Você está na página 1de 186

Patologia Molecular

PosPat

Introdução
à

Imunologia
Lucas Brandão
O QUE É A IMUNOLOGIA ?
O QUE É A IMUNOLOGIA ?

Estudo do Imuno

latim immunis (Senado romano)


O que é a Imunologia?

Definição:
É o estudo do sistema imune (SI) e dos mecanismos que
os seres humanos e outros organismos usam para
defender seus corpos da invasão de microorganimos
células estranhas ou anômalas

Imunidade

Resistência a infecções

5
Dois pontos:

• Sistema imune:
• Formado por órgãos, tecidos, células e
moléculas.

• Resposta imune:
• É a reação coordenada dos componentes do
S.I.

6
Resposta imune Inata Resposta imune específica
Sistema de Defesa dos Animais

• Defesa Inata:
• pele, uma barreira muito
eficiente contra
patógenos

• Defesa Específica:
• proteínas (anticorpos)
capazes de reconhecer,
ligar-se e destruir o
patógeno
Características da Imunidade

• Imunidade inata = natural ou nativa


• Defesa presente em indivíduos, desde o
nascimento e preparada para bloquear a entrada
de micróbios e eliminar micróbios que têm
sucesso entrando em tecidos.

• Imunidade adaptável = específica ou adquirida


• Defesa estimulada por micróbios que invadem
tecidos, i.e., adapta à presença de invasores
microbianos.

9
Características da Imunidade

• Imunidade do hospedeiro
• Defesa inata e adaptativa
• Inata
• Proteção inicial contra infecções
• Mais rápida
• Adaptiva
• Adaptável
• Mais lenta

10
SISTEMA IMUNE

É uma questão
de tempo
SISTEMA IMUNE

É um trabalho
de equipe
Componentes e processos
da Imunidade Inata

• Barreiras Físicas e Químicas


• Barreira Fagocítica
• Barreira Inflamatória
• Sistema do Complemento
BARREIRAS FÍSICOS E
QUÍMICAS
BARREIRAS FÍSICAS E QUÍMICAS
BARREIRAS NATURAIS

Pele intacta Queratina presente no estrato córneo

Secreção de
pH ácido
suor e outros

Lágrimas, saliva Expulsão mecânica, ação lítico (lisozima)

Encapsulamento de microrganismos e
Muco
mascaramento dos receptores

Os cilios A expulsão de muco e microorganismos

Flora bacteriana Competição de nutrientes e secreção de


saprofita substâncias antimicrobianas

Peptídeos
Matar microorganismos
antibióticos
IMUNIDADE INATA

celulas
células dendriticas
“de alerta”
e APC

moléculas de
fagocitos reconhecimento padrão
MBL, PCR, (PRMs)
LBP

celulas
“killer” Defensinas peptídeos
LL37
Istatina ante-microbianos
epcidina

Sistema
do complemento Enzimas e
proteinas ante-microbianos
FATORES SOLÚVEIS

Proteínas antimicrobianas
Imunidade inata
Peptídeos antimicrobianos (AMPs)
- Fatores solúveis
Moléculas de reconhecimento padrão (PRMs)
- Células Sistema do complemento

Defensinas, catelicidina,
epcidina, istatina
Lisozima, lattoferrina

MBL, PCR, SAA


C1, C2, C3, C4, C5, MAC
PROTEINAS ANTIMICROBIANAS
- Fatores solúveis

Lisozima (LYZ)
Enzima de 14 kDa

Atividade

- idrolise do peptidoglicano ---> lise de Gram+ (Streptococci)

-liga a superficie de bacterios ---> facilita fagocitose

---> impede adesao


PROTEINAS ANTIMICROBIANAS

Lactoferrina (LF)

Proteina globular (80KDa) da familia da transferrina

Atividade
- liga o Fe ---> competição hospede/patogeno
- liga receptores microbianos e lipoperoxida---> lise
- liga receptores para vírus e vírus direitamente
- liga DNA e RNA
PEPTÍDEOS ANTIMICROBIANOS

Defensinas
Peptideos cationicos de 3-5 KDa
- α-defensinas (hNPs)

- β-defensinas (hBDs)

Atividade
- microbicida
- anti-viral
- quimiotática

α-defensins (hNPs)

