-

| 68 |

Obstret Gynecol 87:747, 1996

Leiomiossarcoma
Estadio Patolgico I-IVa
Histerectomia total + salpingo-ooforectomia bilateral com ou sem linfadenectomia plvica. No h benefcio de radioterapia plvica nesse subtipo.
Estadio IVb
1 linha:
Gencitabina, 900 mg/m EV D1 e D8
'RFHWD[HO 100 mg/m EV D8 a cada 21 dias, associados a G-CSF, 300 mcg SC do D9
ao D15
Gynecol Oncol 109:323, 2008

2 linha:
Doxorrubicina 50mg/m EV D1 a cada 3 semanas por 4 a 6 ciclos
Cancer 52:626, 1983
Gynecol Oncol 97(2):624-37,2005

Carcinossarcoma
Estdio I-IVA
Histerectomia total + salpingo-ooforectomia bilateral + linfadenectomia plvica e paraartica, seguido de quimioterapia.

| 69 |

Radioterapia plvica nos estdios I-II.


(XU-&DQFHU

Vl. Cncer Ginecolgico


(QGRPpWULR

1 opo:
Carboplatina AUC 6 EV D1
3DFOLWD[HO 175 mg/m EV D1
$FDGDGLDVSRUFLFORV)DYRUHFHPRVRXVRGHGHVVHHVTXHPDSHORPHOKRUSHUOGH
toxicidade.
*\QHFRO2QFRO

CID C54

,([DPHVGH(VWDGLDPHQWR
Exame plvico (ginecolgico e retal)
Hemograma completo, fosfatase alcalina, creatinina, uria, CA125
Raio-x de trax
7RPRJUDDHRX5HVVRQkQFLDGHDEG{PHQHSHOYHQDVXVSHLWDGHGRHQoDORFDOPHQWH

2 opo:
Ifosfamida 1.5 g/m EV D1 a D4
Mesna 1.5 g/m EV D1 a D4
Cisplatina 20 mg/m EV D1 a D4
A cada 21 dias por 3 ciclos
*\QHFRO2QFRO
*\QHFRO2QFRO
*\QHFRO2QFRO

avanada/metasttica
Cistoscopia e retossigmoidoscopia na suspeita de invaso vesical ou de retossigmide

II. Estadiamento
Doena recorrente ou metasttica (IVB)
1 linha:
Carboplatina AUC 6 EV
D1
3DFOLWD[HO 175 mg/m EV D1
$FDGDGLDV)DYRUHFHPRVRXVRGHGHVVHHVTXHPDSHORPHOKRUSHUOGHWR[LFLGDGH
*\QHFRO2QFRO
Ifosfamida 1.5 g/m EV D1 a D4
Mesna 1.5 g/m EV D1 a D4
Cisplatina 20 mg/m EV D1 a D4

A cada 21 dias
*\QHFRO2QFRO

Para pacientes idosas ou com comorbidades realizar monoterapia com platina, paclitaxel ou
ifosfamida.

IV. Seguimento
([DPHItVLFRDFDGDPHVHVSRUDQRVDSyVDFDGDPHVHV
Raio-x de Trax anual
7RPRJUDDV5HVVRQkQFLDFRQIRUPHLQGLFDomRFOtQLFD
No h benefcio na solicitao de marcadores tumorais (Int J
*\QHFRO&kQFHU

| 70 |

Categorias Estdios
TNM
da FIGO
TX

O tumor primrio no pode ser avaliado

T0

No h evidncia de tumor primrio

Tis

Carcinoma in situ (carcinoma pr-invasivo)

T1

7XPRUFRQQDGRDRFRUSRXWHULQR

T1a

IA

7XPRUFRQQDGRDRHQGRPpWULR

T1b

IB

Tumor que invade menos que a metade do miomtrio

T1c

IC

Tumor que invade a metade ou mais do miomtrio

T2

II

T2a

IIA

Tumor que invade o colo uterino, mas no se estende alm


do tero
Somente envolvimento endocervical glandular

T2b

IIB

Invaso cervical estromal

T3 e/ou N1

III

T3a

IIIA

T3b

IIIB

Comprometimento vaginal (extenso direta ou metstase)

N1

IIIC

Metstase para linfonodos plvicos e/ou para-articos

T4

IVA

Tumor que invade a mucosa vesical e/ou intestinal.

M1

IVB

Metstase distncia (excluindo metstase para a vagina,


serosa plvica ou anexos)

'LVVHPLQDomRORFDOHRXUHJLRQDOFRPRHVSHFLFDGRHP7D
T3b e N1, e IIIA, IIIB e IIIC da FIGO, abaixo:
Tumor que compromete a serosa e/ou os anexos (extenso
direta ou metstase) e/ou presena de clulas malignas em
lquido asctico ou lavados peritoneais

| 71 |

G1 - tumores bem diferenciados


G2 - tumores moderadamente diferenciados
G3 - tumores indiferenciados

Carboplatina AUC 5 EV D1 e
3DFOLWD[HO 175 mg/m EV D1

Ciclos de 21 dias para pacientes idosas, com contra-indicao ao esquema anterior ou que
tenham recebido o esquema anterior no tratamento adjuvante.
-&OLQ2QFRO
-&OLQ2QFRO
-&OLQ2QFRO

III.Tratamento
Estdio I
IA: histerectomia total + salpingooforectomia bilateral + linfadenectomia plvica e parartica. Braquiterapia e/ou radioterapia plvica em grau 3.
IB: histerectomia total + salpingoofarectomia bilateral + linfadenectomia plvica e parartica. Braquiterapia e/ou radioterapia plvica para tumores grau 2 ou 3 ou com invaso
vascular linftica.
IC: histerectomia total + salpingoofarectomia bilateral + linfadenectomia plvica e parartica seguido de braquiterapia e/ou radioterapia plvica. Quimioterapia adjuvante para
tumores grau 3.
Estdio II
Histerectomia total + salpingooforectomia bilateral + linfadenectomia plvica e parartica seguido de braquiterapia e/ou radioterapia plvica. Quimioterapia adjuvante para tumores grau 3.
Estdio III-IVA
Histerectomia total + salpingooforectomia bilateral + linfadenectomia plvica e parartica
seguido quimioterapia adjuvante e radioterapia plvica.
+LVWRORJLDVGHVIDYRUiYHLV FDUFLQRPDVHURVRSDSLOtIHURHFDUFLQRPDGHFpOXODV
claras)
Tratamento adjuvante com radioterapia e quimioterapia independente do estadiamento.
Esquemas de quimioterapia adjuvante:
'R[RUXELFLQD 60 mg/m2 EV D1 e
Cisplatina 50 mg/m2 EV D1

Hormonioterapia paliativa com acetato de Megestrol 160 mg via oral por 3 semanas alternado com tamoxifeno 40 mg via oral por 3 semanas uma opo para pacientes oligossintomticas com tumores bem diferenciados e com positividade para receptores hormonais.
*\QHFRO2QFRO

Aps a primeira linha de tratamento avaliar a possibilidade da incluso do paciente em


ensaios clnicos.

IV. Seguimento

Exame clnico a cada 3-6 meses por 2 anos e aps anualmente


Citologia onctica vaginal a cada 6 meses por 2 anos e aps anualmente
Raio-X de trax anualmente e CA125 a cada visita se elevado ao diagnstico.
7RPRJUDD5HVVRQkQFLDTXDQGRFOLQLFDPHQWHLQGLFDGR

Vl. Cncer Ginecolgico


6. Ovrio
CID C 56

Ciclos de 21 dias por 7 ciclos, seguido por um ciclo de cisplatina


3DFOLWD[HO 175 mg/m EV D1 e
Carboplatina AUC 5 EV D1

6.1.1 Cncer epitelial de ovrio

O tratamento ser o mesmo para cncer epitelial primrio de ovrio, peritnio e tuba uterina

Ciclos de 21 dias por 6 ciclos para pacientes idosas ou com comorbidades que contra-indiquem o esquema anterior.
2EVWHW*\QHFRO  
/DQFHW  
*\QHFRO2QFRO
-&OLQ2QFRO  
-&OLQ2QFRO 6 VDEVW

Estdio IVB ou recidiva irressecvel


Quimioterapia paliativa:
Cisplatina
50 mg/m EV D1 e
'R[RUUXELFLQD 45 mg/m EV D1
Ciclos de 21 dias.

,&ODVVLFDomR
$SOLFiYHOSDUDRVWXPRUHVHVWURPDHSLWHOLDLVVXSHUFLDLVPDOLJQRVLQFOXLQGRDTXHOHVGH
malignidade limtrofe ou de baixo potencial de malignidade. Os cnceres no epiteliais
WDPEpPSRGHPVHUFODVVLFDGRVXVDQGRHVWHHVTXHPD'HYHKDYHUFRQUPDomRKLVWROyJLFD
da doena e diviso dos casos por tipo histolgico.

,,([DPHVGH(VWDGLDPHQWR

'R[RUUXELFLQD

60 mg/m EV D1
Ciclos de 21 dias para pacientes com contra-indicao a platina.

| 72 |

Raio-X de trax, se alterado complementar com TC de trax


7RPRJUDDVGHDEGRPHVXSHULRUHSHOYH
8OWUDVRQRJUDDWUDQVYDJLQDOTXDQGRQHFHVViULR
CA 125

| 73 |

CEA em portadoras de adenocarcinoma mucinoso


Puno de derrame pleural e citologia onctica se houver derrame pleural
Citologia onctica de ascite, quando presente
Funo renal, heptica e hemograma completo

III. Estadiamento
Categoria
TNM*

Estdio
FIGO*

Tumor primrio no pode ser avaliado

T0

No h evidncia de tumor primrio

T1b

Tumor limitado aos ovrios (um ou


ambos)

IA

7XPRUOLPLWDGRDXPRYiULRFiSVXOD
intacta, ausncia de tumor na superfcie
ovariana. Ausncia de clulas malignas em
lquido asctico ou lavados peritoneais**

IB

7XPRUOLPLWDGRDDPERVRYiULRVFiSVXOD
intacta, ausncia de tumor na superfcie
ovariana. Ausncia de clulas malignas
em lquido asctico ou em lavados
peritoneais***

T1c

IC

Tumor limitado a um ou ambos ovrios


com qualquer um dos seguintes achados:
cpsula rompida, tumor na superfcie
ovariana, clulas malignas em lquido
asctico ou em lavados peritoneais

T2

II

Tumor que envolve um ou ambos os


ovrios, com extenso plvica

T2a

IIA

Extenso e/ou implantes no tero e/ou em


WURPSD V VHPFpOXODVPDOLJQDVHPOtTXLGR
ascitico ou em lavados peritoneais

T2b

IIB

([WHQVmRSDUDRXWURVWHFLGRVSpOYLFRVVHP
clulas malignas em lquido asctico ou em
lavados peritoneais

IIC

Extenso plvica (2 ou 2b), com clulas


malignas em lquido asctico ou em lavados
peritoneais

III

Tumor que envolve um ou ambos os


ovrios com metstase peritoneal fora da
SpOYLVFRQUPDGDPLFURVFySLFDPHQWHHRX
metstase em linfonodo regional

T2c

T3 e/ou N1

T3a

Metstase peritoneal macroscpica, alm


da plvis, com 2 cm ou menos em sua
maior dimenso

T3c e/ou N1

IIIC

Metstase peritoneal, alm da plvis, com


mais de 2 cm em sua maior dimenso, e/ou
metstase em linfonodo regional

'HQLo}HV

TX

T1a

IIIB

M1

Tumor primrio

T1

T3b

IIIA

Metstase peritoneal microscpica, alm


da plvis

| 74 |

NX

Metstase distncia, exclui metstase


perironeal

IV

Linfonodos Regionais***
Linfonodos regionais no podem ser
avaliados

N0

Ausncia de metstase em linfonodos


regionais

N1

Presena de metstase em linfonodos


regionais
Metstases distncia****

MX

Metstases distncia no podem ser


avaliadas

M0

Ausncia de metstases distncia

M1

Presena de metstases distncia (exclui


metstases peritoneais)

*Os estdios da FIGO tm por base os estadiamentos cirrgicos. Os estdios do TNM tm


SRUEDVHDFODVVLFDomRFOtQLFDHRXSDWROyJLFD
$SUHVHQoDGHDVFLWHQmRPDOLJQDQmRpFODVVLFDGD$SUHVHQoDGHDVFLWHQmRPRGLFDR
estdio, a menos que clulas malignas estejam presentes. Metstases em cpsula heptica:
T3/estdio III, metstases em parnquima heptico: M1/estdio IV. Derrame pleural precisa
ter citologia onctica positiva para ser considerado M1/estdio IV.
***Os linfonodos regionais so os hipogstricos (obturadores), ilacos comuns, ilacos
externos, sacrais laterais, para-articos e inguinais.
**** Exclui metstases peritoneais.

IV.Tratamento
Histologia
(cisto)Adenocarcinoma seroso (papilfero)
(cisto)Adenocarcinoma mucinoso
(cisto)Adenocarcinoma endometriide
Adenocarcinoma de clulas claras
Carcinomas indiferenciados
Cncer epitelial de ovrio estdio I
IA, grau 1 ou 2 e IB grau 1: cirurgia exclusiva
IA grau 3, IB grau 2 ou grau 3: quimioterapia sistmica adjuvante

| 75 |

IC ou II, todos os graus: quimioterapia sistmica adjuvante


Clulas claras, todos IA ou IB: quimioterapia sistmica adjuvante
Ruptura de cpsula antes ou aps a cirurgia

Tratamento anterior com platina):


1. 3DFLHQWHVQmRH[SRVWRVDWD[DQRVSUHYLDPHQWH
3DFOLWD[HO 175 mg/m2 EV em 3 hs no D1
Cada 21 dias

(VTXHPD
Carboplatina AUC 6 EV D1 e
3DFOLWD[HO 175 mg/m2 EV em 3 horas D1
Cada 21 dias. 6 ciclos

JCO 10:1748-53, 1992

*\QHFRO2QFRO
-1&,

2. 3DFLHQWHVUHIUDWiULRVDSODWLQDHWD[DQRV
'R[RUXELFLQD lipossomal 40 mg/m2 EV em 1 hora D1
Cada 4 semanas
JCO 19:3312-22, 2001

Cncer epitelial de ovrio estdio II ou III


Quimioterapia sistmica adjuvante

Pacientes refratrios ou resistentes a platina com progresso e doena aps uma linha de
quimioterapia sistmica: considerar a incluso em ensaios clnicos

(VTXHPD
Carboplatina AUC 6 EV D1 e
3DFOLWD[HO 175 mg/m2 EV em 3 horas D1
Cada 21 dias. 6 ciclos
Ann Oncol 16 suppl 8:viii7-viii12, 2005
Gynecol Oncol 85:71-80, 2002
NEJM 351:2519-29, 2004

Cncer epitelial de ovrio, estdio IV


Quimioterapia sistmica paliativa

V. Seguimento
Trimestral nos dois primeiros anos e semestral nos trs anos seguintes.
Exame clnico em todas as consultas
Em pacientes que alcanaram resposta completa e normalizao do CA125 ao trmino

do tratamento: CA125 a cada consulta e realizar exames de imagem para diagnstico de


progresso se houver sintomatologia compatvel ou se houver elevao do CA 125

(VTXHPD
Carboplatina AUC 6 EV D1 e
3DFOLWD[HO 175 mg/m2 EV em 3 horas D1
&DGDGLDV(QTXDQWREHQHFLRFOtQLFR

2YiULR7XPRUHVGRFRUGmRVH[XDO

Cncer epitelial de ovario recidiva


Paciente sensvel a platina (resposta completa ao tratamento inicial com platina e intervalo
livre de recidiva maior que seis meses do trmino do tratamento)
Carboplatina AUC 6
EV D1 e
3DFOLWD[HO
175 mg/m2 EV em 3 horas D1
Cada 21 dias por 6 ciclos
JCO 22:3120-5, 2004

3DFLHQWHVFRPQHXURWR[LFLGDGHVLJQLFDWLYDQRWUDWDPHQWRDQWHULRU
Carboplatina AUC 4 EV D1
Gencitabina 1000mg/m2 EV em 30 minutos D1 e D8
Cada 21 dias, por 6 ciclos
JCO 24:4699-707, 2006

ou

,&ODVVLFDomR

Utiliza-se a mesma proposta para os tumores epiteliais

II.Histologia
Tumores da granulosa do tipo adulto
Tecoma
Fibroma-Fibrossarcoma
Tumor Estromal Esclerosante
Sertoli
Leydig
Sertoli-Leydig

Carboplatina AUC 5 EV D1
'R[RUUXELFLQD lipossomal 30 mg/m2 EV D1

Cada 28 dias, por 6 ciclos


-&26

Pacientes refratrios ou resistentes a platina ( progresso durante QT


baseada em platina ou doenca estavel como a melhor resposta quimioterapia anterior
baseada em platina ou recidiva em menos que seis meses apos ter sido completado

| 76 |

,,O([DPHVGH(VWDGLDPHQWR
Raio-x de trax, se alterado, solicitar TC de trax
TC de abdome superior e pelve
Funo heptica, renal e hemograma completo
Marcadores tumorais:
nos tumores da granulosa, inibina (se disponvel), estradiol e testosterona

| 77 |

Estdio I pouco diferenciado ou com componente retiforme ou com elementos mesen-

nos tumores de Sertoli e Leydig: andrgenos

IV.Tratamento

Tumores da granulosa tipo adulto


(VWiGLR,EDL[RULVFR
Histerectomia total abdominal ou salpingo-ooforectomia
Considerar cirurgia com preservao de fertilidade e estadiamento em pacientes jovens
No est indicada quimioterapia sistmica adjuvante.
(VWiGLR,DOWRULVFRRXHVWiGLRPDLRUTXH,
&ULWpULRVGHDOWRULVFR
IC com ruptura perioperatria
Presena de ascite maligna
Presena de alto ndice mittico (maior que 4-10 mitoses por campo de grande aumento)
Ausncia de corpos de Call-Exner
Tumor maior que 10 a 15 cm
Idade superior a 40 anos
Invaso do espao linfovascular
Doena macroscpica residual
Quimoterapia sistmica adjuvante
(VTXHPD%(3
Bleomicina
30 U
EV semanal e
Etoposide
100 mg/m2 EV D1-D5 e
Cisplatina
20 mg/m2 EV D1-D5
Cada 21 dias, por quatro ciclos
5HFLGLYDSpOYLFDRXLQWUDDEGRPLQDO
Citorreduo quando possvel

Recidiva
(VTXHPD%(3RXFRPELQDo}HVFRQWHQGRSODWLQDHWD[DQR 7,3
-&OLQ2QFRO
JCO 16:1287, 1998
JCO 12:701-6, 1994

V. Seguimento

Trimestral nos dois primeiros anos e semestral nos trs anos seguintes e anual aps cinco

anos. Recidivas tardias (mais que 10 anos) no so incomuns.


Exame clnico em todas as consultas
tumores da granulosa: inibina pode ser bastante til para diagnstico precoce da recidiva.
tumores de Sertoli-Leydig: andrgenos podem ser teis.
Sugerimos RX de trax e TC de abdome e pelve pelo menos uma vez a cada seis meses
nos primeiros cinco anos.

O&ODVVLFDomR

5HFLGLYDFRPPHWiVWDVHVjGLVWkQFLD
Quimioterapia sistmica baseada em platina (BEP, TIP)

Utiliza-se a mesma proposta para os tumores epiteliais


-&OLQ2QFRO
J Clin Oncol 16:1287, 1998
JCO 12:701-6, 1994

7HFRPDVHEURPDVGRRYDULR
Sem indicao de quimioterapia adjuvante
Tumores de Sertoli-Leydig (androblastomas)
(VWiGLR,EDL[RULVFR
Histerectomia total abdominal ou salpingo-ooforectomia
Considerar cirurgia com preservao de fertilidade e estadiamento em pacientes jovens
No est indicada quimioterapia sistmica adjuvante.

| 78 |

Quimioterapia sistmica adjuvante


(VTXHPD%(3 FRPRDFLPD TXDWURFLFORV

2YiULR7XPRUHVGHFpOXODVJHUPLnativas

Quimioterapia sistmica baseada em platina (BEP,TIP)


Considerar radioterapia para doena localizada

(VWiGLR,DOWRULVFRRXHVWiGLRPDLRUTXH,
&ULWpULRVGHDOWRULVFR

quimais heterlogos.
IC com ruptura perioperatria
Presena de ascite maligna
Presena de alto ndice mittico (maior que 4-10 mitoses por campo de grande aumento)
Ausncia de corpos de Call-Exner
Tumor maior que 10 a 15 cm
Idade superior a 40 anos
Invaso do espao linfovascular
Doena macroscpica residual

ll. Histologia

Disgerminomas
Teratomas imaturos
Carcinomas de celulas embrionaria
Tumores do seio endodermico
Coriocarcinomas ovarianos nao gestacionais
Poliembriomas
Tumores germinativos mistos

lll. Estadiamento
Raio-x de trax, se alterado TC de trax
TC de abdome superior e pelve

| 79 |

0DUFDGRUHVWXPRUDLV'+/DOIDIHWRSURWHtQDJRQDGRWURQDFRUL{QLFD EHWD+&*

0HWRWUH[DWH 1 mg/kg IM D1, D3, D5 e D7 e leucovorim 0,1 mg/kg IM D2, D4, D6 e D8,

cada 14 dias
Quimioterapia sistmica adjuvante (exceto para disgerminomas IA e teratoma imaturo
estadio IA e grau 1)

2 opo:
Dactinomicina, 0,12 mcg/kg EV D1-D5 (mximo de 0,5 mg/dia), cada 14 dias
*\QHFRO2QFRO-DQ  
&DQFHU1RY  
*\QHFRO2EVWHW,QYHVW  

Quimoterapia sistmica adjuvante


(VTXHPD%(3
Bleomicina 30 U EV semanal e
Etoposide 100 mg/m2 EV D1-D5 e
Cisplatina 20 mg/m2 EV D1-D5
Cada 21 dias, por quatro ciclos
JCO 12:701-6, 1994
JCO 17:2760-75, 1999
Gynecol Oncol 95:496-9 2004
JCO 25:2938-43, 2007

Recidiva
(VTXHPD%(3RXFRPELQDo}HVFRQWHQGRSODWLQDHWD[DQR 7,3

lV. Seguimento

Exame clnico e marcadores tumorais a cada quatro semanas e RX de trax a cada 12

semanas no primeiro ano.


Exame clnico, marcadores tumorais e RX de trax a cada trs meses no segundo ano.
Exame clnico, marcadores tumorais e RX de trax a cada seis meses por mais trs anos.
TC de trax, abdome e pelve se houver elevao do marcador ou sintomas.

3DFLHQWHVUHIUDWiULRVDPRQRWHUDSLD0$&,,,PRGLFDGR
0HWRWUH[DWH 1 mg/kg/d IM D1, D3, D5 D7 e
Leucovorim 0.1 mg/kg/d IM D2, D4, D6, D8 e
Dactinomicina 12 mcg/kg/d EV D1-D5 (mx 0,5 mg) e
Ciclofosfamida 3 mg/kg/d EV D1-D5
*\QHFRO2QFRO2FW  

Estdios II e II alto risco ou estdio IV


3ROLTXLPLRWHUDSLD, EMA-CO
Etoposide 100 mg/m2 EV em 30 min D1 e D2 e
0HWRWUH[DWH 100 mg/m2 EV bolus seguido por 200 mg/m2 EV em 12 hs D1 e
Dactinomicina 0.5 mg EV bolus D1 e D2 e
Leucovorin 15 mg VO cada12 hs por 4 doses, incio 24 hs aps o ncio do MTX e
Ciclofosfamida 600 mg/m2 EV D8 e
Vincristina 1.0 mg/m2 EV on D8
5HSURG0HG2FW  

Vl. Cncer Ginecolgico


7. Neoplasia Trofoblstica Gestacional
CID C58
(VWiGLR,KLVWHUHFWRPLDRXHPSDFLHQWHVTXHGHVHMDPSUHVHUYDUDIHUWLOLGDGH
PRQRTXLPLRWHUDSLD
1 opo:
0HWRWUH[DWH 1 mg/kg IM D1, D3, D5 e D7 e leucovorin 0,1 mg/kg IM D2, D4, D6 e D8,
cada 14 dias
2 opo:
Dactinomicina, 0,12 mcg/kg EV D1-D5 (mximo de 0,5 mg/dia), cada 14 dias
*\QHFRO2QFRO-DQ  
&DQFHU1RY  
*\QHFRO2EVWHW,QYHVW  

(VWiGLRV,,RX,,,EDL[RULVFR
1 opo:

| 80 |

| 81 |

Vll. Cncer de Pulmo


1. 1HRSODVLDGHSXOPmRQmRSHTXHQDVFpOXODV

Estdio
0

TisN0M0

IA

T1a-1bN0M0

IB

T2aN0M0

CID C34

T1a-2aN1M0

IIA

T2bN0M0

,([DPHVGHHVWDGLDPHQWR
Hemograma, DHL, fosfatase alcalina, enzimas hepticas, bilirrubinas , funo renal, ccio srico
7RPRJUDDGHWyUD[DEGRPHSHOYH
5HVVRQDQFLDGHHQFpIDORHFLQWLORJUDDyVVHDVHVLQWRPDV
Considerar mediastinoscopia com bipsia se linfonodos mediastinais suspeitos para

acometimento secundrio

T2bN1M0

IIB

T3N0M0
T3N1M0

IIlA

T1a-3N2M0
T4N0-1M0
T1a-4N3M0

IIlB

,,(VWDGLDPHQWR $-&&6pWLPDHGLomRYiOLGRDSDUWLUGHMDQHLUR
de 2010)
7[ tumor primrio no-avalivel
T0: sem evidncia de tumor primrio
Tis: tumor in situ
T1: Tumor 3cm na sua maior dimenso, no invade a pleura visceral, e no tem evidncia
broncoscpica de invaso mais proximal do que um brnquio lobar
T1a: tumor 2cm
T1b: tumor >2cm a 3cm
T2: Tumor com qualquer uma das seguintes caractersticas: >3 cm mas <7 cm na sua maior
dimenso, invade o brnquio fonte com sua extenso proximal a pelo menos 2 cm da carina. Invade a pleura visceral, ou associado com atelectasia ou pneumonite obstrutiva que
se extende regio hilar sem envolver o pulmo inteiro
T2a: tumor >3cm a 5cm
T2b: tumor >5cm a 7cm
T3: Tumor com qualquer uma das seguintes caractersticas: >7cm em sua maior
dimenso,invaso da parede torcica (incluindo tumores do sulco superior), diafragma,
nervo frnico, pleura mediastinal, pericrido parietal, invade o brnquio fonte com sua
extenso proximal a menos de 2 cm da Carina, sem invaso da mesma, associado com
atelectasia ou pneumonite obstrutiva que se extende ao pulmo inteiro, ou ndulos tumorais separados no mesmo lobo do tumor primrio
T4: tumor de qualquer tamanho que invade mediastino, corao, grandes vasos, traquia,
esfago, carina, corpo vertebral, ndulos tumorais separados no em lobos diferentes do
pulmo ipsilateral
1[: linfonodos no avaliveis
N0: sem metstase em linfonodos regionais
N1: metstase em linfonodo peribrnquicos e/ou hilares ipsilaterais e linfonodos intrapulmonares
N2: metstase em linfonodos mediastinais ipsilateral e/ou subcarinais
N3: metstase em linfonodos mediastinais contra-laterais, hilo contralateral, escaleno ipsilateral ou contralateral ou linfonodos supraclaviculares
M0: ausncia de metstase a distncia
M1a: derrame pleural maligno, derrame pericrdico ou ndulos pulmonares contralaterais
M1b: metstase a distncia

| 82 |

T4N2M0

IV

qqTqNM1a-1b
5HIHUrQFLD$QQ7KRUDF&DUGLRYDVF6XUJ)HE  

III.Tratamento
I-IIIa: tratamento cirrgico se paciente com condies clnicas
QT adjuvante:
Para pacientes com doena EC II-III totalmente ressecada. Considerar quimioterapia para
estdio Ib
Cisplatina
80 mg/m2 EV D1
Vinorelbina
30 mg/m2 EV D1, D8, D15
Repetir a cada 3 semanas, total de 4 ciclos
N Engl J Med 350:351,2004

3DUDSDFLHQWHVQmRFDQGLGDWRVDRHVTXHPDDQWHULRU
&DUERSODWLQD3DFOLWD[HO
3DFOLWD[HO 175mg/m2 EV D1
Carboplatina AUC 6 EV D1
Intervalo 21dias, 4 ciclos
Semin Oncol 24 (Suppl 12): S12-14 - S12-17,1997

(VTXHPDFRPELQDGRFRPUDGLRWHUDSLDSDUDGRHQoDLUUHVVHFiYHO(&,,,$RX,,,%
Cisplatina
50 mg/M2 EV D1,D8, D29 e D36
Etoposdeo 50 mg/m2 EV D1-D5 e D29-D33
Repetir a cada 3 semanas, total de 4 ciclos
J Clin Oncol 21:2004, 2003

Para pacientes com ECOG 2 considerar quimioterapia com cisplatina semanal durante a
radioterapia com 30 mg/m2 ou radioterapia isolada
Primeira linha para doena metasttica EC IV:
At o momento nenhum esquema de QT mostrou superioridade sobre os demais. O nmero

| 83 |

de ciclos recomendado 4, observar e, introduzir QT de segunda linha quando progredir.


Cisplatina 80 mg/m2 EV D1
Gencitabina 1000 mg/m2 EV D1, D8
Repetir a cada 3 semanas, total de 4 ciclos

METSTASE ADRENAL ISOLADA;


Considerar resseco cirrgica em pacientes com longo intervalo livre de doena e com
bom performance status.
-&20DU  

$QQ2QFRO(SXE1RY

Opo:
&DUERSODWLQD3DFOLWD[HO
3DFOLWD[HO 175mg/m2 EV D1
Carboplatina AUC 6 EV D1
Intervalo 21-28 dias, 4 ciclos

V. Seguimento
Exame fsico trimestral nos primeiros dois anos, semestral do terceiro ao quinto ano para
Semin Oncol 24 (Suppl 12): S12-14 - S12-17,1997

Para pacientes com baixo performance status (ECOG 2), mais de 70 anos ou intolerncia a
platina prefervel a monoquimioterapia.

pacientes ressecados
7RPRJUDDFRQWUDVWDGDGRWyUD[DFDGDPHVHVDWpDQRVGRGLDJQyVWLFRHGHSRLV
WRPRJUDDVHPFRQWUDVWHDQXDOSDUDSDFLHQWHVRSHUDGRVHTXHUHDOL]DUDPDGMXYkQFLD
Recomendao NCCN 2009
7RPRJUDDVGHFUkQLRWyUD[DEGRPHSHOYHHFLQWLORJUDDyVVHDGHYHPVHUVROLFLWDGRV

conforme sintomas relatados pelo paciente

Gemcitabina
Gemcitabina 1g/m2 EV D1, D8 e D15
Intervalo 28 dias
J Clin Oncol 12: 1535-40, 1994.

Vinorelbine
Vinorelbine 30 mg/m2 EV D1, D8
Intervalo 21- 28 dias

Vll. Cncer de Pulmo


1HRSODVLDGHSXOPmRSHTXHQDVFpOXODV

J Natl Inst. 95: 362-72, 2003

Segunda linha para doena metasttica ou localmente avanada:


'RFHWD[HO 75 mg/m2 a cada 21 dias
-&OLQ2QFRO-XQ  
-&OLQ2QFRO0D\   

Para pacientes no fumantes, portadores de adenocarcinoma, e em especial naqueles com


mutaes ativadoras do EGFR, em segunda ou terceira linha:
Erlotinib 150 mg/dia VO ,continuamente.
1(QJO-0HG-XO  
J Clin Oncol 22 (16): 3238-47, 2004

CID C34

,([DPHVGHHVWDGLDPHQWR
Hemograma, funo renal e heptica, fosfatase alcalina, DHL, eletrlitos
7RPRJUDDVGHWyUD[DEGRPHSHOYHHFUkQLR
&LQWLORJUDDyVVHD

II.Estadiamento(Veterans Administration Lung Cancer


Study Group)
Doena limitada:WXPRUFRQQDGRDXPKHPLWyUD[HOLQIRQRGRVUHJLRQDLVTXHSRGHP

IV.SITUAES ESPECIAIS
TUMOR DE PANCOAST:
Cisplatina 50mg/m2 d1, d8, d29 e d36 associada a Etoposideo 50mg/m2 d1 a d5 e d29 a d33
ambos IV concomitantes Radioterapia na dose de 45Gy durante 5 semanas.
Toracotomia 3 a 5 semanas aps induo.
02 ciclos adicionais de quimioterapia adjuvante semelhantes ao esquema de induo.
7KH-RXUQDORI7KRUDFLFDQG&DUGLRYDVFXODU6XUJHU\

METSTASE CEREBRAL ISOLADA:


3DUDSDFLHQWHVFRPGRHQoDFRQWURODGDIRUDGRFpUHEURHERPSHUIRUPDQFHVWDWXVUHVVHFo cirrgica, quando factvel, seguida de Radioterapia de crebro total.
Radiocirurgia, se disponvel, para tumores de at 3 cm aps radioterapia de crebro total.
&XUU2QFRO$XJ  

| 84 |

ser envolvidos em um s campo da radioterapia


'RHQoDH[WHQVD doena que no seja limitada

III.Tratamento
QT concomitante com RT para pacientes com doena limitada
Tratar com VP16 e cisplatina e iniciar a RT concomitante ao primeiro ciclo de QT, em um
total de quatro ciclos.
93FLVSODWLQD o esquema de quimioterapia padro do departamento.
VP16 80mg/m2 EV 1h D1 a D3
Cisplatina 80 mg/m2EV 2hs D1

Intervalo 21 dias

| 85 |

-&OLQ2QFRO  
1(QJO-0HG  

QT adjuvante
Aps cirurgia de neoplasia de pulmo pequenas clulas recomendamos:
Se N0
VP16 80mg/m2 EV 1h D1 a D3
Cisplatina 80 mg/m2EV 2hs D1
Intervalo 21 dias por 4 ciclos

IV. Seguimento
Exame fsico trimestral nos primeiros dois anos, semestral do terceiro ao quinto ano para

pacientes ressecados
7RPRJUDDVGHFUkQLRWyUD[DEGRPHSHOYHHFLQWLORJUDDyVVHDGHYHPVHUVROLFLWDGRV
conforme sintomas relatados pelo paciente

6H1
Tratamento combinado com radioterapia e quimioterapia
VP16 80mg/m2 EV 1h D1 a D3
Cisplatina 80 mg/m2EV 2hs D1

Intervalo 21 dias por 4 ciclos


Primeira linha para doena metasttica ou localmente avanada
No h um esquema que tenha demonstrado uma superioridade inquestionvel
sobre os demais.
VP16 80mg/m2 EV 1h D1 a D3
Cisplatina 80mg/m2 EV 2hs D1

Intervalo 21 dias, de 4 a 6 ciclos


-&OLQ2QFRO  
-&OLQ2QFRO  

CAV
Vincristina 2mg EV D1
'R[RUXELFLQD 50mg/m2 EVD1
Ciclofosfosfamida 1g/m2 EVD1
Intervalo 21 dias, 4 a 6 ciclos
-&OLQ2QFRO  

Obs:Para pacientes com bom performance clnico e com doena extensa que apresentaram resposta a quimioterapia de induo e sem doena em SNC recomendamos radioteraSLDSUROiWLFDGHFUkQLR
N Engl J Med 357:664,2007

Segunda linha para doena metasttica ou localmente avanada


No possvel eleger um esquema como sendo a primeira opo em segunda linha.
aceitvel oferecer um outro esquema de primeira linha (como segunda) que use drogas
diferentes, ou monoquimioterapia:
3DFOLWD[HO
3DFOLWD[HO 80mg/m2 EV semanal
Intervalo 28 dias
Anticancer Res 26:777, 2006

VP oral
VP16 50mg/m2 VO D1 a D21
Intervalo 28 dias
Semin Oncol 19 (Suppl 14): 28-35, 1992.

| 86 |

| 87 |

Vlll. Timona Invasivo e Carcinoma Tmico


No h indicao de tratamento adjuvante
Neoadjuvncia: Para primeira linha pacientes com estadiamento clnico III ou IVA,

considerar os mesmos esquemas que o tratamento paliativo

lX. Mesotelioma
Mesotelioma pleural
CID C45.0

QT

,([DPHVGHHVWDGLDPHQWR

Primeira linha para doena metasttica


No h um esquema que tenha demonstrado uma superioridade inquestionvel
sobre os demais.

