Você está na página 1de 306

Dissertao de Mestrado apresentada ao Programa de

PsGraduao em Design da Faculdade de Arquitetura,


Artes e Comunicao da Universidade Estadual Paulista
Jlio de Mesquita Filho Campus de Bauru, como
requisitoparaaobtenodottulodeMestreemDesign.
TrabalhodesenvolvidocomapoiodaCAPES.
Orientadora:Prof.Dr.PauladaCruzLandim

Pizarro, Carolina Vaitiekunas.


O designer e a prtica profissional na
indstria automobilstica no Brasil / Carolina
Vaitiekunas Pizarro, 2014.
305 f.
Orientadora: Paula da Cruz Landim
Dissertao (Mestrado) Universidade Estadual
Paulista. Faculdade de Arquitetura, Artes e
Comunicao, Bauru, 2014.
1. Designer. 2. Design de Produto 3.
Automobilstico. I. Universidade Estadual
Paulista. Faculdade de Arquitetura, Artes e
Comunicao. II. Ttulo.

minhafamlia.

Agradecimentos

Deuspormeacompanhar,protegereauxiliaremtodososmomentos.

minhaorientadoraPauladaCruzLandimpelaamizade,disposioeconfianarefletidos
ematendimentosenriquecedores,sempreacompanhadosdetimasconversaseanimadas
risadas.

Aos professores Prof. Dr. Jos Carlos Plcido da Silva, Profa. Dra. Maristela Mitsuko Ono,
Prof. Dr. Osmar Vicente Rodrigues e Profa. Dra. Lucy Carlinda da Rocha de Niemeyer pela
gentilezaemaceitarcolaborarnaconstruodapresentepesquisa.

Aos professores do departamento de Design e da Psgraduao em Design da Unesp de


Bauru, em especial aos professores Plcido, Osmar, Paschoarelli e Marizilda pelo auxlio
duranteacaminhada.

AosmeuspaisOscareMagda,minhairmMarianaeaocunhadoGustavopeloincentivoe
apoioconstantesnabuscapelosmeusobjetivosprofissionais,dedicaoestaqueporvezes
exigemuitoalmdesuaspossibilidadesequemesmoassimrealizadademaneiracorajosa.

A todos os amigos da Psgraduao em Design pelo carinho, amizade, parceria e pelos


diversosmomentosfelizesqueacrescentaramcoraosmeusdias.

Aosdesignersquecolaboraramcomapresentepesquisa,porsuadisposioaocompartilhar
seusconhecimentosepercepesconstituindoabasedessainvestigao,eemespecialaos
designersAnsioCampos,AriRochaeFernandoMoritapelascontribuiessobrearealidade
desefazerdesignautomotivonoBrasilnopassadoenaatualidade.

AodesigneretambmprofessordetcnicasaplicadasaodesignautomotivoNelsonLopes
que to gentilmente cedeu sketches de sua autoria para o desenvolvimento do projeto
grficodestadissertao.

A todos os profissionais da Seo de PsGraduao da FAAC pelo comprometimento e


dedicaomissodemanterentreoutrastantasatribuiesavidaacadmicadens
alunosemordem.

Gislaine e Rosana do Departamento de Design pela simpatia e pratividade a mim


dedicadosdesdequecurseiaGraduaonestainstituioequedamesmamaneiraforam
constantesnoscaminhosdaPsGraduao.

EfinalmenteCAPESporpermitiraminhadedicaointegralpesquisa.

Odesigner,inicialmente,precisaaceitararealidade,
oquenosignificaconformarsecomela.
(BONSIEPE,2011,p.201)

PIZARRO, C. V. O DESIGNER E A PRTICA PROFISSIONAL NA INDSTRIA AUTOMOBILSTICA NO


BRASIL. 2014. 309f. Dissertao (Mestrado em Design). Faculdade de Arquitetura, Artes e
Comunicao,UNESP,Bauru,2014.

RESUMO
Entre os objetos de uso produzidos em escala industrial, o automvel figura como um
emblemtico e complexo produto resultante de anos de pesquisas, as quais contriburam
para o aprimoramento de seus diversos componentes e pautaram sua evoluo.
Notadamente aps a Revoluo Industrial, os avanos obtidos em termos de prtica de
projeto, velocidade de produo e concorrncia crescente de mercado, delinearam a
formao da atividade do desenhista industrial ou designer, o qual, ao longo do tempo,
tornouse responsvel tambm pelo projeto de veculos. Na indstria automotiva da
atualidade, incumbncia dos designers projetar e acompanhar o desenvolvimento de
automveis,levandoemconsideraotantoaspectosobjetivoscomosegurana,confortoe
desempenho, quanto subjetivos potencial para evocar emoes e identificao com o
usurio na produo do produto. A presente pesquisa se props a investigar como os
designersdeempresasdosetorautomobilsticonoBrasilpercebemosprocessosenvolvidos
emsuarotinaprofissional,levantandoaspectosdaprticaqueinfluenciamnodesempenho
desses profissionais e no processo de design de automveis. Tambm objetivou contribuir
para a produo e divulgao dos conhecimentos cientficos nesta rea do design que
ainda pouco investigada. Para tanto, recorreuse investigao de enfoque
qualitativo/quantitativo realizando em um primeiro momento entrevistas abertas com
especialistas, a partir das quais se obtiveram os parmetros necessrios elaborao de
questionrios fechados posteriormente aplicados a uma amostra do universo pesquisado,
visandoobtenodedadosmaisprecisosemrelaoaotemapesquisado.Osresultados
elucidaramvariadosaspectosreferentesprticaprofissionaleaanlisedestespermitiua
realizao de inferncias sobre a atividade do designer de automveis brasileiro,
construindoumpanoramaatualdaprofissoapartirdoolhardosprpriosprofissionais.Por
fim, os resultados da investigao foram tomados como base para a elaborao de
propostas voltadas s Universidades e indstrias polos de formao e de prtica
profissionalcomoobjetivodecontribuirtambmparaamelhoriadaprticaprofissional
emdesignautomotivo.

Palavraschave:Design;Automvel;Designer;Indstriaautomobilstica

PIZARRO, C.V. THE DESIGNER AND PROFESSIONAL PRACTICE AT THE AUTOMOBILE INDUSTRY IN
BRAZIL.2014.309f.Dissertation(MasterinDesign).FaculdadedeArquitetura,ArteseComunicao,
UNESP,Bauru,2014.

ABSTRACT
Amongtheobjectsproducedonanindustrialscale,thecarisanemblematicandacomplex
product that is result of years of research, which contributed to the improvement of its
variouscomponentsandguideditsevolutionalongthetime.EspeciallyaftertheIndustrial
Revolution, the progress made in terms of project practice, speed of production and the
increasingmarketcompetition,outlinedtheformationoftheindustrialdesigner,whichover
timealsobecameresponsibleforvehiclesprojects.Intheautomotiveindustryofnowadays,
is incumbent on designers to design and monitor the development of vehicles taking into
account both the objective aspects such as safety, comfort and performance, like the
subjective ones potential to evoke emotions and identification with the user at the
product production. The present research aimed to investigate how the designers of
companiesintheautomotivesectorinBrazilperceivetheprocessesinvolvedintheirwork
routine, raising aspects of the practice which influence the performance of these
professionals and the process of car design. It sought at the same time, contribute to the
productionanddisseminationofscientificknowledgeinthisareaofdesignresearchwhichis
stilltimidlystudiedinBrazil.Tothisend,weresortedtothequalitative/quantitativeresearch
approach, initially applying open interviews with experts, from which were obtained the
necessaryparameterstotheelaborationoftheclosedquestionnairessubsequentlyapplied
toasamplegroupstudiedinordertoobtainmoreaccuratedatatotheresearchtopic.The
resultselucidatevariousaspectsrelatedtoprofessionalpracticeanditsanalysisallowedto
makeinferencesabouttheactivityofthebrazilianautomobiledesigner,buildingacurrent
overview of the profession from the look of the professionals themselves. Finally, the
researchresultswereusedasabasisfortheelaborationofproposalsaimedatUniversities
andindustriespolestrainingandprofessionalpracticewiththeintenttoalsocontribute
toandimproveprofessionalpracticeinautomotivedesign.

Keywords:Design;Automobile;Designer;Automobileindustry

LISTADEFIGURAS
Figura1PrimeirafbricamontadoradaFordnoBrasilp.46
Figura2InauguraodosescritriosefbricadaGeneralMotorsnoBrasilem1925p.46
Figura3PrimeirainstalaodefbricadaVolkswagendoBrasilp.48
Figura4LinhademontagemdaRomiIsettap.50
Figura5PeruaDKWVemagp.51
Figura6PickupFordF100p.51
Figura7ToyotaBandeirantep.52
Figura8ModelodoprojetoItapuanp.54
Figura9Democratap.55
Figura10OprojetoAruandap.57
Figura11Brasinca4200GTp.60
Figura12UmdosprimeirosprottiposdoGurgelp.60
Figura13MalzoniGTfabricadopelaDKWVemagp.61
Figura14SketcheseprojetoArpoadorp.62
Figura15Carcarp.62
Figura16Carcarfinalizadop.63
Figura17ProttipoPumaderivadodoGTMalzonip.63
Figura18PumaGTouDKWp.64
Figura19PumaGTEp.64
Figura20OstrsPumaGT4Rp.65
Figura21ProttipoFEIX1p.65
Figura22FordGalaxie500p.66
Figura23FordCorcelp.67
Figura24Opalap.67
Figura25LorenaGT;BuggyLorenaeJipeGaiatop.68
Figura26PropagandadoBuggyGlaspacnarevistaQuatroRodasp.69
Figura27VolkswagenFusca1500p.69
Figura28KarmannGhiaTCp.70
Figura29BuggyTropiKadronp.71
Figura30VolkswagenSP2p.72
Figura31VolkswagenBrasliap.73
Figura32MPLaferde1977p.74
Figura33AvalloneTF;Alfa1931;Super90eFeraXKp.75
Figura34GurgelXavantep.75

Figura35JipeJEGp.76
Figura36Miura1977p.76
Figura37Biancop.77
Figura38SM4.1p.77
Figura39GurgelItaipueMiniPumap.78
Figura40VolkswagenPassatp.80
Figura41Fiat147p.82
Figura42ChevetteEnvemoTargap.83
Figura43PassatMalzonip.84
Figura44PeruasPassatdeduasequatroportasp.84
Figura45CorcelIIconversvelp.85
Figura46PropagandadoFormigoveiculadanarevistaQuatroRodasp.85
Figura47VolkswagenGolp.86
Figura48Disetap.87
Figura49Laserp.87
Figura50Farusp.88
Figura51GolCabrioletp.88
Figura52CorcelHatchbackp.89
Figura53CountryeBlazerp.89
Figura54CobraGlaspacp.90
Figura55SketchdoMiniDaconeimagemdeentradadotesteQuatroRodasp.90
Figura56MiuraSpyderp.91
Figura57GurgelXefp.91
Figura58EscortXR3p.92
Figura59FiatUnop.92
Figura60FurglaineePoCaravellep.93
Figura61UnoCabrioletSultanp.93
Figura62Hofstetterp.94
Figura63Ibizap.95
Figura64Topazziop.95
Figura65GurgelBR800p.96
Figura66Nickp.97
Figura67ChevroletKadettp.97
Figura68PropagandadeEnvemoeanncioempginadupladaSidcarp.98
Figura69GMBonanzap.98

Figura70FerrariF40p.99
Figura71Futurap.100
Figura72Alfa164p.101
Figura73BMWVeronap.101
Figura74HondaAccordp.102
Figura75GurgelSuperminip.102
Figura76ChevroletVectrap.103
Figura77ChevroletCorsap.103
Figura78GolgeraoIIp.104
Figura79FachadadafbricadaHondaautomveisp.106
Figura80ToyotaCorollap.106
Figura81TrollerT4p.107
Figura82PlantafabrilPSAPeugeotCitronp.108
Figura83NissanFrontierp.108
Figura84CitronC3p.109
Figura85VolkswagenFoxp.110
Figura86bvio!8282p.111
Figura87Prottipo012dabvio!p.111
Figura88Lobinip.113
Figura89LSPSp.114
Figura90GolgeraoVp.115
Figura91Peugeot207p.116
Figura92DoniRossetp.116
Figura93ProjetoSabi6p.117
Figura94NovoUnop.118
Figura95HyundaiHB20p.120
Figura96NovoEcosport2013p.122
Figura97NovoFuscap.122
Figura98Volkswagenup!p.123
Figura99KineticDesignp.131
Figura100FluidicSculpturep.132
Figura101BentleyContinentalGTp.136
Figura102SketchdomodeloVolkswagenup!p.136
Figura103SketchdosedVolkswagenJettap.137

LISTADEDIAGRAMAS,GRFICOSEQUADROS
Diagrama1CadeiaProdutivadaindstriaautomotivap.125
Diagrama2ProcessodeDesignp.134
Diagrama3Passosdaanlisedecontedodasentrevistasp.149
Diagrama4Sntesedosaspectospercebidospelosdesignersacercadesuaprticaprofissionalp.207
Diagrama5RelaespossveisdeseremestabelecidasentreUniversidadeeIndstriavisandomelhoriada
prticadodesignerautomotivoeoreconhecimentodaprofissop.231

Grfico1Formaodosprofissionaisentrevistadosp.153
Grfico2Hquantotempotrabalhacomdesignautomotivop.154
Grfico3Formaodosprofissionaisparticipantesp.209
Grfico4Hquantotempoquetrabalhacomdesignautomotivop.210
Grfico5Conhecimento/reconhecimentododesignpelosdemaisprofissionais/departamentosp.211
Grfico6Aumentodeoportunidadesparaosdesignersnareaautomotivap.212
Grfico7Autonomiaparaacriaoedesenvolvimentodeprojetosp.213
Grfico8Tendnciadedesenvolvimentodeprojetosglobaisp.213
Grfico9Aspectosnegativospresentesnaprticaprofissionalp.215
Grfico10Melhoriasnaprticaprofissionalp.216
Grfico11Acurtoemdioprazosomercadoeaproduobrasileirosnosofreromuitasmodificaes
p.217
Grfico12Odesignerterpapelfundamentalparaamelhoriaeodesenvolvimentodoprodutocarro,da
mobilidadeemgeraledasociedadep.218

Grfico13Atuaodoprofissionaldependerdepolticaspblicaseficientes,empresasresponsveise
sociedadeconscientep.218

Grfico14Setornarnecessriaacriaodecentrosdepesquisaemdesignavanadonosquaisa
participaododesignerseressencialp.219

Quadro1CategoriasdeAnliseeseusrespectivostemasp.155
Quadro2ndiceseindicadoresoriginadosdoTema1Ap.155
Quadro3ndiceseindicadoresoriginadosdoTema1Bp.158
Quadro4ndiceseindicadoresoriginadosdoTema2Ap.162
Quadro5ndiceseindicadoresoriginadosdoTema2Bp.169
Quadro6ndiceseindicadoresoriginadosdoTema3Ap.174
Quadro7ndiceseindicadoresoriginadosdoTema3Bp.179
Quadro8ndiceseindicadoresoriginadosdoTema3Cp.188
Quadro9ndiceseindicadoresoriginadosdoTema4Ap.197

GLOSSRIO
Briefing Termo em ingls que no mbito do design automotivo utilizado para fazer
refernciaelaboraoporpartedosdesigners,dasinstruesediretrizesnecessriaspara
o encaminhamento do projeto junto aos parceiros e fornecedores direcionando seu
desenvolvimento.

Clay Termo em ingls que denomina uma argila plstica. Tratase de um material de
modelagemmacioemalevel,compostodepartculasdePVC(PolyvinylChloride).Quando
empontodeargilapodesermoldadoeesculpido,aceitandodiversasaesdemodelagem.
Uma vez finalizado o trabalho, a argila aquecida em baixa temperatura e por um tempo
programando, processo responsvel por fundir as partculas de PVC componentes,
resultandoemumplsticoduro,resistenteedurvel.

Color&Trim rea do design automotivo responsvel pelo desenvolvimento de cores e


acabamentosinternoseexternosdosveculos.

ComerciaislevesVeculosvendidosnoBrasilquepossuemPBT,PesoBrutoTotal,deat
3,5toneladas,incluemsepickupspequenasderivadasdoscarrosdepasseio,vans,furgese
utilitriosesportivos.

ConceptsTermoinglsutilizadonombitododesignautomotivoparafazerreferncia:
ideias inovadoras ou conceito de projeto; um setor/time de profissionais que trabalha em
novasideiasouconceitosinovadoresparafuturosveculos;carrosconceito.

Crash test Termo em ingls que designa os testes de impacto contra barreiras
indeformveis (blocos de concreto ou ferro) ou deformveis (bloco deformvel metlico)
realizadosporempresasespecializadasparaavaliaraseguranaautomotiva,verificandose
osveculostestadoscumpremasnormasdeseguranadeproteocolisoemsituaes
deacidentedetrnsito.

Crossover Veculo com caractersticas combinadas de veculos compactos e utilitrios


esportivos.

FaceliftMudanaincrementaldaslinhasdoveculoessencialmenteestticasemimplicar
emumamodificaoradicaldodesigndoproduto.

Feasible Termo ingls utilizado no mbito do design automotivo referente criaes


factveis,possveisdeseremfabricadasemtermosdeviabilidadetcnica.

FeaturesComponentes.

Flexfuel Tecnologia de motorizao que permite ao automvel funcionar com dois


combustveis:lcoolougasolinaequalquermisturadeambos.

Fluidic Sculpture Tendncia de estilo adotada mundialmente pela Hyundai, a qual


incorporanosprojetosdosveculosaexecuodeformasfluidasedinmicas.

Gr Turismo, Gran Turismo ou GT Termo de origem italiana, utilizado para referenciar


veculos esportivos de luxo e alto desempenho, capazes de realizar viagens de longa
distnciaemaltavelocidadecomconfortoeelegncia.

HatchCarrocompactoparaatcincoocupantescomportamalasintegradoaohabitculo
dospassageiros,podeterdeduasquatroportasmaisatampatraseira.

Hatch mdio Maiores que os compactos de entrada apresentam motorizao mais


potente (acima de 1.0) e mantm espao para at cinco ocupantes com portamalas
integrado ao habitculo dos passageiros, pode ter de duas quatro portas mais a tampa
traseira.

InputTermoeminglstraduzidocomoentrada,equenombitododesignautomotivo
utilizado para fazer referncia informaes que do incio s atividades projetuais; o
comeodostrabalhos.

IntentInteno;objetivo.

JewelinsertsTermoeminglsutilizadonombitododesignautomotivoparareferenciar
peas trabalhadas visualmente a fim de simular acabamentos superiores (cromados, ao
escovado,fibradecarbonoentreoutros).

Kinetic Design Tendncia de estilo adotada mundialmente pela Ford, pautada no


dinamismodasformasaplicadasaointerioreexteriordosveculosdamarca,representando
aenergiaemmovimento.

KnowhowTermoeminglsquedesignaoconhecimento;osaberfazeremdeterminada
rea.

MindsetModelomental.

Mini Carro compacto para dois ou quatro ocupantes e duas portas, com carroceria
monovolume.

MinivanCarrofamiliarcomcarroceriamonovolumeparaatseisocupantescomduasou
quatroportasetampatraseira(inteiriaoubipartida).

MonoblocoVeculoscujochassi,motorecarroceriaintegramumapeanica,comopor
exemplo,osnibusosquaiseramanteriormentemontadossobrechassisdecaminhes.

MultivanCarrofamiliarparaquatrooucincoocupantes,comtrsouquatroportas(coma
opo de portas deslizantes) e uma porta traseira (inteiria ou bipartida). Veiculo
multiespaocomcarroceriadoisvolumes.

PackagereadodesignautomotivoresponsvelpeloaspectodimensionaldoveculoAtua
considerandoosespaoseposicionandooscomponentesdocarro,ajustandoedefinindoo
tamanhoidealdomesmoapartirdeestudosergonmicosedeviabilidadetcnica.

PickupVeculolevederivadodosedanouperuadamesmafamlia,oqualservedebase
parafurges.Almdaopocabinesimplesoudupla,apresentacaamba.

PremiumTermoinglsutilizadonombitododesignautomotivoparafazerreferncia
modelossofisticadosdeautomveis.

RenderingExpressoempregadanailustrao2D(duasdimenses),manualoudigitalena
ilustraoeanimao3D(trsdimensesexclusivamentedigitais).Quandoempregadopor
artistas2Dotermorenderingreferesetcnicadeilustraoquepermiteaobtenode
imagens com grande apelo visual e de forma rpida, muito empregada na rea do Design
para ilustrar ideias de novos produtos. Na rea dacomputao grfica3Dorendering
compreendegerarumaimagem2Dapartirdomodelo3Dpreviamenteconstrudo.

Shape rea do design automotivo responsvel pelo estudo e projeto da forma do


automvel.

Sketches Desenhos realizados mo livre ou com a ajuda de recursos digitais, os quais


representamasideiasoudiretrizesdeumprojeto,materializandovisualmenteumconceito.

Sedan Carro de passeio para quatro ou cinco ocupantes com trs volumes separados
(cap,cabineeportamalas).

SuppliersFornecedores.

TimingOprazoquesetemparaodesenvolvimentodoveculo.

TrendyTermoeminglsquedesignaalgoquetendncia;queestnamoda.

Van Carro familiar para at oito ocupantes, com trs ou quatro portas (com opo de
portasdeslizantes),tampatraseira(inteiriaoubipartida)ecarroceriamonovlume.

LISTADEABREVIATURASESIGLAS
ABSAcrnimoparaaexpressoalemAntiblockierBremssystem.Tratasedeumsistema
defreiosantitravamentoderodas,oqualemcasodefrenagemabruptaevitaaderrapagem
docarro,afaltadeadernciadospneuspistaeconsequentedescontroledoveculo.
ANFAVEAAssociaoNacionaldosFabricantesdeVeculosAutomotores
CAPESCoordenaodeAperfeioamentodePessoaldeNvelSuperior
CBTCompanhiaBrasileiradeTratores
CESPCompanhiaEnergticadeSoPaulo
CIPEDCongressoInternacionaldePesquisaemDesign
CKD Sigla adotada mundialmente pela indstria automotiva para designar o termo em
lnguainglesaCompletelyKnockedDownemtraduolivrecompletamentedesmontado
a qual se refere ao fornecimento de veculos, agregados e peas desmontados e que so
montadosefinalizadosnopasondeservendido.
CONTRANConselhoNacionaldeTrnsito
CPIComissoParlamentardeInqurito
DKWDampfKraftWagen
DNA Termo emprestado da rea das Cincias Biolgicas e que na rea do Design
Automotivorefereseidentidadedamarcarepresentadanodesigndeseusprodutos
ESDIEscolaSuperiordeDesenhoIndustrial
FEIFaculdadedeEngenhariaIndustrial
FNMFbricaNacionaldeMotores
GEIAGrupoExecutivodaIndstriaAutomobilstica
GMGeneralMotors
IBAPIndstriaBrasileiradeAutomveisPresidente
IPEAInstitutodePesquisaEconmicaAplicada
P&DDesignCongressoBrasileirodePesquisaeDesenvolvimentoemDesign
P&LPanhardeLevassor
PIBProdutoInternoBruto
SPECSSiglaadotadaemreferentesespecificaestcnicas
SRSouzaRamosconcessionriaFord
SUV Sigla adotada mundialmente pela indstria automotiva para designar o termo em
lngua inglesa Sport Utility Vehicle em traduo livre Veculo Utilitrio Esportivo
desenvolvidoparaquatrooucincoocupantescomduasouquatroportas.
UNESPUniversidadeEstadualPaulista

SUMRIO

1INTRODUO................................................................................................................20

2OBJETIVOS.....................................................................................................................25

3REVISOBIBLIOGRFICA...............................................................................................27
3.1AindstriaautomobilsticanoBrasil:contextualizaodosetor......................................28
3.2Afabricaodeautomveiseaatuaodosdesigners:aspectoshistricos...................32
3.3OdesigneosdesignersautomotivosnoBrasil:doincioatualidade............................40

4MATERIAISEMTODOS...............................................................................................142
4.1Aspectosticos.................................................................................................................143
4.2Materiais...........................................................................................................................144
4.3Procedimentosdecoleta..................................................................................................146
4.4Anlisededados...............................................................................................................147

5RESULTADOSEDISCUSSES.........................................................................................151
5.1Resultadosdaprimeirafasedapesquisa...................................................................152
5.1.1PerfildaAmostra...........................................................................................................153
5.1.2Anlisedecontedodosdadosobtidos.......................................................................154
5.1.2.1Categoria1:OprofissionaldesignerautomotivonoBrasil........................................155
5.1.2.2Categoria2:Odesignerautomotivoeainterdisciplinaridade.................................162
5.1.2.3Categoria3:Autonomia,desafiosemelhoriasnaprticaprofissionaldodesignerde
automveisbrasileiro............................................................................................................174
5.1.2.4Categoria4:OfuturodaprofissonoBrasil.............................................................197
5.2Resultadosdasegundafasedapesquisa...................................................................208
5.2.1PerfildaAmostra...........................................................................................................208
5.2.2Anlisedosdadosobtidos............................................................................................210

CONSIDERAESFINAIS................................................................................................222

7REFERNCIASUTILIZADASECONSULTADAS................................................................234
8APNDICES..................................................................................................................244

20

1INTRODUO

As primeiras intervenes do Homem na natureza objetivando a modificao do


entorno para atender s suas necessidades, permitiram que a ao criativa Humana fosse
responsvel pela produo dos mais variados artefatos. Ao longo do tempo, o
aprimoramento das tcnicas e o desenvolvimento de novas e diferentes ferramentas,
materiaiseprocessospermitiramqueaproduodestesobjetosevolussedemaneiracada
vezmaisveloz,resultandonoaprimoramentodosdiferentesprodutos.
NotadamenteapsaRevoluoIndustrial,osavanosobtidosemtermosdeprtica
de projeto, velocidade de produo e concorrncia crescente de mercado, delinearam a
formao da atividade do desenhista industrial ou designer como profissional
encarregado da criao e desenvolvimento de projetos, que de maneira interdisciplinar
responsvel por conjugar em sua prtica diria, entre outros fatores, o aprimoramento
constantedeprojetos,aotimizaodosprocessosprodutivos,odesenvolvimentodenovos
materiais e o uso de recursos naturais. Tais fatores permeiam a atividade, a qual busca
equilibrarosinteressesdeempresasemercadocomasnecessidadesedesejosdosusurios
naproduodosartefatos.
Entreosobjetosdeusoproduzidosemescalaindustrial,oautomvelfiguracomoum
emblemtico e complexo produto resultante de anos de pesquisas as quais contriburam
para o aprimoramento de seus diversos componentes e pautaram sua evoluo. Com o
passar dos anos, um produto inicialmente caro e com pblico consumidor restrito
popularizouseprincipalmenteapsadifusodaproduoemlinhademontagemsendo
atualmenteumdosobjetosmaisutilizadosnocotidianodosindivduos,oqualincorpora,se
adaptaerefleteasmudanasdegostos,hbitosenecessidadessociaisnoespaodetempo
emqueseencontrainserido.
Tambm a indstria automotiva tornouse produtora de tecnologias as quais
contribuem diretamente para o desenvolvimento industrial como um todo, produzindo
inovaes e processos incorporados inclusive por outras reas tais como o motor
combustoeaproduoemlinhademontagembemcomoaomesmotempofoieainda
influenciadapornovosavanosoriundosdasmaisdiversasreastaiscomooemprego
crescente das tecnologias digitais no formato de computadores de bordo e centrais de
interatividade,cadavezmaispresentesnosprojetoscontemporneos.

21

Na produo deste objeto de uso, a atuao do designer se faz essencial. Em um


cenrio de concorrncia acirrada, no qual as tecnologias so empregadas de maneira
equivalentepelasdiferentesmarcas,odesigndoprodutoumdosimportantesfatoresos
quaisinfluenciamnosucessodoprojetojuntoaopblico,sendoporvezesdeterminantena
escolha por parte do usurio quando do momento da compra (ROBERTI; MATSUBARA,
2012).
No Brasil, a rea de design automotivo vem crescendo nos ltimos anos
principalmente devido implantao de estdios de design anexos s plantas fabris de
empresas multinacionais instaladas em territrio nacional. Tratase de um reflexo da
expansodaatividadededesignnasmatrizes,asquaisvmreconhecendoaimportnciada
mesma e expandindoa s subsidirias. Muitos projetos de sucesso foram e ainda so
desenvolvidoscomimportantescontribuiesdeprofissionaisbrasileiros,osquaistmsido
solicitados mais recentemente a trabalhar dentro da tendncia atual da produo de
projetosglobaisadotadapelasempresas.
No mbito da formao profissional, a partir da dcada de 1960, no Brasil, com a
criao dos cursos de Desenho Industrial oferecidos por instituies de ensino superior
sendo o primeiro deles criado em 1963 com a fundao da Escola Superior de Desenho
IndustrialESDInacidadedoRiodeJaneiroareadedesigndeautomveispassoua
figurar como mais um campo de atuao para os estudantes egressos. Tambm o
desenvolvimentoeaexpansodasindstriasinstaladasnopasfavoreceramaampliaodo
campo de trabalho para que os profissionais interessados se especializassem na rea.
Atualmente,algumasinstituiesmantmcursosdedesigndetransportesoudesignparaa
mobilidade, os quais so oferecidos nas modalidades de psgraduao, especializao ou
extenso,promovendoaprofissoecapacitandoosestudantesdedesignparaaatuaono
setor.
incumbnciadosdesignersprojetareacompanharodesenvolvimentodeveculos
que sejam esteticamente atraentes, ergonomicamente adequados, levando em
consideraotantoaspectosobjetivoscomoseguranaedesempenho,quantosubjetivos
potencialparaevocaremoeseidentificaocomoestilodevidadousurionaproduo
doproduto.Aprticaempreendidapelosdesignersdentrodosestdiosdasmontadoras
atualmente caracterizada como uma atividade interdisciplinar, inserida em um cenrio
problemticoemtermosdemobilidade,noqualonmerodeveculospresentesnasruas

22

tomado como um dos fatores causadores do trnsito, por vezes catico, verificado
principalmente em grandes cidades. Somase a estes pontos a demanda crescente em
inovao por parte das empresas em relao aos designers, como reflexo da concorrncia
acirrada. Nesse cenrio, a importncia do design para a produo de automveis seja
inegvel, a prtica dos designers neste meio apresenta importantes desafios a serem
vencidos.
Emboraosetorautomotivosejaumdosmaisvisadospelosdesignersbrasileirosos
quaisbuscamumaoportunidadenarea,noqueconcernereadedesigndeautomveise
pesquisarelativaaestecampodeatuaonoBrasilprincipalmentesobreaatuaodos
designers neste meio observase ainda uma modesta produo de bibliografias, quando
comparadassdemaisreasdepesquisaemdesign.Salvoalgumasexcees(LAMM;HOLLS,
1996;SPARKE,2002;LARICA,2003;ONO,2004;VIEIRA,2010;KINDERSLEY,2012),amaioria
daproduoenvolvendoocarrocomoobjetodeestudoconfigurasecomoumaliteratura
delazer,voltadaaopblicoadmiradordeautomveis,sendoescassasaspublicaesmais
aprofundadas,deteorcrticoouanalticovoltadasaoassunto.
Noqueserefereproduocientficadeautoriabrasileiraverificada,asquaistm
por objeto de estudo o setor automotivo, boa parte referese a estudos de engenharia e
processos de produo, sendo voltadas principalmente s discusses na rea da gesto
(VIEIRA;GARCIA,2004),estratgiasdecompetitividade(DIAS,2001;DIAS;SALERNO,2003;
CARVALHO,2005;SCAVARDA;BARBOSA;HAMACHER,2005),processosdentrodaindstria
com nfase em engenharia (CARDOSO; KISTMANN, 2009), identidade e marketing
(OLIVEIRA,2006),sendoocasionalmenteinvestigadosaspectoshistricos(CAMARGO,2006)
ouculturaisnosprojetosemdesign(ONO,2004).
Tambm as publicaes de autoria brasileira ou realizadas em parceria com
instituiesestrangeiras,referentesaosetorautomobilsticoencontradasnos41volumesdo
InternationalJournalofAutomotiveTechnologyandManagementosquaiscompilamum
total de 278 estudos publicados entre os anos de 2001 e 2012 perfazem um total de
apenas9artigos,dosquaisnenhumversasobreocampododesigndeautomveis,sendo
em sua maioria referentes gesto da produo (BALCET; CONSONI, 2007; MIYAKE;
NAKANO, 2007; PROFF, 2011; IBUSUKI; KOBAYASHI; KAMINSKI, 2012), gesto da produo
deautopeas(RACHID,2001;TOLEDO;FERRARI;ALLIPRANDINI;MARTINS;MARTINS;SILVA,
2004), aspectos histricos (ZIBOVICIUS; MARX; SALERNO, 2002) estratgias de

23

competitividade(ZILBER;VASCONCELLOS,2005),eengenharia(AMATUCCI;SPERS,2010).No
tocanteproduocientficaespecficadareadodesign,envolvendoosetorautomotivo,a
mesma tambm se mostra tmida. Em estudo bibliomtrico realizado (PIZARRO; LANDIM,
2012),foramanalisadasasproduescientficaspublicadasnastrsediesmaisrecentes
dedoisimportantescongressosdareadoDesign,oP&DDesignCongressoBrasileirode
PesquisaemDesigneoCIPEDCongressoInternacionaldePesquisaemDesign.Somadas
asproduesdasseisediestrsdecadaeventoverificouseque,deumtotalde2.526
trabalhos,apenas21abordavamdealgumamaneiraoautomvelcomooobjetodeestudo.
TalresultadorefleteabaixaproduosobreotemanoBrasilenomundoumavezquea
anliserealizadacompreendeuumeventonacionaleuminternacionalndicepreocupante
em se tratando de um setor no qual o design tem grande peso no sucesso do produto. A
baixa produo reflete a pouca ateno que tem sido dispensada pela comunidade
acadmica a um campo de atuao para o design, no qual a pesquisa desempenhar um
papel importante nos prximos anos, principalmente no que tange aos problemas que se
esboamnaatualidade,emtermosdemobilidade.
A presente pesquisa propese a investigar como se d a prtica profissional dos
designers dentro dos processos de design nas montadoras, quais os aspectos que a
caracterizam,osobstculosaseremequacionados,ospontospositivosaseremreforadose
aprimorados,bemcomooquesepodeesperarparaofuturodaprofisso.Afimdeobter
respostas fiis realidade vivida por esses profissionais, recorreuse investigao da
percepo de profissionais inseridos no mercado e atuantes na rea de design de
automveis. Percepo compreendida nesta pesquisa de acordo com Coelho (2008, p.44)
como [...] processo ou ato de perceber, ou ao efeito ou produto dessa mesma faculdade
[...] o fato de perceber atravs dos sentidos e emoo, ou a representao consciente a
partirdesensaes.usadoparaofatodetomarconhecimentodeobjetosemgeral,outer
aconscinciadealgo.Podendoaperceposervista,aindadeacordocomoautor,como
[...] o reconhecimento intuitivo de uma qualidade moral ou esttica [...] diz respeito
cognioouaojulgamentoimediatoouintuitivo(COELHO,2008,p.44).
A motivao para a pesquisa teve origem a partir das experincias profissionais da
pesquisadoranosdepartamentosdedesigndeduasmontadorasdeveculosVolkswagen
doBrasileCAIOInduscar.Duranteoperododeatuaonasempresas,almdoaprendizado
evivnciadaprticaprofissional,foramdetectadosimportantesaspectosquepermeiama

24

prticaprofissional,osquaisresultavamemfortesinflunciasnodesempenhoprofissionale
de projeto dos designers. Com a inteno de investigar e registrar tais aspectos, a
possibilidadedetransformarosproblemasvivenciadosouobservadosnaprticaemum
problema de pesquisa apresentouse como um caminho natural e desafiador, dado a
escassezdebibliografiascorrelatasaotemaesdificuldadespresentesquandosepretende
trabalhar junto a empresas nas quais o sigilo configurase como parte importante do
trabalho. Uma vez aprovada em processo seletivo pelo Programa de PsGraduao em
Design da UNESP campus de Bauru, a presente pesquisa financiada pela CAPES pde ser
desenvolvida.
A estrutura da dissertao resultante da investigao corresponde a seis captulos,
sendo o primeiro dedicado introduo do tema e o segundo ao esclarecimento dos
objetivosdapesquisa.
O captulo trs compreende a reviso bibliogrfica acerca do tema pesquisado
estabelecendorelaesapartirdedadoshistricosreferentessindstriasdeautomveis
instaladas no Brasil, abordando os fatos histricos, as iniciativas de desenvolvimento
brasileirasparalelasproduodasmultinacionais,osurgimentoeaatuaodosdesigners
nestemeio,bemcomoapresentadadosprovenientesdepesquisasrecentessobreosetor.
O captulo quatro elucida os materiais e mtodos empregados no decorrer desta
pesquisaemsuasduasfases,atendendoaosaspectosticos,relatandoosprocedimentosde
coletaeomtododeanlisededados.
Emseguida,ocaptulocincoapresentaaanlisecompletaeasdiscussesdosdados
coletados nas duas fases da pesquisa. As consideraes finais foram tecidas realizando o
fechamentodapesquisaapartirdaretomadadasreflexesapresentadas,integrandoasao
cenrio obtido a partir da anlise dos dados e apresentando sugestes consideradas
pertinentessUniversidadeseindstriasdeautomveis,visandocontribuirparaamelhoria
daprticaprofissional.

25

26

2OBJETIVOS

ODesigndesempenhaimportantepapelnodesenvolvimentodoobjetoautomvel,
sendo o campo do design automotivo um dos mais competitivos do mercado para os
designersemformaoeumdosmaispromissoresparaosdesignersematividade.
Opresenteestudotevecomoobjetivogerallevantareanalisarcomoosdesignersde
empresasdosetorautomobilsticonoBrasilpercebemosaspectosqueenvolvemsuaprtica
profissional no desenvolvimento de automveis na atualidade e que perspectivas
profissionaisfuturasanteveemparaareadedesignautomotivo.
Comoobjetivosespecficos,oestudointencionouapartirdeumacontextualizao
do setor automotivo, analisar como se deu o surgimento do profissional designer de
automveis; conhecer, compilar e registrar os principais modelos de veculos
comercializados no Brasil e desenvolvidos no pas a partir de iniciativas e de projetos
brasileiros; levantar e analisar a partir do contato com designers automotivos atuantes
como os vrios aspectos da prtica profissional influenciam no desempenho dos
profissionaisenoprocessodedesigndeautomveis.
Pretendeusequeaofimdapesquisa,fossemobtidosindicadoressobreaatividade
profissional,osquaisfavorecessemaelaboraoderecomendaesquecontribuamparaa
melhoriadaformaoprofissionalcontnuaedaprticadosdesignersnareaautomotiva.
Porfim,pretendeusecolaborarparaaproduoedivulgaodosconhecimentosnestarea
dodesignaindatimidamenteabordada.

27

28

3REVISOBIBLIOGRFICA

3.1AindstriaautomobilsticanoBrasil:contextualizaodosetor

Desdeosmaisremotostempos,oserhumanomodificaoambienteemfavordesuas
necessidades. Muito alm de apenas buscar garantir sua sobrevivncia, a histria da
Humanidadefoiepermeadapelompetohumanodevencerlimites,transporbarreiras,
conviver em sociedade e buscar o bemestar. Neste cenrio, criouse e se desenvolveu a
culturamaterialhumana,metamorfoseandoseatravsdostempos,hbitosenecessidades
doHomemetornandoseaomesmotempoobjetodeestudoedeaododesign.
Para Vieira (2008, p.15), o Homem, por natureza, impelido por uma fora motriz
queofazmoverseadiante,rumoaodesenvolvimento,evoluo,stcnicasetecnologias
para vencer o tempo e o espao e, para tal, Ao longo de sua histria cria ferramentas,
substncias, engenhocas, mquinas, veculos, dispositivos, computadores tcnicas e
tecnologiasquefazemessemovimentocadavezmaisveloz,cadavezmaisvelozmente.
Na esteira de tais criaes, muitas foram as solues encontradas para as mais
diferentesnecessidades,asquaisculminaramnainvenodosmaisdiversosobjetos.Entre
taisobjetos,arodainfluencioudemaneiraimportanteocursodosacontecimentos,sendo
suainvenotosignificativaparaaevoluohumana,quantoadescobertadofogo(VIEIRA,
2008,p.19).Seuuso,aplicadoinicialmentenotransportedecargaspesadas,comopassar
dosanosfoiampliado,tornandoapeacomponenteprincipalparaamontagemdemeios
detransportehumanosedecarga.Asdiversasinvenesposterioresrodafavorecerama
composiodoambienteeaproduodasferramentasideaisparaacriaodeumdosmais
emblemticosobjetoscriadospelohomem:oautomvel.
Os avanos em termos de maquinrio e velocidade de produo verificados
principalmente no perodo conhecido como Revoluo Industrial resultaram em sucessivas
transformaes no processo produtivo, culminando na incorporao do projeto e do
profissionalprojetistanasproduesemsrie,noaprimoramentodemtodosdeproduo
e fabricao, na criao de inovadoras tcnicas construtivas e tambm na pesquisa e
desenvolvimento de novos materiais. O carro, um objeto to popular na atualidade, ,
portantoasntesedetodooarcabouohistrico,tecnolgicoematerialqueoprecedeue
permitiuasuamaterializao.Otransporte,deacordocomLarica(2003,p.13),corresponde

29

necessidadedelocomoversedeumpontoaoutro,pormeiosmecnicos,comamxima
convenincia e segurana e o mnimo desconforto, por meio de uma atividade que
proporcione satisfao e divertimento. Ainda para o autor, os meios de transporte no
apenasservemparaotransportedemercadoriasoulocomoohumana,mastambmso
agentesquemoldamocursodenossasvidas,ecompleta:

Algumasvezesafunomaisimportantedoqueoprazer.Outrasvezesoprazer
essencial. Mas, seja qual for o percurso, ambos os atributos funo e prazer
coexistemladoalado,cadaumcomsuaprpriaintensidade.Tantoafunocomo
o prazer dizem respeito ao campo de trabalho do designer industrial. (LARICA,
2003,p.13).

Assim,odesigndeautomveissepropeadesenvolverprojetoslevandoemconta
tanto os aspectos prticofuncionais do objeto como ergonomia, segurana, conforto e
desempenho, quanto os aspectos subjetivos e simblicos do mesmo, os quais sejam a
identificao emocional, adequao ao gosto do consumidor e materializao dos desejos
dos mesmos. Desde sua popularizao o automvel progressivamente foi se tornando
indispensvel para o cotidiano de grande parte dos indivduos tambm no Brasil, os quais
fazem do produto uma extenso de si, por meio do qual expressam seu estilo de vida e
dentrodoqualpassammuitashorasdoseudianaidaaotrabalho,viagensedemaisafazeres
queimpliquemamobilidadeemvariadasdistncias.Suaimportnciatambmdestacada
porOno(2004).

O automvel tem afetado profundamente no somente o desenvolvimento


econmicoeastransformaesdosmeiosprodutivos,mastambmosmodosde
vidadasociedade,omeioambienteeaconfiguraodaarquiteturaedosespaos
urbanos. Tratase de um elemento emblemtico, que tem influenciado direta e
indiretamenteasatividades,asrelaeseosreferenciaisculturaisdosindivduose
grupossociais.(ONO,2004,p.142).

Naatualidade,umdossetoresnoqualodesignreconhecidamenteimportantepara
ainovao,competitividadeepresenanomercadooautomotivo.Nocenrioatual,area
caracterizadapelaforteconcorrnciaentreasmarcas,sendopartedocotidianodeprojeto
detaisempresasanecessidadedesurpreenderousurioemumsetornoqualasdiferentes
marcas absorvem quase que instantaneamente as novas tecnologias. Neste sentido, a
criao,odesenvolvimentoeaproduodenovosprodutostornamseograndediferencial

30

entre as mesmas. Assim, incumbncia dos designers manteremse atentos aos vrios
aspectosculturaisesociaisdacomunidadenaqualestoinseridosesdiferentese,muitas
vezessutismudanasnoscomportamentos,prefernciasehbitosdosconsumidores,afim
de desenvolver projetos inovadores e cada vez mais adequados ao estilo de vida e s
aspiraesdopblico.
As empresas multinacionais e de iniciativa nacional tais como a Gurgel, Puma e
Troller instaladas nopas ajudaram aconstruir e manter um dos mais importantese
lucrativos setores industriais brasileiros, capacitando profissionalmente um grande
contingentedemodeobra,geradoempregos,designeinovao.Atualmente,asempresas
dosetorinvestemnopotencialdecrescimentodomercadonacionalebuscam,pormeiodo
design, produzir de acordo com os anseios do pblico brasileiro, o que no significa
sobremaneiraisentarsedodesenvolvimentodedesigneinovaocompotencialglobal.O
uso de plataformas globais tem se tornado uma constante no setor automotivo, nesse
sistema, h um compartilhamento das estruturas de base do veculo, as quais podem ser
compostaspelochassiestruturametlicanaqualsomontadosoconjuntomecnicoea
carroceria ou o monobloco estrutura composta pelo chassi soldado diretamente
carroceriapermitindoqueumamesmaplataformadorigemadiferentesmodelos.
DeacordocomDiaseSalerno(2003),asvantagensrelacionadasproduodeum
produtoglobalabrangemfatorescomoademanda,naqualsebuscaumapadronizaode
gostoseusosentreaspopulaes;aoferta;abuscaporeconomiasdeescalaumavezque
osdesenvolvimentosdeprodutoseprocessossorealizadosumanicavezparaumvolume
de produo global, e a reduo do tempo de desenvolvimento. Tais vantagens passam
principalmentepelaconcentraodasatividadesdedesenvolvimentodeprodutosemums
local: a matriz. Todavia, afirmam os autores, verificase uma tendncia diferente, de
descentralizaodaproduodeprodutosglobais.

O conceito de produto global, em realidade, modificouse, pois em muitos


setoresopressupostorelativopadronizaodademandanoseverificou;dessa
forma,aindaqueumprodutopossaserconcebidocomvistasavriosmercadosao
mesmotempo,eledeveserminimamenteadaptadoaosgostoseusoslocais.Alm
disso, ao concentrar as atividades de desenvolvimento em uma unidade, a
corporaopodeperderoportunidadesdeacessoatecnologiasdesenvolvidasfora
desse centro, em suas subsidirias ou em instituies externas s filiais, mas
prximasaelas(taiscomouniversidadesecentrosdepesquisa).Haveria,portanto,
no uma centralizao de atividades de desenvolvimento, mas sim uma

31

descentralizaodessasatividadesbuscandoproximidadedosmercadosalvoedas
tecnologiasdesenvolvidaslocalmente.(DIAS;SALERNO,2003,p.1e2).

Embora importantes decises e diretrizes projetuais sejam tomadas no mbito das


matrizes das empresas, cada vez maior o reconhecimento de que fatores como as
necessidades locais, a diversidade dos diferentes mercados nos quais tais companhias
atuam,eprincipalmentenocasodoBrasil,opesoqueafilialbrasileiratemparaosnegcios
damarca,desenhamcenriosmaiscomplexosnoquetangeproduodeprojetoslocais
e/ouglobais.
Enquanto a centralizao apresenta suas vantagens, a descentralizao de projetos
mostrasemaisadequadanabuscapelareduodotempodedesenvolvimentoquandoos
produtosdestinadosaosmercadosdassubsidiriassofremmuitasadaptaes.Esteocaso
do mercado brasileiro, o qual, alm de aquecido mercado interno atualmente apresenta
grandeinflunciatambmnaregiodaAmricaLatina.Destamaneira,tmsidocrescentes
as solicitaes de participao de designers e estdios de subsidirias brasileiras no
desenvolvimento de projetos globais, at mesmo liderando esses projetos, sendo os mais
recentesexemplosodesenvolvimentodosnovosmodelosFordEcosport,lanadoem2012,
eFordKaConcept,umnovoconceitodesignparaoFordKaasercomercializadoemescala
globaleapresentadoem2013,masaindasemprevisodelanamento(MAGALHES,2013).
Oprojetoeproduodeambososmodelosfoilideradopelaequipedosestdiossatlites
damarcainstaladosnoBrasilnascidadesdeGravata(BA)eSoBernardodoCampo(SP).
Em anurio publicado no ms de Junho de 2013 com dados referentes a 2012, a
ANFAVEAAssociaoNacionaldosFabricantesdeVeculosAutomotores,fundadaem15
de maio de 1956, e que rene as empresas fabricantes de autoveculos (automveis,
comerciaisleves,caminhes,nibus)emquinasagrcolasautomotrizes(tratoresderodase
de esteiras, colheitadeiras e retroescavadeiras) com instalaes industriais no Brasil
compilou e divulgou importantes estatsticas sobre as indstrias de automveis instaladas
nopas,bemcomoseudesempenhoemrelaosparesinternacionais.
No escopo da presente pesquisa, considerouse apenas os dados referentes aos
autoveculos, especificamente os automveis e comerciais leves. De acordo com a
publicao, o Brasil figura como o stimo maior produtor de veculos do mundo,
apresentando3.387unidadesfabricadassomentenoanode2012,recebendoinvestimentos
crescentes por parte das matrizes das empresas j instaladas e de novas empresas que

32

buscam entrar no mercado nacional. Tambm a indstria de autoveculos respondeu por


cercade18,7%doPIBIndustrialdopasnoanode2012,faturandocercade90bilhesde
dlares no mesmo ano (ANFAVEA, 2013). A anlise dos dados apresentados pelo relatrio
revelouaimportnciadosetorparaaeconomiaesociedadebrasileiras,sendosignificativas
ascontribuiesdaindstriaautomotivaparaodesenvolvimentodopas,gerandovolumes
de exportao, alm de desenvolver tecnologia e conhecimento, capacitando cidados na
reaindustrial,criandosignificativaquantidadedepostosdetrabalhodiretoseindiretos.
Nosentidodeaprimorarconstantementeaproduodosetoregarantiraampliao
depesquisasparaoprojetodoprodutoautomobilstico,ogovernobrasileirolanou,noms
de Setembro de 2012, o programa InovarAuto ou Programa de Incentivo Inovao
Tecnolgica e Adensamento da Cadeia Produtiva de Veculos Automotores, que tem por
objetivoestimularoinvestimentoeacompetitividadedaindstriaautomotivanoBrasilpor
meio do investimento em pesquisa e desenvolvimento para a fabricao de veculos mais
econmicoseseguros.OProgramaInovarAutofazpartedapolticaindustrial,tecnolgicae
de comrcio exterior chamado Plano Brasil Maior, e concede benefcios em relao ao
Imposto sobre Produtos Industrializados (IPI) para as empresas que estimularem e
investirem na inovao e em pesquisa e desenvolvimento dentro do pas (BRASIL, 2012).
Esperase que at 2015 o Programa levantar mais de R$ 50 bilhes em investimentos no
setor,panoramaessequepodefavorecerodesigneapesquisaemdesignbrasileiros,uma
vez que se abre a possibilidade de que parte desses investimentos sejam aplicados no
somenteemtecnologiasemaquinrios,mastambmnodesenvolvimentoeaprimoramento
deprojetosdedesign.

3.2Afabricaodeautomveiseaatuaodosdesigners:aspectoshistricos

A inveno e o desenvolvimento do automvel se interrelacionam com a prpria


evoluodosmeiosdeproduoedasociedade.Noh,portanto,umadataexata,aqual
possasertomadacomomarcoinicialdaproduodesteobjeto.Aexemplodetantosoutros
artefatosfrutosdacriaohumana,osurgimentodoautomveldeuseapartirdeumasrie
derevoluestcnicasempreendidasnodecorrerdosanos,resultantes,emsuamaioria,de
invenes aliadas a uma srie de procedimentos empricos os quais resultaram em novas
descobertas.Desdeainvenodaroda,atribudahistoricamenteaospovosquehabitavama

33

Mesopotmia (VIEIRA, 2008 p.1920), passando pelo desenvolvimento da metalurgia e do


asfalto,datadosdemilharesdeanosantesdeCristo,muitasforamasmudanas,incluindoa
aberturadasprimeirasestradas,feitoatribudoaosromanosedatadodecercade312a.C
(VIEIRA, 2008 p.30). Mais frente no tempo, durante a Idade Mdia, inmeros avanos
foramconquistadosemtermosdemobilidadedecargas,paraasquaisosprimeirosveculos
sobrerodasforamempregados.Surgiramnesteperodotambmasprimeirascontribuies
inventivasvisandomobilidadehumana.NotadamenteentreofimdaIdadeMdiaeincio
da Idade Moderna dentro do movimento cultural da Renascena cabe destacar as
contribuies de Leonardo da Vinci e seus estudos de engenharia, os quais se tornaram
referncias para projetos futuros de mobilidade, aeronutica, engenharia mecnica, entre
outroscamposdoconhecimento.
No perodo da Idade Moderna com incio em meados do sculo XV at fins do
sculoXVIIImuitosforamoscontributosparaosexperimentosemtermosdemobilidade.
Disseminouseousodascarruagenseamplosforamosepisdiosdedescobertas,osquais
culminaram com o aprimoramento de invenes mecnicas e com o surgimento dos
motoresvapor.Apartirdestes,deuseoinciodeumperododevelozestransformaes
tcnicasconhecidocomoRevoluoIndustrial.Talrevoluoacompanhouecontribuiupara
asmudanas,asquais,entrefinsdosculoXVIIeinciodosculoXIX,marcaramoincioda
IdadeContempornea,aqualperduraatosdiasatuais.
Durante a Revoluo Industrial ergueramse fbricas, e surgiram ao seu redor as
primeiras aglomeraes urbanas, originando assim as grandes cidades. O perodo foi
marcado por invenes significativas para o avano da mobilidade e, no futuro, para a
criao do automvel. Ao longo deste perodo, como ressalta Vieira (2008, p.96130),
tiveram papel significativo o surgimento dos trens e alguns veculos vapor; a criao e
construodasferrovias;osprimeirosmotorescombustointernaeexterna;adescoberta
de potencialidades industriais da borracha e seu processo de vulcanizao, patente n
3.633deCharlesGoodyearem1844,dandoorigemaospneus;osdiversosestudosetestes
com combustveis; a fabricao do ao; o revestimento asfltico criado por Edward J. de
Smedt,datadode1870eaprimoradopeloinventorem1872,eomotorgasolina.
Tais invenes entre muitas mais foram imperativas para o surgimento dos
primeirosautomveisedasprimeirasindstriasfabricantesdeveculosapartirdemeados
dosculoXIXemdianteconstituindo,assim,umdosmaisimportantessetoresindustriais

34

do mundo na atualidade. Neste cenrio, a origem do profissional hoje conhecido como


designerdeautomveisremontaorigemdoprofissionaldesenhistaindustrialempregado
pelaindstria,oqualcomeouasurgirapartirdoperododaRevoluoIndustrial,noquala
inserodamecanizaonosmeiosdeproduofoiacompanhadaporumaradicaldiviso
dotrabalho,umavezqueparaosartefatosproduzidosindustrialmente,aformadetrabalho
tpicadoartesanatonaqualprojetoeproduoeramexecutadospelomesmotrabalhador
ficou cada vez mais obsoleta. Tal mudana organizacional ocorreu no sculo XVIII (FORTY,
2007,p.43),naqualumdosaspectosquemarcaramatransiodafabricaooficinalparaa
industrial foi o uso de projetos ou modelos de base para a produo seriada. Foi neste
contexto que se constituiu a profisso de desenhista industrial ou designer, como ressalta
Schneider:

Acriaodosobjetos(trabalhomental)easuaproduo(trabalhodasmquinas)
tornaramse atividades distintas. Aqui, na diviso industrial do trabalho, surgiu a
modernaatividadedeprojetodeprodutos,surgiuodesignindustrial.Jnoeram
osartesosqueproduziamamaioriadosobjetoselhesdavamforma.(SCHNEIDER,
2010,p.16).