β-defensins (hBDs)
PEPTÍDEOS ANTIMICROBIANOS
PEPTÍDEOS ANTIMICROBIANOS
PEPTÍDEOS ANTIMICROBIANOS

Catelicidina/LL37 (CAMP)
Peptideo cationico

Cathelicidin (LL-37)
[LL-37, 37 aa]
Atividade
- microbicida
- quimiotática
PEPTÍDEOS ANTIMICROBIANOS
PEPTÍDEOS ANTIMICROBIANOS

respiratorio
AMPs e doenças

intestino

genito-urinario

pele
Barreira Fagocítica

28
SISTEMA IMUNE

- “self” e “not self” È uma questão


- açúcar, padrões de reconhecimento
moleculares, proteínas

- solúveis
- celulares

- ação direita (lise) ANTÍGENO


MAC

- opsonização
CÉLULA
ALVO

- fagocitose Atividade
citotóxica
Padrões microbianos e seus receptores
Receptores Reconhecedores
de Padrões de Patógenos
• Toll Like Receptor (TLR)
• Receptor de Manose
• Scavenger
• NLR
• ...

Produção de novas moléculas


Papel Liberação de moléculas estocadas
Fagocitose
RECEPTORES DE RECONHECIMENTO
DE PATÓGENOS (PRRs)
Célula sinalizando
uma via envolvida
na estimulação do
receptor,
estimulando uma
resposta de defsa.
Scavenger
• Muito expressos pelos macrofágos
• Participam no reconhecimento de ligantes específicos geralmente
de origem exógena
• Atuam na:
– Imunidade Inata
– Limpeza dos Corpos Apoptóticos
– Patologias degenerativas (arterosclerose e Alzheimer)
– Obesidade e doenças cardiovasculares - reduzem o acúmulo de
colesterol (aderido na parede)

36
Classes do SR
TLR
• Domínios
– LRR (rico Leucinas)
– TM (transmembranico)
– TIR (Domínio Toll)

Capacidade de ligar: lipopolisacarídeos, lipoproteínas, ácidos nucleicos


42
Toll-Like Receptors (TLRs)
Toll-Like Receptors (TLRs)
Toll-Like Receptors (TLRs)
NOD-like Receptors (NLRs)
NOD-like Receptors (NLRs)
NOD-like Receptors (NLRs)
Collectin-like Receptors (CLRs)

Functions of membrane bound lectins


produced by dendritic cells and
Langerhans cells:

- MMR, DEC-205 (CD205), and Dectin-2:


Antigen Uptake, DC trafficking.
- Dectin-1 and DC-SIGN (CD209):
T-cell interaction, DC trafficking.
Collectin-like Receptors (CLRs)
Barreira Inflamatória
TEREMOS UMA AULA
SÓ PARA ESSE TÓPICO
SISTEMA
COMPLEMENTO
SISTEMA COMPLEMENTO
 Composto de aproximadamente 30 proteínas instáveis,
sensíveis ao aquecimento e estão presentes no soro na forma
inativa

 Início de síntese no primeiro trimestre da vida fetal

 Produzidas no fígado e por macrófagos

 Há 3 maneiras para ocorrer ativação:


– Via Clássica - depende de Ac
– Via Alternativa
– Via Lectina
SISTEMA COMPLEMENTO
NOMENCLATURA
• Moléculas precursoras:

• Via clássica C (1-9)

• Via Alternativa - e B, D, P

• Fragmentos: letras a, b

• Componente inativado: prefixo i (iC3b)

• Produto ativo: barra em cima da sigla


SISTEMA COMPLEMENTO
SISTEMA COMPLEMENTO
VIA CLÁSSICA
VIA CLÁSSICA

• É ativada por uma interação (Ag-Ac).

• A ligação Ag-Ac provoca uma mudança conformacional no

Ac, que abre um sítio de ligação para C1.

C1 é a união de 6
• C1: 6 moléculas C1q, 2 C1s, 2 C1r
moléculas
3 tipos de
subunidades:
C1 C1q, (2) C1r e (2) C1s
do
ul a
c
olé
M
VIA CLÁSSICA
• É ativada por uma interação (Ag-Ac).

• A ligação Ag-Ac provoca uma mudança conformacional no

Ac, que abre um sítio de ligação para C1.