Hemograma, DHL
7RPRJUDDGHWyUD[HDEGRPH
PET-CT se disponvel

PAC:
Cisplatina 50mg/m2 EV D1
Adriamicina 50mg/m2 EV D1
Ciclofosfamida 500mg/m2 EV D1
Intervalo 21-28 dias, 4 -6 ciclos

II.Estadiamento
-&OLQ2QFRO

93FLVSODWLQD
VP16 80mg/m2
EV 1h D1 a D3
cisplatinaPJP(9KV' GRVHPRGLFDGD
Intervalo 21 dias, 4-6 ciclos
J Clin Oncol 14: 814-820, 1996

Segunda linha para doena metasttica ou localmente avanada


No h um esquema que seja aceito como segunda linha. aceitvel oferecer um outro
esquema de primeira linha (como segunda) que use drogas diferentes ou monoquimioterapia com paclitaxel ou gencitabina

T1a: tumor limitado a pleura parietal ipsilateral, incluindo a pleura mediastinal e a pleura
diafragmtica e sem envolvimento da pleura visceral
T1b: tumor limitado a pleura parietal ipsilateral, incluindo a pleura mediastinal e a pleura
diafragmtica, alem de focos esparsos de envolvimento da pleura visceral
T2: tumor envolvendo cada uma das superfcies pleurais(parietal,mediatsinal, diafragmtica
e visceral) e pelo menos um dos seguintes achados: invaso do diafragma e/ou tumor conXHQWHHQYROYHQGRDSOHXUDYLVFHUDORXLQYDVmRGRSDUrQTXLPDSXOPRQDUDGMDFHQWH
T3: tumor que envolve qualquer superfcie pleural homolateral, com pelo menos uma das
seguintes condies: invaso da fscia endotorcica, invaso da gordura mediastinal, foco
solitrio de tumor invadindo partes moles da parede torcica, envolvimento do pericrdio,
no transmural
T4: tumor que envolve qualquer superfcie pleural homolateral, com pelo menos uma
das seguintes condies: invaso multifocal ou difusa de partes moles da parede torcica,
qualquer envolvimento de costela, invaso do peritnio, atravs do diafragma, invaso de
qualquer rgo mediastinal, extenso direta da pleura contralateral, invaso da medula espinhal, extenso a superfcie interna do pericrdio,invaso do miocrdio, derrame pericrdico
com citologia positiva, invaso do plexo braquial
N0: linfonodos regionais no invadidos
N1: metstase para linfonodos broncopulmonares ipsilaterais ou hlares
N2: linfonodos subcarinais ou mediastinais ipsilaterais
N3: linfonodos mediastinais contralaterais, ou cadeia mamria interna contralateral, ou
linfonodos supraclaviculares ipsilaterais ou contralaterais
M0: sem metstase
M1: metstase a distancia

III.Tratamento
Estdio

| 88 |

IA

T1aN0M0

IB

T1bN0M0

Il

T2N0M0

| 89 |

T3N0M0
IIl

T1-3N1M0
T1-3N2M0
T4qqNM0

IV

qqTN3M0
qqTqqNM1

Estdios I e II
Pneumectomia extrapleural
No indicamos tratamento adjuvante
Neoadjuvncia: Pode ser indicado cirurgia no tratamento de doena que se torne
opervel aps incio da quimioterapia
QT PARA DOENA METASTTICA
3HPHWUH[HGHFLVSODWLQD
3HPHWUH[HGH 500mg/m2 EV 1h D1
Cisplatina 75mg/m2 EV 2hsD1
Intervalo 21 dias
J Clin Oncol 21 (14): 2636-44, 2003

QT protocolos alternativos
'R[RUXELFLQD 60mg/m2 D1
Cisplatina 60mg/m2 D1 ambos a cada 21 dias
Cancer 67:2984, 1991
Navelbine 30mg/m2 D1, D8 e D15 a cada 28 dias
J Clin Oncol 18:3912, 2000

Mesotelioma peritoneal
CID C45.1

,([DPHVGHHVWDGLDPHQWR

X. Melanoma
CID C44

,([DPHVGH(VWDGLDPHQWR
Recomendao.
Estgio clnicos I e II ou Paciente N1a e Breslow < 4 mm no ulcerado
Raio-x de Trax e DHL
Comprometimento nodal macroscpico ou N1a com Breslow > 4mm ou ulcerado
Exames laboratoriais com DHL
TC Trax e Abdome
TC de pelve se primrio abaixo da cicatriz umbilical
TC de pescoo de primrio de cabea ou pescoo
RNM de crnio se documentada doena metasttica

II. Estadiamento
&ODVVLFDomR710SDUD0HODQRPDFXWkQHR
T1:PP
a: sem ulcerao,
b: com ulcerao ou Clark IV e V*
T2: DPP a: sem ulcerao,
b: com ulcerao
T3:DPP a: sem ulcerao,
b: com ulcerao
T4: > 4,0 mm
a: sem ulcerao,
b: com ulcerao
N1: um linfonodo positivo a: micro, b: macrometstases
N2: dois a trs linfonodos positivos a: micro, b: macrometstases, c: metstases em trnsito/satlites e sem metstases linfonodais
N3: quatro ou mais linfonodos positivos ou coalescentes, ou metstases em
trnsito/satlite com metstases linfonodais.
M1: metstases a distncia para a: pele, tecido subcutneo ou linfonodo distante,
b: pulmo, c: outros rgos ou DHL elevado
AJCC 2002

Hemograma, DHL, funo renal


5DLR[GHWyUD[7RPRJUDDGHDEGRPHSHOYH
PET-CT se disponvel

Estdio I: T1-T2aN0M0 (sobrevida em 5 anos = 95%)


Estdio II: T2b-T4bN0M0 (sobrevida em 5 anos = 70%)
Estdio III: qqTN1-3M0 (sobrevida em 5 anos = 40%)

II.Estadiamento

Estdio IV: qqTqqNM1 (sobrevida em 5 anos = 5%)

Sem estadiamento padro

III.Tratamento

III.Tratamento
Peritonectomia com QT intraperitoneal para doena localizada
Para doena metaststica recomendamos os mesmos esquemas usados no tratamento

Tratamento Adjuvante
No indicamos tratamento adjuvante

do mesotelioma pleural metastatico

| 90 |

| 91 |

Quimioterapia paliativa
Primeira linha
Dacarbazina 1000mg/m2 D1 a cada 21 dias.

3DFLHQWHVFRPPHWiVWDVHVH[WUDKHSiWLFDV
DTIC 1000mg/m2 a cada 21 dias.
J Clin Oncol 17: 2745,1999.
J Clin Oncol 17: 2745-2751, 1999

Seguimento
Consultas a cada 6 meses com USG de abdome
exames laboratoriais (funo heptica)
3DFLHQWHVMRYHQVERP.36HGRHQoDPHWDVWiWLFDH[WHQVD
CVD Cisplatina 20mg/m2 D1 a D4
Vimblastina 2mg/m2 D1 a D4 a cada 21 dias.
DTIC 800mg/m2 D1
J Clin Oncol 20:2411,2002

Segunda linha
Necessita de discusso caso a caso.
Sugestes:
3DFOLWD[HO 175mg/m2 a cada 21 dias
J Natl Cancer Inst Monogr. 15:185-187, 1993
Interferon alfa 3.000.000u SC 3x semana contnuo
Curr Opin Oncol 8 (2): 167-74, 1996

IV.Seguimento clnico
Recomendao.
Estdio I:
Exame clnico e DHL a cada 4 a 6 meses, nos primeiros 2 anos, a cada 6 meses, at 5 anos.
Raio-x de trax a cada 6 meses, nos primeiros 2 anos a cada 6 a 12 meses, at 5 anos.
Aps 5 anos, avaliao clnica anual.
Estdio II:
Exame clnico e DHL a cada 3 meses, nos primeiros 2 anos, a cada 6 meses, at 5 anos.
Raio-x de trax a cada 6 meses, nos primeiros 2 anos, a cada 6 a 12 meses, at 5 anos.
Aps 5 anos, avaliao clnica anual.
&RQVLGHUDUXOWUDVRQRJUDD 86 GDFDGHLDQRGDOGDUHJLmRGHGUHQDJHPQRGDODFDGD
retorno, caso a pesquisa do linfonodo sentinela no tenha sido realizada.
Estdio III:
igual ao estgio II, sem considerar o US de cadeias nodais.

Melanoma de Coride

No est indicado tratamento adjuvante.


Quimioterapia Paliativa
3DFLHQWHVFRPPHWiVWDVHVKHSiWLFDVH[FOXVLYDV
Quimioembolizao com Cisplatina

| 92 |

| 93 |

Xl. Tumores do Sistema Nervoso Central

1. d) Tratamento na recorrncia:
G &RQVLGHUDUFLWRUUHGXomRFLU~UJLFDDGLFLRQDOVHDPRUELGDGHIRUEDL[D

CID C71

1.d.2) Avaliar RT focal

I.Diagnstico

A ressonncia nuclear magntica (RNM) a modalidade de escolha para o diagnstico,


FODVVLFDomRGHQLomRGDPHOKRUHVWUDWpJLDWHUDSrXWLFDHQRDFRPSDQKDPHQWR0DVR
padro-ouro para o diagnstico permanece sendo a bipsia.

1.d.3) Tratamento sistmico Considerar as opes:


Carmustina 200mg/m2 EV D1
ou
Carmustina 80mg/m2 EV D1-D3
A cada 6-8 semanas

II.Estadiamento

$GPLQLVWUDUFLFORV6HKRXYHUUHVSRVWDFOtQLFDRXWRPRJUiFDFRQWLQXDUDWpSURJUHVVmRGD
doena ou dose total de 1000mg/m2.
Lomustina 130mg/m2 (CCNU)
A cada 6-8 semanas

1RFDVRGRVWXPRUHVGR61&DFODVVLFDomREDVHDGDQR710QmRVHDSOLFD

British J Cancer (2000) 83:588-93


Irinotecano 125 mg/m2 D1, D8, D15, D22

II.Tratamento

A cada 6 semanas
(em pacientes que no tomam anticonvulsivantes indutores enzimticos)

1. Glioblastoma
1. a) Cirurgia
Recomenda-se sempre que possvel a resseco mxima possvel.

Irinotecano 350 mg/m2 D1, D8, D15, D22

1. b) Radioterapia
Recomenda-se a irradiao parcial do crebro compreendendo o volume tumoral (GTV)
com margem de 2 cm. Dose total de 60 Gy em 6 semanas. Em pacientes idosos pode-se
considerar RDT isolada em dose de 40 Gy em 15 dias.
-&2 

1.c) Quimioterapia
Pacientes com resseco macroscpica total ou parcial
ECOG 0 a 2
,GDGHDQRVVHQGRTXHHPSDFLHQWHVDFLPDGHDQRVDSHQDVRVTXHDSUHVHQWDP
006( VFRUH! HPFRQGLo}HVSDUDRH[HUFtFLRGDVDWLYLGDGHVSURVVLRQDLVKDELWXDLV
7XPRUHVSRUWDGRUHVGHPHWLODomRGRSURPRWRUGRJHQHTXHFRGLFDSDUDDHQ]LPD
MGMT (metil-guanina DNA-metil-transferase), independente da extenso da resseco.
*MMSE = Mini-Mental Status Exam

5HFRPHQGDPRVRHVTXHPDDEDL[R
Temozolamida 75mg/m2/dia VO concomitante RDT e, posteriormente,
Temozolamida 150 a 200mg/m2 VO D1 a D5 a cada 28 dias x 6 ciclos
1(-0
-&OLQ2QFRO

Ateno:5HFRPHQGDVHSUROD[LDSDUD3MHURYHFLLFRP70360='6FRPSULPLGRDR
dia, trs vezes por semana, durante a durao da RT.
Seguimento
Para pacientes tratados em adjuvncia, deve-se fazer RM 6 semanas aps a radioterapia e,
posteriormente, a cada 3 meses.

A cada 6 semanas
(em pacientes que tomam anticonvulsivantes enzima indutores: difenil-hidantona, fenobarbital e carbamazepina)
Neuro Oncol (2002) 56:183
Neuro Oncol (2006) 8: 189

OBS: Estes pacientes sero considerados para incluso em estudo clnico sempre que possvel.
2. Astrocitomas anaplsicos
Recomendamos a resseco cirrgica sempre que possvel. Aps o tratamento cirrgico
indicamos a radioterapia nos mesmos moldes dos glioblastomas. O papel da quimioterapia
controverso. No h estudos randomizados de boa qualidade a respeito de quimioterapia
adjuvante.
Deste modo, recomendamos para este grupo de pacientes uma de duas opes:
Radioterapia isolada,

ou
Radioterapia seguida de quimioterapia com esquema PCV:
Procarbazina 60mg/m2/dia VO D8 a D21
CCNU 110mg/m2 VO D1
Vincristina 1,4 mg/m2 EV D8 a D29 (mximo 2 mg)
Reciclar a cada 6 semanas, por 6 ciclos.
/DQFHW

3. Oligodendrogliomas anaplsicos (ou oligoastrocitomas)


A resseco cirrgica recomendada sempre que possve, do mesmo modo dos astrocitomas anaplsicos. Indicamos aps o tratamento cirrgico, uma de duas opes abaixo:
Radioterapia isolada (60 Gy / 30 fraes)

| 94 |

| 95 |

ou
PCV

Carmustina 200mg/m2 EV D1
Procarbazina 60mg/m2/dia VO D8 a D21
CCNU 110mg/m2 VO D1
Vincristina 1,4 mg/m2 EV D8 a D29 (mximo 2 mg)

Reciclar a cada 6 semanas, por 6 ciclos.


J Clin Oncol 24:2715-2722
J Clin Oncol 24:2707-2714
-&OLQ2QFRO 0D\VXSSODEVWU/%$

ou
Carmustina 80mg/m2 EV D1-D3
A cada 6-8 semanas
Seguimento
Para pacientes submetidos a tratamento adjuvante, o seguimento deve ser feito com RM a
cada 3 a 6 meses por cinco anos. Aps esse perodo, a freqncia dos exames diminui.

*OLRPDVGH%DL[RJUDX JOLRPDVJUDX,,20&

5) Meduloblastoma / Pinealoblastomas (os casos em adultos so muito raros)

Inclui:
Astrocitomas difusos
Oligodendrogliomas
Oligoastrocitomas

5. 1) Estadiamento:
Ressonncia magntica, incluindo todo o neuro-eixo e a anlise do lquor (para evidenciar a
disseminao tumoral so mandatrias.
5. 2.) Tratamento

4. a) Tratamento:

5. 2.a) Cirurgia

4.a.1) Cirurgia
Sempre que possvel indicamos a resseco cirrgica. H dados retrospectivos e mais
recentemente o estudo RTOG 9802 demonstrou a importncia da extenso da resseco
como fator prognstico.
4.a.2) Tratamento ps-operatrio
Para efeito de indicao de terapia ps-operatria, dividimos os pacientes em dois grupos
de risco, de acordo com a extenso da resseco e a idade:
%DL[R5LVFR resseco macroscpica completa e idade < 40 anos (ambos)
Alto Risco: resseco sub-total/ bipsia e/ ou idade > 40 anos.
DD %DL[R5LVFR
Para este grupo recomendamos observao vigilante, indicando tratamento na progresso.
4.a.2. b) Alto Risco
Uma de duas opes, dependendo de fatores prognsticos: idade, extenso da resseco e
histologia predominante (oligodendro vs. astrocitoma):
Idade < vs > 40 anos.
Resseco macro total ou sub-total vs. Bipsia
Em tumores mistos, componente Oligodendroglial vs. Astroctico predominante
4.a.2. b1) Radioterapia
Dose total = 54 Gy em 30 fraes
ou

5. 2.b) Radioterapia
Crnio-espinhal, com reforo na fossa posterior
5. 2.c) Quimioterapia (utilidade ainda no clara para pacientes adultos).
Indicado para pacientes de alto risco (resseco incompleta, envolvimento de tronco cerebral, acometimento de espao subaracnide ou citologia liqurica positiva). Nestes casos
indicamos:
Cirurgia seguida de RDT associado a:
Vincristina 1,5mg/m2 EV (mx. 2mg) semanal
Ao trmino da radioterapia, aps intervalo de 6 semanas, iniciamos a quimioterapia adjuvante:
Lomustina 75mg/m2 VO D1 (CCNU)
Cisplatina 68mg/m2 EV D1
VCR 1,5mg/m2 EV (mx. 2mg) semanal D1, D8, D15
Ciclos a cada 6 semanas por 8 ciclos
J Neurocir (1994) 81:690-8

5. 3 d) Recidiva tumoral
Quimioterapia paliativa:
CCNU/Cisplatina/VCR, nitrosurias, cisplatina ou carboplatina, ciclofosfamida, ifosfamida,
metotrexato, etoposdeo, vincristina.
Tumores raros do SNC

DE 5DGLRWHUDSLDVHJXLGDGHTXLPLRWHUDSLD 3&9 


Procarbazina 60mg/m2/dia VO D8 a D21
CCNU 110mg/m2 VO D1
Vincristina 1,4 mg/m2 EV D8 a D29 (mximo 2 mg)
Reciclar a cada 6 semanas, por 6 ciclos.
-&OLQ2QFRO 0D\VXSSODEVWU

 7XPRUHVGHFpOXODVJHUPLQDWLYDV
Responsveis por menos de 1% dos tumores acometendo o SNC em adultos. Localizados
preferencialmente na pineal e na regio supra-celar, podem eventualmente acometer o
tronco cerebral. Disseminao menngea pode ocorrer.
6.1) Estadiamento:
RM cerebral e de neuro-eixo com contraste

4.a.3) Recidiva tumoral:

| 96 |

| 97 |

Exame citolgico do liquor cefalorraquidiano


'HWHUPLQDomRGHQtYHLVGHDOIDIHWRSURWHtQDHJRQDGRWURQDEHWDFRUL{QLFDQRVRURHQR/&5

Xll. Sarcomas

6. 2) Tratamento
Devido a raridade destes tumors no h consenso sobre a melhor combinao de tratamentos, mas em geral observa-se uma tendncia a combinar-se quimio e radioterapia.

1. Partes moles

6. 2. a) Cirurgia
Pela localizao, em geral so pouco acessveis resseco. Alm disto, por serem tumores quimio e radiossensveis, a resseco cirrgica no necessria, exceo feita aos teratomas. Em geral a cirurgia tem papel diagnstico (bipsia aberta ou estereotxica).
6. 2. b) Radioterapia
Tumores localizados: RT local (volume tumoral)
Tumores com disseminao pelo neuro-eixo: adiciona-se a irradiao cranioespinhal
6. 3. c) Quimioterapia
Embora sejam tumores extremamente quimiossensveis, no h consenso sobre a melhor
combinao de drogas. Optamos pelo esquema abaixo (Bouffet et cols.) por ser a maior srie
reportada com resultados interessantes quando associado seqencialmente radioterapia.
So quatro ciclos alternados de dois regimes diferentes, precedendo a radioterapia:
(VTXHPD FLFORVH
Carboplatina 600 mg/m2 D1
Etoposdeo 150 mg/m2 D1 - D3
(VTXHPD FLFORVH
Ifosfamida 1,800 mg/m2 D1 - D5
Etoposdeo 150 mg/m2 D1 - D5
Alternativamente, planejamos implementar estudo piloto utilizando o esquema BEP por 4
ciclos precedendo a radioterapia.
Bouffet E. British Journal of Cancer (1999) 79(7/8), 11991204

CID C49(tecidos conjuntivos, subcutneo e outras partes moles)


C47(nervos perifricos)
C48(retroperitnio)

,([DPHVGH(VWDGLDPHQWR
7RPRJUDDGH7yUD[
Ressonncia Magntica da rea acometida
Em pacientes com sarcoma da regio abdominal incluir TC de abdome e pelve.
Lipossarcomas de Alto Grau Incluir TC Abdome e Pleve
Lipossarcoma Mixoide T2B considerar RNM de coluna total

II.Estadiamento do AJCC 2002


G1:EHPGLIHUHQFLDGR
G2:PRGHUDGDPHQWHGLIHUHQFLDGR
G3:SRXFRGLIHUHQFLDGR
G4: indiferenciado.
T1:WXPRUFPVXSHUFLDO D RXSURIXQGR E 
T2:WXPRU!FPVXSHUFLDO D RXSURIXQGR E 
N0:VHPPHWiVWDVHOLQIRQRGDO
N1: presena de metstase linfonodal.
M0: VHPPHWiVWDVHjGLVWkQFLD
M1: presena de metstase distncia.

7) Meningiomas
Considerar protocolo clnico se disponvel.
O uso de hidroxiuria tem sido uma alternativa para casos inoperveis ou para recidivas
irressecveis, porm com durao de respostas pouco animadoras.
Antiestrognicos e antiprogestgenos, como o tamoxifeno, so de uso questionvel.

Agrupamento (TNM)
Estdio I: G1 a G2, T1a a T2b, N0, M0
Estdio II: G3 a G4, T1a a T2a, N0, M0
Estdio III: G3 a G4, T2b, N0, M0
Estdio IV: qqGqqTN1M0 ou M1

8) Ependimomas
Considerar protocolo clnico se disponvel.
Em doenas recidivantes, BCNU pode ser utilizado.
BCNU 150-200mg/m2 EV D1 a cada 6-8 semanas

III.Tratamento

Alternativa:
CDDP 45-50mg/m2 EV D2 e D3
Etoposdeo 60-100mg/m2 EV D1, D2 e D3

Quimioterapia Neoadjuvante: pacientes com tumores grandes (principalmente > 10 cm),


de alto grau, com boa performance status e histologia favorvel quimioterapia cuja citorreduo pr-operatria do tumor possa facilitar a cirurgia evitando a amputao do membro.
Ifosfamida 2g/m2 D1 a D5
'R[RUUXELFLQD 25 mg/m2 D1 a D3

Mesna na mesma dose da ifosfamida, dividida em 2 aplicaes (pr e aps 4h)


GCS-F 300 mcg subcutneo 1 vez ao dia por 10 dias iniciando no D6 .

| 98 |

| 99 |

Reavaliao com imagem do membro acometido aps 2 ciclos.


Quimioterapia Adjuvante: quimioterapia baseada em antracclicos e ifosfamida para pacientes com doena com histologia favorvel (ex: Sarcoma Sinovial e Lipossarcoma Mixide),
de alto grau de malignidade, tamanho acima de 5 cm, primria de extremidades em pacientes
jovens (at 60 anos de idade) em bom estado geral, sem comorbidades que impeam o regime (em especial o uso da doxorrubicina em decorrncia da cardiotoxicidade).
Pacientes com condies clnicas que no permitam o esquema a seguir, no devem receber adaptaes (reduo primria de dose ou droga isolada)
(VTXHPD
Ifosfamida 2g/m2 D1 a D5
'R[RUUXELFLQD 25 mg/m2 D1 a D3.
5 ciclos com intervalos de 21 dias
Mesna na mesma dose da ifosfamida, dividia em 2 aplicaes (pr e aps 4h)
GCS-F 300 mcg subcutneo 1 vez ao dia por 10 dias iniciando no D6

Segunda Linha paliativa


DTIC 1000 mg/m2 isolado a cada 21 dias.
0RGLFDGRGH&DQ7UHDW5HS)HE  

Angiossarcoma
Tratamento para primeira linha: PRQRTXLPLRWHUDSLD
3DFOLWD[HO 80 mg/m2 semanal (D1, D8 e D15), ciclos a cada 28 dias.
J Clin Oncol 5269-5274, 2008
Eur J Cancer 44: 2433-2436, 2008

Tratamento para segunda linha Angiossarcoma: PRQRTXLPLRWHUDSLD


Doxorrubicina isolada 60 a 75mg/m2 a cada 21 dias.
(dose acumulativa mxima de 450 mg/m2)
-&OLQ2QF-XQ   

(J Clin Oncol 19: 1238-1247, 2001)

Radioterapia Adjuvante: Indicada para pacientes com tumores de extremidades de alto


grau e maiores de 5 cm, ou se margem comprometida.
Considerar o uso de braquiterapia se disponvel
Quimioterapia paliativa:
Tratamento para primeira linha: SROLTXLPLRWHUDSLD
Pacientes jovens, sem limitaes clnicas e performance preservada.
Ifosfamida 2g/m2 D1 a D5
'R[RUUXELFLQD 25 mg/m2 D1 a D3.

5 ciclos com intervalos de 21 dias


Mesna na mesma dose da ifosfamida, dividia em 2 aplicaes (pr e aps 4h)
GCS-F 300 mcg subcutneo 1 vez ao dia por 10 dias iniciando no D6
(J Clin Oncol 19: 1238-1247, 2001)

Tratamento para primeira linha: PRQRTXLPLRWHUDSLD


Pacientes idosos, com outras comorbidades ou performance limitada.
Pacientes idosos com funo cardaca normal.
Doxorrubicina isolada 60 a 75mg/m2 a cada 21 dias.
(dose acumulativa mxima de 450 mg/m2)
-&OLQ2QFRO-XQ   

3DFLHQWHVTXHMiXVDUDP'R[RUUXELFLQDQDDGMXYkQFLD
lfosfamida isolada na dose de 3 g/m2 IV em 3 horas (com MESNA) D1 a D3 a cada 21 dias.

IV.Seguimento
5DGLRJUDDGH7yUD[DFDGDPHVHVQRVSULPHLURVDQRVDFDGDPHVHVGRWHUFHLWRDR

quinto ano
Imagem do sitio primrio, a depender do risco recidiva
Sarcomas de Retroperitneo TC Abdome e Pelve a cada 3-4 meses nos dois primeiros anos.
Sarcomas de extremidades de alto grau Ressonncia Magntica a cada 6 meses nos dois
SULPHLURVDQRVDQXDOPHQWHDWpRTXLQWRDQR
Sarcomas de extremidades de baixo grau,T2B - Ressonncia Magntica anual at o quinto ano.

Xll. Sarcomas
2. Tumor Estromal Gastro-Intestinal (GIST)
,([DPHVGH(VWDGLDPHQWR
7RPRJUDDVGDUHJLmRDIHWDGD
Nos pacientes com doena inicial do esfago, estmago ou reto realizar endoscopia/colo-

noscopia com bipsia.


Ressonncia de Pelve pode contribuir na avaliao de ressecabilidade em massas plvicas.
Obs.: Evitar bipsia percutnea ou por agulha em leses abdominais ressecveis. Neste
caso, encaminhar para resseco do tumor primrio.

-&OLQ2QFRO-XO  

Pacientes com FE < 55% ou ICC


DTIC 1000mg/m2 a cada 21 dias .
0RGLFDGRGH&DQ7UHDW5HS)HE  

| 100 |

| 101 |

II.Estadiamento

Agrupamento Clnico IRSG

AFIP

Gstrico

No-gstrico

SG 5a %

Baixo risco

FPHTTPLW

FPHPLW

100

Intermedirio

> 2-5 cm e > 5 mit

!FPHPLW

88

Alto risco

> 5-10 cm e > 5 mit

FPH!PLW

50

Muito alto risco

> 10 cm e > 5 mit

> 10 cm e > 5 mit

19

Grupo I:Tumor completamente ressecado:


IAWXPRUFRQQDGRDRVtWLRGHRULJHP
IBWXPRUFRPLQOWUDomRGHyUJmRVDGMDFHQWHV

* Mit = mitoses por 50 CGA

Grupo II Cirurgia comprometida e/ou acometimento de linfonodos:


IIAWXPRUORFDOL]DGRFRPUHVVHFomRPDFURVFySLFDFRPSOHWDPDVUHVtGXRPLFURVFySLFR
IIBDFRPHWLPHQWROLQIRQRGDOUHJLRQDOFRPSOHWDPHQWHUHVVHFDGR
IIC acometimento linfonodal regional com resseco macroscpica, mas resduo microscpico.

III.Tratamento

Grupo III: Doena macroscpica residual:


IIIADSyVELySVLD
IIIB aps resseco de grande porte (> 50% de remoo).

Pacientes operados com doena residual ou com massas inoperveis, ou com doena
metasttica.
Imatinibe 400mg/d at progresso.
$YDOLDomRGHUHVSRVWDFRP7RPRJUDD&RPSXWDGRUL]DGDDFDGDPHVHV
J Clin Oncol. 26(4):620-5, 2008.

Aps progresso de doena, aumentar dose para 600mg/d.


Em caso de nova progresso progredir dose para 800mg/d.

Grupo IV: FRPSURPHWLPHQWRPHWDVWiWLFRjGLVWkQFLD


TNM
T1WXPRUFRQQDGRDRVtWLRGHRULJHP7DFP7E!FP
T2H[WHQVmRRX[DomRDyUJmRVDGMDFHQWHV7DFP7E!FP
N0 sem acometimento de linfonodos regionais.
N1 linfonodos regionais acometidos.
M0VHPPHWiVWDVHVjGLVWDQFLD0PHWiVWDVHVjGLVWkQFLD

N Engl J Med 347:472,2002.


J Clin Oncol. 25(9):1107-13, 2007

No caso de progresso aps 800mg, preferencialmente incluir em estudo clnico.


Se indisponvel, manter em dose mxima tolervel.

$JUXSDPHQWR710SUpWUDWDPHQWR ,56*
I: rbita, Cabea/Pescoo (exceto para-menngeo), Genito-Urinrio (exceto bexiga e prsWDWD 7RX7DRXE11RX1[0 VREUHYLGDGHHPDQRV 
II:%H[LJD3UyVWDWD([WUHPLGDGHV&DEHoD3HVFRoRSDUDPHQtQJHRRXWURV7RX7D
VRPHQWH 1RX1[0 VREUHYLGDGHHPDQRV 

IV. Seguimento
Pacientes operados, sem doena residual
Exame fsico trimestral nos dois primeiros anos, semestral do terceiro ao quinto ano
3DUDSDFLHQWHVGHULVFREDL[RHLQWHUPHGLiULRUHFRPHQGDVHWRPRJUDDVVHPHVWUDOQRV
dois primeiros anos , anual do terceiro ao quinto ano
3DUDSDFLHQWHVGHULVFRDOWRRXPXLWRDOWRUHFRPHQGDVHWRPRJUDDVDFDGDPHVHV
nos dois primeiros anos, semestral do terceiro ao quinto ano,.

III:%H[LJD3UyVWDWD([WUHPLGDGHV&DEHoD3HVFRoRSDUDPHQtQJHRRXWURV7RX7E1
M0, ou Qualquer T, N1, M0 (sobrevida de 52-69% em 5 anos).
IV: qualquer T, qualquer N, M1 (sobrevida de 23-30% em 5 anos).
Terapia Neoadjuvante pacientes de alto risco (Grupo 3)
VAC
Vincristina 1,5mg/m2 (max 2,0mg)
Actinomicina-D 0,015mg/kg/d (max 0,5mg)
Ciclofosfamida 2,2g/m2 (com Mesna na mesma dose)

Xll. Sarcomas
3. Rabdomiossarcoma

l. Estadiamento

Induo: Semanas 0 a 16
Semanas 0, 3, 6
VA C
Semanas 1,2,4,5,7,8 V
Semanas 9 e 12
V C
Semanas 10 e 11
V
Semana 16
VA C

&ODVVLFDomR,56*SUpFLU~UJLFD

Continuao: Semanas 20-46

CID C49.9

| 102 |

Radioterapia entre as
semanas 9 e 14

| 103 |

Semanas 20,23,29,32,38,41
Semanas 21,22,24,25

II.Estadiamento TNM

VA C
V

30,31,33,34
39,40,42,43
J Clin Oncol 19:3091-3102, 2001

Pacientes com doena metasttica tambm podem utilizar-se do mesmo esquema, porm
interrompido no momento da melhor resposta.
Tratamento de Resgate
Considerar quimioterapia em alta dose e resgate com transplante de medula ssea.
J Clin Oncol 17:2796-2803, 1999

Quimioterapia paliativa
Ifosfamida 1,8g/m2 D1-5
Etoposide 100mg/m2 D1-5
Filgrastin 300mcg SC por 10 dias
J Pediatr Hematol Oncol. 23(4):225-33, 2001.

ll. Seguimento clnico


Recomendao:
Exame Fsico e Raio -X de Trax a cada 3 meses nos dois primeiros anos, 6 meses do
WHUFHLURDRTXLQWRDQRHDQXDOPHQWHDSyVRTXLQWRDQRLQGHQLGDPHQWH
No casos de tumores abdominais e plvicos, TC de abdome e Pelve a cada 6 meses nos
GRLVSULPHLURVDQRVHDQXDOPHQWHDSDUWLUGRWHUFHLURDQRLQGHQLGDPHQWH
Nos casos de tumores de cabea e pescoo, TC de crnio, face ou pescoo 6 meses nos
GRLVSULPHLURVDQRVHDQXDOPHQWHDSDUWLUGRWHUFHLURDQRLQGHQLGDPHQWH
1RWD1mRKiGLUHWUL]HVGHQLGDV(VWDpXPDGDSWDomRGHXPDUHFRPHQGDomRTXHFRQVLGHramos economicamente razovel, sem prejuzo de seguimento do paciente.

Xll. Sarcomas

TX:WXPRUSULPiULRQmRDYDOLiYHO
T0:VHPHYLGrQFLDGRWXPRUSULPiULR
T1:WXPRUFP7WXPRU!FP
T3: presena de dois tumores separados no mesmo osso.
NX:OLQIRQRGRVQmRDYDOLiYHLV
N0:DXVrQFLDGHPHWiVWDVHVHPOLQIRQRGRV
N1: linfonodos com metstases (equivalente a doena metasttica).
MX:0HWiVWDVHVGLVWDQWHVQmRDYDOLiYHLV
M0:DXVrQFLDGHPHWiVWDVHV
M1:PHWiVWDVHDGLVWkQFLD0DDSHQDVSXOPmR
M1b:TXDOTXHURXWURORFDOGHPHWiVWDVHVLQFOXLQGROLQIRQRGRV*H*EDL[RJUDX
G3 e G4: alto grau.
Estdio IA:*710
Estdio IB:*710
Estdio IIA:*710
Estdio IIB:*710
Estdio III:TXDOTXHU*710
Estdio IVA:TXDOTXHU*TXDOTXHU710D
Estdio IVB: qualquer G, qualquer T, N0-1, M1b.
Osteossarcoma
Todos os pacientes com osteossarcoma so candidatos a abordagem multidisciplinar, objetivando cirurgia funcional com preservao de membro, sempre que possvel. A quimioterapia envolve a fase neoadjuvante (visando avaliar resposta in vivo pelo critrio de Huvos e
erradicao de micrometstases ) e adjuvante.
Quimioterapia com inteno curativa em pacientes com < 25 anos
)DVHGHLQGXomR SUpRSHUDWyULD 
Semanas 0 e 5
Cisplatina 0 mg/m IV, D1 e D2,
'R[RUUXELFLQD 25 mg/m IV, D1, D2, D3
Semanas 3, 4, 8 e 9
0HWRWUH[DWR 12 g/m (mximo de 20 g)

4. sseos

Seguido 24 horas aps de cido folnico, 15 mg (dose no ajustada) 6/6h


Manter at nvel srico de metotrexato esteja abaixo de 100 nmol/L ou 0,1 micromol/L.
Filgrastin 300mcg SC por 10 dias, aps cada ciclo.

CID C40

,([DPHVGH(VWDGLDPHQWR
Ressonncia Magntica de toda a extenso do osso comprometido
7RPRJUDD&RPSXWDGRUL]DGDGH7yUD[
&LQWLORJUDDVVHD

Fase de manuteno (ps-operatria):


Semanas 12 e 17
Cisplatina 60 mg/m IV, D1 e D2,
'R[RUUXELFLQD 25 mg/m IV, D1, D2, D3
Semanas 22 e 27
'R[RUUXELFLQD 25 mg/m IV, D1, D2, D3

| 104 |

| 105 |

Semanas 15, 16, 20, 21, 25, 26, 30 e 31


0HWRWUH[DWR 12 g/m (mximo de 20 g)
Seguido 24 horas aps de cido folnico, 15 mg (dose no ajsuatada) 6/6h
Manter at nvel srico de metotrexato esteja abaixo de 100 nmol/L ou 0,1 micromol/L.
Se nas doses de metotrexato anteriores aos ciclos de cisplatina e doxorrubicina houver
retardo de mais de 1 semana, a segunda dose omitida para que no se comprometa a
intensidade de dose da doxorrubicina.
(Adaptado J Clin Oncol 10: 1579,1992 )

Quimioterapia para pacientes com > 25 anos


'R[RUUXELFLQD 25mg/m2 IV D1, D2, D3
Cisplatina 50-60mg/m2 IV D1, D2
At 6 ciclos de 21 dias com G-CSF por 10 dias.

Pacientes com doena metasttica


Vincristina (V) 2,0 mg (dose total)
'R[RUUXELFLQD (D) 75 mg/m2
Ciclofosfamida (C) 1200 mg/m2 (com Mesna na mesma dose)
Actinomicina-D (A) 1,25mg/m2 (substituindo D aps dose max)
J Clin Oncol 22: 2873-6, 2004

Tratamento de Resgate
Topotecano 0,75mg/m2/d D1-5 cada 28 dias
Ciclofosfamida 250mg/m2/d D1-5
ou
Ifosfamida 1,8gm/2 D1-5 cada 21 dias
Etoposide 100mg/m2 D1-5
Filgrastim 300mcg/dia D6-10

(adaptado J Clin Oncol 10: 1579-1591, 1992)

Conforme a resposta, considerar quimioterapia em alta dose e resgate com transplante de


medula ssea.

Tratamento Paliativo aps falha da adjuvncia ou recidiva


Ifosfamida 1800 mg/m2 EV D1 a D5
Etoposide 100 mg/m2 EV D1 a D5
6 ciclos de 21 dias.

Pediatr Blood Cancer 44:338, 2005


Pediatr Blood Cancer 47:795, 2006
J Clin Oncol 22: 2873-6, 2004

(J Clin Oncol 20: 426-433, 2002)

Recomendamos uso de GCS-F 300 mcg subcutneo 1 vez ao dia, por 10 dias, iniciando no
D6 de cada ciclo.

Seguimento Clnico
7RPRJUDDGH7yUD[DFDGDPHVHVQRVSULPHLURVDQRVPHVHVGRWHUFHLUR
ao quinto ano, depois anualmente.
Realizar Ressonncia Magntica do sitio primrio acometido anualmente.

Xll. Sarcomas
5. (ZLQJ7XPRU1HXURHFWRGpUPLFR3ULPiULR

6.Tumores Desmides

Terapia Neoadjuvante
Vincristina (V) 2,0 mg (dose total)
'R[RUUXELFLQD (D) 75 mg/m2
Ciclofosfamida (C) 1200 mg/m2 (com Mesna na mesma dose)
Actinomicina-D (A) 1,25mg/m2
Ifosfamida (I) 1,8g/m2 x5d
Etoposide (E) 100mg/m2 x5d

,([DPHVGH(VWDGLDPHQWR
TC abdome e pelve (tumores intra-abdominais)
Colonoscopia (investigao de Sind. de Gardner)
7XPRUHVVXSHUFLDLVGHSDUWHVPROHVQHFHVVLWDPVRPHQWHGDDYDOLDomRORFDOSDUDSODQHMD-

mento cirrgico.

VDC* nos ciclos: 1,3,5,7,9,11,13,15,17


IE nos ciclos: 2,4,6,8,10,12,14,16 cada 3 semanas
D substituido por A ao atingir a dose de 375mg/m2
N Engl J Med 348:694, 2003

Tumores raros de crescimento lento sem potencial metasttico.Tumores extra-abdominais e de parede abdominal so tratados com cirurgia preferencialmente. Entretanto, os tumores intra-abdominais/mesentricos recorrentes devem ser tratados com terapia sistmica
devido ao alto ndice de recorrncia e morbidade cirgica.

N Engl J Med 348:694, 2003

Pacientes oligosintomticos com tumores irresecveis


7DPR[LIHQR 120mg/dia + Meloxican 10mg/dia

Cirurgia
Considerar abordagem cirrgica na semana 12 do tratamento.
Radioterapia
Considerar avaliao da radioterapia aps a cirurgia em tumores com margens positivas ou
em tumores considerados irresecveis.
N Engl J Med 348:694, 2003

| 106 |

Xll. Sarcomas

Adaptado Cancer 100:612,2004.

Tratamento deve ser mantido por no mnimo 6 meses caso no ocorra progresso, toxicidade ou eventos trombo-emblicos.

| 107 |

&RQVLGHUDUSUROD[LDGH793FRPFXPDUtQLFRRXKHSDULQD6&

%DL[R5LVFR

presena de qualquer um dos fatores


abaixo
ulcerao ou edema associados

J Clin Oncol 24: 102-105, 2006

Tumor (T)

Segunda linha
Vimblastina 6mg/m2 - Semanalmente at resposta mxima.
0HWRWUH[DWR 30mg/m2

Alto Risco

Presena de todos os fatores


abaixo

Pacientes sintomticos com tumores irresecveis


Primeira linha
'R[R 20mg/m2 d1 a d4 - a cada 21 dias com Meloxican 10mg VO /d
DTIC 150mg/m2 d1 a d4 - por 4-6 ciclos ou at resposta mxima.

GRHQoDFRQQDGDjSHOHRX
linfonodos e/ou mnima doena
oral (no caso SK de plato no
nodular)

SK oral extenso
SK gastrointestinal
SK visceral (exceto linfonodal)

Cancer 92: 1259-1264, 2001

Seguimento
Exame fsico cada 3 meses nos dois primieros anos. Cada 6 meses at o quinto ano
TC abdome e pelve (tumores intra-abdominais)
A cada 3 6 meses nos dois primeiros anos,anual at o quinto ano
Ressonncia Magntica (tumores de extremidades) semestral nos dois primeiros anos,
anual at o quinto ano
7XPRU'HVPRSOiVLFRGHFpOXODVSHTXHQDVHUHGRQGDV
Tumor raro, mais comuns em jovens do sexo masculino. A maior parte dos casos apresenta-se com doena metasttica ou inopervel, desde o diagnstico. Podem ser tratados de
acordo com protocolo descrito para Sarcoma de Ewing.