Oautoraindadestacaque,comoresultadodestamudana,osempresriosdonosde
manufaturas ou fbricas [...] encarregavam os ento denominados projetistas ou
fazedores de amostras (tambm chamados de desenhistas ou modeladores) de
desenvolverem os produtos que depois seriam produzidos pelas mquinas. A formao
destes profissionais ocorria em parte nas escolas de desenho ou de arte, ou os mesmos
obtinham seus juzos de gosto no entorno das academias de arte. Aproximadamente em
1800,otrabalhodeprojetistatornouseentoumaprofissoindependentee,porvoltade
1850, o termo designer j era utilizado para fazer referncia a este profissional. Como
Cardoso(2012)destaca:

Entre1850e1930aproximadamentetrsgeraesdenovosprofissionaisalguns
j apelidados de designers dedicaram seus esforos imensa tarefa de
conformar a estrutura e a aparncia dos artefatos de modo que ficassem mais
atraentes e eficientes. Sua meta era nada menos que reconfigurar o mundo com
confortoebemestarparatodos.(CARDOSO,2012,p.16).

35

Para os fabricantes industriais, empregar um designer, alm de garantir a


padronizaodeprojetos,aindaresultavaemaprimoramentonoprocessoprodutivo,maior
controle sobre as etapas de trabalho e economia em termos de remunerao de mo de
obra especializada. Para Cardoso (2008, p. 33) Separando os processos de concepo e
execuo, e desdobrando esta ltima em uma multido de pequenas etapas de alcance
extremamente restrito, eliminavase a necessidade de empregar trabalhadores com alto
grau de capacitao tcnica. Tornavase suficiente, portanto, a contratao de um bom
designer para desenvolver o projeto, um gerente para supervisionar a produo e muitos
trabalhadoressemqualificaoparaexecutarasetapasemsuamaioriamecanizadas.
medidaqueamecanizaodaproduoseestabelecia,acategoriaincipientedos
designersfoiseconstituindocomo profissional,eovalormonetriodoprojetosetornava
mais explcito. Em pouco tempo, os empresrios da indstria perceberam que o custo
envolvido na criao de um padro ou o modelo de base ou mesmo a compra de tal
padro/modelodeumdesignerindependenteeranicoesuapossibilidadedereproduo
ilimitada, o que tambm garantia s empresas grande lucratividade. Cabe destacar que o
nvel de mecanizao da produo era bastante variado de uma empresa para outra. Em
algumas, determinados processos ainda eram executados mo sendo as primeiras
montadorasdeautomveisumexemplodestas.
Com o tempo, a dinmica industrial foi beneficiada por polticas e investimentos
governamentaisemdiversospases,poreventoscomoasgrandesexposiesinternacionais,
pelo surgimento de indstrias concorrentes para os mais diversos setores, alm das
inmerasinovaesemtermosdemquinasecomponentesquesesucediamacadanova
descoberta de materiais e aprimoramento de processos. Assim, a expanso da produo
industrial ocorreu de maneira importante e, nas primeiras dcadas do sculo XX, uma
variadagamadeprodutoseraproduzidaemsrieapartirdeprojetosprconcebidos.
Apartirdestesdesenvolvimentos,umadasreasdegrandeimpactotantoemtermos
da produo de inovao e projeto, quanto pelo significativo papel desempenhado na
Histria da indstria mundial como um todo, merece lugar de destaque a indstria
automotiva. A fabricao de automveis resultou da juno de diferentes descobertas
tecnolgicasedemateriais,sntesedoesforodeempresrioseinventores,osquaismuitas
vezes de maneira emprica foram responsveis por avanos que deram origem a um dos
objetos de uso que modificaram em grande medida a cultura e a sociedade. O

36

desenvolvimentodocarroocorreuinicialmentedemaneiralenta.Produzidocomoobjetode
luxoepormeiodetcnicasartesanais,ocarroeramontadoevendidoempoucasunidades.
Noincio,muitosmodeloseramproduzidosemfbricasdemquinaseferramentas,como
porexemplo,aempresafrancesaPanhardeLevassorouP&L,que,em1894,eraaprincipal
companhia automobilstica do mundo (WOMACK et al 2004, p. 9) e adotava o Systme
Panhard de montagem, o qual era composto pela configurao: motor alocado na frente,
tracionandoasrodastraseirascomospassageirossentadosemfilaatrsdele.
Eentre as muitas invenes e modelos produzidos e testados, a maior parte do
desenvolvimento inicial dos automveis se deu na Europa Ocidental, sendo a P&L um
exemplodetalpioneirismo.Entretanto,foinosEstadosUnidosqueoveculodeproduo
emmassaebaixocustofoipopularizado,inicialmenteem1901pelaOldsmobile,pormeio
daproduodeumveculocompactosemelhanteaumacarruagem,eposteriormenteem
1908,comoModeloTdaFord.EntreofinaldosculoXIXeinciodosculoXX,muitasdas
marcasatualmenteconhecidasjhaviamsidolanadasecontavamcominmeraspatentes
como fabricantes de peas, motores e mesmo automveis, entre elas a Peugeot, Rolls
Royce,Bugatti,Renault,Fiat,FordeMercedes(VIEIRA,2010p.176334).
Os primeiros projetos de veculos no envolviam um profissional desenhista
industrial dedicado ao design do carro. Em geral estavam envolvidos no projeto, alm de
engenheiros e do empresrio fabricante, os prprios trabalhadores das empresas
montadorasouprestadoresdeserviodeoficinasautnomascomamploconhecimento
tcnico formado a partir da prtica adquirida no diaadia da fabricao de peas e
componentes para o carro. Tais trabalhadores conheciam em detalhes os princpios de
mecnica e os materiais com que trabalhavam. Nos sales de empresas montadoras os
veculos eram produzidos de maneira personalizada objetivando atender ao gosto dos
clientes.Sobasupervisodosengenheiros,osmontadoresencaixavamaspeasfornecidas
de maneira artesanal, ajustando suas medidas, buscando assim alinhar cada pea na
composio do veculo como um todo. De acordo com Womack et al (2004, p. 12), a
produoartesanaldeveculosapresentavacomocaractersticas:

Foradetrabalhoaltamentequalificadaemprojeto,operaodemquinas,
ajuste e acabamentos, na qual muitos trabalhadores progrediam atravs de
umaprendizadoabrangendotodooconjuntodehabilidadesartesanaispor
vezestornandoseprestadoresdeserviosparaasmontadoras;

37

Organizao da produo descentralizada embora concentrada em uma


mesma cidade na qual a maioria das peas e grande parte do prprio
projeto do automvel vinha de pequenas oficinas autnomas, sendo o
sistema

de

compras

montagem

coordenado

por

um

proprietrio/empresrio responsvel pelo contato direto com todos os


envolvidosnoprojetocomoconsumidores,empregadosefornecedores;

Emprego de mquinas de uso geral perfurao, corte entre outras


operaesemmetalemadeiranasvriasfasesdemontagem;

Baixovolumedeproduodemiloumenosunidadesdeautomveisporano,
sendo 50 ou menos derivados do mesmo projeto, e mesmo entre estes 50
noseproduziamsequerdoisidnticos,umavezqueatcnicaartesanalpor
si produzia variaes. Obviamente como todo setor produtivo, as primeiras
montadoras tiveram de enfrentar crescente concorrncia de empresas as
quais produziam veculos de maneira semelhante: Por volta de 1905
centenas de companhias na Europa Ocidental e Amrica do norte estavam
produzindoautomveisempequenosvolumeseusandotcnicasartesanais
(WOMACKetal2004,p.12).

Osanosqueseguiramverificaramamaturidadecrescentedaproduoindustrial,a
produodenovosmaquinrioseotimizaodeprocessosprodutivosparaafabricaode
produtos em geral e tambm do automvel. A produo artesanal de veculos, entretanto
nodeixoudeexistir.EmboraempresascomoaP&Lnotenhamsobrevividoaosaltoparaa
produo em massa verificado posteriormente especialmente aps a Primeira Guerra
Mundial seu mtodo artesanal de produo inspirou o desenvolvimento de empresas
dedicadas a este tipo de produo e que perduram at os dias atuais. Embora adotando
novas tecnologias, tais marcas conservam a tcnica artesanal em significativas partes do
projeto, trabalhando e montando componentes dos carros a partir de projetos
personalizadospeloclienteedevendaexclusivaalgunsexemplosdestasempresassoas
marcasAstonMartineBentley.
Apartirdocrescimentodonmerodeempresasquesededicavammontagemde
veculos,aproduoartesanalcomeouarevelarsuasdesvantagens.Oscustosdeproduo
eramelevados;opblicoconsumidorerarestritoapenasosmuitoricostinhamcondies
de arcar com o valor do produto; cada carro produzido assemelhavase muito a um

38

prottipo, o que oferecia riscos reais aos ocupantes; a falta de testes sistemticos dos
veculosproduzidosnogarantiaaqualidadeedurabilidadedoproduto.
Alm destes fatores, cresceram tambm em nmero e velocidade as descobertas
tecnolgicas envolvendo projetos de produtos em geral, e tambm os de automvel. Isto
no significou, contudo, que as pequenas oficinas e os prprios artesos conseguissem
produzir tecnologias no mesmo ritmo, uma vez que seus recursos no permitiam que
perseguisseminovaestecnolgicasfundamentais,asquaisseriamfrutodeinvestimentos
em pesquisas sistemticas e no apenas de tentativas isoladas um sistema que apenas
grandes companhias teriam condies de executar. Assim, tais limitaes esboaram um
cenrio favorvel ao surgimento de uma nova concepo de produo, a qual viria a
acontecer com a contribuio do americano Henry Ford, empresrio responsvel pela
introduodalinhademontagemnaproduodoautomvel,formandoasbasesdosistema
deproduoemmassa.
Em verdade, foi aps a disseminao das tcnicas de produo em massa e do
consequenteaumentodoconsumo,queaforteconcorrnciaentreasempresasincludas
asfabricantesdeautomveisforoumelhoriasnaproduoenoprojeto,trazendocomo
consequncia a especializao dos profissionais envolvidos, favorecendo a formao do
profissionaldesigner,comoSchneider(2010,p.94)complementaComacrescentepresso
da concorrncia, por exemplo, no setor automobilstico, o design tornouse um fator
importante para a diferenciao dos concorrentes no mercado. Ao mesmo tempo, novas
descobertastambmpermitiramummaiordesenvolvimentodoatentotmidopapeldo
design na fabricao de automveis originalmente mais orientado pelos aspectos de
engenharia. Um exemplo destas inovaes que foram absorvidas pelas empresas foi a
adoo em produo da tinta laca de secagem rpida desenvolvida pela DuPont,
denominadaDUCO(nitrocelluloselacquer),aqualpodiaseraplicadaporpistolaepermitiua
introduodecoresdeacabamentovariadasnosprojetos.Antes,oscarroseramfabricados
apenasnacorpreta,desecagemmaisrpida(LARICA,2003,p.74).Taisavanos,aliados
implantao de diversas linhas de montagem em grande escala nos Estados Unidos e na
Europa, permitiram que o volume de produo de carros tivesse aumento significativo,
ampliandotambmaconcorrnciaeocampodeatuaododesigncomoconsequncia.
No decorrer do sculo XX, notadamente o perodo entre e psGuerras, o que se
presenciou foi uma ampla gama de invenes ou novas aplicaes para as tecnologias

39

disponveis.Nestecenrio,tambmaespecializaodamodeobraconsolidouopapeldo
profissional projetista ou designer tambm nas empresas fabricantes de automveis, os
quais eram responsveis por produzir a interface entre as aplicaes das tecnologias, a
indstriaeosconsumidores.Assim,constantementeacategoriafoidesafiadaadesenvolver
novas formas e expresses para as sucessivas descobertas. A profisso de designer teve
grandeimpulsonoinciodacriseeconmicamundialqueresultounarecessode1929,uma
vez que os fabricantes reconheceram a importncia de uma produo diferenciada e uma
configuraoconsistenteparaincrementarasvendas.DeacordocomHeskett(2006):

Foi nesse contexto econmico que surgiu uma nova gerao de desenhistas
industriais.Elesvinhamdediversasformaeseseusmtodoserealizaeseram
muitovariados,masoresultadodeseutrabalho,odesign,seriareconhecidocomo
caracterstica essencial da atividade comercial e industrial, um elemento de
especializaodentrodadivisodetrabalhoimplcitanaproduoenasvendasem
massa.(HESKETT,2006,p.107).

Nos anos que se seguiram, sendo o design um dos principais fatores responsveis
pelo equilbrio entre os interesses empresariais e as necessidades dos usurios, de acordo
comLbach(2001,p.121)suaaceitaodentrodasempresassedeuprincipalmenteaps
1945, quando as mesmas de fato comearam a estruturar os prprios setores de design.
Mesmo antes de 1945, os denominados departamentos de estilo foram grandes
empregadoreseigualmenteimportantesbasesdetreinamentoparaosdesignersdapoca.
Tambm neste perodo surgiram os designers autnomos ou consultores, os quais
mantinhamescritrioseprestavamserviosavriasempresasinteressadas.
Os avanos tecnolgicos alcanados no perodo entre e durante as Guerras,
culminaramcomodesenvolvimentoeaproduodenovosmateriais,osquaissetornaram
matriaprimaparaosdesigners.Assim,aindstriaautomotivanosomentefoibeneficiada
porestesavanos,mastornouseelaprpriaumamplocampodepesquisaevetordenovas
tendncias e uso de materiais. O design de automveis carrega no apenas os gostos
vigentes em determinada poca, mas tambm todo um repertrio formal e de materiais
que registra a evoluo no apenas das tcnicas de construo, de mecnica ou meios de
produo deste objeto, mas tambm um testemunho da evoluo do design como um
todo ao longo da histria. Sendo um setor no qual investimentos em pesquisa e

40

desenvolvimentosofeitosnaordemdosmilhes,odesignautomotivosetornoureferncia
noapenasparaseuspares,mastambmparadiversasoutrasreasdaprofisso.

3.3OdesigneosdesignersautomotivosnoBrasil:doincioatualidade

Aproduoecomercializaodeveculosdesdeainstalaodasprimeirasindstrias
noBrasilvmsedestacandoecomopassardosanosconstruiuocenrioparaosurgimento
de projetos de design automotivo no Brasil. Nos ltimos cinquenta anos, as matrizes das
indstrias de grande volume verificaram no pas um mercado promissor, bem como um
territriocomgrandepotencialparaatenderprincipalmentearegiodaAmricaLatina.Tal
potencial, fez com que muitas empresas instalassem estdios de design no Brasil,
empregandoosprimeirosdesignersdoramo.
Paralelamente produo industrial, outros tantos designers brasileiros
notadamenteapartirdofimdadcadade1960estiveramempenhadosemdesenvolver
projetos inovadores parte do grande mercado. A criao e desenvolvimento destes
modelos chamados de foradesrie eram, em sua maioria, fruto da unio de designers,
engenheiros e empresrios brasileiros entusiastas do automobilismo Gurgel, Puma, Aldo
Auto Capas/Miura, Lafer, Santa Matilde, Renha, Lautomobile, Furglass, Glaspac entre
outras,surgiramnessecontexto.
As criaes desses projetos tinham como objetivo preencher lacunas na
comercializaodealgunsmodelos,osquaisnoeramproduzidosnoBrasilesportivos,por
exemploecujosusuriosouempresasinteressadosenfrentavamgrandesdificuldadesna
importao de peas e veculos montados, devido s medidas restritivas impostas pelo
governobrasileiroinicialmentenadcadade1950comoobjetivodeprotegeraincipiente
indstriainstaladanopaseposteriormentetornandoaindamaisfortesasrestriesaos
importadosnadcadade1970,visandosegurarodesenvolvimentotecnolgicodosmodelos
produzidospelasmultinacionaisnoBrasil,paramanterospreospraticados.
Como consequncia deste cenrio, surgiram novas experimentaes em projetos e
produesdeveculosforadesrie,refletidosnaproduoderplicasdemodelosfamosos,
buggiesproduzidosemfibradevidro,almdamultiplicaodeprofissionaisespecializados
namodificaodeveculosoriginaisdefbrica.Essassoluesnacionaisganharamforana
dcada de 1980 e, em um curto espao de tempo, vrias empresas surgiram dedicadas

41

criao, produo ou modificao de veculos Dacon, Envemo, Souza Ramos, Sultan,


Engerauto, Sorana, Caltabiano, entre outras buscando atender demanda por modelos
diferenciados no suprida pelas indstrias aqui instaladas. Percebese, portanto, que a
criatividade e atuao dos primeiros designers automotivos brasileiros no se restringiram
s grandes indstrias, antes, se fez da fora de vontade e comprometimento com a
produo de projetos bem executados e inovadores, independente dessa atuao se fazer
dentroouforadasmultinacionais.
Noqueserefereatuaodentrodaindstriaautomotiva,comopassardosanos,
os estdios das subsidirias brasileiras de grandes empresas mostraram sua capacidade
criativa e conquistaram espao diante dos desafios econmicos e mercadolgicos que se
apresentaram no setor. A importncia da produo do pas voltada regio latina
permanece, sendo cada vez maior a participao por parte dos estdios brasileiros no
desenvolvimentodeprojetosglobaisosquaissocomercializadosaoredordomundo.
Opapeldodesignernaindstriavemsemodificandoaolongodosanos.Apartirdo
empregodosprimeirosprofissionaisprojetistas,aprofissoseestabeleceueseadaptous
constantes mudanas dentro do setor industrial e do ambiente sociocultural, firmandose
comoumcampodeatuaodeextremarelevnciatambmnoBrasil.ParaLandim(2010,p.
24e25)odesignenglobaamplavariedadedefunes,tcnicas,atitudes,ideiasevalores.A
autoracompleta:

ummeioatravsdoqualexperimentaesecompreendeomundoquenosrodeia,
desdebensdeconsumoeembalagensatsistemasdetransporteeequipamento
deproduo,enopodesertotalmentecompreendidoforadoscontextossocial,
econmico, poltico, cultural e tecnolgico que levaram sua concepo e
realizao.(LANDIM,2010,p.24,25).

Neste sentido, cabe ao designer a tarefa de projetar produtos, imagens e servios


que atendam aos desejos e necessidades da sociedade, levando em considerao as
variaessocioculturais,econmicasepolticasdeseutempo,comoressaltaOno:

Considerandose que o design envolve planejamento, seleo de modos de


pensamentoevalores,entendesequeodesignercorresponsvelpelasrelaes
que se estabelecem entre os artefatos e as pessoas, bem como pelas suas
implicaesnasociedade.(ONO,2006,p.1).

42

O designer desempenha, portanto, importante papel ao participar da construo


dinmica da paisagem cultural visvel da vida cotidiana ao projetar artefatos, agregando
funes e significados variados na concepo de projetos com os quais os seres humanos
interagem (ONO, 2004, 2006; HESKETT, 2008; NORMAN, 2008; LANDIM, 2010; BONSIEPE,
2011). Um produto do design modificase conforme avanam as tecnologias e materiais;
otimizamse os processos industriais; modificamse as sociedades e suas culturas. Neste
sentido,areasofreinflunciadiretadestasmudanasdemaneiraconstante,paraOno:

No desenvolvimento de produtos industrializados, o design sofre, por um lado, o


impacto dos desenvolvimento tecnolgicoe dos processos tcnicos, e, por outro,
aspressesdastransformaesculturaisdecorrentesdosurgimentodenovosusos
enecessidades,promovidospelosartefatosquesoinseridosnasociedade.(ONO,
2006,p.29).

A contemporaneidade reflete um tempo marcado pelo avano das mais variadas


tecnologias, caracterizada pela ampliao de horizontes por meio de novas mdias,
processoseservios,bemcomopelaforteinteratividadequecrianovasredesderelaes
emescalaglobal,ampliando,destaforma,opanoramadeatuaodoprpriodesignedos
profissionaisdestarea,fomentandonovasdescobertas,criaeseinovaes.ParaCardoso
(2012, p.25), tratase de um mundo complexo, no qual o autor entende a complexidade
como [...] um sistema composto de muitos elementos, camadas e estruturas, cujas inter
relaescondicionameredefinemcontinuamenteofuncionamentodotodo.
Neste cenrio global e complexo, cada vez mais exigido do designer atuante no
mercadoacompanharetraduzirestemundonaformadeprojetosdedesignquelevemem
considerao o usurio, o mercado, a produo, os custos envolvidos, a concorrncia, as
novastecnologias,materiaiseprocessosdefabricao,almdaergonomiaeengenhariade
produo. Atualmente, esto sob a tutela do profissional com diferentes graus de
autonomia no apenas a atividade projetiva, mas tambm empreender junto s demais
reas o desenvolvimento das diferentes fases do projeto, alinhando expectativas da
empresaedousurionaproduodoproduto.
Inseridos no sistema econmico pautado pelo modo de produo capitalista, os
designers alm dos desafios intrnsecos prtica, lidam com diversos obstculos em sua
trajetriaprofissional.Emboraporvezesmesmoimbudodeticaprofissionalnoesteja
aoalcancedodesigneratomadadedecisoemcertosnveisdentrodasempresas,istono

43

significa sobremaneira que o profissional seja alienado perante a realidade social e de


mercado sobre a qual atua. Para alm de fatores econmicos e de mercado, tambm
incumbncia do designer conhecer e considerar as especificidades e necessidades sociais,
ambientais e culturais ao seu redor, visando uma prtica abrangente e transformadora.
Nestesentido,GuiBonsiepe(2011,p.21)alertaparaaimportnciadeodesignerutilizarse
de suas capacidades projetuais [...] para interpretar as necessidades de grupos sociais e
elaborar propostas viveis, emancipatrias, em forma de artefatos instrumentais e
semiticos,umaprticaqueeledenominacomohumanismoprojetual,eprossegue:

Essa afirmao no deve ser interpretada como expresso de um idealismo


ingnuo e fora da realidade. Ao contrrio, uma possvel e incmoda questo
fundamental que qualquer profissional, no somente os designers, deveria
enfrentar. Tambm seria errado interpretla como uma exigncia normativa ao
trabalho do designer, que est sempre exposto s presses do mercado e s
antinomiasentreoqueeoquepoderiaserarealidade.Aintenoaquimais
modesta: formar uma conscincia crtica frente ao enorme desequilbrio entre os
centros de poder e os que esto submetidos a eles. A partir desta conscincia
crtica, podemse explorar espaos alternativos, no se contentando com a
petrificaodasrelaessociais.(BONSIEPE,2011,p.21).

Adaptarsesmudanasconsequentesdeummundoglobalizadoapenaspartede
uma responsabilidade que ultrapassa o mero abastecimento de mercados com produtos
novoseredesenhados.Significa,antes,realizarumaprticainovadora,pormconscientede
seupapeledaimportnciadosobjetosresultantesdestetrabalhojuntosociedade.
Apesardaatividadeestarnaatualidadepermeadapelaideologiadavendaaqualse
impscomocondiodetrabalhoaprticadodesignerdevetercomoobjetivoprincipal
produzir para atender s necessidades do usurio/sociedade para a qual trabalha e
desenvolve estas inovaes. Desta forma, tornase imperativo o senso crtico apurado por
parte destes profissionais, tanto no que concerne prtica de projeto, quanto aos efeitos
que o produto resultante do mesmo ter quando disponibilizado no mercado e acessado
pelosusurios.partedarotinadosdesignersatuantesnoBrasilenomundo,acompanhar
o processo de design, estabelecendo as conexes necessrias entre as demais reas
envolvidas no projeto, aglutinando informaes e negociando estratgias de ao de
maneira que o produto resultante materialize um objeto de valor significativo para o ser
humano.atravsdaprticacoerentedestesprofissionaisqueodesignpodeconstituirse

44

em prtica emancipatria, como destaca Ono (2004 apud LANDIM, 2010, p.2223), desde
queparticipedodesenvolvimentodeprodutosquepromovamoaperfeioamento,aauto
expressoeasoberaniadosindivduosedassociedades,inclusivedaquelesquevivemem
condiesdepobrezaemargemdosmercadoseconmicos.Tratase,portanto,deuma
profissoquesintetizagranderesponsabilidadeeamplainflunciaperanteasociedadena
qualosprojetosresultantesdeseutrabalho,permeiamdemaneiradiretaeemvariados
nveisavidadosindivduos.Apresentepesquisaconsiderataisaspectosnainvestigao
do papel desempenhado pelos designers de automveis dentro da indstria automotiva,
tecendoconsideraesapartirdosdiscursosdosprpriosprofissionais,umavezque,como
destacado por Heskett, a viso dos mesmos acerca de sua atividade uma das reas de
influnciadocontextodeatuaonaprticadodesign:

Emtermosgerais,trsreasdeinflunciadocontextosorelevantesparaaprtica
do design: a organizao profissional do design, ou como os designers vem a si
mesmos; o contextocomercial noqual est inseridaa maior parte das atividades
de design; e as polticas governamentais, que variam entre os pases, mas na
maioriadelespodemterumadimensosignificativa.(HESKETT,2008,p.119).

OdiscursonestecasodosprofissionaisdesignerssegundoKrippendorff(2006in
MEYER,2011,p.32),sintetiza,apresentaasseguintescaractersticas:1.constriseemum
corpodematriatextual;2.mantidovivodentrodacomunidadedeseuspraticantes;3.
Institucionalizaassuasprticasrecorrentes;4.desenhaosseusprprioslimites;5.justificaa
suaidentidadeparaopblicoexterno.Considerandosequeaconstruodeumdiscurso
valese de procedimentos distintos, que variam desde a produo de teorias abstratas
experincia concreta da realizao de prticas profissionais, analisar o contedo presente
nosdiscursosdosdesignersautomotivosparticipantesforneceelementosimportantespara
apesquisa,nabuscaporconhecermelhorasconcepesdosmesmosacercadeseucampo
deatuaoedesuaprpriaprtica,comoMeyer(Ibid.,p.32)destaca:

A imagem que os designers fazem dos domnios da sua profisso um elemento


vivododiscursoprofissional,dizrespeitoaoslimitesdaprofissoeanunciatraos
caractersticosdodesignparaopblicocomum.(MEYER,2011,p.32).

Cabe,nestemomento,umbreveresgatehistricodainstalaoeconsolidaodas
indstrias de automveis no Brasil, bem como da atuao dos designers brasileiros neste

45

cenrio.Tambmpertinenteoregistrodevriasdasmaisnotveiscontribuiesdemuitos
destes designers na tentativa de promover o desenvolvimento de projetos nacionais
muitas vezes fora das indstrias multinacionais visando estabelecer as bases para uma
indstrianacional.Aatuaodosdesignersbrasileirosdentroeforadasindstriasresultou
na criao de projetos memorveis que vieram a se tornar cones do design automotivo
nacional,osquaisinspiramatosdiasatuaismuitosoutrosprofissionaisemformaooude
carreira.
OprimeiroveculoacircularporruasbrasileirasfoiummodeloPeugeotimportado
pelomilionriocafeicultorHenriqueDumontpaideAlbertoSantosDumontnoanode
1893.Jem1903,SoPaulotinhaseiscarros,enoanoseguinteassistiriaaoprimeiroboom
do setor: a frota paulistana cresceria quase catorze vezes chegando a impressionantes 83
veculos (ANFAVEA, 2006, p.94). Importa ressaltar o fato de que muitas das empresas
iniciaramsuasatividadesnopasapartirdeespaosalugadosparaareceptaoerevenda
de veculos montados, ou ainda, para a receptao de veculos completamente
desmontados sistema este denominado pela sigla CKD, empregada em substituio ao
termoeminglsCompletelyKnockedDownparamontagemnoBrasil,visandoreduo
de custos. Portanto, em um primeiro momento no se instalaram fbricas. Neste sentido
destacaCamargo:

A instalao da indstria automotiva no Brasil foi condicionada pela forma como


ocorreu a expanso da indstria internacional desde seu incio, ou seja, num
primeiro momento, a expanso feita via exportao de veculos montados e,
principalmente,deveculosnaformaCKDs;numsegundomomento,investimentos
diretoscomainstalaodeunidadesprodutivasverticalizadas.(CAMARGO,2006,
p.120).

AtaPrimeiraGuerraMundial,oBrasilapenasimportavaautomveismontados.Nos
anosqueseseguiram,ascondiesbrasileiras,taiscomoobaixocustodeproduo,mo
deobra barata e mercado consumidor pouco explorado favoreceram os primeiros
investimentosnoBrasil.
Nas pginas seguintes, divididos por dcadas, sero apresentados marcos do
desenvolvimento do design automotivo no pas, realizados tanto dentro da indstria de
automveis, quanto fora dela por meio de iniciativas de construtores e empresrios
atuantesnocenriobrasileiro.Asimagensapresentadassoregistrosdeapenasalgunsdos

46

muitos modelos representativos produzidos em cada poca, os quais foram dispostos em


umalinhadotempoproduzidapelaautoraeapresentadanoApndiceA.
Dcadasde1920,1930e1940
Aprimeiralinhademontageminstaladanopas,noanode1919,foiinauguradapela
Ford,aqualproduziaoModeloTpartirdosistemaCKD.Nestesistema,aspartesdoveculo
vinhamdesmontadasjuntamentedocumentaodeorientaoparaosprocedimentosde
montagem do veculo, de acordo com os padres Ford. A Figura 1 registra a fachada da
primeiramontadoradaFordinstaladanoBrasil.

Figura1PrimeirafbricamontadoradaFordnoBrasil

Fonte:Contagiros.Disponvelem:<http://contagiros.files.wordpress.com/2011/04/fordmontadoramais
antiganobrasil.jpg>.Acessoem:12/01/2013

Tambm neste sistema, no ano de 1925, a General Motors GM se instalou no


BrasilFigura2einiciouamontagemdeseusveculos,seguidapelaFiatnoanode1928.

Figura2InauguraodosescritriosefbricadaGeneralMotorsnoBrasilem1925.

Fonte:ANFAVEAASSOCIAONACIONALDOSFABRICANTESDEVECULOSAUTOMOTORESBRASIL.
IndstriaAutomobilsticaBrasileira50anos.SoPaulo,2006.Disponvelem:
<http://www.anfavea.com.br/50anos.html>.Acessoem:12/01/2013

47

Em1929,osetorsofreuoimpactodacriseeconmicamundial,fatoquenoimpediu
que no ano de 1930, a GM instalasse sua primeira fbrica no Brasil, na cidade de So
CaetanodoSul(SP).Todavia,apenasapsaSegundaGuerraMundialaindstriaautomotiva
retomariaofortecrescimento,umavezque,duranteoperododebeligerncia,ogoverno
brasileiro adotou uma poltica de substituio de importaes incluindo veculos e
autopeas. Como consequncia, asempresas brasileiras foram motivadas a produzir peas
nacionaisdemontagemereposio.Nestecenrio,GetlioVargas,entopresidente,criou
em1938,aestatalFbricaNacionaldeMotoresFNMdestinadaproduodemotores
paraaeronaves,eque,em1949,tornouseempresadeeconomiamistaparamontagemde
caminhes licenciados da empresa italiana Isotta Fraschini, a qual acabou falindo, sendo
substitudapelaAlfaRomeo.
AlmdaFNM,aVemag,empresa100%brasileirainiciousuasatividadesnoanode
1945,aqual,deacordocomOno(2004,p.150),foiestabelecidacomoobjetivoinicialde
montaredistribuirautomveisecaminhesStudebakers,eque,posteriormente,passoua
montar caminhes Kenworth, mquinas agrcolas MasseyFerguson e Harris, e caminhes
ScaniaVabis.
Dcadade1950
Osanosde1950podemserconsideradosummarcoparaahistriadaindstriade
automveis no Brasil, dcada a qual, ainda de acordo com Ono (2004, p.148) [...] foi
marcada por uma grande expanso rodoviria, com a produo em larga escala de
automveisecaminhes.Defato,naquelapoca,deacordocomaANFAVEA(2006,p.98),
importavase 100 mil veculos/ano, sendo 60% caminhes, alm de autopeas, dados que
superavam em valor o que o Brasil gastava com petrleo e trigo. Assim, o governo
nacionalistadeGetlioVargastomoucomomedidaarestriodeimportaeseemAgosto
de 1952, o ento presidente proibiu a importao de autopeas com similar nacional. Em
Marode1953,proibiutambmaentradadeveculoscompletos.AindaemMarode1952
VargascriouaSubcomissodeJipes,Tratores,CaminheseAutomveis,aqualeraligada
ComissodeDesenvolvimentoIndustrial.Naocasio,oalmiranteLcioMeira,defensorda
produodeveculosnacionais,presidiuacomisso,queconsideradaembriodaindstria
automotiva (ANFAVEA, 2006, p. 98). J em 1954, Vargas criaria a Comisso Executiva de
MaterialAutomobilstico.

48

Adcadadecinquentatestemunhouaconsolidaodaindstriaeatransformao
do automvel em mais do que um til meio de transporte, tambm um objeto de desejo
generalizado. Naquela poca, a publicidade relacionada ao setor ganhou destaque e
preencheu revistas com peas grficas comerciais. O pas atravessava um perodo de
incertezasapsodeclniodaculturacafeeirae,porisso,ogovernoediferentesempresas
visavam revitalizar e economia do pas por meio da indstria, caminho este tortuoso e
desafiador, uma vez que, para o florescimento da atividade industrial no setor, milhes e
milhesdedlaresseriaminvestidosnoprocessodenacionalizaodasmontadoras.Alm
destes fatores, quase no havia na poca trabalhadores habilitados, a tecnologia local era
incipiente,eadisponibilidadedecapitalparaaindstriadeautopeastambmeraescassa,
sendoainfraestruturadopas,portantoconsideradaprecria.
Noanode1950,aVolkswagenimportouoprimeiroFuscacommotor1200afim
detestarsuaaceitaonomercadobrasileiro,e,em23deMarode1953,foiinauguradaa
primeira montadora da Volkswagen do Brasil, instalada em armazm alugado na Rua do
Manifesto, bairro do Ipiranga, em So Paulo (SP), a qual iniciou os trabalhos com a
montagem da Kombi e do sed 1200, como pode ser visto na Figura 3. Em 1953, a Ford
comemorou 50 anos de fundao por Henry Ford e o volume de 40.000.000 de veculos
produzidos no mundo. A marca tambm inaugurou uma fbrica no bairro do Ipiranga, em
SoPaulo(SP),aopassoqueaGMadquiriuvastareadeterranacidadedeSoJosdos
Campos(SP)paraaconstruodefundiodemotoresesegundafbrica.

Figura3PrimeirainstalaodefbricadaVolkswagendoBrasilnobairrodoIpiranga
nacidadedeSoPaulo

Fonte:Vieira(Vol.3),2010,(adaptado),p.896.

Em 1955, as indstrias instaladas no Brasil criaram o Sindicato dos Fabricantes de


VeculosAutomotoresSinfaveaefundaramaAssociaoProfissionaldosFabricantesde

49

Tratores, Caminhes, Automveis e Veculos Similares do Estado de So Paulo. Em 15 de


Maiode1956,aindstriadeveculosagrupadanoSinfaveacriouaAssociaoNacionaldos
Fabricantes de Veculos Automotores Anfavea entidade civil que ganhou fora com o
passar dos anos e se estabeleceu como importante instituio de pesquisa e auxlio ao
desenvolvimentodosetor.
Nombitodasiniciativasbrasileiras,cabedestacarainda,em1956,olanamentodo
RomiIsettaFigura4oprimeirocarrofabricadonopas.Oprojetooriginalfoiconcebido
na Itlia do psguerra 1953 sendo construdo pela empresa IsoAutomoveicoli,
fabricante de motocicletas e triciclos comerciais. No ano de 1955, o projeto foi licenciado
paraaBMW,aqualrebatizouoautomvelcomoBMWIsetta. Noanoseguinte,oimigrante
italiano Comendador Amrico Emlio Romi, fundador da Romi fbrica de mquinas
agrcolas estabelecida em Santa Brbara do Oeste (SP) iniciou a produo do modelo
Isetta,denominadoRomiIsetta,emparceriacomoutrascolaboradoras:

Vriasempresasestiveramenvolvidasemsuafabricao.ATecnogeral,fabricante
demveisdeao,produziaacarroceria;aProbel,doscolches,faziaobanco;os
pneus eram Pirelli, o motor era feito aqui com base no da Iso italiana, e a Romi
faziaochassiemontavaosveculos.(VINHOLES,2008).

Embora o RomiIsetta tenha sido um modelo bem sucedido no mercado, o Grupo


Executivo da Indstria Automobilstica GEIA, instaurado em 1956 pelo ento presidente
Juscelino Kubitschek criou uma lei para obteno de subsdios, a qual classificava o
automvel em si como um veculo que deveria obrigatoriamente transportar quatro
pessoas.
Tal deciso prejudicou de maneira definitiva o potencial do veculo no mercado.
Desta forma, sem os benefcios fiscais, sem uma empresa para firmar parceria e sem
condies de produzir em larga escala com vistas reduo do preo do modelo, a Romi
Isetta tornouse invivel. Os modelos restantes foram montados at 1961, utilizando o
estoqueremanescentedafbricadaRomi,eototaldaproduonacionalchegousomentea
3milunidades.

50

Figura4LinhademontagemdaRomiIsetta(1956)

Fonte:Facobras,2012.Disponvelem:<http://www.facobras.com.br/blog/wpcontent/uploads/2012/10/1956
RomiIsetta.png>.Acessoem:12/01/2013.

Com a posse de Juscelino Kubitschek no ano de 1956 desenvolveuse uma poltica


que beneficiaria de maneira importante a indstria de automveis por meio do chamado
PlanodeMetas,pormeiodoqual,segundoOno(2004,p.150),[...]instauraramsemedidas
cambiais e tarifrias, voltadas promoo da instalao, expanso e diversificao da
indstria nacional, com especial enfoque no setor automobilstico, que figurava entre as
indstriasdemaioresefeitosmultiplicadores.
A criao do GEIA tinha por objetivo estimular a fabricao local e no somente a
montagemdeveculosnoBrasil,almdosPlanosNacionaisdaIndstriaAutomobilstica,os
quaiseramdirecionadosacaminhes,jipes,caminhonetas,caminheslevesefurges,cuja
fabricaofoiinicialmenteestimulada(ONO,2004)emboranocasodoRomiIsetta,como
visto,alegislaodoGEIAtenhaprejudicadodemaneiradecisivaopotencialdomodeloeda
empresa.Aindaemde1956aVemagproduziuaprimeiracaminhonetaDKWsoblicena
da Dampf Kraft Wagen DKW montadora alem integrante daAuto Union,
atualmenteAudidaAlemanha,comndicede60%denacionalizao.
EntendesepornacionalizaoousodepeasecomponentesfabricadosnoBrasil
(ANFAVEA,2006,p.103).UmdosmodelosdesucessocomercializadospelamarcanoBrasil
ficouconhecidocomoperuaDKWVemag,presentenaFigura5.

51

Figura5PeruaDKWmontadapelaVemagem1956

Fonte:Facobras,2012.Disponvelem:<http://www.facobras.com.br/blog/wp
content/uploads/2012/10/1956PeruaDKWVemag.png>.Acessoem:12/01/2013

J em 1957, a Volkswagen inaugurou sua fbrica na cidade de So Bernardo do


Campo (SP), produzindo a Kombi com um ndice de 50% de nacionalizao. A empresa
fechou aquele ano com 2.268 Fuscas e 522 Kombis produzidos. Entre os lanamentos da
FordnaqueleanodestacaramseapickupF100Figura6eocaminhoF600,esteltimo
oprimeirodaempresacomndicedenacionalizaode40%,sendotambmoprimeirocom
motoragasolinadoBrasil.

Figura6PickupFordF100

Fonte:QuatroRodas,2005.Disponvelem:
<http://quatrorodas.abril.com.br/classicos/brasileiros/imagens/0206_abre.jpg>.Acessoem:12/01/2013

Tambmem1957,houveainstalaodamarcasuecaScaniaVabisMotoresDiesel,a
FNM comeou a produzir caminhes, e a WillysOverland marca de veculos at ento
somenteimportadostambmentraemproduonoBrasil(ANFAVEA,2006,p.103),sendo
pioneiranainstalaodeumdepartamentodeestilo,comorecordaOno(2004):

AWillysOverlanddoBrasilfoiaprimeiraempresaautomobilsticaaconstituiruma
rea de design no pas, denominada, na poca, Departamento de Estilo.
Entretanto, a falta de profissionais com formao especfica em design levou a
empresa contratao de profissionais de outras reas relacionadas ao

52

desenvolvimento de produtos, tais como de modelos, ferramentaria, etc. e


contratao de vrios projetistas italianos, espanhis e norteamericanos. Mais
tarde, passouse a contratar pessoas da rea de design, sobretudo nos Estados
Unidos.(PIANCASTELLI,2001inONO,2004,p.156157).

Em23deJaneirode1958,aToyotachegouaoBrasilcomadenominaodeToyota
doBrasilIndstriaeComrcio.AempresainstalousenaRuaBoaVista,noCentrodacidade
deSoPaulo,e,emmenosdeumano,inauguroulinhademontagemnaAvenidaPresidente
Wilson,nobairrodoIpiranga.Oanode1959marcouolanamentodoprimeiroFusca95%
nacional na fbrica da Volkswagen em So Bernardo do Campo. O modelo foi o primeiro
automveldebaixocusto,responsvelpelamotorizaodemilhesdebrasileiros.Tambm
em1959foiinauguradaanovafbricaGMemSoJosdosCampos.Oanotambmmarcou
aprimeiravisitaaoBrasildeHenryFord,queassistiuaolanamentodocaminholeveF350
brasileiro. Neste mesmo ano estabeleceuse a Karmann Ghia do Brasil. A Toyota lanou o
modelo Bandeirante Figura 7 com 60% de nacionalizao, o qual seria fabricado at
2001, e a Scania inaugurou sua fbrica, fazendo seu primeiro motor no Brasil, enquanto a
fbricaSimcaentrouemproduo.

Figura7ToyotaBandeirante1979:lanadoem1959,foiummodelodegrandesucessodaToyota
atoanode2001,quandosuaproduofoisuspensa

Fonte:QuatroRodas,2006.Disponvelem:<
http://quatrorodas.abril.com.br/classicos/brasileiros/conteudo_187939.shtml>.Acessoem:12/01/2013

Dcadade1960
Noanode1960,apresidnciadoBrasilpassousmosdeJnioQuadros,e,nodia
25 de Novembro de 1960, aconteceu o primeiro Salo do Automvel de So Paulo no
Pavilho de Exposies do Parque do Ibirapuera. Em 1961, ocorreu a segunda edio do
evento, alcanando o nmero de 150 expositores compostos por montadoras, marcas de
autopeas,componenteseacessrios.Em1962,oentopresidenteJooGoulartinaugurou

53

afabricaScaniaemSoBernardo,eoalmiranteLcioMeirainaugurouafbricadaToyota
naestradadePiraporinha,emSoBernardodoCampo(SP).Jem1964,apsumgolpede
estado o Brasil entrou no perodo de regime militar sob o comando do general Castelo
Branco.Oregimedurariaatoanode1985comapresidnciarevezadapormilitares.
Emmeadosdadcadade1960,aVemagcriouseudepartamentodeestilo,oqualfoi
constitudo [...]com o apoiodogerentedefabricaodeento,AntniodePduaPrado
Santos, que defendeu que o melhor seria criar um setor especfico de design e de Ari
AntniodaRochaestagiriodaempresa(ROCHA,2002inONO,2004,p.161)eapartirde
ento,segundoOno(2004),foramdesenvolvidasnovascoresparaosveculos,buscousea
racionalizaodeprocessos,visandoevitarodesperdciodemateriais,entreoutrasmedidas
visando a adequao dos produtos ergonomia e ao aprimoramento do produto. Foi
tambm nesta dcada que comearam a surgir as primeiras iniciativas brasileiras de
construodeveculosnacionaisindependentesdegrandesindstrias.Estesprojetoseram
fruto da criatividade de designers e engenheiros aliada a investimentos de empresrios
entusiastasdoautomobilismo.
O interesse crescente da sociedade e dos empresrios sobre o automvel e o
potencialdoBrasilnacriaoeproduodeveculosestimulou,noanode1962,ainciativa
do brasileiro Caio de Alcntara Machado ento idealizador e promotor do Salo do
Automvel em premiar talentos do design automobilstico. Assim, tendo no nome uma
homenagemaoAlmiranteLcioMeiraprimeiropresidentedoGEIAnoanodesuacriao
em 1956, e encarregado do governo Kubitschek para os assuntos relacionados ao setor
automobilsticofoicriadooPrmioLcioMeiradeDesignAutomobilstico.
O concurso tinha por objetivo descobrir novos talentos do design. Sua primeira
edioocorreudentrodoterceiroSalodoAutomvel,em1962oqualapartirdaquele
ano passou a ser bienal. Entre os projetos premiados encontravase o veculo Itapuan
Figura8deautoriadeMrcioLimaPiancastelli,premiaoestaquegarantiuaodesignera
oportunidadedeestagiarnaempresaGhia,localizadaemTurim,naItlia,e,deacordocom
Ono(2004,p.168),emseuretornoaoBrasilatuounaWillysOverlande,apartirde1967na
VolkswagendoBrasil,naqualchefiouaequipededesignentodenominadaEstiloat
1992,perodonoqual,juntamenteaoutrosdesigners,foiresponsvelpelodesenvolvimento
deimportantesprojetossendoosgrandesmarcososmodelosBrasliaeSP2contribuindo
paraodesenvolvimentododesignnoBrasil.

54

Figura8ModelodoprojetoItapuan,deautoriadeMrcioLimaPiancastelli

Fonte:QuatroRodas,jan.1963,p.28.Disponvelem:<http://quatrorodas.abril.com.br/acervodigital/>.Acesso
em:13/01/2013.

No Brasil da dcada de 1960, alm do concurso de design mencionado, entre as


iniciativasbrasileirasdecriaoeproduodeumveculonacional,cabedestacarocasoda
Indstria Brasileira de Automveis Presidente IBAP. Criada no ano de 1963 pelo
empresrioNlsonFernandes,aempresaerafinanciadacompletamenteporcapitalnacional
e pretendia desenvolver e comercializar o modelo Democrata Figura 9. Considerado um
carro fantasma por no ter sido de fato comercializado, foram produzidas apenas cinco
unidadesdomodelo,oqualsepretendiaquefosseproduzidoapartirdaentradadecapital
dosinvestidoresbrasileirosqueteriampreferncianacompradosprimeirosDemocratasa
sair da linha de produo mas que se tornou um dos casos mais intrigantes do setor no
perodo,comodestacaSilva:

[...]Semfbricasquepudessemajudloadesenvolveromotor(haviaumboicote
dasempresasestrangeirasinstaladasnoBrasilaoprojeto),ocarrofoialvodeuma
confusa CPI, cujas maiores provas eram as reportagens publicadas na imprensa
por exemplo sobre um carregamento de 500 motores italianos apreendidos em
guas internacionais, antes de chegar ao porto de Santos. Era poca do regime
militar e a fbrica foi interditada sob acusao de o projeto ser invivel. (SILVA,
2012,p.95).

Nas palavras do empresrio Nlson Fernandes: O exrcito mandou que eu fosse


investigado. Mandaram invadir minha casa para saber qual era a minha ligao com
Juscelino Kubistchek (FERNANDES in SILVA, 2012, p. 95). Acusado de corrupo, o
empresriosseriainocentadojudicialmentenoanode1987.Semoapoiodeinvestidorese
dogovernobrasileiro,aIBAPfoifalncia.

55

Figura9Democrata(conhecidocomoocarrofantasma)

Fonte:QuatroRodas,2007.Disponvelem:<
http://quatrorodas.abril.com.br/classicos/brasileiros/conteudo_264320.shtml#galeria>.Acessoem:
12/01/2013.

Oenfraquecimentodeiniciativasbrasileiras,pelafaltadeumposicionamentofirme
por parte do governo frente ao poderio das multinacionais, tambm refletiu em outras
iniciativas, como destacou Ari Rocha, cujas contribuies sero destacadas a seguir em
entrevista concedida pesquisadora Apndice G visando ao enriquecimento das
discussespropostasnessarevisobibliogrfica:

Em nenhum momento se verificou qualquer tipo de esforo/interesse, que


estimulasse alguma atitude genuinamente nacional, com desenvolvimento de
novasalternativas,outecnologiasapropriadas.Issoseguiu,decertomodo,aforma
deatuaodasprimeirasempresasinstaladasnopas(Ford1919/GM1925),
que s montavam aqui seus carros fabricados nos EUA. Essa condio foi
determinanteparaasaesqueseseguiram.Apolticaindustrialdefinidanesse
perodo de origem influenciou o comportamento da nossa indstria, sobretudo
na rea automotiva (GEIA), para adoo de solues que no contemplavam as
propostaseprojetoslocais.(ROCHA,2013).

Ainda de acordo com o designer, o incio das atividades de projeto dentro das
empresas multinacionais no foi fcil principalmente pela resistncia das matrizes em
permitirquesoluesdedesignfossemdesenvolvidasaqui,salientandoqueAVolkswagen
chegouaproibireameaarcompunioeatdemissosumria,quemnorespeitasseessa
ordem,atqueoLeidingmudasseessequadro.FoiquandosurgiramaBrasliaeoSP2.A
dificuldadeenfrentadanoperodotambmdestacadaporPiancastelli(2002):

[...] na poca do primeiro presidente da Volkswagen do Brasil, Schultz Wenck, o


desenvolvimento de design de veculos era um tabu na subsidiria local, e os
estudos que ocasionalmente surgiam tinham que ser feitos s escondidas, pois

56

eram proibidos pela diretoria. No era permitido sequer utilizar cores nos
desenhos,paranochamaraateno(PIANCASTELLI,2002inONO,2004,p.169).

Odesigneraindadestacouquetalmodelodegestodeprojetosresultounaquase
demissodeumdesignerporterproduzidoumestudocoloridoequefoidescobertoporum
dos diretores que atuavam na poca. Piancastelli tambm reafirmou que apenas com a
vindadeRudolphLeidingem1968houvemudanaparamelhornombitodapossibilidade
decriaoparaosdesignersbrasileirosdentrodaempresa,umavezqueomesmoapreciava
osdesenhoscoloridosdosdesignersbrasileirosoutroratocondenados.
Assim,emboraexistissemesforosporpartedeempresriosnacionaisdetentoresda
maioria dos capitais aplicados na Willys Overland, Vemag e FNM, tais empresas no
detinhamnapocaumvolumedeproduoquesuprisseademandadomercadonacional.
AindadeacordocomOno(2004):

Aidealizaodaindstriaautomobilsticanacionalesbarrounorelativobaixonvel
de desenvolvimento tecnolgico do parque industrial brasileiro, cuja produo
haviaselimitado,atento,produodeacessrios,bateriasevelasdeignio,
no abrangendo componentes mais complexos, tais como motores e peas
estampadas,porexemplo(ONO,2004,p.163).

Tal cenrio, aliado ao incentivo do governo entrada de capital estrangeiro para


investimentos em diferentes setores, favoreceu a compra destas empresas pelas grandes
marcasqueentoampliavamsuasatividadesnoBrasil.Em1964,aquartaediodoSalo
doautomveltambmfoiaocasioescolhidaparasediarparalelamenteasegundaedio
do prmio Lucio Meira de Design Automobilstico, o qual foi conquistado pelo projeto
AruandaFigura10consideradooprimeirocarroconceitodoBrasil,deautoriadoento
estudantedearquiteturadaFAUUSPAriAntniodaRocha.

57

Figura10OprojetoAruandaemsentidohorrioapartirdosketch:desenvolvimentodoprottipo;exposio
no47SaloneInternazionaledellAutomobiledeTurimeexpostonoBrasil

Fonte:AcervopessoaldeAriAntniodaRocha

AriRocharecordaqueogostopordesenhareconhecerautomveissurgiuaindana
infncia,noqualopaientofuncionriodaPirellifabricantedepneuseoavtiveram
importanteinfluncia,oquecontribuiuparaodirecionamentodesuaformaoacadmica:

[...]busqueicaminhoseafaculdadequemaisseaproximassedemeusobjetivos,j
queoscursosdeDesignaindanoeramofertadosnopas.Advidafoidissipando
quando optei por Arquitetura na USP e conheci o Professor Vilanova Artigas, de
quem fiquei amigo, tendo me convidado para conversar sobre o assunto, pois
pretendiaintroduziressareanaFAUUSP.(ROCHA,2013).