• C1: 6 moléculas C1q, 2 C1s, 2 C1r

• C1 liga-se a 1 IgM ou 2 IgG Formação do 1˚


complexo!!!!
SISTEMA COMPLEMENTO
VIA CLÁSSICA

IgM

IgG
SISTEMA COMPLEMENTO
VIA CLÁSSICA

Ordem de ativacao: C1q – C1r – C1s


Cascata de Ativação
C1 quebrando c4 em c4b
C4b se liga a C2 e se transforma em C4b2a (C3 convertase
COMPLEXO DE ATAQUE À
MEMBRANA (MAC)
AS MOLÉCULAS DA VIA
CLÁSSICA PODEM APRESENTAR
OUTRAS FUNÇÕES
SISTEMA COMPLEMENTO
VIA CLÁSSICA
VIA ALTERNATIVA
VIA ALTERNATIVA
Independe de
• Não há formação do complexo Ag-Ac. Anticorpo
• Pode ser ativada pelas C3b ou C3.H2O, ou por alguns tipos
de parede celular.

• Ativação:
- C3 se transforma em C3b

- Fator D (equivalente ao C1s)

- Fator B (equivalente ao C2)

- C2b ou C3.H2O (equivalente ao C4b)

- Properdina ou fator P (estabiliza a C3 convertase)


Cascata de Ativação
1˚- C3 é convertido em C3b
2˚ - C3b se liga ao Fator B
3˚ - Fator D quebra o Fator B.C3b
4˚ -Produzindo C3bBb (C3 convertase)
SISTEMA COMPLEMENTO
VIA ALTERNATIVA
VIA DA LECTINA
VIA DA LECTINA
Similar à via clássica.
MBL (lectina que se ligada à manose).
Liga-se à resíduos de carboidratos na superfície de
bactérias e passa por uma mudança conformacional.
Semelhante à C1q (é capaz de ativar a via clássica na
ausência de C1q).
MASP1: cliva C4 e C2 = C4b2a.
MASP2: cliva C3 diretamente.
Via da Lectina
SISTEMA COMPLEMENTO
EFEITOS
SISTEMA COMPLEMENTO
CONSEQÜÊNCIAS

• Opsonização:

- C3b é uma importante opsonina.

- Reveste o microrganismo e se liga aos receptores(CR1-4) nos macrófagos e neutrófilo

• Recrutamento celular e ativação:

- C4a, C3a, C5a (anafilotoxinas-desgrunalização)

- C3a, C5a (quimiotáticos)

• Lise Celular (bactérias, vírus envelopados)


Efeitos Biológicos de C5a
OPSONISAÇÃO
SISTEMA COMPLEMENTO
CONSEQÜÊNCIAS
RECRUTAMENTO
Via Lítica

LISE
Componentes do MAC

C7
C6

C5

C8
C
9
Via Lítica-MAC
Ativação de C5

C5a

b
C5

C4b b C3b
C2
Via Lítica-MAC
Formação do complexo lítico

C6

C7 b
C5
Via Lítica-MAC
inserção do complexo lítico na membrana
celular

C6

C7 b
C8
C C C5
C C
C9 9 9 9C
C C C
9 9
9 9 9
Imunidade Adaptativa

• Sistema Humoral
• Produção de Anticorpos

• Sistema Celular
• Produção de células efetoras
A Resposta Existem dois tipos de
Imune resposta imune adaptativa:

Quatro peculiaridades
caracterizam a resposta imune:

1. Especificidade,
2. Habilidade em responder a uma grande
variedade de antígenos,
3. Habilidade de distinguir próprio de não-
próprio, e
4. Memória.

• A resposta imune é direcionada contra


antígenos que escapam das defesas
inespecíficas.
• Cada anticorpo ou células T é
direcionado contra um determinante
antigênico.
• Existem dois tipos de resposta imune adaptativa:
– a resposta imune humoral e
– a resposta imune celular.
• A resposta imune humoral emprega anticorpos
secretados pelas células B para combater os
antígenos nos fluidos corporais.
• A resposta imune celular emprega células T para
atacar células corporais previamente alteradas por
infecções virais ou mutações, ou combater antígenos
que invadiram as células.
RESPOSTA IMUNE HUMORAL
A Resposta Imune
Humoral
• Células B ativadas
sintetizam e secretam
anticorpos específicos.