Sistema
Imune (I)

Doena
Sistmica (S)

&'FpOVPLFUR/

CD4 <200 cls/microL

ausncia de histrico de
infeces oportunistas ou
candidase oral

histria de infees oportunistas e/ou


candidase oral

ausncia de sintomas B

presena de sintomas B
Karnofsky <70

.DUQRIVN\36

presena de outra doena relacionada


ao HIV (como p.e. doena neurolgica
ou linfoma)

N Engl J Med 348:694, 2003

III.Tratamento
Leses Cutneas Solitrias
Radioterapia com baixa voltagem em campo envolvido ou campo extendido.
Em pacientes no candidatos radioterapia a exciso da leso a alternativa de escolha.

Xll. Sarcomas
.DSRVL

Doena Cutnea Disseminada


Quimioterapia sistmica (com agente nico) conforme os esquemas abaixo.

CID C46

6DUFRPDGHNDSRVLUHODFLRQDGRj6,'$

6mRHVTXHPDVSRVVtYHLV
3DFOLWD[HO 80 mg/m2 semanalmente (d1, d8 e d15) ciclando a cada 28 dias.
J Clin Oncol 17: 1876-1883, 1999.

,([DPHVUHFRPHQGDGRV
Exames gerais como hemograma e bioqumica do soro (funo heptica e renal)
contagem de CD4 e carga viral
UDGLRJUDDGHWyUD[
TC de trax
USG ou TC de adbome
endoscopia e colonoscopia
broncoscopia

,,(VWDGLDPHQWRH(VWUDWLFDomRGH5LVFR

| 108 |

'R[RUUXELFLQDOLSRVVRPDOSHJXLODGD 20mg/m2 a cada 21 dias, por 6 ciclos.


-&OLQ2QFRO
J Invest Dermatol 128 (6): 1578-80, 2008.

Vinblastina semanal na dose de 0.1 mg/kg, recomenda-se titular a dose para obter uma
contagem de pelo menos 3000 leuccitos.
Cancer 47 (4): 637-9, 1981
Arch Dermatol 112 (7): 958-61, 1976.
Cancer 19 (4): 557-64, 1966.
Cancer 45 (3): 427-31, 1980.

Doena com acometimento de rgos profundos


Recomendamos quimioterapia sistmica com agente isolado, utilizando um dos mesmos
esquemas descritos acima.

| 109 |

3URJUHVVmRGHGRHQoDDSyVTXLPLRWHUDSLDGHSULPHLUDOLQKD
Recomendamos o uso de uma das outras alternativas de quimioterapia como resgate,
conforme descrito acima.

Xlll. Neoplasias Hematolgicas


1. Linfoma no-Hodgkin

IV.Seguimento

CID C83

Histria e Exame Fsico a cada 3 meses (aps o controle das leses, ou resposta mxima,

,/LQIRPD1mR+RGJNLQ'LIXVRGH*UDQGHV&pOXODV%

este acompanhamento pode ser feito pelo infectologista que acompanhar o tratamento
anti-retroviral).
Monitoramento de CD4 e carga viral
A documentao da resposta das leses cutneas complicada por sua subjetividade.
As leses, ao invs de desaparecerem, tornam-se planas e mudam de cor (deixam de ser
violceas e passam para um tom marrom).
Exames de imagem e endoscpicos devem ser solicitados a critrio do mdico, baseados
nos stios de acometimento inicial.

Para o diagnstico realizar bipsia da leso alvo para Hematoxilina-Eosina e imunohisto-

Sarcoma de kaposi clssico

qumica
9HULFDUVRURORJLDSDUDKHSDWLWH%VH$J+%VSRVLWLYRPDQWHUODPLYXGLQDPJYR
12/12hs durante o tratamento quimioterpico
9HULFDUVRURORJLDSDUD+,9
Avaliar funo cardaca por ecocardiograma ou MUGA
$YDOLDUIDWRUHVGHULVFRSDUDLQOWUDomR61& OHVmR3DUDYHUWHEUDO7HVWtFXODU0DPD2YiULR
Seios da Face).
Avaliar se h leso superior ou igual a 7,0 cm (Bulky)
([DPHVGH(VWDGLDPHQWRLQFOXHP7RPRJUDDVGHSHVFRoRWyUD[DEGRPHPHSHOYH
PET/CT e EDA se necessrio

,([DPHVGH(VWDGLDPHQWR

(VWUDWLFDomRGH5LVFR

No so necessrios.Considerar Endoscopia em caso de sintomas Gastrointestinais.

1) ndice de Prognstico Internacional (IPI)

II.Estadiamento

No existe estadiamento formal para o Sarcoma de Kaposi Clssico.

III.Tratamento

No existe um consenso sobre a melhor forma de tratamento para cada apresentao da


doena.

Fatores Prognsticos

Risco

Score

Idade > 60 anos

Baixo

01

3HUIRUPDQFHVWDWXV

Intermedirio baixo

DHL elevado

Intermedirio alto

Estadiamento III / IV

Alto

45

6tWLRVH[WUDQRGDLV
1(QJO-0HG  

Doena Localizada
Considerar radioterapia ou quimioterapia sistmica
 QGLFHGH3URJQyVWLFR,QWHUQDFLRQDODMXVWDGRSDUDLGDGHDQRV ,3,DD
Doena Avanada
Quimioterapia sistmica
Opes :
3DFOLWD[HO 80 mg/m2 semanalmente (d1, d8 e d15) ciclando a cada 28 dias.
J Clin Oncol 17: 1876-1883, 1999

Fatores Prognsticos

Risco

Score

3HUIRUPDQFHVWDWXV

Baixo

DHL elevado

Intermedirio baixo

Estadiamento III / IV

Intermedirio alto

Alto

'R[RUUXELFLQDOLSRVVRPDOSHJXLODGD 20mg/m2 a cada 21 dias, por 6 ciclos.


-&OLQ2QFRO
J Invest Dermatol 128 (6): 1578-80, 2008

1(QJO-0HG  

IV.Seguimento

Histria e exame fsico a cada 3 meses aps controle das leses ou resposta mxima

| 110 |

| 111 |

Protocolos de Tratamento de Resgate (Segunda linha)

 QGLFHGH3URJQyVWLFR,QWHUQDFLRQDOPRGLFDGR 5,3,
Fatores Prognsticos

Prognstico

Score

Ifosfamida

1875 mg/ m2

EV

D2-D5

Idade > 60 anos

Muito bom

Etoposide

75 mg/ m2

EV

D2-D5

2000 mg/ m2 12/12 horas

EV

D2-D3

3HUIRUPDQFHVWDWXV

bom

12

Ara-C

DHL elevado

ruim

35

Mesna

20% IFX
0, 4 e 8 h do IFX

EV

D2-D5

5LWX[LPDEH

375 mg/ m2

EV

D1

0HWKRWUH[DWH

12 mg

IT

D5

'H[DPHWDVRQD

2 mg

IT

D5

GCSF

300 mg/d

SC

D8 at n > 1500/mm3

Estadiamento III / IV
6tWLRVH[WUDQRGDLV
%ORRG

Protocolos de Tratamento Curativos (Primeira linha)

ATMO para quimiossensvei

1 Opo R-CHOP:

Intervalo de 28 dias, 3 a 6 ciclos

Ciclofosfamida

750 mg/m2

EV

D1

'R[RUUXELFLQD

50 mg/m2

EV

D1

Vincristina

1,4 mg/m2

EV

D1

5LWX[LPDE

375 mg/m2

EV

D1

Prednisona

100 mg

VO

D1-D5

Intervalo de 21 dias, 4 a 8 ciclos


1(QJO-0HG

 3UROD[LDSDUDLQOWUDomRGR61&
,QGLFDo}HV/HVmRSDUDYHUWHEUDOLQOWUDomRGHWHVWtFXORRYiULRPHGXODyVVHDVtWLRV
H[WUDOLQIRQRGDLVVHLRVSDUDQDVDLV YHUSURWRFRORHVSHFtFR RURIDULQJHH+,9SRVLWLYR
0HWKRWUH[DWH 12 mg IT D1 dos ciclos 1, 2, 3 e 4
'H[DPHWDVRQD 2 mg
2) Pacientes em EC IA, sem bulky e IPI score 0:
Avaliar resposta aps 2 ciclo
Se RC ps 2 ciclo: completar 4 ciclos de R-CHOP e encaminhar para RT em campo
envolvido
 3DFLHQWHVHP(&,H,,FRP,3,EDL[RHLQWHUPHGLiULREDL[R
Avaliar resposta ps 4 ciclo
Se RC aps 4 ciclo: completar 6 ciclos de R-CHOP

/HXN5HV5LQVKR.HWVXHNL$SU  

2 Opo ,9$&PRGLFDGR5HFLGLYDSyV5&+23FRPGHPHVHV
Ifosfamida

1500 mg/ m2

EV

D1-D5

Etoposide

60 mg/ m2

EV

D1-D5

Citarabina

2000 mg/ m2 12/12 horas

EV

D1-D3

Mesna

20% IFX
0, 4 e 8 h IFX

EV

D1-D5

0HWKRWUH[DWH

12 mg

IT

D5

'H[DPHWDVRQD

2 mg

IT

D5

GCSF

300 mg/d

SC

D8 at n > 1500/mm3

ATMO para quimiossensveis


Intervalo de 28 dias, 3 a 6 ciclos
/HXN5HV5LQVKR.HWVXHNL$SU  

3 Opo - IMVP-16
Ifosfamida

1000 mg/ m2

EV

D1-D5

Etoposide

100 mg/ m2

EV

D1-D3

4) Pacientes em EC III e IV e/ou IPI intermedirio alto ou alto risco:


Programar 8 ciclos de R-CHOP

Mesna

20% IFX 0, 4, 8 h

EV

D1-D5

0HWKRWUH[DWH

30 mg/ m2

EV

D1 e D5

5) Radioterapia 30 a 40 Gy em campo envolvido:


,QGLFDo}HV(VWiGLRSUHFRFH $QQ$UERU,H,, FRPEXON\HPSDFLHQWHVFRPLQOWUDomR
testicular e ovrio, leso ssea nica, leso paravertebral. Pacientes em estdio III e IV com
massa residual avaliar radioterapia.

ATMO para quimiossensveis


Intervalo de 28 dias, 3 a 6 ciclos
&URDW0HG-2FW  

1 Opo - 5,9$&PRGLFDGR5HFLGLYDDSyV5&+23!PHVHVRXUHFLGLYD
refratrios a CHOP

| 112 |

| 113 |

Protocolos de Tratamento Paliativo


1 Opo - Mini-CHOP
Ciclofosfamida

750mg/ m2

EV

D1

'R[RUUXELFLQD

25 mg/ m2

EV

D1

Vincristina

1,4 mg/ m2

EV

D1

Prednisona

100 mg

VO

D1 a D5

Intervalo de 21 dias, 6 a 8 ciclos

0HWKRWUH[DWH

3500 mg/m2

EV em 2h

D1, D15, D30, D45 e D60

Vincristina

1,4 mg/m2

EV

D1, D15, D30, D45 e D60

CCNU

40 mg

VO

D1, D30 e D60

Leucovorin

50 mg

EV

24 hs aps incio MTX

Leucovorin

15 mg/m2

VO

6/6 hs x 11 doses aps EV

0HWKRWUH[DWH

12 mg

IT

'H[DPHWDVRQD

2 mg

IT

D8, D22, D37 e D52

Radioterapia 45 Gy crnio total se < 65 anos


Se LNH ocular - 30-40 Gy na regio ocular

2 Opo - 93'H[D
Etoposide

50 a 100mg/dia

VO

D1 a D7

'H[DPHWDVRQD

20 mg

VO

D1 a D7

Ara-C

3g/ m2 < 60 anos


1,5 g/m2 > 60 anos

EV em 3
horas

D1 e D2
2 ciclos 30/30 dias aps 3 semanas do trmino da RT
J Clin Oncol 18:3144-3150, 2000

Intervalo de 21 dias, 6 a 8 ciclos


Avaliar manter etoposide do D1 a D14 conforme tolerncia do paciente.

,,,/LQIRPD'LIXVRGH*UDQGHV&pOXODV%+,9
Protocolos de Tratamento de Primeira Linha

,,/LQIRPD'LIXVRGH*UDQGHV&pOXODV%3ULPiULR61&

1 Opo &+233UROD[LD61&

Solicitar exame de fundo de olho e USG de testculos


Afastar HIV

(VWUDWLFDomRGH5LVFR
1) ndice de Prognstico para LNH Primrio SNC

Ciclofosfamida

750 mg/ m2

EV

D1

Adriamicina

50 mg/ m2

EV

D1

Vincristina

1,4 mg/ m2

EV

D1

VO

D1-D5

Prednisona

100 mg

Fatores Prognsticos

Risco

Score

'H[DPHWDVRQD

2 mg

Idade > 60 anos

Baixo

01

0HWKRWUH[DWH

12 mg

3HUIRUPDQFHVWDWXV

Intermedirio

23

HAART

DHL srico elevado

Alto

45

Hiperproteinorraquia

IT no D1 dos Ciclos 1, 2, 3 e 4

Seis a 8 ciclos a cada 21 dias


Int J Haematol 2007, v.86:337-342

Comprometimento de estruturas cerebrais


profundas*
* Gnglios basais, regio periventricular, tronco cerebral, cerebelo
J Clin Oncol 21:266-272.

,9/LQIRPDV$JUHVVLYRVGH&pOXODV%GHVHLRV3DUDQDVDLV
GH/LQKD0pGLDHFRP5LVFRGH,QOWUDomRGR61&
1 Opo R-CHOMP

Protocolos de Tratamento de Primeira Linha


1 Opo - ABREY

| 114 |

Ciclofosfamida

750 mg/m2

EV

D2

'R[RUUXELFLQD

50 mg/m2

EV

D2

Vincristina

1,4 mg/m2

EV

D2

5LWX[LPDE

375 mg/m2

EV

D1

Prednisona

60mg/m2

VO

D2-D6

| 115 |

0HWRWUH[DWH
Leucovorin

1500mg/m2
15mg/m2

EV em 2 horas

D2

0HWRWUH[DWH

12mg

IT

VO

D3, D4 e D5 . Iniciar 24 hs
aps MTX, 6/6h (12 doses)

'H[DPHWDVRQD

2mg

IT

Radioterapia em campo estendido ps QT

D8, D22, D36 e D50

5HDYDOLDomRFRPWRPRJUDDVHPLHORJUDPDVHPHGXODyVVHDLQOWUDGD
Reinduo

Intervalo de 21 dias, 6 a 8 ciclos


Experincia do grupo de Linfoma no Hodgkin - HC FMUSP

V. Linfoma Linfoblstico
Protocolos de Tratamento de Primeira Linha
1 Opo - BFM 86
Introduo l
Vincristina

1,5mg/m2

EV

D8, D15, D22 e D29

Daunoblastina

40mg/m2

EV

D8, D15, D22 e D29

L-Asparaginase

10.000U

IM

D19, D22 , D25, D28, D31, D34, D37 e D40

Prednisona

60 mg/m2

VO

D1 a D28

0HWRWUH[DWH

12 mg

IT

D1, D8, D15, D22, D29

'H[DPHWDVRQD

2 mg

IT

D1, D8, D15, D22, D29

6HPHGXODyVVHDLQOWUDGDDYDOLDUUHVSRVWDQR'FRPPLHORJUDPDHKHPRJUDPD
Introduo ll

Vincristina

1.5mg/m2

EV

D8, D15, D22 e D29

Adriamicina

30mg/m2

EV

D8, D15, D22 e D29

L asparaginase

10.000U

IM

D8, D11, D15 e D18

'H[DPHWDVRQD

10mg/m2

VO

D1 a D21

Ciclofosfamida

1000mg/m2

EV

D36

6 Tioguanina

60mg/m2

VO

D36 a D49

Ara-C

75mg/m2

EV/ IM/ SC

D38 a D41, D45 a D48

0HWRWUH[DWH

12mg

IT

'H[DPHWDVRQD

2mg

IT

D38 e D45

1RQDOGRSURWRFRORGH5HLQGXomR
(PSDFLHQWHVFRPLQOWUDomRGR61&UHDOL]DUUDGLRWHUDSLDFUDQLDQDFRP*\
1RVSDFLHQWHVFRPLQOWUDomRWHVWLFXODUUHDOL]DUUDGLRWHUDSLDHPUHJLmRHVFURWDOFRP*\

Manuteno
6 Mercaptopurina

60mg/m2

VO

18 meses

0HWRWUH[DWH

20mg/m2

IM/ sem

18 meses

Durante a manuteno realizar reavaliao a cada 3 meses

Ciclofosfamida

1000 mg/m2

EV

D43 e D71

Ara-C

75mg/m2

EV /IM /SC

D45 a D48, D52 a D55, D59


a D62 e D66 a D69

6Mercaptopurina

30mg/m2

VO

D43 a D70

0HWRWUH[DWH

12 mg

IT

D45 e D59

1 Opo - CODOX-M IVAC

'H[DPHWDVRQD

2 mg

IT

D45 e D59

Ciclofosfamida 800 mg/m2

EV

D1

Ciclofosfamida 200 mg/m2

EV

D2, D3, D4 e D5

Vincristina

1,5 mg/m2

EV

D1, D8

'R[RUUXELFLQD

40 mg/m2

EV

D1

Ara-C

70 mg

$YDOLDUUHVSRVWDDRQDOGDLQGXomR,,FRPWRPRJUDDV6HPHGXODyVVHDLQOWUDGDUHDOL]DU
mielograma.
Consolidao
6Mercaptopurina

25mg/m2

VO

D1 a D56

0HWRWUH[DWH

3000mg/m2

EV em 4 h

D8, D22, D36 e D50

Acido folnico

50mg

EV

D9, D23, D37 e D51 (iniciar rigorosamente 24 h. aps MTX)

VO 6/6h

''H'''H'
''H'''H'
(Total de onze doses)
Iniciar 6hs aps a dose de Leucovorin EV.

Acido folnico

15mg/m2

| 116 |

Protocolos de Tratamento de Segunda Linha

IT

D1 e D3

'H[DPHWDVRQD 2 mg

IT

D1 e D3

0HWKRWUH[DWH

1200 mg/m2

EV em 1 h

0HWKRWUH[DWH

240 mg/m2/h

EV em 23 h

Leucovorin

192mg/m2

EV

36h aps incio do MTX

Leucovorin

15 mg/m2

EV 6/6 h

Ajustar conforme metotrexatemia

0HWKRWUH[DWH

12 mg

IT

D15

IT

D15

'H[DPHWDVRQD 2 mg

| 117 |

D10

G-CSF

5 g/Kg

SC

At N >1000/mm3

Iniciar prximo ciclo quando N > 1000/mm3 e plaq > 75.000/mm3


Esquema IVAC

IIIB
IV

Doena intra-abdominal com envolvimento multiorgnico


(QYROYLPHQWRGR61&HRXPHGXODyVVHD VH!GHQHVH//$/

Ifosfamida

1500 mg/ m2

EV em 1 h

D1 a D5

Grupo A

Etoposide

60 mg/ m2

EV em 1 h

D1 a D5

Ara-C

2000 mg/ m2
12/12 h

EV em 3h

D1 e D2 (4 doses)

0HWKRWUH[DWH

12 mg

IT

D5

Todos os pacientes com Linfoma de Burkitt localizado


nico stio nodal, DHL normal e estdio I ressecado.
TGI localizado completamente ressecado (estdio II).
Exclui acometimento extralinfonodal e/ou extra-digestivo

'H[DPHWDVRQD 2 mg

IT

D5

Mesna

20% IFX
0, 4 e 8 h IFX

EV

D1-D5

GCSF

5 g/Kg

SC

At n >1000/mm3

Intervalo 28 dias, 8 ciclos alternados

Grupo B
Todos os pacientes com Linfoma de Burkitt avanado sem acometimento
de MO ou SNC
Todos estdio I, exceto nodal nico totalmente ressecado.
Todos estdio II, exceto primrio do TGI totalmente ressecado.
Todos estdio III

Ann Oncol 2002, v.13:1264-1274

Grupo C
7RGRVRVSDFLHQWHVFRPPHGXODyVVHDLQOWUDGD
MO com < 30% de blastos
Todos com LLA-L3: MO > 30% blastos
7RGRVFRP,QOWUDomRGH61&
Citologia onctica positiva
Paralisia de 1 ou + pares cranianos
Paraplegia por invaso tumoral ou epidurite tumoral.

VI. Linfoma de Burkitt HIV Negativo


Protocolos de Tratamento de Primeira Linha
1 Opo LMB95
1. Estadiar pacientes de acordo com critrios de Murphy
2.&ODVVLFDURVSDFLHQWHVHPJUXSRV$%H&
3. Programar o tratamento de acordo com o grupo
Bull Cancer, 2005 v.92:193-98

Estadiamento de St. Jude / Murphy pra Linfoma de Burkitt


Estdio
I

Descrio
Tumor nico extranodal ou nodal, com exceo de tumores mediastinais
ou abdominais
Tumor extranodal nico com envolvimento de linfonodos regionais

II

Dois tumores extranodais do mesmo lado do diafragma, com ou sem envolvimento nodal regional
Tumor primrio gastrointestinal com ou sem envolvimento de linfonodos
mesentricos
Duas ou mais reas nodais acometidas do mesmo lado do diafragma

IIR

III

Tumor intra-abdominal completamente ressecado

2JUXSR&pGLYLGLGRHPJUXSRVGHDFRUGRFRPLGDGHHDFRPHWLPHQWRGH61&
C1: < 40 anos sem acometimento de SNC
C2: < 40 anos com acometimento de SNC
C3: > 40 e < 60 anos sem acometimento de SNC
C4: > 40 e < 60 anos com acometimento de SNC
C5: > 60 anos sem acometimento de SNC
C6: > 60 anos com acometimento de SNC
ATENO:
Grupo B: Na ausncia de reposta a citorreduo com COP:
Tratar paciente de acordo com grupo C
Grupo B: Reavaliar aps 1 fase da consolidao :
Se RC: continuar protocolo

3DFLHQWHVFODVVLFDGRVFRPR*UXSR$
(VTXHPD&23$'

Dois tumores extranodais localizados em ambos os lados do diafragma

Ciclofosfamida

250 mg/m2 2 x ao dia

EV

D2 a D4

Todos os tumores primrios intra-torcicos

Vincristina

1,4 mg/m2

EV

D1 e D6

Todos tumores paraespinhais ou epidurais

Adriamicina

60 mg/m2

EV

D2

Doena primria intra-abdominal extensa

Prednisona

60 mg/m2

VO

D1 a D6

Duas ou mais reas nodais em ambos os lados do diafragma


IIIA

Doena intra-abdominal localizado, porm no ressecada

| 118 |

| 119 |

(VTXHPDSDUDSDFLHQWHVFODVVLFDGRVFRPR*UXSR%
1) Citorreduo: 1 Ciclo de COP
COP
300 mg/m2

EV

D1

Vincristina

1 mg/m2

EV

D1

Prednisona

60 mg/m2

VO

D1 a D7

0HWKRWUH[DWH

15mg

IT

D1

'H[DPHWDVRQD

2 mg

IT

D1

2) Induo: 1 COPADM 1 e 1 COPADM 2


COPADM 1: Iniciar no D8 do COP
250 mg/m2 2 x ao dia

EV

30 mg

'H[DPHWDVRQD

2 mg

Leucovorin

50 mg EV 24 hs aps MTX

IT

D6

Leucovorin 15 mg/m2 VO 6/6 hs 11 doses aps dose EV

Ciclofosfamida

Ciclofosfamida

Ara-C

 0DQXWHomRFLFORGDVHTXrQFLD,
6HTrQFLD,,QLFLDU'GR&<0
Ciclofosfamida

500 mg/m2

EV

D1 e D2

Vincristina

1,4 mg/m2

EV

D1

0HWKRWUH[DWH

3000 mg/m2

EV em 3 horas

D1

Adriamicina

60 mg/m2

EV

D2

D2 a D4

Prednisona

60mg/m2

VO

D1 a D5

15 mg
IT

D2

Vincristina

1,4 mg/m2

EV

D1

0HWKRWUH[DWH

0HWKRWUH[DWH

3000 mg/m2

EV em 3 horas

D1

'H[DPHWDVRQD

50 mg EV 24 hs aps MTX
15 mg/m2 VO 6/6 hs 11 doses aps dose EV

Adriamicina

60 mg/m2

EV

D2

Leucovorin

Prednisona

60mg/m2

VO

D1 a D6

Leucovorin

0HWKRWUH[DWH

15 mg

'H[DPHWDVRQD

2 mg

IT

D2 e D6

Leucovorin

50 mg EV 24 hs aps MTX

Leucovorin

15 mg/m2 VO 6/6 hs 11 doses aps dose EV

2 mg

(VTXHPDSDUDSDFLHQWHVFODVVLFDGRVFRPR*UXSR&
1) Citorreduo: 1 ciclo de COP
COP

COPADM 2: Iniciar D21 COPADM-1 ou n >1500/mm3 e Pl >100.000mm3

Ciclofosfamida

300 mg/m2

EV

D1

Vincristina

1 mg/m2

EV

D1

VO/EV

D1 a D7

Ciclofosfamida

500 mg/m2 2 x ao dia

EV

D2 a D4

Prednisona

60 mg/m2

Vincristina

1,4 mg/m2

EV

D1 e D6

Ara-C

40 mg

0HWKRWUH[DWH

3000 mg/m2

EV em 3 horas

D1

0HWKRWUH[DWH

15 mg

Adriamicina

60 mg/m2

EV

D2

'H[DPHWDVRQD

2 mg

Prednisona

60mg/m2

VO

D1 a D6

0HWKRWUH[DWH

15 mg

IT

D2 e D6

'H[DPHWDVRQD

2 mg

IT

D2 e D6

Leucovorin

50 mg EV 24 hs aps MTX

Leucovorin

15 mg/m2 VO 6/6 hs 11 doses aps dose EV

3) Consolidao: Dois ciclos de CYM


CYM 1 e 2: Iniciar D21 COPADM 2 e CYM 1 ou n >1500/mm3 e Pl >100.000/mm3

IT

2) Induo: 1 ciclo de COPADM 1 e 1 ciclo de COPADM 2


COPADM 1: Iniciar no D8 do COP
Ciclofosfamida

250 mg/m2 2x ao dia

EV

D2 a D4

Vincristina

1,4 mg/m2

EV

D1

0HWKRWUH[DWH

3000 mg/m2

EV em 3 horas

D1

Adriamicina

60 mg/m2

EV

D2
D1 a D6

Prednisona

60mg/m2

VO

0HWKRWUH[DWH

3000 mg/m2

EV em 3 horas

D1

Ara-C

40 mg

IT

Ara-C

50 mg/m2 2 x ao dia

SC

D2 a D6

0HWKRWUH[DWH

15 mg

IT

0HWKRWUH[DWH

15 mg

'H[DPHWDVRQD

2 mg

IT

IT

D2

Leucovorin

50 mg EV 24 hs aps MTX
15 mg/m2 VO 6/6 hs 11 doses aps dose EV

'H[DPHWDVRQD

2mg

Leucovorin

| 120 |

D1, D3 e D5

| 121 |

D2, D4 e D6

COPADM 2: Iniciar D21 COPADM 1 ou n > 1.500/mm3 e Pl > 100.000/mm3

6HTrQFLD,9
Igual a seqncia II

Ciclofosfamida

500 mg/m2 2 x ao dia

EV

D2 a D4

Vincristina

1,4 mg/m2

EV

D1 e D6

0HWKRWUH[DWH

3000 mg/m2

EV em 3 horas

D1

Adriamicina

60 mg/m2

EV

D2

Prednisona

60mg/m2

VO

D1 a D6

Ara-C

40 mg

IT

Ciclofosfamida

300 mg/m2

EV

D1

0HWKRWUH[DWH

15 mg

IT

Vincristina

1 mg/m2

EV

D1

'H[DPHWDVRQD

2 mg

IT

Prednisona

60 mg/m2

VO/EV

D1 a D7

Ara-C

40 mg

IT

0HWKRWUH[DWH

15mg

IT

'H[DPHWDVRQD

2 mg

IT

Leucovorin

D2, D4 e D6

50 mg EV 24 hs aps MTX
15 mg/m2 VO 6/6 hs 11 doses aps dose EV

Leucovorin

3) Consolidao: Dois ciclos de CYVE


CYVE 1 e 2: Iniciar D21 COPADM2 e D28 do CYVE 1 ou n >1500 e Pl > 100.000/
mm3

(VTXHPDSDUDSDFLHQWHVFODVVLFDGRVFRPR*UXSR&
1) Citorreduo: 1 ciclo de COP
COP

D1,D3, D5

2) Induo: Um ciclo de COPADM 1 e 1 ciclo de COPADM 2


COPADM 1: Iniciar no D8 do COP

Ara-C

50mg/m2

SC s 20:00 h

D1 a D5

Ciclofosfamida

250 mg/m2 2 x ao dia

EV

D2 a D4

Ara-C

2000mg/m2

EV das 8:00 s 11:00h

D2 a D5

Vincristina

1,4 mg/m2

EV

D1

VP-16

200mg/m2

EV das 14:00 s 16:00h

D2 a D5

0HWKRWUH[DWH

8000 mg/m2

EV

D1

Adriamicina

60 mg/m2

EV

D2

Prednisona

60mg/m2

VO/EV

D1 a D6

Ara-C

40 mg

IT

0HWKRWUH[DWH

15 mg

IT

'H[DPHWDVRQD

2 mg

IT

 0DQXWHQomR,QLFLDUVHTrQFLDVQR'GRFLFORDQWHULRU,,,,,,H,9
6HTrQFLD,
Ciclofosfamida

500 mg/m2

EV

D1 e D2

Vincristina

1,4 mg/m2

EV

D1

0HWRWUH[DWH

3000 mg/m2

EV

D1

Adriamicina

60 mg/m2

EV

D2

Prednisona

60mg/m2

VO

D1 a D5

ARA-C

40 mg

IT

0HWKRWUH[DWH

15 mg

IT

'H[DPHWDVRQD

2 mg

IT

Leucovorin

50 mg EV 24 hs aps MTX

Leucovorin

15 mg/m2 VO 6/6 hs 11 doses aps dose EV

ARA-C

50 mg/m2 2 x ao dia

SC

D1 a D5

VP-16

150 mg/m2

EV

D1 a D3

| 122 |

50 mg EV 24 hs aps MTX

Leucovorin

15 mg/m2 VO 6/6 hs 19 doses aps dose EV

&23$'0,QLFLDU'&23$'0RXQ!PPHSODT!PP
D2

6HTrQFLD,O

6HTrQFLD,,,
Igual seqncia I, porm sem MTX-HD e QT IT

Leucovorin

D2, D4, D6

Ciclofosfamida

500 mg/m2 2 x ao dia

EV

D2 a D4

Vincristina

1,4 mg/m2

EV

D1 e D6

0HWKRWUH[DWH

8000 mg/m2

EV

D1

Adriamicina

60 mg/m2

EV

D2

Prednisona

60mg/m2

VO/EV

D1 a D6

Ara-C

40 mg

IT

0HWKRWUH[DWH

15 mg

IT

'H[DPHWDVRQD

2 mg

IT

D2, D4, D6

Leucovorin

50 mg EV 24 hs aps MTX

Leucovorin

15 mg/m2 VO 6/6 hs 19 doses aps dose EV

| 123 |

3) Consolidao: Dois ciclos de CYVE


CYVE 1 e 2: Iniciar D21 COPADM2 e D28 CYVE1 ou n>1500/mm3 e Pl >
100.000/mm3
Ara-C

50mg/m2

SC s 20:00 h

D1 a D5

Ara-C

3000mg/m2

EV das 8:00 s 11:00h

D2 a D5

VP-16

200mg/m2

EV das 14:00 s 16:00h

D2 a D5

Reavaliar aps CYVE II


 0DQXWHQomR,QLFLDUVHTXrQFLDVQR'GRFLFORDQWHULRU
6HTrQFLD,

Ara-C

40 mg

IT

0HWKRWUH[DWH

15mg

IT

'H[DPHWDVRQD

2 mg

IT

D1, D3 e D5

2) Induo: Um ciclo de COPADM 1 e um de COPADM 2


COPADM 1: Iniciar no D8 do COP
Ciclofosfamida

250 mg/m2 2 x ao dia

EV

D2 a D4

Vincristina

1,4 mg/m2

EV

D1

0HWKRWUH[DWH

2000 mg/m2

EV

D1

Ciclofosfamida

500 mg/m2

EV

D1 e D2

Adriamicina

60 mg/m2

EV

D2

Vincristina

1,4 mg/m2

EV

D1

Prednisona

60mg/m2

VO/EV

D1 a D6

0HWKRWUH[DWH

8000 mg/m2

EV

D1

Ara-C

40 mg

IT

Adriamicina

60 mg/m2

EV

D2

0HWKRWUH[DWH

15 mg

IT

Prednisona

60mg/m2

VO

D1 a D5

'H[DPHWDVRQD

2 mg

IT

Ara-C

40 mg

IT

0HWKRWUH[DWH

15 mg

IT

'H[DPHWDVRQD

2 mg

IT

Leucovorin
Leucovorin

D2

50 mg EV 24 hs aps MTX
15 mg/m2 VO 6/6 hs 19 doses aps dose EV

Leucovorin

50 mg EV 24 hs aps MTX

Leucovorin

15 mg/m2 VO 6/6 hs 11 doses aps dose EV

3) Consolidao: Dois ciclos de CYVE


CYVE 1 e 2 : iniciar D21 COPADM2 e D28 CYVE1 ou n>1500/mm3 e Pl >
100.000/mm3

RT crnio 24Gy aps trmino da seqncia I


6HTrQFLD,,
Ara-C

50 mg/m2 2 x ao dia

SC

D1 a D5

VP-16

150 mg/m2

EV

D1 a D3

6HTrQFLD,,,
Igual seqncia I, porm sem MTX-HD e QT IT

Ara-C

50mg/m2

SC s 20:00 h

D1 a D5

Ara-C

2000mg/m2

EV das 8:00 s 11:00h

D2 a D5

VP-16

200mg/m2

EV das 14:00 s 16:00h

D2 a D5

Reavaliar aps CYVE II


 0DQXWHQomR,QLFLDUVHTrQFLDVQR'GRFLFORDQWHULRU
6HTrQFLD,

6HTrQFLD,9
Igual a seqncia II

(VTXHPDSDUDSDFLHQWHVFODVVLFDGRVFRPR*UXSR&
1) Citorreduo: 1 ciclo de COP
COP

Ciclofosfamida

500 mg/m2

EV

D1 e D2

Vincristina

1,4 mg/m2

EV

D1

0HWKRWUH[DWH

2000 mg/m2

EV

D1

Adriamicina

60 mg/m2

EV

D2

Prednisona

60mg/m2

VO/EV

D1 a D5

Ara-C

40 mg

IT

0HWKRWUH[DWH

15 mg

IT

EV

D1

'H[DPHWDVRQD

2 mg

IT

1 mg/m2

EV

D1

Leucovorin

50 mg EV 24 hs aps MTX

60 mg/m2

VO/EV

D1 a D7

Leucovorin

15 mg/m2 VO 6/6 hs 11 doses aps dose EV

Ciclosfosfamida

300 mg/m2

Vincristina
Prednisona

| 124 |

D2, D4 e D6

| 125 |

D2

6HTrQFLD,O

Adriamicina

60 mg/m2

EV

D2

Ara-C

50 mg/m2 2 x ao dia

SC

D1 a D5

Prednisona

60mg/m2

VO/EV

D1 a D6

VP-16

150 mg/m2

EV

D1 a D3

Ara-C

40 mg

IT

0HWKRWUH[DWH

15 mg

IT

'H[DPHWDVRQD

2 mg

IT

Leucovorin

50 mg EV 24 hs aps MTX

Leucovorin

15 mg/m2 VO 6/6 hs 11 doses aps dose EV

6HTrQFLD,,,
Igual seqncia I, porm sem MTX-HD e QT IT
6HTrQFLD,9
Igual a seqncia II

(VTXHPDSDUDSDFLHQWHVFODVVLFDGRVFRPR*UXSR&
1) Citorreduo: Um ciclo de COP
COP
Ciclofosfamida