O sucesso de seu projeto garantiu que, em novembro do ano seguinte 1965 o


prottipofosseconstrudonaCarrozzeriaFissore,aconvitedoproprietrioMarioFissore,na
Itlia, recebendo o prmio de proposta mais inovadora do 47 Salone Internazionale
dellAutomobile de Turim. O Aruanda definitivamente estava frente de seu tempo e
poderiaviraserumimportanteprojetonabuscaporsolucionarotrnsitourbano,que,na
poca, comeava a interferir no cotidiano das grandes cidades brasileiras. A edio de
Fevereiro 1965 da revista Quatro Rodas destacava tais atributos na reportagem intitulada
Carrinhodefeiratambmvaiguerra:

58

Ari Antnio, embora sem desprezla, subordinou a esttica funcionalidade.


Buscouemprimeirolugarumasoluoeconmicaabrangendoopreodecustoe
facilidade de produo. Fatalmente encontraria atravs desta linha uma soluo
social:carromaisbarato,acessvelmesmosclassestrabalhadorasmaispobres.O
delineamento e a viabilidade de produo esto dentro do projeto, com uma
recomendao: para manter o preo equivalente ao do poder aquisitivo de um
milho de cruzeiros atualmente, quem se encarregar em produzir o carrosonho
deveralanarnomercadoummnimode80milunidadesanuais.(QUATRORODAS,
1965,p.44).

Embora se tratasse de um grande avano em termos de design automotivo, o


Aruandatambmnoobteveoapoionecessrioparachegaraomercadoeaosusurios.De
acordo com Ono (2004), segundo o prprio designer, o projeto foi plagiado por uma
empresa italiana, contudo, no foi possvel a contestao judicial, uma vez que o governo
brasileironoapoiouaao,vistoque,segundoomesmo,nohaviapatentesreferentesao
projeto, patentes estas que segundo o prprio designer, ele j havia requisitado e foram
extraviadas (ROCHA, 2002 in ONO, 2004 p.167). A autora ainda destaca, com base em
relatos do designer, que houve contatos com a FNM, visando fabricao do veculo,
entretanto,nohaviainteressedasdemaismontadorasinstaladasnoBrasilemenfrentara
concorrnciaqueoprojetocriaria,almdeofatodeoGEIAnoteraprovadoomesmopara
fabricao.SemaaprovaodoGEIAeconcorrendodiretamentecomomercadodeusados
ento muito aquecido a ANFAVEA no emitiria parecer favorvel, segundo o prprio
designer.
Ari Antnio da Rocha tambm realizou estgio na montadora DKWVemag entre
1963 e 1964, perodo no qual, a pedido do Gerente Industrial e engenheiro Antonio de
Pdua Santos, estruturou o Departamento de Design da DKWVemag chamado Estilo. O
designer relembra as dificuldades enfrentadas nos primeiros anos de implantao do
departamentodeDesignnasempresas:

[...] os empresrios em geral nem sequer conheciam Design e achavam a palavra


estranha, a ponto de que um dos Diretores da Vemag comentou que parecia
nome de remdio [...] mesmo os mais cultos, considerados esclarecidos,
dispunhamdepouqussimainformaoaesserespeito.(ROCHA,2013).

Essa postura levaria anos para ser modificada assim como a estrutura dos
departamentos, os quais segundo Rocha, contavam com [...] pouqussimos funcionrios,
queeramobrigadosafazertudo.Nohaviaaseparaonemmesmodeexterior/interior.

59

Ari Rocha tambm esteve envolvido, antes da criao do Aruanda, em projetos


coordenadosporRigobertoSolerdesignercomexperinciasnaVemag,WillysOverlande
Brasinca e que, ao fim da dcada de 1960, atuava como professor da Faculdade de
EngenhariaIndustrialnaqualchefiouoDepartamentodeEstudosePesquisasemveculos.
Nos projetos em que esteve envolvido, Ari Rocha destaca particularidades dos
processosdedesigndaquelesanos,osquaisdiferemdosmtodosadotadosnaatualidade.
Em seus anos de atuao, o designer relembra que um nmero menor de funcionrios
permitia uma interao mais aproximada de todos os profissionais envolvidos no projeto,
inclusivenonveldecisrio,divergindodascaractersticasatuaisdoprocessodedesignem
grandesempresas:

Noscasosemqueatuei,semprehouveumdilogoefetivocomosnveistcnicoe
dedecisodasempresas.Issofacilitavaparachegarssoluesadequadas,poisas
solicitaes de tarefas a sercumpridas no se resumiam como acontece hoje em
que as equipes so numerosas na maioria das empresas, ao envio de briefings
elaboradosporumintermediador.Asnfasesaseremadotadaseramdefinidasem
conjuntoedeformainterativa:abuscadesolues,apsdefinidasasopesmais
promissoras, era testada naprtica em modelos (oudiretamente em prottipos).
Muitasvezeseumesmouseiosfinaisdesemana,paraexperimentaralgumasdas
solues elaboradas (como no caso dos bancos moldados, por exemplo)
diretamentenapistadetestes.OcontatopermanentecomaEngenhariafavorecia
naobtenoderesultadosviveis,tantotcnicaquantoeconomicamente.(ROCHA,
2013).

UmdosdesenvolvimentosnoqualAriatuoujuntoaRigobertoSoler,compondosua
equipedeprojeto,foidoveculoinicialmentenomeadoUirapuru,umprottipodoqueseria
o primeiro carro esportivo fabricado no Brasil. Mais tarde renomeado e lanado como
Brasinca4200GTFigura11oveculofoidesenhadoedesenvolvidonoBrasilpelaequipe
chefiadaporSolerentochefedodepartamentodeengenhariadeprodutosdaBrasinca.
OBrasinca4200GTfoioprimeirocarroesportetotalmentecriadoedesenvolvidono
BrasilapartirdemecnicaChevrolet,comvistasaatendercertafaixadomercadocarente
de veculos deste tipo, frente dificuldade de importao. Cerca de um ano aps o
lanamentodoveculo,aBrasincanomaismanteveaproduoemfunodosaltoscustos,
masomodelocontinuouaserconstrudopelaSTV,empresadeprojetosdaqualRigoberto
Soler era diretor na poca. At 1967 foram fabricados 77 exemplares, includos os trs
conversveisproduzidos.

60

Figura11Brasinca4200GTemsentidohorrioapartirdaimagemsuperioresquerda:construodo
prottipoUirapuru;exposionoSalodoAutomveledoismodeloscomercializadosnascoresazule
vermelho.

Fonte:AcervopessoaldeAriAntniodaRocha

Jem1965,oempresrioeengenheiroJooAmaralGurgel,empresriodedicadoao
desenvolvimento de projetos inovadores para a rea automobilstica, apresentou revista
QuatroRodasoprottipodeumcarropopular,e,naocasio,apublicaosentenciavaem
reportagem denominada Carro barato esbanja com 16 marchas, presente na edio de
Outubrode1965,queoveculonomeadopelosobrenomedoseucriador,Gurgel,Figura
12poderiaviraseroverdadeirocarropopularbrasileiro.

Figura12UmdosprimeirosprottiposdoGurgel:projetadopeloengenheiroJooAmaralGurgelnafotode
gravataesuaequipe,pretendiasequefosseumcarropopularbrasileiro

Fonte:QuatroRodas,out.1965,p.90.
Disponvelem:<http://quatrorodas.abril.com.br/acervodigital/>.Acessoem:13/01/2013.

61

Aindanadcadade1960,oGrTurismobrasileiroGTMalzoniFigura13chamou
aatenodamdiaedopblicoem1964.Oveculofoiprojetadoinicialmenteparacorridas
e produzido em um galpo na fazenda de Genaro Rino Malzoni empresrio do setor
alcooleirodeMato(SP)eentusiastadoautomobilismo.
O sucesso do GT Malzoni garantiu que o mesmo viesse a ser fabricado pela DKW
Vemag em 1966, sendo tambm denominado DKW Malzoni e produzido com base no
prottipocriadoporRinoMalzoniesuaequipe.
AequipequeapoiavaRinoeracompostaporAnsioCamposexpilotodecorridas
daVemag,Simca,WillyseDaconque,aofimdascorridascomequipesoficiaisdefbricase
conhecendoRinoMalzoni,dedicouseaprojetarveculos,aperfeioandotraoetcnicacom
base em anos de experincia com o apoio em engenharia de Jorge Lettry profissional
especialistaemmecnicaquefoiChefedoDepartamentodeCompetiesdaVemagecom
ampla experincia em corridas e preparaes de veculos e Marinho expiloto tambm
comamplaexperincianarea.ODKWMalzoni,produzidoem1966,dariaorigem,meses
depois,aoPumaDKW.

Figura13MalzoniGTfabricadopelaDKWVemag

Fonte:QuatroRodas,abr.1966,p.9495.Disponvelem:<http://quatrorodas.abril.com.br/acervodigital/>.
Acessoem:13/01/2013.

OsnomesenvolvidosnaproduodoDKWMalzoniestiveramtambmdedicadosa
outrainteressanteiniciativabrasileiradadcadade1960,acriaoeodesenvolvimentodo
Carcar. Idealizado por Jorge Lettry, projetado e desenhado por Ansio Campos e com
carroaria construda pelo experiente construtor Rino Malzoni, o Carcar projeto
inicialmente denominado Arpoador, Figura 14 resultou da associao VemagMalzoni
visandoaconstruodoprimeirocarronacionalaestabeleceroinditorecordebrasileirode
velocidadeabsolutaemlinhareta,commotorDKWechassiVemag.
Figura14esquerdaosprimeirossketchesdeAnsioCamposedireitaAnsioCampos(camisetapreta)e

62

RinoMalzonitrabalhandonosdetalhesdoprojetoArpoador(futuroCarcar)

Fonte:QuatroRodas,jul.1965,p.1518.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:13/01/2013.

O Carcar Figura 15 projetado e produzido artesanalmente, alcanou seu


objetivo,comoregistradonareportagemintituladaCarcarvoaaoamanhecerdarevista
Quatro Rodas de Agosto de 1966. Seu teste foi realizado no trecho inicial da rodovia Rio
Santos ento em construo e, na ocasio, o veculo atingiu 212.903 km/h, primeira
marcabrasileiraesulamericanadealtavelocidadeemlinhareta.

Figura15Carcar,projetadoparabaterorecordebrasileirodevelocidade

Fonte:QuatroRodas,ago.1966,p.5051.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:13/01/2013.

O veculo recebeu acabamento na cor branca como mostra a Figura 16


reconhecidacomoacortradicionaldaVemag,almdaassinaturadosdesigners[...]Assinei
com Rino Malzoni o design e o projeto, colocamos a inscrio"CARROARIA MALZONI
CAMPOS"naslaterais,abaixodafaixaverdeeamareladoBrasil(CAMPOS,2013).

63

Figura16Carcarfinalizado

Fonte:AnsioCamposDesign,2013.Disponvelem:<http://www.anisiocampos.com/bio.html>.Acessoem:
15/01/2013.

AlmdeacompanharofeitodoCarcar,nomesmoanode1966,nomsdeOutubro,
arevistaQuatroRodascriouoTrofuQuatroRodasparaomelhorCorrozziereBrasileiro,
visando estimular os esforos empreendidos por projetistas brasileiros, premiando os
melhoresprottipos.Oganhadordacompetio,jnoanode1967,foioPumaFigura17
veculo prottipo derivado do GT Malzoni e projetado pela equipe chefiada por Rino
Malzoni,aqualeracompostaporAnsioCampos,JorgeLettryeMiltonMasteguin(QUATRO
RODAS,1967,p.2833).

Figura17ProttipoPumaderivadodoGTMalzoni

Fonte:QuatroRodas,jun.1967,p.98.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:15/01/2013.

No final da dcada, 1960 Rino Malzoni se associou a Lus Roberto Costa, Jos Luz
Fernandes,JorgeLettryeMiltonMasteguin,fundandoafbricaPuma,comAnsioCampos
como designer responsvel pelo design dos veculos. Em 1968, foi lanado o Puma GT

64

Figura18primeiromodeloaserproduzidopelamarcaPuma,sendoinicialmentefabricado
a partir dechassie mecnica da marcaDKW. Por essa razo, os modelos fabricados neste
perodosotambmdenominadosPumaDKW.

Figura18PumaGTouDKWprimeiroaserproduzidoem1967commecnicaDKWVemag

Fonte:AutoGaragem,nov.2011
Disponvelem:<http://autogaragem.wordpress.com/page/25/>.Acessoem:15/01/2013.

Ao fim das atividades da Vemag, o Puma GT passou a ser montado sobre chassi
KarmannGhiaemecnicaVolkswagen,comnovodesignedesignaoGTEFigura19a
partirde1969,umprojetodegrandesucesso.

Figura19PumaGTE,derivadodoGT,redesigndomodelolanadoem1969commecnicasobrechassi
KarmannGhiaemecnicaVolkswagen

Fonte:QuatroRodas,abr.2008.
Disponvelem:<http://quatrorodas.abril.com.br/classicos/brasileiros/conteudo_276380.shtml>.Acessoem:
15/01/2013.

Comosucessodosveculosdamarca,arevistaQuatroRodassolicitoujuntoPuma
ummodeloesportivoexclusivo,doqualseriamproduzidastrsunidadesexclusivasaserem
sorteadas entre os leitores da revista. O carro nomeado Puma GT 4R Figura 20 foi
criado,desenvolvidoeproduzidoentreJaneiroeSetembrode1969(QUATRORODAS,1969,
p.7073).

65

Figura20OstrsPumaGT4Rsorteadosem1969,foramreunidospelarevistaQuatroRodasemSetembrode
2010paracomemoraros50anosdarevista

Fonte:QuatroRodas,2010.
Disponvelem:<http://quatrorodas.abril.com.br/reportagens/sagapumagt4r600568.shtml>.Acessoem:
15/01/2013.

NoSalodoAutomvelde1968,outrainiciativabrasileiradestavezvindadarea
acadmica ganhou projeo nacional. Tratavase do FEI X1 Figura 21. O veculo
construdo em madeira, foi apresentado na ocasio por estudantes de engenharia da FEI
comoumexercciodecarrodofuturo.
AorientaoeodesigndoprojetocouberamaRigobertoSoler,napocaprofessor
decarroariasdaFEI,eoprottipotinhaumaparticularidade:atos60km/h,atraoera
feitapelasrodastraseiras,entretanto,acimadestavelocidadeocarroeraimpulsionadopela
hliceeapoiadopelasrodasdetrs,eafrenteeralevantadaesustentadapelocolchode
arformadoembaixodoveculo.

Figura21ProttipoFEIX1

Fonte:QuatroRodas,dez.1968,p.64.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:17/01/2013.

Quanto aos lanamentos das grandes indstrias automobilsticas, em 1967 a Ford


LanouomodeloGalaxie500Figura22comacabamentodeluxo,motorV8.Nomesmo
ano em que assumiu o controle no Brasil da Willys Overland, enquanto a Volkswagen

66

incorporouaVemagemarcouaproduode500milcarrosVolkswagennoBrasilnofinal
daquele mesmo ano saiu de linha o ltimo DKW Vemag. A FNM, aps srios problemas
administrativosefinanceirosfoicompradapelaAlfaRomeonoanode1966.
Tambm em 1966 a Volkswagen iniciou as atividades na rea de design em sua
plantafabrillocalizadanaRodoviaAnchietaemSoBernardodoCampo.Noanode2003a
fbricateveseusmeioseprocessosprodutivoscompletamentemodernizados,ampliandoo
centrodedesenvolvimento,pesquisaedesign.Cincoanosdepoisem2008foiinauguradoo
Centro de Realidade Virtual anexo ao centro de design que recebeu novas instalaes em
2011.
Na mesma poca, outra empresa que estruturou sua rea dedicada ao design de
produtosfoiaFord,apartirdaaquisiodaWillysOverlanddoBrasil.Oprimeiromodeloa
ter suas linhas suavizadas para atender o gosto do consumidor local, foi o Ford Galaxie,
sendooCorceloprimeiroveculodamarcadesenhadonopasseguidodaBelina,CorcelII,
DelRey,PampaeVerona.Amarcamantmatualmenteemsolobrasileiroumdeseuscinco
centrosmundiaisdecriaodeveculos,responsvelpelodesenvolvimentodeautomveis
depassageiros,picapeslevesemdias,utilitriosesportivosecaminhesparaaAmricado
SuleoMxico.

Figura22FordGalaxie500:PrimeiroveculodeluxodesenvolvidoparaoBrasil,baseadonomodelonorte
americano,media5,33mdecomprimentoe2mdelargura

Fonte:AutoEsporte,2010(adaptado).Disponvelem:<
http://revistaautoesporte.globo.com/Revista/Autoesporte/0,,EMI14275510142,00.html>.Acessoem:
17/01/2013.

Oanode1968marcouoinciodoperododenominadomilagreeconmicooqual
durariaatoanode1973enomesmoanoaVolkswagen,FordeGMforamresponsveis
porquase98%dosveculosproduzidos.AFordlanouoCorcelquatroportasFigura23e
oGalaxieLTD.

67

Figura23Corcelquatroportaslanadoem1968pelaFord

Fonte:QuatroRodas,2012(adaptado).Disponvelem:<
http://quatrorodas.abril.com.br/classicos/brasileiros/fordcorcelsedan687725.shtml#galeria>.Acessoem:
17/01/2013.

Aindaem1968,aGMlanouoOpalaFigura24oprimeirocarrodepassageirosda
marcanoBrasil,derivadodoOpeleuropeu.

Figura24OpalalanadopelaGMem1968eumgrandesucessonoBrasilcomercializadoata
dcadade1980

Fonte:QuatroRodas,2013.Disponvelem:<
http://quatrorodas.abril.com.br/galerias/imagens/120518_70_02.jpg>.Acessoem:17/01/2013.

Tambmem1968ocorreuolanamentonoBrasildeumnovoesportivodeiniciativa
nacional,oLorenaGT.IdealizadoeconstrudonoBrasilpeloimigrantechilenoLen"Lorena"
LarenasIzquierdo,oLorenaGTresultoudaexperinciadodesignernaempresaamericana
FerrerMotorsCorporation,depropriedadedeFrankFerrer,naqualacompanhouacriao
doautomvelFerrerGTveculonoqualoLorenafoibaseado.
Posteriormente, trabalhando no Brasil, Len fabricaria as primeiras unidades do
LorenaGTna"Fibraplastic"deSoPaulo,empresadeCelsoCavallarieAnsioCamposeem
1969 passou a ser fabricado em sua prpria empresa, a Lorena S/A Industrial de Veculos
fundada juntamente Prottipos Lorena Carrocerias Especiais Ltda. Ao final de 1969, a
Prottipos Lorena Carrocerias Especiais Ltda iniciou a fabricao do Buggy "Lorena", um

68

outromodelodesucessodamarcaparalelamenteaproduodoLorenaGT,e,noinciode
1971,encerrousuaproduo.
Nomesmoanode1969,sucedendoaempresa"LorenaS/AIndustrialdeVeculos",
estabeleceusea"TambatajVeculosLtda",quepassouaproduziroJipeGaiato,projetoda
LorenaS/AcriadoporCelsoCavallari.OsmodelospodemservistosnaFigura25:

Figura25Emsentidohorrio:LorenaGT(1968)eBuggyLorena(1969)produzidospelaLorenaS/AeJipe
Gaiato(1969),quandoLorenapassouaserTambatajVeculos

Fonte:LorenaGT,2013.Disponvelem:<http://www.lorenagt.com/>.Acessoem:17/01/2013.

AlmdoBuggyLorena,outromodelofabricadopelaGlaspacempresadoPaulistano
DonaldPacey,pioneiranaproduodeartigosemfibradevidrooBuggyGlaspacFigura
26 tambm comeou a fazer sucesso, antecipando uma tendncia ao surgimento de um
novo e promissor nicho de mercado que se verificaria na dcada seguinte: o dos veculos
foradesrie.

69

Figura26PropagandadoBuggyGlaspacnarevistaQuatroRodas

Fonte:QuatroRodas,mar.1970,p.10.
Disponvelem:<http://www.lorenagt.com/>.Acessoem:20/01/2013.

Dcadade1970
OBrasiliniciouadcadade1970comapopulaourbanaultrapassandoarural,a
indstria automobilstica vendendo ao mercado interno 416.704 mil carros e exportando
409unidades.AVolkswagenlanouochamadoFusco,commotor1500Figura27.

Figura27VolkswagenFusca1500:OpopularFusco

Fonte:QuatroRodas,2006(adaptado).Disponvelem:<
http://quatrorodas.abril.com.br/classicos/brasileiros/fordcorcelsedan687725.shtml#galeria>.Acessoem:
20/01/2013.

Almdesselanamento,aVolkswagenaindainiciouaexportaodaVariantefirmou
parceriacomaKarmannGhia,daqualresultounoesportivoTC1600Figura28.Oprojeto
do TC foi completamente concebido pelos designers da Volkswagen de So Bernardo do
Campo sendo posteriormente repassado para a Karmann Ghia brasileira, responsvel por
fabricarascarrocerias(BEREZOVSKY,2004).

70

Figura28KarmannGhiaTC

Fonte:QuatroRodas,2004(adaptado).Disponvelem:<
http://quatrorodas.abril.com.br/classicos/brasileiros/conteudo_140432.shtml#galeria>.Acessoem:
20/01/2013.

Aindaem1970oSalodoAutomvelchegousua7edioemudoudeendereo,
saindodoIbirapueraemdireoaoPavilhodoAnhembinoqualosgrandeslanamentos
foramDodgeCharger,AlfaRomeo2150daFNM,CorcelGT,FordLandau,KarmannGhiaTC,
Volkswagen TL e Variant. Tambm em 1970 ocorreu a estreia de Emerson Fittipaldi na
Frmula1.
Noquesereferesiniciativasdeprojetosbrasileiros,adcadade1970foimarcada
porcriaesenovosdesenvolvimentostantonaindstriaquantoparalelamentemesma.
A difuso das tcnicas de produo em fibra de vidro e o aprimoramento da prtica de
projeto permitiram tentativas mais ousadas por parte dos designers e construtores
brasileiros. Com a importao de veculos estrangeiros desencorajada por fora de lei e
tributao desde a dcada de 1950 e com a restrio ainda mais forte por parte da lei
vigenteapartirdoanode1976,apossibilidadedeaquisiodeumveculonovodiferente
dosproduzidosnoBrasilpelasviaslegaistornavasepraticamentenula.
Paraatenderafaixadomercadocarentedeveculosdiferenciadosfrenteproibio
deimportaovigente,verificaramsenosanosiniciaisdadcadade1970umaconfirmao
da tendncia verificada na dcada anterior ainda com a produo do Carcar, Malzoni GT
entre outros: as produes dos veculos conhecidos como foradesrie. O termo forade
sriefoiempregadoparadesignarosveculosnoproduzidosemsrieporgrandesfbricas.
Taismodeloseramconstrudosapartirdetcnicasmuitasvezesartesanaiseproduzidospor
pequenosfabricantesparaatenderanichosdemercadoespecficos.
Assim,surgiramtambmdiversosmodelosdebuggys,rplicas,esportivosdefibrade
vidro, conversveis, jipes, carros de produo industrial customizados e transformados. A

71

produodestesveculosfortaleceusenadcadade1970,consolidousenadcadade1980
perdurando at os primeiros anos da dcada de 1990 quando a abertura do mercado
importaesreduziudrasticamenteaprocuraporestesveculos,tornandoosrelquias.
Entre os veculos foradesrie produzidos, os buggys alcanaram sucesso junto ao
pblico.Erampequenosjipesesportivosdecarroceriaaberta,geralmentefabricadaemfibra
de vidro, comrodasepneuslargos para bom desempenho em variados tipos de terrenos.
Assim como no projeto dos Buggys Glaspac e Lorena anteriormente abordados, era
significativaaatuaodeprofissionaisbrasileirosnacriaoefabricaodestesveculos,a
exemplodoprprioAnsioCampos,responsvelpeloprojetodoBuggyTropiKadronde1970
Figura29desenhadoparaaKadron,fabricantedeacessriosparaautomveiseprimeiro
buggyaserfabricadoemsrienoBrasil.AGurgeltambmproduziuomodeloBuggyBugato
noano de1971evriosmodelossimilareschegaramaomercado(QUATRORODAS,1970,
p.110117).

Figura29BuggyTropiKadronde1970originalpreservado

Fonte:QuatroRodas,2013.Disponvelem:<http://quatrorodas.abril.com.br/carros/classicosbrasileiros/tropi
kadron734986.shtml>.Acessoem:20/01/2013.

A cidade do Rio de Janeiro tornouse um importante polo produtor de veculos do


tipo buggy, na qual foram lanados modelos de sucesso como o Bugre SS criado e
fabricado em 1971 por Francisco Cavalcanti ; Buggy Reno com estilo de N.A.Halbot e
produzidopelaRenoindstriadePlsticos;BuggyWoodyDesenhodeWladimirMartins,
idealizadopelomesmoeporAntnioPereiracomoapoiodeCludioDutradeAboimeuma
equipe de admiradores de automveis, e Play Bug Criado por Fernando Pinheiro dos
SantoscomaajudadeseuirmoRonaldo,oveculofoifabricadopelaTecnofibra(QUATRO
RODAS,1972,p.6067).

72

Paralelamente, no setor industrial, em 1972, a Fiat iniciou os testes no Brasil por


meiodosmodelos126e127,afimdeescolherqualdestesfabricarianopas.Oanomarcou
aedionmero8doSalodoAutomvel,oqualapresentouosmodelosChevettefigura
31Dodge1800,FordMaverick,PumaGTB.
Dentro das grandes indstrias, o design e os designers brasileiros comeavam a
conquistar algum reconhecimento. Um exemplo foi o desenvolvimento dos modelos
VolkswagenSP2eBraslialanadosem1972e1973respectivamente.DeacordocomOno
(2004,p.170172),ambososprojetosforamcoordenadosporMrcioLimaPiancastellicom
atuao de Jos Vicente Novita Martins e George Yamashita Oba, sendo o design dos
veculoscompletamentedesenvolvidonoBrasil.Aautoraaindadestacaoamplosucessodo
Braslia,quesuperouemvendasoVolkswagenSedan1200,oFuscaaoalcanaramarca
de 1.064.416 unidades vendidas de 1973 1981, sendo tambm exportado para outros
pases. O SP2 Figura 30 foi trabalhado sobre a plataforma do Variant e partiu de um
desejo do ento presidente da Volkswagen, Rudolph Leiding, o qual gostaria de ver no
portfliodaempresaummodeloesportivo.

Figura30VolkswagenSP2:oesportivofoioprimeiroprojetobrasileirodaVolkswagen.

Fonte:QuatroRodas,2002(adaptado).Disponvelem:
<http://quatrorodas.abril.com.br/classicos/brasileiros/imagens/0403sp2_abre.jpg>.Acessoem:20/01/2013.

Foi tambm por solicitao do presidente que Piancastelli e sua equipe


desenvolveramoBrasliaFigura31.ComodestacaOno,combaseemrelatosdoprprio
Piancastelli:

[...] o presidente da Volkswagen do Brasil disse equipe: "Eu gostaria de ter um


Fuscamaismodernoemaisamplo".Istoporque,segundoomesmo,"oFuscaera
muito fechado e, em seu interior, as pessoas se sentiam muito oclusas". O
presidente expressouse ainda da seguinte forma: "Eu quero um veculo meio
quadrado,aocontrriodoFusca,equetenhaumareaenvidraadamuitogrande;

73

queapessoasesintaemumasaladevisitas.(PIANCASTELLI,2002inONO,2004,
p.170).

O Volkswagen Braslia, de acordo com Ono (2004, p.172), foi o automvel mais
vendidonoBrasilnadcadade1970ultrapassandoasvendasdoSedan1200(Fusca),tendo
sidotambmexportadoparaoutrospases.Odesenvolvimentodestesdoismodelos,apartir
doposicionamentodoentopresidentedaVolkswagendoBrasil,RudolphLeiding,nabusca
pela diversificao da produo local conduta empreendedora que o conduziu
presidnciamundialdaVolkswagenem1973forammarcosimportantesparaaconquista
deummaiorpoderdenegociaodasubsidiriabrasileiraeconsequentepesododesign
local dentro de uma empresa multinacional. O sucesso de ambos os modelos reiterou,
frentepresidnciamundialdaempresa,opotencialqueassubsidiriasdetinhamdecriare
conduzirprojetoscompletos.
Alm destes modelos, nos anos em que esteve no departamento de Estilo da
Volkswagen, o designer Mrcio Piancastelli ainda colaborou com o desenvolvimento dos
modelos Gol, Voyage, Saveiro, Parati, Santana, Versailles produzidos no perodo entre
1990e1996,noqualVolkswageneFordseassociaramformandoaAutolatina,integrando
suasfbricaseoperaes,comvistasacompartilharcustosepotencializarospontosfortes
decadaempresaatuandotambmnodesenvolvimentodosmodelosApolo,Logus,Pointer
eNovoGol.

Figura31Braslia:Projetoeproduo100%nacionais.

Fonte:QuatroRodas,2004(adaptado).Disponvelem:<
http://quatrorodas.abril.com.br/classicos/brasileiros/conteudo_140426.shtml#galeria>.Acessoem:
20/01/2013.

Com o fim do milagre econmico em 1973, os salrios foram desvalorizados, a


dvida externa do pas aumentou e tambm os investimentos estrangeiros. O cenrio de
criseincitoumudanasquefavoreceramomercadodeautomveis,taiscomoaampliao

74

docrditoaoconsumidorearevisodasnormasdeproduo,autorizandoafabricaode
carros mdios. Estas medidas atraram fortes investimentos principalmente de grandes
marcascomoaGM,FordeChrysler.Nomesmoano,aFiatformalizou,juntoaogovernode
MinasGerais,aconstruodesuafbricaedefiniucomobasedeproduodeseuprimeiro
carronoBrasil,omodelo127oqualsofreuadaptaesmecnicasparaadequarseaosolo
brasileiro,recebendomotorizaomaispotenteesuspensoreforada,originandoassimo
modeloFiat147.Na9 diodoSalodoAutomvelforamdestaquesosmodelosPassat,
Fusco1600eCaravan.
No setor de produo dos modelos foradesrie, contemporneos aos buggys,
conquistaram notoriedade as rplicas de modelos famosos estrangeiros. As rplicas
consistem em carros mecanicamente atualizados a partir de componentes mecnicos
venda no mercado mas que mantm as linhas clssicas do modelo no qual foram
inspiradas no configurando uma cpia ilegal, uma vez que no infringem leis de
preservao s patentes industriais originais. No decorrer da dcada de 1970, surgiram
muitas rplicas de modelos estrangeiros clssicos. A primeira tentativa brasileira de
construir uma rplica foi baseada no MG TD de 1952, e a empresa responsvel pelo seu
projetofoioGrupoLafer,fabricantedemveisecabinesemfibradevidro.Arplicafielao
originalfoinomeadaMPLaferFigura32efoilanadaem1974,fazendomuitosucesso
entreaclientelabuscavaaexclusividadedestesmodelos(QUATRORODAS,1974,p.3641).

Figura32MPLaferde1977restaurado

Fonte:QuatroRodas,nov.2005.Disponvelem:<
http://quatrorodas.abril.com.br/classicos/brasileiros/conteudo_150381.shtml>.Acessoem:20/01/2013.

Outras rplicas famosas produzidas na poca foram Avallone TF, de 1976 rplica
brasileiradoMGTDconstrudopelopilotoeconstrutordecarrosdecorridaAntnioCarlos
Avallone; Alfa 1931, de 1976 rplica brasileira do Alfa Romeo 2300 Monza; Fera XK, de

75

1979 rplica do Jaguar XK, 120 com mecnica Opala, feita pela Indstria de Artefatos
MetlicosBolasS.AemSoPauloeSuper90,de1979rplicadoPorsche356Cfeitopela
EnvemoEngenhariadeVeculosemotoresemSoPaulo(SP).Osquatroprojetospodemser
visualizadosnaFigura33.

Figura33Emsentidohorrioapartirdaimagemsuperioresquerda:AvalloneTF,Alfa1931,
Super90eFeraXK

Fonte:QuatroRodas,2013.
Disponvelem:<http://quatrorodas.abril.com.br/classicos/brasileiros/>.Acessoem:20/01/2013.

Paralelamenteaosbuggyserplicas,entreosforadesrie,iniciouseaproduodos
primeiros modelos esportivos. Fabricados por empresas consolidadas como o Jipe Gurgel
Xavante1972,Figura34ouporempresaspequenascomoojipeJEG1977,Figura35
da ABCDiesel, estes veculos abriram caminho para outras produes independentes
financiadasporempresriosdoramoouconstrutores.

Figura34GurgelXavante,umdosprimeirosesportivosnacionais

Fonte:QuatroRodas,2013.Disponvelem:<http://quatrorodas.abril.com.br/galerias/especiais/carros
marcaramanos70685183.shtml>.Acessoem:20/01/2013.

76

Figura35JipeJEG

Fonte:QuatroRodas,ago.1978,p.86.Disponvelem:<
http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:20/01/2013.

Assim,chegaramaomercado,emvolumeevariedadecrescente,esportivoscomoo
AdamoGT1970,umhbridodebuggyouroadsterurbanoproduzidoporMiltonAdamoe
equipe, e o Miura, de 1977, com mecnica VW produzido pela Aldo Auto Capas de Porto
Alegre(RS),empresaespecializadaemtransformarcarrosFigura36.

Figura36Miura1977desenvolvidopelaempresaAldoAutoCapas

Fonte:AutoClassic,2013.Disponvelem:<http://www.autoclassic.com.br/autoclassic2/?p=9853>.Acessoem:
20/01/2013.

Outro modelo de sucesso, entre os foradesrie, foi o Bianco tambm chamado


Bianco S de 1977 construdo por Toni Bianco, projetista de longa tradio nas pistas
brasileirasemsuaempresanacidadedeDiadema(SP)Figura37.

77

Figura37Bianco,veculoprojetadoporToniBianco,experienteconstrutordeveculosepreparadordecarros
decorrida

Fonte:QuatroRodas,jun.2005(adaptado).Disponvelem:<
http://quatrorodas.abril.com.br/classicos/brasileiros/conteudo_138719.shtml>.Acessoem:20/01/2013.

Mesmo indstrias no atuantes diretamente no mercado automotivo, mas que


detinham conhecimento de processos metalrgicos, tambm desenvolveram projetos
marcantesparaodesignbrasileiro,comofoiocasodoSM4.11978modeloelaboradoa
partirdoprojetodesenvolvidoporAnaLdiaP.D.daFonsecaefinanciadoporHumberto
PimentelDuartepresidentedaCompanhiaIndustrialSantaMatilde,fabricantedevagese
equipamentosagrcolascomoauxliodopilotoepreparadordecarrosRenatoPeixoto
Figura38.

Figura38SM4.1,projetadoporAnaLdiaP.D.daFonsecaeproduzidonaCompanhiaIndustrialSantaMatilde

Fonte:QuatroRodas,nov.2002(adaptado).Disponvelem:<
http://quatrorodas.abril.com.br/classicos/brasileiros/conteudo_143482.shtml>.Acessoem:28/01/2013.

OutrosmodelosproduzidospocaforamoDardoF131979tambmprojetadoe
produzidoporToniBiancocommecnicaFIAT,eVentura1979,produzidopelaempresa
Lautomobile(SP)apartirdemecnicaVolkswagen.
Ainda na dcada de 1970, as empresas brasileiras Gurgel e Puma, paralelamente
sua produo, realizaram estudos em prottipos para veculos urbanos. A primeira

78

apresentouem1974,oItaipu,carroeltricoidealizadoporJooGurgel,oqualchegouater
alguns modelos fabricados com o apoio da prefeitura de Rio Claro (SP), para testes de
estacionamento e postos de recarga. Contudo, o projeto no conseguiu o apoio suficiente
parasedesenvolver.ApesardeacordosestabelecidoscomaPrefeituradeRioClaroecoma
Companhia Energtica de So Paulo CESP para um plano piloto de implantao do
veculocomotransporteurbanonoforamobtidosmaioresavanos.
A falta de incentivo governamental para as pesquisas e os obstculos impostos
importao de peas e componentes essenciais ao projeto inviabilizaram para a Gurgel a
produoemsriedomodelo.SimilarfoiocasodoMiniPuma,em1974,umprottipode
veculourbanoidealizadoporMiltonMasteguin,cujograndediferencialeraaeconomiade
combustvel teoricamente o tanque de trinta litros poderia oferecer uma autonomia de
quase 600km at o prximo abastecimento (MANERA, 1975, p. 27). Nunca chegou a ser
fabricadoemsrie,emboraamarcatenhaapresentadooprottiponoSalodoAutomvel
daquele ano com vistas a obter investimentos para a construo de uma nova fbrica, na
qual o modelo seria produzido. Os modelos podem ser visualizados na Figura 39. Tal
inteno vinha ao encontro do clima poltico favorvel, no qual o governo federal
incentivavanovoseeconmicosdesenvolvimentosautomobilsticos,nabuscaporamenizar
os efeitos das sucessivas crises envolvendo a produo e exportao/importao de
petrleoeseusderivados.Estesincentivos,contudo,nosetornaraminvestimentosdefato
aomenosnoemempresasbrasileirasmenoresdoqueamultinacionaisaquiinstaladas.

Figura39Apartirdaesquerda:GurgelItaipueMiniPuma,projetosdedesignnacionaiscomgrande
potencial,osquaisnotiveramoapoionecessrioparadesenvolvimento

Fonte:QuatroRodas,abr.1979,p.54(adaptado).Disponvelem:<
http://quatrorodas.abril.com.br/acervodigital/home.aspx>Acessoem:28/01/2013.

Emumfuturoprximo1979afaltadeincentivodogovernoparaestasiniciativas
brasileiras foi tema da reportagem de Srgio Buarque Esta cidade j poderia existir no

79

Brasil,publicadanarevistaQuatroRodasdeAbrilde1979(p.5258),naqualselamentavao
fimprematurodoschamadosminicarros.Naocasio,foramapresentadasashistriasdos
trsmodelosdepequenosveculosurbanosquepoderiammodificarahistriadotransporte
emgrandesmetrpoles.TratavasedoAruandadeAriAntniodaRocha1960;doItaipu
projetodaGurgeldecarroeltrico1974edoMiniPumacarrogasolinaextremamente
econmicodaPuma1975.Ostrsprojetostinhamemcomumalmdanotriaoriginalidade
que os situava frente de seu tempo, antecipando problemticas e prevendo as
necessidadesdedeslocamentoemgrandescentrosurbanos,tambmodescasodogoverno
brasileiroemapoiartaisiniciativas.
O Aruanda, embora tivesse se tornado um sucesso na Europa sendo exposto e
premiadonoSalodeTurimnofoiproduzidopelaFNMintenoinicialdeAriRochae
tampouco foi produzido no Centro Industrial de Aratu na Bahia, onde era quase certa sua
fabricao por conta do parecer contrrio da Grupo Executivo da Indstria Mecnica
GEIMEC que desaconselhava a produo do modelo to simples e barato, sob pena de
lotarasgrandescidadescomessesveculos.
Embora o engenheiro Joo Amaral Gurgel deixasse claro que no objetivava obter
lucrosnoprojetoItaipuumavezosgastosforamsuperioresaqualquerganhoemtodasas
fases do projeto mas que sim, tinha interesse em desenvolver uma tecnologia brasileira
queseriaessencialdentroembrevesegundosuaviso,oItaipuenfrentousriosobstculos
e a Gurgel no obteve sequer iseno de impostos do governo para trazer para o pas os
componentesessenciaisparaafabricaodomodelo.QuandopocaosEUAdivulgaram
seus estudos, buscando a tecnologia do carro eltrico, Joo Gurgel declarou [...] o Brasil,
ento,talvezprecisepagarmilhesdedlaresanuaisemroyaltiesporumatecnologiaque
poderiateraqui(BUARQUE,1979,p.54).
A reportagem destacava que o caso do MiniPuma tambm refletiu a falta de
empenho governamental para que o projeto fosse de fato executado. A Puma, primeira
indstriaautomobilsticabrasileiraareceberroyaltiesdeforaporcontadaexportaode
modelos e venda de direitos de fabricao para a frica do Sul desenvolveu aquele
prottipoapartirdemuitaspesquisasetentativasdaempresaemconseguirincentivospara
sua fabricao. Ao tentar um emprstimo para ampliao de instalaes e contratao de
modeobra, era de praxe o banco repassar a inteno ao governo, visando obter o aval
paraaliberaodoinvestimento,oquenoocorreu.

80

Ogovernoposicionousecontrrioaoemprstimo,eastentativasdaPumaseguiram
atoanode1973,quandoaFiatseinstalounoBrasiletrouxecomocarrodetestesede
entrada a partir de 1976 o modelo 147, cujo principal atributo era a economia de
combustvel, sendo portanto concorrente direto do MiniPuma. Diferente das polticas de
incentivo que sempre permearam os negcios com as multinacionais, os trs projetos
esbarraram na burocracia e na falta de empenho dos governantes da poca, em levar
adianteprojetosparalelossindstriasdegrandeporte.
Nomercadodegrandesvolumes,em1974deuseaconstruodafbricadaFiat,na
cidadedeBetim(MG),eolanamentodoPassat,primeiroVolkswagenbrasileirorefrigerado
aguaecomtraodianteiraFigura40.

Figura40VolkswagenPassat:PrimeiroVolkswagenbrasileirorefrigeradoagua

Fonte:QuatroRodas,2003(adaptado).Disponvelem:<
http://quatrorodas.abril.com.br/classicos/brasileiros/conteudo_143476.shtml#galeria>.Acessoem:
28/01/2013.

Oanode1974tambmmarcouafinalizaodaproduodoprimeiroprojetodeum
veculoFrmula1brasileiro,desenvolvidopelopilotoWilsonFittipaldiJr,abrindocaminho
para a fundao, em 1975, em parceria com seu irmo Emerson Fittipaldi, da primeira
equipebrasileiraacompetirnaFrmula1.AestreianaspistasocorreunoGPdaArgentina
de 1975, com Wilson Fittipaldi Jr. como piloto. Em 1976, Emerson Fittipaldi comeou a
correr pela equipe, a qual era chefiada por seu irmo com patrocnio da Copersucar
CooperativadeProdutoresdeCanadeAcar,AcarelcooldoEstadodeSoPaulo.
Emboraoaprimoramentodoprojetodoveculoparaascompetiesfosseconstante
cabedestacaroimportantepapeldesempenhadopeloengenheiroeprojetistabrasileiro
Ricardo Divila, responsvel pelos veculos da equipe a cada corrida ficavam evidentes as
deficincias e ajustes necessrios aos veculos para que se tornassem competitivos.
Significativas dificuldades enfrentadas pela escuderia e a falta de apoio no pas foram
decisivasparaodestinodaequipe.EmentrevistaconcedidaCamanzietalparaarevista

81

QuatroRodasdeDezembrode1977,Emersonfezdeclaraesreveladorassobreasituao
apsrenovaodopatrocniocomaCopersucar:

[...] foi muito peito da Copersucar renovar, porque o que eles receberam de
presso para no renovar no foi mole. Presso da opinio pblica, de alguns
usineiros,daimprensa,dergosdogovernoquediziamcomovocsvmpedir
financiamento se vo gastar toda essa grana com equipe de corrida? [...] Algum
dia,talvez,eupossacontartudo.Almdomais,vejacomosoascoisas:aTyrrel
patrocinadapelaElf,queaPetrobrsfrancesa,efazexatamenteoopostodoque
aPetrobrsfaz.AFranatambmnotempetrleo,masenquantoaPetrobrss
pensa em cortar nossas corridas, l a Elf patrocina uma escola de pilotagem,
patrocina a Frmula Renault, a Frmula 3 e 2 e em 78 vai patrocinar mais uma
equipedeFrmula1.(CAMANZIetal,1977,p.144).

Ainda na mesma entrevista, perguntado sobre como ele via a atitude do Conselho
Nacional de Petrleo que, para diminuir os gastos com combustvel resultante da crise do
petrleo que marcava a poca reduziu o nmero de provas no Brasil, o piloto deixou
transparecernovamenteafaltadeapoio:

tremendamente negativa, um absurdo que s acontece aqui. E a economia


resultanteridcula.Hmilharesdelanchasgastandogasolinanosfinsdesemana
nesse litoral todo, no h? Se fosse para economizar, realmente, deveria parar
tudo.Noapenasoautomobilismo,queumfatordedesenvolvimentotcnico.Eu
tenhofaladoquandoposso,masoautomobilismonoBrasilaindanotemtradio
e muita gente pensa que somos s um bando de playboys tentando se matar.
Talvezalgumdiaaprendamqueestavamenganados.(CAMANZIetal,1977,p.144).

Contudo, mesmo no desfavorvel cenrio, no ano de 1978, Emerson Fittipaldi


conseguiu omelhorresultado da CopersucarFittipaldi, conquistando o segundo lugar no
Grande Prmio do Brasil, disputado em Jacarepagu (RJ), e, no ano seguinte 1979 o
pilotoaindaadquiriuaequipeWolf,comoobjetivodemelhorartecnicamenteocarroea
equipeparaoanoseguinte.
Os resultados vieram e, no campeonato de 1980, a CopersucarFittipaldi terminou
emoitavolugar,frentedaFerrariquefinalizouemdcimolugar.Nototal,aescuderia
disputouoitocampeonatos1975a1982e,emMarode1980,EmersonFittipaldicorreu
sualtimadisputaesubiuaopdionaF1,conquistandooterceirolugarnoGrandePrmio
dosEstadosUnidos.

82

Os altos custos envolvidos para manterse na categoria, aliados falta de apoio no


pas,almdasadadaCopersucarcomopatrocinadora,somadadificuldadeemencontrar
outros investidores interessados no patrocnio da equipe, foram alguns dos motivos pelos
quais a CopersucarFittipaldi enfrentou sucessivas dificuldades para se manter, resultando
em seu fim no ano de 1982. Aquele ano marcou a ltima temporada na qual a escuderia
participou, com apenas um piloto, o brasileiro Chico Serra. Outros brasileiros alm de
WilsonFittipaldiJr.equedefenderamaequipeforam:AlexDiasRibeiroeIngoHoffmann.
OcasodaCopersucarFittipaldi,assimcomode outrasiniciativasnacionaisasquais
dependiam em certa medida de um maior apoio por parte do governo ou de entidades
nacionais em alguma instncia, demonstra a dificuldade e inoperncia destes em criar
condiesparaquesedesenvolvesseumdesignautomotivonacional.
A metade da dcada foi marcada, em 1975, pela criao do Prolcool Programa
Nacional do lcool pelo governo brasileiro, como soluo nacional de combustvel
alternativogasolina,porcontadacrisedopetrleoqueseabatiasobreomercadoglobal.
Oanode1976marcouainauguraodafbricadaitalianaFiatemBetim(MG)eoFiat147
Figura41surgiucomoopoaoFuscaentoocarromaisvendidodoBrasil.
O10SalodoAutomvelfoimarcadopeloambientedeincertezaquepairavasobre
a economia do pas como consequncia da crise mundial do petrleo. Ainda assim, foram
lanadosoFiat147,OpalaDiplomataeAlfaRomeoExecutiveeoVolkswagenBrasliaverso
quatroportas.

Figura41Fiat147:CompactodaFiateconcorrentedoFusca

Fonte:QuatroRodas,2002(adaptado).Disponvelem:
<http://quatrorodas.abril.com.br/classicos/brasileiros/conteudo_143483.shtml#galeria>.Acessoem:
29/01/2013.

Prximo ao final da dcada de 1970, entre os foradesrie comearam a surgir os


primeirosmodelosoriginadosapartirdamodificaodosmodelosoriginaisdefbricapor

83

empresas especializadas ou concessionrias. Tambm os veculos transformados visavam


preencherlacunaspresentesnomercadobrasileiro,oqualeracarentealmdosesportivos
demodelosdotipoStationWagon(perua);SUVseVans,porexemplo.
Emgeral,essastransformaesseguiamaordemdacompradoveculozeroKmna
concessionria por parte do cliente, o qual caso optasse pela modificao, solicitava o
servio a ser realizado na concessionria por uma equipe especializada, geralmente com a
colaboraodeumdesignerouapartirdekitsprfabricadosparamodificao.Oscustosda
transformaoeramacrescentadosaovalorfinaldoveculo.
Tambmerapossvelcompraroveculoemumaconcessionriaquenodispusesse
doserviodetransformaoemodificloposteriormenteemoutraempresa,especializada
notipodemodificaobuscada.
Caberessaltarcomoumpontopositivoodestaquedadopelaimprensadosetora
essas criaes, garantindo a elas o mesmo espao dado aos modelos produzidos pelas
grandes indstrias. Um destes modelos foi o Chevette Envemo Targa Figura 42 um
Chevetteoriginaldefbrica,modificadopelaempresaEnvemoEngenhariadeVeculose
Motoresespecializadaemrplicaseadaptaes.Talmodelofoitrabalhadodemaneiraa
transformaroChevetteemumconversvelparaquatropassageiros

Figura42ChevetteEnvemoTarga:modificaodoChevettedelinhafeitapelaEnvemo

Fonte:QuatroRodas,jul.1977,p.36.Disponvelem:<
http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

Em 1978, muitos modelos transformados ganharam o mercado, tais como o Passat


MalzoniFigura43,umesportivodesenvolvidoporRinoMalzoni,tendocomobaseoPassat
LSouTS,oqualeracompradopelosclientesemodificadosobencomendapelaequipede
RinoMalzoniemAraraquara(SP).

84

Figura43PassatMalzoni

Fonte:QuatroRodas,mar.1978,p.60.Disponvelem:<
http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

Tambm foram produzidos modelos peruas a partir dos veculos Ford Maverick e
Volkswagen Passat. O primeiro era feito sob encomenda, pela firma especializada Sul
Americana,apedidodaconcessionriaSouzaRamosautorizadadaFordemSoPaulo(SP)
tendocomobaseoMaverick.
Nessecaso,oprojetofoiaprovadopelaFordeagarantiaeraderesponsabilidadeda
Souza Ramos. As peruas Passat de duas e quatro portas eram produzidas a partir da
modificaodosmodelosdesriedoPassatpelaDacon,revendedoradaVolkswagenecom
experincianamodificaodecarrosdesrie.Omodeloquatroportastraziacomoinovao
otetopanormicoFigura44.

Figura44PeruasPassatdeduasequatroportas

Fonte:QuatroRodas,mai.1978,p.48.Disponvelem:<
http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

85

Uma das mais radicais transformaes poca foi realizada pela Sonnervig,
revendedoraForddeSoPaulo,noveculoFordCorcelII,transformandooemummodelo
conversvelFigura45produzidoapartirdomodelodesrie.

Figura45CorcelIIconversvel

Fonte:QuatroRodas,jun.1978,p.54.Disponvelem:<
http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

Aindaem1978,foilanadoummodelopickupforadesriebrasileiro,oFormigo
Figura46produzidopelaRenhaIndstriaeComrciodeVeculosLtda.noRiodeJaneiro
(RJ),comdesignprpriooriginalemecnicaVolkswagen.

Figura46PropagandadoFormigoveiculadanarevistaQuatroRodasemMarode1979

Fonte:QuatroRodas,mar.1979,p.10.Disponvelem:<
http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

86

No mesmo ano de 1978, o setor industrial automotivo bateu recorde de produo


emumano,ultrapassandoamarcade1.060.000milveculos.AFiatlanou,nomesmoano,
opicape147,primeirocomerciallevederivadodecarrocompactodoBrasileocorreua11
ediodoSalodoAutomvel,noqualforamlanadososmodelosChevettequatroportas,
Alfa Romeo 2300 e o nibus Mercedes 0364. A MercedesBenz comea a produzir em
Campinas (SP), sua atual Central de Peas. Ao final da dcada 1979 a indstria
automotiva ultrapassou a barreira de 1.000.000 de veculos vendidos no mercado interno.
Naqueleano,deacordocomaAnfavea(2006,p.112),foram1.014.925milunidades.

Dcadade1980
Em1980,apesardasincertezasdomercadoeconmico,osetorautomotivorecebeu
investimentos,eafbricaVolvofoiinauguradaemCuritiba(PR).OmodeloBandeirantede
nmero30milfoiproduzidopelaToyota.O12SalodoAutomvellanounaqueleanoos
modelosGolFigura47VoyageeSaveiro,FordDelRey,FiatPanoramaeGurgelXef.

Figura47VolkswagenGollanadoem1980

Fonte:QuatroRodas,2005(adaptado).Disponvelem:<
http://quatrorodas.abril.com.br/classicos/brasileiros/conteudo_147119.shtml>.Acessoem:29/01/2013.

Em1981,oprojetodeumforadesriechamouaatenodaimprensa:oDiaseta
Figura48.ProjetadoapartirdomodeloRomiIsetta,oDiasetaseriafabricadoporHumberto
Dias, dono de uma fbrica de autopeas no ABC paulista, que via no modelo um projeto
adequado para deslocamento em grandes centros urbanos. Embora se tratasse de uma
tentativanaqualoprojetistadepositavamuitasexpectativasdevendaesucesso,noforam
encontradosnabibliografiaindciosdesuaproduooucomercializao.

87

Figura48Diseta,oforadesriebaseadonoRomiIsetta

Fonte:QuatroRodas,fev.1981,p.100101.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

Aindaem1981,nomsdeMaiofoilanadooLaserFigura49offroadforade
srie resultante da transformao do modelo GM Veraneio, de srie, idealizado pelo
publicitrio Valter Gonalves com financiamento particular e produzido sob encomenda.
Comaproibiodeimportaovigente,talmodelofoiumatentativadereproduzirnoBrasil
os modelos offroad produzidos no exterior, com acabamento interno de luxo, estepe
externo,bagageiro,entreoutrositensdiferenciados.

Figura49Laser:offroadforadesrieresultantedatransformaodaGMVeraneio

Fonte:QuatroRodas,mai.1981,p.104105.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

OestadodeMinasGeraistambmdesenvolviaseusveculosforadesrie,sendoum
dos mais conhecidos o Farus ML 929 Figura 50 produzido em Belo Horizonte por Alfio
Russo,empresriodonodaFarusIndstriadeVeculosEsportivosLtda.Comprojetooriginal
eusodemecnicaFiat.

88

Figura50Farus:foradesriemineiro

Fonte:QuatroRodas,nov.1981,p.7076.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

Adcadade1980compreendeuoperodonoqualastransformaesdeveculosde
srieatingiramseupice.
Todososlanamentoseramacompanhadosdepertopelaimprensaespecializada,e
as publicaes indicavam em suas reportagens nomes e endereos de empresas
responsveis pelas modificaes. Assim, surgiram transformaes mesmo em modelos de
muitosucesso,comooGolCabrioletFigura51transformadopelaDacon,concessionria
deSoPaulo(SP).