• A unidade básica de um
anticorpo, ou
imunoglobulina, é um
tetrâmero: duas cadeias
leves idênticas e duas
cadeias pesadas também
idênticas, cada uma
consistindo em uma região
conservada e outra variável.
• As regiões variáveis das cadeias leves e pesadas colaboram para
formar o sítio ligador entre o antígeno e o anticorpo específico.
Cada antígeno geralmente tem diferentes determinantes
antigênicos (sítios de ligação para anticorpos específicos). As
regiões variáveis determinam a especificidade de cada anticorpo
por um determinante. A região constante determina o destino e
função do anticorpo.
• Existem cinco classes de imunoglobulinas. A IgM, primeira a ser
formada, é um receptor de membranas células B, assim como a IgD. IgG
é a classe de anticorpo mais abundante e desempenham muitas funções
de defesa. A IgE participa na inflamação e reações alérgicas. IgA está
presente in vários secreções corporais.
• Anticorpos
Monoclonais
consistem em
moléculas de
imunoglobulinas
idênticas
direcionadas contra
um único
determinante
antigênico.
RESPOSTA IMUNE CELULAR
A Resposta Imune Celular

• Receptor de célula T

• A resposta imune celular é


direcionada contra células
alteradas ou infectadas.

• As células TC atacam células


infectadas por vírus ou tumorais,
promovendo a lise dessas
células.

• As células TH ativam as células B


e influenciam no desenvolvimento
de outras células T e macrófagos.
Os receptores de células T, na
resposta imune celular, são
análogos das imunoglobulinas na
• O complexo de
histocompatibilida
de principal (MHC)
codifica muitas
proteínas de
membrana.

• As moléculas do
MHC nos
macrófagos,
células B, ou
células corporais,
ligam-se aos
antígenos e
apresentam-nos às
células T.
• Na resposta imune celular,
as moléculas do MHC classe
I, células TC,CD8, e citocinas
colaboram na ativação das
células TC com a
especificidade apropriada.

• Células T em
desenvolvimento são
submetidas a dois testes:
Elas tem que ser capazes de
reconhecer suas moléculas
MHC, e não devem se ligar
ao mesmo tempo às
moléculas do MHC e aos
antígenos do próprio corpo
As células T que falharem a
esses testes, morrem.

• A rejeição a transplantes de
órgãos resultam de
diversidades genéticas das
moléculas do MHC.
RESPOSTA RESPOSTA
HUMORAL CELULAR
Parte Genética

Anticorpo
Receptor de Cel. T
MCH
Loci dos anticorpos, receptores de células T
e MHC

• Linha germinativa
• Somática

• De acordo com a teoria da linha germinativa, cada anticorpo é codificado por um


gene herdado, não sendo modificado durante o desenvolvimento somático e por
isso, precisa haver um grande número de genes codificadores de anticorpos.
• De acordo com a teoria somática existem apenas um pequeno número de genes
codificadores de anticorpos, mas apresentando bastante diversidade nas células
somáticas devido a mutações e/ou recombinações.
Teoria Somática

Número limitado de genes Diferentes arranjos Milhares de Anticorpos


• Atualmente, é conhecido o número de
segmentos de genes codificadores de
anticorpos em humanos. Sabe-se
detalhadamente como estes segmentos
são somaticamente modificados por
recombinação e mutação e qual é a
contribuição desses genes e processos
somáticos para a especificidade e afinidade
das respostas dos anticorpos.

• Sabe-se também que certas estratégias


utilizam tanto os genes codificadores de
anticorpos, quanto os que codificam os
receptores de células T (recombinação
gênica), outras utilizam os genes
codificadores de anticorpos mas não os de
receptores de células T (hipermodulação
gênica) e que a estratégia fundamentada
na habilidade das proteínas do MHC de
interagirem com diferentes antígenos é
o polimorfismo gênico. Desse modo, a
genética do sistema imune tem sido
revelada nesses últimos anos.
ANTICORPO
Base Genética da Diversidade dos
Anticorpos