300 mg/m2

EV

D1

Vincristina

1 mg/m2

EV

D1

Prednisona

60 mg/m2

VO/EV

D1 a D7

Ara-C

40 mg

IT

0HWKRWUH[DWH

15mg

IT

'H[DPHWDVRQD

2 mg

IT

D1,D3,D5

2) Induo: Um ciclo de COPADM 1 e um de COPADM 2


COPADM 1: Iniciar no D8 do COP

D2, D4, D6

3) Consolidao: Dois ciclos de CYVE


CYVE: Iniciar D21 COPADM2/D28 CYVE1 ou n > 1500/mm3 e Pl > 100.000/mm3
Ara-C

50mg/m2

SC s 20:00 h

D1 a D5

Ara-C

2000mg/m2

EV das 8:00 s 11:00h

D2 a D5

VP-16

200mg/m2

EV das 14:00 s 16:00h

D2 a D5

Reavaliar aps CYVE II


 0DQXWHQomR6HTrQFLD,,,,,,H,9LQLFLDU'GRFLFORDQWHULRU
6HTrQFLD,
Ciclofosfamida

250 mg/m2 2 x ao dia

EV

D2 e D3

Vincristina

1,4 mg/m2

EV

D1

0HWKRWUH[DWH

3000 mg/m2

EV

D1

Adriamicina

60 mg/m2

EV

D2

Ciclosfosfamida

250 mg/m2 2 x ao dia

EV

D2 a D4

Prednisona

60mg/m2

VO/EV

D1 a D5

Vincristina

1,4 mg/m2

EV

D1

Ara-C

40 mg

IT

0HWKRWUH[DWH

3000 mg/m2

EV

D1

0HWKRWUH[DWH

15 mg

IT

Adriamicina

60 mg/m2

EV

D2

'H[DPHWDVRQD

2 mg

IT

Prednisona

60mg/m2

VO/EV

D1 a D6

Leucovorin

50 mg EV 24 hs aps MTX

Ara-C

40 mg

IT

Leucovorin

Leucovorin 50 mg EV 24 hs aps MTX

0HWKRWUH[DWH

15 mg

IT

'H[DPHWDVRQD

2 mg

IT

Leucovorin
Leucovorin

D2, D4, D6

RXT crnio 24Gy aps trmino da seqncia I


6HTrQFLD,,

50 mg EV 24 hs aps MTX
15 mg/m2 VO 6/6 hs 11 doses aps dose EV

&23$'0,QLFLDU'&23$'0RX1!PPHSODTXHWDV!PP
Ciclofosfamida

500 mg/m2 2 x ao dia

EV

D2 a D4

Vincristina

1,4 mg/m2

EV

D1 e D6

0HWKRWUH[DWH

3000 mg/m2

EV

D1

| 126 |

D2

Ara-C

50 mg/m2 2 x ao dia

SC

D1 a D5

VP-16

150 mg/m2

EV

D1 a D3

6HTrQFLD,,,
Igual seqncia I, porm sem MTX-HD e QT IT
6HTrQFLD,9
Igual a seqncia II

| 127 |

(VTXHPDSDUDSDFLHQWHVFODVVLFDGRVFRPR*UXSR&
1) Citorreduo: Um ciclo de COP
COP

Ara-C

50mg/m2

SC s 20:00 h

D1 a D5

Ara-C

1000mg/m2

EV das 8:00 s 11:00h

D2 a D5

VP-16

200mg/m2

EV das 14:00 s 16:00h

D2 a D5

Reavaliar aps CYVE II

Ciclosfosfamida

300 mg/m2

EV

D1

Vincristina

1 mg/m2

EV

D1

Prednisona

60 mg/m2

VO/EV

D1 a D7

Ara-C

40 mg

IT

0HWKRWUH[DWH

15mg

IT

'H[DPHWDVRQD

2 mg

IT

D1, D3 e D5

2) Induo: Um ciclo de COPADM 1, 1 COPADM 2


COPADM 1: Iniciar no D8 do COP

 0DQXWHQomR,QLFLDUVHTXrQFLDQR'GRFLFORDQWHULRU
6HTrQFLD,
Ciclofosfamida

500mg/m2

EV

D1 e D2

Vincristina

1,4 mg/m2

EV

D1

0HWKRWUH[DWH

1000 mg/m2

EV

D1

Adriamicina

60 mg/m2

EV

D2

Prednisona

60mg/m2

VO/EV

D1 a D5

VO 6/6 hs x 11 doses
aps Leucovorin Ev

Ciclofosfamida

250 mg/m2 2 x ao dia

EV

D2 a D4

Leucovorin

15 mg/m2

Vincristina

1,4 mg/m2

EV

D1

Leucovorin

50 mg EV 24 hs aps MTX

0HWKRWUH[DWH

1000 mg/m2

EV

D1

0HWRWUH[DWH

15mg

IT

Adriamicina

60 mg/m2

EV

D2

Ara-C

40mg

IT

Prednisona

60mg/m2

VO/EV

D1 a D6

'H[DPHWDVRQD

2mg

IT

Ara-C

40 mg

IT

0HWKRWUH[DWH

15 mg

IT

'H[DPHWDVRQD

2 mg

IT

D2, D4 e D6

Leucovorin

50 mg EV 24 hs aps MTX

Leucovorin

15 mg/m2 VO 6/6 hs 12 doses aps dose EV

COPADM 2: Iniciar D21 COPADM1 ou n >1500/mm3 e Pl > 100.000/mm3


Ciclofosfamida

500 mg/m2 2 x ao dia

EV

D2 a D4

Vincristina

1,4 mg/m2

EV

D1 e D6

0HWKRWUH[DWH

1000 mg/m2

EV

D1

Adriamicina

60 mg/m2

EV

D2

Prednisona

60mg/m2

VO/EV

D1 a D6

Ara-C

40 mg

IT

0HWKRWUH[DWH

15 mg

IT

'H[DPHWDVRQD

2 mg

IT

D2, D4 e D6

D2

6HTrQFLD,O
Ara-C

50 mg/m2 2 x ao dia

SC

D1 a D5

VP-16

150 mg/m2

EV

D1 a D3

6HTrQFLD,,,
Igual seqncia I, porm sem MTX-HD e QT IT
6HTrQFLD,9
Igual a seqncia II

(VTXHPDSDUDSDFLHQWHVFODVVLFDGRVFRPR*UXSR&
1) Citorreduo: Um ciclo de COP
COP
Ciclofosfamida

300 mg/m2

EV

D1

1 mg/m2

EV

D1
D1 a D7

Leucovorin

50 mg EV 24 hs aps MTX

Vincristina

Leucovorin

15 mg/m2 VO 6/6 hs 11 doses aps dose EV

Prednisona

60 mg/m2

VO/EV

Arabinosdeo-C

40 mg

IT

0HWKRWUH[DWH

15mg

IT

'H[DPHWDVRQD

2 mg

IT

3) Consolidao: Dois ciclos de CYVE


CYVE 1 e 2 : Iniciar D21 COPADM2 e D28 CYVE1 se n >1500/mm3 e Pl >
100.000/mm3

| 128 |

| 129 |

D1, D3 e D5

2) Induo: 1 Ciclo de COPADM 1 e 1 ciclo COPADM 2


COPADM 1: Iniciar no D8 do COP
Ciclofosfamida

250 mg/m2 2 x ao dia

EV

D2 a D4

Vincristina

1,4 mg/m2

EV

D1

0HWKRWUH[DWH

2000 mg/m2

EV

D1

Adriamicina

60 mg/m2

EV

D2

Prednisona

60mg/m2

VO/EV

D1 a D6

Ara-C

40 mg

IT

0HWKRWUH[DWH

15 mg

IT

2 mg

IT

'H[DPHWDVRQD

50 mg EV 24 hs aps MTX

Leucovorin

15 mg/m2 VO 6/6 hs 11 doses aps dose EV

COPADM 2: Iniciar D21 COPADM1 ou n > 1500/mm3 e Pl > 100.000/mm3


Ciclofosfamida

500 mg/m2 2 x ao dia

EV

D2 a D4

Vincristina

1,4 mg/m2

EV

D1 e D6

0HWKRWUH[DWH

2000 mg/m2

EV

D1

Adriamicina

60 mg/m2

EV

D2

Prednisona

60mg/m2

VO/EV

D1 a D6

Ara-C

40 mg

IT

0HWKRWUH[DWH

15 mg

IT

2 mg

IT

'H[DPHWDVRQD

60mg/m2

VO/EV

Ara-C

40 mg

IT

0HWKRWUH[DWH

15 mg

IT

'H[DPHWDVRQD

2 mg

IT

D1 a D5
D2

Leucovorin 50 mg EV 24 hs aps MTX

D2, D4 e D6

Leucovorin

Prednisona

D2, D4 e D6

Leucovorin 15 mg/m2 VO 6/6 hs x 11 aps leucovorin EV


RT crnio 24Gy aps trmino da sequncia I
6HTrQFLD,,
Ara-C

50 mg/m2 2 x ao dia

SC

D1 a D5

VP-16

150 mg/m2

EV

D1 a D3

6HTrQFLD,,,
Igual seqncia I, porm sem MTX-HD e QT IT
6HTrQFLD,9
Igual a seqncia II

9,,/LQIRPDGH%XUNLWWHPSDFLHQWHV+,9
Protocolos de Tratamento de Primeira Linha
1 Opo - Hyper-CVAD: pacientes com Perfomance Status=0-2
Ciclos 1, 3, 5 e 7

Leucovorin

50 mg EV 24 hs aps MTX

Leucovorin

15 mg/m2 VO 6/6 hs 11 doses aps leucovorin EV

Ciclofosfamida

300 mg/m2

EV em 2 hs 12/12 hs

D1- D3 (6 doses)

'R[RUXELFLQD

50 mg/m2

EV em 2 hs

D4

Vincristina

2mg

EV

D4 e D11

'H[DPHWDVRQD

40 mg

VO/EV

D1-D4 / D11-D14

0HWKRWUH[DWH

12 mg

IT

D2

'H[DPHWDVRQD

2 mg

IT

D2

Ara-C

100 mg

IT

D7

Reavaliar aps CYVE II

'H[DPHWDVRQD

2 mg

IT

D7

 0DQXWHQomR6HTrQFLD,H,,DOWHUQDGRVSRUFLFORVLQLFLDU'
6HTrQFLD,

Mesna se cistite hemorrgica prvia

3) Consolidao: Dois ciclos de CYVE


CYVE: Iniciar D21 COPADM2 e D28 CYVE1 se n > 1500/mm3 e Pl > 100.000/mm3
Ara-C

50mg/m2

SC s 20:00 h

D1 a D5

Ara-C

1000mg/m2

EV das 8:00 s 11:00h

D2 a D5

VP-16

200mg/m2

EV das 14:00 s 16:00h

D2 a D5

Ciclofosfamida

500mg/m2

EV

D1 e D2

Vincristina

1,4 mg/m2

EV

D1

0HWKRWUH[DWH

2000 mg/m2

EV

D1

Adriamicina

60 mg/m2

EV

D2

| 130 |

HAART
Ciclos 2, 4, 6 e 8
0HWKRWUH[DWH

1000 mg/m2

EV em 24 hs

D1

Ara-C

3000 mg/m2

EV em 2 h 12/12 hs

D2 e D3 (4 doses)

Leucovorin

50 mg

EV 12 h aps trmino do MTX

| 131 |

Leucovorin

15 mg

EV 6/6 h 8 doses ou at metotrexatemia < 0,1 M

0HWKRWUH[DWH

12 mg

IT

D2

0HWKRWUH[DWH

12 mg

IT

D2

'H[DPHWDVRQD

2 mg

IT

D2

'H[DPHWDVRQD

2 mg

IT

D2

Ara-C

100 mg

IT

D7

Ara-C

100 mg

IT

D7

'H[DPHWDVRQD

2 mg

IT

D7

'H[DPHWDVRQD

2 mg

IT

D7
5LWX[LPDEH

375 mg/ m2

EV

D1

0HWKRWUH[DWH

1000 mg/ m2

EV

D2

Ara-C

3000 mg/ m2

EV 12/12 h

D3 e D4

Leucovorin

50 mg

EV 24 h aps MTX

Leucovorin

15 mg/ m2

VO 6/6 h 11 doses

0HWKRWUH[DWH

12 mg

IT

D2

9,,,/LQIRPDGH&pOXODVGR0DQWR

'H[DPHWDVRQD

2 mg

IT

D2

(VWUDWLFDomRGH5LVFR
1) MIPI:

Ara-C

100 mg

IT

D7

'H[DPHWDVRQD

2 mg

IT

D7

Ciclos 2, 4, 6 e 8

HAART
1)&LFORVFRPLQWHUYDORGHSHORPHQRVGLDVHDWpFRQWDJHPGHQHXWUyORV!PP
e plaquetas > 60.000/mm3
2)3UROD[LDVSULPiULDVOHYRR[DFLQDXFRQD]RODFLFORYLUH60;703
3) GCSF 10mcg/kg/d SC aps 24hs do trmino do ciclo, manter at N > 1500/mm3
Cancer 2002, v.94:492-499

Pontos

Idade (anos)

ECOG PS

'+/ [/61

Leuccitos / mm3

< 50

01

< 0,67

< 6700

50 59

0,67 0,99

6700 9999

60 69

24

1,00 1,49

10.000 14999







Pacientes < 65 anos avaliar ATMO


$QQ+HPDWRO

2 Opo 5&+23SDFLHQWHVDQRV
Ciclofosfamida

750 mg/ m2

EV

D1

Baixo Risco

0 3 pontos

'R[RUXELFLQD

50 mg/ m2

EV

D1

Risco Intermedirio

4 5 pontos

Vincristina

1,4 mg/ m2

EV

D1

Alto risco

6 11 pontos

Prednisona

100 mg

VO

D1-D5

5LWX[LPDEH

375 mg/m2

EV

D1

*LSN: limite superior da normalidade


%ORRG

Seis a 8 ciclos 21/21 dias


-&OLQ2QFRO

 QGLFHGHSUROLIHUDomRFHOXODU.L!
&DQFHU0DU  

IX. Linfoma Folicular


Protocolos de Tratamento de Primeira Linha

 (VWUDWLFDomRGH5LVFR)/,3,
Fatores Prognsticos

1 Opo R-Hyper-CVAD: pacientes < 65 anos


Ciclos 1, 2, 3, 5 e 7
5LWX[LPDEH

375 mg/ m2

EV

D1

Ciclofosfamida

300 mg/ m2

EV 12/12 h

D2-D4

Adriamicina

50 mg/ m2

EV

D5

Vincristina

1,4 mg/ m2

EV

D4 e D11

'H[DPHWDVRQD

40 mg

VO/EV

D1-D4 e D11-D14

| 132 |

Risco

Score

Idade > 60 anos

Baixo

01

Hemoglobina < 12g/dl

Intermedirio

DHL elevado

Alto

35

Estadiamento III / IV
6tWLRVQRGDLVHQYROYLGRV
%ORRG

| 133 |

 &ULWpULRVSDUDWUDWDPHQWR
Critrios elaborados pela Groupe pour lEtude de Lymphome Folliculaire (GELF)

Prednisona

100 mg

VO

D1-D5

Seis a 8 ciclos 21/21 dias

GELF

Blood, 2005 v.106:3725-3732

Massa com dimetro > 7 cm


VtWLRVQRGDLVHQYROYLGRV

X. Linfoma da Zona Marginal Esplnica

Sintomas sistmicos
Bao > 16cm (pela CT)*

Protocolos de Tratamento de Primeira Linha

'HUUDPHVFDYLWiULRVVLJQLFDWLYRV
1 Opo 0RQRWHUDSLDFRP5LWX[LPDE

Presena de risco de compresso local


Linfoma em fase leucmica*

5LWX[LPDEH

3UHVHQoDGHFLWRSHQLDV +EJGOOHXFRPP
e plaquetas<100.000/mm3)

375 mg/ m2

EV

Semanas 1, 2, 3, 4 , 5 e 6

ntervalo semanal
&DQFHU

* Considerar tratamento de outros fatores associados


-&OLQ2QFRO
Estdios Avanados Assintomticos - Observar
Estdios Localizado (Ann Arbor I e II) sintomticos / assintomticos - Radioterapia
Estdios Avanados Sintomticos - Quimioterapia

2 Opo Esplenectomia
Esplenectomia
&DQFHU

Protocolos de Tratamento de Segunda Linha


Protocolos de Tratamento de Primeira Linha

1 Opo FC: pacientes < 60 anos

1 Opo FCR: pacientes < 60 anos


Ciclofosfamida

250 mg/ m2

EV

D1-D3

Fludarabina

25 mg/ m2

EV

D1-D3

5LWX[LPDEH

375 mg/ m2

EV

D1

Ciclofosfamida

250 mg/ m2

EV

D1-D3

Fludarabina

25 mg/ m2

EV

D1-D3

Seis ciclos com intervalo de 30 dias


&DQFHU

Seis ciclos 30/30 dias


Cncer, 2007 v.110:121-128

2 Opo R-CVP: pacientes > 60 anos

2 Opo Clorambucil: pacientes > 60 anos


Clorambucil

VO

D1-D6

Mnimo 6 ciclos 30/30 dias

Ciclofosfamida

250 mg/ m2

EV

D1

Vincristina

1,4 mg/ m2

EV

D1

5LWX[LPDEH

375 mg/ m2

EV

D1

Prednisona

100 mg

VO

D1-D5

Haematologica 2006:91:1662-1673

Protocolos de Tratamento de Primeira Linha

Seis a 8 ciclos 21/21 dias


Blood, 2005,V.105:1417-1423

3 Opo R-CHOP: FLIPI alto risco, LF grau IIIB

;,/HXFHPLDGH&pOXODV3LORVDV
1 Opo 0RQRWHUDSLDFRPFKORURGHR[\DGHQRVLQH &G$

Ciclofosfamida

750 mg/ m2

EV

D1

Adriamicina

50 mg/ m2

EV

D1

Vincristina

1,4 mg/ m2

EV

D1

5LWX[LPDEH

375 mg/ m2

EV

D1

| 134 |

10mg/ m2/d

Cladribina 2-CdA

0,09 mg/kg/dia

EV contnuo

D1 - D7

Cladribina 2-CdA

0,14 mg/kg/dia

EV em 2 hs

D1 - D5

ou

Ciclo nico
N Engl J Md 1987 v. 317:901 e Ann Oncol, 2000 v.13: 1641-9

| 135 |

Protocolos de Tratamento de Segunda Linha

2 Opo 0RQRWHUDSLDFRP&ORUDPEXFLOSDFLHQWHVDQRV
Clorambucil

1 Opo 0RQRWHUDSLDFRP5LWX[LPDE
5LWX[LPDEH

375 mg/ m2

EV

Semana 1, 2, 3 e 4

10mg/ m2/d

VO

D1-D6

Mnimo 6 ciclos 30/30 dias


Haematologica 2006:91:1662-1673

Quatro doses semanais


Haematologica, 2008, v.93, p.1426-1428.

2 Opo Monoterapia com Interferon


Interferon alfa

3 milhes IU

SC

2 4 6 feiras
Best Pract Res Clin Hematol 2003, 16:69-81

3 Opo 0RQRWHUDSLDFRP)OXGDUDELQDSDFLHQWHVDQRV
Fludarabina

40 mg/ m2

VO

D1-D5

Fludarabina

25 mg/ m2

EV

D1-D5

ou

Seis a 8 ciclos 30/30 dias


N Engl J Med 2000, 343:1750-1757

3 Opo Esplenectomia
4 Opo mini-CHOP

Esplenectomia
Best Pract Res Clin Hematol 2003, 16:57-68

;,,/HXFHPLD/LQIRFtWLFD&U{QLFD%/LQIRPD/LQIRFtWLFR

Ciclofosfamida

650 mg/ m2

EV

D1

Adriamicina

25 mg/ m2

EV

D1

Vincristina

1,4 mg/ m2

EV

D1

Prednisona

100 mg

VO

D1-D5

Seis a 8 ciclos 21/21 dias

Avaliar citogentica Tumoral : del 17p/p53 mutado


Avaliar indicaes de tratamento

Baillieres Clin Haematol 1993 v. 6:867-78

Indicaes de Tratamento

5 Opo CVP

Sintomas B ou fadiga extrema


Esplenomegalia progressiva ou > 6 cm (exame fsico)
Linfonodomegalia progressiva ou > 10 cm
7HPSRGHGXSOLFDomROLQIRFLWiULDPHVHV

Ciclofosfamida

650 mg/ m2

EV

D1

Vincristina

1,4 mg/ m2

EV

D1

Prednisona

100 mg

VO

D1-D5

Seis a 8 ciclos 21/21 dias

Hb < 11g/dl

Baillieres Clin Haematol 1993 v. 6:867-78

Plaquetas < 100.000/mm3


Fenmenos auto-imunes
NCCN Practice Guidelines in Oncology, 2009

Protocolos de Tratamento de Segunda Linha


1 Opo Monoterapia com Alemtuzumabe
Primeira linha em pacientes com deleo 17p / p53 mutado
//&UHFLGLYDGDRXUHIUDWiULDDDOTXLODQWHVXGDUDELQD

Protocolos de Tratamento de Primeira Linha


1 Opo FCR: pacientes < 65anos
Ciclofosfamida

250 mg/ m2

EV

D1-D3

Fludarabina

25 mg/ m2

EV

D1-D3

5LWX[LPDEH

375 mg/ m2

EV

D1 1 ciclo

5LWX[LPDEH

500 mg/ m2

EV

D1 ciclos 2 a 6

Alemtuzumabe

10 mg

sc

D1 1 semana

20 mg

sc

D2 1 semana

30 mg

sc

2x/semana nas 2 e 3 semanas

30 mg

sc

1x/semana nas semanas 4, 6, 8, 10, 12, 16, 20, 24, 28


34 e 40

Pacientes < 55 anos encaminhar para aloTMO

Seis ciclos 30/30 dias


Blood 2008 v.112:975-980

| 136 |

%ORRG%ORRG SW D

| 137 |

XIII. Leucemia Prolinfoctica B


Protocolos de Tratamento de Primeira Linha
1 Opo FC: pacientes < 65anos
Ciclofosfamida

250 mg/ m2

EV

D1-D3

Fludarabina

25 mg/ m2

EV

D1-D3

500mg

VO

12/12h

$PR[DFLOLQD

1000mg

VO

12/12h

Omeprazol

20mg

VO

12/12h

Tratar por 7 dias

Protocolos de Tratamento de Segunda Linha


1 opo Radioterapia e Antibiticoterapia para H. pylori

Seis ciclos 30/30 dias


0HG6FL0RQLW  5$

a. Paciente com persistncia do linfoma, H. pylori negativo e assintomtico:


Observar e repetir EDA em 3 meses
b. Paciente com persistncia do linfoma, H. pylori negativo e sintomtico:
Radioterapia

Protocolos de Tratamento de Segunda Linha

c. Persistncia de H. pylori positivo com linfoma estvel:


$QWLELyWLFRWHUDSLD HVTXHPDGHIDOrQFLD

1 Opo Monoterapia com Alemtuzumabe

Alemtuzumabe

Claritromicina

10 mg

sc

D1 1 semana

20 mg

sc

D2 1 semana

30 mg

sc

2x/semana nas 2 e 3 semanas

30 mg

sc

1x/semana nas semanas 4, 6, 8, 10, 12, 16, 20, 24,


28 34 e 40

d. Persistncia de H. pylori positivo e linfoma em progresso:


5DGLRWHUDSLDDQWLELyWLFRWHUDSLD HVTXHPDGHIDOrQFLD

Considerar TMO alognico em 1 RC em pacientes < 55 anos com doador compatvel


0HG6FL0RQLW  5$

2 Opo 0RQRWHUDSLDFRP)OXGDUDELQDSDFLHQWHVDQRV
Fludarabina

40 mg/ m2

VO

D1-D5

Fludarabina

25 mg/ m2

EV

D1-D5

ou

(VTXHPDGHIDOrQFLD
Sal de Bismuto

240mg

VO

12/12h

Furozolidona

200mg

VO

12/12h

Omeprazol

20mg

VO

12/12h

$PR[DFLOLQD

1000mg

VO

12/12h

Tratar por 14 dias

2) Doena localizada ( Estadio I e II1 e II2) em pacientes


H. pylori negativos

Seis a 8 ciclos 30/30 dias


0HG6FL0RQLW  5$

Protocolo de Tratamento de Primeira Linha


1 opo Radioterapia

XIV. Linfoma MALT gstrico


Avaliar estadiamento de Lugano
Checar positividade para H.pylori pelo exame histopatolgico ou testes no invasivos

Protocolos de Tratamento de Segunda Linha


1 opo Fludarabina: em pacientes sintomticos

1) Doena localizada ( Estadio I e II1 e II2) em pacientes


H. pylori positivos

Fludarabina

40 mg/ m2

VO

D1-D5

Fludarabina

25 mg/ m2

EV

D1-D5

Protocolos de Tratamento de Primeira Linha

2 opo clorambucil: em pacientes sintomticos

1 opo Antibiticoterapia para H. pylori


(VTXHPDGHHVFROKD

Mnimo 6 ciclos 30/30 dias

| 138 |

Clorambucil

10mg/ m2/d

VO

| 139 |

D1-D6

ou

3) Doena avanada (estadio IIe, III e IV)

Xlll. Neoplasias Hematolgicas

Tratar se doena sintomtica, presena de bulky ou progresso

/LQIRPDQmR+RGJNLQGH&pOXODV7

Protocolos de Tratamento de Primeira Linha

,/HXFHPLD/LQIRPDGH&pOXODV7GR$GXOWR

1 opo FCR: pacientes < 60 anos


Ciclofosfamida

250 mg/ m2

EV

D1-D3

Fludarabina

25 mg/ m2

EV

D1-D3

5LWX[LPDEH

375 mg/ m2

EV

D1

&ULWpULRVSDUDGHQLomRGH$7//
&ULWpULRV&OtQLFRV

Seis ciclos 30/30 dias

Leso de pele

Fase Leucmica ( > 2% de clulas linfides anormais)

&ULWpULRV/DERUDWRULDLV

2 Opo R-CVP: pacientes > 60 anos


Ciclofosfamida

250 mg/ m2

EV

D1

Vincristina

1,4 mg/ m2

EV

D1

5LWX[LPDEH

375 mg/ m2

EV

D1

Prednisona

100 mg

VO

D1-D5

Adriamicina

50 mg/ m2

EV
EV

Anticorpo anti-HTLV-I

Expresso do receptor alfa da IL-2 (CD25)

Integrao monoclonal do HTLV ao genoma da clula tumoral

2
Score total

Clssica

SRQWRV

Provvel

5 6 pontos

D1

Possvel

3 4 pontos

D1

Inconsistente com ATLL

3 Opo R-CHOP:
750 mg/ m2

Clulas T com fentipo aberrante

&ODVVLFDomR

Seis a 8 ciclos 21/21 dias

Ciclofosfamida

Pontos

Hipercalcemia

Vincristina

1,4 mg/ m2

EV

D1

5LWX[LPDEH

375 mg/ m2

EV

D1

Prednisona

100 mg

VO

D1-D5

< 3 pontos
Int J Cancer. 1994, 59(4):491-3

Formas Clnicas WHO 2008

Seis a 8 ciclos 21/21 dias

Smoldering

&U{QLFD

Aguda

Linfocitose

No

Presente

Presente

Linfomatosa
No

/LQIyFLWRVDQ{PDORV

>5%

Aumentado

Aumentado

<1%

Protocolos de Tratamento de Segunda Linha

DHL

Normal

Pouco
aumentado

Aumentado

Aumentado

1 opo Fludarabina: em pacientes sintomticos

Hipercalcemia

Normal

Normal

Presente

Raramente

Rash cutneo

Discreto

Varivel

Varivel

Varivel

Linfadenopatia

Ausente

Discreta

Presente

Proeminente

Hepatoesplenomegalia

Ausente

Discreta

Presente

Discreta

,QOWUDomRGDPHGXOD
ssea

Ausente

Ausente

Presente

Ausente

Fludarabina

40 mg/ m2

VO

D1-D5

Fludarabina

25 mg/ m2

EV

D1-D5

Seis a 8 ciclos 30/30 dias


2 opo clorambucil: em pacientes sintomticos
Clorambucil

10mg/ m2/d

VO

D1-D6

ou

Protocolos de Tratamento de Primeira Linha

Mnimo 6 ciclos 30/30 dias


$7//IRUPDVVPRXGHULQJHFU{QLFD

| 140 |

| 141 |

Protocolos de Tratamento de Segunda Linha

1 opo ,QWHUIHURQ$=7
Interferon

3 milhes ui

3 x semana

Zidovudina

1000 mg/d

VO

Contnuo

Leukemia Lymphoma, 2007, v. 48:330-336

1 Opo -(VTXHPDFRP/$VSDUDJLQDVH
L-asparaginase

6.000 IU/m2

EV

D1-D7

Vincristina

1,4 mg/m2

EV

D1

'H[DPHWDVRQD

10 mg

EV

D1-D7

Intervalos de 28 dias, 6 ciclos

ATLL formas Linfomatosa e Aguda

+HPDWRO2QFRO  

1 opo CHOEP seguido de TMO alognico ou manuteno


FRPLQWHUIHURQ$=7
Ciclofosfamida

750 mg/ m2

EV

D1

Adriamicina

50 mg/ m2

EV

D1

Etoposide

100 mg/ m2

EV

D1-D3

Vincristina

1,4 mg/ m2

EV

D1

Prednisona

100 mg

VO

D1-D5

Seis a 8 ciclos, 21/21 dias


Pacientes < 60 anos com doador compatvel Avaliar TMO alognico

III. Leucemia Prolinfoctica T


Protocolos de Tratamento de Primeira Linha
1 Opo FC: pacientes < 60 anos
Ciclofosfamida

250 mg/ m2

EV

D1-D3

Fludarabina

25 mg/ m2

EV

D1-D3

Seis ciclos, 30/30 dias


European Journal of Haematology, Feb, 2008

Pacientes com contraindiaes ao TMO alognico:

Protocolos de Tratamento de Segunda Linha


,,/LQIRPDGH&pOXODV71.1DVDO

1 Opo - Monoterapia com Alemtuzumabe

Protocolos de Tratamento de Primeira Linha


1 Opo - Radioterapia-CHOMP

Alemtuzumabe

5DGLRWHUDSLDFDPSRH[WHQGLGRDQWHVGDTXLPLRWHUDSLD
Ciclofosfamida

750 mg/m2

EV

D1

'R[RUXELFLQD

50 mg/m2

EV

D1

Vincristina

1,4 mg/m2

EV

D1

0HWKRWUH[DWH

1500 mg/m2

EV

D1

Leucovorin

15 mg/m2

VO 6/6 hs 12 doses 24 hs aps incio do MTX

Prednisona

100 mg

VO

0HWKRWUH[DWH

12 mg

'H[DPHWDVRQD

2 mg

10 mg

sc

D1 1 semana

20 mg

sc

D2 1 semana

30 mg

sc

2x/semana na 2 e 3 semanas

30 mg

sc

1x/semana nas semanas 4, 6, 8, 10, 12, 16, 20, 24, 28


34 e 40

Pacientes < 55 anos encaminhar para aloTMO


(XURSHDQ-RXUQDORI+DHPDWRORJ\

,9/LQIRPD73HULIpULFR1mR&ODVVLFDGRV

D1-D5

Protocolos de Tratamento de Primeira Linha

IT D1 dos Ciclos 1, 2, 3 e 4

1 Opo CHOEP

Intervalo 21 dias, 6 a 8 ciclos


Cancer 6018-24,1987

| 142 |

Ciclofosfamida

750 mg/ m2

EV

D1

Adriamicina

50 mg/ m2

EV

D1

Etoposide

100 mg/ m2

EV

D1-D3

Vincristina

1,4 mg/ m2

EV

D1

| 143 |

Prednisona

100 mg

VO

D1-D5

Se < 60 anos Encaminhar para ATMO em RC1

Protocolos de Tratamento de Segunda Linha


2 Opo *HPFLWDELQDYLQRUHOELQD6tQGURPHGH6p]DU\UHIUDWiULD
ou estdio III / IV

Anaplsico ALK negativo Encaminhar para ATMO em RC1

Gemcitabina

Seis a 8 ciclos 21/21 dias


Hematology Am Soc Hematol Educ Program 2006:331-337

3 x semana

Vinorelbine

3 milhes UI SC

3 x semana

Contnuo

Seis a 8 ciclos a cada 21 dias

2 Opo CHOP

2QFRORJ\  

Ciclofosfamida

750 mg/ m2

EV

D1

Adriamicina

50 mg/ m2

EV

D1

Etoposide

100 mg/ m2

EV

D1-D3

Vincristina

1,4 mg/ m2

EV

D1

Prednisona

100 mg

VO

D1-D5

Pacientes < 60 anos avaliar Mini alo TMO

VI. Leucemia de linfcitos T Grandes Granulares

Se < 60 anos Encaminhar para ATMO em RC1


Anaplsico ALK negativo Encaminhar para ATMO em RC1

1) Pacientes assintomticos e sem citopenias


Manter observao
2) Pacientes sintomticos ou com citopenias

Seis a 8 ciclos 21/21 dias


Hematology Am Soc Hematol Educ Program 2006:331-337

Protocolos de Tratamento de Primeira Linha


Protocolos de Tratamento de Segunda Linha

1 Opo Fludarabina

1 Opo ,9$&PRGLFDGR

Fludarabina

25 mg/m2

VO

D1-D5

Reavaliar aps 3 ciclos

Ifosfamida

1500 mg/ m2

EV

D1-D5

Etoposide

60 mg/ m2

EV

D1-D5

Citarabina

2000 mg/ m2 12/12 horas

EV

D1-D3

Protocolos de Tratamento de Segunda Linha

Mesna

20% IFX
0, 4 e 8 h IFX

EV

D1-D5

1 Opo &LFORVSRULQD$SDFLHQWHVUHIUDWiULRVRXUHFLGLYDGRVDSyVXGDUDELQD

0HWKRWUH[DWH

12 mg

IT

D5

'H[DPHWDVRQD

2 mg

IT

D5

GCSF

300 mg/d

SC

D8 at n > 1500/mm3

ATMO para quimiossensveis

V. Linfomas T Cutneos

CSA

100 mg 2x dia at 5 g/kd/dia

Manter nvel srico entre 100 a 120 ng/ml


Avaliar funo renal (Cr < 2 mg/dl) e repor magnsio

0HWRWUH[DWH

Protocolos de Tratamento de Primeira Linha

15 mg/m2

IM

Reavaliar aps 3 ciclos

1 Opo 389$,QWHUIHURQ6GGH6p]DU\

Interferon

3 x semana
3 milhes UI SC

Contnuo

2 Opo 0HWRWUH[DWHSDFLHQWHVUHIUDWiULRVD&V$HXGDUDELQDRXFRPFRQtra indicaes para estas

0LFRVH)XQJyLGHH6tQGURPHGH6p]DU\

PUVA

VO

Reavaliar aps 3 ciclos

3 x semana

Contnuo

+HPDWRO2QFRO&OLQ1RUWK$0

| 144 |

| 145 |

1 x semana contnuo

Xlll. Neoplasias Hematolgicas


2. Linfoma de Hodgkin

I.3 Terceira Opo:


,&(PRGLFDGR
Frmaco

Dose

IFOSFAMIDA

1500 mg/m2

EV

Via
D1 a D3

Dias

CID C81

ETOPOSIDE

100 mg/m2

EV

D1 a D3

Doena de Hodgkin

CARBOLATINA

5 x AUC

EV

D1

Repetir esquema a cada 21 dias

Diagnstico

Para diagnstico realizar bipsia da leso alvo para Hematoxilina-Eosina e imunohistoqumica


9HULFDUVRURORJLDVSDUD+HSDWLWH%&H+,9
Avaliar funo cardaca por ecocardiograma ou MUGA
Avaliar se h leso superior ou igual a 7,0 cm (Bulky)
Exames de Estadiamento incluem: CT pescoo, trax, abdomem e pelve, PET/CT

%ORRG  

,(VTXHPDSDOLDWLYR
CEM
Frmaco

I.1 Primeira Opo


ABVD

Frmaco

Dose

ADRIBLASTINA

25 mg/m

BLEOMICINA

10 mg/m

VINBLASTINA

6 mg/m

DTIC

375 mg/m

Via

Dias

EV
EV
EV
EV

D1
D1
D1
D1

e
e
e
e

D15
D15
D15
D15

N.Engl. J Med, 1992. 327:1478-1484

Realizar 4 a 8 ciclos conforme estdio clnico e resposta

I.2 Segunda Opo


GIV
Frmaco

Dose

Via

IFOSFAMIDA

1500 mg/m

EV

MESNA

20% da dose de IFX antes, 4 e 8 h aps

EV

GEMCITABINA

1000 mg/m

VINORELBINA

25 mg/m

EV
EV

Dias
D1 a D5
D1 a D5

Dose

Via

CITOSTAL

100 mg/m2

VO

D1

ETOPOSIDE

100 mg/m2

VO

D1 a D3
D21 a D23

METOTREXATE

30 mg/m2

IM

D1 e D8
D21 e D28

Repetir esquema a cada 42 dias


-&OLQ2QFRO2FW  

I.5 RADIOTERAPIA
Indicaes:
%XON\ PDVVDFPRXUD]mRPHGLDVWLQRWyUD[!
Estdios Clnicos I e II sem sintomas sistmicos: 4 ciclos de QT + radioterapia de campos
acometidos1
Estdios Clnicos I e II com sintomas sistmicos ou bulky: 4 a 6 ciclos QT + radioterapia
de campos acometidos1
Pacientes com estdio clinico IA acometimento cervical alto ou mediastino anterior com
contra-indicao a quimioterapia ou intolerantes devido a mltiplas comorbidades: considerar a radioterapia isolada (NCCN clinical practice guidelines v2. 2009).

D1 e D8
D1 e D8

5HY%UDV+HPDWRO+HPRWHU 
+DHPDWRORJLFD  

Realizar 1 ciclo a cada 28 dias e encaminhar a TMO autlogo

| 146 |

Dias

| 147 |

Xlll. Neoplasias Hematolgicas

Bortezomibe

1,3 mg/m2/dia

EV, BOLUS

D1, D4, D8, D11

JCO, 21:2732-39, 2003


Associar: Ondansentrona 8 mg EV pr QT no D1, D4, D8 e D11
Hidratao com SF 1000 ml EV apenas no ciclo 1
Nmero de ciclos: Se doena estvel mais 2 ciclos adicionais. Mximo de 8 ciclos.
Intervalo dos ciclos: 21 dias
Bortezomibe: intervalo das doses devem ser rigorosamente de 72 hs, monitorizar funo

3. Mieloma Mltiplo
CID C90 Mieloma mltiplo e neoplasias malignas de plasmcitos

renal, transaminases, neuropatia perifrica e hemograma.


Reduzir dexametasona se DM, ICC, Soluo, HAS.

,([DPHVGLDJQyVWLFRV
Eletroforese de protenas
,PXQR[DomRVpULFDHXULQiULD
Proteinria de 24 horas
$VSLUDGRGHPHGXODyVVHDSDUDPLHORJUDPDSDUD),6+SDUD'HOW  W  RX

citogentica convencional para pesquisa da deleo 13 e hipodiploidia


Raio X de esqueleto.

II. Pacientes candidatos ao Transplante de Medula


ssea autlogo
CTD 1 linha, 1 Opo
Ciclofosfamida

500mg

VO

D1 , D8 e D15

'H[DPHWDVRQD

40 mg/dia

VO

D1 - D5 e D14 - D18

Talidomida

100 mg/dia

VO

D1 - D5 e D12 - D18

Nmero de ciclos: 3 a 4 ciclos pr TMO


+HPDWRO-  
Intervalo dos ciclos: 30 dias
Associar: Ondansentron 8mg vo 8/8h D1, D8 e D15
Talidomida: monitorizar freqncia cardaca, trombose, neuropatia perifrica e autonmica

2EVHUYDomRVHQmRREWLGDUHVSRVWDDSyVFLFORVGHERUWH]RPLEHHGH[DPHWDVRQDVHUiDGLFLRQDGRFLFORIRVIDPLGDFRQIRUPHSURWRFRORDEDL[R
'H[DPHWDVRQD

40 mg/dia

EV

D1, D4, D8, D11

'H[DPHWDVRQD

40 mg/dia

VO

D2, D5, D9 ,D12

Bortezomibe

1,3 mg/m2/dia
1,0 mg/m2/dia se IR

EV, BOLUS

D1, D4, D8, D11

Ciclofosfamida

500 mg

VO

D1, D8, D15

%ORRG
Dose de Dexametasona pode ser reduzida se Diabetes, ICC, Soluo, HAS
Associar: Ondansentrona 8 mg EV pr QT no D1, D4, D8 e D11 e VO 8/8hs no D15
Hidratao com SF 1000 ml EV apenas no ciclo 1
Nmero de ciclos: 3 a 4 ciclos pr TMO
Intervalo dos ciclos: 21 dias
Bortezomibe: intervalo das doses devem ser rigorosamente de 72 hs, monitorizar funo

renal, transaminases, neuropatia perifrica e hemograma.


Pacientes com recidiva ou refratrio aps TMO autlogo
MM recidiva < 1 ano aps ASCT ou refratrio

1 Opo : DTPACE 1 linha

e rash cutneo
Reduzir dexametasona se DM, ICC, Soluo, HAS.
5HDOL]DUSUROD[LDSDUD793

'H[DPHWDVRQD

40 mg/dia

VO

D1- D4

Talidomida

400 mg/dia

VO

CONTNUO

Cisplatina

10 mg/m2/dia

EV, infuso contnua 24 hs

D1- D4

'H[DPHWDVRQDLQGXomR IDVHV OLQKDVHJXQGDRSomR

'R[RUUXELFLQD

10 mg/m2/dia

EV infuso contnua

D1- D4

Ciclofosfamida

400 mg/m2/dia

EV infuso contnua

D1- D4

Etoposide

40 mg/m2/dia

EV infuso contnua

'H[DPHWDVRQD

40 mg/dia

VO

D1- D4, D9- D12, D17- D20

Nmero de ciclos: 3 a 4 ciclos.