Figura51GolCabriolet

Fonte:QuatroRodas,ago.1981,p.56.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

EoCorcelHatchbackFigura52oqualfoiprojetadoporAnsioCamposapartirda
modificao do modelo Belina, construdo e comercializado pela Souza Ramos,
concessionriadaFordemSoPaulo(SP)

89

Figura52CorcelHatchback

Fonte:QuatroRodas,mai.1980,p.115117.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

Em 1981, foi lanado ainda um novo modelo de perua Passat, construda e


comercializada pela revendedora da Volkswagen Sorana, de So Paulo (SP), a partir do
modelo de srie Passat LSE. J em 1982, foram apresentados os modelos Conversvel Del
Rey,projetadoapartirdoveculodefbrica,sendotransformadoemconversvelpelaCia.
SantoAmarodeAutomveisrevendedoraForddeSoPaulo(SP);oVoyageSR:modificado
pela SR Veculos Especiais de SP, um setor daSouza Ramos; Apickup El Paso, originada a
partir da modificao de uma pickup D10 da GM feita pela Envemo. Naquele ano alm
destes, foram produzidos executivos de luxo a partir dos seds de srie, como o Del Rey
Executivo, o qual era modificado pela Souza Ramos Indstria e Comrcio, e o Opala
Executivo, modificado pela Cia. Pereira Barreto de Automveis. A partir de 1983, as
modificaes em veculos pickups ganharam fora, e foram produzidos modelos como o
BlazereoCountryFigura53.Estesforamalgunsdosveculosdotipoperuacidadecampo
hojeSportUtilityVehicleouSUVsendooBlazerfeitosobencomendapelaSulam(So
PauloSP)apartirdeumapickupC10daGM,eaCountryproduzidapelaSouzaRamosou
SR(SoPauloSP),apartirdeumpickupF100daFord.

Figura53CountryeBlazer,algunsdosprimeirosveculosdotipoSUVsproduzidosnoBrasilapartirde
transformaesempickupsdelinha

Fonte:QuatroRodas,fev.1983,p.5455.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

90

Nareadasrplicas,aGlaspacproduziu,em1982,oCobraGlaspac,umarplicado
Cobra1960Figura54.

Figura54CobraGlaspac

Fonte:QuatroRodas,mar.1982,p.41.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

Entreasiniciativasbrasileiras,em1982foiapresentadooMiniDaconouDacon828
Figura 55 projetado pelo designer Ansio Campos e pelo engenheiro Paulo Goulart. O
modelo era um projeto de veculo urbano produzido pela Dacon, revendedora da
VolkswagendeSP.

Figura55SketchdoMiniDacondeautoriadeAnsioCamposeimagemdeentradadotesteQuatroRodas
veiculadonaediodeMaiode1982

Fonte:QuatroRodas,mai.1982,p.3640.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

Aindaporpartedasproduesoriginais,em1983,aMiura,aderindotendnciados
conversveis,lanouomodeloMiuraSpyderFigura56esportivooqualvisavasubstituir
os modelos importados, e do tipo que s era possvel adquirir a partir de carros
transformados.

91

Figura56MiuraSpyder

Fonte:QuatroRodas,dez.1983,p.45.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

Tambm a Gurgel, lanou em 1983, o veculo Gurgel Xef Figura 57 um veculo


produzidoempequenasrie,comacabamentodeluxoedepequenasdimenses,visando
atenderaumafaixadepblicorestrita,aqualprezavaporqualidadeempequenosveculos.

Figura57GurgelXef

Fonte:QuatroRodas,dez.1983,p.49.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:29/01/2013.

Aindaem1983,deacordocomaAnfavea(2006,p.114),aeconomiadopaspassou
por momentos de crise, e, desde 1981, o PIB mostraria queda mdia de 1,6%, sendo os
setoresdaindstriadebensdecapitaleconsumodurvelosmaisatingidos.
Mesmonestecenrio,aFordlanouaomercadoomodeloEscortXR3Figura58
nicomodeloconversvelfabricadoemsriepocadeseulanamento,tornandoocone
da marca , Del Rey Scala e motores CHT, enquanto a Volvo alcanava a marca de 5 mil
caminhesbrasileirosproduzidos.

92

Figura58EscortXR3:nicomodeloconversvelfabricadoemsrienapocadeseulanamento

Fonte:QuatroRodas,2011(adaptado).Disponvelem:<
http://quatrorodas.abril.com.br/classicos/brasileiros/conteudo_143481.shtml#galeria>.Acessoem:
29/01/2013.

Noanoseguinte,1984,opasapresentouinflaogalopanteacimados200%aoano,
oquefezcomqueosetorautomotivosofressequedabruscanasvendas,somando677mil
veculos vendidos, uma queda de 66,71% contra os 1.140.000 mil registrados em 1979
(ANFAVEA, 2006, p.114115). Ainda assim, o setor prosseguiu investindo, e o 13 Salo do
AutomvelapresentoucomonovidadesosmodelosFiatUnoFigura59,osVolkswagen
Santana e Quantum, o Gurgel Carajs e os caminhes Ford Cargo mdios. Naquele ano,
enfrentando dificuldades financeiras, a Puma interrompeu sua produo e tambm o
mercado de foradesrie sofria com sucessivas crises financeiras agravadas pela recesso
econmica,umavezqueosmodelosproduzidosapresentavamcustoselevadosdeproduo
influenciandodiretamentenopreodoprodutofinal.

Figura59FiatUno:ComprojetooriginaldeGiorgettoGiugiaro,oUnofoiproduzido
noBrasilemodelosucessordo147

Fonte:Quatrorodas,2009.Disponvelem:<http://quatrorodas.abril.com.br/classicos/brasileiros/fiatuno
mille484709.shtml>.Acessoem:29/01/2013.

Para driblar a crise muitas empresas passaram a produzir uma maior variedade de
modelosvisandoatenderadiferentesnichosdemercado(QUATRORODAS,1983,p.9698).
Assim,em1984nomercadodosveculosforadesrietransformadoscomearamachegar

93

osprimeirosmodelosdotipoVan,comooFurglaine,umdesignbrasileirodesenvolvidopela
FurglassapartirdeumaFordF100eoPoCaravelle,ummodeloconstrudosobrechassiF
100eF1000pelaSulamericanaFigura60.

Figura60Vans:esquerdaFurglaine(Furglass)edireitaPoCaravelle(Sulamericana)

Fonte:QuatroRodas,out.1984p.128.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:02/02/2013.

O ano de 1985 marcou o fim do regime militar, quando, por meio de eleies
indiretas, o colgio eleitoral Parlamento , elegeu Tancredo Neves presidente, que na
vsperadesuaposse,faleceuemSoPaulonodia21deAbril,sendosubstitudoporJos
Sarney.Naqueleano,ogovernorestringiuasimportaesmasaindalidavacomndicesde
inflao daordem dos 200%. Ainda em 1985, a Engenheiros Especializados S.A Engesa
empresa cujo portfolio era preenchido principalmente pela produo de veculos para as
ForasArmadasBrasileiraslanouoJipeEngesa4,comaintenodeocuparavagado
modeloJipeWillysoqual,em1982teveaproduodescontinuada.OEngesacomeoua
ser comercializado a partir de 1985 e, alm de seu emprego pelo Exrcito brasileiro, fez
muito sucesso entre o pblico civil. Entre as transformaes de veculos de srie, foram
lanadosoMonzaconversveleoMonzaperua,modificadospelaEnvemoeoUnoCabriolet
SultanFigura61feitopelaSultan,revendedoradaFiatemGarulhos(SP)eSantos(SP).

Figura61UnoCabrioletSultan

Fonte:QuatroRodas,mai.1985,p.6264.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:02/02/2013.

94

Em 1986, o governo lanou o plano cruzado e tomou medidas para conter a crise
econmica,aqualcausouquedanaproduodeveculospara966,7mil,dosquais763,1mil
foramvendidosaomercadointernoe207,6milexportados(ANFAVEA,2006,p.115).Como
reflexo da crise, as montadoras associadas da Anfavea no participaram do 14 Salo do
Automvel,oqualapenasdivulgouveculosimportadosouforadesrie.
Em1986, a administrao da empresa Puma vende suas marcas e patentes para
aAraucria Veculos, empresa que fabricaria um pequeno nmero de veculos at que a
marcafosseadquiridaem1989,pelaempresaAlfaMetais,quefinalizousuaproduo.
Entre os foradesrie, um modelo esportivo em especial marcou o ano de 1986: o
HofstetterFigura62.ConstrudopeloempresriobrasileiroMrioHofstetter,oveculo
apresentadonoSalodoAutomveldoanode1984elanadoem1986eracaracterizado
pelodesignfuturistae,almdechamaraatenodopblicopelosistemadeaberturadas
portas do tipo asadegaivota. Vrios modelos foram comercializados, entretanto, o
processodeproduoartesanalqueencareciaoprodutofinaleaausnciadeumaestrutura
devendasculminaramcomofimdesuafabricaoem1991.

Figura62Hofstetter:Foradesriecomdesignfuturista

Fonte:QuatroRodas,set.1986,p.170176.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:02/02/2013.

Noanode1987,foilanadooIbizaFigura63umforadesriedotipoVan/Perua
executiva produzido pela Souza Ramos Veculos Especiais SR a partir do modelo Ford
F1000,cujoprojetocomportavaatoitopassageirosebagagem.Tratavasedeumveculoj
popularizadoempasescomoosEstadosUnidos,masque,noBrasil,eranovidade.

95

Figura63Ibiza:foradesriedotipoVan/PeruaexecutivaproduzidopelaSouzaRamosVeculosEspeciais

Fonte:QuatroRodas,jul.1987,p.7677.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:02/02/2013.

Nomesmoano,foicriadopelodesignerAnsioCampos,oTopazzioFigura64um
utilitrio esportivo comercializado pela Engerauto. Embora tivesse como base o modelo
PampadaFord,amodificaoempreendidanoprojetodeAnsiofoiradical,apontodeno
restarnenhumalinhadecarternoveculoqueremetesseaoPampa.Soluescomoado
Topazzio refletem a competncia e versatilidade dos designers brasileiros que chega a
tornarse uma caracterstica dos mesmos em encontrar solues projetuais adequadas e
tornlas viveis mesmo em condies desfavorveis, como durante as vrias crises
econmicasqueopasenfrentounoperodo.

Figura64Topazzio:projetododesignerAnsioCampos

Fonte:QuatroRodas,dez.1987,p.8287.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:02/02/2013.

Noanode1988,emSoCaetanodoSul(SP),foiinauguradoocentrotecnolgicoda
GM em So Bernardo do Campo (SP), que deu origem ao Centro de Design brasileiro
operante atualmente. No ano de 2010, o Centro de Design foi totalmente reformulado,
tendoasuareatiltriplicadaparadesenvolverprojetossimultaneamentecomosdemais
centrosdedesenvolvimentoglobaisdaGMeconta,atualmente,segundodadosfornecidos

96

pela empresa, com 220 profissionais alm de se equiparar aos demais centros no que diz
respeitoarecursostecnolgicosutilizados(GeneralMotors,2012).
Em1988,foilanadotambmoGurgelBR800Figura65conhecidoem1987como
projeto Cena Carro Econmico Nacional. O modelo foi o primeiro carro completamente
desenvolvidonoBrasil.Atento,aGurgelfabricavaapartirdecomponentesVolkswagen,
sendooBR800montadoapartirdeconjuntomecnicoprprio100%desenvolvidonoBrasil
e60%daspeasecomponentesfabricadospelaprpriaGurgel.Nomesmoanoo15Salo
do Automvel aconteceu em So Paulo sendo os destaques do evento os modelos GM
VeraneioeBonanzaeoVolkswagenParati1.8.
Ogovernobrasileiro,napoca,visandoincentivarproduescomoessa,estabeleceu
uma reduo no valor do IPI 5% contra os 25% ou mais para os outros carros para o
modelo popular da Gurgel. Em 1990, tal incentivo foi estendido a todos os carros com
motores at um litro, culminando com a produo e entrada da Fiat no mercado dos
popularescomolanamentodoUnoMille,posturaseguidapelasdemaismultinacionais.

Figura65GurgelBR800:OprimeirocarrocompletamentedesenvolvidonoBrasil

Fonte:AutoEsporte,2012(adaptado).Disponvelem:
<http://revistaautoesporte.globo.com/Revista/Autoesporte/0,,EMI31459410142,00.html>.Acessoem:
02/02/2013.

No mercado de rplicas, em 1988, foi lanado o 550 Spyder, rplica do original


PorscheSpyder,produzidopelaAMEAmazonasMotocicletasespeciais.Entremodificados
brasileiros, foram lanados o Aldee acrnimo do nome da empresa Almir Donato
EquipamentosEsportivosconstrudoapartirdoGolGTSporAlmirDonatoexcampeo
demotovelocidadeeoNickFigura66projetadoporAnsioCamposparaaDacon.

97

Figura66NickprojetadoporAnsioCampos

Fonte:QuatroRodas,abr.1988,p.4652.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:02/02/2013.

No ano seguinte 1989 o governo tomou novas medidas para tentar conter a
inflao e lanou o Plano Vero, o qual, em sntese, significou novos congelamentos,
desvalorizao da moeda frente ao dlar, criao do Cruzado Novo e do dlar turismo.
Mesmo diante deste cenrio, os investimentos no setor permitiram Toyota projetar sua
fbricabrasileiraparaaproduodomodeloCorollaocarrodamarcademaiorsucesso
mundialaocompraramplareaemIndaiatuba(SP),prximadocampodeprovasdaGM,
marcaquelanounestemesmoanooKadettFigura67.

Figura67ChevroletKadett:Lanamentodesucessodamarca

Fonte:QuatroRodas,2011(adaptado).Disponvelem:
<http://quatrorodas.abril.com.br/classicos/brasileiros/chevroletkadett618986.shtml>.Acessoem:
02/02/2013.

Entre meados e o fim da dcada de 1980, as pickups no Brasil j denominadas


Picapesficaramemevidncianomercado.Taltipodeveculotornouseumimportante
nicho de atuao para empresas e concessionrias especializadas na transformao dos
modelosdesrieutilitriosemverdadeiroscarrosdeluxo.
AsmodificaeseramrealizadasprincipalmentenosmodelosF1000daFordeD20
da GM. Muitas empresas como a Sidcar e a Envemo Figura 68 eram especializadas na

98

vendadeacessriosenatransformaodeveculosnovosouusados,comomostramosdois
annciospublicitriosveiculadosnarevistaQuatroRodasdeJulhode1989:

Figura68esquerdapropagandadeEnvemoedireitaanncioempginadupladaSidcar

Fonte:QuatroRodas,jul.1989,p.45ep.104105respectivamente.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:02/02/2013.

O sucesso desses projetos foi to grande que, no ano de 1989 a GM se associou


Brasinca para lanar o modelo GM Bonanza Figura 69 a primeira SUV na poca
chamadaBlazernacionaldefbrica:

Figura69GMBonanza:produzidaemassociaocomaBrasinca

Fonte:QuatroRodas,dez.1989,p.148153.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:02/02/2013.

Dcadade1990
A dcada de 1990 teve incio com a posse de Fernando Collor de Mello como
presidente do Brasil e ficou marcada pela deciso do mesmo de confiscar o contedo de
contas bancrias e cadernetas de poupana da populao, sob o pretexto de auxiliar na
recuperaodacriseeconmica.Aproduocaiupara914,4milveculos,sendo712,6mil
vendidosaomercadointerno(ANFAVEA,2006,p.120).Naqueleano,ogovernoabriuopas

99

para as importaes de veculos e forou a competitividade da indstria, at ento


artificialmenteprotegidaporreservasdemercado.
Aindaem1990,aGMintroduziuumprogramadenominadoGlobalSourcing,oqual
tinhaporobjetivoredimensionarmundialmenteosveculosdamarca,demodoqueaspeas
pudessemseradquiridasemqualquerpas.Nomesmoano,aFiatalanouomodeloUno
1.0ealcanouaproduoacumuladade3.000.000demotoreseexportaode1.000.000
de veculos. A partir da abertura para importao, o 16 Salo do Automvel foi marcado
pelapresenadosmodelosimportados,taiscomoFerrariF40Figura70MercedesBenz,
Alfa Romeo, Thunderbird, Cadillac, Buick, Saab 9000, Volvo 960, Toyota Crow e
notadamentepelosbrasileirosonovoMonzaeanovalinhaGol.

Figura70FerrariF40:Umadasgrandesatraesimportadasdo16SalodoAutomvelem1990

Fonte:Netcarshow,s/d(adaptado).Acessoem:04/02/2013.

Tambm em 1990 foi lanado modelo Futura, primeira Van brasileira cujo projeto
noeraderivadodeumpickup,massimcompletamenteconstrudoinspiradonoRenault
Espace.AproduoeraderesponsabilidadedaGrancar,revendedoradaFordemSoPaulo
(SP),apartirdemecnicadamesmamarca.Legalmente,osprojetoseramcompletamente
diferentes.
Naaparncia,entretanto,eramidnticos.Anovidadechamouaatenodaimprensa
edomercado.Assim,arevistaQuatroRodasemsuaediodeJaneirode1990,publicouem
reportagemasinovaestrazidaspelomodelo,comomostraaFigura71:

100

Figura71Futura:aprimeiravanbrasileiranoderivadadepickup

Fonte:QuatroRodas,jan.1990,p.3239.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:04/02/2013.

Aindaem1990,foramlanadosalgunsforadesriecomoosuperpicapeDeserterXK
fabricadapelaSRSouzaRamos,amaiorempresafabricantedeveculosespeciaisdoBrasil
napoca,eoJipeJavali,projetadopelaCompanhiaBrasileiradeTratoresCBT.EmAgosto
daqueleano,omercadobrasileirofoiabertosimportaeseogovernobrasileiropermitiu
que as indstrias aqui instaladas importassem modelos de seu portflio produzidos no
exteriordentrodolimitede10%dofaturamentocomsuasexportaesoriginadasnoBrasil.
Apartirdaaberturadomercadonacional,marcascomoBMW,MercedesBenz,Audi,
Toyota,Lada,Peugeot,Citron, MazdaeasdeluxocomoMaseratieFerraricomearama
sersolicitadaspelosrevendedores.
O Alfa Romeo 164 Figura 72 foi o primeiro importado a chegar ao pas sob
encomenda da Fiat do Brasil para ser revendido no pas psabertura, como destacou a
reportagemintituladaAlfa164aprimeiraestrela,veiculadanarevistaQuatroRodasem
suaediodeAgostode1990(p.3642).

101

Figura72Alfa164foiumdosprimeirosmodelosimportadospelaFiatdoBrasilpsaberturadomercado
brasileiroaosimportados

Fonte:QuatroRodas,ago.1990,p.39.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:04/02/2013.

A abertura do mercado aos importados prejudicou de maneira irreversvel e


previsvelomercadodosveculosforadesrie.Apossibilidadevislumbradapelaclientela
dos veculos especiais em trazer modelos de sucesso de outros pases absorveu seus
investimentos,osquaisanteseramdirecionadosapagaraltosvaloresemveculosexclusivos
oumodificados.Apartirdoanode1991aspublicaesreferentesaosetorforamtomadas
peloslanamentosnosomentebrasileiros,mastambmdomercadoexterno,osquaisse
tornaram possibilidades reais de compra no Brasil. Mesmo neste cenrios alguns poucos
foradesrie ainda foram produzidos como o BMW Verona Figura73 modificao do
FordVeronapelaSRinspiradonoBMWM3nofinalde1990eoCamper,offroaddeluxo
fabricadopelaEnvemoem1991.

Figura73BMWVerona:foradesriefabricadopelaSRSouzaRamos

Fonte:QuatroRodas,set.1990,p.8688.Disponvelem:
<http://quatrorodas.abril.com.br/acervodigital/home.aspx>.Acessoem:04/02/2013.

102

O ano de 1991 correu de maneira turbulenta para a indstria automotiva, a qual


lidou com as constantes mudanas econmicas e polticas da maneira que fosse possvel,
buscandoumareaopositivaprincipalmentefrenteaberturadomercadobrasileiroaos
importados a qual impactou seriamente o setor de autopeas. Em 1992, o 17 Salo do
Automvel exps diversos modelos importados como o Saab 900, Lumina, Audi 100, Ford
Explorer,Alfa164,GhiaViaeosmodelosHondaAccordFigura74eCivic.

Figura74HondaAccord:Umadasatraesimportadasdo17SalodoAutomvelem1992

Fonte:QuatroRodas,2006(adaptado).
Disponvelem:<http://quatrorodas.abril.com.br/carros/usado/conteudo_194839.shtml#galeria>.Acessoem:
04/02/2013.

Noanode1992,entreosbrasileiros,aGurgellanousuanovapropostadeveculo
urbanoemsubstituioaoBR800,modeloqueperdeuespaoquandoogovernoestendeu
osincentivosfiscaisproduodeveculoscomatmotorizaodeat1litro,favorecendo
aentradadasmultinacionaisnonichodeveculospopulares.TratavasedomodeloGurgel
SuperminiFigura75oqual,emsuapocadelanamento,eraonicoveculofabricado
pela nica montadora nacional. As dificuldades enfrentadas nesse perodo foram
determinantesparaofimdaGurgel,aqual,noanode1995,tevesuafalnciadecretadae
suasatividadesencerradas.

Figura75GurgelSupermini:lanadoem1992emsubstituioaoBR800

Fonte:QuatroRodas,out.2003.Disponvelem:<
http://quatrorodas.abril.com.br/classicos/brasileiros/conteudo_143471.shtml#galeria>.Acessoem:
04/02/2013.

103

Em 1993, o ento presidente Itamar Franco criou o Programa do Carro Popular e


convenceu o ento presidente da Volkswagen do Brasil, Pierre Alain De Smedt, a fabricar
novamenteoFusca.NomesmoanoaGMlanouosedVectraFigura76eaFordlanou
o novo Verona, o popular Escort Hobby, o Escort com motor Zetec. Beneficiandose da
abertura do mercado, a Volvo iniciou a importao de caminhes completos e chassis de
nibus.

Figura76ChevroletVectra:LanamentodaGMsubstitutodoMonza

Fonte:QuatroRodas,2011(adaptado).
Disponvelem:<http://quatrorodas.abril.com.br/classicos/brasileiros/chevroletvectragsi
641080.shtml#galeria>.Acessoem:04/02/2013.

Em 1994, nos primeiros meses do ano, o ento ministro da Fazenda, Fernando


Henrique Cardoso, iniciou uma srie de medidas para o lanamento de um novo plano
econmico:oPlanoReal.Anovamoedaadcimadopaserasobrevalorizadafrenteao
dlar,eauxiliounoaumentodopoderrealdecompra,combatendoainflao.Nomesmo
ano,naGM,saiudelinhaoChevette,eocorreuolanamentodoCorsaFigura77.

Figura77ChevroletCorsa:Sintetizouatendnciadearredondamentodaslinhasverificadaapartirdadcada
de1990

Fonte:QuatroRodas,s/d(adaptado).
Disponvelem:<http://quatrorodas.abril.com.br/galerias/imagens/brasil_111104_05.jpg>.Acessoem:
04/02/2013.

104

Ainda em 1994, a Volkswagen lanou a segunda gerao do Gol Figura 78


popularmenteconhecidocomoGolBolinha,devidomudananaslinhasdoshapedesign,
maisarredondadas,rompendocomodesenhoretilneotradicionaldoGol.Asmudanasde
estilotambmforamrepassadasSaveiro.A18ediodoSalodoAutomvelapresentou,
entre muitos modelos o Fiat Tipo, o Volkswagen Passat, o Ford Mondeo e o Ford Fiesta
(QUATRORODAS,1994).

Figura78GolgeraoII:OpopularGolBolinha

Fonte:QuatroRodas,2010(adaptado).
Disponvelem:<http://quatrorodas.abril.com.br/reportagens/historiavolkswagengol559804.shtml#galeria>.
Acessoem:04/02/2013.

No mesmo ano, a revista Quatro Rodas destacava, em reportagem de Jlio Csar


MorenoeintituladaDaspranchetasaoscomputadores,comoodesigndosveculoshavia
mudado ao longo dos anos. Na ocasio, o reprter destacava a dificuldade da insero do
design brasileiro nos projetos, que, aos poucos, deixavam de considerar aspectos locais,
mudanasestasquecaracterizaramodesignautomotivopraticadopelasgrandesindstrias
na dcada de 1990, antecipando as tendncias que se verificariam no decorrer dos anos
2000comoodesenvolvimentoeproduodeprojetosglobais:

Aindstriabrasileira,porsuavez,nuncasedestacoupelacriaonodesign.No
por falta de capacidade, mas pelo desinteresse das montadoras que preferem
importar os modelos produzidos nas matrizes. Quando tiveram chance, nossos
centrosdeestilochegaramadesenvolverbonsprojetoscomoodaBraslia,doSP2
edoPuma,esportivofeitodefibradevidro.AVolkswagensemprefoiaempresa
que mais valorizou o design nacional. Hoje, com exceo do Fusca, toda sua
produo teve concepo brasileira, como o Pointer [...] As outras montadoras,
depoisdeumafaseemqueapenasadaptavamosprodutosdamatriz,hojepodem
opinar,interligadascomoscomputadoresdasede,sobreosmodelosqueentraro
nomercado.(MORENO,1994,p.7475).

105

Ainda a reportagem registrou a fala de Marcos Carvalho, da Fiat, para quem, na


poca,Projetarumautomvelparaumlocalespecficocoisadopassado(CARVALHOin
MORENO,1994,p.75).Comoexemplodessatendnciaentonascenteojornalistacitou
o modelo Mondeo, o qual foi elaborado em reunies via satlite entre os designers do
CentroTcnicoEuropeudaFordemDuntonnaInglaterraeosdeoutrassedesinstaladas
naAlemanhaenosEstadosUnidos.Comopassardosanosodesenvolvimentodeprojetos
globais tornaramse uma constante nas grandes indstrias, contudo, como j visto, anos
mais tarde a fala de Marcos Carvalho se tornaria obsoleta pela prprio movimento do
mercado e pelo mau xito da tendncia de padronizao da demanda, visto que a
diversidadedepblicosapresentanecessidadesegostosespecficosquedevemserlevados
em considerao na concepo de qualquer projeto de produto. O que verificouse,
portanto,aolongodosanosfoiumamudanadedireodasempresasfabricantesrumo
descentralizao dos desenvolvimentos voltados mercados que necessitavam de
adaptaes constantes nos projetos para atender demandas diversas embora o nvel
decisriomaisaltodosprojetosaindasejacentralizadonasmatrizes.
No ano de 1995, mais um recorde foi alcanado pela indstria quando o mercado
absorveu 266 mil automveis importados. J em 1996, muitas foram as inauguraes no
setor, das quais destacaramse a constituio da Honda Automveis do Brasil, a qual
construiusuafbricaemSumar(SP),aGMinaugurouseucentrodistribuidordepeasna
cidade de Sorocaba (SP), e a Volkswagen chegou a So Carlos (SP), constituindo ali sua
fbrica de motores, alm de uma outra planta fabril voltada produo de caminhes e
nibusnacidadedeResende(RJ).O19SalodoAutomvel,apresentouentreosmuitos
modelosimportados,osbrasileirosVolkswagenPoloSed,FiatPalioWeekendeVectra(GM)
(QUATRORODAS,1996).
Noanoseguinte1997aHondainaugurouafbricadeSumar(SP)Figura79,e
a Iveco anunciou a construo de fbrica na cidade de Sete Lagoas (MG), alm da
inauguraodeconcessionriasparaimportao.

106

Figura79FachadadafbricadaHondaautomveisemSumar(SP),inauguradaem1997

Fonte:HondaAutomveis,s/d(adaptado).
Disponvelem:<http://www.honda.com.br/sobreahonda/nobrasil/Paginas/hondaautomoveisdo
brasil.aspx>.Acessoem:04/02/2013.

Em 1998, a Nissan e a Renault se instalaram no Brasil, assim como a International


Caminhes, e a Toyota iniciou a produo do modelo Corolla, com 1 mil 921 unidades
Figura80.OSalodoautomveldenmero20apresentouosmodelosVolkswagenGolfe
NewBeetle,osmodelosFiatBrava,FiatStradaeMarea,aGM,omodeloChevroletAstraea
Peugeotomodelo206(QUATRORODAS,1998).

Figura80ToyotaCorolla:produobrasileiraapartirde1998

Fonte:QuatroRodas,s/d(adaptado).
Disponvelem:<http://quatrorodas.abril.com.br/carros/usadodomes/corolla.shtml>

No ano de 1999, a Renault inaugurou sua planta fabril na cidade de So Jos dos
Pinhais(PR).
Aindaem1999,foramnovidadeasinstalaesdaLandRoveraqualproduziu363
veculos;daDaimlerChryslerresultantedafusodaMercedeseChrysleraqualpassoua
produzirautomveisemJuizdeFora(MG),edaVolkswagenAudi,queseinstalouemSo
JosdosPinhais(PR).
Tambm em 1999 foi lanado o Jipe Troller Figura 81 criado e fabricado em
FortalezanoCearpelafbricademesmonomecomoalternativaaosbuguesdedunas.Seu
desempenhoimpressionavaemterrenosirregulareseemtrilhas.

107

Omodelocomeouaserfabricadonoanode1994emumaoficinaimprovisadano
Cear, em empresa fundada por Roogrio Farias, despertando a ateno do empresrio
Mrio Araripe empresrio do setor de tecelagem e construo civil que apostou no
negcio, comprandoo e fundando a marca em 1997. Sua inteno era transformar o off
road em uma opo aos tpicos bugues que circulam pelas dunas da regio. O projeto de
linhasfortesedesigncompetentetornousesucessojuntoaopblico,eomercadorecebeu
muitobemoproduto, oqualconquistousucessotambmnascidades.Noano de2007,a
FordadquiriuaTroller,empresaquepassouaintegraroGrupoFord.

Figura81TrollerT4:projetoefabricaobrasileirosat2007

Fonte:QuatroRodas,abr.2004.
Disponvelem:<http://quatrorodas.abril.com.br/carros/usado/conteudo_139962.shtml>.Acessoem:
04/02/2013.

Dcadade2000
Oano2000foimarcadopelainauguraodocomplexoindustrialdaGMemGravata
(RS), a qual, em Setembro daquele ano produziu o modelo Celta em parceria com
fornecedoresinstaladosnaregio.OSalodoAutomvel,emsua21edio,exps,entre
asmuitasnovidades,osmodelosCryslerPTCruiser,oCitronXsaraPicassomodeloque
inauguroualinhadeproduodePortoReal(RJ)eoVolkswagenBora(QUATRORODAS,
2000).
Odecorrerdoano2001foimarcadoporinauguraesimportantescomoainstalao
dafbricadaPSAPeugeotCitronnacidadedePortoReal(RJ)Figura82aqualproduziu
18mil116veculosnaqueleano,entreelesaCitronXsaraPicassoeoPeugeot206.

108

Figura82PlantafabrilPSAPeugeotCitronemPortoReal(RJ):produobrasileiraapartirde2001

Fonte:PSAPeugeotCitron,s/d(adaptado).
Disponvelem:<http://www.psapeugeotcitroen.com.br/psapeugeotcitroenbrasil/centrodeproducao>.
Acessoem:04/02/2013.

No mesmo, ano ocorreu a inaugurao da fbrica da Alliance resultado da


associao entre Nissan e Renault em So Jos dos Pinhais (PR), na qual iniciouse a
produodosmodelosFrontierFigura83eXterra.AindaaHondacomemorou4anosde
BrasileanunciouavindadomodeloHondaFit.AFordinaugurouemparceriacommaisde
trintafornecedoressuaplantafabrildeCamaari(BA),cominvestimentodeUS$1,9bilho.

Figura83NissanFrontier:produobrasileiraapartirde2001nafbricadeSoJosdosPinhais(PR)

Fonte:QuatroRodas,2006(adaptado).
Disponvelem:<http://quatrorodas.abril.com.br/carros/usado/conteudo_194883.shtml#galeria>.Acessoem:
04/02/2013.

Noanode2002,o22SaloInternacionaldoAutomvellanounovidadestaiscomo
o utilitrio esportivo Ford Ecosport, o compacto Citron C3 Figura 84 e como grande
atrao internacional a Ferrari modelo Enzo projetada em homenagem ao criador da
escuderia Enzo Ferrari sendo este um dos modelos mais icnicos da marca (QUATRO
RODAS,2002).

109

Figura84CitronC3:Produobrasileiraapartirde2002nafbricadePortoReal

Fonte:QuatroRodas,2006(adaptado).
Disponvelem:<http://quatrorodas.abril.com.br/carros/usado/conteudo_270751.shtml>.Acessoem:
04/02/2013.

J em 2003, as montadoras alcanaram ndices de exportao recorde, atingindo o


faturamento de US$ 4.678.000.000 em autoveculos, motores e componentes, sendo o
maior importador o Mxico US$ 1.254.000.000 seguido pela Argentina US$
826.500.000.Emseuprimeiroanodevendas,oscarrosbicombustveispassveisderodar
comlcoolougasolinatotalizaram48.200unidades.
Aindaem2003aFiatinaugurounoBrasilemsuaplantafabrilnacidadedeBetim
MG seu Polo de Desenvolvimento e Centro de Estilo. De acordo com a empresa, ambos
capacitamaFiatAutomveisadeteratecnologianecessriaparaprojetarumautomvel,do
designataconstruodosprottipos.Taisreascontamcomlaboratriosequipadoscom
recursosdeltimagerao,capazesdesimulaesetestesdinmicosemescalareal,sendo
oCentroEstiloanicareadeconcepodedesigndaFiatforadaEuropa.
OCentrodeEstiloutilizatecnologiasdecriaodemodelosvirtuaiscomomximo
de fidelidade ao real, os quais so posteriormente materializados pelarea de Construo
deProttiposantesdeseguiremparaaproduoemsrie(FIAT,2012).
Tambmem2003aVolkswagencompletou50anosdeatuaonoBrasil,totalizando
maisde13.000.000deveculosproduzidosetornandoopasumdosprincipaismercadosdo
Grupo Volkswagen, no qual o volume de vendas representava 9,5% do total mundial
arrecadado pela multinacional. Em 2003 tambm foi lanado o modelo que seria outro
grandesucessodamarca:oVolkswagenFoxFigura85.

110

Figura85VolkswagenFox:Projetodesenvolvidopeloestdiodedesign
damarcanoBrasil

Fonte:QuatroRodas,s/d(adaptado).
Disponvelem:<http://quatrorodas.abril.com.br/eleitos/2009/hatchescompactospremium/>.Acessoem:
04/02/2013.

Idealizado e coordenado por Luiz Alberto Veiga, o projeto do Volkswagen Fox foi
desenvolvidonoBrasilsobreaplataformadoVolkswagenPolo:

Ocarronasceudentrodoestdioqueeuutilizava,foiideiaminhadesdeodesenho
do guardanapo at o carro comear a ser vendido nas ruas [...] A Alemanha no
sabia de nada, fizemos o carro totalmente escondido e depois de pronto eu o
apresentei ao meu diretor, que depois apresentou para o presidente. (VEIGA in
PADILHA,2010,p.8).

A princpio, a inteno era de que o Volkswagen Fox substitusse o modelo Gol,


entretanto,concludooprojeto,adiretoriadaVolkswagenoptouporsituloumacategoria
acimadoGol,devidoimportnciadomesmonomercadobrasileiro.OsucessodoFoxno
Brasil se repetiu tambm em outros pases, sendo o veculo exportado at mesmo para a
Alemanha, passede da companhia. Como projeto de design, a ousadia dos designers
brasileirossemostrou presentenovamentenocasodoFoxcomoemoutrosprojetosde
outros tempos aqui apresentados sendo esta uma caracterstica desses profissionais, os
quaisa despeitodasdificuldadesencontradasnocaminhodeseprojetarprodutosemum
pas em desenvolvimento, conseguem driblar obstculos na busca pela produo de
produtoscompetentes.
De acordo com a Anfavea (2006, p.129), em 2004, as vendas de veculos
bicombustveis tambm referenciados pelo termo flex atingiram mais de 328.300
unidades. Naquele ano, o 23 Salo do Automvel apresentou os Volkswagen CrossFox e
Polosed,oCitronC4,NissanSentra,eoprimeiroveculohbridomovidoadoistiposde

111

motores atuantes alternadamente: um eltrico e outro gasolina da marca Toyota com


autonomia e desempenho para uso equivalente aos carros movidos apenas motor de
combusto (QUATRO RODAS, 2004). Cabe destacar alguns projetos de design automotivo
desenvolvidos na dcada de 2000 paralelamente ao mercado de grande volume, como os
projetos8282e012daempresabvio!fabricantedeveculosbrasileira,queentreosanos
de2001e2009uniuseaodesignerAnsioCamposparaaproduodosdoismodelos.
Osubcompacto8282,redesigndoDacon828projetadoporAnsioCamposePaulo
Goulart em 1982 Figura 86 foi desenvolvido sob a coordenao de Ansio Campos e
executado em equipe formada pelos designers Celso Santos, Bruno Pauletti e Gustavo
Mayworm, com motorizao Tritec fbrica de motores pertencente ao jointventure
Chrysler/BMW.

Figura86esquerdabvio!8282edireitaAnsioCampos(apartirdaesquerda),CarlosdeCarvalho,Fabio
OshiroeSauloTatizawa,partedaequipedabvio!

Fonte:AnsioCamposDesign,2013.Disponvelem:<http://www.anisiocampos.com/his.html>.Acessoem:
04/02/2013.

O modelo 012 Figura 87 , de autoria de Ansio Campos, foi projetado e


desenvolvido no Brasil, tendo como base a tecnologia alem empregada pela Porsche,
tambmcommotorizaoTritec.

Figura87Modelo012dabvio!tambmprojetadoporAnsioCamposeequipe

Fonte:Autoblog,ago.2005.Disponvelem:<http://www.autoblog.com/2005/08/03/obvio8282and012
comingtoamerica/>.Acessoem:04/02/2013.

112

Os planos da bvio! para ambos os veculos, no entanto, foram abreviados pela


problemticaenfrentadajuntoTritec,comodestacadoporAnsioCampos:

Oinciodeproduodosveculosestavadefinidaparaofinalde2008,mascomo
srio problema do atraso no seu cronograma de entrega para a encomenda de
50.000 unidades para o Distribuidor dos Estados Unidos, ocorrido em funo do
encerramento de operaes da fbrica Tritec Motors em 2007, que a obrigou a
paralisar os projetos de engenharia com as empresas Lotus Engineering na
Inglaterra e com a Porsche Engineering na Alemanha, j contratadas.A Tritec
MotorseraumafbricademotorespertencenteaojointventureChrysler/BMW
queseencerrouemJulhode2007epassouaserdepropriedadedaChryslerLLC
que produzia no Brasil os motores do MINI Cooper BMW localizada em Campo
Largo,ParaneerafornecedorachavedaObvio!,tendoparticipadoporcincoanos
do desenvolvimento do projeto. Esse fato gerou considervel prejuzo e originou
duasaesjudiciaiscontraaTritec.(CAMPOS,2013).

Nesse contexto, embora os prottipos estivessem prontos e tenham sido


apresentados em sete exposies automotivas nos Estados Unidos, alm de amplamente
divulgadospelaimprensanoexterior,ambososprojetosnuncaentraramemproduo,mas
marcarammaisumainiciativabrasileiranosetor.
Em2005,aGeneralMotorscompletou80noBrasil,sendoasegundamaioroperao
damarcaforadosEstadosUnidoseamaiorsubsidiriadaGMCnaAmricadoSul.Tambm
em 2005, pela primeira vez, a venda de veculos flex superou a dos movidos gasolina,
totalizando866.002milveculos,oquecorrespondeua53,6%domercado.Aindaem2005,
merece destaque a criao do estdio con Design. Coordenado pelos designersNelson
LopeseMarcio Sartori ambos com ampla experincia na grande indstria, o primeiro na
Volkswagen do Brasil e o segundo na Ford, Fiat e Volkswagen do Brasil o estdio
especializado nas reas automotiva e de produto, oferecendo cursos especficos para
formao continuada em design, tais como sketch automotivo e de produto, rendering
digitalautomotivoedeproduto,Gestaltautomotivoedeproduto,softwaresemodelao
em clay. Os cursos ministrados tornaramsereferncia de formao continuada em design
no Brasil principalmente no que se refere ao design automotivo preparando mode
obra qualificada com alta aprovao e frequente absoro por parte dos estdios das
grandes indstrias instalados no pas. A criao da con permitiu a complementao da
formao para o design de automveis paralelamente formao oferecida pelas
Universidades e como auxiliar destas, sendo at os dias atuais considerada referncia na
rea.

113

Entre os foradesrie, em 2005 ocorreu o lanamento do Lobini H1 Figura 88


veculo com projeto inicial datado de 1999 e originado da iniciativa e associao entre o
advogado Jos Orlando Lobo e o engenheiro Fabio Birolini, os quais tinham por vontade
desenvolverumesportivonacional.Foidauniodossobrenomesdosseusidealizadoresque
resultouonomeLobini,acrescidodasiglaH1,emhomenagemaoengenheiroinglsGraham
Holmes,umdosresponsveispelodesenvolvimentodoveculo.ProduzidoemCotia(SP),o
Lobini chamou a ateno da imprensa e do pblico. Em 2006, a empresa foi comprada
pelaBraxAutomveis,aqualadquiriuamarcaLobiniesuafbricaeresponsvelporsua
produoatosdiasatuais.OmodeloatualmentecustaR$180.000,00eproduzidosob
encomenda(LOBINI,2013).

Figura88Lobini:oesportivoforadesriebrasileiroproduzidoemCotia,nointeriordeSoPaulo

Fonte:Lobini,2013.
Disponvelem:<http://www.lobini.com.br/site/index.php?pagina=wallpaper>.Acessoem:05/02/2013.

No ano de 2006, o 24 Salo do automvel celebrou os 50 anos da indstria


automotiva no Brasil e apresentou, entre muitas novidades, os modelos Volkswagen
SpaceCross e o importado Eos, alm dos Fiat Idea Adventure e do conceito Fiat FCC, bem
como apresentou o Ford Edge e Chevrolet Prisma sed baseado no compacto Celta
(QUATRORODAS,2006).
Jem2007,aVolkswagenfoiaempresaquemaiscresceuemvendasdeveculosno
pas,colocandonomercado537.975carros,31,3%amaisqueem2006.NaFiat,osaltofoi
de30,5%,seguidapelaGM(21,7%)eFord(20,1%).NomesmoanoaSulcoreanaHyundaise
instalounoBrasilpormeiodoGrupoCaoa,ativandoumalinhademontagemnacidadede
Anpolis(GO)fabricandooutilitrioHR.
Cabedestacar,noanode2007,osurgimentodeoutrainiciativabrasileiraparteda
indstria de grandes volumes, o prottipo esportivo LSPS Figura 89. Criado e construdo
pela empresa AmoritzGT, fundada no ano de 2005 pelo designer Fernando Morita

114

profissional com ampla experincia em design automotivo, adquirida nos anos em que
trabalhounosestdiosdaVolkswagendoBrasiledaAlemanhaoLSPSfoioprodutode
apresentao da marca, um prottipo elaborado sem a inteno de produo e venda,
antes, tornouse um teste das potencialidades do estdio em produzir um veculo e a
materializao dos desejos da equipe em projetar e produzir um design automotivo
brasileiropartedagrandeindstria.
De acordo com o prprio Fernando Morita, o carro [...] foi feito em um poro, na
zona norte de So Paulo, utilizando apenas madeira, poliuretano e gesso, para ficar mais
baratoerpidodefazeromockup[...]acaractersticaprincipaldocarroaideiadeserum
carroclssiconoconceito(MORITA,2013a,p.115).

Figura89LSPSemsentidohorrioapartirdaesquerda:Sketchdoprojeto,construodomodeloeexposio
doveculoprontonoeventoXTtremeMotorsports2007

Fonte:AmoritzGT,2013.
Disponvelem:<http://www.amoritzgt.com.br/projetos_lsps.asp>.Acessoem:05/02/2013.

OprojetoLSPSteveimportanterepercussonamdiaejuntoaopblico,projetando
a AmoritzGT no cenrio automotivo nacional. Em 2008, a Volkswagen divulgou planos de
investimento, visando liderana do mercado mundial at 2018, e lanou o Novo Gol
Figura90eVoyageemsuaquintagerao.

115

Figura90GolgeraoV:Projetodedesigncompletamentenovo,incluindopackage,mecnicaeestilo

Fonte:QuatroRodas,2008(adaptado).
Disponvelem:<http://quatrorodas.abril.com.br/carros/testes/conteudo_290091.shtml>.Acessoem:
05/02/2013.

Tambmem2008,oatualgerenteexecutivodoCentrodeDesigndaVolkswagendo
Brasil,LuizAlbertoVeigaentoresidindotemporariamenteemWolfsburg,naAlemanha
conseguiu intervir em favor da criao de um estdio de design brasileiro permanente
dentrodamatriz.DeacordocomVeiga:

[...]Eufundei,em2008,oVolkswagendoBrasilDesignCorner,queumestdio
brasileiropermanentedentrodoCentrodeDesigndaVolkswagenemWolfsburg.A
partirda,temosdesignersetcnicosresidenteseumvolumegrandedeviajantes
todososanosparal.Comisso,estamosalinhadosquantolinguagemdedesign
damatrizedeixamosdeservisitantesparafazermospartedaforaintelectualdo
design mundial da marca. Nossos projetos fluem muito melhor com esse posto
avanado e estamos com uma cadeira cativa no pas que faz os melhores
automveis do mundo. Isso tem um valor incalculvel para ns. (VEIGA in
MOREIRA,2011).

TalpassotevegrandeimportnciaparaodesenvolvimentododesigndaVolkswagen
voltado ao Brasil e Amrica Latina. Sendo a regio latina um importante mercado
consumidor dos produtos da marca e o estdio da subsidiria brasileira um competente
desenvolvedordeprojetosdesucessocomoosVolkswagenGoleFoxoestabelecimento
de um nvel de intercmbio entre matriz e subsidiria favorvel estruturao de uma
representao brasileira constante dentro do centro de design mundial da empresa
favoreceuaotimizaodosprocessosdedesignnoBrasil,aomesmotempoemquemantm
estdio e designers em constante atualizao em relao s inovaes direcionadas ao
aprimoramento da linguagem de design da marca e consequentemente nos projetos de
produto da mesma. Outros lanamentos importantes do ano de 2008 foram Kia Soul
modeloimportadoHondaCity,RenaultGrandScniceSanderoStepway,alinhaPeugeot
207Figura91eKiaSportage.O25SalodoAutomvelexps,nopavilhodoAnhembi

116

osmodeloscompactosdeluxoMiniCooper,SmarteFiat500.AVolkswagenapresentouo
modeloVolkswagenPickupoqualsetornariaoVolkswagenAmarok,eaHondaomodelo
Fit.AGMtrouxeaoBrasilnaocasiooVoltcarroeltricodamarca.

Figura91Peugeot207:Substitutodomodelo206fabricadonoBrasil,egrandelanamentoda
Peugeotem2008

Fonte:QuatroRodas,2008(adaptado).
Disponvelem:<http://quatrorodas.abril.com.br/carros/impressoes/conteudo_291535.shtml>.Acessoem:
05/02/2013.

Aindaem2008,oestdiobrasileiroAmoritzGTinicioumnovoprojetoforadesrie:
o Doni Rosset Figura 92 um superesportivo de srie limitada 50 unidades
desenvolvido sob encomenda de William Denis Rosset, pela equipe composta por Clvis
Augusto de Souza, Rafael Augusto de Souza, Alexandre Hirata, Lucas Rodrigues, Felipe
MllereGuilhermeVituri,lideradaporFernandoMorita.

Figura92DoniRossetemsentidohorrioapartirdaesquerda:Sketchdoveculo,modeloemclayeproduto
finalapresentadoimprensaeaopblico

Fonte:AmoritzGT,2013.
Disponvelem:<http://www.amoritzgt.com.br/projetos_doni_rosset.asp>.Acessoem:05/02/2013.

117

A apresentao do veculo ocorreu em 2012, e o resultado do projeto impactou o


pblicoea imprensaespecializada,noapenas peloimpressionanteresultadofinal obtido
no design de um veculo superesportivo cujo projeto foi concebido e produzido no Brasil,
mas tambm pelo potencial do estdio em entregar umproduto extremamentecomplexo
demaneiracompetente.
Na rea acadmica, no ano de 2009, merece destaque a premiao do veculo
experimentalSabi6Figura93produzidopelaequipecoordenadapeloprofessorJairo
JosDrummondCmaradaEscoladeDesigndaUniversidadedoEstadodeMinasGerais
UEMG.Naqueleano,oprojetoconquistouoprimeirolugarnacategoriadeDesignInovador,
noeventoShellEcoMarathonAmricas,realizadonaCalifrnia,EstadosUnidos.
O evento do tipo maratona acadmica reconhecido internacionalmente e rene
equipes competidoras de escolas e universidades de todo o mundo, com o objetivo de
apresentar solues para o desenvolvimento sustentvel da indstria automotiva. O
primeiroveculoexperimentaldesenvolvidopelaequipedoprofessor,paracompetiremtais
maratonas de economia energtica, foi produzido no ano de 1994 e, na ocasio de sua
primeira competio da Shell EcoMarathon realizada na Frana, recebeu o prmio de
Honra em Design. No ano 2000, no mesmo evento, o veculo Sabi 3 ganhou o Prmio
EspecialdeDesignatribudoaumaEquipeEstrangeira,tambmnaFrana.OveculoSabi
4 comps, em 2003, todo o material grfico de divulgao mundial da 19 Shell Eco
Marathonrealizadanaqueleano(BOTELHO;CMARA,2009,p.125).

Figura93ProjetoSabi6:VencedordoprimeirolugarnacategoriadeDesignInovador,noeventoShellEco
MarathonAmricas,em2009,eequipelideradapeloProf.JairoJosDrummondCmara(nafotosentadode
bonbranco).

Fonte:SitedaEscoladeDesignUEMG.Disponvelem:<http://www.ed.uemg.br/noticias/2009/05/sabia6e
premiadonashellecomarathon>.Acessoem:05/02/2013.

As premiaes obtidas pelo Sabi, ento inditas, reforaram o potencial das


universidades brasileiras em contribuir para o desenvolvimento de projetos em design

118

automotivo.Nopanoramanacionaldaindstria,oanode2009,segundodadosdaAnfavea
(2010,p.9),oBrasilregistrouumcrescimentode11,4%novolumedeautoveculosvendidos
no mercado interno em relao 2008. Entretanto, as exportaes de veculos, em 2009,
ficaram 35,5% abaixo do volume de 2008. O ano de 2010 foi marcado por grandes
investimentosrealizadospelasmatrizesdasmontadorasdeautomveisemsuassubsidirias
brasileiras.ForamlanadososmodelosnovoSpaceCross,FiatLineaeFiatNovoUnoFigura
94.
ONovoUnomarcouoslanamentosdoanoeveioaomercadocomamaisradical
mudana desde o lanamento do modelo Uno no Brasil na dcada de 1980. O modelo
lanado em 2010 foi resultante de um projeto completamente novo, o qual foi elaborado
pelosdesignersdafbricadaFiatemBetim(MG),emcolaboraocomoCentroEstiloda
matriz italiana, tendo sua plataforma refeita em 80%.A tendncia de design adotada pela
marcanorenegouaslinhasretilneasquemarcamomodelo,masadotouochamadoestilo
RoundSquare,oqualagregouinternaeexternamentelinhasdiferenciadasediretamente
inspiradas nas retas que compunham o modelo clssico, porm com os cantos
arredondados,asquaisderamaomodeloumaspectoirreverente.

Figura94NovoUno:VendidonoBrasildesde1984,onovoprojetolanadoem2010refletiumudanas
radicaisnaslinhasdomodelo

Fonte:QuatroRodas,2010(adaptado).
Disponvelem:<http://quatrorodas.abril.com.br/carros/lancamentos/novofiatuno556006.shtml#galeria>.
Acessoem:05/02/2013.

Alm das mudanas radicais de projeto, o Novo Uno trouxe como diferencial a
possibilidade de personalizao dos veculos a partir de kits compostos por adesivos
exclusivos,rodas,apliquesnopainelenosretrovisoresemcoresegrafismosdiversos,todos
montados em concessionrias de acordo com as preferncias do cliente, o qual poderia
escolherentrecatorzecoresdesenvolvidasparaomodelo.

119

A possibilidade de personalizao foi destacada pelo brasileiro Cledorvino Belini


ento presidente do Grupo Fiat para a Amrica Latina como uma grande inovao no
mercado, na ocasio da apresentao do veculo ao pblico e imprensa, projeto o qual
BeliniafirmouserumeventofundamentalnahistriadaFiatedaindstriaautomobilstica
mundial.Oempresriocompletou:

Porqueumprodutodemassanopodeserpersonalizado?Estaeoutrasperguntas
foramrespondidaspelomercado.DesdeolanamentodoPlioem1996,estaa
primeiravezqueaFiatbrasileiraparticipacomoprotagonistadodesenvolvimento
deumcarroquenasceinteiramenteaqui.(BELINIinDIRIOCOMRCIOINDSTRIA
&SERVIOS,2010).