• Os supergenes da cadeia pesada das Imunoglobulinas são


construídos a partir de cada um dos inúmeros segmentos V, D,J e
C. Os segmentos V,D e J combinam-se por rearranjos do DNA, e a
transcrição produz uma molécula de RNA que é processada para
formar um mRNA traduzível. Outra família de genes dão origem
às cadeias leves.
Como resultado desses rearranjos do DNA, existem
milhões de possíveis anticorpos. Rearranjos imprecisos
de DNA, mutações e adições aleatórias de bases no fim
do DNA contribuem para uma maior diversidade.
• Mudança de
classe após
produção inicial
de imunoglobulina
resulta em
anticorpos com a
mesma
especificidade ao
antígeno, mas
com uma função
diferente. Isso é
realizado por
cortes e rearranjos
dos genes que
codificam a região
constante.
A localização cromossômica dos genes dos
anticorpos, de receptores de células T e do
MHC em humanos
RECEPTOR DE CÉLULA T
Evidências de recombinações somáticas
(rearranjos) dos anticorpos e os genes TCR
• A hipótese que os genes dos anticorpos
resultantes da “fusão” de dois genes diferentes
(um gene V e um gene C) foi postulada em 1965
por W Dreyer e J Bennett. Esta hipótese propõe
uma explicação sobre os dados da seqüência da
proteína que se acumularem ao longo do tempo e
sobre as observações sorológicas e genéticas,
indicando que o mesmo idiotipo pode ser
encontrado em associação em diferentes isotipos.
• A “dois genes – um polipeptídico”, hipótese
comprovada nos anos 70 por N Hozumi, que
demonstrou que as sondas para as cadeias leves
C ou C+V do mRNA hibridizam com diferentes
fragmentos de restrição de DNA genômico
embrionário mas hibridizam com o mesmo
fragmento de restrição de DNA de mielomas. Este
experimento confirmou que um processo de
rearranjo somático ocorreu na célula produtora de
anticorpos.
Os loci dos receptores de Células T (TCR)
a/d,b e g
• Embora existam quatro tipos de cadeias de receptores de células T (a, b, g e d), e
existem apenas três loci porque o locus “d” é interdispersado em um locus “a”. O locus
humano a-d é complexo e incluem 54 segmentos do gene Va, dos quais 45 são
funcionais. O locus também contém um notável número (61) de segmentos Ja, dos
quais a maioria é funcional.O locus humano “b” foi o prmeiro a ser descoberto ao ser
totalmente mapeado e seqüenciado. Esse locus mede ~0.6 Mb e contém 62-65 genes
V, dos quais 39-41 são funcionais. O locus humano “g’ é muito mais simples, medindo
~ 0.1 Mb e contendo 12-15 genes V, dos quais 4 -6 são funcionais.
Complexo de Histocompatibilidade Principal

MHC
• MHC desempenha um papel essencial na resposta imune: permite
os Linfócitos T reconhecerem o antígeno.
• MHC trabalha junto com TCR e influencia o repertório dos
antígenos T capazes de reconhecer o antígeno.
• Essa é a razão porque o complexo MHC desempenha um papel
fundamental na susceptibilidade a muitas doenças complexas e
auto-imunidade.
Estrutura MHC I
• Expressa na superfície celular

• Reconhecida por TCR de linfócitos


T CD8 (citotóxicos)
• CD8 liga o complexo peptídeo-MHC
I
• MHC I são requisitados para
reconhecimento de antígenos
endógenos (via citosólica)
• Constituído por duas cadeias: a
alfa codificada por genes MHC e a
microglobulina beta, codificada por
um gene externo ao cluster MHC
• A cadeia alfa possui 3 domínios
externos, 1 transmembrânico,
juntos com o alfa 3 ligam as
moléculas à membrana e a uma
cauda citoplasmática
Estrutura MHC II
• MHC II são heterodímeros
constituídos de duas cadeias alfa e
duas beta, ambas codificadas por
genes do cluster MHC.
• Ambas as cadeias apresentam dois
domínios extracelulares e uma
cauda citoplasmática.
Estrutura MHC III
• As proteínas codificadas pelo MHC III não são receptores de
membrana e não estão envolvidos na apresentação de antígenos
• Foi proposto que as alterações das proteínas do MHC III estão
envolvidas em doenças auto-imunes.
• As proteínas do MHC III têm funções e seqüências diferentes:
algumas delas são proteínas do complemento, outras são
enzimas (i.e. 21- hidrolase), citocinas inflamatórias, fator de
necrose tumoral e proteínas “heat hock”.
Localização das proteínas do
MHC
O locus MHC