Blood, 80, 887-890, 1992
Intervalo dos ciclos: 30 dias.
Reduzir dexametasona se DM, ICC, Soluo, HAS.

%RUWH]RPLEH'H[DPHWDVRQDOLQKDHP3DFLHQWHVFRPLQVXFLrQFLDUHQDO
HRX),6+'HOW  W  RXFLWRJHQpWLFDFRQYHQFLRQDOGHOHomRRX
hipodiploidia
'H[DPHWDVRQD

40 mg/dia

EV/OU

D1, D4, D8, D11

'H[DPHWDVRQD

40 mg/dia

VO

D2, D5, D9, D12

| 148 |

D1- D4
JCO, 21:2732-39, 2003

Nmero de ciclos:
,QWHUYDOR GRV FLFORV D FDGD  D  VHPDQDV RX QHXWUyORV ! PP H SODTXHWDV !
PP6HWR[LFLGDGHQmRKHPDWROyJLFDJUDXDGLDGRDGLDUSUy[LPRFLFORDWpWR[LFLGDGHHUHGX]LUSUy[LPDVGRVHVHPD$VGRVHVGLiULDVGHFLVSODWLQDFLFORIRVIDPLda e etoposide so diludas em 1 litro de SF.. A doxorrubicina administrada separadamente
em SG 5%. Administrar via catter venoso central.
5HDYDOLDUDSyVFLFORVVHUHGXomRGRSLFRPRQRFORQDODDYDOLDUHQFDPLQKDPHQWR

| 149 |

para TMO mini-alognico. Paciente no candidatos a TMO mini-alognico manter tratamento


at no mximo 6 ciclos.

III. Pacientes no candidatos ao Transplante de Medula


ssea autlogo
1 linha, 1 Opo: MD ou MDT
Associar talidomida em pacientes sem respostas satisfatria aps ..... ciclos de MD
Melfalano

10 mg /m/dia

VO

D1- D4

'H[DPHWDVRQD

20mg /dia

VO

D1- D4

Talidomida

100 mg/dia

VO

Contnuo
Medical Oncology 17, 219-226, 2002.

1RYHFLFORVHPPpGLD
Dose de dexametasona pode ser reduzida se Diabetes, ICC, Soluo, HAS
Talidomida: monitorizar freqncia cardaca, trombose e neuropatia perifrica e autonmica.
0HOIDODQRPRQLWRUL]DUFRPKHPRJUDPD DMXVWHGHGRVHSDUDPDQWHUQHXWUyORVDFLPDGH
1500/mm3) e funo renal.
3UROD[LDSDUD793

Se no obtida resposta aps dois ciclos, ser acrescentado ciclofosfamida, conforPHSURWRFRORDEDL[R


'H[DPHWDVRQD

20 mg/dia

EV

D1, D4,D8,D11

'H[DPHWDVRQD

20 mg/dia

VO

D2, D5, D9,D12

Bortezomibe

1,3 mg/m2

EV, BOLUS

D1, D4, D8, D11

Ciclofosfamida

500 mg

VO

D1, D8, D15

%ORRG
Dose de Dexametasona pode ser reduzida se Diabetes, ICC, Soluo, HAS
Associar: Ondansentrona 8 mg EV pr QT no D1, D4, D8 e D11 e VO 8/8hs no D15
Hidratao com SF 1000 ml EV apenas no ciclo 1
Nmero de ciclos: 9 ciclos
Intervalo dos ciclos: 30 dias
Bortezomibe: intervalo das doses devem ser rigorosamente de 72 hs, monitorizar funo

renal, transaminases, neuropatia perifrica e hemograma.

IV.Tratamento adjuvante- Doena ssea


Pacientes com leses Lticas, fraturas compressivas por osteopenia.
1 Opo :FLGR=ROHGU{QLFR

1 linha 2 Opo : CTD

Pamidronato

Ciclofosfamida

150 mg 12/12 hs - Dose total

VO

D1 - D5

'H[DPHWDVRQD

20 mg/dia

VO

''''

Talidomida

100 mg/dia

VO

''''

+HPDWRO-  
Ondansentron 8mg vo 8/8h D1 a D5
Nmero de ciclos: mximo 9
Intervalo dos ciclos: 30 dias
Talidomida: monitorizar freqncia cardaca, trombose e neuropatia perifrica e autonmica

90 mg/dia

EV

Aplicao mensal - Infuso em 3 horas

JCO, 25:2464-72, 2007


Mximo de 24 ciclos
Se indicada a medicao aps os 24 ciclos, prescrever aplicao trimestral
Avaliao odontolgica pr tratamento
Monitorizao: funo renal, clcio srico e microalbuminria

 2SomR  %RUWH]RPLEH  'H[DPHWD]RQD  3DFLHQWHV FRP LQVXFLrQFLD UHQDO


HRX),6+'HOW  W  RXFLWRJHQpWLFDFRQYHQFLRQDOGHOHomRRX
hipodiploidia
'H[DPHWDVRQD

20 mg/dia

EV

D1, D4, D8, D11

'H[DPHWDVRQD

20 mg/dia

VO

D2, D5, D9, D12

Bortezomibe

1,3 mg/m2/dia
1,0 mg/m2/dia se IR

EV, BOLUS

D1, D4, D8, D11

JCO, 21:2732-39, 2003


Associar: Ondansentrona 8 mg EV pr QT no D1, D4, D8 e D11
Hidratao com SF 1000 ml EV apenas no ciclo 1
Nmero de ciclos: Se doena estvel mais 2 ciclos adicionais. Mximo de 8 ciclos.
Intervalo dos ciclos: 21 dias
Bortezomibe: intervalo das doses devem ser rigorosamente de 72 hs, monitorizar funo

renal, transaminases, neuropatia perifrica e hemograma.

| 150 |

| 151 |

Xlll. Neoplasias Hematolgicas


4. Leucemia Mielide Aguda

BT >3,0mg/dl: 50% dose


Se creatinina srica > 3,0mg/dl: 50% dose

Consolidao (4 ciclos)

CID C92.0
Leucemia Mielide Aguda

Frmaco

Dose

Via

Dias

Citarabina (Ara-C)

3000 mg/m2

EV em 3h. 12/12h (6 doses)

D1, D3 e D5

FLFORVFGLDVRXVHPDQDDSyVUHFXSHUDomRPHGXODU 1PPPHSODTXHWDV

,([DPHVGLDJQyVWLFRV
Mielograma
Imunofenotipagem painel para leucemia aguda de medula ssea ou sangue perifrico
Citogentica de medula ssea ou sangue perifrico
Amostra de medula ssea ou de sangue perifrico para exames de biologia molecular para pes-

quisa de FLT3, PML-RARA, bcr-abl e outros marcadores de acordo com o subtipo de leucemia.

II.Protocolo 1 Linha para LMA M0, M1, M2, M4, M5, M6, M7
Pacientes < 60 anos; Frao de Ejeo normal; ECOG 0-2
PRGLFDGRGR0D\HUHWDO1(-0 

Induo (VTXHPD'$ DWpGRLVFLFORV


Frmaco

Dose

Via

Dias

Daunorrubicina (DRM)

60mg/ m2

EV

D1 a D3

Citarabina (Ara-C)

200 mg/m2

EV infuso contnua

D1 a D7

PP
Utilizar colrio de metilcelulose 2/2h
Realizar mielograma c/ 2 ciclos
$VGRVHVGH$5$&+'GXUDQWHFRQVROLGDomRGHYHUmRVHUPRGLFDGDVGDVHJXLQWHIRUPD
A) subtrair 1 dose de ARA-C HD no ciclo seguinte se:
1) recuperao medular >28 dias
2) erupo cutnea maculo-papular e/ou descamao de pele
3) fotofobia ou conjuntivite sem melhora com esterides oftlmicos
4) diarria >4 episdios/dia
5) TGO, TGP ou FA > 4 x valor normal
6) BT>3mg/dl
B) diminuir todas as doses de ARA-C HD para 400mg/m2 se:
1)DWD[LDFHUHEHODU PRGLFDomRGDHVFULWDRXVLQDLVSUHFRFHV 
2) confuso mental
3) outras manifestaes neurolgicas leves no associadas a uso de antiemticos
C) suspender ARA-C HD se leso neurolgica grave ou persistente
Manuteno (6 ciclos)
Meses 1; 3 e 5 POMP

Alternativa:(VTXHPD,$
Frmaco

Dose

Via

Dias

Frmaco

Dose

Via

Dias

Idarrubicina (IDA)

12mg/ m2

EV

D1 a D3

6mercaptopurina (6MP)

70 mg/m2

VO

D1 a D5

Citarabina (Ara-C)

200 mg/m2

EV infuso contnua

D1 a D7

Mielograma no D14: se blastos >5% ou celularidade >20% na BMO: iniciar 2 ciclo. Se

blastos <5% ou BMO hipocelular: aguardar e realizar mielograma no D30 ou quando comear a recuperar contagem de sangue perifrico.
Administrar G-CSF 5 mcg/Kg/dia ps esquema de induo nos neutropnicos febris
Se RC : iniciar consolidao,
Se RP : 2 ciclo idntico ao 1 e realizar mielograma aps.
3UROD[LD61& Ara-C 60mg + Dexa 2mg IT no dia 30
6HLQOWUDGRUHDOL]DU/&5VHPDQDOFRP$5$&'H[DDWpFODUHDUHDSyV

Vincristina (VCR)

1.4mg/m2

EV

D1

0HWRWUH[DWH 07;

30 mg/m2

EV

D1

Prednisona (PRD)

60 mg/m2

VO

D1 a D5

Meses 2; 4 e 6
Frmaco

Dose

Via

Dias

Citarabina (Ara-C)

100 mg/m2

SC/ IM 12/12h

D1 a D5

6tioguanina (6TG)

100 mg/m2

VO 12/12h

D1 a D5

Obs: durante manuteno realizar mielograma cada 3 meses.


&RQVLGHUDVHUHPLVVmRFRPSOHWD02QRUPDOEODVWRV1PPHSODTXHWDV
100.000/mm3
Pacientes primariamente refratrios a este protocolo, <50 anos e boas condies clnicas

Observaes:
Reduzir dose de DRM se:
BT 1,2-3,0mg/dl: 75% dose

| 152 |

| 153 |

devero ser encaminhados para TMO alognico.

III. Protocolo 1 Linha para LMA M0,M1,M2,M4,M5,M6,M7


Pacientes 61-65 anos; Frao de ejeo normal, ECOG 0-2, no secundria a SMD.
PRGLFDGRGR5RZH/HXNHPLD

Induo (VTXHPD0$
Frmaco

Frmaco

Dose

Via

Dias

6-mercaptopurina (6MP)

70 mg/m2

VO

D1 a D5

Vincristina (VCR)

1.4mg/m2

EV

D1

0HWRWUH[DWH 07;

30 mg/m2

EV

D1

Prednisona (PRD)

60 mg/m2

VO

D1 a D5

Meses 2; 4 e 6 $UD&7*
Dose

Via

Dias

Frmaco

Dose

Via

Dias

Citarabina (Ara-C)

100 mg/m2

SC/ IM 12/12h

D1 a D5

6-tioguanina (6TG)

100 mg/m2

VO 12/12h

D1 a D5

0LWR[DQWURQD 07=

12 mg/ m2

EV

D1 a D3

Citarabina (Ara-C)

100 mg/m2

EV infuso contnua

D1 a D7

Mielograma no D14: se blastos >5% ou celularidade >20% na BMO: iniciar 2 ciclo. Se

blastos <5% ou BMO hipocelular: aguardar e realizar mielograma semanal.


Se RC : iniciar consolidao,
Se RP : 2 ciclo idntico ao 1 e realizar mielograma aps.
G-CSF: 5g/k/d a partir do D8 at N>1500/mm3
3UROD[LD61&$5$&PJ'H[DPJ,7QRGLD
6HLQOWUDGRUHDOL]DU/&5VHPDQDO$5$&'H[DDWpFODUHDUHDSyV

Obs: durante manuteno realizar mielograma cada 3 meses.

IV. Protocolo 1 Linha para LMA M3 (Promieloctica Aguda)


)HQDX[HWDOPRGLFDGR%ORRG

Induo
6HOHXFyFLWRVPP EDL[RRXLQWHUPHGLiULRULVFR HDQRV

Consolidao
Frmaco

Dose

Via

Dias

Citarabina (Ara-C)

1500 mg/m2

EV em 3h. 12/12h (6doses)

D1, D3 e D5

Frmaco
cido all-trans-retinico
(ATRA)
Daunorrubicina (DRM)

2 ciclos cada 28 dias ou 1 semana aps recuperao medular.


Utilizar colrio de metilcelulose 2/2h
G-CSF: 5g/k/d a partir do D6 at N>1500/mm3
$VGRVHVGH$5$&+'GXUDQWHFRQVROLGDomRGHYHUmRVHUPRGLFDGDVGDVHJXLQWHIRUPD

A) subtrair 1 dose de ARA-C HD no ciclo seguinte se:


1) recuperao medular >28 dias
2) erupo cutnea maculo-papular e/ou descamao de pele
3) fotofobia ou conjuntivite sem melhora com esterides oftlmicos
4) diarria >4 episdios/dia
5) TGO, TGP ou FA > 4 x valor normal
6) BT>3mg/dl
B) diminuir todas as doses de ARA-CHD se:
1)DWD[LDFHUHEHODU PRGLFDomRGDHVFULWDRXVLQDLVSUHFRFHV 
2) confuso mental
3) outras manifestaes neurolgicas leves no associadas a uso de antiemticos
C) suspender ARA-C HD se: Leso neurolgica severa ou persistente

Citarabina (Ara-C)

Dose

Dias
D1 a D90 se
necessrio

60mg/m

EV em 1h 1x/dia

D3 a D5

200 mg/m

EV em infuso
contnua

D3 a D9

Dose

Via

Alternativa:
Frmaco
cido all-trans-retinico
(ATRA)
Idarrubicina (IDA)
Citarabina (Ara-C)

VO dividido em 2
45 mg/m2
tomadas por dia

Dias
D1 a D90 se
necessrio

60mg/m

EV em 1h 1x/dia

D3 a D5

200 mg/m

EV em infuso
contnua

D3 a D9

Se leuccitos > 5.000/mm (alto risco), independente da idade


Frmaco

Dose

Via

Dias

cido all-trans-retinico
(ATRA)

45 mg/m2

VO dividido em 2
tomadas por dia

D1 a D90 se
necessrio

Daunorrubicina (DRM)

60mg/m

EV em 1h 1x/dia

D1 a D5

200 mg/m

EV em infuso
contnua

D1 a D7

Citarabina (Ara-C)
Manuteno
Meses 1; 3 e 5 (POMP)

| 154 |

Via

VO dividido em 2
45 mg/m2
tomadas por dia

| 155 |

Alternativa:

Manuteno (24 meses)

Frmaco

Dose

cido all-trans-retinico
(ATRA)

Via

VO dividido em 2
45 mg/m2
tomadas por dia

Dias

Frmaco

Dose

Via

Meses

D1 a D90 se
necessrio

ATRA

45 mg/m2

VO dirio

D1 a D15 a cada 3 meses

6 mercaptopurina (6MP)

90 mg/m2

VO dirio

24 meses

0HWRWUH[DWH 07;

15 mg/m2

VO/IM semanal

24 meses

Idarrubicina (IDA)

12mg/m

EV em 1h 1x/dia

D1 a D3

Citarabina (Ara-C)

200 mg/m

EV em infuso
contnua

D1 a D7

Frmaco

Dose

Via

Dias

cido all-trans-retinico
(ATRA)

45 mg/m2

VO dividido em 2
tomadas por dia

D1 a D90 se
necessrio

Pacientes > 65-75 anos

Se atingir remisso completa:


Frmaco

Dose

Via

Dias

Daunorrubicina (DRM)

60 mg/m2

EV em 1h 1x/dia

D1 a D3

Citarabina (Ara-C)

200 mg/m

EV em infuso contnua

D1 a D7

Alternativa:
Frmaco

Dose

Via

Dias

Idarrubicina (IDA)

12 mg/m

EV em 1h 1x/dia

D1 a D3

Citarabina (Ara-C)

200 mg/m

EV em infuso contnua

D1 a D7

Reavaliao com mielograma no D30. Se MO < 5% de blastos, aguardar critrios de remis-

VmRFRPSOHWD$VVLPTXH5& SODT!HQHXWUyORV! VHJXLUSDUDFRQVROLGDomR


(manter ATRA at incio da consolidao). Se MO hipocelular porm com < 5% de blastos,
manter ATRA at 90 dias e ir reavaliando com mielograma semanal.
3UROD[LD61&$UD&PJGH[DPHWDVRQDPJ,7DSyV5&6HLQOWUDomRGR61&DSOL-

car semanalmente at clarear, aps, consolidar com mais 2 aplicaes.

Observaes:
1 -6HRFRUUH6tQGURPHGR$75$ IHEUHQmRH[SOLFDGDDXPHQWRGHSHVRLQOWUDGRSXOPRQDU
LQWHUVWLFLDOGHUUDPHSOHXUDOHRXSHULFiUGLFRLQVXFLrQFLDUHVSLUDWyULDLQVXIUHQDO VXVSHQder ATRA e iniciar Dexametasona 10mg EV 12/12 horas x 3 ou mais dias at resoluo dos
sintomas.
Se o quadro clnico remite reiniciar ATRA 75% da dose inicial, aumentar gradualmente a dose
at 100% em 3 a 5 dias.
2 - PCR para PML/RAR@ deve ser feito em amostras de medula ssea a cada 3 meses a
partir da RC at 2 anos. Aps, colher semestralmente at 5 anos e aps, anualmente. Hemograma e bioqumica (com eletrlitos, funo heptica e renal) devem ser feitos mensalmente
at 2 anos, aps semestralmente at 5 anos, posteriormente anualmente.
3 - Se o PCR para PML-RAR@ mantiver-se positivo aps 3 meses da data do diagnstico, ou
WRUQDUVHSRVLWLYRDSyVWHUVLGRQHJDWLYRGHYHVHUUHSHWLGRHPVHPDQDV6HFRQUPDGR
trata-se de falncia ou recada molecular. Reiniciar ento reinduo e avaliar TMO alognico.
Tratamento de suporte:
1 - Concentrado de plaquetas irradiadas: manter >50.000/mm3 at desaparecimento da
coagulopatia.
2 - Plasma fresco se INR > 1,5 e/ou sangramento
3 -&ULRSUHFLSLWDGRVHEULQRJrQLRHRXVDQJUDPHQWR

V. Protocolo 2 Linha para tratamento LMA


M0,M1,M2,M4,M5,M6,M7
Protocolo FLAG
3DFLHQWHVDQRV(&2*UHFLGLYDSUHFRFH DWpPHVHVDSyV5&
ou refratrio a 1 ou 2 ciclos de induo de 1 linha. 2 linha para LMA
secundria a SMD com caritipo normal.

Consolidao
Pacientes < 65 anos: 2 ciclos
Pacientes > 65 anos: realizar somente o 2 ciclo
&LFORLGrQWLFRjLQGXomR '50$UD&RX,'$$UD& VHP$75$
2 Ciclo:
Frmaco

Dose

Via

Dias

Daunorrubicina (DRM)

45 mg/m2

EV em 1h 1x/dia

D1 a D3

Citarabina (Ara-C)

1000 mg/m

EV 1x/dia

D1 a D4

Frmaco

Dose

Via

Dias

EV em 50 minutos

D1 a D5

2000 mg/m2

EV em 4 h.(Infundir aps
KPGRPGD)OXGDUD

D1 a D5

5g/kg

Iniciar no dia anterior


QT

'DWpQHXWUyORV
>500/mm3

Fludarabina (FDR)

30 mg/m2

Citarabina (Ara-C)
G-CSF

Utilizar colrio de metilcelulose 2/2h desde o incio at 24h aps a administrao

de Ara-C altas doses


Se RC, encaminhar para TMO alognico
Se remisso parcial, realizar mais um ciclo

| 156 |

| 157 |

VI.Protocolo 3 Linha para tratamento LMA


M0,M1,M2,M4,M5,M6,M7

VII. Protocolo para tratamento da LMA em RECIDIVA


TARDIA - M0,M1,M2,M4,M5,M6,M7

Protocolo MEC
Pacientes < 65 anos, ECOG 0-2 e recidiva precoce

Pacientes <65 anos, ECOG 0-2


(Berman et al., Blood, 77: 1666-1674)
(Amadori et al. JCO, 9: 1210-14, 1991)

Induo

Reinduo (2 ciclos)
Frmaco

Frmaco

Dose

Etoposide (VP-16)
Citarabina (Ara-C)

80 mg/m2

Via

Dias

Idarubicina (IDA)

EV em 1 h.

D1 a D6

Citarabina (Ara-C)

EV em 6 h
1000 mg/m2
(Infundir imediatamente aps VP16)

0LWR[DQWURQD 07=

6 mg/m2

D1 a D6

EV em 1 hora (Iniciar 3h aps o


PGR$UD&

D1 a D6

Citarabina (Ara-C)

60 mg

IT

D15

'H[DPHWDVRQD '[

2mg

IT

D15

Dose

Via

Dias

12 mg/m2

EV

D1 a D3

200 mg/m2

EV (inf.cont.)

D1 a D7

Mielograma no D14: se blastos >5% ou celularidade >20% na BMO: iniciar 2 ciclo. Se

blastos <5% ou BMO hipocelular: aguardar e realizar mielograma semanal.


Se RC : encaminhar para TMO ALOGNICO se < 50 anos.
Se RP : 2 ciclo e realizar mielograma aps. Se RC aps 2o ciclo e < 50 anos TMO
alognico
Se no tiver doador HLA compatvel ou > 50 anos: TMO AUTLOGO.

Precaues:
Aplicar Colrio de Metilcelulose 1 gota em cada olho de 2 em 2 horas durante todo o ciclo
de QT.

VIII.Protocolo para tratamento da LEUCEMIA MIELIDE


AGUDA (NO M3) IDOSOS OU PALIATIVO

Observao:
Vepeside (VP16) diluir cada 1mg do frmaco em 1ml de SF 0.9%.

Pacientes > 65 anos ou < 65 anos


sem possibilidade de incluso nos protocolos de QT intensiva.

Consolidao
,GrQWLFDjLQGXomRSRUpPGXUDQWHGLDV
Se 2 RC e < 50 anos: Encaminhar para TMO alognico.
Se no tiver doador HLA idntico ou > 50anos : TMO autlogo

1 Linha para pacientes com CTG de no alto risco


Frmaco

Dose

Via

Dias

Ara-C

20 mg

SC 12/12h

D1 a D10 (20 doses)

Manuteno DVHUUHDOL]DGDHQTXDQWRDJXDUGDR702
Meses 1, 3, 5: POMP:

Repetir o ciclo a cada 4 a 6 semanas, total de 4 ciclos


Se leuccitos > 30 000 realizar citorreduo com hidroxiuria antes de iniciar o protocolo
Critrio de excluso: transaminases e/ou bilirrubinas > 2x o valor da normalidade

Frmaco

Dose

Via

Dias

6mercaptopurina (6MP)

70 mg/m2

VO

D1 a D5

Vincristina (VCR)

1.4mg/m2

EV

D1

0HWRWUH[DWH 07;

30 mg/m2

EV

D1

Frmaco

Dose

Via

Dias

Prednisona (PRD)

60 mg/m2

VO

D1 a D5

+GUR[\XUHLD +8

500 mg-2.5g

VO

Dirio

Etoposide (VP-16)

100mg

VO

Dirio

Meses: 2, 4, 6:$5$&7*
Frmaco

Dose

Via

Dias

Citarabina (Ara-C)

100 mg/m2

SC/ IM 12/12h

D1 a D5

6-tioguanina (6TG)

100 mg/m2

VO 12/12h

D1 a D5

Durante manuteno realizar hemograma mensal, mielograma cada 3 meses.

2 Linha e/ou leucocitose >20.000

3 Linha com leuccitos < 20.000


Frmaco

Dose

Via

Dias

Talidomida

50 a 100mg

VO

Dirio

Associar AAS 100 mg/dia


* Idade entre 55 e 75 anos com ECOG > 2 e/ou comorbidades importantes

| 158 |

| 159 |

IX - Monitorizao e consideraes teraputicas gerais

X. Consideraes sobre transplante de mededula ssea em LMA

2REMHWLYRQDOGDWHUDSLDGHYHULDVHUDHUUDGLFDomRGRFORQHOHXFrPLFRHUHVWDEHOHFLPHQWRGDKHPRSRHVHQRUPDO&RPHVWDQDOLGDGHRWUDWDPHQWRGD/0$VHGLYLGHHPGXDV
grandes etapas :

O transplante de medula ssea alognico aparentado HLA full-match recomendado em

a. Induo da remisso completa.


Objetivo: restaurar a hematopoese normal caracterizada no sangue perifrico por ausncia
GHEODVWRVQtYHLVQRUPDLVGHSODTXHWDVQHXWUyORVHKHPRJORELQD02FRPGHPLHORblastos, sem bastonete de Auer.
b.Tratamento ps- remisso.
Objetivo: erradicar o clone leucmico.
Induo da remisso completa
um procedimento que deve ser feito com o paciente internado, requer servio especializaGRHSURVVLRQDLVFRPH[SHULrQFLDQRWUDWDPHQWRGHSDFLHQWHVOHXFrPLFRV
Nesta etapa do tratamento dever:
Evitar a sndrome de lise tumoral
Tratar processos infecciosos bacterianos , fngicos e eventualmente virais agressivamente
Terapia de suporte com hemocomponentes para manter nvel de hemoglobina com a qual
o paciente se sinta confortvel (> 8g/dl ), manter nmero de plaquetas > 10.000 x mm3 se
paciente estiver afebril, > 20.000 x mm3 se febril/infectado ou hipertenso no controlado,
com exceo da LMA M3 onde o nmero de plaquetas deve ser mantido > 50.000 xmm3
Utilizar hemocomponentes irradiados e leucodepletados. As unidades de plaquetas devem
ser obtidas por afrese.
WHUDSLDDQWLOHXFrPLFDHVSHFLFD
Aps RC, deve-se colher mielograma a cada 3 meses nos 3 primeiros anos aps o tratamento e a cada 6 meses no quarto e quinto anos. Aps, anualmente. Colher mielograma
tambm sempre que suspeita de recidiva (citopenias inexplicadas, blastos em SP, etc.)
CONTRAINDICAES: no h contraindicaes absolutas, sim relativas: cuidado com
DGPLQLVWUDomRGHTXLPLRWHUiSLFRVHPSDFLHQWHVFRPLQVXFLrQFLDUHQDOFDUGtDFDRXKHSiWLFD
Para isso so realizados exames de laboratrio previamente ao inicio da QT.
([DPHVGHODERUDWyULR
Bioqumica completa: Uria,Creatinina, sdio, potssio, bilirrubinas totais e fraces , DHL,
TGO, TGP, Fosfatas alcalina,gama-GT , exame parasitolgico de fezes com Kato-Katz), cido
rico, clcio, fsforo, Magnsio.
Tipagem HLA do paciente e dos seus irmos
Urina tipo I
Sorologia completa: hepatites A, B, C, HIV, HTLV, Chagas, Varicela, CMV, Toxoplasmose.
&LWRJHQHWLFD )LVK 3&5  PRUIRORJLD 0  )/7 3&5 SDUD %&5$%/ DVSLUDGR GH
medula ssea)
Pacientes com morfologia de LMA M2 ou M4 variante eosinoflica colher PCR para AML/
ETO (RUNX1/RUNXT1) ou CBFb/MYH11, respectivamente. (MO)
1RVSDFLHQWHVFRPW  581;581;7W  RXLQY  &%)E0<+VROLcitar pesquisa de mutao do c-Kit (MO)
Rx de Trax F e P
Ultrassom de abdomem
Ecocardiograma ou MUGA
Coagulograma completo

| 160 |

primeira remisso completa para:


pacientes com menos de 55 anos e sem comorbidades importantes (ECOG
0-2), com citogentica de alto risco. Considerar pacientes jovens com citogentica de risco intermedirio (exceto com mutao do NPM-1 e com FLT3-ITD negativo). Considerar
tambm pacientes com mutao do FLT3-ITD, LMA secundria a mielodisplasia, LMA com
displasia multilinhagem ou LMA secundria a teraputica.
pacientes com menos de 55 anos e sem comorbidades importantes que necessitaram de 2 ciclos de induo para atingir remisso completa, independente da citogentica.
Pacientes com menos de 55 anos e sem comorbidades importantes (ECOG 0-2) com
refratariedade primria aos esquemas de induo de 1 linha ou que apresentaram recidiva
precoce ou tardia tambm tem indicao de TMO alognico aparentado. Considerar TMO
no-aparentado ou autlogo na ausncia de doador.
O transplante de medula ssea alognico no-aparentado considerado para pacientes
com menos de 50 anos, sem comorbidades importantes (ECOG 0-1), em primeira remisso
completa em casos de citogentica de alto risco ou necessidade de 2 ciclos de induo para
atingir RC.
O transplante de medula ssea autlogo indicado como alternativa terapia de consolidao em casos de contra-indicao QT (por exemplo toxicidade ou efeitos adversos ao
Ara-C altas doses).
Considerar TMO autlogo em 2 RC na ausncia de doador aparentado.

Xlll. Neoplasias Hematolgicas


5. Leucemia Linfide Aguda
CID C91

,([DPHVGLDJQyVWLFRV
Mielograma,
Imunofenotipagem painel para leucemia aguda de medula ssea ou sangue perifrico,
Citogentica de medula ssea ou sangue perifrico a
Amostra de medula ssea ou de sangue perifrico para exames de biologia molecular

para pesquisa de bcr-abl e outros marcadores de acordo com o subtipo de leucemia

,,(VWUDWLFDomRGHULVFRHIDWRUHVSURJQyVWLFRV
&RPEDVHQRVIDWRUHVGHULVFR WDEHOD RSURWRFROR*0$//FODVVLFDRVSDFLHQWHV
em trs grupos: risco padro (RP), alto risco (AR) e muito alto risco (MAR). Os pacientes
de AR e MAR devem realizar TMO alognico aps a Consolidao I (1 remisso).

| 161 |

Tabela 5. (VWUDWLFDomRGHULVFRHIDWRUHVSURJQyVWLFRV *0$//


(VWUDWLFDomR, )DWRUHVGHULVFR
Linhagem B

Incluso:
Pacientes com diagnstico recente de LLA, virgens de tratamento.
Idade: 15 a 65* anos (*55 a 65 anos quando biologicamente jovens).

Linhagem T

RC>D2 6 (s no D46, aps


Induo II)
Leucocitose>30.000/mm3
LLA pr-B

LLA-T precoce (pr e pr-T)

7  //$$)

LLA-T madura

CTG complexa*

CTG complexa*

7  %&5$%/

Alto risco(AR)

Muito alto risco (MAR)

Nenhum dos acima (LLA


tmica)

Nenhum dos acima

Risco padro (RP)

(VWUDWLFDomR,, '50
Avaliao intermediria: D71 a 16 semana
['50!

Alto risco antecipado (AR)

$YDOLDomR)LQDO DRQDOGRSULPHLURDQRGHWUDWDPHQWR
D71

16 a 52 semana

DRM>10-4

['50!
ou sem queda 2x consecutivas
<10-4

O9&ULWpULRVGHLQFOXVmRHH[FOXVmR

([FOXVmR
Pacientes <15 anos e >65 anos.
Complicaes graves decorrentes da leucemia ou doenas secundrias.
,QVXFLrQFLDUHQDOQmRFDXVDGDSHODOHXFHPLD
,QVXFLrQFLDFDUGtDFDHUHQDOFU{QLFD
Doenas pulmonares crnicas obstrutivas ou restritivas
Infeco por HIV que no permitem o tratamento dos pacientes com quimioterapia
LQWHQVLFDGD
Doena psiquitrica grave que no permita compreenso e cooperao do paciente.
Tratamento prvio com citostticos (h >7 dias)
LLA-B madura (burkitt-like).
Recidiva tardia de LLA da infncia.
Gravidez.
Doenas psiquitricas graves ou outras situaes que no permitem que o paciente compreenda as explicaes ou no garantam sua cooperao durante o tratamento.
Participao em outro estudo clnico, que possa interferir na terapia em questo.
Tratamento da LLA Ph-negativo (15 a 65 anos)
(GMALL 07/2003)

Alto risco (DRM-AR)

No foi possvel ou inconclusiva

Risco intermedirio (DRM-RI)

aps D71 DRM <10-4 e negativa na 52 semana

Baixo risco (DRM-BR)

'HQLomRDEHUUDo}HVHSHORPHQRVXPDDEHUUDomRHVWUXWXUDO VmRH[FOXtGRVKLSHUGLSORGLD !FURPRVVRPRV W  DEHUUDomRTW  W  TW  RXW  

lll.Tratamento
Ateno:
Adaptaes: Realizamos a seguintes adaptaes devido indisponibilidade em nosso
servio no momento de algumas medicaes do protocolo original:
1. Substitumos vindesina 3mg/m2 por vimblastina 6mg/m2
2. Substitumos pegasparaginase (Oncaspar) 1.000UI/m2/dose no D20 da Induo I por
L-asparaginase (Elspar) 7.000UI/m2/dose em 5 doses (D8, D11, D15, D19 e D23) da
Induo I.
3. Substitumos pegasparaginase (Oncaspar) 500UI/m2/dose no D2 e D16 das Consolidaes II, III e VI por L-asparaginase (Elspar) 10.000UI/m2/dose no D2 e D16 das mesmas
Consolidaes (dose semelhante era adotada no GMALL 05/93)
4. Na falta de tenoposide (100mg/m2 em D1 a D5), substituir por etoposide 60mg/m2 em
D1 a D5 da Consolidao IV.
5. Como no dispomos de anfotericina B VO no Brasil e a candidemia tem baixa prevalnFLDHPQRVVRVSDFLHQWHVQmRIDUHPRVXVRGHVVDPHGLDomRSURODWLFDPHQWH
6. Adriamicina 50mg/m2 ou Idarrubicina 10mg/m2.
Assim que as medicaes originais estiverem disponveis, sero prontamente adotadas.

| 162 |

Figura 1. Esquema completo de tratamento para LLA adaptado do Multizentrische Thera-

pieoptimierungsstudie der akuten lymphat. Leukmie bei Erwachsenen und Adoleszenten ab


15 J., GMALL 07/2003.
(VWUDWLFDomRGH5LVFR RP, AR ou MAR.(vide pgina 4)
Mielograma com coleta de imunofenotipagem, PCR (translocaes mais comuns e BRC-ABL P190 e P210) e CTG no D0
OBS1: O resultado do BRC-ABL deve estar pronto em no mximo 7 dias.
OBS2: GCSF sempre que N<500 at N>1000 (por 2 dias).
OBS3:3UROD[LDFRPOHYRR[DFLQD92HDQIRWHULFLQD%92VHPSUHVH10DQWHU
60=703SUROiWLFRGXUDQWHWRGRRWUDWDPHQWR

| 163 |

PARA TODOS OS PACIENTES CONTACTAR RADIOTERAPIA NO INCIO


DA PR-FASE/INDUO I PARA PROGRAMAR RDT SNC
PARA TODOS OS PACIENTES PEDIR HLA DOS IRMOS E PAIS AO
DIAGNSTICO
6HOHXFyFLWRVLQLFLDUSHODSUpIDVHVHOHXFyFLWRVLQLFLDUSHOD
induo I
Se /&5LQOWUDGRUHDOL]DU0$',7[VHPDQDDWpUHVXOWDGRVQHJDWLYRVHP
seguida LCR conforme protocolo
3UpIDVH(1 semana) 07; ,7 'H[D&LFOR7RGRVRVSDFLHQWHVFRP/!
0HWRWUH[DWH

15mg

IT

Pr-QT

D1

'H[DPHWDVRQD

10mg/m2/d

VO

3x/d

D1-D5

Ciclofosfamida SF
0,9%

200mg/m2
250mL

IV

1h

D3-D5

IV

0, 4 e 8h ps-incio CTX em
D3-D5

6)%LF1D 2000mL+80mEq/d

IV

24h

D1-D5 (pH
urina>7,4)

GCSF

5ug/Kg/d

SC

1x/d

'VH/

Metoclopramida

50mg

VO/IV

30 pr-CTX

D3-D5

Alopurinol

300mg

VO

1x/d

D1-D5

Anfotericina B#

500mg/5mL

VO

6/6h

D1-D5

Omeprazol

20mg

VO

Cedo

D1-D5

SMZ-TMP 160/800

1cp

VO

2x/d

A partir do D1

/HYRR[DFLQD

500mg

VO

1x/d

se N<500 >10
dias

Mesna

40mg/m2

Adaptado do Multizentrische Therapieoptimierungsstudie der akuten lymphat. Leukmie bei Erwachsenen und Adoleszenten ab 15 J., GMALL 07/2003.
Engelhardt M., Berger D., Mertelsmann R. Das Blaue 2007-2008: Chemotherapie-manual Hmatologie
und internistische Onkologie.

* No disponvel no Brasil via oral.

Mielograma

D11

PEG-Asparaginase**
SF 0,9%

1.000U/m2(500U/
m2>55a)
100mL

IV

2h

D20

&RQWUROHVpULFR
aspar

D20, D26 e D32

GCSF

5ug/Kg

SC

1x/d

L<500 at L>1000 2d

SF 0,9%

1.000mL

IV

4h

SUp47''' 
D14

SF 0,9%

500mL

IV

2h

15 pr-QT D20

Metoclopramida

50mg

IV

15min

pr e 4h-ps QT D20

Ondansetron

8mg

IV

Bolus

SUp47''' 
D14

Anfotericina B#

500mg/5mL

VO

6/6h

At L>500

Omeprazol

20mg

VO

Cedo

Contnuo

SMZ-TMP 160/800

1cp

VO

2x/d

SUROiWLFR

/HYRR[DFLQD

500mg

VO

1x/d

N<500 por >10d at


N>1000

Adaptado de Multizentrische Therapieoptimierungsstudie der akuten lymphat. Leukmie bei Erwachsenen und Adoleszenten ab 15 J., GMALL 07/2003.
Engelhardt M., Berger D., Mertelsmann R. Das Blaue 2007-2008: Chemotherapie-manual Hmatologie
und internistische Onkologie.
* Iniciar D13 se N>500, atrasar no mximo 1 semana. Se RC ou RP no D11 e N<500, associar GCSF
e atrasar at 1 semana o incio da QT. Se no houver RC/RP ou se progresso a terapia deve continuar.
** Ajuste de dose e cuidados: PEG-ASP: vide anexo 2 e vide equivalncia para o L-aspar se necessrio.
DNR: vide anexo 3.VCR: vide anexo 3.