Cabedestacar,contudo,queoprodutofoielaboradopelosdesignersbrasileirosem
colaboraocomoCentrodeEstilodamatrizitaliana.Omodelorapidamentetornouseum
sucesso e podese afirmar que seu lanamento no mercado brasileiro causou tanta
repercussoquantoolanamentodeseuantecessornadcadade1980,confirmandomais
umavezopotencialdosdesignerseequipesdedesenvolvimentobrasileirosnaconcepo,
produo e entrega deprodutos automotivos competentes. No Salo do Automvel 2010,
de edio nmero 26, as atraes foram o Mitsubishi ASX, o Peugeot 3008, Fiat Bravo,
CitronDS3,VolkswagenJettaeRenaultFluence(QUATRORODAS,2010).
No que tange s influncias externas aos projetos de design, no ano de 2010 foi
instauradooLatinNCAPLatinNewCarAssessmentProgrammeouProgramadeAvaliao
de Automveis Novos para a Amrica Latina. A verso latina do programa derivada dos
programasNorteAmericanoNCAPNewCarAssessmentProgramme,fundadoem1979e
Europeu,oEuroNCAPEuropeanNewCarAssessmentProgramme,fundadoem1997a
qualpassouaavaliartambmoscarrosproduzidosnoBrasil.
OLatinNCAP,emsuma,umdosprogramasdeseguranaautomotivaematuao
nomercado,oqualfoifundadopelaFederaoInternacionaldoAutomvelFIAcomo
objetivodeavaliarosnovosprojetosdeautomveiseseudesempenhoquantosdiversas
ameaas de segurana do veculo e seus ocupantes. Estas avaliaes visam balizar os
desenvolvimentos de design e engenharia, com a inteno de incentivar a criao de
projetos que resultem em produtos mais seguros e adequados aos usurios. Nestes
programas, o crash test teste de batida ou ensaio de choque a ferramenta principal

120

utilizada para avaliao do comportamento do produto em situaes limite, nas quais a


qualidadedomesmo,noquetangeseguranadosmotoristasepassageiros,avaliada.
Ostestesempreendidospelosprogramascitadosconsistemnapontuaoespecfica
paraosveculossubmetidosaimpactofrontal de64km/h contraumabarreiradeformvel
(LATINNCAP, 2013). Os resultados so publica e amplamente divulgados revelando as
marcaseosmodelosdeveculostestados.
A instaurao dos NCAPs condicionou as montadoras ao exerccio de projetar de
forma que atendam de maneira adequada e contnua os requisitos de segurana exigidos
pelostestes,osquaissoelaboradosdeacordocomalegislao.Obviamentetaisrequisitos
impactaramdemaneiraimportantenodesigndoprodutocarro,paraoqualforambuscadas
soluesqueminimizemosriscosaosusuriososshapedesignsdaslatariasemformato
arredondadossemcantosdengulosagudoseaopoporparachoquesfeitosbasede
polmeros,aoinvsdasantigasbarrasdeferro,foramalgumasdestassolues.Percebese,
portanto,queosdesignersficaramtambmcondicionadosamaisestavarivelnacriaode
novosprojetos.
Em2011,foramlanadosnoBrasilosmodelosFiatFreemont,NovoPalio,Chevrolet
Cruze, os modelos da Nissan March e Versa, o novo Volkswagen Space Cross, Ford New
Fiesta,RenaultDuster.Jem2012,nomsdeMaio,ogovernofederalreduziuoIPIparaos
carrosat31deAgostode2012,afimdeestimularoconsumoeocrescimentodaeconomia
do pas.Tal medida impulsionou as vendas no setor. No mesmo ano, muitos foram os
modeloslanados,entreelesoprimeirocompactopopulardaHyundai,oHB20Figura95.

Figura95HyundaiHB20:OcompactofoioprimeiromodelototalmentefabricadonoBrasilpela
montadorasulcoreana

Fonte:QuatroRodas,2012(adaptado).
Disponvelem:<http://quatrorodas.abril.com.br/noticias/mercado/hyundairevelaprecohb20
701466.shtml>.Acessoem:05/02/2013.

121

TambmforamlanadosonovoFordEcosportFigura96ChevroletOnixeToyota
Etios. O projeto do modelo Ecosport foi o primeiro desenvolvimento global liderado pela
equipe de designers da Ford do Brasil. Assim como na Volkswagen, a importncia que os
mercados brasileiro e latino adquiriram no cenrio mundial ao longo dos anos e a
capacidadedemonstradapelasequipesbrasileirasdedesignemadaptarmodelosepropor
novas solues de design, permitiram que os estdios das plantas subsidirias tivessem
maiorpoderdenegociaojuntosmatrizes.
NocasodaFord,oaumentoconfianaporpartedamatrizamericanasecristalizou
noprojetodoEcosport,comodestacadoporFeltrin:

Outra gigante americana que conseguiu convencer a matriz de que valia a pena
investiremprojetosglobaisdeveculosapartirdoBrasilfoiaFord.Omarcodesse
ritual de passagem foi o desenvolvimento do EcoSport, utilitrio esportivo
concebidonoinciodadcadapassadanoBrasiledepoislevadocomsucessopara
aArgentinaeoMxicoe,apartirdesteano,tambmaomercadoeuropeu[...]
TotalmentedesenvolvidonaunidadedaForddeCamaari,naregiometropolitana
deSalvador(BA),omodelojfabricadoemoutrostrspasesChina,ndiae
Tailndia e ser comercializado em 100 mercados onde a montadora atua.
(FELTRIN,2013).

AindadeacordocomRogelioGolfarbvicepresidentedeassuntoscorporativosparaa
FordAmricadoSul,oBrasiltornouseozeladordoprojetoEcosport,ecompleta:Sabemos
quearesponsabilidadeporeventuaisajustesemelhoriascabeengenhariabrasileiraa
contrapartida da confiana depositada pela empresa na operao local (GOLFARB in
FELTRIN,2013).
Apsolanamento.omodeloobteveamplaaceitaonomercado,tornandoseum
sucesso. e, no dia 27 de Novembro de 2013, obteve uma conquista indita ao se tornar o
primeiro modelo completamente projetado e comercializado no Brasil a conquistar cinco
estrelas nos testes realizados pela LatinNCAP para passageiros adultos. As cinco estrelas
correspondemaonvelmximodeseguranaoferecidoemumveculo.Tambmobtiveram
cinco estrelas os importados Volkswagen Jetta e a terceira gerao do Ford Focus, ambos
comercializadosnoBrasil(WITGEN,2013).

122

Figura96NovoEcosport2013:Projetogloballideradopeloestdiode
designdamarcanoBrasil

Fonte:NetCarShow,2013(adaptado).
Disponvelem:<http://www.netcarshow.com/ford/2013ecosport/03.htm>.Acessoem:05/02/2013.

O sucesso do modelo e o reconhecimento do avano em questes relativas


seguranadosprojetosproduzidosnoBrasilreforamopotencialdosdesignersbrasileiros
ementregarprojetoscompetentesebemexecutados.
Nomesmoanode2012,o27SalodoAutomvelapresentou,almdosMitsubishi
Lancer e os modelos Trailblazer e Tracker da GM, tambm o novo compacto da marca
Volkswagen denominado up!, alm do Novo Fusca. Embora montado no Mxico, o
substitutodoNewBeetlerecebeuautorizaodamatrizalempara,noBrasil,denominarse
Fusca,revivendoumdosnomesmaissimblicosdahistriaautomotivanacionalFigura97
(QUATRORODAS,2012).

Figura97NovoFusca:Lanadoem2012,recebeuonomedoprimeiromodelodesucessodamarca
VolkswagenfabricadonoBrasil

Fonte:QuatroRodas,2012(adaptado).
Disponvelem:<http://quatrorodas.abril.com.br/noticias/fabricantes/vwexibenovofuscasaopaulo
703122.shtml>.Acessoem:05/02/2013.

Naocasiodosalo,foramtambmdivulgadasaimplantaonoBrasildasfbricas
da BMW primeira fbrica da marca alem no Brasil, a ser construda em Araquari (SC)
(MORAES, 2012) e da chinesa Chery em Jacare (SP), a qual tem previso de incio das
operaesemdezembrode2013econclusototaldasobrasat2014(MATSUBARA,2012).
Aimplantaodenovasplantasfabrisevidenciaaatraoqueomercadobrasileiroexerce

123

smarcasprodutorasdosetor,bemcomoopotencialdopasemrecepcionareincentivara
estruturaoeodesenvolvimentodenovasindstriasautomotivas.
O ano de 2014 comeou com um grande lanamento por parte da Volkswagen do
BrasilnomsdeFevereiro:omodeloVolkswagenup!grafadocomopontodeexclamao
pela prpria fabricante. O veculo subcompacto Figura 98 de pequenas propores
3,60metrosdecomprimentofoiapresentadoeaclamadopelaimprensacomofuscado
sculo XXI. Segundo Thomas Schmmall (in VENTURA, 2014) presidente da subsidiria
brasileira: " um dos mais importantes lanamentos da Volkswagen no Brasil nos ltimos
tempos, um carro que chega com o melhor que ns temos em tecnologia para a
segurana". De fato o veculo alcanou cinco estrelas nos testes aplicados pelo LatinNCAP
tanto para segurana de adultos quanto de crianas e nota A em todas as avaliaes de
consumodecombustveldentrodoConceptprogramadeetiquetagemveiculardoInmetro
feitosessesqueoposicionamcomoocarromaisseguroedemaioreficinciaenergtica
rodandonopasatomomento.

Figura98Volkswagenup!:Lanadoem2014obtevemritosqueoposicionamcomooveculomaisseguroe
econmiconoBrasil

Fonte:QuatroRodas,2014(adaptado).
Disponvelem:<http://quatrorodas.abril.com.br/carros/lancamentos/volkswagenup772368.shtml>.Acesso
em:14/05/2014.

Agrandemudanaverificadanosprocessosdedesignduranteadcadade2000foia
incorporaodasferramentasdigitaisnaproduodocarro,aqualteveincionadcadade
1990. cada vez mais amplo o uso de softwares em vrias fases do projeto, desde o
mapeamento 3D do modelo final em escala, a fim de se obter a matemtica do carro,
passandopelassimulaesdefuncionamento,prospecesdovisualfinaldoveculopronto,
at a edio das imagens finais para apresentaes internas da empresa e produo do
material de divulgao externa. Tais tecnologias, contudo, no substituiro to cedo as

124

simulaesfsicasdoobjetoparaestudosmaisaprofundados,comoafirmadopelodesigner
Fernando Morita em entrevista concedida pesquisadora Apndice H durante a
elaboraodopresentelevantamentohistrico:Emtermostecnolgicos,semdvidao3D
irrevolucionaroprocessodedesenvolvimento,eacelerlo.Porm,sempreexistirespao
para o clay, uma vez que carro sempre ser fsico. Design s muda quando a tecnologia
muda(MORITA,2013b).
Com vistas a complementar o conhecimento sobre como se desenvolveu o
automveleoseudesignnoBrasilaolongodosanos,oApndiceAapresentaumalinhado
tempo com os principais veculos criados, desenvolvidos e comercializados no Brasil entre
1950 e 2013. A seleo dos modelos que compem tal linha foi realizada com base na
reviso do acervo digital completo da revista Quatro Rodas disponvel em seu site na
internet. Foram compilados os modelos os quais receberam destaque por parte da
publicao, seja no formato de reportagem de capa ou de reportagem interna. Tal
parmetro foi adotado, a fim de levantar os principais modelos de automveis
representativosdodesigndecadadcada.
Seguiuse a ordenao cronolgica dos modelos, a captao e edio de fotos e a
posterior composio da linha do tempo nos moldes em que apresentada ao final desta
dissertao. Sua inteno registrar visualmente as mudanas e evolues no design dos
veculoscomercializadosnoBrasil,bemcomorefletir,apartirdasimagens,asprefernciase
o comportamento do mercado brasileiro ao longo do tempo, quanto s produes
brasileiras e multinacionais. Na atualidade, de modo geral, a cadeia produtiva automotiva
brasileiraintegradanosnveisdeproduo,segueahierarquiaapresentadapeloDiagrama
1:

125

Diagrama1CadeiaProdutivadaindstriaautomotiva

Fonte:Frainer,2010,p.66(adaptado).

Os designers que buscam atuar na rea automotiva so geralmente empregados


pelos estdios de design instalados no pas, prestando servios para as montadoras.
Entretanto, so tambm muitos os designers que trabalham nos diversos fornecedores de
tecidos, linhas, tintas, couros e plsticos niveis 2 e 3 do diagrama , bem como nas
empresasdenominadassistemistasnivel1dodiagramaasquaisfornecemcomponentes
principaisousubconjuntosdeautopeasjmontadossindustriasdeautomveis.NoBrasil,
tambm muitos designers optam por seguir a rea de maneira autnoma, constituindo
empresasprpriasvoltadasconsultoriaeaodesenvolvimentodeprojetosexclusivos,tais
comoasjcitadasconDesigneAmoritzGT.
Especificamente nas indstrias automotivas, o papel do designer compreende o
desenvolvimento de produtos que incrementem o portfolio das mesmas e ampliem sua
atuaonomercado.Versandosobreopapeldodesignercomoempregadonestesistema
quevisaaosucessocomercialespecialmentecompetitivo,comoocasodoprodutocarro
Heskett(2008)destaca:

126

[...] a maioria dos designers quase no trabalha por conta prpria: eles prestam
servios para clientes ou empregadores, e o lado comercial deve, portanto, ser
vistocomoaprincipalesferadessaatividade[...]Polticaseprticascomerciaisso,
portanto, fundamentais para entender como o design funciona no aspecto
operacionaleconhecerospapisefunesqueelecapazdedesempenhar.No
entanto,ficadifcilanalisarasabordagenscomerciaisdodesign,umavezqueso
relativamenterarasinformaesespecficassobreseupapelnaestratgiageraldas
empresas. O posicionamento do design na hierarquia das empresas tampouco
servedeorientao,jquehimensasvariaesodesignpodeporexemplo,ser
uma ocupao autnoma, estar subordinado engenharia ou ao marketing ou,
ainda, fazer parte de um departamento de pesquisas e desenvolvimento.
(HESKETT,2008,p.120).

Os estdios de design de automveis presentes no Brasil esto instalados junto s


plantas fabris das montadoras, compondo a rea de desenvolvimento de produtos. So
departamentos constitudos de estrutura prpria, os quais realizam desenvolvimentos sob
sigilo. Nestes departamentos, seus profissionais geralmente executam prticas
interdisciplinares,asquaisenvolvemcontatosconstantesediretoscomoutrasreascomo
marketing, engenharia, custos, entre outras, respondendo diretamente diretoria e/ou
presidnciadaempresa.
Salvo as diferenas de denominao e organizao, a estrutura destes tambm
denominados centros de estilo composta pela figura do diretor de Design ou Chief
Designeroqualcoordenaegerenciaofuncionamentododepartamento.sobsuatutela
que respondem os setores de Shape Design responsvel pelas formas dos carros ,
Color&Trim Design responsvel pelos acabamentos internos e externos dos veculos ,
Package responsvel pelo desenvolvimento de medidas e aspectos ergonmicos do
projeto,ModelagemVirtualoqualrespondepelodesenvolvimentodemodelosvirtuaise
mapeamento 3D do veculo, dando suporte ao Package no aprimoramento de medidas e
composio da matemtica final do veculo e a Modelao rea a qual desenvolve
modeloseprottiposemclayemvariadasescalasnodecorrerdoprocessodedesign,para
escaneamento3DeproduodematemticapeloPackage,almdeavaliaoevalidao
junto presidncia. Em alguns estdios o departamento de design conta com tapearia
prpria e cabine de pintura, visando produo de peas prottipo para avaliaes
preliminares internas, tornando o departamento independente do estoque da linha de
montagemoudepeasprottipodisponibilizadaspelosfornecedores.

127

So os estdios estabelecidos nas dependncias das filiais brasileiras de grandes


indstrias multinacionais do setor os principais empregadores dos designers automotivos
brasileiros.Emboramuitostrabalhemtambmcommodelagemvirtualouatmesmocoma
modelao de prottipos em clay, as principais reas de atuao dos designers de
automveis nos estdios das montadoras so a rea de Shape Design e a de Color&Trim
Design.
PorShapedesignersrespondemosprofissionaisresponsveispelacriaodasformas
internaseexternasdosveculos.EmumprojetodeShapedesignsodesenvolvidosnovos
conceitos estticos do produto aliados funcionalidade, visando atender aos anseios dos
usurios.Cabeaessesprofissionaisdesenvolverosdesenhosdaslinhasdoobjetocarropor
meio de sketches mo livre e ilustraes digitais. Embora nesta fase de produo do
veculo os designers tenham liberdade para explorar novos conceitos, tais criaes devem
seguirdiretrizesprdefinidaspelosetordePackage,oqualguiaoprojeto,definindosuas
propores, posicionamento de motor, nmero de passageiros, ergonomia, entre outros
aspectos.tambmincumbnciadestesprofissionaisprojetarnoapenasaspeasinternas
do habitculo, como tambm todos os componentes da parte externa, incluindo grupos
ticos,rodas,calotas,frisos,emblemasmetlicos,capasdeespelhoretrovisor,aerofliose
peasacessrias.Todoesteconjuntomaterializaaformadoveculoecarregaaidentidade
damarca.ParaLarica(2003):

Ametadodesignerdeautomveistransformaroseuprojetonumaesculturaem
movimento, mas no deve deixar de considerar os critrios de ergonomia e
segurana, de produtividade e reciclabilidade, de conforto e individualidade. O
objetivodeveserdesenvolverumalinguagemesttica,umestiloprprioquefaa
com que a expresso da potncia, a impresso de segurana e a sensao de
agilidade aflorem do desenho e sejam uma experincia tangvel tanto para o
usuriocomoparaoobservadordoproduto.(LARICA,2003,p.97).

Aliado ao trabalho dos Shape designers, os Color&Trim designers trabalham na


criao e desenvolvimento de acabamentos internos e externos, aplicados a cada um dos
componentes aos quais os consumidores tero acesso direto no veculo, otimizando desta
maneira a interface entre o usurio e o automvel. Assim, criam e desenvolvem cores e
acabamentos,figurinosparaosbancosdosveculos,almdetecidosenotecidosmanta
flexvel e porosa composta por fibras ou filamentos, os quais podem ser orientados

128

direcionalmente ou ao acaso, formando aglomeradas sendo fixadas por processos


mecnicos,trmicosouqumicos,aocontrriodosprocessostxteiscomunsdetecelagem
pararevestimentos,logotipiasespeciaiseapliquesgrficosbietridimensionaisparauso
interior e exterior , texturas para diferentes superfcies, e mais atualmente projetos de
acessrios de uso pessoal produtos que compem linhas de grife com foco no estilo de
vidadousurioeparaosveculos.ParaLarica:

O design de interiores de veculos deve levar em conta: espao, forma, peso e


materiaisadequados.Oserhumanosempredecoraascoisasquemaisgostaoud
importncia.Adecoraofundamentalporque,almdeseguranaeconforto,o
viajante espera ter prazer em olhar e fazer parte de um ambiente que o agrada.
(LARICA,2003,p.22).

Dentro das competncias dos Color&Trim designers, os itens so trabalhados de


maneirasensitiva,considerandoalmdocontatottil,fatoresrelacionadosviso,olfato,e
afetividade dos usurios. Para tanto, so tambm levados em considerao os aspectos
psicolgicos,sociolgicoseculturaisdopblico,visandoaoconforto,seguranaeaobem
estar. No sentido de captar as necessidades e desejos do pblico, imperativo para tais
profissionais acompanhar o desenvolvimento da sociedade, detectar e conhecer as
mudanas de comportamento, bem como desenvolver uma pesquisa minuciosa de
tendnciaseestilosdevida.
Tanto para o Shape designer quanto para o Color&Trim designer, de vital
importncia considerar em cada passo do desenvolvimento do projeto a adequao
proposta apresentada no briefing, bem como a criatividade das formas e das solues
adotadas, alm de buscar a viabilidade construtiva do modelo escolhido, priorizando a
preservaodaidentidadedamarca.
EmexperinciaadquiridacomoColor&TrimDesignernasempresasCAIOInduscare
Volkswagen do Brasil, a autora da presente pesquisa vivenciou as diferentes prticas
desenvolvidasaolongodosprocessosqueoriginamcomoprodutofinalumveculoacabado.
A experincia vivenciada na Volkswagen do Brasil deuse em um estgio de doze
meses no ano de 2010, realizado na fbrica de So Bernardo do Campo SP, no
Departamento de Design e Package, na rea de Color&Trim Design, como premiao do
concursouniversitrioTalentoVolkswagenDesignedio2009,doqualapesquisadorafoi
vencedoradacategoriaColor&Trimdesign.Duranteoestgio,almdasrotinasdoestdio,

129

foram trabalhados o processo de criao e desenvolvimento de novos acessrios de


personalizaoexecutadosparaosveculosdamarcaVolkswageneseususurios.
Neste perodo, foi possvel verificar como se d a dinmica de atuao nos
departamentos de design, as quais envolvem muito alm da concepo projetual em
prancheta. A figura dos designers recebe constante suporte por parte de muitos outros
profissionais modeladores 3D, modeladores em clay, tapeceiros, pintores e
administradores. Desta maneira, o departamento de design e os designers no apenas
respondem pela criao e desenvolvimento de novos desenhos externos e internos dos
veculos,comotambmviabilizamdiversosoutrosaspectosintegrantesdoprojetocomo
peasdeacabamento,rodas,calotas,adesivos,entreoutrospormeiodereuniesjuntoa
fornecedoresedemaisreasdaempresataiscomoossetoresdeComunicao,Compras,
Marketing, Vendas, Psvendas, entre outras. Alm destas atribuies cabe tambm aos
designers pensar novas possibilidades, em termos de desenvolvimentos de materiais e
componentes quando o custo assim permite gerenciando tambm em sua rotina,
problemas surgidos no mbito do desenvolvimento do produto e montagem em linha de
produo. Tratase de uma rotina interdisciplinar e de ritmo acelerado, a qual por vezes
prejudicada pelo curto espao de tempo entre os vrios desenvolvimentos e novos
lanamentos.
Especificamente no setor automotivo, o Design atualmente o elemento
diferenciador entre os produtos das diversas empresas, alm de um fator decisivo no
momento da compra, em um campo no qual as diferentes marcas absorvem quase que
instantaneamenteasnovastecnologiasdemaneiraequiparada.Comojdito,produzirum
novo design ou um mesmo empreender um redesign de produto constitui uma atividade
interdisciplinar,envolvendodiversasreasnoprocesso.
Tambm Landim (2012, p.25) destaca que, na produo industrial atual, a relao
entreconcepo,planejamentoefabricaofragmentadaecomplicadaporumasriede
atividades especializadas e interligadas, envolvendo diferentes atores. Assim, [...] os
produtosdodesignqueresultamdesseprocessomultifacetadonosofrutodedesigners
individuais,masdeequipesdeindivduos,cadaumcomsuasideiaseatitudessobrecomoas
coisas devem ser feitas. Em umacadeia de produo complexa na qualesto aplicados
diretamenteinvestimentosdaordemdemilhescomoadoautomveltaisrelaesso
ainda mais estreitas, e os pontos definidos ou trabalhados por cada uma destas trazem

130

consequnciasdiretasparaoprojetocomoumtodoaprimorandoooudispersandosuas
potencialidadese,nolimite,paraaprticaprofissionaldosdesigners.
O processo de design de um automvel geralmente tem incio nas pesquisas de
produtoeanlisedetendnciasestticasedeestilodevidaporpartedosdesignesede
mercado por parte dos profissionais de marketing. A fase de conceituao na qual so
trabalhadasasprimeirasideiaspautadapelaliberdadedecriaoporpartedosdesigners,
aqualdeve,contudo,prevernostraosdoveculointerioreseexterioresoatendimento
scaractersticasasquaisdefinemaidentidadedamarcadoprodutojuntoaopblico.
Para tal, as indstrias de automveis adotam linguagens de design especficas, as
quais condizem com a identidade buscada ou j consolidada pela marca. Essas aes
visammanterosprojetosdeseusprodutosunificadosdopontodevistadoconceitovisual
pretendido, o qual embora possa ser trabalhado de maneira varivel dependendo do
modelo e do mercado para qual o mesmo destinado deve ser facilmente identificvel
pelos usurios, favorecendo o reconhecimento do produto como pertencente ao portfolio
daquelamontadora,aomesmotempoemqueodiferenciadaconcorrncia,fixandoamarca
nesseprocesso.
Emboratodasasempresasmantenhamumalinguagemdedesignprpria,amaioria
divulgaamesmanaformadosatributosvisuaisdoveculoquandodoseulanamentoenas
campanhaspublicitrias,porexemplo,ressaltandoasimplicidade,ominimalismodeformas,
comonocasodaVolkswagen,oudandodestaqueparaasformasdinmicas,apraticidadee
asofisticao,comonocasodaGM.Algumas,contudo,nomeiamsualinguagemdedesign
parafacilitaraapreensopelopblicoeaumentaraidentificaocomamarca,como o
casodaamericanaFordedasulcoreanaHyundai.
A primeira trabalha a partir da linguagem Ford Kinetic Design. Criada em 2004 por
MartinSmithdiretorexecutivodedesigndaFordEuropaanovalinguagemcaracterizou
amaisradicalmudananodesigndosprodutosFordemsuahistriarecenteedefinidapor
seucriadorcomoalinguagemdaformacomunicadaatravsdegrandessuperfciescom
linhasmarcadas,dinmicas.QuandoseobservaoKineticDesign,podesevisualizaraenergia
emmovimento"(SMITHinFORD,2013).
Entre os modelos comercializados no Brasil, o Ford Fiesta, lanado em 2008 na
EuropalanadonoBrasilcomalgumasalteraesem2011ecomfaceliftem2013foium
dos primeiros a incorporar a linguagem Kinetic Design, apresentada inicialmente pelo

131

conceito Verve no qual o Fiesta foi baseado apresentado em 2007 no Salo do


AutomveldeFrankfurt,ambospresentesnaFigura99:

Figura99KineticDesign:oconceitodeenergiaemmovimentoaplicadoaoprottipoVerve(emmagenta)e
posteriormenteexecutadonoFordFiesta(emverde).

Fonte:Ford,2013(adaptado).
Disponvelem:<http://www.ford.pt/VeiculosPassageiros/KineticDesign>.Acessoem:10/05/2013.

AsulcoreanaHyundainomeoualinguagemdedesignaplicadaaseusprodutoscomo
FluidicSculpture,umconceitoquenorteiaosdesenvolvimentos.Deacordocomamarca:

Fluidic Sculpture a nova filosofia de design da Hyundai, a qual incorpora no


projetoaexecuodeformasfluidasedinmicas.AHyundaiadotadanaturezae
sua interminvel evoluo, a harmonia da coexistncia humana e a sabedoria de
umcrescimentosustentvel,paracriarumavisodesignprogressivoeapaixonado
paraofuturo.(HYUNDAI,2013,traduonossa).

Em catlogo de divulgao do modelo Hyundai iX35, distribudo no ano de 2010, a


definio do Fluidic Sculpture apresentada anteriormente divulgada, alm de ser
destacado entre os atributos do veculo, o design que flui, como caractersticamarcante
noprojeto,comorevelaaFigura100:

132

Figura100FluidicSculpture:linhasfluidascompemodesigndosveculosdamarca

Fonte:Hyundai,2010(adaptado).
Disponvelem:
<http://www.hyundai.com/ba/en/wcm/groups/public/@ba/documents/unclassifiedcontent/ix35katalog.pdf>.
Acessoem:10/05/2013.

Aimagemdoveculo,retratadaemdetalhesampliados,reforaospontosdoveculo
nos quais as linhas fluidas ficam em evidncia, reforando para o pblico o diferencial da
linguagemdaHyundai.
Independente da linguagem de design ser trabalhada e divulgada como uma
filosofia com nome prprio ou por meio de vrios conceitos trabalhados no projeto, a
mesma se torna a diretriz do processo criativo dos designers em todos os estgios do
desenvolvimento.Assim,umavezproduzidososprimeirossketchesinterioreseexteriores
elaboradospelosShapedesigners,deacordocomalinguagemdedesigndaempresa,tm
inicio as etapas nas quais so realizados os primeiros estudos tcnicos e dimensionais do
projeto. Tais estudos refinam as ideias, produzem as primeiras medidas e do incio aos
estudos de viabilizao de peas e componentes relativos estrutura formal interna e
externadoveculoPackage,layouteConfiguraodointeriorsoossetoresresponsveis
poressasfases.
Seguem ento as vrias etapas de modelao e escaneamento 3D de superfcie
visandoacorreodeimperfeieseaconcretizaodaformaemadequaoaosmateriais
empregadoseaoShapedesignpretendidoparaomodelo.Paralelamentesodesenvolvidos
os desenhos tcnicos mais detalhados os quais ajustam as medidas e consideram a
ergonomiadoscomponentes,sendocorrigidosacadaumadasvriasavaliaessquaisos
modelossosubmetidos.Apartirdomodeloemescalareduzida1:4tmincioosprimeiros
escaneamentos3D,osquaisvisamidentificarfalhasepossveisaprimoramentosnodesign.

133

Em seguida, produzido o modelo em clay j na escala real 1:1, o qual novamente


escaneado em trs dimenses e no qual trabalhado o alisamento de superfcies. Neste
pontodoprojeto,oveculojpassaporavaliaespreliminaresconstanteseescaneado
emtrsdimensesnovamenteparaconfernciaeajustesfinais.
Por fim, so produzidos os modelos e prottipos de avaliao, os quais depois de
validados por parte da presidncia da empresa, seguem para a realizao dos desenhos
finais de engenharia, produo de ferramental, peas e componentes junto aos
fornecedores e, enfim, so destinados linha de montagem. Durante todo o processo, os
designersacompanhamaevoluodoprojetodoveculo,osajustesemodificaessquais
omesmosubmetidoesoresponsveisporalinharcadafasedeacordocomocalendrio
daempresaeocronogramadelanamento,produzindoinclusiveosrevestimentosinternos,
peas de acabamento, cores e texturas aplicados ao interior e exterior do veculo. O
processodedesigndocarroduraemmdiaquatroanos,desdeaconcepodasprimeiras
ideiasatolanamentodomodeloeapresentaoimprensaeaopblico.
As etapas e a ordem com que as mesmas ocorrem podem variar de acordo com o
processo produtivo de cada empresa, mas, em linhas gerais, o processo de design de um
automvelpodesercompreendidocomodispostonoDiagrama2.

134

Diagrama2ProcessodeDesign

Fonte:AdaptadodeLarica,2006,p.106.

135

OprincipaldesafioparaosdepartamentosdeDesign,segundoLarica(2008,p.83),
configurarumprodutocomplexo,oqualsubmetidoscondicionantesdeprojetovariadas,
taiscomoonivelamentotecnolgicoapresentadoentreasgrandesmarcasconcorrentes;a
necessidadedediferenciaoestticaparaestabeleceraidentidadedamarca;respeitopela
histriaeculturadecadamarca;acomplexidadeestruturaldevidosnormasdesegurana;
balanceamentodoscustosdedesenvolvimentotcnicoedeproduo,emrelaofaixade
preo de venda sugerida para o modelo; atendimento ao gosto e ao emocional do cliente
potencial; enfrentamento do risco de projetar um produto complexo com altos custos de
desenvolvimento e com escala de produo elevada, em um mercado pautado pela forte
concorrnciaesubmetidosvariaesdogostovigente.Oautoraindacomplementaque,
almdestespontos,osdesignersaindadevematendernaconcepodoprojetoa:

[...] fatores limitadores de custos, resultados de pesquisas com usurios,


possibilidadedeproduonaslinhasdemontagemexistentes,regulamentaesde
trnsitoeambiental,imposiesdeaerodinmicaedeeconomia,possibilidadede
incorporao de acessrios e opcionais, aproveitamento de componentes de
modelos anteriores ou compartilhados, normas de segurana etc. (LARICA, 2003,
p.83).

Os fatores limitadores so ainda mais perceptveis nos desenvolvimentos


empreendidosnospasesemdesenvolvimento,comoocasodoBrasil.Nestesmercados,
asdificuldadesencontradaspelosdesigners,principalmentedeordemfinanceiradurantea
execuodoprojeto,fazemcomqueosprofissionaisbrasileirosprecisemdesenvolvermeios
prpriosparachegaraoresultadoesperado.
Na condio de necessitar improvisar solues com frequncia ou encontrar novos
meiosparaoatendimentoaumanecessidadeespecficadoprojeto,tornousecaracterstica
dos profissionais aqui formados a flexibilidade para lidar com fatores inesperados e
gerenciamento de conflitos. Tais atributos favoreceram o movimento cada vez mais
frequentedeexportaodosdesignersbrasileirosparaatuaonoexterior,comoocaso
dosdesignersRaulPiresedosirmosJooCarloseMarcoAntnioPavone.
O primeiro foi, no perodo de 1999 a 2011, Chefe de Design Exterior da Bentley
marcainglesadeautomveispertencenteaogrupoVolkswagentendoemseuportfolioo
modeloBentleyContinentalGTFigura101oqualfoipremiadonoSalodeParisde2002

136

e no Salo Detroit de 2003, contribuindo de maneira importante para a recuperao do


prestgiodaBentleynosegmentodeautomveisdeluxo.

Figura101BentleyContinentalGT:projetodobrasileiroRaulPiresoqualsetornouummarconodesignda
Bentley

Fonte:BentleyMotors,2013.
Disponvelem:<http://www.bentleymotors.com/models/continental_gt/>.Acessoem:10/05/2013.

Entre os anos de 2011 e 2013, Raul foi Chefe de Design Automotivo da Italdesign
GiugiaroeatualmenteoChefedeDesignAvanadodaAudiAGambaspertencentesao
grupoVolkswagen.OsirmosMarcoAntnioeJosCarlosPavoneiniciaramsuascarreiras
naVolkswagendoBrasilerapidamentealcanarampostosimportantesnoestdiodamatriz
alem. Atualmente Marco Antnio gerente de Design da Volkswagen da Alemanha e de
seuportfolioconstamosmodelosSpaceFoxeVolkswagenup!Figura102.

Figura102SketchdomodeloVolkswagenup!deautoriadeMarcoAntnioPavone:previsodelanamento
noBrasilem2014

Fonte:CarandDriver,2012.Disponvelem:<http://caranddriverbrasil.uol.com.br/carros/especial/conhecaos
irmaospavonedesignersdovwupejetta/2595>.Acessoem:10/05/2013.

137

SeuirmogmeoJosCarlosatualmenteGerentedeDesigndeExteriornoestdio
da Volkswagen dos Estados Unidos e de seu portfolio constam o design dos novos
VolkswagenPassateJettaFigura103.

Figura103SketchdosedVolkswagenJettadeautoriadeJosCarlosPavone:omodeloimportadopelo
Brasil

Fonte:CarandDriver,2012.
Disponvelem:<http://caranddriverbrasil.uol.com.br/carros/especial/conhecaosirmaospavonedesigners
dovwupejetta/2595>.

Cabeconsiderarqueasdificuldadesenfrentadasnodiaadiadaprofisso,derivadas
decondiesespecficasdoBrasilcomoprojetarcomomenorcustopossvel,porexemplo
constituem verdadeiros desafios aos designers brasileiros, os quais se tornam mais
flexveis perante os obstculos que possam surgir na rotina de projeto, caracterizando,
portanto, um aspecto positivo. essa flexibilidade uma das caractersticas que fazem com
que os profissionais brasileiros sejam cada vez mais requisitados para atuar no exterior.
Todavia,essepotencialporvezesnosuficienteparatransporcertosobstculosinerentes
prticacomoascrisesadvindasdasrelaesinterdisciplinaresnecessriasaoprocesso
dedesigneogerenciamentodocurtoespaodetempoentreosvriosdesenvolvimentos.
Embora o design seja por vezes decisivo para o sucesso de uma empresa na
atualidade, sendo tambm um fator essencial de estratgia de planejamento, produo e
marketing, os designers ainda sofrem certo grau de resistncia aceitao de uma
autonomia maior de sua profisso por parte de outros setores dentro das empresas,
principalmentequandocomparadosareasmaistradicionaisengenhariaemarketing,por
exemploasquais,conformeapolticadaempresa,noapenasparticipamdoprocessode
design, mas definem diretrizes de projeto. Tal resistncia destacada por Phillips (2008,

138

p.153)comoumdosobstculosenfrentadospelodesignersnodiaadiadaprofisso,sendo
umfatordeimpactonegativojuntosaspiraesdecarreiradestesprofissionais.
No outro extremo, o autor destaca a defasagem dos profissionais de design em
aprimorar suas habilidades referentes aos campos correlatos ao projeto falhas que
tambmcontribuemparaonoreconhecimentodareaoudoprofissionalsendourgente
oaprimoramentodacomunicaodosdesignersjuntosdemaisreas.Eletambmsinaliza
a necessidade de os designers aprenderem a interpretar fatores econmicos da empresa
com os quais o design pode colaborar, alm da realizao de pesquisas constantes que
corroborem a importncia do papel do design para aquele segmento, afirmando a
importncia da rea como parte de um plano de gesto. A comunicao dos designers
tambmumpontocrticolevantadoporMozotaetal(2011,p.66)aoafirmarque[...]a
maioriadosdesignersnoestpreparadaparatrabalharcomgesto.Osindivduoscriativos
costumam cultivar um ego, mas paradoxalmente, carecem de confiana e se comunicam
mal.
Considerando tais fatores como influentes no cenrio profissional do designer, no
qualtambmaempresaempregadoradesempenhaimportantepapel,Escorel(2000,p.40)
versasobreocampodeatuaodosdesignersnoBrasileidentificacomosendocomumo
enfraquecimento do design frente s demais reas tradicionais dentro das empresas, por
conta desta ser uma rea a qual ainda no conseguiu definir seu campo de atuao com
nitidez:

Noscasosemqueestoemjogointeressesfinanceirosimportanteseumpblico
muito extenso, por exemplo, o desejo do cliente e das instncias que costumam
falarporele,comoasagnciasdepublicidadeeespecialistasemmarketing,podem
interferirdeformadecisivanoprocesso,nemsempredirecionandoasoluopara
suamelhoralternativanoplanodoprojeto[...]Sendoassim,acabamporditaras
normaseatividadesmaissolidamenteplantadasnomercado,tambmligadasao
universodacomunicaoentreasempresas,seusprodutoseospblicosaquese
dirigem.Ora,considerandoqueodesigntemcomofuno,basicamente,oprojeto
deprodutosenquantoomarketingeapublicidadeestocomprometidoscomsua
venda, evidente que a confuso entre as trs reas implica desorganizao do
campomaisfraco.(ESCOREL,2000,p.40).

Caberefletir,todavia,queafunododesignvaimuitoalmdoprojeto,elaperpassa
todo o caminho do desenvolvimento do produto em suas diversas fases, de maneira

139

interdisciplinar. Sendo assim, as problemticas decorrentes da prtica conjunta como a


confuso ou desorganizao das reas citadas pela autora devese mais pela falha de
comunicao adequada entre as mesmas e pelos conflitos advindos das relaes
interpessoaisdosprofissionaisdoquepelafraquezadocampododesignemsi.
Atualmente,osprodutosquesedestacamemummercadodemuitasofertascomo
o caso da indstria automotiva so aqueles que, alm de suas qualidades intrnsecas,
possuemumaimagemforte,desenvolvidaapartirdodesejoedasexpectativasdopblico
para o qual foram concebidos. Nesta rea altamente competitiva, na qual o produto final
maisdoqueumobjetodeusoquedeveserfuncional,umobjetodedesejocomgrande
impactoemocional,osdesignersdesempenhamumpapelchavenaproduodainovaoe,
portanto,dadiferenciaonomercado,influenciandodiretamenteasexpectativasehbitos
decompradosusurios.
As montadoras de automveis, embora estruturem departamentos de design, nem
sempre se utilizam das potencialidades que a rea pode oferecer. Segundo Lbach (2001,
p.107122),odesignconfiguraumareasubordinadadiretoriaeconsideradaapenasuma
partedoextensoprogramadeumaempresa,aqualtmnolucroeemseudesenvolvimento
o objetivo principal. Assim, o trabalho do designer industrial influenciado diretamente
pelas estratgias de vendas por ser considerado o impulsor das mesmas. Uma vez que
grande parte das muitas e importantes decises referentes ao projeto ainda so tomadas
neste nvel dos negcios e vendas pelos atores responsveis por estes setores,
notadamente a diretoria e no no nvel estratgico de projeto com a participao dos
responsveisporsuaconcretizao,nocasoosprojetistas,Landim(2010,p.27,28)ressalta:

Para ser usado de modo estratgico, o design deve participar das definies
estratgicas a partir de nvel decisrio mais alto e integrado com todas as reas
relevantes.Odesignestratgicomaterializasequandooimportantedesenvolver
oprodutocertotereficciadoprocessodedesign,enosomentedesenvolver
corretamenteoproduto,tendoeficincianoprocessodedesign.(LANDIM,2010,
p.2728).

Nosepretende,nestemomento,tomarumposicionamentoradical,defendendoa
posturadequeodesignersejaoprofissionalidealparadelinearasestratgiasdeempresas
oucompanhias,oumesmoparalideraraorganizaocomoumtodo,posturaestaindicada
por MOZOTA et al (2011, p. 66) como equivocadamente adotada por alguns designers.

140

Pretendeserefletiretecerconsideraessquaiscontribuamparaummaiorconhecimento
sobre os diversos aspectos da prtica profissional, reconhecer as potencialidades dos
profissionais designers automotivos brasileiros e, ao mesmo tempo, gerar conhecimento
sobreaprofissonesseprocesso.
Sendoinegvelsuacontribuioparaumavanoestratgicodequalquerempresa
nestecasoemespecficodasmontadorassemperderofoconousurioenasociedade,os
designers so importantes atores no desenvolvimento de inovao, e seu posicionamento
comoprofissionalcontribuiparaseureconhecimentocomotal:

A consolidao profissional do design depende do posicionamento da categoria


dianteda sociedade, dosoutros profissionais e do mercado. Deveseenfatizar ao
designer,aindanasuaformao,aconscinciadesuascompetnciaseseupapel
em cada um desses aspectos. A autocrtica essencial ao designer, tanto na
concepodenovosprodutoscomoemrelaoaoseuposicionamentodentrode
contextos mais amplos de outras profisses e da sociedade. (SILVA et al., 2013,
p.52).

Sobesteaspecto,umamaiorvalorizaodacategoriadentrodacompanhiatornase
umimportantecontributoparaoprprioprocessodedesigncomoumtodo.Intencionase,
no presente trabalho, portanto, que a discusso favorea a reflexo por parte dos
profissionais com base em sua prpria prtica, a fim de que os mesmos identifiquem os
pontosaseremmelhoradosparaqueaprofissopreservesuaessnciadeprojetaromelhor
para o ser Humano, sendo o sucesso mercadolgico nada alm do reflexo de um projeto
bemexecutado,aoqueEscorel(2000)completa:

[...] considerando o contexto, preciso que se pare, de vez em quando, para


refletirumpoucosobreanaturezadastensessobasquaisodesignerbrasileiro
tem atuado, tentando no perder de vista nem a origem nem a essncia da
profisso.precisoqueseencareodesigncomoumaatividadenaqualavenda
consequnciadeumprojetocorretamenteconceituado,fabricadoedistribudo,e
no uma finalidade em si mesma. E, mesmo admitindo que a fronteira entre os
desgnios do projeto e os desgnios da venda tenham se tornado tnues,
necessrio aprender as nuances para que se possa continuar a caminhada sem
perdadadireoprincipal.(ESCOREL,2000,p.44).

Neste sentido, cabe registrar o importante papel que a pesquisa desempenha,


fomentando discusses e vislumbrando possibilidades. A rea de design de automveis

141

configuraumcampodepesquisaamplo,pormpoucoexplorado,oqualmereceumolhar
maisapuradoporpartedacomunidadeacadmica.SendooDesignumarearelativamente
nova de conhecimento, a pesquisa cientfica desempenha importante papel trabalhando
para auxiliar a consolidao da rea, da profisso e seus profissionais, bem como para
divulgaraproduoeinovao,visandoconstruirmaisdoqueopresente,tambmofuturo
doDesign,oqual,paraLandim(2010,p.36),[...]requercooperao,envolvendoeducao
em design, organizao em design, designers, pesquisadores, crticos, a imprensa, a
comunidade empresarial e a pblica. Tambm como pano de fundo esto o Estado e a
sociedade.
Afimdecontribuirparaestefuturoevisandoconhecermelhorosaspectososquais
influenciam nas prticas profissionais dos designers de automveis brasileiros, as pginas
que se seguem exploram os dados levantados por meio de entrevistas realizadas com
designersatualmenteematividadenoBrasil.

142

143

4MATERIAISEMTODOS

A presente pesquisa caracterizase por ser um modelo qualitativo e quantitativo,


fundamentado parte em raciocnio indutivo e parte em raciocnio dedutivo, de cunho
exploratrioeinterpretativo,desenvolvidaemtrsetapas:pesquisabibliogrfica,coletade
dadoseanlisedosdadosobtidos.
Na etapa de pesquisabibliogrfica, buscouse caracterizarhistoricamente o cenrio
deatuaodosdesignersdeautomveisbrasileirosapartirdahistriadaprpriaindstria
automotivainstaladanopas,bemcomoopapeldodesignernaindstriadeautomveise
comosedsuaprticaprofissional.
A etapa de coleta de dados buscou captar, dos prprios profissionais participantes,
suas percepes acerca da rea e de sua prtica desenvolvida no Brasil, e deuse em dois
momentos:emumprimeiromomento,foramrealizadasentrevistassemiestruturadascom
oitoespecialistasetomadascomoprteste.Apartirdeseusresultados,pdese obteras
diretrizesnecessriasparaaelaboraodequestionriosfechadosaplicadosaumaamostra
do universo pesquisado, na inteno de obter dados mais precisos em relao ao tema
pesquisado.
Por fim, a anlise dos dados permitiu discutir as consideraes presentes nas
respostas das entrevistas e questionrios luz da bibliografia, a fim de gerar inferncias
relativas ao papel do designer atuante na indstria automotiva instalada no Brasil na
atualidade.

4.1Aspectosticos

Sendoapesquisaapoiadanaparticipaodesereshumanos,osprocedimentosaqui
apresentadosforamsubmetidosaoComitdeticaemPesquisadaFaculdadedeCincias
daUniversidadeEstadualPaulistaJliodeMesquitaFilho,dacidadedeBauru/SP,processo
n13004/46/01/12,eaprovadosnodia22denovembrode2012.
Os participantes convidados a colaborar com a pesquisa assinaram um Termo de
Consentimento Livre e Esclarecido (TCLE) Apndice B previamente realizao das
entrevistas e participao atravs dos questionrios, sendo elucidados na ocasio, para
cadaparticipante,quaisosobjetivosdoestudoaoqualseriavoluntrio,daisenototalde

144

coaoouconstrangimentodequalquerespcieedapossibilidadederetirarsedapesquisa
aqualquermomento,seassimoquisesse.
Apesquisadoraresponsvelporestainvestigaorealizoutodasascoletasdivulgadas
napresentepesquisa,adotandocomopadrooesclarecimentoprviodetodosospossveis
questionamentosporpartedoentrevistadoemcadaabordagem.Tambmfoielaboradoum
Termo de Autorizao para uso de Imagem Apndice C assinado pelo designer Nelson
Lopes,autorizandoousodeimagensdesuaautorianaformadesketchesautomotivospara
finsexclusivamenteacadmicos,cientficosedeusorestritoparailustraroprojetogrfico
dadissertaoresultantedestapesquisa.

4.2Materiais

Apesquisadesenvolvidaocorreuemdoismomentosdistintos.Assim,aseleodos
designers participantes da primeira fase compreendeu uma amostra do tipo no
probabilsticaouporconvenincia,noqualosubgrupodapopulaoestudadofoicomposto
porumaseleodeamostrasdotipoespecialistas.Destamaneira,optousepelaabordagem
dosprofissionaisatuantesnosquatromaioresestdiosdedesignautomotivoinstaladosno
pas.Seguiuseocontatocomdoisdesignersdecadaumadasquatroempresas,totalizando
oito participantes, sendo cada dupla composta por um Shape designer e um desginer de
Color&Trim, visando, desta maneira, abranger os dois principais campos nos quais os
designersatuamdentrodosestdios.
Para o segundo momento da pesquisa, optouse pela amostragem do tipo
probabilstica. Para obteno da amostra, foram contatadas doze empresas as quais
possuemplantasindustriaisinstaladasnoBrasileresponsveispelaproduodeveculose
comerciais leves (ANFAVEA, 2013) Fiat, Ford, GM, Honda, Hyundai, MercedezBenz,
Mitsubishi,Nissan,PSAPeugeotCitron,Renault,ToyotaeVolkswagenafimdeconhecer
onmerodedesignersatuantesempregadospelasmesmas.Destetotal,foipossvelobtero
nmerodeprofissionaisatuantesemseisempresas.Taisnmerosforamobtidosapartirdo
contato direto com designers atuantes nestas companhias totalizando um universo ou
populaode92designers.

145

Com base em Barbetta (2001, p. 60), para uma primeira aproximao do valor
tamanho mnimo da amostra vlida, considerandose um nvel deconfiabilidade no qual o
erronoultrapasse3,5%,aequaoempregadafoi:
n0=1/E20
Onde:
n0=umaprimeiraaproximaoparaotamanhodaamostra
E0=erroamostraltolervel
Apartirdovalorresultantedaprimeiraaproximao,adequandooclculoemfuno
dotamanhodapopulaoN=92indivduosempregouseafrmula:
n=N.n0/N+n0
Naqual:
N=tamanho(nmerodeelementos)dapopulao;
n=tamanho(nmerodeelementos)daamostra;
n0=umaprimeiraaproximaoparaotamanhodaamostrae
Assim,paraumnveldeconfianade90%,commargemdeerrode3,5%,aamostra
mnimaobtidadouniversode92designers,foin=79indivduos.Asrespostasobtidasforam
organizadasemgrficoseapresentadaspormeiodeporcentagens.
Noprimeiromomentodacoletadedados,omodelodeentrevistasemiestruturado
foi adotado como o instrumento mais adequado para captar as impresses dos oito
especialistas contatados. Assim, com base nasleituras realizadas, nos aspectos destacados
pelosautorescomorelevantesparadiscussosobreopapeldodesignercomoprofissionale
naexperinciaprofissionaldapesquisadora,foielaboradooroteirodeentrevistaApndice
Dcontendo11questesabertas,sendoastrsprimeirascomvistasaidentificaroperfildo
entrevistadopelonome,formaoetempoemquetrabalhacomdesigndeautomveis,ea
ltimaabertaparaconsideraesfinaisseoentrevistadoassimdesejasse.Ocontedodas
questesseguiuumroteirocrescente,investigandoconceitosquepartemdoparticularpara
ouniversal,intencionandoobterumpanoramageraldaprofissoapartirdoolhardequem
avivencia.
Para registro dessas interaes entre pesquisadora e participantes, por conta das
dificuldades encontradas para o deslocamento da pesquisadora s diferentes plantas
industriais, bem como disponibilidade dos profissionais em atender a pesquisadora
pessoalmente,optousepelaagravaodeudiodecadadilogoapartirdeumdispositivo

146

vinculadolinhatelefnicaeaocomputadorsimultaneamente.Terminadaagravao,esse
arquivofoisalvonocomputador,ficandodisponvelparaanlisesposteriores.
Nosegundomomentodacoletadedados,combasenaspercepesidentificadasna
primeira fase de entrevistas com especialistas, foi elaborado o questionrio a ser aplicado
emumaamostradouniversopesquisado,comafinalidadedeobterdadosmaisprecisose
generalizveis em relao atuao do profissional do design dentro da indstria
automobilstica.Algumasdasvantagensdousodosquestionrioscompreendemofatodeo
mesmo resultar em respostas rpidas e precisas, com menor risco de distoro pela no
influnciadopesquisador,almdegarantirmaioruniformidadenaavaliaoresultanteda
naturezaimpessoaldoinstrumento.Entreasdesvantagens,destacamseadevoluotardia
dosquestionrios,fatorprejudicialaocalendriodapesquisaeaporcentagempequenados
questionrios,osquaisretornamrespondidos,sendoque,dosquestionriosexpedidos,em
mdia25%sodevolvidos(MARCONIeLAKATOS,2009,p.8687).
Para a presente pesquisa foi elaborado um questionrio contendo 10 questes
fechadas, sendo o mesmo disponibilizado em plataforma virtual de maneira a facilitar o
acessoporpartedosparticipanteseampliaroalcancedapesquisaApndiceE.

4.3Procedimentosdecoleta

Para a primeira fase da coleta, aps o contato inicial, foram agendados com cada
profissional o melhor dia e horrio para a realizao das entrevistas, as quais foram feitas
por telefone e registradas a partir da gravao telefnica do dilogo. Antes de cada
entrevista,apesquisadoraresponsveladotoucomopadroinformaroentrevistadosobrea
gravao da conversa, sobre os objetivos da pesquisa, bem como sobre a importncia do
TCLE,oqualfoienviadoporemailnomesmodiadaentrevistaedevolvidotambmpore
mail,devidamenteassinadoporcadaparticipanteepelapesquisadora.
Nos dias e horrios agendados realizaramse as entrevistas, as quais tomaram o
temponecessriopara queosprofissionaisse manifestassemlivremente.Aofinaldecada
entrevista,foipermitidoaosparticipantestecerconsideraes,asquaisacreditassemserem
pertinentes aos objetivos da pesquisa. A fim de garantir o anonimato de cada designer
entrevistado, bem como da empresa para a qual trabalha, a pesquisadora convencionou
referirseaosprofissionaispelaletrainicialdapalavradesignerportantoletraDseguida

147

do nmero de ordem cronolgica da realizao de cada entrevista, sendo o primeiro


entrevistadodenominadopelasiglaD1,osegundopelasiglaD2eassimsucessivamente.O
mesmoprocedimentofoiadotadoparaasindstriasreferenciadaspelaletraMseguidas
daordemcronolgicadeentrevistadosseusfuncionrios,sendoosdoisprimeirosD1eD2
funcionrios da M1; D3 e D4 funcionrios da M2 e assim sucessivamente. Uma vez
concludas, todas as entrevistas foram transcritas Apndice F formando o corpus de
anlise.
Na segunda fase da coleta, uma vez obtido o valor da amostra de 79 indivduos,
seguiuseocontatocomoschefesdosdepartamentosdesigndasseisempresaspesquisadas
e, na presena de obstculos quanto ao contato com estes chefes, foram contatados
diretamente designers atuantes nestas empresas, solicitando aos mesmos que
respondessemaoquestionrioonline,bemcomodivulgassemamplamenteentreoscolegas
de departamento o link de acesso ao formulrio. No total 32 indivduos foram contatados
diretamente, ocasio na qual foi solicitando aos mesmos que encaminhassem o link aos
demais designers do departamento no qual atuavam e com os quais a pesquisadora no
obteveocontato.