• O locus humano MHC mede aproximadamente 4 Mb no braço curto do


cromossomo 6 (6p21). Este locus compreende três regiões: um grupo com
aproximadamente 20 genes classe I (telomérico), um grupo com
aproximadamente 15 genes classe II (centromérico), e um grupo
heterogêneo com aproximadamente 30 genes classe III localizados entre
os cluster classes I e II.
Genes MHC I e MHC II
Locus MHC
• 421 loci, 252 deles são classificados como genes expressos
PRINCIPAIS CARACTERÍSTICAS
DO LOCUS DO MHC

• MULTIGÊNICO: muitos genes codificadores de diferentes


moléculas classes I e II, cada uma com diferentes
especificidades por vários peptídeos.
• POLIMORFISMOS ALÉLICOS: um grande número de
alelos estão presentes em cada gene.
• CODOMINANTE: produtos de ambos os alelos de cada
gene são produzidos.
• A região classe III é rica em genes (um gene a cada 15 kb)
e incluem genes de fatores do complemento (C2, C4 e fator
B), a proteína “heat shock” HSP70 e os genes de TNF-alfa
e beta

• Existem três produtos polimórficos de genes classe I


(definido em humanos como HLA-A, HLA-B e HLA-C)
envolvidos na apresentação de antígenos para as células
T citotóxicas. Entre os outro genes classe I existem alguns
pseudo-genes, contudo também são funcionais.

• A função desses outros genes necessita ser investigada.


Eles são menos polimórficos que os genes A, B e C, e dois
são expressos de forma tecido-específica. Em ratos, no
mínimo um gene está envolvido na apresentação de
peptídeos bacterianos formil-metionil para as células do
• Existem três produtos polimórficos de genes classe II
(HLA-DR, HLA-DQ e HLA-DP) e muitos
pseudogenes classe II (por exemplo os genes DPA2
e DPB2)
• A base molecular dos polimorfismos gênicos classes I e II
consiste na substituição de aminoácidos e no fato de que a
maioria dos alelos estão presentes na população em
freqüências significantes. Isto argumenta contra mutações
neutras e sugere seleção sobredominante (vantagem do
heterozigoto) ou seleção dependente da freqüência.
• A sugestão feita por H Zinkernagel e P Doherty, que diz que o
polimorfismo é mantido por vírus, é plausível. Recombinação
dentro do locus ocorrem em sítios determinados.
• Isto lida com o desequilíbrio do linkage (i.e. A ocorrência de
alelos de dois genes juntos em uma freqüência maior que a
freqüência esperada de um único alelo; os loci são, portanto,
classificados como em desequilíbrio de linkage )
Polimorfismos alélicos do MHC em
cada gene: possibilidade de
recombinação
A localização cromossômica dos genes dos
anticorpos, de receptores de células T e do
MHC em humanos
Componentes do
Sistema Imune
ANATOMIA DO SISTEMA IMUNE
• Órgãos
• Tecidos
• Células
• Proteínas
Nos linfonodos, os fluídos
são filtrados e as cél.
Brancas maturadas • Muitas das nossas
Ductos linfáticos conduz a defesas são
implementadas por
linfa

As cél. T maturam-se no
Timo células e proteínas
transportadas na
corrente sanguínea e
Linfócitos acumulam-se e
maturam-se no baço
no sistema linfático.

Cél. B maturam-se na
Medula óssea
Células do Sistema Imune são
produzidas/maturadas pelos tecidos
Linfóides:
- Linfonodos
- Baço
- Tonsilas
- Timo

E também pela medula óssea


Origem HEMATOPOIESE
MEDULA ÓSSEA
LEUCÓCITOS
[LEUC(O)-BRANCO + CYTO-CÉLULA]
>
Valores
totais
5.000
a
10.000/µL <

Leucopenia Leucocitose
Resposta
de
fase
aguda
Existem duas classes de leucócitos

Granulados

Agranulados
LINFÓCITO


NEUTRÓFILO EOSINÓFILO PLASMÓCITO

MONÓCITO












BASÓFILO


GRANULÓCITOS

MONONUCLEARES
POLIMORFONUCLEARES
NEUTRÓFILO EOSINÓFILO












BASÓFILO


GRANULÓCITOS
POLIMORFONUCLEARES
Neutrófilos respondem rapidamente a
inflamação, movendo-se do sangue para o
tecido inflamado, onde realizam a fagocitose
de debris celulares e patógenos. Neutrófilos
também fagocitam patógenos opsonizados
por anticorpos