Controle: Hemograma, eletrlitos, amilase, lipase, bilirrubinas total e fraes, transaminaVHVPRQ{PHURVEULQD'XUDQWH$VSDUDJLQDVH7$3773D)LEULQRJrQLR$7,,,6HFLWRSHQLD


durante Radioterapia, interromper todas as drogas da QT e seguir com RDT.
Se RC aps Induo I: fazer RDT do SNC (A) durante a induo II
Se no h RC aps a induo I, fazer induo II e s aps, a RDT do SNC
Com ou sem RC, se /&5LQOWUDGR realizar RDT durante a induo II
A consolidao I inicia-se pelo menos 4 semanas aps a RDT
7&GHWyUD[QR'H'VH//$7FRPWXPRUPHGLDVWLQDODRGLDJQyVWLFR

Controle: HMG, Eletrlitos, Uria e Creatinina, Clearance de creatinina, cido rico, DHL,
balano hdrico, enzimas heptica. Monitorizao de lise tumoral. Atrasar puno LCR se
blastos elevados em SP.

Se massa mediastinal residual >2cm fazer RDT mediastinal (B) aps a Induo II

Induo I: DVHPDQD 'H[D9&5'15$637RGRVRVSDFLHQWHV


'H[DPHWDVRQD

10mg/m2/d

VO

3x/d

''' '

Daunorrubicina**
SF 0,9%

45mg/m2(30mg/
m2>55a)
100mL

IV

1h

D6-D7
D13*-D14

Vincristina**

2mg (1mg>65a)

IV

Bolus

D6, D13*, D20

| 164 |

A. RDT do SNC.

B. RDT mediastinal.

| 165 |

Induo II: (4 a 7 semanas) MTXIT/ARAC/CICLO/6-MP.Todos os pacientes.

0HWRWUH[DWH
SF 0,9%

1,5g/m2(1g/
m2>55) 500mL

IV

10% 30min
90% 23,5h

D1

D26-D46

Etoposide*
SF 0,9%

250mg/m2
250mL

IV

1h

D4 e D5

1h

D26 e D46

2x2g/m2(2x1g/
m2>55a) 250mL

IV

3h

1h

D28-D31, D35D38, D42-D45

ARA-C
SF 0,9%
cido folnico

IV
IV/VO

conforme protocolo de resgate


(vide anexo 1)

IV bolus

0, 4h e 8h
ps-CTX
iniciar

30mg/m2
15mg/m2

D26 e D46

5ug/Kg

SC

1x/d (manh) at L>1000

GCSF

5ug/Kg

SC

Radioterapia (LLA-T)

24 Gy

mediastino

PDVVDFP
(TC)

D26 e D46

MTX/ARA-C/
'H[D

15mg/40mg/4mg

IT

Radioterapia

24 Gy

SNC

D26 a D46

Hidratao
DQH[R

3.000ml/m2

IV

Bicarbonato
de Sdio

500mg

Furosemida

0HWRWUH[DWH

15mg

IT

6-MP*

60mg/m2

VO

Ciclofosfamida
SF 0,9%

1.000mg/m2
500mL

IV

ARA-C
SF 0,9%

75mg/m2
250mL

IV

Mesna

200mg/m2

GCSF

Plaq>20.000

Mielograma
SF 0,9%

1000mL

'H[DPHWDVRQD

8mg

D28, D35, D42

DRM

D26 e D46

IV

4h

D26 e D46

IV bolus

15ps-CTX
em 15

D26 e D46

Ondansetron

8mg

IV bolus

15 pr-QT

D26, D28-D31,
D35-D38, D42D45

SMZ-TMP 160/800

1cp

VO

2x/d

3UROiWLFR

1x/d

S/N

Alopurinol

Dosagem MTX

D5

24, 36, 42h, 48h e 54h aps MTX iniciar


1x/d

D7-D15/D16 at coleta
D12

24h

D1-D3
pHurina>7,4

VO

2cp 4x/d

D1-D4

40mg

IV

6 e 12h ps
inicio MTX

D1

Ondansetron

8mg

IV

15 pr-QT

D1-D4 e D5

SF 0,9%

1.000mL
2000mL

IV

15pr-QT,
12h - 24h

D4
D5-D7

'H[DPHWDVRQD
colrio

2gts/olho

IO

4/4h

D5-D6

Omeprazol

20mg

VO

1x/d (cedo)

Contnuo

Metoclopramida

50mg

IV

15min

S/N

SF 0,9%

2-3gts/olho

IO

4/4h(alternar
colrios)

D5-D12

Anfotericina B#

500mg/5mL

VO

6/6h

At N>500

/HYRR[DFLQD

500mg

VO

1x/dia

at N>500

SMZ-TMP
160/800

1cp

VO

2x/d

3UROiWLFR

20mg

VO

1x/d (cedo)

Contnuo

Anfotericina B#

500mg/5mL

VO

6/6h

at N>500

/HYRR[DFLQD

500mg

VO

1x/d

at N>500

se inidicado
ATMO

D15/D16

Adaptado de Multizentrische Therapieoptimierungsstudie der akuten lymphat. Leukmie bei Erwachsenen und Adoleszenten ab 15 J., GMALL 07/2003.
Engelhardt M., Berger D., Mertelsmann R. Das Blaue 2007-2008: Chemotherapie-manual Hmatologie
und internistische Onkologie.
* Se em uso de alopurinol reduzir 1/3 da dose.
Se citopenias prologadas atrasar tratamento, evitar reduzir doses.

Controle: Hemograma, eletrlito, enzimas hepticas, glicemia, coagulograma, Uria e Creatinina, Clearance de creatininr, cido rico, monitoramento da asparaginase em D26 e D32.
RDT: dose total 24 cGy (1,8 at 2 Gy, 5 x semana).
Consolidao I: VHPDQD $5$'H[D(7307;91'7RGRVRVSDFLHQWHV
Mielograma

DRM

D1

'H[DPHWDVRQD

10mg/m2/d

VO

3x/d

D1-D5

Vindesina*
0D[ PJ

3mg/m2

IV

bolus

D1

| 166 |

Omeprazol

Coleta de stem
cell

por afrese

Multizentrische Therapieoptimierungsstudie der akuten lymphat. Leukmie bei Erwachsenen und


Adoleszenten ab 15 J., GMALL 07/2003.
Engelhardt M., Berger D., Mertelsmann R. Das Blaue 2007-2008: Chemotherapie-manual Hmatologie
und internistische Onkologie.
Se citopenia pausar tratamento, evitar reduzir doses. Se sintomas cerebelares ou cerebrais interromper.
*Ajuste de dose e cuidados:VMB ou VND: vide anexo 3, vide equivalncia da vimblastina se necessrio.
MTX: vide anexo 1. ETP: vide anexo 3.
# No disponvel no Brasil via oral.

Controle: Hemograma, eletrlitos, enzimas hepticas, coagulao, Uria e Creatinina, Clearance de creatinina, balano hdrico, neurotoxicidade, MTX-srico.

| 167 |

continuao, o protocolo muda, conforme o risco inicial! Em resumo:


Risco padro: consolidao II reinduo II ... manuteno
Alto risco:
Sem doador: coleta de stem cell consolidao II (CLAEG se LLA-T ou FLAG-IDA se
LLA-B) ATMO (se no for possvel TMO seguir em QT pela reinduo II)
Com doador: TMO alognico aparentado ou no-aparentado
As consolidaes III, IV,V,VI so intercaladas (antes/depois) com a manuteno
(6-MP/MTX)
1mRLQLFLDURFLFORGDFRQVROLGDomRDWpTXH1!HSODTXHWDV!
Consolidao II, III,VI:
Pacientes risco padro: semanas 16-18, 30-32 e 46-48
3DFLHQWHVDOWRPXLWRDOWRULVFRTXHQmR]HUDP702H
Manuteno Intensiva: meses 17 e 23
6-MP*

60mg/m2

0HWRWUH[DWH
SF 0,9%

1,5g/m2(1g/
m2>55)
500mL

VO

D1-D7 e D15-D21
10% 30
90% 23,5h

IV

07;VpULFR
PEG
Asparaginase*
SF 0,9%
cido folnico

IV

2h

D2 e D16

30mg/m2
15mg/m2

IV
IV/VO

Conforme protocolo de resgate


(vide anexo 1)

Hidratao
DQH[R

3.000mL/
m2

IV

24h

D15-16(7), D1-D2(3)
controle K+, pHurina>7,4

Furosemida

40mg

IV bolus

6 e 12h ps
incio MTX

D1 e D15

Bicarbonato de
sdio

500mg

VO

2cp 6/6h

D1, D2, D15, D16

'H[DPHWDVRQD

20mg

IV

15 pr-QT

D1 e D15

Ondansetron

8mg

VO

15 pr-QT

D1 e D15

Anfotericina B#

500mg/5mL

VO

6/6h

At N>500

Omeprazol

20mg

VO

Cedo

Contnuo

SMZ-TMP 160/800 1cp

VO

2x/d

At N>500

/HYRR[DFLQD

VO

1x/d

se L<500>10d at L>500

500mg

Mielograma

* Ajuste da dose e cuidados: MTX: vide anexo 1. ASP: vide anexo 2. 6-MP: Se alopurinol reduzir 1/3 da dose.
# No disponvel via oral no Brasil.

Controle: Hemograma, eletrlitos, Uria e Creatinina, Clearance de Creatinina, balano


KtGULFRPRQLWRUL]DomRGDDSDUDJLQDVH73773D$7,,,EULQRJrQLRJOLFHPLDDPLODVHOLSDVH
Bilirrubinas total e fraes, transaminases, PDF, dosagem srica do MTX.
Consolidao II: VHPDQD &/$(*3DFLHQWHV$5FRP//$7TXHIDUmR$702
Mielograma

DRM

D1 (Cons. II e III)

07;$5$&'H[D

15mg/40mg/4mg

IT

Cladribina
SF 0,9%

0,2mg/m2
500mL

IV

2h

D1-D5

Etoposide*
SF 0,9%

60mg/m2
100mL

IV bolus

15

D1-D5

ARA-C*
SF 0,9%

1,5g/m2(1g/m2>55a)
IV
250mL

1,5h

D1-D5
at 6a hora tto

GCSF

5ug/Kg

SC

1x/d

'DWp1!

'H[DPHWDVRQDFROtULR 2gts/olho

IO

3/3h

D1-D7

SF 0,9%

IO

3/3h

D1-D14

'H[DPHWDVRQDFROtULR 2gts/olho

IO

3/3h

D1-D7

SF 0,9%

IO

3/3h

D1-D14

'H[DPHWDVRQDFROtULR 2gts/olho

IO

3/3h

D1-D7

Anfotericina B#

500mg/5mL

VO

6/6h

At N>500

Omeprazol

20mg

VO

Cedo Contnuo

SMZ-TMP 160/800

1cp

VO

2x/d

3UROiWLFR

/HYRR[DFLQD

500mg

VO

1x/d

se N<500 >10d at
N>500

2-3gts/olho
2-3gts/olho

D1

Adaptado de Multizentrische Therapieoptimierungsstudie der akuten lymphat. Leukmie bei Erwachsenen und Adoleszenten ab 15 J., GMALL 07/2003.
Engelhardt M., Berger D., Mertelsmann R. Das Blaue 2007-2008: Chemotherapie-manual Hmatologie
und internistische Onkologie.
*Ajuste da dose e cuidados: ETP: vide anexo 3. ARA-C: vide anexo 3.
# No disponvel via oral no Brasil.

Controle: Hemograma, eletrlitos, enzimas hepticas, glicemia, Uria, Creatinina, Clearance


de cretinina, balano hdrico.
OBS: Encaminhar paciente para ATMO

| 168 |

D1

D1 e D15

24, 36, 42h, 48h e 54h aps MTX iniciar


500U/m2
100mL

Adaptado de Multizentrische Therapieoptimierungsstudie der akuten lymphat. Leukmie bei Erwachsenen und Adoleszenten ab 15 J., GMALL 07/2003.
Engelhardt M., Berger D., Mertelsmann R. Das Blaue 2007-2008: Chemotherapie-manual Hmatologie
und internistische Onkologie.

| 169 |

Consolidao II: VHPDQD )/$*,'$//$%$5RX0$5TXHIDUmR$702


Mielograma

DRM

D1

Metoclopramida

50mg

IV

SUp47KHKSyV47
em 15

Anfotericina B#

500mg/5mL

VO

6/6h

At N>500

MTX/ARAC/
'H[D

15mg/40mg/4mg

Omeprazol

20mg

VO

Cedo

Contnuo

Idarrubicina

10mg/m2(7mg/m2>55) IV

15min

15pr-ARAC em D1 e D3

SMZ-TMP 160/800

1cp

VO

2x/d

3UROiWLFR

Fludarabina
SF 0,9%

30mg/m2
250mL

IV

1h

D1-D5

/HYRR[DFLQD

500mg

VO

1x/d

se N<500 >10d at
N>500

ARA-C*
SF 0,9%

2g/m2(1g/m2>55)
250mL

IV

2h

KSyVWpUPLQRGDXGDUD
em D1-D5

GCSF

5ug/Kg

SC

1x/d

At N>1000

Adaptado do Multizentrische Therapieoptimierungsstudie der akuten lymphat. Leukmie bei Erwachsenen und Adoleszenten ab 15 J., GMALL 07/2003.Engelhardt M., Berger D., Mertelsmann R. Das Blaue
2007-2008: Chemotherapie-manual Hmatologie und internistische Onkologie.

SF 0,9%

2.000mL

IV

24h

D1-D5

'H[DPHWDVRQD
SF

20mg/100mL

IV

15min

15 pr-QT em D1-D5

'H[DPHWDVRQD
colrio

2gts/olho

IO

3/3h

D1-D7

SF 0,9%

2-3gts/olho

IO

3/3h

D1-D14

Ondansetron

8mg

IV

15

bolus pr-QT em D1-D5

Anfotericina B

500mg/5mL

VO

6/6h

At N>500

Omeprazol

20mg

VO

Cedo

Contnuo

SMZTMP160/800

1cp

VO

2x/d

3UROiWLFR

/HYRR[DFLQD

500mg

VO

1x/d

N<500 >10d at N>500

IT

D1

Se citopenia prolongada atrasar tratamento (evitar reduzir doses).


* Ajuste de dose e cuidados: ADRIA: vide anexo 3.VMB: vide anexo 3.
**A partir do D15 reduzir dose da predsnisolona: dose/dia/3dias dose/d/3dias 1/8 dose/d/3 dias
# No disponvel no Brasil via oral.

Controle: Hemograma, eletrlitos, enzimas hepticas, glicemia, Uria, Creatinina, Clearance


de creatinina, funo cardaca, neurotoxicidade.
Reinduo II: ARAC/CICLO/THIOG
Pacientes risco padro: semanas 24 e 25
3DFLHQWHVDOWRULVFRPXLWRDOWRULVFRTXHQmR]HUDP702VHPDQDVH
MTX/ARAC/
'H[D

15mg/40mg/4mg

IT

D15

Ciclofosfamida* 1.000mg/m2
SF 0,9%
500mL

IV

1h

D15

6-Thioguanina*

60mg/m2/d

VO

(muito lquido)

D15-D28

ARA-C
SF 0,9%

75mg/m2
250mL

IV

1h

D17-D20, D24D27

Mesna

200mg/m2

IVbolus

0, 4h e 8h ps-CTX D15

SF 0,9%

1000mL

IV

15pr-QT em 4h

D15

Controle: Hemograma, eletrlitos, DHL, enzimas hepticas, glicemia, Ur, Cr, cido rico,
gasometria, funo cardaca, neurotoxicidade, ECG para idarrubicina.

'H[DPHWDVRQD

8mg

IV

15 bolus, 15 psCTX

D15, D17-D20,
D24-D27

OBS: Encaminhar paciente para ATMO!

'H[DPHWDVRQD

8mg

VO

2x/d

D16

Reinduo I:VND/ADR
Pacientes risco padro: semanas 22 e 23
3DFLHQWHVDOWRULVFRPXLWRDOWRULVFRTXHQmR]HUDP702VHPDQDVH

Ondansetron

8mg

IV

bolus 15 pr-QT

D15

SMZ-TMP
160/800

1cp

VO

2x/d

3UROiWLFR

D1

Omeprazol

20mg

VO

1x/d (cedo)

Contnuo

D1

Metoclopramida

50mg

IV bolus

15 pr-QT e 8h
ps-QT, em 15

D17-D20
D24-D27

Metoclopramida

30mg

VO

6/6h

D16

Anfotericina B# 500mg/5mL

VO

6/6h

At N>500

/HYRR[DFLQD

VO

1x/d

At N>500

Adaptado de Multizentrische Therapieoptimierungsstudie der akuten lymphat. Leukmie


bei Erwachsenen und Adoleszenten ab 15 J., GMALL 07/2003
Engelhardt M., Berger D., Mertelsmann R. Das Blaue 2007-2008: Chemotherapie-manual
Hmatologie und internistische Onkologie.
* Ajuste de dose e cuidados: ARA-C:vide anexo 3.

Mielograma

DRM

07;$5$&'H[D

15mg/40mg/4mg

IT

Prednisolona**

3x 20mg/m2

VO

D1-D14 desmame

9LQGHVLQD  0D[ PJ 3mg/m2

IV

bolus

Adriamicina*

50g/m2

IV

15 bolus D1 e D7

Pamidronato

60mg

IV

3h

D1

SF 0,9%

1.000mL

IV

4h

15pr-QT D1 e D7

| 170 |

D1 e D7

500mg

| 171 |

Adaptado de Multizentrische Therapieoptimierungsstudie der akuten lymphat. Leukmie bei Erwachsenen und Adoleszenten ab 15 J., GMALL 07/2003.
Engelhardt M., Berger D., Mertelsmann R. Das Blaue 2007-2008: Chemotherapie-manual Hmatologie
und internistische Onkologie.

Mielograma

DRM

07;$5$&'H[D

15mg/40mg/4mg

IT

ARA-C*
SF 0,9%

500mg/m2
250mL

IV

Controle: Hemograma, eletrlitos, enzimas hepticas, glicemia, Ur e Cr, ClCr, cido rico.

Ciclofosfamida*
SF 0,9%

1.000mg/
m2(650mg/
m2>55a
500mL

2%6(QWUHRPGDUHLQGXomR,,HRLQtFLRGDFRQVROLGDomR,,,ID]HUPDQXWHQo 6-MP/MTX

Mesna
SF 0,9%

Se citopenia prolongada pausar tratamento (evitar reduzir dose).


* Ajuste de dose e cuidados: CTX: vide anexo 3. 6-TG: vide anexo 3.
# No disponvel no Brasil via oral.

Consolidao IV:TENOPOSIDE/ARAC
Pacientes risco padro: semana 36
3DFLHQWHVDOWRULVFRPXLWRDOWRULVFRTXHQmR]HUDP702VHPDQDV
Manuteno intensiva: meses 15 e 21

D1
D15

24h

D1

IV

1h

D1

200mg/m2

IV bolus

SUpKHKSyV
CTX

D1

2.000mL

IV

24h

D1

'H[DPHWDVRQD

8mg/100mL SF

IV bolus

SUpHKSyV
D1
ARAC

Ondansetron

8mg

IV bolus

15 pr-QT

D1

D1

SMZ-TMP 160/800

1cp

VO

2x/d

3UROiWLFR

1h

D1-D5

Anfotericina B#

500mg/5mL

VO

6/6h

At N>500

/HYRR[DFLQD

500mg

VO

1x/d

At N>500

IV

1h

D1-D5

250mL

IV

15 pr-QT em 2,5h

D1-D5

8mg

IV bolus

15-pr QT

D1-D5

8mg

IV bolus

15 pr-QT

D1-D5

SMZ-TMP 160/800 1cp

VO

2x/d

3UROiWLFR

Metoclopramida

50mg

IV bolus

15

cido flico

5mg

VO

Anfotericina B#

500mg/5mL

VO

6/6h

At N>500

/HYRR[DFLQD

500mg

VO

1x/d

at N>500

07;$5$&'H[D

15mg/40mg/4mg

IT

ARA-C*
SF 0,9%

150mg/m2
250mL

IV

Teniposide*
SF 0,9%

100mg/m2
10mL

SF 0,9%
'H[DPHWDVRQD
Ondansetron

Adapatado de Multizentrische Therapieoptimierungsstudie der akuten lymphat. Leukmie bei Erwachsenen und Adoleszenten ab 15 J., GMALL 07/2003.
Engelhardt M., Berger D., Mertelsmann R. Das Blaue 2007-2008: Chemotherapie-manual Hmatologie
und internistische Onkologie.
* Ajuste da dose e cuidados: ARA-C:vide anexo 3. CTX: vide anexo 3.

Controle: Hemograma, eletrlitos, enzimas hepticas, glicemia, Ur eCr, ClCr, neurotoxicidade.


,QLFLDUPDQXWHQomRGH+E!1!HSODTXHWDV!

A partir D1

Adaptado de Multizentrische Therapieoptimierungsstudie der akuten lymphat. Leukmie bei Erwachsenen und Adoleszenten ab 15 J., GMALL 07/2003.
Engelhardt M., Berger D., Mertelsmann R. Das Blaue 2007-2008: Chemotherapie-manual Hmatologie
und internistische Onkologie.
* Ajuste de dose e cuidados: ARA-C:anexo 3. TNP ou ETP: anexo 3.Vide equivalncia ao etoposide se
necessrio.
# No disponvel no Brasil via oral.

A manuteno inicia-se aps a reinduo e se intercala com as etapas


de consolidao
Manuteno: MTX/6-MP
Pacientes risco padro: semanas 26-29, 33-35, 37-40, 42-45
3DFLHQWHVDOWRULVFRPXLWRDOWRULVFRTXHQmR]HUDP702VHPDQDV
0HWRWUH[DWH 

20mg/m2

IV

bolus

D1, D8, D15(22)

6-MP*

60mg/m2

VO

Manh

D1-D21(-D28)

1h

D1, D8, D15(22)

SF 0,9%

500mL

IV

Controle: Hemograma, eletrlitos, enzimas hepticas, glicemia, Ur eCr, ClCr e diurese.

'H[DPHWDVRQD

4mg

IV bolus 15-pr QT em 15 D1, D8, D15(22)

2%6(QWUHRPGDFRQVROLGDomR,9HRLQtFLRGD9ID]HUPDQXWHQomR0307;

SMZ-TMP 160/800 1cp

VO

2x/d

3UROiWLFR

Anfotericina B#

500mg/5mL

VO

6/6h

At N>500

/HYRR[DFLQD

500mg

VO

1x/d

At N>500

Consolidao V: CICLO/ARA-C
Pacientes risco padro: semana 41
3DFLHQWHVDOWRULVFRPXLWRDOWRULVFRTXHQmR]HUDP702VHPDQDV
Manuteno intensiva: meses 13, 17

| 172 |

Adaptado de Multizentrische Therapieoptimierungsstudie der akuten lymphat. Leukmie bei Erwachsenen und Adoleszenten ab 15 J., GMALL 07/2003.
Engelhardt M., Berger D., Mertelsmann R. Das Blaue 2007-2008: Chemotherapie-manual Hmatologie
und internistische Onkologie.

| 173 |

* Reduzir 1/3 da dose se alopurinol concomitantemente.


* e ** Se citopenia: L 2000-3000 ou plaq 100.000-150.000 reduzir ambos 66%. Se L 2000-1500 ou plaq
50.000-100.000 reduzir ambos 50%. Se <1500 ou plaq<50.000: pausar tratamento.
# No disponvel no Brasil via oral.

Controle: Hemograma, eletrlitos, enzimas hepticas, glicemia, Ur e Cr, ClCr, cido rico.
Fazer MADIT em D1 da 52 semana
0LHORJUDPDHDYDOLDomRGH'50SDUDHVWUDWLFDomRGHULVFRQDVHPDQD
(VWUDWLFDomRGHULVFR,, (conforme Doena Residual Mnima)
DRM alto risco: transplante/protocolo experimental
DRM risco intermedirio: manuteno intensa: (doses semelhantes s da consolidao/
manuteno)
Intercalar 6-MP/MTX com:
1 Ciclo/ARA-C/MADIT (semana 58)
Mielograma DRM
2 VM/ARA-C/ MADIT (semana 66)
3 HD-MTX/ASP (semana 74)
Mielograma DRM
4 Ciclo/ARA-C/MADIT (semana 82)
5 VM/ARA-C/MADIT (semana 90)
Mielograma DRM
6 HD-MTX/ASP (semana 96)
Semana 104: mielograma DRM
'50ULVFRSDGUmRPGRWUDWDPHQWR

Induo: Ciclos 1, 3, 5, 7:
Ciclofosfamida

300mg/m2

EV em 3h de 12/12h

D1, D2, D3 (6 doses)

Vincristina

2mg

EV

D4 e D11

Adriamicina

50mg/m2

EV (em 24h)

D4

'H[DPHWDVRQD

40 mg

VO / EV

'D''D'

Mesna*

600mg/m2/dia

IV contnuo 24h

D1 a D3 (comear com CTX


e terminar 6h aps ltima
dose)

MTX

12mg

IT

D2

Ara-C

100mg

IT

D7

Ciclos 2, 4, 6, 8:
0HWRWUH[DWH

1000mg/m2

EV 10% em 30min
e 90% em 23,5h

D1

Ara-C

3000mg/m2

EV em 2 h de
12/12h

D2 e D3 (4 doses)

cido folnico (Lv)

25mg/m2

EV

D2 (iniciar rigorosamente
24h ps-incio do MTX)

cido folnico (Lv)

25mg/m2

IV/VO 6/6h

D2, D3, D4 (6h aps Lv IV)


(8 doses)

Bicarbonato de
sdio

500mg

VO de 6/6h

D-1 a D3 (intercalar com Lv)

'H[DPHWDVRQD
colrio

2gts/olho

IO

3/3h

D1-D7

SF 0,9%

2-3gts/olho

IO

3/3h

D1-D14

MTX

12mg

IT

D2

Ara-C

100mg

IT

D7

Hidratao (vide
DQH[R

Monitorizao YLGHDQH[RV
FE% para antracclicos
Funo renal para MTX
Alcalinizar a urina para MTX
BT para vincristina e antracclicos

Tratamento de LLA - Protocolo Hiper C-VAD (2 opo)


(8 ciclos alternados)

(VWUDWLFDomRGHULVFR
(VWUDWLFDomRGH5LVFR/&5

Fatores

Alto Risco

DHL>600
QGLFHGHSUROLIHUDomR 6*0 

Risco desconhecido

Desconhecido

Baixo risco

Sem os fatores acima

6H/&5LQOWUDGRUHDOL]DU47,7[VHPDQDDWpSHORPHQRVUHVXOWDGRVQHJDtivos consecutivos

E.H. Estey S.H. Faderl H.M. Kantarjian. ALL Therapy: Review of the MD Anderson Program. Hematologic Malignancies: Acute Leukemias. Springer Berlin Heidelberg 2008.
Kartarjan H.M. et al. Results of treatment with hyper-CVAD, a dose-intensive regimen, in adult acute
O\PSKRF\WLFOHXNHPLD-&OLQ2QFRO)HE  

Radioterapia mediastinal ps 8 bloco com 24 cGy se massa mediastinal e LLA-T


1. Usar GCSF durante induo e consolidao: comear no D5 e D4, respectivamente.
2. 3ROD[LDOHYRR[DFLQDPJGXFRQD]ROPJGHDFLFORYLUPJ[G
3. LCR:
Hyper-CVAD (original) (2000)
Grupo de Risco
%DL[RULVFR

| 174 |

+\SHU&9$' PRGLFDGR 

Total de QT IT

Grupo de Risco

Total de QT IT

4 IT (blocos 12)

%DL[RULVFRH
Risco Padro

6 IT

| 175 |

Risco Padro e
desconhecido

8 IT (blocos 14)

Alto risco

16 IT (courses 18)

Alto risco
LLA B Madura

TRATAMENTO DA LLA NO IDOSO (>65 anos)

8IT

(ALL GMALL Elderly 01/2003)

16 IT

Multicenter Study To Optimize Treatment in Elderly Patients (> 55 Years, No Upper Age Limit) With
Acute Lymphoblastic Leukemia (GMALL Elderly 1/2003) (Amend 2)

Se envolvimento de nervos cranianos: RDT 24 cGy (dividida em 10-12 cursos)


Consolidao: HD-MTX/ARAC
0HWRWUH[DWH

200mg/m2
800mg/m2

IV

2h
24h

D1

Acido folnico
DMXVWDUSRUDQH[R

15mg

IV

6/6h (24h aps incio


do MTX)

Total=8
doses

'RVDU0HWRWUH[DWHPLD
+LGUDWDomR YLGHDQH[R
ARA-C

3g/m2

IV

2h de 12/12h

D2-D3 (4
doses)

'H[DPHWDVRQDFROtULR

2gts/olho

IO

3/3h

D1-D7

SF 0,9%

2-3gts/olho

IO

3/3h

D1-D14

Metilprednisolona

50mg

IV

2x/d

D1-D3

Encaminhar para TMO!


Se no houver a possibilidade de TMO:
Manuteno: POMP (por 2 anos)
6-MP

50mg

VO

3x/d

MTX

20mg/m2

VO

Semanalmente

Prednisona

200mg

VO

1x/ms

D1-D5

Vincristina

2mg

IV

1x/ms

com prednisone

CRITRIOS DE INCLUSO (emenda 2)


Diagnstico de LLA B precursora (pr-B, pr-B ou B-comum) ou LLA-T pela morfologia
e imunofenotipagem
Idade >55 anos (sem limite superior de idade)
Consentimento informado por escrito
CRITRIOS DE EXCLUSO (amend 2)
Complicaes graves associadas leucemia no controladas antes do tratamento:
Infeces que ameaam a vida: sepse, pneumonia, hipxia, choque
Hemorragia que ameace a vida
Doena grave secundria
,QVXFLrQFLDUHQDOGHVFRPSHQVDGD QmRFDXVDGDSHODOHXFHPLD FRP&U![/61
,QVXFLrQFLDFDUGtDFD 1<+$,,,,9 DQJLQDLQVWiYHOHVWHQRVHFRURQDULDQDJUDYHLQVXcincia heptica ex. cirrose ou hepatite crnica ativa, com B>1,5mg/dl e/ou TGO, TPG ou
TP>2,5 LSN
Desordem metablica descompensada (ex. diabetes no tratvel)
Doena obstrutiva ou restritiva pulmonar grave com hipoxemia
Doena psiquitrica ou neurolgica, prejudicando a aderncia do paciente
Neoplasias secundrias ativas
Infeco pelo HIV
Condio geral muito reduzida
Tratamento citosttico da LLA pr-tratada participao em outros estudos clnicos,
interferindo com a terapia do estudo
GMALL ELDARLY 01/2003

3UROD[LD60=703[GQVGHVHPDQDHDFLFORYLUPJG RX[VHPDQD 
1RK\SHU&9$'PRGLFDGRSRGHVHHVWHQGHUDPDQXWHQomRSRUDQRVFRPFXUVRVDGLFLRQDLV
de MTX/L-ASPAR nos meses 6 e 8 da manuteno. (E. H. Estey S. H. Faderl H. M. Kantarjian. ALL
Therapy: Review of the MD Anderson Program. Hematologic Malignancies: Acute Leukemias. Springer
Berlin Heidelberg 2008).

Xlll. Neoplasias Hematolgicas


/HXFHPLD/LQIyLGH$JXGD&'
Considera-se o paciente como LLA CD20+ quando:
&'TXDQGR&'SUHVHQWHHP!GRVEODVWRV

| 176 |

| 177 |

Mielograma com coleta de imunofenotipagem, PCR (BRC-ABL P190 e P210)


e CTG no D0
OBS:0DQWHU60=703HSUROD[LDVGDPHVPDIRUPDTXHQRSDFLHQWHMRYHP
PR-FASE: (D1 a D5) DEXA/C
'H[DPHWDVRQD

10mg/m2/d

VO

3x/d

D1-D5

Ciclofosfamida
SF 0,9%

200mg/m2
250mL

IV

1h

D3-D5

Mesna

40mg/m2

IV bolus

0, 4 e 8h ps-CTX iniciar D3-D5

6)%LF1D
2000mL+80mEq/d
8,4%

IV

24h

Metoclopramida

50mg

VO/IV

30 pr-CTX

0HWRWUH[DWH

12mg

IT

D1-D5 (pH urina>7,4)


D1

Schmoll H.J. et al. Kompendium Internistische Onkologie Standards in Diagnostik und Therapie.
6SULQJHU$XHGLWLRQ

'HWHUPLQDUVWDWXVGR%&5$%/HGR&'HPQRPi[LPRGLDV
6H%&5$%/ *,0(0$ SURWRFROR/$/%

6)%LF1D
8,4%

1000mL

IV

4h

D21 e D35

'H[DPHWDVRQD

8mg

IV

pr-CTX

D21 e D35

Ondansetron

8mg

IV

Pr-ARA-C

D22-D25 e D29-D32

Paracetamol

750mg

VO

30 pr-RTX

D20

Benadryl

50mg

IV

30 pr-RTX

D20

07;$5$&'H[D

12mg/40mg/4mg IT

IV

Bolus

D7 e D14

Idarrubicina*

10mg

IV

30min

D7-D8 e D14-D17

GCSF

5ug/Kg/d

SC

1x/d

a partir do D1(N>500)

Paracetamol

750mg

VO

30 pr-RTX

D6

Benadryl

50mg

IV

30 pr-RTX

D6

SF 0,9%

1000mL

IV

4h

D7-D8 e D14-D17

MTX/ARAC/
'H[D

12mg/
40mg/4mg

IT

D13

* Ajuste de dose e cuidados: RTX: vide anexo 4.VCR: vide anexo 3. IDR: vide anexo 3.
Schmoll H.J. et al. Kompendium Internistische Onkologie Standards in Diagnostik und Therapie.
6SULQJHU$XHGLWLRQ

CONSOLIDAO I, III e V: (semana 10a, 32a e 48a) IDMTX


0HWRWUH[DWH
SF 0,9%

500mg/m2
500mL

IV

6-MP*

25mg/m2

VO

Ciclofosfamida*
SF 0,9%

500mg/m2
500mL

ARA-C*
SF 0,9%

60mg/m2
250mL

Mesna

40mg/m2

DRM

D20

1h

D21 e D35

IV

1h

D22-D25 e D29-D32

IV

bolus 0, 4 e 8h ps-CTX iniciar D21


e D35

IV

24h (contnuo)

D2 e D16
D2-D8 e D16-D22

07;VpULFR

24, 36, 42h, 48h e 54h aps MTX iniciar


30mg/m2
15mg/m2

IV
IV/VO

Conforme protocolo de resgate


(vide anexo 1)

Hidratao
DQH[R

3.000mL/m2

IV

24h

D2-D4 e D16-D18
controle K+, pHurina>7,4

Furosemida

40mg

IV bolus

6 e 12h ps incio
MTX

D2 e D16

Bicarbonato
de sdio

500mg

VO

2cp 6/6h

D2, D3, D16, D17

'H[DPHWDVRQD

20mg

IV

15 pr-QT

D2 e D16

Ondansetron

8mg

IV

Pr-QT

D2 e D16

Paracetamol

750mg

VO

30 pr-RTX

D1

Benadryl

50mg

IV

30 pr-RTX

D1

DRM

Semanas 10, 32 e 52

Mielograma

* Reduzir para 1/3 da dose se uso concomitante de alopurinol.


** Ajuste da dose e cuidados: RTX: vide anexo 4. MTX: vide anexo 1.

INDUO II: (D20 a D35) CTX/ARAC


Mielograma

D36

Schmoll H.J. et al. Kompendium Internistische Onkologie Standards in Diagnostik und Therapie.
6SULQJHU$XHGLWLRQ

cido folnico

1mg

DRM

* Ajuste de dose e cuidados: RTX: vide anexo 4. CTX: vide anexo 3. ARA-C: vide anexo 3.

INDUO I: (D6 a D17) VNC/IDAR


Vincristina*

D21, D28 e D35

Mielograma

Schmoll H.J. et al. Kompendium Internistische Onkologie Standards in Diagnostik und Therapie.
6SULQJHU$XHGLWLRQ

CONSOLIDAO II e IV: (semana 17 e 41) - VM26/ARAC

| 178 |

ARA-C*
SF 0,9%

75mg/m2
250mL

IV

1h

D2-D6

VM26*

60mg/m2

IV

1h

D2-D6

| 179 |

MANUTENO: MTX/6MP

GCSF

5ug/Kg

SC

1x/d

a partir do D7

Ondansetron

8mg

IV

Pr-ARA-C

D2-D6

Paracetamol

750mg

VO

30 pr-RTX

D1

Benadryl

50mg

IV

30 pr-RTX

D1

MTX

20mg/m2

IV ou VO

07;$5$&'H[D

12mg/40mg/4mg

IT

D2

6-MP

60mg/m2

VO

07;$5$&'H[D

12mg/40mg/4mg

IT

Mielograma

DRM

Semana 17 e 41

* Ajuste de dose e cuidados: RTX: vide anexo 4. ARA-C: vide anexo 3.VM26: vide anexo 3,
vide equivalncia para etoposide se necessrio.
Schmoll H.J. et al. Kompendium Internistische Onkologie Standards in Diagnostik und Therapie.
6SULQJHU$XHGLWLRQ

1 ano: aps induo II, entre as consolidaes.