4.4Anlisededados

Aanlisedosdadosobtidosnaprimeiraetapadapesquisa,qualitativa,foirealizada
luzdomtododeAnlisedeContedo(BARDIN,2011),o qualcaracterizadoporserum
conjunto de tcnicas de anlise das comunicaes, visando compreender criticamente o
sentidodascomunicaes,seucontedomanifestooulatente,assignificaesexplicitasou
ocultas.
Uma vez de posse dos dados coletados, o mtodo composto pelas seguintes
etapas:

Organizao da anlise fases de pranlise, leitura flutuante e explorao do


material;

Codificaodosdados;

Categorizao;

Inferncia.

148

Comoobjetivodeotimizaraanlise,afasedepranlisecorrespondeorganizao
domaterial,tornandoooperacionalesistematizandoasideiasiniciais.Emseguida,realiza
se a leitura flutuante uma leitura inicial e escolha dos documentos. No caso, todas as
entrevistas foram consideradas vlidas, procedendose constituio de um corpus de
anliseelevandoemconsideraotodososelementosdestecorpus,semexcluirqualquer
um destes. Tal corpus deve ser homogneo e adequado enquanto fonte de informao.
Tambmfazempartedapranliseaformulaodashipteseseobjetivosoolharcom
quesebuscaainformao,sendootrabalhodoanalistaorientadoporhiptesesimplcitas.
Segueseentoelaboraodeindicadoresouitens,emfunodashiptesespreviamente
levantadas.
Afasedeexploraodomaterialcompostaporoperaesdecodificao,desconto
ouenumerao,emfunoderegraspreviamenteformuladas.Nestafase,osresultadosso
tratados de maneira a serem significativos e vlidos. A codificao ou tratamento do
materialpropriamenteditocorrespondeaumatransformaoefetuadasegundoregras
dos dados brutos do texto, as quais por recorte, agregao e enumerao, permitem
atingir uma representao do contedo, esclarecendo o analista acerca das caractersticas
dotexto,podendoservirdendices.
Nocasodopresenteestudo,empreendeusealeituradasentrevistas,realizandose
umaanlisedecontedodecarterqualitativo.Nestesentido,talanlisefoifundamentada
na presena do ndice, o qual pode ser uma palavra ou um tema. Para a elaborao dos
ndices foi considerado como unidade de registro o tema. Assim, tomando por base tal
codificao inicial, procedeuse a categorizao dos ndices encontrados, elucidando
tambmosindicadoresqueosfundamentam.Ascategoriasrenemumgrupodeelementos
unidadesderegistrosobumttulogenrico,agrupamentoesteefetuadoemrazodos
caracterescomunsdesteselementos.
Categorizaroselementosverificadosnamensagemimpeainvestigaodoquecada
um tem em comum com os outros. Desta forma, o que permite o agrupamento de
informaesemcategoriasapartecomumexistenteentreelas.Acategorizao,portanto,
compreende o processo de, em um primeiro momento, isolar os elementos e,
posteriormente, reagruplos por semelhana em categoriasl, e visa fornecer, por
condensao, uma representao simplificada dos dados brutos, sendo a inferncia final
efetuadaapartirdomaterialreconstrudo,oureagrupadoporsemelhanadecontedo.

149

Como ltimo estgio da anlise de contedo, a inferncia resultado da leitura


crtica de uma mensagem, e se faz como um bom instrumento de induo para se
investigaremascausasvariveisinferidasapartirdosefeitosvariveisdeinfernciaou
indicadores. Assim, podese, a partir das categorias, realizar inferncias sobre aqueles
discursos, obtendose desta maneira informaes significativas relacionadas inteno da
pesquisa. Tal procedimento permite interpretaes a partir dos dilogos registrados a
propsitodosobjetivosprevistospeloestudo,ouquedigamrespeitoaoutrasdescobertas
inesperadas, mas igualmente ricas para a produo do conhecimento acerca do objeto de
estudo.ODiagrama3representaasetapasdeanlisedecontedodesenvolvidasdurantea
pesquisa:

Diagrama3Passosdaanlisedecontedodasentrevistas

Fonte:AdaptadodeBardin,2011,p.102.

Na segunda etapa da pesquisa, de carter quantitativo, a qual compreendeu a


aplicao de questionrios online, a fase de anlise teve incio a partir da compilao e

150

tabulao dos dados provenientes do sistema de formulrios online utilizado como base
paraadisponibilizaodoquestionrioemrede.
Uma vez organizados, os dados obtidos foram analisados por meio da estatstica
descritiva, a partir da distribuio de frequncias para cada uma das variveis estudadas,
descrevendoposteriormentearelaoentreasmesmas(SAMPIERI;COLLADO;LUCIO,2006,
p.415).Porfim,foramrealizadasasrepresentaesgrficasdosresultados,osquaisforam
discutidosparalelamente.

151

152

5RESULTADOSEDISCUSSES

No total, foram entrevistados oito designers automotivos na primeira fase da


pesquisa qualitativa e 25 na segunda fase. Na primeira fase, os dados foram
categorizadoseorganizadosemquadros,sendodiscutidossimultaneamente.Asegundafase
quantitativacompreendeuaclassificaoeorganizaoemplanilhadosdadosobtidosa
partir dos questionrios online respondidos pelos participantes. Tais dados foram
posteriormenteanalisadospormeiodeestatsticadescritiva,sendoapresentadosnaforma
degrficosquefundamentaramsuadiscusso.
A pesquisa do tipo qualitativa, e quantitativa permitiu em um primeiro momento
obter informaes em profundidade sobre a prtica profissional dos designers de
automveis para em seguida a partir das percepes dos profissionais obter parmetros
para a elaborao do questionrio objetivo aplicado a uma amostra do universo de
profissionais atuantes. Em seguida, os resultados de ambas as fases foram revisados e
confrontadoscomosobjetivosdapesquisa,resultandonasconsideraesfinaissobrecomo
temsedadoaprticaprofissionaldosdesignersnasindstriasautomobilsticasinstaladasno
Brasilnaatualidade.Aseguir,soapresentadososresultadoseasdiscussesreferentess
duasetapasdapesquisa.

5.1Resultadosdaprimeirafasedapesquisa

Na primeira fase da pesquisa, tomada como prteste, a investigao atravs das


entrevistasteveincionomsdeSetembrode2012,estendendoseNovembrodomesmo
ano.Oformulriodeentrevistafoielaboradocontendo11questesabertas.
Combasenabibliografiaeintencionandoconhecermaissobreaamostra,bemcomo
as percepes dos profissionais acerca de seu campo de atuao, a estrutura de tal
documentofoiconstrudasolicitandoinicialmentequeosmesmosidentificassemotrabalho
do designer de automveis, e explicitassem sua viso sobre a profisso e seu
desenvolvimento no Brasil, na atualidade. Em seguida, considerando as dinmicas dos
estdios de design dentro das montadoras, os entrevistados foram questionados sobre
como se do as relaes interdisciplinares entre o design e as demais reas envolvidas no
projeto de um automvel, e at que ponto tais relaes interferem em sua prtica

153

profissional.Aquestoseguintesolicitouaosmesmosquedefinissememsuaopinio,qual
seria o nvel de relao desejvel entre o design e estas reas. Na sequncia, as demais
questespropuseramaosparticipantesversarsobreaautonomiadosdesignersbrasileiros
no desenvolvimento de projetos; sobre os principais desafios enfrentados no diaadia da
profisso; e quais os aspectos a serem trabalhados para melhorar sua prtica. A ltima
questoindagouosparticipantessobrequalseropapeldodesignerautomotivonofuturo,
tendo em vista problemas de amplo espectro nos quais o projeto do carro como meio de
transporte est envolvido, tais como a preservao do meio ambiente, mobilidade em
grandes cidades, interao com os demais meios de transporte entre outros. Por fim, foi
assegurada aos entrevistados a liberdade de tecer consideraes finais as quais julgassem
importantes para o enriquecimento da rea, da profisso e, como consequncia, da
pesquisa. Na segunda fase, os dados obtidos nesta primeira etapa de prteste guiaram a
elaboraodoquestionriofechadoaplicadoamostradouniversopesquisado.

5.1.1PerfildaAmostra

Nessa primeira fase, foram entrevistados oito profissionais designers automotivos,


atuantes nos estdios de design de quatro montadoras de grande volume instaladas no
Brasil, sendo quatro Shape designers e quatro Color&Trim designers. Os grficos a seguir
mostramoutrosdetalhessobreoperfildosprofissionaisentrevistados:

Grfico1Formaodosprofissionaisentrevistados

Fonte:Aautora,2013.

154

ApartirdosdadospresentesnoGrfico1podeseobservarqueentreosdesigners
participantesdapesquisa,amaioriatemformaoacadmicanonveldeGraduao63%
seguidos por 25% de profissionais os quais, alm da graduao, possuem psgraduao
dotipolatusensu,sendoapenasumparticipanteatuantecomformaotcnica.
No que se refere ao tempo de atuao na rea, o Grfico 2 mostra os dados
fornecidospelosoitoentrevistados:

Grfico2Hquantotempotrabalhacomdesignautomotivo

Fonte:Aautora,2013.

O Grfico 2 revela que, eentre os participantes da pesquisa, 37% atuam como


designers automotivos h cinco anos ou menos. Metade dos participantes atua no setor
entre cinco e dez anos 50% e o profissional que atua h mais de dez anos 13%
contabiliza20anosdeprticaemprojetosdeautomveis.

5.1.2Anlisedecontedodosdadosobtidos

Apsatranscriodasentrevistasrealizadasjuntoaosprofissionais,empreendeuse
aleituraflutuantedosdocumentos.Emseguida,foramelaboradasascategoriasdeanlise
oriundasdasleituras,sendocadaumadestascompostasporseustemasinternos,osquais
forneceram informaes para a definio de hipteses e objetivos, os quais foram
responsveispelodirecionamentonadefiniodosndiceseseusrespectivosindicadores.O
Quadro1elucidaaestruturaseguidanesteprimeiromomentodaanlise:

155

Quadro1CategoriasdeAnliseeseusrespectivostemas

CategoriasdeAnlise

Temas

1.OprofissionaldesignerautomotivonoBrasil

1A.Definiodafunodedesignerautomotivo

2.Odesignerautomotivobrasileiroeaprtica
interdisciplinar

3.Autonomia,desafiosemelhoriasnaprtica
profissionaldodesignerdeautomveis
brasileiro
4.OfuturodaprofissonoBrasil

1B. Percepo acerca da profisso de designer


automotivonoBrasil,naatualidade.
2A. Dinmica das relaes entre o design e as
demaisreasenvolvidasnoprojeto
2B. Interao desejvel entre o design e as
demaisreas
3A.Aautonomiadosdesignersautomotivos
3B.Desafiosdaprofisso
3C.Melhoriasnaprticaprofissional
4A. O papel do designer automotivo no Brasil
nosprximosanos

Fonte:Aautora,2013.

5.1.2.1Categoria1:OprofissionaldesignerautomotivonoBrasil

Compem esta categoria as duas primeiras questes da entrevista aplicada, sendo


seus temas representados pelo contedo principal de cada uma destas questes. Aps a
leitura de cada conjunto de respostas obtidas, foram definidas as hipteses e objetivos,
seguidosdaelaboraodosndiceseobtenodosindicadores,comosegue.
Tema1A:Definiodafunodedesignerautomotivo
OQuadro2apresentaosndiceseindicadoresencontrados.
Quadro2ndiceseindicadoresoriginadosdoTema1A
ndice:
1.Promoveralinguagemdamarcaevaloresdaempresaatravsdoproduto

Indicadores:
D1 [...] o papel do designer ser a cara da empresa e de representar os valores da empresa
enquantomarcamesmo

D7[...]basicamentevocverquaisasnecessidadesdeumaempresa,aoque[...]seriaogosto
popular,aoqueaspessoasentendemcomobeleza,adequarsnecessidadesdevenderumproduto
queestejaemadequaocomoqueoconsumidorpodeencontrar

ndice:
2.Criaoeaparnciadoveculo

Indicadores:
D2 [...] tudo aquilo que aparente no veculo, seja externo, interno ns fazemos a... o
desenvolvimentodestesmateriais,aaprovao,apesquisadetendncias

D3 [...] o trabalho do designer ... lgico em qualquer rea, mas especificamente na rea

156

automobilstica, absolutamente importante, hoje em dia... ... na realidade o designer por fazer
essa casquinha... a parte visvel do automvel, ele tem a responsabilidade de definir a parte
visveldoautomvel

D5 [...] hoje o meu trabalho ele apesar de ser dentro da rea de design a gente trabalha com
Color&Trim que uma rea assim, que cuida de tudo o que tem a ver com a aparncia do carro.
Ento, revestimento, pintura, tecido, peas decorativas, texturas plsticas... tudo o que tem a ver
comaparncia,masagentetemumaligaobemassimprximacomoestdio...entoosdesigners
que fazem realmente o shape do carro que mudam as linhas que desenham o carro interior e
exterior

ndice:
3.Foconafuno,namobilidadeenousuriodentrodoprojetodeveculos

Indicadores:
D4[...]euachoqueprincipalmente...[pausa]pensaramobilidade,pensarafunosejaqual
foromeiodetransportequevserproduzido,comoissopodeinteragireserfuncional,agradvel,
confortvel com todos os atributos que ocliente esperano uso.Entoeu achoque o designer de
automvel tem que entender do contexto da mobilidade, do uso e de quem o consumidor
especfico,tantopraaqueleautomvelouveculo,quantodentrodeledivididoporverses

D5 [...] eu acho que conseguir claro com a ajuda de outras reas capturar qual ... no
necessariamenteoespiritodapocaporqueagentevaifazerumprojetopradaliquatrooucinco
anos.Masassim,capturaroespiritodoquevaiserdaquelemomentoproqualocarrofoiprojetado,
oescopodessecarro,apartirdeumdesejoqueesseconsumidor[...]

ndice:
4.Desenvolvertendncias,tecnologiaseinovao

Indicadores:
D5 [...] ento voc capturar a essncia dessa necessidade que esse consumidor tem... e voc
projetarocarropraqueelesejapramimcompatvelcomasinovaesquenoseriamsinovaes
delinhaeaparncia,mastambminovaotecnolgica,voctrazerissoprocarroporqueocarro
elepraticamenteumaextensodocorpodessapessoa...quandoelatselocomovendo,ounos
assimquandoultrapassaessacoisadosetransportar,selocomover,quandotambmtemavercom
a identidade da pessoa, voc conseguir imprimir isso nesse objeto.... nesse objeto que muito
funcional

D6[...]odesignerdeautomveisconsiste...emalmdeagregaraparteestticaqueoque
todomundoimaginainicialmente,gerarinovaoemtermosdetecnologia[...]deumamaneira
informalexatamenteisso,agregartecnologiaeinovaoproprodutoe...aquiprincipalmenteno
Brasil,tambmachoquefoisumpouquinhoinovar,porqueaengenhariamuitoamarradaassim,
muito presa a critrios e tecnologias j comprovadas e... e j testadas, ento muito difcil
convencer a engenharia a inovar, a criar algo novo ento... eu acho que o papel do designer
automotivojustamenteforaronovo[...]

D8[...]entoespecificamenteassimnanossarea,agentetraduziroquetacontecendoem
tendnciasemercadosdevriossetores,etraduzirissoemacabamentospraindstriaautomotiva
[...]umprodutoquetemquetalinhadocomomercado,comastendnciasetudoomaiseao
mesmotempotemqueterumadurabilidadeat...nosemtermosdematerial,masemtermos
estticos,muitomaior

157

Entre os participantes, dois designers (D1 e D7), definiram a profisso como


responsvel por promover a linguagem da marca e valores da empresa atravs dos
produtos. A maioria dos entrevistados, contudo, sintetizou sua atuao como responsvel
pela criao e aparncia dos veculos (D2, D3 e D5), definio esta por vezes influenciada
pela concepo popular do que o design. Tal fato se revela na fala do D3, ao proferir a
frase [...] na realidade, o designer, por fazer essa casquinha... a parte visvel do
automvel,eletemaresponsabilidadededefinirapartevisveldoautomvel[...].Ousoda
palavracasquinharemeteaoqueSilvaetal.(2012,p.51,52)destacamcomosendoreflexo
dabanalizaodotermodesign,resultadodapopularidadequeomesmovemalcanando
nos ltimos tempos, caracterizando uma concepo que visualiza na ao do design um
incrementoestticonoproduto.Nestesentido,osautoresprosseguem:

Casos como esse so comuns e tendem a se multiplicar na medida em que os


meiosdecomunicao,mesmonoscasosaplicveiscomoododesignautomotivo,
ressaltam o design apenas como fator determinante da beleza do automvel,
enquanto a engenharia e outras reas contemplam desempenho e tecnologia.
(SILVAetal.,2012,p.51,52).

Definiesmaisabrangentestambmforamrelatadas,situandoocampododesign
deautomveiscomoresponsvelnoapenaspelaproduodoprodutocarro,mastambm
comoumareadeatuaomaisampla,envolvendoamobilidadeemgeral,discussoesta
presentenafaladoparticipanteD4:[...]euachoqueprincipalmente...[pausa]pensara
mobilidade, pensar a funo, seja qual for o meio de transporte que v ser produzido [...]
Ento,euachoqueodesignerdeautomveltemqueentenderdocontextodamobilidade,
dousoedequemoconsumidorespecfico[...].
Duas outras definies apresentadas pelos designers dizem respeito ao seu papel
comodesenvolvedoresdeprodutoscomfoconafuno,namobilidadeenousuriodentro
doprojetodeveculos(D4eD5)ecomoprodutoresdetendncias,tecnologiaseinovao
(D5,D6eD8).
EmboraformadosnareaouemreasafinscomoocasodaModaasdiferenas
entreasdefiniesapresentadaspelosparticipantesemesmoapresenadoindicadorde
faladeummesmodesigneremdoisdiferentesndicesdemonstramaamplavariabilidade
da compreenso acerca da funo do designer de automveis, indo ao encontro das
consideraesdeCardoso(2012,p.238),paraquemodesignumcampoimpossveldeser

158

delimitado, Tratase de uma rea por demais complexa e multifacetada para caber em
qualquer definio estreita, muito menos para ser reduzida pratica de determinado
indivduo ou escola. Campo jovem, o design encontrase ainda em fase de aprendizado e
experimentao.
A pluralidade de definies, portanto, indica que a percepo dos designers em
relaoatividadequedesempenhamsedtambmcomoreflexodoentornoqueenvolve
sua rotina diria fortemente influenciada pelo peso das marcas, pela competitividade
acirradaepelabuscadoequilbrioaoprojetar,visandoatendersnecessidadesdaempresa,
domercadoedousurio.
Tema 1B: Percepo acerca da profisso de designer automotivo no Brasil na
atualidade
OQuadro3apresentaosndiceseindicadoresrelativosaotema1B.
Quadro3ndiceseindicadoresoriginadosdoTema1B
ndice:
1.Aumentodeoportunidadesedesenvolvimentoprofissional

Indicadores:
D1 [...] Acho que o brasileiro t tendo oportunidades nos ltimos tempos, e tem condio e
precisacompetirnomesmonvelqueosdesignersdoexterior[...].

D2[...]euvejoquetemcrescimento...assim,nosnaM1masemoutrasmontadoras[...]

D4 [...] eu vejo que hoje ns temos estdios bem avanados pra vrias montadoras, ou outros
tiposdelocomooecomdesignerscomexperinciainternacional[...]

D5[...]euachoassimqueatpelofatodagenteterhojetodasasmontadoras,todasaspessoas
que trabalham numa montadora... existe uma... uma vontade muito grande de aproveitar, por
exemplo no caso da M3 que tem um grande centro de design, aproveitar toda essa estrutura pra
podertrazerpraessescarrosapesardetodasasbarreirashojequeexistem,politicas,osimpostos
enfim,aproveitartodaessaestruturapratrazerinovaocadavezmaispraessescarros[...]temum
ladovocacionalqueeuachoquevocentranumcentrodedesignvocvqueaspessoassomuito
assim ... dedicadas mesmo, elas so pessoas que gostam de apresentar um projeto que no
meramente uma estratgia de nmeros... ela uma estratgia inspiracional, uma estratgia que
temavernoscompesquisadoqueestacontecendonomercado,maspesquisadetendncias
entoumambientemuitocriativo...eeuacreditoquehojenanossareaumareaassimqueela
tedumsuportepravocconseguirsedesenvolver

D6 [...] eu vejo que uma profisso que t crescendo... mas no muito por no ter tantas
oportunidadesetantasempresascomestdioaquinoBrasil[...]euvejoqueaprofissotganhando
mais respeitoem relao aprpria imagem quens temos em relao as montadoras, aos outros
profissionaisdrea,engenharia,marketing...soasreasquesoligadasaodesignassim

159

ndice:
2.Exignciadeprofundaformaotcnicaeartstica

Indicadores:
D1[...]assim...agentetemsidomuitocobradoemquestodequalidade,dedesenvolvimento
tcnicomesmo,eatartsticosabe[...]

ndice:
3.Campodeatuaorestrito

Indicadores:
D3[...]quantoaosestdios...vocvaipercebersefizerumacontagem,dosdesignersbrasileiros,
profissionais automotivos trabalhando dentro da indstria automotiva voc vai chegar em um
nmeropequenode400[pausa]200ou300pessoas,seil400dentrodeumapopulaodenosei
quantos milhes de pessoas que temos no Brasil hoje. Ento um campo restrito e bastante
competitivo,pracadavagaqueapareceexisteumabrigamonstruosapraquemvaificarcomessa
vagaento...umramodifcildeseatuarnoBrasil,porexemploumacoisaqueat[pausa]nofaz
muito sentido, porque existem tantas escolas de desenho... [pausa] de desenho industrial ou de
designpraterummercadodedesign,principalmenteodeautomveis,topequeno

D7 Eu diria que no Brasil a gente praticamente tem as mesmas atribuies e as mesmas... as


mesmasoportunidadesqueosoutrosdesignerstemlfora.Eunovejodemaneiraalgumacomo
tipo...noBrasiloulforasejamalgumacoisadiferente.Euvejoasduascomonaverdadeamesma
coisa

D8 [...] eu acho que hoje aqui no Brasil ainda ... um... se bem que eu no sei se s no Brasil
sabe... mas ainda mais restrito. Porque a indstria automotiva ainda ... ainda so menores...
menoresnodaindstriaemsi,masmenoresdeestdiodedesignetal,sevocforvertodasas
outrasindstrias,aondeteriaespaopradesignereuaindaachoqueaautomotivaamaisrestrita.
algoquenormalmentemuitagentequerentrarseil,enemsempreconsegueeacabamtambm
partindo pra outras reas e tal. Ento eu ainda vejo isso... ainda vejo que um pouco restrito no
Brasil

ndice:
4.Atuaoglobal

Indicadores:
D1 [...] hoje em dia agenteno mais um... assimum profissional isolado, a gente t exposto
globalmente

D2 [...] esto montando equipes de design dentro da indstria automobilstica como lder de
designdeprogramasglobais...quasetodasasmontadorasestonocaminhodeprogramasglobais
e... esto [pausa] permitindo os designers brasileiros a liderarem esses programas... ento a
demandatendeacrescerassim,deprofissionaispraessasreas

D4[...]osprpriosestdiosestocadavezmaisinterligadosnomundo...nasmultinacionaiseeu
vejo que assim, so estdios que no s produzem hoje pra necessidade local ou do Brasil, mas
tambmcontribuemcomprojetosglobais

D7Agenteaquitemcondiesde...deprojetarcarrosqueforemdozeroedesenvolveroscarros
que forem do zero da mesma forma que as pessoas tem... os alemes tem de fazer esse carro
ousado,ositalianospossuem,osamericanos,damesmaformaosbrasileirosestopelomenoscom
omesmocacifedeknowhowecapacidadeprafazertantoquantoqualquerdesignerqueestejano

160

exterior
ndice:
5.Reconhecimentodoprofissional(internamentecompanhiaeexternamente,inclusiveno
exterior)

Indicadores:
D3[...]aprofissobastantevalorizada,justamenteporserde[pausa]vocvaiencontraressa
profisso somente em empresas multinacionais muito bem estruturadas, empresas que tem
processosbastanteestruturados,temempresasquefuncionammuitobem,quevalorizammuitoo
serhumano,equecuidamdosseusfuncionriosdeumamaneiraexemplarvamosdizerassim,mas
temessacoisa...umaprofissoqueumpoucolimitada...[pausa]bastantelimitada

D4 Ento eu acho que assim... foi uma necessidade da indstria que virou no fundo uma coisa
bacana,umaexperinciaboaprosdesignersquehojetrabalhampraprojetosqueatendemnoso
mercadobrasileiromastambmomercadoglobal

D6[...]euachoquetcrescendo...tcrescendo,tganhandoimportncia,nos...[pausa]t
sendo reconhecida l fora. Principalmente eu que trabalho na M3 um estdio global, um dos
estdiosglobaisdaM3eagentesabequelforaelesrespeitammuitoosdesignersbrasileiroseaos
poucos a gente t conseguindo espao na mdia internacional no s construindo carros de
mercados emergentes que so aqueles carros mais baratos, assim, com menos sofisticao, e a
gentetcomeandoaganharespaolfora

D8 Valorizao [pausa] bom... tambm acho que lgico poderia ser melhor [risos] porque, na
verdade em termos de design em geral, no s o automotivo, no Brasil a gente ainda v que a
culturadedesignnotobemconsolidada.Essaaminhaimpresso.Emoutroslugaresagentej
tem um reconhecimento maior do designer, no s daquela coisa... mais ... [pausa] superficial...
assim ahh isso tem um design bonito e no sei o que..., mas do design realmente como pea
estratgicadentrodeumaempresa,quepodeatmudarorumodaempresa

No que tange percepo dos entrevistados acerca da profisso de designer


automotivo no Brasil na atualidade, a maioria dos participantes (D1, D2, D4, D5 e D6)
identificou a rea como sendo um campo o qual apresenta progressivo aumento de
oportunidades e de desenvolvimento profissional, como destacou D2: [...] eu vejo que t
em crescimento... assim, no s na M1, mas em outras montadoras [...] e D4 [...] e eu
acredito que hoje, na nossa rea, uma rea, assim que ela te d um suporte pra voc
conseguirsedesenvolver.
Taldesenvolvimentofavorecenoapenasocrescimentodocampodeatuao,como
tambm permite uma maior compreenso acerca da importncia do designer dentro da
empresa.
Embora empregados por empresas multinacionais, fundadas em pases nos quais o
campododesigneseupotencialadquiriramummaiorreconhecimentoaolongodosanos,
quantoaoseupapelcomocontribuinteparaoavanodasociedade,noBrasil,osdesigners
automotivos encontramse sujeitos s reticncias que o mercado e o meio empresarial

161

brasileiro tem em relao importncia do design e em como desenvolvlo no pas.


DesencontroestedestacadoporLandim:

O Brasil ainda est desencontrado com seu culturalismo plural, sua capacidade
produtivaecomaverdadeiracapacidadedeatuaonomercadoglobal,umavez
que ainda faz muito uso de solues estrangeiras para suplantar a incapacidade
nacional na fabricao de produtos competitivos. O pas precisa, acima de tudo,
observar suas qualidades de centro e periferia e adequar o design a elas [...] De
maneira geral, o Brasil no carente de profissionais ou de bons projetos. A
questoproblematalveznosejadescobrirodesignbrasileiro,mascomoodesign
vemseinserindonoBrasil.(LANDIM,2010,p.135).

Outro ponto destacado foi o fato de a prtica exigir profunda formao tcnica e
artstica (D1), como destacou o participante D1: [...] assim... a gente tem sido muito
cobradoemquestodequalidade,dedesenvolvimentotcnicomesmo,eatartsticosabe
[...].Tambmosparticipantesrevelarampreocupaocomofatodeocampododesignde
automveis ainda ser muito restrito insero de novos profissionais interessados na
carreira(D3,D7eD8).
Apesar das dificuldades, muitos participantes indicaram um maior reconhecimento
da profisso (D3, D4, D6 e D8), tanto no mbito interno das empresas quanto em outros
pases,fatodestacadopelosparticipantesD1,D2,D4eD7,osquaisabordaramacrescente
atuao de muitos profissionais em projetos globais, como representado pela fala de D2
[...] esto montando equipes de design dentro da indstria automobilsticacomo lder de
design de programas globais, quase todas as montadoras esto no caminho de programas
globaise...esto[pausa]permitindoosdesignersbrasileirosalideraremessesprogramas...
entoademandatendeacrescerassim,deprofissionaispraessasreas.
Emboraestereconhecimentoestejaocorrendo,avalorizaodoprofissionalaindase
encontra distante do desejvel. Destacandose a fala de D8, o participante admitiu o
reconhecimento,masenfatizouquepoderiasermelhor,ressaltandoafaltadecompreenso
sobre o que o design no Brasil como grande empecilho para um avano efetivo neste
sentido Valorizao [pausa] bom... tambm acho que lgico poderia ser melhor [risos]
porque,naverdadeemtermosdedesignemgeral,nosoautomotivo,noBrasilagente
ainda v que aculturade design no to bem consolidada [...]. A falta daconsolidao
desta cultura do design como denominada pelo participante, tambm foi discutida por
Escorel (2000, p.74) ao destacar que [...] nos pases ditos desenvolvidos o design j se

162

incorporou ao cotidiano, pois l como a qualidade condio para que um produto


permaneanomercado,cabeaodesignconferirodiferencial.
As consideraes positivas dos participantes quanto evoluo da profisso no
Brasil, permitem verificar que avanos foram conquistados, mas, ainda h muito a ser
construdo. Neste sentido, Cardoso (2008, p.251) infere que O design uma profisso
aindaincipienteeseudestinobastanteimprevisvel[...]NoBrasil,pelomenosnohbase
empricaparafalaremrecuoouencolhimentodocampo.
O campo de atuao para os profissionais brasileiros tende, portanto, a crescer, na
medida em que o papel e a importncia do design sejam reconhecidos como relevantes
instrumentos para o avano econmico do Brasil, um pas marcado por contrastes e
diversidadedeproduo,comodestacadoporDeMoraes(2006,p.263)Procurarentender
oparadigmabrasileiro,comtodaasuaenergiaepluralidadeintrnseca,,acreditase,uma
maneira de refletir sobre novas e possveis estradas para o design neste novo mundo
globalizado.

5.1.2.2Categoria2:Odesignerautomotivoeainterdisciplinaridade

Compemestacategoriaasquestesdenmerotrsequatrodaentrevistaaplicada,
tambm seus temas foram representados pelo contedo principal de cada uma destas
questes. Seguiuse ento os passos de definio das hipteses e objetivos, seguidos da
elaboraodosndiceseobtenodosindicadores.
Tema 2A: Dinmica das relaes entre o design e as demais reas envolvidas no
projeto
Encontramse organizados no Quadro 4 os ndices e indicadores encontrados
referentesaotema2.
Quadro4ndiceseindicadoresoriginadosdoTema2A

ndice:
1.Interfernciadereascomoengenharia,marketingecustos

Indicadores:
D1[...]soduascoisasassim,principalmenteengenhariaemarketing,quesoasprincipaisreas
queagenteinterage.Entoaengenhariainterferemuitonoaspectotcnicomesmodeviabilizaro
queagentefaz[...]Ecomomarketing...[pausa]soosinputsqueelespassampragentesobreo
que o consumidor espera vai, digamos assim, qual o perfil do consumidor ento a gente recebe a
informaodeleetrabalhaemcimadisso

163

D2[...]agentelidarealmentecomtodasasreas,elidabastantecomengenharia,comcompras,
comosdesignersdeshapeetal

D3 [...] a gente sempre tem a tendncia de falar o que que as outras reas interferem e
dificultamavidadodesigner...equandonarealidadedeveriaserdiferentequalaformaodesse
designerparaatenderosclientesdelequesoasoutrasreas?.Entoatendnciadodesigner
semprefalarahhessaengenhariaump...quenoseioque;porqueaproduomuitochatae
no aceita nada e assim por diante, e ai eles travam o trabalho do designer. A realidade
completamente diferente, o designer que tem que ser... vamos dizer assim, tem que ser
profissionalsuficientepraconseguiratendertodososrequisitos,todasasnecessidadesdetodasas
reaseencimadisso...levandotudoissoemconsideraoconseguirfazerumtrabalhobom

D4[...]Bom,nomeupontodevistafundamental[pausa]euachoqueemqualqueratuaoo
designer necessita ter uma atuao interdisciplinar na empresa, eu acho que at o designer
centralizador dessas aes, ... o designer participa desde a criao, ele o input inicial, num
briefing,nocontatocomocliente,naobservaonasclinicasetemqueacompanharoprojetoato
nascimento

D6Bom,oqueeupossofalaraexperinciaqueeutenhodeM3eumpoucodeM2.Euvejo
que,pelo...eununcafuiprafora,nuncatrabalheifora,masassim...[pausa]pelosrelatosdosmeus
amigosequeagentesabequeacontece,euachoquelforaodesignertemmuitomaisfora,tem
poder de negociao. Aqui no Brasil ... o designer ele ainda... como eu falei ele t ganhando
reconhecimentomaseleaindasofreumpouquinhodepreconceitoassim,preconceitonosentidode
noterumavoztoativa,ou...[pausa]comopossodizer......amesmafora,omesmopesoque
aengenhariatemouomarketingtem[...]hojeemdiatodososcarrossoiguais,astecnologiasso
as mesmas, os fornecedores so os mesmos, ento o qu que tem que diferencia um produto de
umacompanhiapraoutraodesign,nosaaparncia,ainovao,oququeagenteoferece
amaisquevaichamaraatenodoconsumidor

D7 [...] bom eu vejo muito a relao da parte exata. A gente t sempre lidando muito com a
engenharia e com os rigores que a engenharia te impe, e acho que isso algo que a gente tem
muito forte junto com o design l. E logicamente a gente tem tambm a parte que arte, que
basicamenteoextremoopostodaengenharia[...]

D8Olhaainteraorealmentemuitointensa...otempotodoelaacontece...otempointeiroa
gente t relacionado tanto com a engenharia, quanto com a questo de custo do projeto. Bom, a
gente tem que sempre, a gente j recebe o input de uma outra rea j, ento ... da rea de
estratgiadelinhadeprodutoetal,entojcomeapora...aomesmotempoessareaelatem
que,...agentepodedarumsuportetambm[...]

ndice:
2.Interfernciasnegativas

Indicadores:
D1[...]...temmuitadiscussoemuitaassim...brigaat,svezes,praviabilizaroqueagente
quer...svezesagenteganhaeasvezesagenteperdemastemmuito...essetrabalhoconstante
sabe?diaadiafazendoestetrabalhosabe?

D2[...]entoissosvezesatrapalhanapartecriativadacoisa.Ento,principalmentecustospor
exemplo,[risos]agentepropemateriaisouacabamentos,quehoraquevaivertemumcustoque...
ouocustoprapassarnasSPECS...queaindstriaautomobilsticatemtestesmuitorigorosospara
tecido,praacabamento[...]Entoassim,svezesagentequerproporumacoisaquetrendy,...
queseriaumainovaomasqueprapassarna....emtodasasespecificaesdetestesagentevai
reduzindoaquelacoisamaravilhosaqueeranocomeo[risos]eissoacabaatrapalhando

164

D4 [...] na verdade o dilema maior sempre vai ser ... unir o foco da viabilidade tcnica, da
produodaqualidadedaproduoemsrie,comasideiasiniciasdodesign.Eapassaaserfuno
dodesigneriralmdessasideiasiniciais,conseguirnegociarcomasoutrasreas,acompanharcom
as outras reas o desenvolvimento tcnico das ideias. Ento acho que assim, qualquer dificuldade
nessesentidocabebastanteaosdesignerssobrepor,acharcaminhospraqueissoacontea

D5 Olha... teoricamente, o fato de voc ter ali engenharia, ... o grupo de design, o grupo de
compras, o grupo mais tcnico... deveria ser assim, teoricamente. Nossa perfeito! um grupo
multifuncional, assim... eu posso te dizer que isso traz mais benefcios do que prejuzos, mas hoje
assim,opontocomunicao[risos]umdesafiodirioassim[...]

D6 A gente s vezes tem muitas brigas principalmente com a engenharia, o marketing nem
tanto... o marketing tem uma mente mais aberta a gente consegue uma negociao legal. Mas a
engenhariaaindatravamuitootrabalhodosdesignersnoBrasil

ndice:
3.Interfernciaspositivas

Indicadores:
D2[...]acreditoquepraumprograma,issoajuda,essainteraocomtodasasoutrasreasassim,
ajudaagenteaterumavisoumpouquinhoengenharstica,masagentetemtambmaquelacoisa
de propor coisas novas, de criatividade, ento assim a gente acaba sendo um aglutinador de
informaesdoprograma

D4 Quanto mais o designer e o departamento de design interagem com outras reas, de


planejamento,demarketing,decustos,finanas,maiseuachoque[pausa]demaisexcelnciavai
seroprodutofinal

D5[...]agentetemumestilodetiminghojequeelesuperacirrado,entovoctemtodosesses
desafios,mas,nofinal,achoqueosaldopositivo,apesardemuitasvezesagenteverassimque
notem...notemcomotodomundosairganhando

D8 [...] eu vejo que, assim, a gente consegue tambm atravs do nosso trabalho at... ...
conquistarmesmoasoutrasreas,numsentidoassim,asprpriaspessoasqueestotrabalhando
naquilo, apesar de ver uma dificuldade, elas gostam da proposta, elas acham interessante, elas
querem que aquilo v pra frente tambm. Ento a gente acaba ... conquistando ali... e a pessoa
realmentefalanossaseriamuitobacanaseissofosseprafrenteassim.Ento,elavaitrabalharpra
aquiloconseguirserfeito.Entoassim,agentetemvistoissoacontecereachoque...amelhor
formadesetrabalhar,noqueaconteasempre,masissoachoquenatural

ndice:
4.Alteraesindesejadasnoprojetodeveculosemconsequnciadeintervenes

Indicadores:
D2Ecustostambm,porqueviraemexeprecisaircortandoprater,o...ovalordocarroqueele
precisa e t no final, o posicionamento com a concorrncia, e a ento acaba tambm denegrindo
vai, aquilo que a gente props no comeo... acho que so as duas coisas que mais interferem no
nossodesenvolvimento

D5 s vezes a gente tem que abrir mo de um acabamento ou porque ele no vivel


financeiramente, ou porque ele no vivel em termos de engenharia ele no funciona, ou ele
precisaria de mais tempo pra funcionar, ento acho no final o saldo positivo mas a grande...
[pausa]assim...apimentadodiaadiasabe?essacoisadevocconseguirsecomunicarcomas
diferentesreasemanteraqualidadedoproduto

165

D6[...]hojenoBrasilagenteaindatemque...primeirodecideseascoisanaengenharia,depois
decidem as coisas no marketing e depois eles passam isso pra gente. E no deveria ser assim. Eu
acho que as discusses deveriam ser de forma equalizada assim... o designer propor coisas pro
marketing,omarketingtentarcorreratrsdoqueagenteprope,aengenhariatambmaceitarum
pouco mais das nossas ideias e no o contrrio. Normalmente eles tentam jogar o package pra
gente,tudodefinido,tudopronto...nacabeadoengenheiroassim:odesignerfazacascado
carro,enobemassim

D7Naverdadeaempresano...vamosdizerassimuma...nocapazdefazerabsolutamente
tudooquesaidacabea...entoagentetemahistoriado...dasnecessidadesqueasmatemticas,
queosarquivos3D,ostcnicosetudomaisquetmuitomaisrelacionadoasexatasquetrazempra
gente.Entovamosdizerassim,euvejoessasrelaesemmomentosdistintosdaprofisso,porque
nem sempre voc t preso pelas amarras das exatas, e nem sempre voc t livre pela...pela
liberdadedashumanas

D8Eadepoistemtodaaquestodeengenharia,deergonomia,atdefuncionalidadedascoisas,
daspropostasetudoomais,edepoislgicoaquestodecustos.Seoprojetonotemumcusto...
...bom,comosedizfactvel[risos],elenosobrevive[...]ento,realmenteagentetemessepapel
de comunicao, com as outras reas muito intenso e acaba at influenciando mesmo, numa
deciso,numacoisaquepoderianoirprafrentesefossesomenteumtcnico,pensandonaquilo

ndice:
5.Dficitdeformaodosdesigners

Indicadores:
D3Entoessaumaprofissomuitoimportante,equemesmoassim,ela...[pausa]mesmocom
toda essa importncia, ainda ela tem dificuldades... [pausa] uma profisso muito difcil porque
normalmente todos os designers que saem da escola tem um pensamento... muito vamos dizer
assim,muitoingnuodafunododesigner.Eleachaquedesenhar,fazersketchesbonitosserum
designer,enaverdadenonadadisso.Odesignereletemque...prarealizarasideiasdele,eletem
quetmuitoconsciente,temqueterumconhecimentotcnicoprofundo,tantodeprodutoquanto
das tcnicas de desenvolvimento e tem que lidar com a escultura do automvel, com a forma do
automvel, mas sempre levando em considerao todos os processos industriais, porque se voc
fizerumaformaqueinviveldeserfabricadaentoelano...vocnuncavairealizar

A interdisciplinaridade caracterstica intrnseca ao campo do design e, por


conseguinte,nosetorautomotivo.Amaioriadosparticipantesdapresentepesquisa(D1,D2,
D3,D4,D6,D7eD8)identificaramqueexecutamumaprticainterdisciplinar,mastambm
explicitaramofatodequeestaprticanosefazapenasdosuporteprovenientedasdemais
reas ao trabalho dos designers, existindo antes interferncias diretas de outras reas,
notadamente engenharia, marketing e custos, no decorrer do processo de design de
automveis,comodestacouD8:Olhaainteraorealmentemuitointensa...otempo
todoelaacontece...otempointeiroagentetrelacionadotantocomaengenharia,quanto
com a questo de custo do projeto. Neste cenrio interdisciplinar, Silva et al. (2012)
inferem:

166

[...]namaioriadosempreendimentosatuais,odesignaindanovistocomoum
componente estratgico, que pode colaborar decisivamente no sucesso de um
produto.Comisso,odesignerquasesempreaindasubordinadoaosprofissionais
de outras reas, como a engenharia ou o marketing. Normalmente, o designer
trabalhaemequipe,tantocomoutrosdesignerscomocomprofissionaisdeoutras
reas.Otipoeaamplitudedaatuaododesignerdependemdaorganizaodo
departamento de design e de como ele se integra estrategicamente empresa.
(SILVAetal.,2012,p.30).

Tais interferncias por vezes so percebidas como positivas na medida em que


instrumentalizam o designer para a melhoria e adequao de projetos (D2, D4, D5 e D8)
comodestacaafaladeD4:Quantomaisodesignereodepartamentodedesigninteragem
com outras reas, de planejamento, de marketing, de custos, finanas, mais eu acho que
[pausa]demaisexcelnciavaiseroprodutofinal.Mas,emsuamaioria,asintervenesdas
demaisreasnodecorrerdoprocessodedesignsovistaspelosdesignerscomonegativas
(D1, D2, D4, D5 e D6), resultando inclusive em brigas oriundas de divergncias na prtica,
como destacaram os participantes D1 [...] ... tem muita discusso e muita assim... briga
at,svezes,praviabilizaroqueagentequer...eD6Agentesvezestemmuitasbrigas
principalmente com a engenharia, o marketing nem tanto [...] a engenharia ainda trava
muito o trabalho dos designers no Brasil [...] hoje em dia todos os carros so iguais, as
tecnologias so as mesmas, os fornecedores so os mesmos, ento o qu que tem que
diferencia um produto de uma companhia pra outra o design, no s a aparncia, a
inovao, o qu que a gente oferece a mais que vai chamar a ateno do consumidor.
Neste sentido, Ono (2006) tambm destaca o papel do designer como fundamental no
desenvolvimentodeinovaoediferenciaodoproduto:

Diantedeumcenrioemconstantemutao,pormcadavezmaisequilibradoem
termos de tecnologia, fornecedores, canais de distribuio, custos e servios, a
inovaoeaqualidadeapresentamsesempresascomovantagenscompetitivas
potenciais. Neste contexto, o designer desempenha papel fundamental no
desenvolvimento de produtos, por meio de sua capacidade de sintetizar ideias e
solues, conjugando os vrios requisitos dos objetos e fatores envolvidos, e de
participar interativamente junto s diversas reas responsveis pelo processo.
(ONO,2006,p.47).

Emtermosdeprticadeprojeto,estasintervenesrefletememalteraesdiretas
nos produtos em diferentes nveis e fases desenvolvimento (D2, D5, D6, D7 e D8), o que
torna este um ponto nevrlgico da relao entre os designers e os demais profissionais
provenientesdeoutrasreas,asquaisporvezessoresponsveispelasprimeirasdiretrizes

167

doprojetopapelesteque,esperasequesejadesempenhadotambmpelosdesignersem
uma construo conjunta com as demais reas como revelou a fala de D6 [...] hoje no
Brasilagenteaindatemque...primeirodecideseascoisanaengenharia,depoisdecidemas
coisasnomarketingedepoiselespassamissopragente.Enodeveriaserassim.Euacho
que as discusses deveriam ser de forma equalizada assim. Tambm o participante D5
revelou que o projeto do veculo por vezes perde por conta destas intervenesE custos
tambm,porqueviraemexeprecisaircortandoprater,o...ovalordocarroqueeleprecisa
etnofinal,oposicionamentocomaconcorrncia,eaentoacabatambmdenegrindo
vai,aquiloqueagentepropsnocomeo[...].
Poroutrolado,asdificuldadesenfrentadaspelosdesignersnaatuaoemconjunto
s outras reas tambm foram indicadas como reflexo de um dficit de formao dos
prprios designers, como destacou o participante D3: [...] uma profisso muito difcil,
porquenormalmentetodososdesignersquesaemdaescolatemumpensamento...muito
vamosdizerassim,muitoingnuodafunododesigner[...]Odesigner,eletemque...pra
realizar as ideias dele, ele tem que t muito consciente, tem que ter um conhecimento
tcnicoprofundo,tantodeprodutoquantodastcnicasdedesenvolvimentoetemquelidar
com a escultura do automvel, com a forma do automvel, mas sempre levando em
considerao todos os processos industriais [...]. Na percepo de D3, a formao
deficitria,emtermosdeconhecimentotcnicoaprofundado,prejudicaosdesignerseseu
poderdenegociaodentrodaempresa,permitindoqueoutrosprofissionaisintervenhame
desempenhem este papel. Para o participante, quanto mais amplo o conhecimento do
designer,maioresserosuaschancesdenegociareatenderaosrequisitossolicitadospelas
demaisreas.Agestododesignvariadentrodasempresas,masoaspectointerdisciplinar
da profisso acompanha a prtica e por vezes mantm tnues as linhas que separam as
competnciasdecadareaemrelaoaoprojeto,prejudicandoocampododesign,como
ressaltaEscorel:

Noscasosemqueestoemjogointeressesfinanceirosimportanteseumpblico
muito extenso, por exemplo, o desejo do cliente e das instncias que costumam
falarporele,comoasagnciasdepublicidadeeespecialistasemmarketing,podem
interferirdeformadecisivanoprocesso,nemsempredirecionandoasoluopara
suamelhoralternativanoplanodoprojeto.Quandoissoocorre,odesignerpassa
deparceiroameroexecutantededecisescomasquaispode,inclusive,noestar
identificado. Essa situao muito comum no Brasil onde o design ainda no
conseguiudefinirseucampocomnitidez.Sendoassim,acabamporditarasnormas

168

eatividadesmaissolidamenteplantadasnomercado,tambmligadasaouniverso
dacomunicaoentreasempresas,seusprodutoseospblicosaquesedirigem.
(ESCOREL,2000,p.40).

OsproblemasdecorrentesdaconfusoedesorganizaonoprocessodePesquisae
Desenvolvimento dos produtos em relao atuao interdisciplinar do design residem,
entreoutrosfatores,tambmnafalhadecomunicaoentreasdiferentesreas.Estefator
influencia inclusive a percepo dos profissionais das diversas reas sobre quais suas reais
competnciaseopapeldesuaintervenodentrodosprojetos,comodestacadopelasfalas
dosparticipantes.
Nestecenrio,tornaseimperativoaosdesignersencontrarosmeiosadequadosde
sefazercompreenderdemaneiraeficiente,visandoconquistarodevidoespaoeorespeito
dos demais profissionais provenientes das reas com as quais interage no decorrer do
projeto, fortalecendo o prprio campo do design como consequncia. Cabe tambm s
diretoriaseestdios,realizaremumdiagnsticosobreoquoadequadatemsemostradoa
atual abordagem interdisciplinar no estabelecimento das necessrias interrelaes e
interdependncias entre as diversas reas no desenvolvimento do produto carro, o qual
envolve grande nmero de profissionais com as mais variadas competncias a serem
aplicadas nos diferentes nveis da produo. Nesse sentido, a tentativa de implantao de
umaprticatransdisciplinaremboradifcildeservisualizadanaestruturacorporativaatual
configura uma alternativa interessante a ser considerada. Nicolescu (2005) apresenta de
maneira sinttica, no seu Manifesto da Transdisciplinaridade, as diferenas entre as
abordagens:

A necessidade indispensvel de laos entre as diferentes disciplinas traduziuse


pelo surgimento, na metade do sculo XX, da pluridisciplinaridade e da
interdisciplinaridade.Apluridisciplinaridadedizrespeitoaoestudodeumobjetode
uma mesma e nica disciplina por vrias disciplinas ao mesmo tempo [...] A
interdisciplinaridadetemumaambiodiferentedaqueladapluridisciplinaridade.
Ela diz respeito transferncia de mtodos de uma disciplina para outra [...] A
transdisciplinaridade,comooprefixo'trans'indica,dizrespeitoquiloqueestao
mesmo tempo entre as disciplinas, atravs das diferentes disciplinas e alm de
qualquerdisciplina.Seuobjetivoacompreensodomundopresente,paraoqual
umdosimperativosaunidadedoconhecimento.(NICOLESCU,2005,p.34).

Sendo o automvel um produto complexo, o qual prev um desenvolvimento


baseado na articulao de diferentes saberes, a abordagem transdisciplinar aplicada ao
projetodeautomveispoderiaconstituirseemumaprticacoesa,naqualaconstruodo

169

produto emerge da construo conjunta de conhecimento proveniente das diversas reas,


umavezqueoprojetodoveculoseenquadrariacomoanteriormentedestacadopeloautor
[...]entreasdisciplinas,atravsdasdiferentesdisciplinasealmdequalquerdisciplina.
Opapeldodesigneredosdemaisprofissionaisnodesenvolvimentodoprojetoseria,
nesse caso, de interagir entre si desde a fase inicial do projeto, desprendendose das
posturas hierrquicas entre os departamentos e compreendendo a importncia das
diferentescompetnciasnosucessododesenvolvimentodoprodutofinal.Aadoodetal
abordagem, entretanto, dependeria de uma mudana de postura por parte das empresas
modificandosuaestruturaedosprpriosprofissionaisenvolvidos,osquaisdeveriamestar
abertos s diversas contribuies das diferentes reas abstendose das ainda muito
presentes categorizaes recorrentes entre reas, atribuindoas titulaes como
tradicionais/novasmaisimportantes/menosimportantes,eprincipalmente,dedicandosea
aprimoraraprpriaposturanasrelaesinterpessoaisestabelecidasnodecorrerdaprtica
profissional.
Tema2B:Interaodesejvelentreodesigneasdemaisreas
O Quadro 5 apresenta os ndices e seus indicadores correspondentes encontrados
referentesaotema2B.
Quadro5ndiceseindicadoresoriginadosdoTema2B
ndice:
1.Maioraberturaporpartedasdemaisreasemrelaoaodesign

Indicadores:
D1[...]meupontodevistaassim,nosodesignerquetemqueseroprofissionalcriativo...o
engenheiro,eletemquesercriativotambm,praacharassoluesquenonecessariamentesoas
queelefazhdezouquinzeanosento...domesmojeitoqueodesignertemquepuxarpracriar
coisasnovas,oengenheirotambmtemqueteressacabeadedesenvolvimentomesmo,debuscar
onovoedeviabilizarcoisasnovas,enosimplesmentefazermaisdomesmo

D2 [...] ento assim voc t trabalhando assim... [pausa] checando as opes e podendo ver,
porquetemmuitacoisaquenahoradovamosverahhnopodemaisporqueaferramentajt
pronta, ento no pode... vai ter que ser pintura, voc no pode escolher um outro acabamento
mais moderno, mais diferenciado pra uma pea porque a engenharia j foi no arroz com feijo,
ento assim, no d tempo de a gente propor uma coisa nova... a gente conhece acabamentos
diferentes,maspra...[pausa]agenteteriaqueterumgrupo,umtimeemavanadopraviabilizar
[...]