Eosinófilos migram do sangue para outros


tecidos e matam parasitas opsonizados por
anticorpos

Juntamente com os mastócitos, os basófilos


liberam histamina, que apresentam
importante papel na resposta inflamatória e
alérgica. Basófilos também promovem o
desenvolvimento das células T.
LINFÓCITO


PLASMÓCITO

MONÓCITO

MONONUCLEARES
Monócitos circulam na corrente sanguínea,
migram para outros tecidos e diferenciam-
se em macrofágos

Macrófagos estão localizados numa


variedade de tecidos do corpo. Eles são
células fagocíticas que engolfam e digerem
microorganismos. Eles também ativam
células T através da liberação de citocinas.

Células dendríticas estão localizados numa


variedade de tecidos do corpo. Eles são
potentes células apresentadoras de
antígenos que apresentam antígenos às
células T.
Macrófago + pseudopodes
• O complexo de
histocompatibilida
de principal (MHC)
codifica muitas
proteínas de
membrana.

• As moléculas do
MHC nos
macrófagos,
células B, ou
células corporais,
ligam-se aos
antígenos e
apresentam-nos às
células T.
Os Linfócitos

– Reconhecimento do próprio x não


próprio (self x non-self)
– Reconhecimento celular
– Organização gênica

175
• As células brancas do sangue, incluindo os linfócitos (células B e T) e
fagócitos (tais como neutrófilos e macrófagos), desempenham muitos
papéis de defesa

As cél. B diferenciam-se para formar as cél


plasmáticas que secretam anticorpos; e cél.
de memória promovem imunidade as
futuras Infecções por patógenos familiares.
Cél. B perfazem 10-20% dos linfócitos.
Linfócitos perfazem 15-50% das cél.
brancas.

As cél. T auxiliares (também chamadas de


Th ou CD4+) atuam tanto no sistema imune
humoral e celular pela secreção de citocinas.
Cél T citotóxicas (também chamadas de Tc
Ou CD8+) reconhecem e matam cél. Infectadas
por vírus e outras cél próprias alteradas.
Cél. T perfazem 68-75% dos linfócitos

Cél. Natural killers atacam e lisa as cél.


Infectadas por vírus e cancerosas do corpo.

Cél. Natural killers perfazem 5-10% dos


linfócitos no sangue.
Imunoglobulina

IgA= predominante nas lágrimas, leite materno (secreções);

IgG= imunidade a longo prazo, ela atravessa a placenta da mãe;

IgM= é a primeira a ser produzida em resposta a um antígeno;

IgE= envolvida nas reações alérgicas e atividades parasitarias.


• As regiões variáveis das cadeias leves e pesadas colaboram para
formar o sítio ligador entre o antígeno e o anticorpo específico.
Cada antígeno geralmente tem diferentes determinantes
antigênicos (sítios de ligação para anticorpos específicos). As
regiões variáveis determinam a especificidade de cada anticorpo
por um determinante. A região constante determina o destino e
função do anticorpo.
• Existem cinco classes de imunoglobulinas. A IgM, primeira a ser
formada, é um receptor de membranas células B, assim como a IgD. IgG
é a classe de anticorpo mais abundante e desempenham muitas funções
de defesa. A IgE participa na inflamação e reações alérgicas. IgA está
presente in vários secreções corporais.
• Na resposta imune celular,
as moléculas do MHC classe
I, células TC,CD8, e citocinas
colaboram na ativação das
células TC com a
especificidade apropriada.

• Células T em
desenvolvimento são
submetidas a dois testes:
Elas tem que ser capazes de
reconhecer suas moléculas
MHC, e não devem se ligar
ao mesmo tempo às
moléculas do MHC e aos
antígenos do próprio corpo
As células T que falharem a
esses testes, morrem.

• A rejeição a transplantes de
órgãos resultam de
diversidades genéticas das
moléculas do MHC.
RESPOSTA RESPOSTA
HUMORAL CELULAR