2 ano: contnuo

Mielograma

10mg/m2/d

VO

3x/d

D2-D9

Vincristina*

1mg

IV

Bolus

D2

Idarrubicina*

10mg

IV

30min

D2, D5 e D9

Ciclofosfamida*
SF 0,9%

500mg/m2
500mL

IV

1h

D11

ARA-C*
SF 0,9%

60mg/m2
250mL

IV

1h

D13-D16

Mesna

40mg/m2

IV bolus

0, 4 e 8h ps-CTX iniciar D21


e D35

GCSF

5ug/Kg

SC

1x/d

a partir do D2

6)%LF1D

1000mL

IV

4h

D21 e D35

'H[DPHWDVRQD

8mg

IV

Pr-CTX

D11
D11, D13-D16

Ondansetron

8mg

IV

Pr-ARAC e
CTX

Paracetamol

750mg

VO

30 pr-RTX

D1

Benadryl

50mg

IV

30 pr-RTX

D1

07;$5$&'H[D

12mg/40mg/
4mg

IT

Mielograma

D2
DRM

Semana 24

* Ajuste de dose e cuidados: RTX: vide anexo 4.VNC: vide anexo 3. IDAR: vide anexo 3.
ARA-C: vide anexo 3.
Schmoll H.J. et al. Kompendium Internistische Onkologie Standards in Diagnostik und Therapie.
6SULQJHU$XHGLWLRQ

07;$5$&'H[D

12mg/40mg/
4mg

IT

Semana 52

Schmoll H.J. et al. Kompendium Internistische Onkologie Standards in Diagnostik und Therapie. SprinJHU$XHGLWLRQ

| 180 |

Diariamente
Se frail

meses 14, 17,


20 e 23

DRM

meses 14, 17,


20 e 23

Schmoll H.J. et al. Kompendium Internistische Onkologie Standards in Diagnostik und Therapie.
6SULQJHU$XHGLWLRQ

REINDUO: (semana 24) RTX/DEXA/IDAR/CTX/ARAC


'H[DPHWDVRQD

1x/semana

| 181 |

XlV. 1iXVHDVHY{PLWRVUHODFLRQDGRV


DTXLPLRWHUDSLDSUROD[LD
e tratamento

,&DWHJRULDVGHULVFRHPpWLFR
$OWRSRWHQFLDOHPpWLFR risco de mese >90%
Moderado: risco >30% a 90%
%DL[R 10-30%
Mnimo:10%

,,,5LVFRHPpWLFRGHDJHQWHV92
5LVFRHPpWLFR
Alto

Risco
HPpWLFR

Agente

Alto

Cisplatina
Mecloretamina
Estreptozotocina
&LFORIRVIDPLGDPJP
Carmustina
Dacarbazina
Dactinomicina

Moderado

Risco
HPpWLFR

Baixo

Oxaliplatina
Citarabina>1g/m2
Carboplatina
ifosfamida
Ciclofosfamida<1500mg/m2
Doxorrubicina
Daunorrubicina
Epirrubicina
Idarrubicina
Irinotecano

Moderado

Baixo

Capecitabina
Tegafur uracil

Mnimo

Clorambucil
Hidroxiuria
Metotrexato
*HWLQLE
Erlotinib

Agente
Paclitaxel
Docetaxel
Mitoxantrona
Topotecano
Etoposdeo
Pemetrexed
Metotrexato
Mitomicina
Gencitabina
&LWDUDELQDPJP
Fluouracil
Bortezomib
Cetuximab
Trastuzumab
Bevacizumab
Vincristina

Mnimo

Annals of Oncology 17: 2028, 2006

,95HFRPHQGDo}HVSDUDFDWHJRULDVGHULVFRHVSHFtFDV
Alto risco: QT baseada em cisplatina
Antagonista do receptor da serotonina 5-HT3 e dexametasona para mese aguda
'H[DPHWDVRQD 4mg VO 12/12hs associado a metoclopramida 0,5mg/kg VO 6/6hs D2-4
Alto risco: QT no baseada em platina
Antagonista do receptor da serotonina 5-HT3 e dexametasona
Para mese tardia: dexametasona agente nico 4 mg 12/12hs D2-4
Risco moderado: UHJLPH$& GR[RUUXELFLQDFLFORIRVIDPLGD
Antagonista do receptor da serotonina 5-HT3 e dexametasona para mese aguda
'H[DPHWDVRQD 4mg VO 12/12hs associado a metoclopramida 0,5mg/kg VO 6/6hs
D2-4 para mese tardia

Bleomicina
Vinorelbine

Risco moderado: outros regimes


Antagonista do receptor da serotonina 5-HT3 e dexametasona
Para mese tardia: dexametasona agente nico 4 mg 12/12hs D2-4

Fludarabina
Vinblastina

%DL[RULVFR
'H[DPHWDVRQD 8 mg IV ou metoclopramida 10mg IV

Rituximab

Risco mnimo:
QmRGHYHVHUDGPLQLVWUDGRSUROD[LDDQWLHPpWLFDGHURWLQDHPSDFLHQWHVVHPKLVWyULD
de nuseas e vmitos

J Clin Oncol 24:2932-2947. 2006

| 182 |

Hexametilmelamina
procarbazina
Ciclofosfamida
Etoposdeo
Imatininb
Temozolamida

Annals of Oncology 17:20-28, 2006

,,5LVFRHPpWLFRGHDJHQWHV,9

Agente

| 183 |

V. Doses de antagonistas do receptor do 5-HT3


Agente

Via

Dose

Ondasetron

IV
VO

8mg
16mg

Granisetron

IV
VO

1mg
2mg

Dolasetron

IV
VO

100mg
100mg

Tropisetron

IV
VO

5mg
5mg

Palonosetron

IV

0,25mg

XV. Complicaes relacionadas


ao cncer e/ou ao tratamento
1. Sndrome da Veia Cava Superior
,'HQLomR

&RQMXQWRGHVLQDLVHVLQWRPDVGHFRUUHQWHVGDREVWUXomRGRX[RGHVDQJXHDWUDYpVGDYHLD
cava superior em funo de invaso direta, compresso extrnseca ou trombose intraluminal.

II. Etiologia

Annals of Oncology 17: 2028, 2006

Em doses equivalentes para preveno de mese aguda, os antagonistas do 5-HT3 de priPHLUDJHUDomRDSUHVHQWDPVHJXUDQoDHHFiFLDVLPLODUHV

Cncer de pulmo e LNH, que em conjunto so

responsveis por 95% dos casos


Neoplasias malignas (60-85%)

Causas menos freqentes: timoma, tumor de

Em doses equivalentes , formulaes VO so to efetivas e seguras quanto EV

clulas germinativas (primrio de mediastino ou


metasttico) e tumores metastticos, como cncer
de mama.

9,'RVHGHGH[DPHWDVRQD

Mediastinite fribosante
Trombose (relacionada presena de

Risco alto

mese aguda
mese tardia

20mg dose nica


4mg 2x/d 3-4d

Causas no-neoplsicas (15-40%) dispositivos endovasculares para procedimentos


como quimioterapia, hemodilise, nutrio
parenteral ou marcapasso)

moderado

mese aguda
mese tardia

8 mg dose nica
8mg/d 2-3 dias

III. Diagnstico

Baixo

mese aguda

4-8mg dose nica


Annals of Oncology 17: 2028, 2006

VII. Situaes especiais


&RPELQDo}HVGHTXLPLRWHUDSLD
Administrar anti-emtico apropriado para o agente quimioterpico de maior potencial
emetognico
Mltiplos dias consecutivos de QT
Anti-emtico apropriado para a classe de risco do agente deve ser administrado diariamente. Manter por mais 2 dias se apropriado
mese antecipatria
Terapia comportamental
Uso de benzodiazepnicos pode ser til

A intensidade das manifestaes clnicas varia em funo do grau de obstruo, da velocidade de sua instalao e do nvel (acima ou abaixo da emergncia da veia zigos, principal
colateral).
Dispnia o sintoma mais comum. O paciente pode queixar-se tambm de tosse, cefalia,
edema facial, cervical e de membros superiores, dor torcica, disfagia e rouquido. Os achados ao exame fsico incluem: distenso das veias do pescoo e da parede torcica, pletora
IDFLDOHQRVFDVRVPDLVJUDYHVDOWHUDomRGRVWDWXVPHQWDOHVLQDLVGHLQVXFLrQFLDUHVSLUDWyULD
por obstruo de vias areas.
Estudos de imagem:$ WRPRJUDD FRPSXWDGRUL]DGD 7&  GH WyUD[ FRP FRQWUDVWH p R
H[DPHPDLVLPSRUWDQWHQDSUiWLFDFOtQLFD'HQHRQtYHOHDH[WHQVmRGREORTXHLRYHQRVR
FRPH[DWLGmRGHWHUPLQDDSUHVHQoDGHFRODWHUDLVYHQRVDVHSHUPLWHLGHQWLFDURPHFDQLVPR
(invaso direta, compresso extrnseca ou trombose) e sugerir a causa da SVCS. Outros
mtodos menos empregados na prtica incluem ressonncia nuclear magntica (til para
pacientes com histria de alergia ao contraste iodado e/ou com comprometimento da funo
UHQDO HYHQRJUDD UDUDPHQWHXWLOL]DGD 
Diagnstico antomo-patolgico: citologia do escarro, citologia do lquido pleural,
SXQomR DVSLUDWLYD FRP DJXOKD QD RX ELySVLD H[FLVLRQDO GH XP OLQIRQRGR DXPHQWDGR VX-

| 184 |

| 185 |

pra-clavicular, por exemplo) so mtodos minimamente invasivos que so diagnsticos em


DSUR[LPDGDPHQWHGRVFDVRVPpWRGRVPDLVLQYDVLYRVLQFOXHPEURQFRVFRSLDPHGLDVWLQRVFRSLDYLGHRWRUDFRVFRSLDELySVLDJXLDGDSRUXOWUDVVRQRJUDDHQGRVFySLFDSXQomRSRUDJXOKD
guiada por TC e toracotomia.

XV. Complicaes relacionadas


ao cncer e/ou ao tratamento
2. Carcinomatose menngea

III.Tratamento
O tratamento baseia-se, inicialmente, na gravidade do quadro clnico. Os pacientes que
apresentam alterao do status mental em decorrncia de edema cerebral e aqueles com
comprometimento da permeabilidade de vias areas por edema de laringe so candidatos ao
tratamento intervencionista (stent endovascular), modalidade teraputica que proporciona
alvio rpido dos sintomas, usualmente dentro de 48 horas.
No caso dos pacientes que apresentam o quadro compensado, no h urgncia e a programao teraputica deve seguir os princpios do manejo da causa subjacente. A presena da
SVCS, como fator isolado, raramente coloca em risco a vida desses pacientes.
Medidas gerais:LQWHUQDomRHPDPELHQWHKRVSLWDODUFDEHFHLUDHOHYDGDDGHTXDGREDODQoR
KtGULFRHYLWDQGRVREUHFDUJDGHYROXPHR[LJrQLRVXSOHPHQWDUKHSDULQL]DomRSUROiWLFDHYLtar venclise nos membros superiores. O uso de corticides, apesar de no encontrar suporte em estudos controlados, deve ser considerado nos pacientes portadores de neoplasias
responsivas ao seu uso, como os linfomas.
7XPRUHVVHQVtYHLVjTXLPLRWHUDSLD tumor de pulmo de pequenas clulas (SCLC small
cell lung cancer), linfomas no-Hodgkin (LNH) e tumor de clulas germinativas so exemplos
de neoplasias sensveis quimioterapia. A melhora dos sintomas geralmente acontece dentro
de uma a duas semanas do incio do tratamento e remisso duradoura e paliao dos sintomas geralmente so alcanados com o tratamento padro. Em algumas situaes, a adio de
radioterapia pode reduzir as taxas de recorrncia local. Em pacientes com SCLC - doena
limitada ou LNH em estdios iniciais, a terapia combinada tem se mostrado superior em termos de sobrevida global. Nesses casos, a presena de SVCS no implica um pior prognstico
em relao aos pacientes sem a sndrome.
7XPRUGHSXOPmRQmRSHTXHQDVFpOXODV 16&/&QRQVPDOOFHOOOXQJFDQFHU 
Ao contrrio do que acontece para o SCLC, a presena da SVCS impe um pior prognstico
aos pacientes com NSCLC, com uma sobrevida mdia de apenas 5 meses. A terapia freqentemente empregada com o intuito de paliao dos sintomas, mais do que com o objetivo
de curar ou atingir remisso prolongada. Em uma reviso sistemtica, a mais importante para
SVCS por carcinoma broncognico, 60% dos pacientes com NSCLC obtiveram alvio dos
sintomas com radioterapia e quimioterapia e a taxa de recorrncia foi da ordem de 19%. Freqentemente esses pacientes necessitam de uma modalidade alternativa de interveno ou
terapia de resgate, como o emprego de mtodos endovasculares. Nessa srie, os pacientes
que receberam tratamento intervencionista precocemente obtiveram alvio dos sintomas em
95% dos casos, com taxa de recorrncia de 11%. Esses dados, apesar de no avaliados de maneira prospectiva, sugerem que o tratamento intervencionista precoce deve ser considerado
neste grupo de pacientes.
1(QJO-0HG
&OLQ2QFRO 5&ROO5DGLRO 

A necessidade de anticoagulao aps o implante de um stent controversa. Alguns autores


preconizam a terapia por no mnimo 3 meses, com heparina de baixo peso molecular ou
cumarnicos.

A carcinomatose menngea (CM) ocorre aproximadamente em 5% dos cnceres metastticos, sendo os adenocacinomas de mama e pulmo e o melanoma os tumores mais comumente relacionados.

1.Diagnstico
Clnico - envolvimento multifocal do sistema nervoso central, especialmente de pares cranianos.
5HVVRQkQFLD QXFOHDU PDJQpWLFD 50  deve ser o primeiro exame a ser solicitado.
Recomenda-se ateno especial base do crnio e tronco cerebral. Se possvel com pesquisa
GHX[ROLTXyULFR
3XQomROLTXyULFDORPEDU sempre aps a RM. Para aumentar a sensibilidade, preconizase pelo menos 3 punes, totalizando pelo menos 30 ml de lquido cefalorraquidiano para
anlise. Pesquisa de clulas neoplsicas, presso de abertura, protenas, glicose e contagem
total de clulas devem ser avaliadas em cada amostra. Caso a citologia onctica seja negativa,
RTXDGURFOtQLFRVXJHVWLYRHRVDFKDGRVUDGLROyJLFRVWtSLFRVVmRVXFLHQWHVSDUDHVWDEHOHFHU
o diagnstico de CM.
Cancer (2009) 115(9):1941-6

2.Tratamento
a) Avaliao do prognstico do paciente
Os fatores prognsticos de todos os pacientes com diagnstico de CM devem ser avaliados.
Caso o paciente apresente 1 ou mais fatores de mau prognstico, ele no candidato a traWDPHQWRRQFROyJLFRHVSHFtFRGHYHQGRVHUUHDOL]DGRFXLGDGRVSDOLDWLYRV
Mau prognstico:
KPS < 70
'pFLWVQHXUROyJFRVP~OWLSORVH[RV
Doena sistmica extensa e/ou sem opes de tratamento sistmico
Encefalopatia ou doena extensa em SNC
Bom prognstico:
KPS > 70
'pFLWVQHXUROyJLFRVPtQLPRVRXQmR[RV
Possibilidade de tratamento sistmico do tumor
Arch Neurol. (2009) 66(1):74-8
NCCN Clinical Practice Guidelines in Oncology: Central Nervous System Cancers,Version 1. 2005

/XQJ&DQFHU

| 186 |

| 187 |

b) Radioterapia
2WUDWDPHQWRLQLFLDOGRSDFLHQWHFRPERPSURJQyVWLFRYLVDUHVWDEHOHFHURX[ROLTXyULFR
1HVVHVHQWLGRGHYHVHUVXEPHWLGRjUDGLRWHUDSLDORFDOL]DGDHPSRQWRVGHREVWUXomRGHX[R
ou em locais de grande volume tumoral ao longo do neuro-eixo 10 x 3 Gy.
Neurology (1996) , 46(6): 1674-7

c) Quimioterapia intra-tecal
$SyVUHVWDEHOHFLGRRX[RLQLFLDVHRWUDWDPHQWRFRPPHWRWUH[DWR 07; HGH[DPHWDVRQD
(DEXA) por via intra-tecal com o seguinte esquema:
Fase de induo

MTX 12mg + DEXA 4mg = 2 x semana por 4 semanas


Fase de consolidao

MTX 12mg + DEXA 4mg = 1 x semana por 4 semanas


Fase de manuteno

MTX 12mg + DEXA 4mg = 1 x ms at 6 meses


Cancer (1982) 49:759772
Ann Oncol ( 2004) 15 Suppl 4:iv285-91
J Clin Oncol. 1993, 11(3):561-9
J Clin Oncol. 1987, 5(10):1655-62
Oncologist. 2008 , 13(9):967-77

XV. Complicaes relacionadas


ao cncer e/ou ao tratamento
3. Sndrome de Compresso Medular
,'HQLomRH(SLGHPLRORJLD
'HQHVHDVtQGURPHGHFRPSUHVVmRPHGXODU 6&0 PDOLJQDTXDQGRRFRUUHFRPSUHVVmR
do saco dural e seus componentes (medula espinhal e/ou cauda eqina) por uma massa tumoral extradural. Inclui critrios clnicos e radiolgicos. Na presena apenas de evidncias raGLROyJLFDVGHFRPSUHVVmRGHQHVHDFRPSUHVVmRPHGXODUVXEFOtQLFD3RGHVHUFDXVDGDSHOD
extenso de uma massa do corpo vertebral, pela extenso anterior de uma massa originria
nos elementos dorsais ou pelo crescimento de uma massa que invada o formen vertebral.
A incidncia da SCM maligna varia de acordo com a neoplasia primria envolvida, sendo
relatadas incidncias variando de 0,22% em neoplasias pancreticas at 7,91% em casos de
mieloma. A incidncia cumulativa tambm diminui com a idade.
Embora qualquer neoplasia possa causar a SCM, as mais freqentes relatadas, em adultos,
so as neoplasias de prstata, mama e pulmo (cada uma representado 15 a 20% dos casos),
seguidas ento por linfoma no-Hodgkin, mieloma mltiplo, carcinoma renal, cncer colorretal e sarcomas.
Lancet Oncol 6:15-24, 2005
JCO 23: 20282037, 2005

3. Seguimento
Reduo do nmero absoluto de clulas neoplsicas

Basear-se na amostra coletada aps 4 semanas de tratamento


Parmetros clnicos

Se recada ou piora clnica, considerar parada de tratamento ou insero


de paciente em estudo clnico

&RQVLGHUDo}HVQDLV
6HPSUHTXHSRVVtYHOPDQWHURWUDWDPHQWRRQFROyJLFRVLVWrPLFRHVSHFtFRSDUDGRHQoD

de base.
Caso no seja possvel a realizao de quimioterapia por via intra-tecal, a radioterapia em
locais sintomticos ou de crnio total isoladamente pode ser considerada.
Utilizar dexametasona (16mg/dia) no manejo inicial do paciente com sintomatologia de
KLSHUWHQVmRLQWUDFUDQLDQDUHGX]LUDGRVHRPDLVUiSLGRSRVVtYHODWpDGRVHPtQLPDHFD]
Utilizar cido folnico 15mg via oral 12/12h por 3 dias aps MTX intra-tecal.em caso de
disfuno renal ou incidncia de mucosite
1mRpQHFHVViULRXWLOL]DUDQWLFRQYXOVLYDQWHVGHIRUPDSUROiWLFD

II. Quadro Clnico e Fatores de Risco


Um dos principais sintomas da SCM a dor, presente em at 95% dos casos. Como caractersticas, mais freqente no segmento torcico (60-80%), ocorrendo tambm no segmento
ORPERVDFUDO  HFHUYLFDO  pLQLFLDOPHQWHORFDOL]DGDDXPHQWDQGRGHLQWHQVLGDGH
QRSHUtRGRGHSRXFDVVHPDQDVSLRUDFRPRUHSRXVRHSUHFHGHRVVLQWRPDVQHXUROyJLFRV
em cerca de 7 semanas.
'pFLW PRWRU p HQFRQWUDGR HP  D  GRV FDVRV DR GLDJQyVWLFR VHQGR XP SRXFR
PDLVFRPXPTXHDSUHVHQoDGHGpFLWVHQVLWLYR$SUHVHQoDGHGLVIXQo}HVLQWHVWLQDOHYHVLFDO
ocorre, em geral, mais tardiamente.
Alguns autores mostraram alguns fatores como preditivos de risco de SCM. Talcott, junto
com outros autores, descreveu os fatores: incapacidade de deambulao, diminuio de reH[RVSURIXQGRVUDGLRJUDDHYLGHQFLDQGRIUDWXUDFRPFRPSUHVVmRSUHVHQoDGHPHWiVWDVHV
sseas, presena de metstases sseas h mais de um ano e idade inferior a 60 anos como
preditivos de risco de SCM. Quando todos estiveram presentes este risco foi de 87%, sendo
de apenas 4% na ausncia dos mesmos. Tendo com enfoque apenas a neoplasia de prstata,
Bayley e colaboradores mostraram a extenso da doena ssea (mais de 20 metstases) e
durao da terapia hormonal como fatores preditivos de risco de SCM.
Lancet Oncol 6:15-24, 2005
JCO 23: 20282037, 2005
Support Care Cancer 7(1):31-8, 1999
Cancer 92(2):303-10, 2001

| 188 |

| 189 |

III. Diagnstico

pacientes que se apresentam paraplgicos antes do incio da radioterapia).

$VXVSHLWDFOtQLFDGHYHVHUVHPSUHFRQUPDGDFRPXPH[DPHGHLPDJHP5DGLRJUDDV
simples de coluna, quando normais, no excluem o diagnstico, uma vez que a incidncia de
falso negativo chega a 17%, porm a presena de vrtebras colapsadas associa-se com SCM
em at 75% dos casos.
$WRPRJUDDFRPSXWDGRUL]DGDGHFROXQDSRGHVHU~WLOSDUDRGLDJQyVWLFRSRUpPRPpWRdo de escolha deve ser sempre a ressonncia nuclear magntica, pois apresenta sensibilidade
GHHVSHFLFLGDGHGHHDFXUiFLDGLDJQyVWLFDGH5HFRPHQGDVHDDYDOLDomRGH
toda a extenso da coluna, pois freqentemente h mais nveis de compresso.
Lancet Oncol 6:15-24, 2005
JCO 23: 20282037, 2005

IV.Tratamento
1.Tratamento Medicamentoso:
O uso de corticides, sendo a dexametasona a droga mais descrita, tem como base
VLRSDWROyJLFDDUHGXomRGHHGHPDHUHVSRVWDLQDPDWyULDHDHVWDELOL]DomRGHPHPEUDQDV
YDVFXODUHVUHWDUGDQGRDVVLPRGpFLW(VWXGRUDQGRPL]DGRFRQGX]LGRSRU6RUHQVHQHFRlaboradores mostrou melhores taxas de deambulao com o uso de dexametasona quando
associada radioterapia versus radioterapia isolada (81% vs. 63%).
Eur J Cancer 30A: 2227, 1994

Embora a dose de dexametasona possa variar de 10 a 100mg/dia administrada de maneira


rpida ou em infuso contnua, pois no h um esquema padro estabelecido, favorecemos:
'H[DPHWDVRQD 20 mg EV em bolus, seguida de 4 mg EV 6/6h

Deve-se monitorar a glicemia dos pacientes devido dose alta de corticide. Lembramos que
no h indicao de corticoterapia na ausncia de disfuno neurolgica.
Am J Clin Oncol 19:179-183, 1996

2.Tratamento Radioterpico:
Os esquemas mais utilizados de radioterapia so: 30 Gy divididos em 10 fraes e 8 Gy
em dose nica. Uma meta-anlise mostrou que, em relao ao controle de dor, no houve
diferenas em relao dose nica quando comparada com a dose fracionada (controle de
cerca de 60%), sendo a dose nica, no entanto, associada a maiores taxas de retratamento
(21,5% vs. 7,4%) e fratura patolgica (3% vs. 1,6%). Com base nestes resultados, a recomendao que a dose nica deva ser reservada apenas a pacientes muito debilitados.
8PIDWRULPSRUWDQWHDVHUFRQVLGHUDGRpHPUHODomRDRWHPSRGHLQVWDODomRGRGpFLW
SRLVSDFLHQWHVTXHDQWHVGDUDGLRWHUDSLDDSUHVHQWDYDPXPWHPSRGHLQVWDODomRGRGpFLW
maior que 14 dias tiveram melhores resultados funcionais do que pacientes com velocidade
GHLQVWDODomRGRGpFLWPDLRU WHPSRLQIHULRUDGLDV 
A radioterapia deve incluir uma e, possivelmente, duas vrtebras abaixo e acima da leso,
pois at 64% dos pacientes podem ter recorrncia precoce entre as duas vrtebras mais
prximas.
Outros fatores importantes a serem considerados antes do tratamento radioterpico so
a presena ou no de compresso ssea (veja abaixo, em tratamento cirrgico) e o fato do
paciente estar ou no deambulando (pacientes deambulando antes do incio da radioterapia
tem taxas de deambulao aps o tratamento de 80 a 100%, sendo que esta taxa cai para
cerca de 30% em pacientes que no esto deambulando e pode ser apenas de 2 a 6% em

| 190 |

Lancet Oncol 6:15-24, 2005


Clin Oncol (R Coll Radiol) 15: 34552, 2003
Int J Radiat Oncol Biol Phys 53:975-979, 2002

3.Tratamento Cirrgico:
O tratamento cirrgico o nico mtodo com possibilidade de alvio imediato e estabilizao mecnica direta. indicado em casos em que h a presena de fragmentos sseos no
canal medular, coluna instvel, ausncia de resposta a um eventual tratamento radioterpico
prvio ou impossibilidade de nova dose de radioterapia. Recomenda-se sempre a avaliao
de um neurocirurgio com experincia em casos de SCM.
Um estudo randomizado e multicntrico conduzido por Patchell e colaboradores, comparou a cirurgia (seguida de radioterapia) com o tratamento isolado de radioterapia, com
desfecho primrio de deambulao. O estudo foi interrompido na anlise interina, pois as taxas de deambulao favoreceriam o grupo que inclua a cirurgia no tratamento (84% vs. 57%,
p = 0,001), apesar de no haver vantagens em relao sobrevida. Apesar de muitas crticas
(como a de que o resultado do grupo de radioterapia isolada foi inferior ao que relatado na
literatura), trata-se de um trabalho positivo e que sempre citado pelos neurocirurgies.
Destaca-se que a radioterapia deve ser sempre utilizada aps um tratamento cirrgico,
pois conduz melhores resultados, quando comparada com a cirurgia isolada.
Lancet Oncol 6:15-24, 2005
Lancet 366:643-648, 2005

7UDWDPHQWR3UROiWLFR
Apesar do pouco nmero de pacientes nos trabalhos, alguns autores recomendam o
tratamento radioterpico para pacientes com SCM sub-clnica. Tal indicao deve ser sempre
discutida com o radioterapeuta.
5.Tratamento da Recidiva aps a Radioterapia
Aps um tratamento inicial com radioterapia, considerar tratamento cirrgico ou re-irradiao, que pode ser efetiva, com baixa incidncia de mielopatia secundria a radioterapia. Se
a falha ocorrer durante a radioterapia, considerar o resgate com cirurgia imediata, que pode
levar a taxas de deambulao de at 30%.
Ann Neurol 37:583-589, 1995
JCO 23: 20282037, 2005
Lancet 366:643-648, 2005

XV. Complicaes relacionadas


ao cncer e/ou ao tratamento
4. Sndrome de Lise Tumoral
,&ODVVLFDomRGH&DLUR%LVKRS
1. Sndrome de Lise Tumoral Laboratorial
Presena de duas ou mais das seguintes alteraes laboratoriais entre trs dias antes e sete
dias aps a terapia citotxica:

| 191 |

cido rico

PJGORXDXPHQWRHPGRYDORUGHEDVH

Potssio

PJ/RXDXPHQWRHPGRYDORUGHEDVH

Fsforo

PJGORXDXPHQWRHPGRYDORUGHEDVH

Clcio

PJGORXUHGXomRHPGRYDORUGHEDVH

,,,3UROD[LDH7UDWDPHQWR
O reconhecimento precoce dos fatores de risco, aliado s intervenes apropriadas, a
melhor abordagem na preveno tanto da sndrome de lise tumoral laboratorial quanto da
sndrome com suas manifestaes clnicas.

2. Sndrome de Lise Tumoral Clnica


Presena de sndrome de lise tumoral laboratorial associada a uma ou mais das seguintes
FRPSOLFDo}HVFOtQLFDVLQVXFLrQFLDUHQDODJXGDDUULWPLDFDUGtDFDPRUWHV~ELWDHFRQYXOV}HV
Graduao
0

Creatinina [/61 [/61

Arritmia
cardaca

Convulso

Nenhuma

Nenhuma

Sem necessidade
de interveno

![
LSN

> 3,0-6,0 X
LSN

![/61

Morte

Necessidade
de interveno
no urgente

Sintomtica
e controlada
parcialmente
com frmacos
ou controlada
com dispositivos

Ameaa
vida
(arritmia associada a IC,
hipotenso,
sncope ou
choque)

Morte

Um episdio
breve de
convulso
generalizada,
convulses
bem controladas com anticonvulsivantes
ou convulses
motoras focais
que no interferem com as
AVD

Convulso
com alterao
da conscincia,
de difcil
controle, associada a crises
episdicas
apesar de
interveno
medicamentosa

Convulso
de qualquer
natureza, de
padro prolongado ou
reentrante
(status
epilepticus
ou epilepsia
intratvel)

Morte

1. Hidratao
Recomendada a infuso venosa de NaCl 0,9% 2 a 3 L/m2/dia para todos os pacientes
de risco alto ou moderado, associado a monitorizao do dbito urinrio, que deve ser
mantido entre 80 a 100 ml/m2/h.
5HFRPHQGDVHKLGUDWDUFRPFDXWHODDTXHOHVSDFLHQWHVFRPLQVXFLrQFLDUHQDOPDQLIHVWD
LQVXFLrQFLDFDUGtDFDRXSDFLHQWHVLGRVRVRQGHDLQIXVmRGHVDOLQDGHYHVHUEDVHDGDQR
dbito urinrio do paciente.
2. Alcalinizao da urina
No recomendado de rotina.
,QLELGRUGD[DQWLQDR[LGDVH DORSXULQRO 
Uso recomendado para pacientes de risco alto ou moderado nas doses de 50 a 100
mg/m2 a cada 8 horas, por via oral (mximo de 300mg/m2/dia ou 800 mg/dia).
Deve ser iniciado entre 1 a 2 dias antes do incio da quimioterapia, mantendo-se o uso
entre 3 a 7 dias aps, conforme o risco de desenvolver a sndrome.
1DSUHVHQoDGHLQVXFLrQFLDUHQDORDMXVWHGHGRVHVHID]QHFHVViULR
Clcr 80 ml/minuto: 250 mg/dia
Clcr 60 ml/minuto: 200 mg/dia
Clcr 40 ml/minuto: 150 mg/dia
Clcr 20 ml/minuto: 100 mg/dia
Clcr 10 ml/minuto: 100 mg a cada 2 dias
Clcr 0 ml/minuto: 100 mg a cada 3 dias
Na vigncia de hemodilise, a dose de alopurinol deve ser administrada aps o procedimento, caso contrrio, administrar uma dose suplementar de 50%.

/61OLPLWHVXSHULRUGDQRUPDOLGDGH$9'DWLYLGDGHVGHYLGDGLiULD,&LQVXFLrQFLDFDUGtDFD
%U-+DHPDWRO2FW  

II. Fatores de Risco


As seguintes caractersticas clnicas esto associadas a um maior risco de desenvolvimento
de sndrome de lise tumoral, seja ela espontnea ou induzida pelo tratmento citotxico:
Neoplasias hematolgicas (alto risco)
Neoplasias slidas quimiossensveis (risco intermedirio)
Elevada carga tumoral
DHL elevado (> 2 x LSN)
Hiperuricemia
Desidratao
Uremia
,QOWUDomRWXPRUDOUHQDO
%U-+DHPDWRO2FW  
-&OLQ2QFRO-XQ  

| 192 |

XV. Complicaes relacionadas


ao cncer e/ou ao tratamento
5. Hipercalcemia
l. Introduo
Hipercalcemia ocorre em cerca de 10 a 20% dos pacientes com cncer durante a evolu-

o da doena
3RGHVHUOHYHPRGHUDGDHJUDYH &DDPJG/DPJG/HPJG/
respectivamente)

| 193 |

ll. Fisiopatologia
Metstases osteolticas: estmulo de osteoclastos por fatores locais produzidos pelas

clulas tumorais. Responsvel em 20% dos casos, usualmente devido a cncer de mama,
no-pequenas clulas de pulmo e mieloma mltiplo
Hipercalcemia humoral: secreo tumoral da protena relacionada ao hormnio da paratireide (PTHrP). Causa mais comum (80%) dos casos em pacientes com tumores slidos
no-metastticos e alguns pacientes com linfoma no-Hodgkin
Calcitriol: causa rara (menos que 1% casos), sendo devido secreo de vitamina D ativa
pelas clulas neoplsicas, usualmente relacionada aos linfomas

lll. Quadro clnico


2VVLQWRPDVVmRLQHVSHFtFRVDIHWDQGRYiULRVVLVWHPDVRUJkQLFRVHFRPVHYHULGDGHYDULiYHO
de acordo com grau de hipercalcemia e a velocidade de instalao. No trato gastrointestinal
a constipao o sintoma mais comum, geralmente associada anorexia, nuseas, vmitos e
desconforto abdominal vago. Distrbios cognitivos, inclusive com quadro confusional agudo,
SRGHP RFRUUHU )UDTXH]D PXVFXODU SRGH VHU LQWHQVD DR SRQWR GH FRQQDU R SDFLHQWH QR
leito. As alteraes nefrolgicas so principalmente decorrentes da alterao da capacidade
de concentrao renal, determinando poliria persistente, depleo de volume e queda da
OWUDomRJORPHUXODU3UXULGR FXWkQHR SRGH RFRUUHU 'RUHV yVVHDVSRGHP RFRUUHU VHP OHses sseas detectveis. Os diagnsticos diferenciais devem ser lembrados por sua relativa
frequncia (hiperparatiroidismo, hipertiroidismo, imobilizao, excesso de vitaminas A e D,
diurticos tiazdicos e ltio, doena de Paget do osso e doenas granulomatosa)

tao, para promover calciurese


Bifosfonato: agentes mais efetivos, porm com ao retardada em cerca de 48 h e nadir
em 4 a 5 dias.
1) Pamidronato: 60 a 90 mg EV em 2 a 4 h
Cai ou corrigido 12-13,5 mg/dL: 60 a 90 mg EV em 2 a 24 hs
Cai ou corrigido > 13,5: 90 mg EV dose nica de 2 a 24 hs
Repetio, se indicado, com intervalo 7 dias e eventualmente a cada 2 a 3 semanas
Ajuste Funo Renal: a dose total de pamidronato pode ser administrada tanto em infuso
nica como em infuses mltiplas, durante 2 a 4 dias consecutivos. A dose mxima para cada
tratamento de 90 mg, tanto para o tratamento inicial como para os tratamentos subsequentes. Estudos farmacocinticos indicam no ser necessrio o ajuste de dose em pacientes
FRPTXDOTXHUJUDXGHLQVXFLrQFLDUHQDO(QWUHWDQWRDWpTXHVHDGTXLUDPDLRUH[SHULrQFLD
UHFRPHQGDVHDYHORFLGDGHPi[LPDGHLQIXVmRGHPJKHPSDFLHQWHVFRPLQVXFLrQFLD
renal, e as doses podem ser administradas como na tabela abaixo.
&iOFLRVpULFRLQLFLDO
(nmol/litro)

&iOFLRVpULFRLQLFLDO
(mg %)

Dose Total Recomendada


(mg)





15 30

3,0 3,5

12,0 14,0

30 60

3,5 4,0

14,0 16,0

60 90

Maior que 4,0

Maior que 16,0

90

$MXVWHSHODIXQomRKHSiWLFDQmRpUHTXHULGRHPSDFLHQWHVFRPLQVXFLrQFLDKHSiWLFDOHYH

a moderada.

lV. Diagnstico
Dosagem de Ca+2 inico
Dosagem Ca+2 total e albumina, para clculo de Ca+2 corrigido

>&DFRUULJLGR &DWRWDO[ DOEXPLQDPJG/ @


Dosar uria e creatinina, Na+, K+, Mg+2, fsforo e glicemia.
A dosagem de PTHrP deve ser realizada nos casos em que o diagnstico no pode ser
UPDGRFOLQLFDPHQWH
Dosagem de 1,25 (OH)2D necessria nos casos de suspeio diagnstica

V.Tratamento
Tratamento da doena de base
2TXDGURFOtQLFRQHPVHPSUHUHHWHRVQtYHLVVpULFRVGHFiOFLR
Medidas gerais: retirar clcio das solues parenterais e suplementos orais, suspender

medicaes hipercalcmicas (ltio, calcitriol, vitamina D e tiazdicos), estimular a deambulao e, caso possvel, descontinuar ou reduzir o uso de sedativos
Reposio de fosfato via oral se P < 3 mg/dL (manter entre 2,5 e 3 mg/dL)
Expanso volmica: com soluo salina isotnica 200-300 ml/h, monitorando sobrecarga
hdrica
Diurticos de ala: furosemida 20 a 40 mg EV a cada 2 a 4h, iniciando aps atingida hidra-

| 194 |

 FLGR]ROHQGU{QLFRPJ(9HPPLQXWRVDFDGDDVHPDQDV$JXDUGDU
no mnimo 7 dias para re-administrar a medicao, caso necessrio.
,QVXFLrQFLD5HQDO/HYHD0RGHUDGDVHPDMXVWH
,QVXFLrQFLD5HQDO*UDYHRX&U!PJG/DYDOLDUULVFREHQHItFLR
Mieloma Mltiplo e metstase sseas, iniciar de acordo com o clearance de creatinina,
administrando a cada 3-4 semanas, como na tabela abaixo.
Clearance de Creatinina (mL/min)

Dose Total Recomendada (mg)

> 60

60 50

3,5

49 40

3,3

39 30

3,0

< 30

No recomendado

Se houver albuminria > 500 mg/24 horas, no aplicar a medicao e reiniciar aps 3 a 4 sema-

nas at retornar ao valor normal e, considerar reiniciar infuso durante ao menos 30 minutos

| 195 |

1mRVHWrPGDGRVGDQHFHVVLGDGHGHDMXVWHHPLQVXFLrQFLDKHSiWLFD

lll. Medidas Gerais


Evitar alimentos salgados, cidos ou secos
A ingesta hdrica deve ser enfatizada, mas em graus avanados de acometimento pode ser

Vll. Outras recomendaes


Glicocorticides: em linfomas com nveis elevados de 1,25 (OH)2D, pode-se usar Predni-

necessrio aporte por via parenteral


Higienizao oral deve ser realizada preferencialmente c/ escova macia, sendo fator de
proteo contra infeco secundria.

sona 60 mg/dia.
Calcitonina: em casos graves e sintomticos devido pico de ao precoce. Dose 4-8UI/Kg
a cada 8-12 h.
Dilise: em casos graves sintomticos em que hidratao adequada no possa ser realizada

lV. Analgesia

XV. Complicaes relacionadas


ao cncer e/ou ao tratamento
6. Mucosite
Pode ser dividida em mucosite oral e gastrointestinal de acordo com a localizao.

(PERUDRFRQWUROHDGHTXDGRGDDQDOJHVLDSRVVDVHUQHFHVViULRFRPPRUQD 3&$ HP


pacientes submetidos a transplante de clulas-tronco, pode haver boa resposta com o uso
de lidocana a 2% tpica nas mucosites menos intensas.

V. Mucosite na Radioterapia
Nos pacientes submetidos a radioterapia de dose moderada para cncer de cabea e
pescoo, benzidamida recomendada, mas no existe suporte p/ uso de clorexidine nas
mesmas condies.
Sucralfato no recomendado para tratamento de mucosite aps radioterapia.

MUCOSITE ORAL
l. Introduo

Vl. Mucosite na Quimioterapia

eXPDLQDPDomRGDPXFRVDGDFDYLGDGHRUDOHRURIDULQJHFDUDFWHUL]DGDSRUHGHPDHULWHPDDWURDHSURJUHVVLYDXOFHUDomR$SUR[LPDGDPHQWHGRVSDFLHQWHVHPTXLPLRWHUDSLD
GHVHQYROYHPPXFRVLWHVHQGRTXHHPGHVWHVKiQHFHVVLGDGHGHPRGLFDo}HVQRWUDWDmento ou de analgesia parenteral.