D6[...]teriaqueserumaconversadeigualpraigual,notemumtermoqueeupossotefalar
assim,masdeveriaterassim......osprodutos,osnovosprodutose...asnovasdireesdecriao
deprodutodeveriamserconversadosdeformaigualeentrenstambm,entreengenharia,design
emarketing...eaquiloqueeutefalei,noexisteaindamuitoisso

D7[...]achoquerealmenteainteraodeveriaaconteceremtodooprocesso,enodeixarem

170

momentosespecficoscomoterummomentopraarteagora,depoisvocvaiterummomentopra
resolver os problemas ... matemticos, os problemas exatos, e depois l na frente voc tem
dificuldadecomosproblemasdecustos.Euachoquevocdeixariadeterproblemasnafrentese
todomundoseconversasseantes,nocomeodetudo.Eissovaleprocomeo,meioefimdoprojeto
dequalquerforma

D8[...]euachoquetemquesersvezesatmais...maisconectado,maisligadodoquehoje
[...]algumasvezesagentevqueideiasqueagentegostariamuitodelevarfrenteeelasnoso
levadas,emseguidaelassoapresentadasnomercadoporoutra...poralgumconcorrentequefor

ndice:
2.Criaodeumaequipedepesquisaemdesignavanado(laboratriodeinovaointernoao
departamentodedesign)

Indicadores:
D2 [...] Ento, ideal, que at seria meu sonho de departamento [risos] seria a gente poder
trabalharemavanado...eaquinaM1infelizmentenonossodepartamentoacoisa...sopoucas
pessoasaindaprotantodeprogramasglobaisqueagentetdesenvolvendo,agentenoconsegue
trabalharemavanado... sem t trabalhandoproprograma [...] O ideal seria que agente pudesse
antes, de chegar um programa, ou ter uma pessoa, um time, ou a gente mesmo na folga de um
programaprooutroqueatentonuncaacontece...seriaagentedesenvolveremavanadocoisas
que olha tem essa tendncia... como que eu posso fazer pra que... ... pra aplicar isso em um
programareal

D5 [...] da gente ter como se fossem pequenos grupos multifuncionais que conseguissem
anteciparprojetos...enessaantecipaofazerumpoucodessesprocedimentoscriativos,devocali
comear com uma ideia que no necessariamente uma ideia de carro [...] Ento assim, tentar
pensarnesseprodutonodeumaformatoimediatacomoagenteprecisaporquestodeprazo
mesmo,devocteroiniciomeiofimdeumprojetoederepentevocprecisachegarnumresultado
final muito rapidamente e voc no tem tempo de ultrapassar o obvio. Ento eu acredito que
deveriaassim...seriamuitointeressanteagenteterrealmenteassimcomosefosseumcentrode
designavanadosabe?Noqualvocpossadeslancharcomnovasideiasmasassim,tendoosuporte
detodasessareasquesovitais

ndice:
3.Reconhecimentododesigncomocentrododesenvolvimentodeprodutos

Indicadores:
D3 [...] o designer sempre o primeiro da fila. Ele o cara que comea com todo o
desenvolvimento[...]odesigneuvejocomoocentrodetodoodesenvolvimentodeumproduto,ele
estnocentro.Eleapartequeaglutinaosdesejosdetodasasreas,eleoaglutinador,eporisso
mesmo ele importantssimo e por isso mesmo o designer tem uma responsabilidade cada vez
maior...dentrodaindstria.Issomuitodifcilde......[pausa]dacompetnciaque...euvoltoa
insistir nesse ponto, os designers esto muito pouco preparados quando eles saem da escola. A
escola ela abrange o assunto design de uma maneira muito superficial, e muito acadmica vamos
dizerassim

D4[...]euachoquenofuncionaumdesignerqueficaenclausuradonodepartamentodedesign,
ele tem que t o dia inteiro negociando, conversando com marketing entendendo todas as
expectativas e unindo o desenvolvimento porque se isso vai muito pra uma rea ou pra outra o
produto vai perdendo qualidade, ou vai perdendo preo [...] o designer tem que se envolver nos
processosdacompanhiapraqueoprodutoganhe,praqueoconsumidorfinalganhe

D6 Normalmente assim: o presidente estipula uma verba; passa isso pra engenharia; a

171

engenhariausaessaverbaeoquesobraelapassaprodesignsobrouissoaquievocstemquese
virar. E no assim... t... eu acho que a conscincia de design j tem que partir direto da
presidncia, e ela distribuir de forma igual essas metas pra que todas as reas trabalhem em
conjuntoprachegarnumprodutofinal

D7 [...] acho que se tivesse um pouquinho mais de interao das exatas no comeo voc se
balizaria um pouquinho melhor pra que seu trabalho no fosse rejeitado por conta de ele estar
avanadodemaisporexemplo,ounocasomaisprafrentecomoexatamenteocontrrio,setivesse
um pouquinho da arte inserido nas dificuldade tcnicas, nas pessoas que vo t executando essa
tcnica com voc, especialmente engenheiros, eu acho que voc poderia tambm extravasar,
puxar... passar um pouquinho das bordas deles por causa de um pensamento tambm to
quadrado

D8[...]entoeuachoquederepenteseagentetivessetodaaquelaimportnciaqueemoutros
lugaresagentejv,emoutrospasestal,talvezagentefosselevadomaisemconsiderao

Apartirdaconstataodasinterfernciasefetivasdasdemaisreasemvriasetapas
doprocessodedesigndeautomveisinclusiveemnveisdecisriososprincipaispontos
os quais poderiam ser melhorados visando uma interao desejvel, segundo cinco dos
entrevistados(D1,D2,D6,D7eD8),passamporumamaioraberturaporpartedasdemais
reas em relao ao design e seu papel dentro das companhias. A fala de D6 enfatizou a
necessidade das relaes e decises serem tomadas de maneira mais igualitria ou ao
menosmaiscolaborativanasmontadoras[...]teriaqueserumaconversadeigualpraigual,
notemumtermoqueeupossotefalarassim,masdeveriater,assim......osprodutos,os
novos produtos e... as novas direes de criao de produto deveriam ser conversadas de
formaigualeentrenstambm,entreengenharia,designemarketing...eaquiloqueeu
te falei, no existe ainda muito isso. Tal posicionamento foi compartilhado por D7, ao
refletir Eu acho que voc deixaria de ter problemas na frente se todo mundo se
conversasse antes, no comeo de tudo. E isso vale pro comeo, meio e fim do projeto de
qualquerforma.
Tambmfoidestacadaaimportnciaqueteriaparaaprticadeprojetoacriaode
uma equipe de pesquisa em design avanado ou um laboratrio de inovao interno ao
departamento de design (D2 e D5), o qual trabalhasse antecipadamente na pesquisa a
viabilizao de novos materiais, acabamentos e tecnologias, considerando tambm as
necessidades e limitaes das demais reas tal equipe de pesquisa teria entre seus
profissionais designers e um membro representante de cada uma das demais reas
envolvidasnoprojetoobjetivandoequacionarcomantecednciapossveiscomplicadores.A
fala de D2 refletiu tal necessidade [...] Ento, ideal, que at seria meu sonho de

172

departamento [risos], seria a gente poder trabalhar em avanado... e aqui na M1


infelizmente no nosso departamento a coisa ... so poucas pessoas ainda pro tanto de
programas globais que a gente t desenvolvendo, a gente no consegue trabalhar em
avanado[...].TambmD5identificouacriaodogrupodepesquisacomoumfatorque
melhoraria as relaes interdisciplinares no decorrer do projeto: [...] eu acredito que
deveria assim... seria muito interessante a gente ter realmente assim como se fosse um
centro de design avanado sabe? No qual voc possa deslanchar com novas ideias mas
assim,tendoosuportedetodasessareasquesovitais.
Esse posicionamento por parte dos designers, em relao ao tema 2B Interao
desejvel entre o design e as demais reas sinaliza uma predisposio para o
desenvolvimento de uma prtica mais aproximada entre as diferentes reas no
desenvolvimentodoprojeto.Aintenodosdesignersemtomarpartededesenvolvimentos
e pesquisas futuras por meio da estruturao de uma equipe de pesquisa em design
avanado ou um laboratrio de inovao, indica que a materializao desse
centro/laboratrio,dentrodosestdiosdedesign,podefomentarumaprticaprofissional
diferenciadaemaisprximarealidadedousurioesmudanasdeprojetodemandadas
pelosmesmos.
Nesse cenrio, tambm competncia dos designers manter uma postura
profissionalaqualreflitaemumaprticatransformadoraefavoreacomqueocampodo
design adquira o reconhecimento necessrio, no desempenhando uma atuao passiva,
sendopermeadopelasdemaisreascomoocorreatualmentemastambmpermeando
as demais, estabelecendo trocas constantes, com vistas a expandir seu alcance e sua
atuao,comodestacaDahlstrom:

O designer tambm deve almejar influir mais na engenharia do processo de


desenvolvimento de novas tecnologias e novos materiais. Historicamente, novos
materiais e tcnicas tm um efeito direto na evoluo da rea; a utilizao de
conhecimentos e tecnologias caractersticas de outras reas um dos aspectos
clssicos da interdisciplinaridade do design. No futuro, o design passar a fazer
partedeumaequipedepesquisaquetentaralargarsuasfronteiras,nabuscade
novos caminhos que auxiliem as empresas a servir melhor seu usurio final, com
ergonomiaesustentabilidade,adaptandomateriaisexistentesaodesenvolvimento
denovosprodutos.(DAHLSTROM,2006apudSILVAetal.,2012,p.47).

173

Osparticipantesrevelaramaindaque,paraumaprticadesejvel,seriaimportante
o reconhecimento do design como centro do desenvolvimento de produtos, o qual, de
maneirainterdisciplinarcoordenariaoprocessodedesign(D3,D4,D6,D7eD8),aoqueD3
inferiu [...] o designer sempre o primeiro da fila. Ele o cara que comea com todo o
desenvolvimento [...] o design eu vejo como o centro de todo o desenvolvimento de um
produto, ele est no centro [...]. O participante ainda destacou novamente a formao
acadmicacomodeficitria,nosentidodeprepararodesignerparatalatuao[...]epor
issomesmo,odesignertemumaresponsabilidadecadavezmaior...dentrodaindstria.Isso
muito difcil de... ... [pausa] da competncia que ... eu volto a insistir nesse ponto, os
designersestomuitopoucopreparadosquandoelessaemdaescola.Aescolaelaabrangeo
assuntodesigndeumamaneiramuitosuperficial,emuitoacadmicavamosdizerassim.
O entrevistado D6 afirmou que tal reconhecimento no ocorre nas montadoras na
atualidade,comoenunciou:Normalmenteassim:opresidenteestipulaumaverba;passa
isso pra engenharia; a engenharia usa essa verba e o que sobra ela passa pro design
sobrouissoaquievocstemquesevirar.Enoassim...t...euachoqueaconscinciade
designjtemquepartirdiretodapresidncia,eeladistribuirdeformaigualessasmetaspra
que todas as reas trabalhem em conjunto pra chegar num produto final. Tambm D8
enfatizouanecessidadedeummaiorreconhecimentoparaumaprticainterdisciplinarmais
adequada[...]ento,euachoque,derepentese,agentetivessetodaaquelaimportncia
queemoutroslugaresagentejv,emoutrospasestal,talvezagentefosselevadomais
em considerao. A atuao do designer envolve o estabelecimento de relaes com um
amplo espectro de profisses visando a soluo de problemas complexos ligados
produo. Assim, sua atuao, de acordo com Ono (2006), no deve ser relegada a uma
participaofinal,comoumapndicenodesenvolvimentodeprodutos,antes:

[...] deve interagir com as vrias reas e fases envolvidas, de modo a, alm de
atender requisitos como os de qualidade e custos, otimizar os processos de
fabricao, necessidade que surge da concorrncia capitalista de reduzir os
procedimentos e as dificuldades dos processos de transformar os produtos. Para
tanto,odesignerdeveobservartantoomicro,quantoomacroambienteemque
se insere o produto, ou seja, tanto o usurio, o consumidor, a empresa, os
fornecedores, os intermedirios, os concorrentes, quanto a dimenso social e
cultural, em um sentido mais amplo, a ecologia, a economia, a tecnologia, a
legislaoeapoltica.(ONO,2006,p.49).

174

Aimportnciadeodesignestarintegradosdemaisreasdemaneiracolaborativa
dependetambmdoempenhodaempresaemestruturarseusdepartamentosdemaneira
que sejam favorecidas estas integraes, respeitando, contudo, a autonomia e as
potencialidadesdecadasetorenvolvidonoprojeto,diminuindoacentralizaodedecises
combaseemaspectosadministrativos,comodestacadoporLandim:

O design como atividade interdisciplinar ter mais chances de sucesso em


empresas em que a integrao organizacional prevalea. Do contrrio, o design
ter grandes barreiras em uma empresa com grande estrutura burocrtica, com
uma minuciosa diviso de trabalho e com elevada centralizao das decises
acumuladasemsuacpula.(LANDIM,2010,p.138).

Assim,paraumaprticainterdisciplinarefetiva,tornasenecessrioumamodificao
dos padres organizacionais estabelecidos pelas empresas. Fazse imperativo tambm que
no apenas os designers busquem a integrao no diaadia, mas que o ambiente
corporativofavoreatalprtica.

5.1.2.3Categoria3:Autonomia,desafiosemelhoriasnaprticaprofissionaldodesignerde
automveisbrasileiro

Acategoria3compostapelasquestesdenmerocinco,seisesetedaentrevista
aplicada.Damesmamaneiraquenascategoriasanteriores,seustemasforamrepresentados
pelocontedoprincipaldecadaumadestasquestes,definindoseemseguidaashipteses
eobjetivos,eposteriormenteelaborandoseosndiceseobtendoseosindicadores.
Tema3A:Aautonomiadosdesignersautomotivos
NoQuadro6possvelobservarosndiceseindicadoresobtidos,referentesaotema
3A.
Quadro6ndiceseindicadoresoriginadosdoTema3A
ndice:
1.Submissomatriz(pontospositivosenegativos)

Indicadores:
D1 [...] a gente tem uma autonomia, mas ao mesmo tempo a gente responde numa estrutura
muito maior [...] a parte boa que a parte dessa exposio mesmo de voc trabalhar num nvel
muito maior, de um produto que vai alcanar muito mais gente. Alcana milhes de pessoas no
mundointeironosummercado,ento...esseoladopositivo.Oladonegativoquesvezes
vocacabatendoqueseguirodirecionalquenemsempreoagradvel,assim,pragentedentroda
nossacultura,masfazpartedotrabalhoreceberessetipodeinformaosabe

175

D2[...]estamosmostrandopromundoqueagenteconseguefazer...entopodeserqueanossa
autonomia cresa, mas falando de procedimentos de programa global, a gente sabe que pitacos
viroeodesignerquetrabalhanoramoautomotivotemqueteressahumildadedeouvircriticade
tudo que lado, de ouvir opinies divergentes, e conduzir o desenvolvimento da melhor forma
assim.Noquevoctenhaquecederatodoequalquercomentrioassim,massevoctemtodoo
direcionalbaseadonumapesquisaquejustifiqueoporququevoctindo,entovocmostraqual
que a tendncia e justifica, mas que nem sempre, nem toda a batalha voc vai ganhar, vai ter
batalhaquevocvaiperderque...boralquenofinaldascontasvaidarcerto

D3Naverdadeaautonomiamuitorelativa,porqueamaioriadascompanhiastem...porserem
companhias estrangeiras, elas deveriam, como no caso da minha companhia, ela, sendo a dona,
ela...definealinhade...oconceitodedesign,alinhadedesign.Entoessaautonomianossa,no
que uma autonomia pequena, mas ns somos ferramentas dentro dessas mquinas de
desenvolvimentodeautomveisequeseguemumalinhadeterminadapelamatriz

D4[...]achoqueumarelaodialtica...porumlado,todaaindstriamultinacionaldepende
bastantedamatriz,masporoutroladoissogerabenfciocontrriotambm.Entoaomesmotempo
que os designers dependem da aprovao da matriz eles tambm levam novidades que so
implementadasl,entopassaaserumatroca...nosum...simplesmenteumadependncia,
masdomeupontodevistaumatroca

D5[...]entoagentesempreprecisa...submeterostrabalhoslideranaprapoderassim,ver
se no tem nenhum fio solto no sentido de ah ser que aquele carro que a gente j tem no
mercado,eaentrandocomessedanoportfliodaquiXanosserqueissodaivaificarcompatvel
comaidentidadequeagentequerimprimiraquinoBrasil?

D6Olhacomplicadoissoporqueexisteumavisoassimumpoucoglamurosaeromnticade
que o designer que fez aquele carro, ahh o designer criou. Na verdade isso no existe em
companhianenhuma,emnenhumlugarnomundo.Oquevoctemumadiretoria,voctemuma
identidade que voc tem que seguir [...] e ento ns temos autonomia de propor o que a gente
quiser,squeobviamenteoqueagentepropetemqueseguiruma...umalinhaderaciocnioque
jmeioacertadadentrodacompanhia,enofinaldascontasquemescolheoSr.Diretorento
[...]

D8Claroquealgumacoisa...fazparteda...damatriz,anaveme[...]

ndice:
2.Tomadadedecisoemnveisquedesconsideramodepartamentodedesigneseusprofissionais

Indicadores:
D6Entonaverdade......nstemosmaisqueobedecerordens.Odiretordecidequeagente
temqueseguiraquelalinhaeagentemeioquevairefinando...nssomosa...comoeucostumo
brincarlnaM3,nssomosamoquemoveomouse[risos]Naverdadeagentefazoqueochefe
manda,obedecequemtemjuzo

ndice:
3.Autonomiasatisfatria

Indicadores:
D3 [...] ns conseguimos hoje, depois de muito trabalho junto matriz, de ter uma voz ativa.
Porque eles mesmos esto percebendo que impossvel voc fazer carro no Brasil se voc um
cidado [cita a nacionalidade da empresa],que vive em [cita o pas deorigem da empresa] e tem
umaviso[citaanacionalidadedaempresa].impossvel,porqueexistemcertascaractersticasque
sseaplicamapasescomooBrasil

176

D8 Eu vejo que a gente tem uma autonomia bem satisfatria, porque um... um... ramo o
Color&Trimqueelemuitomaisligadospeculiaridadesdolocal

ndice:
4.Autonomiainsatisfatria

Indicadores:
D1[...]ento...essaquestoqueeudissequeagentetemqueseexpornomercadoglobaldentro
...deumaempresamultinacional,temsidoassim,agentetemumaautonomia...temquecriaras
coisas, mas tem muito direcional que vem de fora pra justamente t alinhado com a marca toda
sabe?Agentenocriamaisumprodutobrasileiro,agentecriaumprodutomundial...ento,assim
fogedombitopasassimsabe?[...]

D2Ahh...eudiriaqueainda...aindanottotalmentesatisfatriapelofatodequepelomenosna
M1 t, programas globais algo muitonovo aqui t, epra o [citaum modelo recm lanado pela
empresa] foi o primeiro programa global, o... eu falo os cdigos [risos], o [cita novamente o
modelo],onovo[citanovamenteomodelo]quetlanando[...]Achoquehojeaconfianaainda
precisa crescer, a autonomia precisa aumentar, muito difcil, muito difcil dizer que existe
autonomia completa, porque, ... uma... so... os gostos s vezes divergem de uma regio pra
outra e quando voc fala em programa global, o mundo inteiro dando pitaco [risos]... at gente
queno...ocarronovailanarnaquelaregio,mascomosopessoaschavenodesenvolvimento
doprodutoelastambmvodaraopiniodelas,porqueelasnoestoacostumadasporexemplo
comumcarroBouumcarropraregio...deBrasil,Chinaendia,algumseildaEuropaquet
acostumadocomaquelamentesupertop,comcoisassuperassim...tambmdpitaco,entoassim
falaremautonomiaaindaumpoucocomplicado

D5[...]aautonomiaelamdia,porqueassim,vocsempretemumescopo...entovocpode
propor,vocpodetrazernovasideias,masnoadianta,aquelamarca,elazelaporumaidentidade,
entoassimocuidadomuitogrande

D6[...]curiosoporqueagenteacompanhamuitoassimnasmdias,notciasetudoomaisea
gentesemprevocomentriodaspessoasquandosaiumcarro,enormalmentequandoopessoal...
quandoocarronoagradaopblico...opessoalcaimatando...porqueodesignerquedesenhou
essecarrodeviatbbado...porqueodesignerdaM3maluco,porqueodesignerdaM3nosei
oque...enoassim.Quemfazocarroodiretor,seocarrosaiufeiooubonitoquemfezfoipor
gosto e ordem do nosso diretor! [risos] Ento a gente no tem essa autonomia que as pessoas
acham que a gente tem... de desenhar o que a gente quiser. So projetos que envolvem milhes,
bilhesdedlares,e...ningumvaisermalucodedeixarnamodeumcaraspraelefazeroque
quiser

ndice:
5.Aautonomiacomoestratgiadaempresa

Indicadores:
D3[...]issodependedecadacompanhia...dafilosofiaeestratgiadecadacompanhia[...]

D7[...]jportertrabalhadoemduasempresasdiferenteseupossotedizerquevariamuitoda
polticadaprpria empresa. mais uma viso do seuchefe... sobrecomo gerir opessoal dele,de
gerirdeacordocomapoliticadaempresa,dedesign,doquepropriamentedaprofissoemsi[...]
voc no tem uma... essa liberdade ela no t atrelada na verdade profisso de designer
automotivomastmaisdeacordocomacasaquevocestinserido

177

Questionados sobre o nvel de autonomia dos designers no exerccio profissional


dentro dos limites possveis em uma empresa multinacional a maioria dos entrevistados
(D1, D2, D3, D4, D5, D6 e D8) caracterizou uma prtica submissa matriz da empresa,
condioestaqueapresentapontospositivosenegativos.
ParaD1,[...]agentetemumaautonomia,masaomesmotempoagenteresponde
numaestruturamuitomaior[...].Nestesentido,D3visualizaumprovvelcrescimentoda
autonomia por parte dos designers [...] estamos mostrando pro mundo que a gente
conseguefazer...entopodeserqueanossaautonomiacresa.
Embora a submisso matriz seja um posicionamento previsvel dentro de uma
corporaomultinacional,odesignnoseestabeleceuaindacomoumareaqueparticipae
tem condies de influenciar no nvel decisrio mais alto da empresa, como relatou D6
Olhacomplicadoissoporqueexisteumavisoassimumpoucoglamurosaeromnticade
queodesignerquefezaquelecarro,ahhodesignercriou.Naverdade,issonoexisteem
companhianenhuma,emnenhumlugarnomundo.Oquevoctemumadiretoria,voc
temumaidentidadequevoctemqueseguir[...]eentonstemosautonomiadeproporo
queagentequiser,sque,obviamente,oqueagentepropetemqueseguiruma...uma
linhaderaciocnioquejmeioacertadadentrodacompanhia,enofinaldascontasquem
escolhe o Sr. Diretor ento [...]. Essa realidade tambm discutida por Heskett (2006)
paraquemsovariadasasfontesqueoportunizamourestringemaatividadedodesigner
entreestasogostopessoaldosresponsveispelaaprovaodeprojetos:

Anaturezaexatadesseprocessodedesigninfinitamentevariadaeportantodifcil
de resumir em numa simples frmula ou definio. Pode ser o trabalho de uma
pessoaoudeumaequipetrabalhandoemcooperao;podesurgirdeumsurtode
intuiocriativaoudeumjuzocalculadobaseadoemdadostcnicosepesquisade
mercadoouatmesmo,comosustentamalgunsdesigners,serdeterminadopelo
gosto da mulher de um gerente administrativo. Restries ou oportunidades
podem ser fornecidas, entre outros fatores, por decises comerciais ou polticas,
pelo contexto organizacional em que um designer trabalha, pelo estado do
material disponvel e pelas instalaes de produo ou por conceitos sociais e
estticospredominantes:avariedadedecondiespossveisimensa.(HESKETT,
2006,p.10).

Almdestesfatoresomesmoparticipante(D6)enfatizouofatorecorrentedeque,
em ocasies s quais envolvem tomada de deciso em relao ao projeto, por vezes
desconsiderase as indicaes dos designers e do departamento de design: Ento na
verdade......nstemosmaisqueobedecerordens.Odiretordecidequeagentetemque

178

seguir aquela linha e a gente meio que vai refinando... ns somos a... como eu costumo
brincarlnaM3,nssomosamoquemoveomouse[risos].Naverdade,agentefazoque
ochefemanda,obedecequemtemjuzo.Talposturaporpartedasdiretoriasdasempresas
revelaareticnciacomqueasmesmaslidamcomodesigncomopartedodesenvolvimento
estratgicodacompanhia,sendoosetorporvezesvistocomoumcorpoestranhodentroda
gestoempresarial.Essadificuldadequeocampoeseusprofissionaisenfrentamtambm
objetodereflexonaliteratura,comoressaltadoporSilvaetal:

De maneira geral, o design est no fogo cruzado entre interesses polticos,


empresariaiseosdapopulaoconsumidora,semapoiodenenhumdoslados.O
designcontacomumapoiorestritodoEstado,aindavistocomocorpoestranho
nagestoempresarial,enotemumatradioparasustentlo;muitasvezes,no
nem reconhecido pela cultura nacional como linguagem particular. Cada vez
mais,utilizadocomoinstrumentoparaavenda[...].(SILVAetal.,2013,p.28).

Doisdesigners(D3eD8)declararamsersatisfatriaaautonomiadentrodaempresa
emquetrabalhamcomoexplicitouD3:[...]nsconseguimoshoje,depoisdemuitotrabalho
juntomatriz,deterumavozativa.Equatrodelesdeclararamserinsatisfatrioonvelde
autonomia (D1, D2, D5 e D6), seja por conta do crescimento de projetos globais ou pela
reticncia da gerncia em relao ao design confiana esta prejudicada pelo j
apresentadofatordeareadodesignserrecentefrentesreasmaistradicionais,asquais
recebemmaiorconfianaporpartedosadministradoresediretores.
Neste sentido, D2 destacou: Acho que hoje a confiana ainda precisa crescer, a
autonomia precisa aumentar, muito difcil, muito difcil dizer que existe autonomia
completa,porque,...uma...so...osgostossvezesdivergemdeumaregiopraoutrae
quando voc fala em programa global, o mundo inteiro dando pitaco [risos]... at gente
que no ... o carro no vai lanar naquela regio, mas como so pessoas chave no
desenvolvimento do produto elas tambm vo dar a opinio delas [...]. Tambm D6
complementou, enfatizando que a configurao final do veculo muitas vezes depende
principalmente das escolhas do diretor [...] normalmente quando o pessoal... quando o
carronoagradaopblico...opessoalcaimatando...porqueodesignerquedesenhouesse
carrodeviatbbado...porqueodesignerdaM3maluco,porqueodesignerdaM3no
seioque...enoassim.Quemfazocarroodiretor,seocarrosaiufeiooubonitoquem

179

fezfoiporgostoeordemdonossodiretor![risos]Ento,agentenotemessaautonomia
queaspessoasachamqueagentetem[...].
Ainda dois outros profissionais (D3 e D7) declararam ser o nvel de autonomia
dependentedaestratgiadaprpriaempresa,comopdeserverificadonafaladeD3:[...]
isso depende de cada companhia... da filosofia e estratgia de cada companhia [...]
posicionamento compartilhado por D7: [...] j por ter trabalhado em duas empresas
diferentes eu posso te dizer que varia muito da poltica da prpria empresa. mais uma
visodoseuchefe...sobrecomogeriropessoaldele,degerirdeacordocomapoliticada
empresa,dedesign,doquepropriamentedaprofissoemsi[...].
Nestesentido,algunsavanostmsidoobtidosealgunsestdiosinstaladosnoBrasil
tm conseguido participar de projetos, bem como exportar designers no sistema de
intercmbiocomamatriz.Estessoganhosimportantesparaummaiorreconhecimentoe
consequentepossvelampliaodaautonomiaedoespaododesigndentrodasempresas,
espaoesteoqual,deacordocomMozotaetal.(2011),ilustraamissoqueodesigntem
naquelacompanhia:

O espao do design na estrutura organizacional e a quem o departamento


respondeilustramamissododesignemtermosdeestratgiaempresarial.Ouas
responsabilidades pelo design so atribudas a um departamento que impe sua
viso a outros, ou a cooperao entre departamentos estimulada, bem como a
independncia do departamento de design dentro da estrutura da empresa.
(MOZOTAetal.,2011,p.260).

Observouse,portanto,apartirdasfalasdosparticipantesqueemboraodesignseja
imperativo para o sucesso de um produto complexo como o carro em um cenrio de
competioglobal,aindahmuitoaserfeitoporumaautonomiaparticipativamaisampla
dentrodasempresas.
Tema3B:Desafiosdaprofisso
EncontramseorganizadasnoQuadro7osndiceseindicadoresreferentesaotema
3B.
Quadro7ndiceseindicadoresoriginadosdoTema3B
ndice:
1.Processodecriaoeseusdesdobramentostcnicos

Indicadores:
D1[...]apartedacriao,queinerenteaprofisso,vocsemprevaiterqueteresempre

180

umdesafiovocbuscaronovo...ento...vocnuncavaificarrefazendooquevocjfez,cadadia
vocvaiterquecriarumacoisanovaeseexercitarpraisso,praviabilizarisso

D3[...]oprincipaldesafiododesignerodeconseguirsemprerenovaroDNAdamarca.difcil
decompararassim...mashojeemdiaoprincipaldesafionofazerumaesculturamirabolante...
porque cada marca tem o seu carter e a sua filosofia e o designer o responsvel por isso. o
responsvelporfazeressa...essafilosofiaestarsempreemevoluo,masnuncaperderdevistao
DNAdamarca,aquiloquemaisimportante...aquiloqueamarcarepresenta

D8 [...] A prpria questo de t muito dentro, muito vinculado indstria, mas isso no em
todososcasos,temcasosqueoescritriodedesignumpoucoseparado.Issotemvantagens,que
agentetaquivendooprocessoprodutivo,aqualquermomentoeuvoualievejoocarronalinha
saindoetal,masaomesmotempoessaexignciadafbricaemsi,queeuvejoqueodesignerele
precisaumpoucode...deestarnarua,deestarconvivendo,deestarvendooutroscenrios.Ento
issoeuachofundamentalpragentedarumaventilada[...]...pesquisa.Issooprofissionalcriativo
emgeral...precisadeambientesdiferentes,precisadessetipodeestmulo...isso

ndice:
2.Limitaestcnicasedecustonabuscapelaviabilidadedeprojetos

Indicadores:
D1Pramimpessoalmenteosdesafiosso...hojeemdiasomaistcnicosassim,almdacriao
voctemmuitodesafiotcnicopraconseguirrealmente...noimpor,masconseguirviabilizaroque
voctpensando.Entoissoqueumdesafioquevocvai...comotempovocvaiagregando
conhecimentoeissovaiteajudandonasdiscusses[...]

D5 [...] hoje assim um grande desafio voc conseguir inovar, sendo que voc de repente no
temaliumrecursomuitoaltoprainvestirnaqueleprojeto

D6EntopramimachoqueodesafiomaioraquinoBrasilagenteconseguirfazerumcarro
[pausa]almdasexpectativasdoconsumidor.difcilagenteconseguirjustificarpranossadiretoria
prapresidncia,oqueforquenstemosqueiralmdoqueexistehoje[...]Agentetenta,quando
sai um programa novo olha vamos fazer um carro novo e a vem aquela lista de contedos e
nossa que bacana!. A vem um monte de coisas, um monte de acessrios, um monte de cosias
novaseaagentecomeaadesenhar...eanoseioququefazemlnadiretoria,napresidnciae
da ahh cortaram isso aqui... olha agora no tem mais o paralamas, agora s farol e para
choque... ahh no... agora no tem mais o farol agora s o parachoque. Ento vai sabe... vai
semprecortandoagente,semprepodandonossacriatividade,anossavontadedemostraralgonovo
e a gente acaba sempre oferecendo um produto que a gente sabe o potencial. Por questes de
custos,essacoisa,essadoenadecarrosemergentes

ndice:
3.Pressoporinovaoemcurtoespaodetempoparadesenvolvimentos(devidoprincipalmente
competionomercado)

Indicadores:
D2 [...] os desafios acho que... um pouco isso que eu falei assim [pausa] , de trabalhar com
muita informao, ademanda muitogrande, existe uma srie de burocracias internas, decoisas
que as vezes desanimam o profissional de design que quando entra imagina que criao,
desenvolvimento,noseioque,eno...temmuitareunioprafalardetimingotempoquevoc
temquedesenvolverumacertacoisa,ouprafalardeumasriedecoisasmaisengenharsticasda
coisaequeodesignemsi,acriao,osbriosdacoisamaravilhosaficameiodelado[...]

D4Hojeeuvejoqueacompetitividade,entojustamentetodosesses...todaamovimentaodo
mercadoglobalhoje...todaaindstriaquemovidapramobilidadevemcrescendomuitonoBrasil

181

hojetemaentradadevriosnovoscompetidoreseissocriouumaloucuraporlanamentosnovos,
porum...naminhaopiniotambmumexagerodelanamentosedenovidadesquenemsempreo
prprioclienteacompanha

D8 [...] eu ia falar que o primeiro entrar no mercado... [risos] ... que ainda mais restrito
lgico.Ento,at pra comear a maioria t em So Paulo, ento a gente j v que mais restrito
realmente,noemtodolugarquevocencontra....bom,depois,achoqueestasquestesassim,
deestarligadoaumaindstriaquemuitoexigente,isso...claro...entocomrelaoaprazosa
qualidade,masissoacabatambmnosmelhorandocomoprofissionais

ndice:
4.Alinhamentodetodasasvariveisdeprojeto(foconousurio;aspectosmercadolgicos;
interfernciadeoutrasreaseprocedimentosburocrticos)

Indicadores:
D2Ento,odesafioquecomtodoessetempo,comtodasessasburocraciaseprocedimentos
internosvocaindaconsigafazerumbomtrabalho.Desenvolverumbomtrabalhocomodesigner,
achoqueissooprincipal.

D4[...]maisdomesmo,entoouavariaodomesmotema,ouentoanteciparlanamento,
e nem sempre t todo mundo preocupado com o consumidor mais a competio em si... ento
acho que o desafio principal esse, no meio dessa loucura toda continuar mantendo foco no
consumidornouso,noconfortoqueoqueinteressanofinaldascontas

D6[...]oquemevemnacabeaagorajustamenteessacoisadainovao.Eutrabalhonuma
companhiaquenaminhaopinioelano...elatemcertomedodeousar,algo...serlder

D8[...]porqueeuvejoqueassim,muitacoisaquevocdesenvolvepracquetemumaexigncia
muito grande, voc vai conseguir desenvolver tambm para outras indstrias que de repente no
temtanta...tantorigordenormaeetc

ndice:
5.Relaesinterpessoais(principalmentecomasdemaisreasenvolvidasnoprojeto)

Indicadores:
D1Edopontodevistadodesigneremsi,assim...nodiaadiamesmo,umpontoqueachomuito
importante a relao pessoal... assim com os outros profissionais. O designer automotivo
principalmente,elenofaz...assim,elenofazumcarrosozinho,impossveldesefazerumcarro
sozinho, ento uma equipe muito grande envolvida e como voc disse uma equipe
multidisciplinar[...]

D5 E um outro desafio muito grande acho que a pergunta que voc fez no comeo. Essa
comunicaodessegrupomultifuncional.Muitasreas...trabalhandojuntas

D7[...]eu,peloqueeuvejo,naminhaopiniodifcilasvezesvoclidarcompessoasqueno
temamesmavontadedefazeraquiloacontecerquevoctemsabe?Voc,cheganumdeterminado
nveldeempolgaoquesvezesmuitosuperioraodeoutraspessoas,evocdependedelaspra
que o seu trabalho v pra frente... tipo... especialmente quando a gente trata com engenharia,
porque engenheiro adora falar que muita coisa no pode, que muitacoisa difcil, e todo mundo
sabequeapesardesecontarissocomoumalenda...nolenda...nofolclore.Agentemesmo,j
chegouempontodagentesaberquecomumpoucodeboavontadevocconseguiriairalm,voc
conseguiriapensarnumasoluoquepudessedarumavoltanaquiloquevocgostaria,naquiloque
fosse um desejo do designer de fazer. Ento eu vejo que tipo... aonde... a dificuldade mesmo
quando voc esbarra em um problema que voc sabe que mais humano do que tcnico, e que
voctdependendodaspessoasquenotemamesmavontadedeprogredir,amesmavontadede

182

fazeraquiloquevocacreditaacontecer

No que se refere aos desafios da prtica profissional, os quais por vezes se


configuram como obstculos, trs participantes identificaram um deles como sendo o
processo de criao e seus desdobramentos tcnicos (D1,D3 e D8 ).A fala de D1 enfatiza
estaquesto:[...]apartedacriao,queinerenteaprofisso,vocsemprevaiterque
teresempreumdesafiovocbuscaronovo[...]. TambmoparticipanteD3destacou
quenafasedecriao,mantersefieleaomesmotemporenovaraoDNAdamarcaum
grandedesafio[...]oprincipaldesafiododesignerodeconseguirsemprerenovaroDNA
da marca [...] porque cada marca tem o seu carter e a sua filosofia, e o designer o
responsvel por isso. o responsvel por fazer essa... essa filosofia estar sempre em
evoluo,masnuncaperderdevistaoDNAdamarca,aquiloquemaisimportante...aquilo
que a marca representa. Ainda D8 referindose ao processo criativo, destacou a
importncia de ao profissional ser permitida a realizao de pesquisas, a explorao de
novosambientes,visandofavoreceroprocessocriativo.
Outros desafios indicados pelos participantes foram as limitaes tcnicas e de
custosnabuscapelaviabilidadedeprojetos(D1,D5eD6).Emtermostcnicos,D1declarou:
[...]almdacriao,voctemmuitodesafiotcnicopraconseguirrealmente...noimpor,
masconseguirviabilizaroquevoctpensando.Ento,issoqueumdesafioquevoc
vai...comotempovocvaiagregandoconhecimentoeissovaiteajudandonasdiscusses
[...].Todososentrevistadossoconscientesdadinmicacapitalista,aqualvisaoaumento
dolucro,tendocomoumdosfatoresfavorveisaestedesempenhoaprogressivareduode
custos. Entretanto, os designers destacaram que muitos obstculos tcnicos e de custos
poderiamserequacionados,visandomelhoressoluesdeprojeto.Afaltadesseempenho
porpartedadiretoriatmresultadonadoenadecarrosemergentes,comorevelouafala
deD6EntopramimachoqueodesafiomaioraquinoBrasilagenteconseguirfazerum
carro[pausa]almdasexpectativasdoconsumidor.difcilagenteconseguirjustificarpra
nossadiretoria,prapresidncia,oqueforquenstemosqueiralmdoqueexistehoje[...]
Entovaisabe...vaisemprecortandoagente,semprepodandonossacriatividade,anossa
vontadedemostraralgonovo,eagenteacabasempreoferecendoumprodutoqueagente
sabeopotencial.Porquestesdecustos,essacoisa,essadoenadecarrosemergentes.

183

A doena de carros emergentes, a que o participante se refere, sustentada no


cenrio brasileiro, no qual dadas as condies econmicas da maioria da populao, os
modelos mais vendidos so os denominados carros populares ou modelos de entrada.
Em geral, os modelos a que se refere D6 so os veculos mais simples do portfolio das
empresas, com motorizao 1.0, sem muitos itens tecnolgicos agregados, podendo ser
equipadosapartirdepacotesdeacessriosopcionais.
Tratandose do projeto destes veculos, qualquer mudana,no sentido de tornlos
maiscompletosoumaisseguros,implicanoaumentodecustoseconsequenteelevaodo
preo final, uma condio problemtica frente ao preo pago pelo brasileiro j bastante
elevado por conta da poltica tributria incidente sobre o produto. Tal poltica alm da
imparcialidade do governo e dos prprios usurios em exigir um produto de qualidade
proporcional ao preo praticado favoreceu durante muito tempo o posicionamento das
empresasemmanternomercadoosmodelosdeentradaobsoletosoumesmodesprovidos
deinovaestecnolgicasedeseguranaelementares.Umexemplodessaposturaficaclaro
quandoat2013itensconsideradosessenciaisparaaseguranadosocupantescomoairbag
efreiosdotipoABSeramvendidoscomoitensopcionaisnomercadobrasileiro.Umgrande
passo para a mudana da legislao vigente foi dado no incio de Janeiro de 2014, ms a
partir da qual, de acordo com as resolues 311 e 395 do CONTRAN, todos os modelos
novos fabricados no Brasil ou importados devero apresentar airbag e freios do tipo ABS
comocomponentebsicodeseguranaenomaiscomoopcional.
AfaladeD6enfatizaaconscinciadosdesignerssobreaqualidadefinaldealguns
dos produtos por eles projetados e mais impactados pelas polticas empresariais vigentes,
nas quais o lucro consta como um dos componentes principais do projeto de veculos. O
posicionamentocontrriodeD6revelaodescontentamentododesigneremestarenvolvido
nessarealidade,tendodeaceitlacomopartedaprticaprofissionaldiria.
Embora as marcas desenvolvam uma poltica de aprimoramento constante dos
veculosesatisfaodoconsumidor,aposturadasfabricantesemmanterprojetosantigos,
realizandomudanasimportantesquandosobpressogovernamentalousocialnouma
exclusividadedaatualidade.ArevistaQuatroRodasdeJaneirode1976,naseodeopinio
doleitortrouxe,acrticadoleitorFernandoCaiuby,oqualrelatoupoca,quecomprouum
Chevette1975estandosatisfeitocomelesobvriosaspectos,pormfoisurpreendidopelo
cinto de segurana ser do tipo abdominal e no de trs pontos modelo mais seguro. O

184

leitorentosugeriuGMquereadequasseosprojetosdoChevetteouaomenosoferecesse
ocintodotipotrspontoscomoopcional.Emresposta,amontadoradeclarou:

Quando escolhemos o tipo de cinto atualmente instalado em nossos veculos,


procuramoscompatibilizarosseguintesfatores:a)potencialdeproteo,b)nus
para os clientes, c) taxa prevista de efetiva utilizao. Concordamos com o seu
leitor e nosso cliente em que os cintos de trs pontos tm maior potencial de
proteo que os cintos subabdominais, mas gostaramos de ponderar que,
infelizmente, seu custo maior e so tambm mais incmodos, fato que
certamente viria aumentar o j elevado ndice de resistncia entre usurios para
sua utilizao adequada. Assim sendo, a instalao deste tipo de cinto s ser
justificvel se pudermos ter certeza de que ir ser usado por um nmero
expressivo de ocupantes dos nossos veculos. Uma legislao especfica e uma
fiscalizao rigorosa da utilizao so, portanto, condies prvias e essenciais
mudanadenossaorientao.(QUATRORODAS,1976,p.6).

Oposicionamentodaempresapocafoiclaro:smudariaoprojetoadequandoo
cintodeseguranacasohouvesselegislaoespecficaparaessefimmesmoqueoobjeto
dacrticadoleitorfosseumitemindispensvel,oqual deveriaseroferecidopelasmarcas
sempredomelhormodeloecomamelhorqualidade.Essecenrioseestendeuatosdias
atuais e tanto o airbag, quanto o freio ABS s sero oferecidos como itens de srie aps
resoluesdoCONTRAN.NomsdeMaiode2013obteverepercussomundialoresultado
dos testes do LatinNCAP Programa de Avaliao de Automveis Novos para a Amrica
LatinaparaoscarrosproduzidosnoBrasil.Ostestesevidenciaramqueoscarrospopulares
produzidos no pas no atendem minimamente a requisitos internacionais de segurana,
sendo que de acordo com os organizadores dos testes os carros mais populares
encontramse cerca de 20 anos atrasados nesse quesito em comparao aos modelos
produzidos dos pases industrializados alm de situarse abaixo dos padres globais. A
justificativa das montadoras para tal desempenho foi de que as mudanas necessrias no
projetoencareceriamoprodutofinal.
Na poca, Alejandro Furas, diretor tcnico dos programas globais do padro NCAP,
declarou: Custo no , nem deveria ser jamais, a justificativa, uma vez que o valor do
mdulodeairbagcompletoparamotoristaepassageiroeinstaladodeUS$70menos
deR$150paraofabricante(inBRITO,2013).Otcnicoaindasalientouqueaculpano
deve ser repassada ao consumidor, o qual vtima sob qualquer ponto de vista, e
prosseguiu:

185

Oconsumidorbrasileironoestacostumadoacomprarcarrousandoasegurana
comocritrio,masnosepodeculplo,umavezquedomodelobsicoepelado
aotopodagama,jequipadocomitensdesegurana,adiferenadevalorespagos
pode variar entre 25% e 30% [...] Mesmo na Europa, onde os preos so mais
justos, o consumidor no cobra segurana, obrigao que do governo e das
autoridades do sistema virio. No Brasil, como o Governo no cuida disso, as
montadorassonegligenteseoconsumidorficasemao.(FURASinBRITO,2013).

Em resposta, atravs de comunicado oficial, o presidente da ANFAVEA, Luiz Moan


YabikuJunior,rebateuascrticasaosveculosproduzidosnoBrasil,destacandoaexistncia
de diversos fatores, os quais influenciam nas altas taxas de acidentes mortais no Brasil,
desdecondiesdasestradas,inabilidadedosmotoristas,almdaprecariedadedoestado
deconservaodosprpriosveculoseeventuaisdesrespeitossinalizaodetrnsito:

[...]Arealidadequemuitosocupantessosalvosexatamentepelaboaqualidade
dosveculosproduzidosnoPas,comaadoodetodososquesitosdesegurana
passivaeativaregulamentadospeloContran.Maisainda:aindstriacumpretodas
asprescriesdeseguranaregulamentadaspelosrgosdegovernoeatestadas
por ensaios realizados conforme procedimentos normatizados e auditveis. As
normasesistemasprodutivosexistentesnoBrasilsoosmesmosadotadospelos
maisavanadoscentrosprodutivos.Comoamaioriadasplataformassomundiais,
as especificaes so idnticas e os cuidados com a produo so os mesmos.
Quandoexistemalteraes,nadenominadatropicalizaodosprodutos,sopara
deixar os veculos ainda mais robustos e seguros para as respectivas aplicaes
(YABIKUinCESAR,2013).

Embora os designers tenham sua atuao condicionada ao limiar entre o que a


legislaosolicitaeoqueaempresaautorizaserfeito,adiscussoreferentequalidadedos
projetos produzidos no Brasil ser sempre salutar, visando adequao dos mesmos no
sentido de atingir os melhores padres estabelecidos na produo de veculos
independentedafaixadepreonaqualomesmosesituaserpopularoudeluxo.preciso
que governo e empresas assumam seus papis e entreguem ao consumidor brasileiro
produtosecondiesadequadosaousosegurodeveculos,semmanteroposicionamento
unilateraldestacadoporLarica:

Cada pas tem sua cultura de mercado, as suas prprias condies


macroeconmicas,asuaconcepodemobilidade,assuaslimitaesgeogrficase
climticas, alm de suas prprias condies de trfego (estradas, densidade de
trnsito, infraestrutura de atendimento etc.). Mas no podemos esquecer que,
acimadetudo,soosinteresseseconmicosdasgrandesmontadorasqueditamas
regraseinfluemnaofertadeprodutos.(LARICA,2003,p.198).

186

A presso por inovao constante em curto espao de tempo para os


desenvolvimentosdevidoprincipalmenteacirradacompetionomercadotambmfoi
indicadapelosparticipantesD2,D4eD8,comoumdesafiodirionaprticadosdesigners.
Nestecenrio,oparticipanteD4declarou[...]todaaindstriaquemovidapramobilidade
vem crescendo muito no Brasil. Hoje tem a entrada de vrios novos competidores e isso
criouumaloucuraporlanamentosnovos,porum...naminhaopinio,tambmumexagero
delanamentosedenovidadesquenemsempreoprprioclienteacompanha.TambmD2
destacouapressodiriacomoumobstculo[...]temmuitareunioprafalardetimingo
tempoquevoctemquedesenvolverumacertacoisa,ouprafalardeumasriedecoisas
maisengenharsticasdacoisa,equeodesignemsi,acriao,osbriosdacoisamaravilhosa
ficameiodelado[...].
Outro obstculo indicado pelos designers (D2, D4, D6 e D8) foi a dificuldade em
alinhartodasasdemaisvariveis,almdacriaoetcnicaquefazempartedoprojeto,tais
comomanterofoconousurio,lidarcomaspectosmercadolgicos,comainterfernciade
outrasreaseprocedimentosburocrticos.OparticipanteD2declarou:Ento,odesafio
que com todo esse tempo, com todas essas burocracias e procedimentos internos voc
aindaconsigafazerumbomtrabalho,pensamentoestecompartilhadoporD4:[...]oua
variao do mesmo tema, ou ento antecipar lanamento, e nem sempre t todo mundo
preocupado com o consumidor. mais a competio em si... Ento acho que o desafio
principal esse, no meio dessa loucura toda continuar mantendo foco no consumidor no
uso,noconfortoqueoqueinteressanofinaldascontas.Estefoconousurioporvezes
negligenciadoprincipalmentepelabuscadalideranademercadoeampliaodoportfolio
frente aos concorrentes como destacou o participante, primordial para um projeto de
design bem sucedido culturalmente e socialmente adequado, que tenha como objetivo
contribuir para a qualidade de vida, dadas as importantes relaes estabelecidas entre
usurioeobjeto:

Osobjetoseasociedademoldamseeinfluenciamseemumarelaodinmicano
processodeconstruodomundo.E,sobesteprisma,cabeaosdesignersconjugar
asuaatitudecriativa,dentrodacomplexateiadefunesesignificadosemqueas
percepes, aes e relaes se entrelaam, no contexto de espao e tempo em
queseinserem,buscandoaadequaodosobjetossnecessidadeseanseiosdas
pessoas, e a melhoria da qualidade de vida da sociedade como um todo. (ONO,
2006,p.47).

187

Tambmreferindoseaoalinhamentodoprojeto,oparticipanteD6indicouomedo
da empresa em inovar como uma outra varivel a ser considerada: Eu trabalho numa
companhiaquenaminhaopinioelano...elatemcertomedodeousar,algo...serlder.
Talposicionamentorefleteumoutroacontecimentomuitofrequentenosetorautomotivo:a
mimesedecomponentesdosconcorrentesmaisfortes,oqueporvezestornaseempecilho
paraotrabalhocriativodosdesignersesuaintenodeinovao.Porfim,osentrevistados
(D1,D5eD7)caracterizaramasrelaesinterpessoaisprincipalmentecomasdemaisreas
envolvidas no projeto como obstculos a serem transpostos no diaadia da profisso,
comoressaltouD5:Eumoutrodesafiomuitograndeachoqueaperguntaquevocfez
no comeo. Essa comunicao desse grupo multifuncional. Muitas reas ... trabalhando
juntas.
Taisrelaesconfiguramobstculonamedidaemqueaaoconjuntadodesigner
com outros profissionais, principalmente no que tange s fases do projeto nas quais h
dependnciadoprimeiroemrelaoaosegundo,impedemoavanodostrabalhos,como
ficouclaronafaladeD7[...]naminhaopinio,difcilasvezesvoclidarcompessoasque
no tem a mesma vontade de fazer aquilo acontecer que voc tem, sabe? [...] A gente
mesmo j chegou em ponto da gente saber que com um pouco de boa vontade voc
conseguiria ir alm, voc conseguiria pensar numa soluo que pudesse dar uma volta
naquiloquevocgostaria,naquiloquefosseumdesejododesignerdefazer.Entoeuvejo
quetipo...aonde...adificuldademesmoquandovocesbarraemumproblemaquevoc
sabequemaishumanodoquetcnico[...].Nestesrudosdecomunicaoentreodesign
e as outras reas, Phillips (2008) versa sobre a necessidade de o designer aprimorar sua
prpriacomunicaonaempresa,utilizandosedelaparapromoveredestacararelevncia
dodesignparaacompanhia:

[...]acoisamaisimportanteaprenderapensarecomunicardemaneiraeficiente.
Essa a principal lio que os designers deveriam aprender. Os designers devem
ter a capacidade de apresentar as vantagens e benefcios do design de maneira
simples, sem usar uma linguagem tcnica ou rebuscada. Para isso, eles precisam
compreender profundamente os objetivos dos negcios e o papel que o design
pode desempenhar nesse contexto. O design deve atuar de maneira positiva,
buscandoparceirosealiadosaolongodetodaaempresa.(PHILLIPS,2008,p.172).