Nos pacientes submetidos a quimioterapia dose-padro, pode ser feito preveno de mucosite oral atravs da crioterapia (deixar derreter pedaos de gelo por 30 minutos), antes do
E{OXVGHXRURXUDFLO

OO&ODVVLFDomR

Vll. Mucosite e Monilase

Grau
1

([DPH&OtQLFR

Sintomas / Funo

Eritema

Sintomas mnimos / dieta normal

Ulceraes / Pseudomembranas

Sintomtico, mas pode beber / comer


GLHWDPRGLFDGD

Ulceraes / pseudomembranas
FRQXHQWHVRXVDQJUDPHQWRDR
menor trauma

Sintomtico e incapaz de receber dieta


ou hidratao adequadamente

Necrose / sangramento espontneo /


Sintomas associados com risco de vida
risco de vida

Morte

Morte

| 196 |

5XEHQVWHLQ(%&DQFHU

$SHVDUGRULVFRGHLQIHFomRSRU&DQGLGDDOELFDQVQmRKiEHQHItFLRQDDGPLQLVWUDomRSURltica de soluo de nistatina.


'H*UHJRULR0:&DQFHU  

Vlll. Mucosite no Tratamento de Cncer de Cabea e Pescoo


A terapia com laser de baixa dose, quando disponvel, deve ser incorporada prtica clnica para
tratamento de mucosite relacionada quimiorradioterapia para cncer de cabea e pescoo j
TXHHVWiDVVRFLDGDDPHQRULQWHUUXSomRGRWUDWDPHQWRHDPHOKRUGRVHHFiFLDGDUDGLRWHUDSLD1RFRQWH[WRSUROiWLFRDVVRFLDVHjPHQRULQFLGrQFLDGHPXFRVLWHJUDXVH
&DVWUR*-&OLQ2QFROV VXSSODEVWU

| 197 |

MUCOSITE GASTROINTESTINAL

O uso de enemas c/ sucralfato (suspenso de sucralfato 10% em gua 20 mL 2x/dia) pode ser
EHQpFRSWUDWDPHQWRGHSURFWLWHDFWtQLFD
5XEHQVWHLQ(%&DQFHU

l. Introduo
A mucosite gastrointestinal (MGI) pode se apresentar como dor, distenso, nuseas e disfagia, contribuindo para a reduo da ingesta alimentar e favorecendo a perda de peso e
conseqente desnutrio. Pode se manifestar como ulcerao que atua como substrato para
VDQJUDPHQWRHFRORQL]DomRFRPLQIHFomRORFDOHULVFRGHGLVVHPLQDomR3RGHHQPVHUFDXVD
de diarria, que evolui com desequilbrio hidroeletroltico e mal-absoro, com progressiva
perda de peso.

V. Mucosite na Quimioterapia
Ranitidina (150 mg duas vezes ao dia) e omeprazol (20 mg/dia) tm benefcio comprovado
QD SUHYHQomR GH 0*, FDXVDGD DSyV FLFORIRVIDPLGD PHWRWUH[DWH XRURXUDFLO FRP RX VHP
leucovorin.
No tratamento da diarria que ocorre por MGI que no teve resposta aps o uso de lopeUDPLGDUHFRPHQGDVHRFWUHRWLGHJ6&[GLD
5XEHQVWHLQ(%&DQFHU

OO&ODVVLFDomR
Grau

([DPH&OtQLFR

Sintomas / Funo

Eritema

Sintomas mnimos / dieta normal

Ulceraes / Pseudomembranas

Sintomtico, mas pode beber / comer dieta


PRGLFDGD

Ulceraes / pseudomemEUDQDVFRQXHQWHVRX
sangramento ao menor
trauma

Sintomtico e incapaz de receber dieta ou hidratao adequadamente

Necrose / sangramento
espontneo / risco de vida

Sintomas associados com risco de vida

Morte

Morte

lll. Medidas Gerais

XV. Complicaes relacionadas


ao cncer e/ou ao tratamento
'LDUUpLD
I. Introduo
A diarria associada ao tratamento oncolgico pode ocorrer em decorrncia da quimioterapia utilizada ou ainda da irradiao plvica e abdominal.

II. Principais Agentes

Considerar o diagnstico diferencial


Ateno para a manuteno de adequada hidratao e para risco potencial e transitrio

a. Fluoropirimidinas: especialmente nos esquemas em bolus e na associao ao cido


IROtQLFR'HYHVHFRQVLGHUDUDSRVVLELOLGDGHGHGHFLrQFLDGHGLKLGURSLULPLGLQDGHVLGURJHQDVH '3' HQ]LPDHQYROYLGDQRPHWDEROLVPRGDVXRURSLULPLGLQDVHPFDVRVGHGLDUUpLD
mucosite e pancitopenia severas e de difcil manejo.

de intolerncia lactose
'LHWDFRQVWLSDQWH VHPEUDVRXFDIp IUDFLRQDGDHULFDHPOtTXLGRV
Loperamida pode ser usada at 16 mg ao dia. Pode ser necessrio o uso de antiemticos,
pr-cinticos e analgsicos como sintomticos
Antibioticoterapia pode ser disponibilizada no risco de infeco
Tratar os distrbios hidroeletrolticos associados

b. Irinotecano: pode causar diarria de incio precoce ou tardio.


'LDUUpLDSUHFRFH durante a infuso ou algumas horas aps, associada a sintomas colinrgicos como clicas, hiperssalivao, rinite e lacrimejamento e com durao de cerca de 30
minutos. Deve ser manejada com atropina.

Cancer 68: 499, 1991

Oncology 12: 72,1998

'LDUUpLDWDUGLD incio cerca de 6 a 11 dias aps a administrao. dose-independente e


multifatorial (dismotilidade, secretria e por efeitos txicos diretos).

lV. Mucosite na Radioterapia

J Clin Oncol 16: 2745, 1998

A radioterapia plvica externa pode ser acompanhada por enterite actnica e a sulfassalazina
(500 mg por via oral 2x/dia) pode ser usada como preveno. No existe benefcio na preveno de mucosite GI aps RT atravs do uso de sucralfato ou cido 5-amino-saliclico.

| 198 |

c. Inibidores de tirosinoquinases

| 199 |

,OO&ODVVLFDomR
A diarria pode ser graduada conforme os critrios do National Cancer Institute (NCICTC
National Cancer Institute Common Toxicity Criteria).(tabela 1)
7DEHOD&ULWpULRVGH7R[LFLGDGHSDUD'LDUUpLD
Grau
0

Pacientes sem
Ausente
colostomia

Pacientes com
Ausente
colostomia

Aumento
<4 evacuaes/dia

Aumento 4-6
HYDFXDo}HVGLD
evacuaes
noturnas

$XPHQWR
evacuaes/dia
ou incontinnFLDQHFHVVLGDGH
de hidratao
EV

Choque
hipovoOrPLFR
necessidade
de cuidados
intensivos

Aumento moderado de dbito


aquoso por
colostomia

Aumento
importante de
dbito aquoso
por colostomia,
com comprometimento de
atividades de
rotina

Choque
hipovoO{PLFR
necessidade
de cuidados
intensivos

Aumento
leve de
dbito
aquoso por
colostomia

NOTA: Adaptado de National Cancer Institute

0RGLFDo}HVGLHWpWLFDV
Ingesto hdrica
Refeies fracionadas
Suspenso de produtos hiperosmolares, com lactose, cafena e lcool
Loperamida:
Dose de ataque: 4mg VO
Manuteno: 2mg VO 4/4h ou aps cada evacuao
Dose mxima: 16mg/dia
Suspenso se 12 horas sem diarria
Se em uso de irinotecano, considerar doses altas de loperamida:
Dose de ataque: 4mg VO
Manuteno: 2mg VO 2/2h ou 4mg VO 4/4h
Suspenso se 12 horas sem diarria
J Natl Cancer Inst 86: 446, 1994

3HUVLVWrQFLDGHGLDUUpLD!KRUDV
Loperamida 2mg VO 2/2h por at mais 24 horas
$QWLELRWLFRWHUDSLD )OXRURTXLQRORQDV&LSURR[DFLQRPJ92K
3HUVLVWrQFLDGHGLDUUpLD!KRUDV
Suspender loperamida
Octreotide: 100 a 150 mcg SC 8/8h
Considerar a necessidade de admisso hospitalar
([DPHVODERUDWRULDLV+0*HOHWUyOLWRVSHVTXLVDGHVDQJXHHOHXFyFLWRVQDVIH]HVSHVTXLVDVHVSHFtFDVSDUD&GLIFLOH6DOPRQHOOD(FROLH&DPS\OREDFWHUQDVIH]HV
J Clin Oncol 22: 2918, 2004

lV. Avaliao inicial


Determinar incio e durao da diarria
4XDQWLFDUQ~PHURGHHSLVyGLRV
Caracterizar aspecto das fezes (produtos patolgicos?)
'HQLUJUDXGHWR[LFLGDGHVHJXQGRR1&,&7&1DWLRQDO&DQFHU,QVWLWXWH&RPPRQ

Toxicity Criteria (tabela 1)


,GHQWLFDUPHGLFDo}HVHPXVRTXHFDXVDPGLDUUpLD
,GHQWLFDUDOLPHQWRVQDGLHWDTXHFDXVDPGLDUUpLD
,GHQWLFDUGLDUUpLDFRPSOLFDGDSHODSUHVHQoDGHXPGRVVHJXLQWHV
Diarria Grau III ou IV
Diarria Grau I ou II acompanhada de um dos sintomas a seguir:
Clicas moderadas a severas
1iXVHDV9{PLWRV*UDX
Performance status comprometido
Febre
Sepse
Neutropenia
Sangramento
Desidratao

b. 'LDUUpLDFRPSOLFDGD
Admisso hospitalar
Ressucitao volmica
Octreotide:
100 a 150 mcg SC 8/8h at 500 mcg SC 8/8h
20-50 mcg/h (mximo 500mcg/h) EV em BIC at controle dos sintomas
$QWLELRWLFRWHUDSLD )OXRURTXLQRORQDV&LSURR[DFLQRPJ92K
([DPHVODERUDWRULDLV+0*HOHWUyOLWRVSHVTXLVDGHVDQJXHHOHXFyFLWRVQDVIH]HVSHVTXLVDVHVSHFtFDVSDUD&GLIFLOH6DOPRQHOOD(FROLH&DPS\OREDFWHUQDVIH]HV
Suspender quimioterapia at resoluo completa dos sintoma

XV. Complicaes relacionadas


ao cncer e/ou ao tratamento
8. Neutropenia Febril
I.Introduo

V.Tratamento

A Neutropenia Febril (NF) uma complicao decorrente do tratamento oncolgico


que pode cursar com altas taxas de mortalidade, at 36% nos pacientes de maior risco de
desenvolver complicaes graves durante o episdio mesmo com tratamento adequado. No

a. 'LDUUpLDQmRFRPSOLFDGD
Primeiras 24 horas:

| 200 |

| 201 |

HQWDQWRSRGHPRVLGHQWLFDUJUXSRVGHPHQRUULVFRGHFRPSOLFDo}HVTXHSRGHPVHUWUDWDdos com segurana sem internao hospitalar, com antibioticoterapia intravenosa ou oral
O adequado manejo do paciente com NF depende de uma avaliao clnica e laboratorial
LQLFLDOHGHVXDFODVVLFDomRTXDQWRDRULVFRGHFRPSOLFDomRJUDYHGXUDQWHRHSLVyGLRGD1)
bem como da monitorizao do paciente com ou sem indicao de internao hospitalar at
a resoluo do episdio de NF.
Adotamos o ndice de gravidade MASCC (Multinational Association of Supportive Care
&DQFHU  SDUD FODVVLFDomR GH ULVFR GH FRPSOLFDomR JUDYH GXUDQWH R HSLVyGLR GH 1) 3HOR
tQGLFHGH0$6&&RHVFRUHPi[LPRpGHHDSRQWXDomRPHQRUTXHGHQHRSDFLHQWH
de alto risco de complicaes graves, isto , com chance maior do que 5% de complicaes
JUDYHV2SDFLHQWHGHEDL[RULVFRpGHQLGRSHORtQGLFH0$6&&LJXDORXPDLRUDHSUHVHQa de outras condies clnicas favorveis, como previso de neutropenia de curta durao
e doena oncolgica controlada. Na ausncia dessas outras condies clnicas favorveis o
SDFLHQWHpGHQLGRFRPRULVFRLQWHUPHGLiULRGHFRPSOLFDo}HV

,,'HQLomR
Neutropenia
QHXWUyORVPPRX
QHXWUyORVPPFRPH[SHFWDWLYDGHTXHGDSDUDQRVSUy[LPRVGRLVGLDV
Episdio febril
4XDOTXHUPHGLGDGHWHPSHUDWXUDD[LODU&

Sem hipotenso
Sem DPOC
Tumor slido ou hematolgico sem infeco fngica
Sem desidratao
Paciente ambulatorial (no internado no incio da NF)
Idade < 60 anos

5
4
4
3
3
2

V.Avaliao Diagnstica Inicial


Hemograma, bioqumica
Hemocultura perifrica (1 par)
HMC cateter (1 par por lmen)
Urina I/ Urocultura
5;GHWyUD[3$H3HUO
TC de trax (se Rx alterado)
Coprocultura + pesq. toxina Clostridium (se diarria)
Bipsia e cultura de leso de pele
Investigao direcionada se foco suspeito
Checar antecedente de doena fngica invasiva (DFI)

VI.Escolha de Local de Tratamento e Antibioticoterapia


Emprica Inicial

,,,&ODVVLFDomRGH5LVFR
%DL[R5LVFR
(VFRUH0$6&&
Previso de neutropenia intensa (ANC < 100) < 7 dias
Doena oncolgica controlada (que no esteja em progresso)
$XVrQFLDGHLQOWUDGRSXOPRQDU
No uso de alemtuzumab
Mucosite grau < 2
1mRXVRGHSUROD[LDDQWLELyWLFDFRPTXLQRORQD
Risco Intermedirio
(VFRUH0$6&&
Alto Risco
Escore MASCC < 21

IV.Escore de MASCC

VII.Indicao de Vancomicina ou Teicoplanina

Caractersticas
Pontuao
Carga de doena (considerando todas as comorbidades)
sintomas leves ou ausentes
5
sintomas moderados
3

| 202 |

Infeces relacionadas a cateter (suspeita clnica)


Presena de secreo no local de insero do cateter ou no trajeto

subcutneo do cateter implantvel/ semi-implantvel


Presena de bacteremia relacionada manipulao do cateter

| 203 |

+0&FRPUHVXOWDGRVSDUFLDLVFRPJUDPSRVLWLYRDQWHVGDLGHQWLFDomRQDO
Colonizao por MRSA (S. aureus resistente oxacilina)
Sepse grave (presena dos critrios de sepse + sinais disfuno rgo acidose ltica,

oligria, hipotenso, alterao nvel conscincia) e choque sptico


Mucosite grau > 1

9,,,'HQLomRGH'RHQoD)~QJLFD,QYDVLYD
De acordo com os critrios revisados do EORTC/MSG de Doena Fngica Invasiva
Considerar apenas os diagnsticos provvel e provado de DFI baseados

em achados histopatolgico ou microbiolgicos


5HYLVHGGHQLWLRQRILQIDVLYHIXQJDOGLVHDVHIURPWKH(XURSHDQ2UJDQL]DWLRQIRU5HVHDUFK
and Treatment of Cancer/Invasive Fungal Infections Cooperative Group and the National
Institute of Allergy and Infectious Diseases Mycoses Study Group (EORTC/MSG) ConsenVRX*URXS&OLQ,QIHFW'LV

IX. Indicaes de terapia antifngica emprica


No incio do diagnstico da neutropenia febril se antecedentes de doena fngica invasiva
Aps 96hs de persistncia de febre se padro radiolgico pulmonar sugestivo de doena

fngica invasiva.
'HQLomRSDGUmRUDGLROyJLFRSXOPRQDUVXJHVWLYRGH'),
Consolidao, ou leso circunscrita com ou sem sinal do halo, ou sinal
de ar crescente, ou cavidade dentro de uma rea de consolidao.
Neutropenia febril por mais de 7 dias
Escolha de Antifngicos
$QIRWHULFLQD%GHR[LFRODWR
Se clearance > 50 ml/min
Dose: 1 mg/Kg/dia
Administrao: pr-medicao, hidratao e infuso em pelo menos 6 horas
$QIRWHULFLQD%FRPSOH[ROLStGLFR 
Se clearance < 50 ml/min OU
Se reao infusional anfotericina B deoxicolato de difcil controle
'RVHPJ.JGLD
Administrao: pr-medicao se necessrio e infuso em pelo menos 4 horas
Anfotericina B liposomal
6HGLPLQXLomRGRFOHDUDQFHPOPLQHPUHODomRDRFOHDUDQFHTXHLQGLFRX
o uso da Anfot B complexo lipdico OU
Se reao infusional Anfot B complexo lipdico de difcil controle
'RVHPJ.JGLD
Administrao: pr-medicao se necessrio e infuso em pelo menos 4 horas
Pr-medicao: Difenidramina 50 mg ou hidrocortisona 50 mg IV pr-infuso

GDDQIRWHULFLQD
+LGUDWDomRDFULWpULRPpGLFRVXJHVWmRPOGH6)
concomitante administrao da anfotericina.

| 204 |

X. Reavaliaes peridicas do tratamento da NF


Persistncia de febre aps 72h
Repetir exames da Avaliao Diagnstica Inicial
Avaliar Piora Clnica:
Hipotenso ou necessidade de droga vasoativa
,QVXFLrQFLDUHVSLUDWyULDSD2PP+JHP$$RX,27
Admisso em UTI
Coagulao intravascular disseminada
Alterao nvel de conscincia
ICC com alterao no RX de trax e indicao teraputica
Sangramento com indicao de transfuso
Arritmia ou alteraes no ECG com indicao de tratamento
,QVXFLrQFLDUHQDOFRPLQGLFDomRGHLQYHVWLJDomRHWUDWDPHQWR

UHSRVLomRGHXtGRVGLiOLVHRXWURV
2XWUDVFRPSOLFDo}HVLQWHUSUHWDGDVFRPRFOLQLFDPHQWHVLJQLFDWLYD
Se no houver piora clnica, avaliar possibilidade de manuteno do esquema antimicrobiano inicial.
Se piora clnica:
Hospitalizao
Troca do esquema antimicrobiano inicial
%DL[R5LVFRHPXVRGH&LSURR[DFLQR$PR[LFLOLQD&ODYXODQDWR
Piperacilina-tazobactan
Associar Vancomicina SE INDICAO

Riscos Intermedirio ou Alto:


Imipenem
Associar Vancomicina SE INDICAO
Considerar terapia antifngica se padro radiolgico pulmonar sugestivo
de DFI
Persistncia de febre aps 96h
Considerar infeces subsequentes e concomitantes
Persistir monitorizao clnica e coleta de hemocullturas a cada 2 3 dias
CT de seios da face (sem contraste)
Repetir CT de trax a cada 3 dias (sem contraste)
Exames imagem (direcionado para focos suspeitos)
Investir em diagnstico etiolgico (procedimentos invasivos, bipsias)
Hemocultura para fungo
Iniciar terapia antifngica se padro radiolgico pulmonar sugestivo de DFI

IX.Tempo de Tratamento
Situao
$IHEULOVHPIRFRGHQLGR )2, FRP
resposta ao primeiro esquema ATB

Tempo de tratamento
48 horas afebril se ANC > 500 cel/mm3
7 dias afebril se ANC < 500

| 205 |

$IHEULOVHPIRFRGHQLGR )2, FRP


UHVSRVWDDRWUDWDPHQWRPRGLFDGR

Individualizar deciso
Considerar ANC > 500

$IHEULOHFRPIRFRGHQLGR

Tempo de tratamento sugerido para o stio


da infeco

Situao

Tempo tratamento

XVl. Manejo da Dor Oncolgica


Dor moderada a severa muito freqente na histria natural do cncer. Em pacientes
DPEXODWRULDLVPHWDVWiWLFRVFKHJDDVHUUHODWDGDHPDWpGRVSDFLHQWHV>1(QJO-0HG
0DU   @ SRGHQGR DWLQJLU DWp  GH SUHYDOrQFLD HP IDVHV PDLV DYDQoDGDV GH
HYROXomRGDGRHQoD>3DLQ1RY  @(PERUDSUHYDOHQWHDGRUSRGHVHUFRQtrolada em 70 a 100% dos pacientes com medidas farmacolgicas convencionais.
-$0$'HF  

Infeco pele e partes moles

ATB por 7 14 dias

Infeco corrente sangunea

Gramnegativos: 10 14 dias
Gram-positivos: 7 dias
S. aureus: 14 dias + ETE
Candida sp: 2 semanas aps 1 HMC
negativa + ETE

Infeco relacionada a cateter

Retirar cateter se infeco por S. aureus,


Cndida sp, infeco tnel

Pneumonia bacteriana

ATB por 10 21 dias

'LDUUpLDSRUWR[LQD&ORVWULGLXPGLIFLOH

ATB por 10 dias

X. Uso de G-CSF
)LOJUDVWLPDPFJ'SyVTXLPLRWHUDSLD
Indicaes
3UROD[LDVHFXQGiULDDSyVHSLVyGLRGHQHXWURSHQLDIHEULOHQ DGMXYkQFLD
No constituem indicaes de uso de G-CSF:
Doena metasttica: sempre considerar possibilidade de reduo de dose
Neutropenia G3/4 assintomtica
Neutropenia febril na fase aguda
$UWLFLDOPHQWHFRUULJLUXPDQHXWURSHQLDFRPDOJXPDVDPSRODVGH*&6)SDUDSRGHU
administrar a QT

2 FRQWUROH GD GRU p PDLV HFD] FRP WHUDSLD DQWLWXPRUDO FLUXUJLD TXLPLRWHUDSLD HRX
radioterapia). Contudo, estas modalidades de tratamento, ou por no serem aplicveis ou
SRU QmR VHUHP LPHGLDWDPHQWH HFD]HV H[LJHP GR PpGLFR D FDSDFLGDGH GH SURYHU DOtYLR
sintomtico rpido, em geral, utilizando medidas farmacolgicas.
Avaliando a dor. A intensidade da dor no diretamente proporcional ao grau de dano teFLGXDOHXVXDOPHQWHpLQXHQFLDGDSRUIDWRUHVHPRFLRQDLVItVLFRVHHVSLULWXDLVeIXQGDPHQWDO
portanto, uma abordagem holstica na avaliao da dor:
1. Acreditar no relato do paciente:
Dor sempre subjetiva e pessoal.
Na dor crnica sinais adrenrgicos de sofrimento esto comumente ausentes.
Ansiedade e depresso, em geral, exacerbam a percepo da dor e no exageram o seu
UHODWR,GHQWLFDUHWUDWDUHVWDVFRQGLo}HVWHPLPSDFWRQRPDQHMRGDGRU
4XDQWLFDUGDGRU$HVFDODYHUEDOQXPpULFD facilmente compreendida e reproGX]tYHOSHORVSURVVLRQDLVGHVD~GHHSDFLHQWHVVHUYLQGRWDPEpPjVDYDOLDo}HVVHULDGDV
Sendo Zero = nenhuma dor e DEZ = pior dor imaginvel, qual a dor que o Sr.(a) est
sentindo agora de 0 a 10 ?
$QDPQHVHHH[DPHItVLFR para determinar a causa e mecanismo da dor.
O que provoca a dor? Carter da dor (queimao, facada)? Irradiao? Tempo de instalao?
A dor usualmente causada por efeitos diretos do tumor (p. ex.: invaso ssea, compresVmRQHUYRVDLQDPDomR 1mRUDUDPHQWHpSURYRFDGDSRUFRPSOLFDo}HVGRWUDWDPHQWR S
ex.: ps-operatrio, radiodermite, mucosite, neuropatia induzida por QT).
4XDQWRDRPHFDQLVPRDGRUSRGHVHUFODVVLFDGDHP
a) Nociceptiva por estimulao de terminaes nervosas: somtica (dor ssea)
ou visceral (distenso cpsula heptica)
b) Neuroptica por leso nervosa direta: invaso plexo, compresso de raiz
nervosa p.ex..
Tratamento e resposta variam de acordo com o tipo da dor.
Princpios da terapia farmacolgica. A aplicao das Diretrizes da OMS para o manejo
GDGRUWHPVHPRVWUDGRHFD]QRDOtYLRGDGRUHPDWpGRVSDFLHQWHVFRPFkQFHU>3URFHHGLQJVRIWKH6HFRQG,QWHUQDWLRQDO&RQJUHVVRQ3DLQ9ROS@HHPGH
SDFLHQWHVWHUPLQDLV>-3DLQ6\PSWRP0DQDJH  @7HUDSLDIDUPDFROyJLFDGHYH
ser administrada:
1. Pela boca. Conveniente, no-invasiva e custo-efetiva.
2. Pelo relgio. Administrao em intervalos regulares (4-6 horas) com doses extras
para escape episdico prov nvel constante da medicao reduzindo sua recorrncia.

| 206 |

| 207 |

mais fcil prevenir a dor do que remediar a dor j instalada

2 Degrau: Adio de opiide fraco


Em caso de dor persistente, adicionaremos um opiide fraco. Em nosso servio, disponveis:

3. Pela escada. Pacientes podem iniciar em qualquer degrau da escada podendo ascender em degraus at estarem livres da dor.

Dose

)UHTrQFLD

Via

Observaes

Codena

30mg
60mg

6h

VO

GDSRWrQFLDDQDOJpVLFDGDPRUQD
10% da populao no fazem converso
SDUDPRUQD
3RGHDFXPXODUVHQDLQVXFLrQFLDUHQDO

Tramadol

50mg
100mg

68h

VO
EV

GDSRWrQFLDGDPRUQD
Constipao menos freqente, nusea comum
Inibem recaptao de aminas como os tricclicos
Reduz limiar convulsivo
3RGHDFXPXODUVHQDLQVXFLrQFLDUHQDO

Erro comum na prtica diria no reconhecer a dor como severa e insistir na prescrio de
opiides fracos, muitas vezes em doses elevadas e s custas das toxicidades inerentes classe
(nusea, sedao, obstipao). No h diferena inerente entre opiides fracos e fortes.

4. De forma individualizada.
Pacientes com dor severa podem iniciar teraputica com opiides fortes.
A via oral pode no estar disponvel (nvel conscincia, vmitos etc).
Grande variao individual entre doses de um mesmo frmaco
5. Com medicaes Adjuvantes. (mais adiante)
1 Degrau: $QDOJpVLFRVVLPSOHVH$,1(V
Exercem seus efeitos atravs da inibio da cicloxigenases (COX-1 e 2) e sntese de prostaglandinas. Paracetamol parece ter ao central por mecanismo ainda no esclarecido.
Para dor leve, usualmente representam a primeira linha. Mais utilizados em nosso servio:
Frmaco

Dose

)UHTrQFLD

Via

Paracetamol

500mg - 1g

6h

VO

Dipirona

500mg

6h

VO

Diclofenaco

50mg

8h

VO

Naproxeno

250 500mg

8 - 12 h

VO

Celecoxibe

200mg

12 h

VO

Cetoprofeno

100mg

12 h

EV

*Dor decorrente de metstases sseas relativamente resistente opiides. Nesses casos


RXVRGH$,1(VpGHFLVLYRSDUDFRQWUROHXPiOJLFRHFD]DVVLPFRPRHPRXWUDVGRUHVFRP
FRPSRQHQWHLQDPDWyULRLPSRUWDQWH
Ao prescrev-los, sobretudo os AINEs, importante considerar suas potenciais toxicidades:
Histria prvia de hipersensibilidade asma, urticria (pode ser classe dependente)
Toxicidade gastrointestinal - Dispepsia, lcera gstrica e sangramentos.
Em caso de uso prolongado: Omeprazol 20 mg VO 1xd
Em pacientes idosos ou com leses em trato gastrointestinal damos
preferncia ao Celecoxibe (inibidor seletivo COX-2)
Agregao plaquetria. Predisposio sangramento devido interferncia com a sntese de
tromboxane at 2 dias aps suspenso. Utilizar com cautela em pacientes plaquetopnicos
ou com sangramentos ativos.
Nefrotoxicidade. IRA reversvel, nefrite intersticial e predisposio NTA em indivduos
hipovolmicos so alguns aspectos da nefrotoxicidade dos AINES. Cautela em pacientes
com hipertenso, IRC e ICC.

| 208 |

Frmaco

3 Degrau: Adio de opiide forte


Os opiides devem ser largamente utilizados no tratamento da dor, pois so seguros, de
fcil titulao, com vrias vias de administrao disponveis, sendo ativos em todos os tipos
e mecanismos de dor. H um forte preconceito e temor pelas toxicidades e potencial de
GHSHQGrQFLDWDQWRSRUSDUWHGRVSURVVLRQDLVGHVD~GH VREUHWXGRQmRRQFRORJLVWDV TXDQWR
SHORVSDFLHQWHV$OJXQVGRVHVWLJPDVGDPRUQD
$PRUQDYLFLD
2SLyLGHVLQGX]HPWROHUkQFLD GHFUpVFLPRHFiFLDHGXUDomR HGHSHQGrQFLDItVLFD VLQWRmas de abstinncia na suspenso abrupta). Estas so respostas farmacolgicas normais do
organismo. A despeito disso, a progresso de doena a principal causa da necessidade do
DXPHQWRGHGRVH>3DLQ1RY  @
$$GLomR GHSHQGrQFLDSVtTXLFD pUDUtVVLPDHPSDFLHQWHVFRPFkQFHU>$QQ1<$FDG6FL
@&RPSRUWDPHQWRGHSVHXGRDGLomRHPJHUDOpGHFRUUHQWHGHFRQWUROH
iOJLFRLQHFLHQWH
$PRUQDVyGHYHVHUXWLOL]DGDHPSDFLHQWHVWHUPLQDLVHSRGHDFHOHUDUDPRUWH
'HSUHVVmRUHVSLUDWyULDFOLQLFDPHQWHVLJQLFDWLYDpUDUDFRPXVRFRUUHWR(PJHUDOVmR
mais sujeitos os pacientes idosos, virgem de opiides, via parenteral e com DPOC. Tolerncia aos efeitos respiratrios rapidamente desenvolvido.
$PRUQDGHL[DRVSDFLHQWHVDSiWLFRV
Sedao, quando ocorre est restrita aos primeiros dias de tratamento.
Entre os opiides fortes, dispomos:
Frmaco

Apresentao )UHTrQFLD

Via

Observaes

Sulfato de
PRUQD

10mg 30mg

46h

VO, EV, SC

Metabolizada pelo fgado em


M6G e excretada pelo rim
2/3 dos pacientes necessitam
de > 180 mg/dia

Oxicodona

20mg

8 - 12 h

VO

Menos sedao, nusea, delrio


Mais constipao

| 209 |

Metadona

Fentanil

10mg

50mcg/h

8 12 h

72 h

VO

Metabolismo heptico
e excreo fecal
Antagonismo receptor NMDA
dor neuroptica
Meia-vida longa ~ 24 horas

TD

No utilizar em quadros agudos


Incio de ao em 12-24 horas

**Meperidina particularmente perigosa e no deve ser utilizada, uma vez que seu metaEyOLWRQRUPHSHULGLQD GHPHLDYLGDSURORQJDGD WHQGHDVHDFXPXODUQDLQVXFLrQFLDUHQDO
e no uso crnico, alm de seu efeito excitatrio sobre o SNC e elevado potencial para
dependncia.
0RUQDGHYHVHURRSLyLGHLQLFLDOGHHVFROKD devido meia-vida rpida, fcil titulao

e custo-efetividade.
0RUQDPJ92K DQDOJpVLFRVDGMXYDQWHV pXPUHJLPHLQLFLDODFHLWiYHO
Calcular dose de resgate para casos de escape lgico ou dor dependente da atividade. Em

geral, 50 a 100% da dose regular, com uma droga de meia-vida curta e ao rpida respeitanGRXPLQWHUYDORPtQLPRGHKRUDVSHORPHQRV(PQRVVRFDVR0RUQDPJ92VHGRU
inicialmente.
$GRVHWRWDOXWLOL]DGDQDVKRUDV KRUiULRV[RVGRVHVGHUHVJDWH GHYHUiVHUXWLOL]DGD

como base nos clculos de converso para outros opiides com meia-vida mais longa e posoORJLDPDLVFRQYHQLHQWHXPDYH]GHQLGDVHHVWiYHLVDVQHFHVVLGDGHVDQDOJpVLFDVGLiULDV
No h virtualmente dose mxima de qualquer frmaco opiide.

Efeitos colaterais:

Devem ser antecipados e manejados adequadamente para garantir aderncia ao tratamento. H


uma grande variabilidade interindividual na sensibilidade aos efeitos adversos dos opiides.
1iXVHDVY{PLWRV Envolve trs mecanismos: ativao zona quimioreceptora, retardo
esvaziamento gstrico e maior sensibilidade vestibular.
Vmitos ps-alimentares - Metoclopramida 10 mg VO 6/6h.
Associadas com movimento - Dimenidrato 100mg VO 8/8 h
Corticides, fenotiazinas e benzodiazepnicos podem ser teis em alguns casos
Tolerncia usualmente se desenvolve rapidamente
2. Constipao. Efeito colateral mais comum.
A mo que prescreve o opiide a mesma que prescreve o laxante
Utilizados em nosso servio: Lactulose 20-30ml VO 3-4xd ou leo mineral 10 ml 4xd
e/ou Bisacodil 10mg VO noite esporadicamente.
4. Tontura e confuso. Particularmente em idosos - atentar para diagnsticos diferenciais.
Haloperidol 2.5 mg VO pode ser utilizado excluindo-se causas orgnicas para o delirium.
Sedao, quando ocorre est restrita aos primeiros dias de tratamento. Se persistir, a troca
para uma dose equi-analgsica de outro opiide est indicada.
5. Depresso respiratria.&OLQLFDPHQWHVLJQLFDWLYDpUDUDFRPXVRFRUUHWR(PJHUDOVmR
mais sujeitos os pacientes idosos, virgem de opiides, via parenteral e portadores de DPOC.
Tolerncia aos efeitos respiratrios rapidamente desenvolvido. Naloxone 0.2 0.4mg EV
em caso de emergncia.

| 210 |

6. Prurido. Liberao direta de histamina. Observado em 2 a 10% dos pacientes. Anti-histamnicos como Hidroxizine 25mg VO 8/8 h podem ser utilizados.
0LRFO{QXVHKLSHUDOJHVLD so de ocorrncia rara e podem ser observados em doses
elevadas de opiies. Benzodiazepnicos e anticonvulsivantes podem ser teis.
Em todos os casos, com a estratgia de substituio por outro agente pode alcanar um
balano mais favorvel entre analgesia e efeitos colaterais (rotao de opiides).

Rotao de opiides:

VXEVWLWXLomRGHXPRSLyLGHSRURXWURTXDQGRDWR[LFLGDGHRXEDL[DHFiFLDVHHVWDEHlecem. Esta estratgia se baseia na grande variabilidade interindividual da sensiblidade aos


efeitos dos diferentes opiides.
Diretrizes para converso de dose:>-&29RO1R 0D\ SSVV@
1. Calcule a dose equianalgsica utilizada em 24 horas.
2. Ao trocar para Metadona, reduza a dose equianalgsica em 75% a 90%.
PJ0RUQD92GLD  LHPJPHWDGRQH PJPRUQD 
DPJGLDGH0RUQD92H!PGLD UDWLRVGHH
>-&OLQ2QFRO-XQ  @

3. Para Fentanil transdrmico, no reduza a dose.


4. Ao trocar para qualquer opiide que no fentanil ou metadona, diminua a dose equianalgsica em 25% a 50%.
5.Considere ainda nas alteraes da dose equianalgsica as comorbidades e a severidade da dor:
(PLGRVRVKHSDWRSDWDVRXFRPLQVXFLrQFLDUHQDOFRQVLGHUHUHGXo}HVPDLRUHV
Em paciente com dor intensa, considere redues menores.
6. Calcule a dose de resgate como 5 a 15% da dose total diria de opiide e administre em
intervalo apropriado.
7. Reavalie e titule a dose do novo opiide.
&RQYHUVmRSDUD)HQWDQLOWUDQVGpUPLFR
0RUQD
oral / 24 h

'RVH(TXLYDOHQWH)HQWDQLO
(cada 72 horas)

90mg

25 mcg/h (Fentanil 25 patch)

180mg

50 mcg/h (Fentanil 50 patch)

270mg

75 mcg/h (Fentanil 75 patch)

360mg

100 mcg/h (Fentanil 100 patch)

| 211 |

&RQYHUVmR(TXLDQDOJpVLFD
Droga

Dose

Via

0RUQD

30mg

oral

0RUQD
parenteral

10mg

SC, EV

Metadona

10mg

oral

Oxicodona

20mg

oral

Converso para )HQWDQLOWUDQVGpUPLFR


Reservado para pacientes que no podem utilizar via oral.
Dor controlada e estvel com medicaes orais, porm efeitos colaterais no manejveis
GRUQmRFRQWURODGDFRPPRUQDQmRVHUiUHVROYLGDSHODFRQYHUVmRDXPDGRVHHTXLYDOHQte de Fentanil TD.
Importante prover doses de resgate com opiide de ao rpida.
No aumente a dose do patch com intervalo menor que 72 h.
Mantenha opiide anteriormente utilizado por at 12 a 24 h aps aplicao do patch.

Medicaes adjuvantes:

Analgsicos adjuvantes (anticonvulsivantes, antidepressivos, p.ex.) so utilizados pelo seu efeito poupador de opiide, diminuindo efeitos colaterais e tolerncia aos opiides. Tm papel
importante no tratamento da dor neuroptica.
1. Antidepressivos tricclicos. So mais utilizados em nossa prtica.
Mecanismo de ao analgsica: aumento da concentrao de monoaminas no corno
dorsal da medula, causando estimulao de receptores alfa-2.
Dor neuroptica a principal indicao
Amitriptilina 25mg a 75mg VO noite, sobretudo quando sedao efeito desejvel.
Nortriptilina menos sedativa.
Ao independente de ao anti-depressiva.
Se depresso for diagnosticada, preferimos inibidores de recaptao de serotonina como
Fluoxetina 20-40mg/dia ou Setralina 50-100mg/dia.
2. Anticonvulsivantes.3DUWLFXODUPHQWHHFD]HVQDGRUQHXURSiWLFDODQFLQDQWH
Carbamazepina 100 mg VO 12/12 h com aumentos graduais atentando para sedao,
vertigem e, eventualmente, reaes cutneas.
GabapentinaPJ92K DWpPJGLD pRSomRFRPERPSHUOGHWROHUkQFLD
3. Corticides.6HPSUHTXHKiLQDPDomRRXGRUSRUHGHPDYDVRJrQLFR PHWiVWDVHVFHUHEUDLV
com hipertenso intracraniana, compresses mielorradiculares, distenso cpsula heptica).
'H[DPHWDVRQD 4 a 8 mg/dia VO. Efeitos adversos comuns aos cortioesterides.
2VXFHVVRQRDOtYLRGDGRUUHTXHUDYDOLDomRFULWHULRVDGDGRUHREVHUYDomRGRV
princpios da terapia farmacolgica descritos.

| 212 |