Ainda de acordo com o autor, comum aos demais profissionais admitirem a


competncia dos designers em desenvolver solues estticas, todavia os mesmos no

188

acreditam que os designers possam pensar e atuar estrategicamente, apresentando


soluesadequadassnecessidadesdosnegcios.
Assim,tornasenecessrioaosdesignersadquirircredibilidadeeconfianadosseus
colegas no designers. Neste processo, a comunicao eficiente entre as reas fazse
primordial.
Tema3C:Melhoriasnaprticaprofissional
OQuadro8apresentaosndiceseindicadoresobtidos,referentesaotema3C.
Quadro8ndiceseindicadoresoriginadosdoTema3C
ndice:
1.Comunicaoentrereas

Indicadores:
D1 Pra mim assim, o que dificulta cem por cento as coisas a comunicao. As falhas de
comunicaoprosdesignersassim.Soprojetosgrandesqueagentetrabalhaqueenvolvemmuita
gente,muitodinheiro,temmuitapressoporcausadeprazo,dequalidade,entoqualquervirgula
fora do lugar acaba gerando atraso, acaba gerando estresse, acaba gerando um monte de coisa
que... at tempo de... assim, acaba tirando at seu tempo de criao sabe...porque voc acaba
criando um negcio que no vai funcionar por causa de uma besteirinha sabe? Dai voc tem que
refazer tudo s vezes... ento assim um ponto crtico comunicao. Mas do ponto de vista do
designemsitrabalhando,nodiaadia...achoquenoBrasilemsiagentetemquemelhoraressa
questo de saber trabalhar dentro de uma empresa mundial assim sabe... assim de nvel tcnico,
desdequandovocsaidafaculdadeassim...[pausa]

ndice:
2.Nveldeformaodosdesigners(tcnica;dinmicadeatuaonaindstriaepostura
profissional)

Indicadores:
D1Infelizmenteagentesaidafaculdademuitodespreparado...pormaisqueosalunostenham
boa vontade, tenham vontade de aprender, os professores tenham vontade de ensinar, a gente
muitodefasadoemrelaoaoquesaidasfaculdadesdeforasabe...eujtiveexperinciaemoutros
pases e... e realmente gritante a diferena, a gente aprende tudo na raa... quando consegue
entrarnareaquevoccomea...praticamentecomeadozero

D3[...]ograndedesafioestarpreparadoprapodernegociar,eprapodernegociarporexemplo
comareatcnica,vocprecisaterumconhecimentotcnicoprofundo[...]Entoaprimeiracoisa
formaointelectualetcnicadodesigner.Porqueodesignerhojeemdia...euencaroosdesigners
brasileirosemuitoseuropeustambm,americanos...meio...elesqueremsersuperstars,aprimeira
coisaquetnacabeadeledeserumapessoafamosaporqueeledesigner.Eissoaltima
coisaqueinteressa

D8 Olha eu acho que... ... a gente ainda no construiu muito em termos de histrico e
conhecimento dentro dessa rea de automveis [...] A gente no tem no Brasil algum... sei l um
cursodepeso,algumacoisamaisdedicadaaisso.Noexistemuitoesse...esseembasamento,mas
aomesmotempofunonossacriarisso,porquequemtvivendoacoisaquevaicomearacriar
isso

189

ndice:
3.Pesquisaemdesignavanado
Indicadores:
D2[...]setivesseaquele...seil,ncleodepesquisaqueagentepudessegastarumpoucomais
de tempo apressando esse tipo de coisa, em vez de s... a estrutura eu acho, a estrutura do
departamento tinha que mudar um pouco, a gente separar mais aquilo que seria trabalhar com
design,ouatenderoprograma,e...e...balancearmelhoroteutempo,praquecomodesignervoc
possacriarmais,possafazerumtrabalhomaisrobustodedesign

D5Umacoisaqueeuachoquesempreagregapraqualquerempresa,qualquertimedetrabalho,
independentedoqueeleproduz,euachoquesempreolharpraoquetacontecendonosna
internet,agenteficouumpoucoviciado,agentetemacessoaumportalqueespecificopracaptar
tenncias, mas assim viajar mais sabe, olhar o que t acontecendo na Europa, olhar o que t
acontecendo na sia, ... estudar mais, mas assim no dia a dia muito difcil opinar sobre isso
porque eu acho que o andamento de uma empresa tem a ver muito com a filosofia daquela
empresa

D7 [...] eu acredito que basicamente se voc conseguisse juntar numa mesma empresa ...
pessoasquetrabalhassemvamosdizerassim...deixaeuverseeuconsigomefazerentender,tipose
as diferentes reas da empresa escalassem pessoas que sei l, elas acreditam que so mais
visionriasdentrodecadareapraquetrabalhassemjuntosemmomentosquenaverdadeagente
chama de prprojeto. Eu acredito que isso ajudaria muito e... que as pessoas no estivessem
pensandojustamentenasdificuldadesquevocvaiternoprojeto,esimnasoportunidadesquevoc
vaiterproprojeto

D8[...]umacoisaqueagenteaprende,vaivivendo,vaitendoasexperinciasetudoomais,
masque......vocnoencontramuitoa,apesardeserumaindstriaantigaequedeveriaterum
histrico bem documentado e tudo o mais, eu pelo menos no vejo muito assim. Eu acho que as
informaessvezessoatdifceisdeseencontrar,porquenoforamregistradas

ndice:
4.Foconousurio

Indicadores:
D3[...]Aprofissododesignerumaprofissodura,noficaremcimadeumpalconumshow,
apresentando o produto dele. No, Isso no a misso do designer. A misso do designer ter
conhecimento suficiente pra gerar um produto que possa ser bonito, mas que atenda a todas as
premissastcnicas,demarketing,deproduo,denegcio[...]Eassimqueeuvejoodesigner,o
designernoumsuperstar,muitopelocontrrio,eleumtrabalhadorduroetemqueproduzir,
temquefazerotrabalhodelequemuitoimportanteeoquevaivenderocarro,masquandoele
termina um ele comea outro e isso vai continuar durante toda a vida profissional dele, e poucos
designersfamosos,ocaraquetrabalhounele,quefoil,queralounoestdio,muitopoucosdeles
vochegarasubirnumpalcopraapresentaroproduto

D4Euachoqueexatamentenisso,nodiaadiatodomundocorrendocomodesenvolvimentoe
perdendoofocodoqueoconsumidor.Entoachoqueodesignertemaobrigaodemantera
observao no consumidor. Ento manter a observao e trazer pra companhia. As necessidades
reaisdoconsumidor

ndice:
5.Melhoriadapolticadaempresaemrelaoaodesign

Indicadores:
D4 Ento acho que o desafio e a meta final tem que ser se manter nessa, no simplesmente
continuarfazendo,correndoelanandosemolharpraoquetacontecendodeverdadenodiaadia

190

[...]ostemposdedesenvolvimentosocadavezmenores,aquantidadedelanamentosdeverses
cadavezmaiores,entoassimtemaumentado[apresso]

D6 Olha eu... sinceramente eu no sei porque... essas dificuldades que eu relatei... ela envolve
custo.dinheiro.[...]avontadequeacompanhiatemdecriarumprodutonovo,ento...issoj
uma coisa de estratgia que ainda t muito acima de design, no existe uma soluo mgica.
simplesmente vontade da companhia. De investir entendeu. Estratgia da companhia. O [cita o
nome do presidente da montadora na qual trabalha] eles traam as estratgias deles e isso gera
nossaconsequnciaaquidefazerumcarromelhorouno.Ento...noexisteum...noumacoisa
quetnonossombito,umacoisamuitomaiorentendeu?

D7[...]odesigner...queeuvejoumadasnicasreasquetrabalhamcomoqueaindavaiser,
enquantoasoutrasreasaindaestotrabalhandomuitocomascoisasqueso.
Entoachoqueseil,sevocconseguissejuntarnummesmoambienteprapensarprafrentetodas
asoutrasreasjuntas,euachoqueissoiarealmenteserumdiferencialmuitolegal.Eufaloissono
casodaempresamesmo,queaspessoasnoestoaliparacriardificuldadesoupensarnoquque
hojenopossvel,masquemsabeoququeamanhpodeserpossvel[...]Pravoctrazerparaa
realidade do design as outras reas, porque o que eu falei... eles s... eles s chegam, eles s
entram num projeto quando o projeto t rolando. Os prprojetos, e as coisas que vem antes, os
conceitos bem difcil que voc veja o pessoal de marketing envolvido, o pessoal de engenharia
envolvido, pessoas das reas vamos dizer duras. Eles praticamente nunca to envolvidos em
momentosemque...quepossvelvocviajarnumaideia,quepossvelvocpensaralmcomo
odesignerfazissobasicamentetododia

Uma vez identificados os desafios da profisso, os designers foram questionados


sobrequaisseriamosaspectosaseremtrabalhadosvisandomelhoriadesuaprtica.Um
ponto destacado pelo participante D1 referese melhoria da comunicao entre reas.
Paraele,Pramimassim,oquedificultacemporcentoascoisasacomunicao.Asfalhas
de comunicao pros designers assim. So projetos grandes que a gente trabalha que
envolvemmuitagente,muitodinheiro,temmuitapressoporcausadeprazo,dequalidade,
ento qualquer virgula fora do lugar acaba gerando atraso, acaba gerando estresse, acaba
gerando um monte decoisa que... at tempo de... assim, acaba tirando at seu tempo de
criao sabe...porque voc acaba criando um negcio que no vai funcionar por causa de
umabesteirinhasabe?.Novamenteficaevidenteaproblemticadasrelaesinterpessoais
queinfluenciamnodecorrerdodesenvolvimentodoproduto.
OparticipanteD1aindaprosseguiu,destacandoodficitdeformaodosegressos
doensinosuperioremestaraptosaatuaremumaempresamultinacional:Masdoponto
devistadodesignemsitrabalhando,nodiaadia...achoquenoBrasil,emsi,agentetem
que melhorar essa questo de saber trabalhar dentro de uma empresa mundial, assim
sabe...assimdenveltcnico,desdequandovocsaidafaculdadeassim...[pausa].

191

Onveldeformaodosdesignerslevandoemconsideraoaformaotcnica,a
dinmica de atuao na indstria e a postura profissional tambm foram identificados
pelos entrevistados (D1, D3 e D8) como melhorias a serem realizadas. Sob este aspecto
declarouD1:Infelizmenteagentesaidafaculdademuitodespreparado...pormaisqueos
alunostenhamboavontade,tenhamvontadedeaprender,osprofessorestenhamvontade
deensinar,agentemuitodefasadoemrelaoaoquesaidasfaculdadesdeforasabe[...]
realmentegritanteadiferena,agenteaprendetudonaraa...quandoconsegueentrarna
reaquevoccomea...praticamentecomeadozero.
SegundoestudodeDePaulaetal.(2010,apudSilvaetal.,2012,p.24)oBrasilainda
apresentamuitasdeficinciasnocampodoensinoemdesign,noqualmuitosdocentesou
gestoressemostramindiferentesimportnciadoprocessodecapacitao,resultandoem
umreduzidonmerodemestresedoutoreseemumacargahorriaincipientededicada
pesquisa, tendo como reflexo uma produo acadmica baixa. Para os autores o corpo
docenteestcarentedeestmulos,apoioerecursosparasuaformaopedaggicaesoma
seaistoonmeroreduzidodecentrosdepesquisaseinformaes,almdorestritonmero
de bibliografias especializadas e atualizadas disponveis em lngua nativa no cenrio
nacional.AindadeacordocomSilvaetal.:

Quantoaosdiscentes,omesmoestudodestacaquehumaformaodesegundo
grau deficiente e uma baixa cultura geral, com exceo dos alunos que vm da
camadamaisaltadasociedade.Algunsingressamnocursosemterplenaconvico
daprofisso que escolheram ouas habilitaes disponveis. Somese a isso que a
estrutura oferecida por muitas instituies ainda fraca e criase um ambiente
propcio evaso escolar ou ao abandono da profisso aps o trmino do curso.
(SILVAetal.,2012,p.24).

Importadestacar,entretanto,queaafirmaofeitaporSilvaetalcombaseemDe
Paula et al em relao aos discentes precipitada, ao afirmar que, os alunos carecem de
culturageralcomexceodosalunosquevmdascamadasmaisaltasdasociedade,na
medida em que no h garantias de que a formao dos indivduos abastados supere
sempre a dos menos favorecidos. Da mesma forma, a condio social no determinante
para o acesso e apreenso de saberes relacionados cultura geral. De qualquer maneira,
independente da posio social, a postura discente um fator de grande influncia tanto
paraaprticadocente,quantoparaaformaofinaldoprofissional.

192

TambmCardoso(2012),destacaqueocurrculodoscursosdeensinosuperiorem
designoutroimportantefator,oqualtemconsequnciasdiretasnaformaoresultante
dos futuros profissionais, enfatizando que o empreendedorismo poderia ser mais bem
abordado no ensino do design. Partindo do princpio de que o mercado se faz um
importante instrumento para o suprimento de necessidades e para a adequao de
propostas sociais, e o valor de mercado dos objetos influencia a percepo dos demais
valoresabstratostaiscomoqualidade,belezaemritooscurrculosdoscursosdedesign
devemestaraptosaconsiderartaisfatoresnaelaboraodoscontedosaseremoferecidos
duranteaformaodosalunos,eprossegue:

Noentanto,existemcurrculosdedesignquenocontemplamafacetaempresarial
emercadolgicadocampo,anoserdemodosuperficialeburocrtico.Omercado
assunto digno de ser levado a srio, e reas de estudo como economia,
administrao, sociologia, psicologia e mercadologia (ou marketing) tem
contribuiesimportantesafazernessesentido.(CARDOSO,2012,p.249).

Osproblemasacimacitados,referentesestruturadeensinorefletemdiretamente
no perfil do aluno egresso, impactando o profissional que chega ao mercado de trabalho.
EssavisocompartilhadaporD3,oqualdestacou,almdodficitemformao,apostura
distorcidaporpartedealgunsdesignersemrelaoaseupapel[...]prapodernegociarpor
exemplo,comareatcnica,vocprecisaterumconhecimentotcnicoprofundo[...]Ento
a primeira coisa formao intelectual e tcnica do designer. Porque o designer hoje em
dia..., eu encaro os designers brasileiros e muitos europeus tambm, americanos... meio...
eles querem ser superstars, a primeira coisa que t na cabea dele de ser uma pessoa
famosaporqueeledesigner.Eissoaltimacoisaqueinteressa.
Odficitnaformaocausadotambmpordiversosfatoresextraclassetaiscomoa
falta de estrutura em algumas instituies de ensino notadamente as de financiamento
pblico a falta de interesse em aprimorarse por parte de alguns alunos e professores,
entre outros aspectos de ordem mais especfica. Neste sentido, destaca Cardoso (2012), a
importnciadeosalunos,soborientaodosdocentes,buscaremumaconstanteampliao
dosconhecimentosadespeitodetaisdificuldades:

Os melhores designers so os que sabem incutir aos seus projetos um nvel de


erudiomaiordoqueseriaexigidoapenasparacumprirminimamenteobriefing
proposto [...] o bom designer de produtos costuma ser o que se interessa por

193

processos de fabricao. E assim por diante. O aprofundamento e o estudo


atribuemaotrabalhoumadensidadequeodiferenciadocomum.Soosdesigners
mais cultos que se destacam em suas atividades [...] Por erudio e cultura,
entendese um amplo conhecimento geral e algum aprofundamento maior em
reasespecficas,ambosdosquaisdevemsermovidosporcuriosidadeintelectual
genuna[...]Omelhormododeestimularerudiocomopartedoaprendizadodo
design buscar conhecimentos fora da rea, em outros campos de interesse do
aluno.(CARDOSO,2012,p.252)

O autor ainda destaca que, quanto maior for a integrao entre o ensino e outras
instnciastaiscomoomercado,aindstriaeomeiocultural,maioresseroaschancesdese
estabelecer um aprendizado verdadeiro, atuando em parceria com o prprio campo
profissional,afimdeformarprofissionaisinseridosnarealidadedaprofissoedasociedade.
AinteraoentreUniversidadeeindstriaautomobilstica,contudo,umtemacontroverso
entre os empresrios do setor, como destacado por Negri e Lemos (2011, p.392393) ao
inferirquedoisaspectossorecorrentesnodiscursodosmesmos,quandotratamdotema
interao universidade e empresa. O primeiro aspecto o reconhecimento da dificuldade
das empresas em buscar parcerias com Universidades, pois no tm departamento de
pesquisaouequipequeconsigaexpressarsuasnecessidadesedemandasaessescentros.O
segundo aspecto diz respeito avaliao negativa por parte dos empresrios, os quais
desqualificam o comportamento do pesquisador, considerandoos despreparados para
entenderasnecessidadesdecurtoprazodaindstria,caracterizandooscomoprofissionais
futurologistas,queapresentamfaltadeobjetividadeeexcessodeteoria.
Entretanto, segundo os autores, os empresrios do setor costumam citar como
grandesinovaesdareacasoscomoodaadoodatecnologiaflexfueloudacadeiade
biocombustveis,declarandoqueoscentrose Universidadespblicas,almdaEmbrapae
Instituto Tecnolgico da Aeronutica, foram fundamentais na produo de conhecimento
que possibilitou tais inovaes. Para Negri e Lemos (2011), importante que exista tal
interaocomopartedapolticapblicaparaainovao:

Investigar e corrigir as causas pelas quais a cooperao um fenmeno menos


comum na indstria brasileira pode ser um instrumento de poltica pblica
importante para estimular a inovao e o desenvolvimento tecnolgico do setor.
Isso importante, dado que observamos a relevncia da cooperao para a
inovaonospases desenvolvidos. Essa baixa taxa de cooperao e de interao
comoutrosagentesdosistemadeinovaopodeestarrelacionadacomgargalos
nareadepropriedadeintelectual,porexemplo.Tambmpodeterrelaocoma
pequena importncia que s empresas do setor conferem s Universidades e
Instituies Pblicas de Pesquisa: o fato dos pases Europeus terem um maior

194

nmerodeacordosdecooperaocomessasinstituiespodeexplicarporque,l,
acooperaoumfenmenomaiscomum.(NEGRI;LEMOS,2011,p.377)

Aindadentrodocampodeformaoprofissional,aescassezdepesquisasvoltadasao
design de automveis tambm foi destacada por D8, que considera papel dos prprios
designerscomearadesenvolverestasinvestigaesOlhaeuachoque......agenteainda
no construiu muito, em termos de histrico e conhecimento, dentro dessa rea de
automveis[...]AgentenotemnoBrasilalgum...seil,umcursodepeso,algumacoisa
maisdedicadaaisso.Noexistemuitoesse...esseembasamento,mas,aomesmotempo
funo nossa criar isso [...]. Tal posicionamento tambm compartilhado por Cardoso
(Ibid.,p.253),paraquemcrucialsuperaroantiintelectualismoquemantmodesigncomo
reademenorcredibilidadeacadmica,semabrirmodasqualidadesespecficasdocampo.
Para o autor: Precisamos integrar ainda mais projeto e pesquisa, prtica profissional e
atividades culturais, sem perder de vista a natureza essencial do design como atividade
projetual, capaz de viabilizar solues sistmicas e criativas para os imensos desafios do
mundocomplexo.
Estamaiorintegraoentreprticaepesquisadirecionadaparaodesignavanado
tambm foi elencada(D2, D5, D7 e D8) como uma melhoria importante a ser alcanada
pelos departamentos de design, como pode ser visto na declarao de D2 [...] se tivesse
aquele... sei l, ncleo de pesquisa que a gente pudesse gastar um pouco mais de tempo
apressando esse tipo de coisa, em vez de s... a estrutura eu acho, a estrutura do
departamentotinhaquemudarumpouco,agentesepararmaisaquiloqueseriatrabalhar
comdesign,ouatenderoprograma,e...e...balancearmelhoroteutempo,praquecomo
designervocpossacriarmais,possafazerumtrabalhomaisrobustodedesign.
TalposturatambmfoicompartilhadaporD7[...]euacreditoquebasicamentese
voc conseguisse juntar numa mesma empresa ... [...] se as diferentes reas da empresa
escalassempessoasqueseil,elasacreditamquesomaisvisionriasdentrodecadarea
praquetrabalhassemjuntosemmomentosquenaverdadeagentechamadeprprojeto.
Euacreditoqueissoajudariamuitoe...queaspessoasnoestivessempensandojustamente
nasdificuldadesquevocvaiternoprojeto,esimnasoportunidadesquevocvaiterpro
projeto.Comopartedapesquisanosetor,D5eD8indicaramanecessidadedosdesigners
estarem o tempo todo em busca de novidades e aprimoramento pessoal alm da
importncia de registrar tais investigaes, como inferiu D8: [...] apesar de ser uma

195

indstria antiga e que deveria ter um histrico bem documentado e tudo o mais, eu pelo
menos no vejo muito assim. Eu acho que as informaes s vezes so at difceis de
encontrar,porquenoforamregistradas.
Outro ponto crtico, segundo dois entrevistados (D3 e D4), compreende a condio
deodesignerconseguirmanterofocodotrabalhonousurioemumcenriocompetitivo
quecontribuiparaocontrrio,comorevelouD4Euachoqueexatamentenisso,nodiaadia
todomundocorrendocomodesenvolvimentoeperdendoofocodoqueoconsumidor.
Entoachoqueodesignertemaobrigaodemanteraobservaonoconsumidor.Ento
manteraobservaoetrazerpracompanhiaasnecessidadesreaisdoconsumidor.
Neste cenrio, D3 refletiu sobre a necessidade de o designer ter conscincia da
importncia de seu trabalho, no o desempenhando apenas com vistas ao imediato e
individual: [...] A profisso do designer uma profisso dura, no ficar em cima de um
palco num show, apresentando o produto dele. No, isso no a misso do designer. A
misso do designer ter conhecimento suficiente pra gerar um produto que possa ser
bonito, mas que atenda a todas as premissas tcnicas [...] o designer no um superstar,
muito pelo contrrio, ele um trabalhador duro e tem que produzir, tem que fazer o
trabalhodelequemuitoimportanteeoquevaivenderocarro[...].
Alm do foco do designer em relao a sua atuao, tambm foi indicado por trs
participantes(D4,D6eD7)comoumaspectoquecontribuiriademaneirabenficaparaa
prtica,umamelhoriadapolticadaempresaemrelaoaodesign,visandoqualidadedo
produto e o consumidor. Na busca incessante por enfrentar a concorrncia, por vezes, a
empresa no avalia os impactos negativos desta postura imediatista no projeto, como
ressaltou D4: Ento acho que o desafio e a meta final tm que ser se manter nessa, no
simplesmentecontinuarfazendo,correndoelanandosemolharpraoquetacontecendo
de verdade no dia a dia [...] os tempos de desenvolvimento so cada vez menores, a
quantidade de lanamentos de verses cada vez maiores, ento, assim tem aumentado [a
presso].
Embora o design seja o responsvel por caracterizar o produto da empresa no
mercado,definindoporvezesacompradeumveculoemdetrimentodeoutro,aindaassim,
dentro da empresa, a colocao dos designers bem como o crdito dedicado a eles ainda
revela reticncias por parte da estrutura empresarial, como revelou D6 ao versar sobre a
melhoria no design dos produtos brasileiros, os quais, em sua viso, ainda esto muito

196

aqumdosconcorrentesinternacionaissimplesmentevontadedacompanhia.Deinvestir
entendeu. Estratgia da companhia. O [cita o nome do presidente da montadora na qual
trabalha],elestraamasestratgiasdeles,eissogeranossaconsequnciaaquidefazerum
carromelhorouno.Ento...noexisteum...noumacoisaquetnonossombito,
umacoisamuitomaiorentendeu?.
A vontade da empresa em avanar nos processos de design tambm foi destacada
por D7, que inferiu ser necessrio um posicionamento mais estratgico da companhia em
manter o design como parte integrante de um centro desenvolvedor de carter
interdisciplinar posio esta que a sntese do campo do design como profisso
mantendoacontribuiodasdemaisreascomosuportesatlite,demaneiraqueodesign
organize o processo, coordenandoo em conjunto s demais reas envolvidas [...] o
designer...,queeuvejo,umadasnicasreasquetrabalhamcomoqueaindavaiser,
enquantoasoutrasreasaindaestotrabalhandomuitocomascoisasqueso[...]Eufalo
isso no caso da empresa mesmo, que as pessoas no esto ali para criar dificuldades ou
pensarnoququehojenopossvel,masquemsabeoququeamanhpodeserpossvel
[...]Pravoctrazerparaarealidadedodesignasoutrasreas[...]Osprprojetoseascoisas
quevemantes,osconceitos,bemdifcilquevocvejaopessoaldemarketingenvolvido,o
pessoal de engenhariaenvolvido, pessoas das reas vamos dizer, duras. Eles praticamente
nuncatoenvolvidosemmomentosemque...quepossvelvocviajarnumaideia,que
possvelvocpensaralmcomoodesignerfazissobasicamentetododia.
Tornarodesignumcentroaglutinadordosdemaisprocessosoriundosdasdiferentes
reasenvolvidasnoprojeto,comojvisto,envolveumamodificaodeposturaporparte
das companhias, as quais embora tenham estruturado centros de estilo em suas plantas
fabris,aindavisualizamodesigncomoumanexoresponsvelpelaatualizaoconstantede
aspectos estticos dos produtos da marca, e no como um setor com potencialidade para
contribuirnasdefiniesestratgicasdaempresa.
Os pontos destacados pelos participantes como cruciais para a melhoria de sua
prticarevelamseudescontentamentodiantedostatusquodefinidoparaaprofissoeseus
profissionais dentro da empresa e fora dela. Para Bonsiepe (2011), tal descontentamento
devesetornarferramentadetransformaonamodosdesigners:

197

O designer que trabalha profissionalmente, aplicando as ferramentas disponveis,


achase frente ao desafio de traduzir sua postura contra o status quo em uma
proposta projetual vivel. Em outras palavras, cabe ao designer intervir na
realidade com atos projetuais, superando as dificuldades e no se contentando
apenas com uma postura crtica frente realidade e persistindo nessa posio.
Afinal,projetar,introduzindoasmudanasnecessrias,significaterapredisposio
paramudararealidadesemsedistanciardela.(BONSIEPE,2011,p.36,37).

Tal transformao depende de o profissional designer no adotar uma postura


passiva diante do status quo como lembra Phillips: (2008, p.159) Ele deve trabalhar
seriamenteparaelevaroconceitododesigndentrodaempresa,transformandooemuma
atividade importante e participativa das decises estratgicas. Cabe aos designers,
portanto, tomar conscincia das dificuldades encontradas em sua prtica e desenvolver
habilidadesqueosauxiliemnabuscaporummaiorreconhecimentoprofissional,visando
melhoriaconstantedesuaprtica.

5.1.2.4Categoria4:OfuturodaprofissonoBrasil

Seguindo o padro adotado anteriormente, a categoria 4 composta pela ltima


questo da entrevista antes das consideraes finais do entrevistado, as quais sero
abordadas no captulo seguinte e seus temas foram representados pelo contedo
principaldecadaumadestasquestes.
Tema4A:OpapeldodesignerautomotivonoBrasilnosprximosanos
OQuadro9apresentaosndiceseosindicadoresqueosfundamentam,presentesno
tema4A.
Quadro9ndiceseindicadoresoriginadosdoTema4A
ndice:
1.Projetarapartirdenovaspolticasenovasposturasculturais(considerandosesociedade,
governoeempresas)

Indicadores:
D1 [...] cabe tanto aos designers trabalhar algumas questes nessa relao, mas tambm cabe
muitoaopessoaltantopolitico,urbanistaresolveresseproblema...certo?[...]Entoassimopapel
dodesignerachoqueentrarianombitomuitomaiorassimdediscussodasempresas,eagentev
que tem no mercado... t tendo algumas experincias em relao a isso... de montadora fazendo
bicicletaeltrica,quepossaintegraraocarro...essetipodecoisaassim,pranodeixarocarrocomo
umprodutoisoladoassim

D3[...]odesignereletambmtemcomomissopensarnisso,masacoisatodat...euvejoque
muito mais forte quando a empresa tem essa mentalidade, isso um exemplo e o que eu vejo...

198

tambmdependemuitodoqueogovernovaiquererfazercomessepas[...]comovocvaievoluir,
dopontodevistadomeioambiente...euachoqueumprimeirograndepassoestnamaneiracomo
oprpriogovernovailidarcomissoedarcondiespraqueissoacontea

D4Euvejoqueassim,omundointeirotrepensandomobilidade,eospasessubdesenvolvidos
estosempreumpassinhoatrs...muitasvezesporfaltadeinvestimentoemtecnologia,ouporfalta
deknowhowtambmemalgunsaspectos...eaeuachoqueodesafioproBrasilvaiserjustamente
esse.Conseguiralcanar...[pausa]avanotecnolgicoouavanoemmeiosdepensaramobilidade
quenosoautomveldentrodessaloucuratoda.Entoomundotmudando,ascidadesesto
apresentandovariasoutrasnecessidadesequevaipuxaressatransioemalgummomento

D5[...]achoassimqueopapeldodesignerincorporaressascoisasnoprojeto,olharprocarro
nomaismeramentecomoumproduto,masassim...vocfaloudeinteraocomoutrosmeiosde
transporte, acho que ele tambm trazer esses inputs que a gente recebe do mercado, das
pesquisas que so profundas sobre a mobilidade urbana, e trazer isso pro seu projeto como
necessidade. E eu acho que aos poucos cada montadora vai entender em que frequncia ela vai
implementarcadacoisa,cadatecnologia

D6[...]euvejoassim......ns...voltandoainsistirnessacoisademercadoemergente.Aminha
visoqueagenteaindatemqueselivrardesseestigma,achoqueessaapalavracorreta...me
corrijaseeuestivererrado...desairdessa....dessaimagemqueagentecarregadefazercarropra
mercado emergente. O que ns vemos que a Europa, a Europa ela sempre uma referncia de
inovao em tecnologia automotiva. Ela j t caminhando pra isso, criando produtos novos,
inovadores, pensando em tudo isso que voc falou de ecologia, consumo inteligente,
sustentabilidade,mobilidade.Masaquiagenteainda,temessadificuldadesabe.NoBrasilfalando
aquidonossopaisinho,...euvejoqueaindanosprximosanosagenteaindavaicontinuarfazendo
carros... ahh... pelados, carros com pouca inovao, consumo alto. A gente s vai comear a criar
coisas novas depois que... o mundo inteiro j tiver fazendo isso e o governo provavelmente
incentivar...elejtbuscando...tbemtmidoaindaessacoisadeincentivodogovernoemrelao
a carros eltricos e tudo o mais. Mas acho que se no partir [pausa] se a iniciativa no partir do
governoedasociedade,ascompanhiasvocontinuarproduzindoosmesmoscarrosqueagentet
vendohojenarua.Porqueumaquestodelucrofcil

D7 Olha eu acredito realmente que, pelo que eu tenho visto de projetos em andamento, pelo
prximos dez anos vou chutar, no sei se eu... eu apostaria at quinze, o Brasil vai praticamente
continuarexatamentedamaneiracomot...tipo,osdesignersvocontinuartrabalhandodamesma
forma porque os carros brasileiros ainda tem muito, mas muito o que andar, tem muito o que
evoluirprachegarnoscarros...especialmentenoscarroseuropeuscomoagentepodeverhoje[...]o
Brasilemsi,naminhavisoaindatemmuitochoaindapraqueimar,mesmopraconseguirquea
profissotenhaquebuscarocaminhomaiseficiente,ocaminhomaissegurolnofuturo[...]Ento
at que a gente consiga caminhar culturalmente pra que a profisso tenha que mudar em algum
aspecto,euachoqueagentevaipelosprximosmuitosanoscontinuartrabalhandoexatamenteda
mesmaforma
D8 Eu j vejo que a gente conhece, a gente sabe, a gente ouve, mas no sei se tem um
movimentoassimmaisfortesendofeitosabe?Naverdadeeuachoqueascoisassomuitolentas,
elas demoram um pouco pra acontecer, ento o nosso papel vai ser bastante esse, de ir
antecipando,deirtrazendo,irforandopracoisaumdiaacontecermesmo

ndice:
2.Ampliaodaparticipaodedesignersbrasileirosemprojetosglobais

Indicadores:
D1 O meu desejo e a minha expectativa poder realmente participar mais ativamente desse
mercado global sabe? [...] Acho que tem perspectiva e tem espao pro profissional brasileiro
continuaraquinoBrasil,mascriarnummbitoglobalsabe?[...]MasosestdiosnoBrasilestose
preparando, esto trabalhando j nesse aspecto pra voc manter assim, o digamos assim... os

199

profissionais brasileiros aqui mesmo sabe, e ai a gente tem potencial pra criar coisas que vo ser
utilizadasnomundointeiro

ndice:
3.Participaofundamentalnodesenvolvimentodepesquisaseprojetosemdesignavanado

Indicadores:
D2fundamental,ecomeaassimdanossareadeColor&Trimpra...evaicascateandopratodas
asoutrasassim,noquesitosustentabilidadeseagentenocomeaadesenvolvernovosmateriais,
seagentesempretrabalhalpra...programaslprafrente,ento...estamosem2012vaiserum
programa pra sei l, daqui dois anos... se a gente no pega pra parar e mudar o mindset assim, a
cabea,dequetemquedesenvolvercoisaquetemporcentagemdefioPET,ouporcentagemdealgo
reciclvel,ouquenodanifiquetanto,cruciallprafrentequeagentevaitsendomaisoumenos
sustentveis,assim...edamesmaformaapartedemobilidade

D3Nstemosessapreocupao,umapreocupaoquenodehoje,odesigner...eletemque
tligadoaisso,eletemquetentando...eletemessamissotambmdepensarsobreissomas...o
queeuvejoassim,comoeudisse,odesignerumfuncionrio...ofuncionriodeumaempresae
praelepoderdesenvolveralgumacoisa,queestejarelacionadaaomeioambiente,aempresatem
queteressafilosofia...demeioambiente

D5Maseuachoqueagentetemumpapelimportantesim,porquemuitasvezesumtimede
marketingoudemarketingestratgicoquesinalizaumanecessidademasassim,aideiaquemvende
otimededesign,quejuntocomesseoutrogrupoconseguetornarvisualanecessidade

D8[...]euachoqueonossopapelvaiserdegrandesincentivadores,edebotaressasideiaspra
frente,porqueporessanossavisoassim...defuturo,edeenxergaranecessidadedousurioeno
outrasnecessidades.Entoeuachoqueonossopapelvaiserbemesse.

Noquetangeaofuturodaprofisso,amaioriadosparticipantesdapesquisa(D1,D3,
D4,D5,D6, D7eD8)indicaramqueserpapeldodesignerautomotivonofuturoprojetar
melhoresprodutos,namedidaemquemelhoraremaspolticasvigentesesedesenvolverem
novas posturas culturais considerandose sociedade, governo e empresas. Os problemas
relativosmobilidadeeaomeioambienteverificadosnaatualidade,tendoosautomveise
oaumentoprogressivodafrotacomoatoresprincipais,demandamsmontadorasecomo
consequncia aos designers a necessidade do desenvolvimento de novas solues.
Todavia,taismudanas,navisodosdesigners,nodevemrecairapenassobreodesigndo
produto,antesdevecompreenderauniodeesforosentremontadorasnarealizaode
pesquisas e desenvolvimento do design; governo ao incentivar a produo e contribuir
com melhorias de infraestrutura; e sociedade, ao buscar realizar uma compra consciente,
exigindo das autoridades investimentos na melhoria do sistema virio e das montadoras
umamaiorqualidadedosprodutos.
Para D1, far parte do papel do designer influenciar as polticas de melhoria do
produtodentrodaprpriaempresa,setiverespaoparatal[...]cabetantoaosdesigners

200

trabalhar algumas questes nessa relao, mas tambm cabe muito ao pessoal tanto
politico, urbanista resolver esse problema... certo? [...] Ento, assim, o papel do designer,
acho que entraria no mbito muito maior assim de discusso das empresas.
Complementando esta declarao, D3 ressaltou que um posicionamento dos designers
passaantespelaposturadaprpriamontadoraemterporobjetivomelhorarseusprocessos
e adequar o produto s adversidades que se apresentam, alm da postura do governo
brasileiroempromoveresteavano:[...]euvejoquemuitomaisfortequandoaempresa
temessamentalidade,issoumexemplo,eoqueeuvejo...tambmdependemuitodoque
o governo vai querer fazer com esse pas [...] como voc vai evoluir, do ponto de vista do
meio ambiente... eu acho que um primeiro grande passo est na maneira como o prprio
governovailidarcomissoedarcondiespraqueissoacontea.Emrelaosmudanas
necessrias para o futuro, Larica (2003) reflete que o designer ter condies de propor
inovaesesoluesnecessriasparaosprojetos:

Odesignertemopoderdeinfluenciarnestamudanaatravsdesoluescriativas
noprojetodeprodutosesistemas,dousodemateriaisecologicamentecorretos,
da opo pela simplicidade, do alongamento da vida til dos produtos. Manter o
foconafunobsicadoobjeto,deacordocomasnecessidadesreaiseotempode
utilizaoditadopelasexpectativasdosusurios,podeserachaveparaasportas
deumfuturomelhor.(LARICA,2003,p.162).

OsdesignersD6eD7apontaramainda,afaltadevontadedasempresasaliadaao
lucrofcildasmontadorasaoperpetuaremprojetosantigosreadaptadosevendidossobre
preos de projetos novos e do governo brasileiro isentandose da fiscalizao sobre a
qualidade do produto, do incentivo a melhorias na infraestrutura e da integrao com
demais meios de transporte como causa principal da problemtica da mobilidade
enfrentadaprincipalmentenasgrandescidadesnaatualidade.Taisposturassodestacadas
porLandim:

Na prtica, as polticas de design, em geral, so motivadas principalmente pelos


benefcios que podem trazer s empresas lucratividade e aos governos
vantagem econmica. A essncia das polticas de design no contempla
necessariamente a sustentabilidade, a noser de forma indireta. (LANDIM, 2010,
p.60).

DeacordocomosentrevistadosD6eD7,osprximosanosreservamaosdesigners
dificuldades na aplicao tanto das tecnologias j existentes, quanto das que viro, se tal

201

cenrio no sofrer uma modificao, como refletiu D6: [...] , eu vejo assim... ... ns...
voltando a insistir nessa coisa de mercado emergente. A minha viso que a gente ainda
temqueselivrardesseestigma,achoqueessaapalavracorreta...mecorrijaseeuestiver
errado...de sair dessa.... dessa imagem que a gente carrega de fazer carro pra mercado
emergente [...] No Brasil, falando aqui do nosso paisinho, ... eu vejo que, ainda nos
prximos anos, a gente ainda vai continuar fazendo carros... ahh... pelados, carros com
poucainovao,consumoalto.Agentesvaicomearacriarcoisasnovasdepoisque...o
mundointeirojtiverfazendoissoeogovernoprovavelmenteincentivar[...]Masachoque
senopartir[pausa]seainiciativanopartirdogovernoedasociedade,ascompanhiasvo
continuar produzindo os mesmos carros que a gente t vendo hoje na rua. Porque uma
questodelucrofcil.
OparticipanteD7tambmcompartilhadessaopinioaodeclarar:[...]oBrasilemsi,
na minha viso, ainda tem muito cho ainda pra queimar, mesmo pra conseguir que a
profisso tenha que buscar o caminho mais eficiente, o caminho mais seguro l no futuro
[...]Ento,atqueagenteconsigacaminharculturalmentepraqueaprofissotenhaque
mudar em algum aspecto, eu acho que a gente vai pelos prximos muitos anos continuar
trabalhando exatamente da mesma forma. Compartilhando desta perspectiva, os
participantesD4,D5eD8enfatizaramalentidodospasesemergentescomooBrasilem
absorver tecnologias e impulsionar os desenvolvimentos neste sentido. Tais profissionais
acreditam, contudo, que lentamente o governo e as montadoras se adaptaro s diversas
condiesexistentes,comobemidentificaafaladeD4Euvejoqueassim,omundointeiro
trepensandomobilidade,eospasessubdesenvolvidosestosempreumpassinhoatrs...
muitasvezesporfaltadeinvestimentoemtecnologia,ouporfaltadeknowhowtambmem
algunsaspectos...eaeuachoqueodesafioproBrasilvaiserjustamenteesse.
Outro aspecto relativo ao futuro da profisso no Brasil, ressaltado pelo profissional
D1refereseampliaodaparticipaodedesignersbrasileirosemprojetosglobais,oque
emsuaviso,auxilianocrescimentoereconhecimentodoprofissional,comodeclarou:[...]
AchoquetemperspectivaetemespaoproprofissionalbrasileirocontinuaraquinoBrasil,
mascriarnummbitoglobalsabe?[...]MasosestdiosnoBrasilestosepreparando,esto
trabalhando j nesse aspecto pra voc manter assim, o digamos assim... os profissionais
brasileiros aqui mesmo sabe, e ai a gente tem potencial pra criar coisas que vo ser
utilizadas no mundo inteiro. Por fim, os designers reconheceram que, no futuro, ser

202

fundamentalaparticipaodosdesignersnodesenvolvimentodepesquisaseprojetosem
design avanado (D2, D3, D5 e D8), como maneira de antecipar solues e desenvolver
melhoresprodutosfrentesadversidades.Nofuturo,paraSilvaetal.:

Os designers tm e tero ao seu alcance a capacidade de demonstrar, tanto na


formacomonosmateriaisenosprocessosutilizadosnaconcepodeumproduto,
que os objetos tm um impacto no mundo, seja social ou ambiental [...] Embora
essesobjetivosjfaampartedacondutadodesignatual,esperasequeganhem
cadavezmaispesonoensinoenaprticadodesign,possibilitandoaformaode
profissionais mais conscientes e responsveis, social e ambientalmente. (SILVA et
al.,2012,p.53).

Tal participao, contudo, depende da estratgia de cada empresa em relao ao


departamento de design e do uso que far das potencialidades de seus designers na
viabilizaodesolues,comorefletiuD3:[...]odesigner...eletemquetligadoaisso,ele
temquetentando...eletemessamissotambmdepensarsobreisso,mas...oqueeuvejo
assim,comoeudisse,odesignerumfuncionrio...ofuncionriodeumaempresaepra
ele poder desenvolver alguma coisa, que esteja relacionada ao meio ambiente, aempresa
temqueteressafilosofia...demeioambiente.
Tambm D8 destacou como importante o papel do designer brasileiro no futuro,
comoincentivadordemudanasemelhoriasnosprojetos:[...]euachoqueonossopapel
vaiserdegrandesincentivadores,edebotaressasideiasprafrente,porqueporessanossa
visoassim...defuturo,edeenxergaranecessidadedousurioenooutrasnecessidades.
Ento eu acho que o nosso papel vai ser bem esse. Ainda D2 e D5 ressaltaram a
responsabilidadedosdesignersnapromoodapesquisadenovosmateriaisenacriaode
projetos inovadores, sustentveis e adequados realidade brasileira, como ressaltou D2:
[...] se a gente no pega pra parar e mudar o mindset assim, a cabea, de que tem que
desenvolvercoisaquetemporcentagemdefioPET,ouporcentagemdealgoreciclvel,ou
que no danifique tanto, crucial l pra frente que a gente vai t sendo mais ou menos
sustentveis,assim...edamesmaformaapartedemobilidade.
Para Heskett (2008), o design intrnseco ao ser Humano e por isso mesmo um
elementodeterminantedaqualidadedevidadaspessoas:

O design uma das caractersticas bsicas do que significa ser humano e um


elemento determinante da qualidade de vida das pessoas. Ele afeta todo mundo
em todos os detalhes de todos os aspectos de tudo o que as pessoas fazem ao
longododia.E,comotal,odesignextremamenteimportante.Hpouqussimos

203

aspectos do ambiente em que vivemos que no podem ser aperfeioados de


maneiradecisivapormeiodemaioratenoaseudesign.(HESKETT,2008,p.10).

A misso principal do design compreende, portanto, criar e desenvolver


constantementeartefatos,serviosesistemasquecontribuamparaamelhoriadaqualidade
de vida do ser Humano. Assim, sendo o design influenciado pelo meio sociocultural
circundante e tambm influenciador dos rumos deste, a responsabilidade dos designers
frente ao futuro do carro e de projetos para a mobilidade est diretamente atrelada aos
rumos que as polticas empresariais e governamentais seguiro, sendo igualmente
condicionadapelasposturasdosusuriosedasociedadenademandaporprojetosmelhores
emaisadequadossdiferentesrealidadesenecessidadesbrasileiras.

Consideraesdosparticipantes
Ao final das entrevistas, foi oportunizado aos participantes tecer consideraes s
quaisacreditassemserrelevantesparaaoobjetivodapesquisaouparaaprofisso.Dototal
de respondentes, 50% (D2, D4, D5 e D8) consideraramse satisfeitos com os pontos
abordados,osoutros50%(D1,D3,D6eD7)ressaltaramalgunsaspectos.OentrevistadoD1
destacouaimportnciadosdemaisprofissionaisedopblicoemgeralbuscarconhecermais
sobre o que design. Tambm retomou que um dos maiores desafios do designer
viabilizar ideias dentro de todas as restries que se apresenta sua prtica. Nas suas
palavras, [...] o designer automotivo nem sempre ouvido no Brasil, acho que passa por
esseaspectoassim,atporserumarearestritavocacabanotendo...assimaspessoas
no tem noo realmente, no por m vontade ou qualquer coisa, mas acaba no tendo
acessoaoququeessarea...eassim..todomundoageassimahno,beleza,area
maislegalouseil..porque...sabeselporque,mastemmuitagentequeachaquelegal
essarea,eassimgeraassimumencantosabe?.
Oparticipanteaindaressaltouasdificuldadesdotrabalhonodiaadiaedoempenho
necessrioparaconcretizaroprojeto,bemcomoodficitdeformaonapreparaopara
uma prtica, a qual exige do designer habilidades alm das que ele foi preparado para
executar: Para aprovar qualquer coisinha que voc vai fazer um sacrifcio realmente, e
voc tem que ficar ali trabalhando, trabalhando e trabalhando pra fazer as coisas
acontecerem.Entodigamosassim,noquenemagentebrincaaquidoluxoeglamour,
notemnadadissosabe?muitotrabalhomesmo,sangueesuor,eagente,noBrasil,pelas

204

deficinciasqueagentetem...deaprendizadoetal,agenteacabatendoquesevirarnos
trintamesmoefazerdetudoumpouco,esvezesmuitomaisdoqueumprofissionalno
exterior faz. A gente... por exemplo...[pausa] l fora o cara... tem um cara que faz s
rendering e outro que s faz design, a gente tem que fazer tudo, a gente tem que fazer
apresentao, rendering, ir pro clay s vezes modelar alguma coisa, ento a gente acaba
tendoquesermaispolivalentedoqueosoutros...deoutrasreas.
Ao tecer suas consideraes, o profissional D3 ressaltou seu posicionamento
contrrio viso de alguns designers, os quais entendem sua profisso como arte: o
designer no um artista, o designer um tcnico... um cara que tem uma grande
responsabilidade,e,porissomesmo,eletemquecrescer,eletemqueestudar,eletemque
se aprofundar dentro da profisso dele... ele tem que ser um cara completo. Ser bom em
desenho,mastambmtemqueserbomemtransferirodesenhopromodelo,eletemque
ser bom no relacionamento com os parceiros, ele tem que ter conscincia social, ele tem
quesabermuitosobremoda,sobretodaaquelahistriaquevocjconhece.Eletemque
estar por dentro das coisas, acompanhar tendncias, ento ele tem grandes
responsabilidadeseissoqueeletemquelidar.
Tambm o profissional ressaltou o papel das escolas de design na formao deste
profissional e a necessidade dos designers atentaramse a outros ramos de produo to
importantesquantooautomotivo,emumpasnoqual,emsuaopinio,aindahmuitoaser
feito e mais ainda a ser trabalhado e melhorado pelo design: Por outro lado, as escolas,
tambm elas devem ser conscientes disso e, vamos dizer assim, melhorar o padro do
ensino, dar mais condies pra que essa matria entre em profundidade, ela venha
realmente formar designers de qualidade... e no olhar s pro automvel. Porque o
automvel como ns falamos na primeira pergunta, um meio muito restrit. Eu diria pro
designer brasileiro se preocupar mais com outras coisas, se preocupar mais com outros
produtos,teressavisodequetemmuito,praticamentetudoaserfeito.
Nas palavras de D6 um aspecto relevante a se considerar a postura de alguns
docentes relativa vontade de alguns discentes em buscar o caminho do design de
automveis. Segundo o entrevistado: Eu vejo ainda um preconceito, pelo menos ns
passamos na minha faculdade, no de todos os professores, mas de um ou dois que
criticarammuitoagente,nosagente,masasturmasanterioreseasposteriorestambm
pornstrabalharmosporessacoisadedesignautomotivo.Nsfomosxingadosporalguns,

205

tevebaixariasabe...algunsprofessoresnogostamdessacoisadedesignautomotivoe,por
questespessoais,profissionais,eunosei.Elespassamessaimagem,tentampassaressa
imagemnegativaprosalunos,dizendoquesonho,quepodedesistir.
Ainda versando sobre os obstculos encontrados em ambiente acadmico, o
profissional declarou que muitos de seus colegas que buscaram entrar no setor, embora
aindamuitorestrito,conseguiramsecolocar,eprosseguiudestacandoanecessidadedese
rompercomestepreconceitooriginadoaindanaformaodoprofissional:Euachoque...
voc me perguntou no comeo quais so as dificuldade no Brasil sobre o design
automotivo...romperessepreconceitotambm,nauniversidade,nasescolas,jcomea
da,opreconceitojcomeadai,temmuitagentequerendotecolocarprabaixo,pratentar
fazervocdesistir.Oentrevistadoconcluiufalandoque,pocadofatoocorrido,haviaa
dificuldadedealgunsprofessoresemlidarcomasexpectativasdestesalunos,pois,apesar
da boa vontade, os mesmos no eram preparados para o ensino de aspectos tcnicos
especficosexigidospelaprofisso,comooensinoaprofundadodetcnicasderenderingou
sketchesvoltadosreadeautomveis,conhecimentosessesque,nosdiasatuais,podem
serobtidosemcursosparticulares,especializadosnoensinodetaistcnicas.
Porfim,oparticipanteD7declarouseucontentamentoporfazerpartedacategoria
de profissionais designers automotivos e destacou as dificuldades enfrentadas na prtica,
como aspectos problemticos da profisso, os quais so responsveis por desestimular os
designersatquevejamofrutodeseutrabalho:Eladifcilvamosdizerassim,comoeuj
tinha dito, por causa de tantos problemas que voc acaba encontrando por dificuldades
tcnicasepordificuldadeseconmicas.Ento,tipo,umaprofissoque,tipo...queparece
querealmentenovaleapenaatomomentoemquevocvoseuprodutonarua[...]
Ento,parecequeodesignautomotivovocconseguedesanimarumpouquinhonomeiodo
processo porque ele bastante complicado, bastante difcil, tem muitos custos e muito
dinheiroenvolvido.Ento,podeparecerdecomeo...quenoexatamenteaquiloqueas
pessoas sonham durante a faculdade, que voc vai desenhar carro, que voc vai fazer as
coisas.
Apesardasdificuldades,oentrevistadodestacavalerapenaconfrontarosobstculos
osquaistmincioaoconseguirsecolocarnomercadodetrabalhoeposteriormentese
manterneleparaproduzirumobjetodedesejoegrandeimportncianavidadosusurios:
[...] um trabalho extremamente gratificante quando voc v que aquilo que voc

206

trabalhoutantochegounarua,easpessoasacabamdesejandoaquiloporqualquerqueseja
o motivo. Ento, se eu pudesse deixar alguma coisa, tipo, apesar de ser difcil tanto pra
entrar,quantoprasemanter,tantoquantopravencerldentro,quandocheganofinale
vocvoseutrabalhopronto,achoquevaletodaapenadomundo.
ODiagrama4apresentaumasntesedosaspectospercebidospelosdesignersacerca
de sua prtica profissional. Os itens indicados no diagrama resultam das percepes mais
recorrentesverificadasnasrespostasdadaspelosparticipantes.

207

Diagrama4Sntesedosaspectospercebidospelosdesignersacercadesuaprticaprofissional

Fonte:Aautora,2013.

208

Tais indicadores oferecem informaes sobre os pontos crticos da prtica


profissional, bem como quais os aspectos positivos os quais demandam incentivos e
aprimoramentos.Osmesmostambmrevelamquaisasmelhoriasconsideradasurgentesna
opinio dos prprios designers e qual a sua percepo diante do futuro da profisso. Na
viso dos participantes, quando tais itens forem levados em considerao dentro da
estrutura da empresa, haver uma melhoria significativa na prtica, refletindo no
aprimoramentocontnuodoprprioprocessodedesigndeautomveis,comreflexodireto
noprojetodoproduto.
CombasenosaspectossintetizadoseapresentadosnoDiagrama4,buscandoobter
informaes mais fiis e replicveis, foi elaborado o questionrio aplicado a uma amostra
significativa do universo de profissionais designers automotivos atuantes, compondo a
segundafasedapesquisa,cujosdadosseroapresentadosaseguir.

5.2Resultadosdasegundafasedapesquisa

Na segunda fase da pesquisa, aps o clculo da amostra vlida de 79 indivduos


dentrodouniversodedesignersautomotivosatuantesnoBrasiloqualcorrespondea92
indivduos, de acordo com as informaes fornecidas pelos prprios profissionais em
atuaofoielaboradoumquestionriocompostodedezquestesobjetivas.
O questionrio foi disponibilizado para acesso online por parte dos
designers, entre os meses de Setembro e Novembro de 2013. As questes presentes no
questionrioforamelaboradascombasenoDiagrama4,oqualsintetizoueapresentouas
principais consideraes tecidas pelos oito profissionais entrevistados na primeira fase. As
respostas obtidas atravs do sistema de formulrios online foram posteriormente
organizadasemplanilhanosoftwareMicrosoftExcel2010,paraentoprocederseanlise.

5.2.1PerfildaAmostra

Emboraosclculosestatsticostenhamapontadoonmerode79participantescomo
amostravlidadouniversopesquisado,apresentepesquisaintegrouocenriodescritopor
MarconieLakatos(2009,p.86)segundooqualEmmdia,osquestionriosexpedidospelo

209

pesquisador alcanam 25% de devoluo, ao obter 25 respondentes vlidos,


correspondendoa32%dototalpretendido.
Na ocasio dos primeiros contatos realizados no ms de Outubro de 2013, foi
enviadoviaemaileredessociaistantoparaosdesignersquantoparaoschefesdedesign
das diferentes empresas atuantes no Brasil um convite formal para participao na
pesquisa. Nesta oportunidade foram esclarecidos os objetivos e os variados aspectos do
estudo bem como do formulrio aplicado, visando equacionar com antecedncia possveis
dvidas.
Anexo ao convite foi enviado o link de acesso ao formulrio online, solicitando ao
profissional que o repassasse a seus colegas designers do departamento, a fim de que a
pesquisa tivesse o maior alcance possvel, obtendose uma amostra significativa de
participantes. Os grficos a seguir mostram o perfil dos profissionais participantes
correspondentessquestesumedois,respectivamente.

Grfico3Formaodosprofissionaisparticipantes

Fonte:Aautora,2013.

A partir dos dados presentes no Grfico 3, podese observar que, entre os


respondentes, a maioria representada por 15 participantes possui graduao,
correspondendoa60%dototal.Osoutros10participantespossuempsgraduaodotipo
latu sensu 40%. No que se refere ao tempo de atuao na rea, o Grfico 4 mostra os
dadosobtidos:

210

Grfico4Hquantotempoquetrabalhacomdesignautomotivo

Fonte:Aautora,2013.

O Grfico 4 revela que, entre os participantes da pesquisa, houve empate entre as


categorias at cinco anos 9 designers ou 36% da amostra e h mais de dez anos 9
designersou36%daamostra.Osdemais7designerscorrespondentesa28%daamostra
trabalhamnosetorentrecincoedezanos.Podeseobservar,portanto,queosrespondestes
compuseram grupos equilibrados, entre os iniciantes na carreira, os profissionais atuantes
humperodomdioeosprofissionaisveteranos.
Tal distribuio favoreceu a pesquisa, na medida em que foram obtidos pareceres
dosdiversosprofissionais,cujaatuaosedeuemdiferentespocas,oportunizandoassima
coletadeimpressesmaisabrangentessobreaprticaprofissional.

5.2.2Anlisedosdadosobtidos

Umavezrespondidasasquestesrelacionadasaoperfil,aterceiraperguntaindagava
aos participantes sobre sua viso quanto interdisciplinaridade atuao conjunta com
diversasreasnodesenvolvimentodosprojetosdeautomveis.Todosos25participantes
responderamseresteumaspectopositivodaprticaprofissional.
Sobre o conhecimento/reconhecimento do papel dos designers na indstria
automobilstica pelos demais profissionais e departamentos da empresa, objeto de
investigaodaquestoquatro,oGrfico5mostraque9profissionais36%consideram
queopapeldodesignerreconhecidodentrodaempresa,aopassoemque15profissionais
60%acreditamquetalreconhecimentoaconteceempartes,maspoderiamelhorar.No

211

outroextremo,apenas1profissional4%noacreditaqueseupapelesuasatribuies
sejam plenamente reconhecidos pelos demais profissionais ou departamentos dentro da
empresa.

Grfico5Conhecimento/reconhecimentododesignpelosdemaisprofissionais/departamentos

Fonte:Aautora,2013.

Emgeralosentrevistadosadmitiramqueoreconhecimentodoprofissionaldesigner
fosseumarealidade,entretanto,emsuaviso,avalorizaoaindaseencontradistantedo
desejvel. Reconhecese que o papel do designer importante no planejamento de
produtos e na estratgia da marca, mas o valor do profissional na empresa no adquiriu
ainda a mesma importncia dos atuantes em outras reas, conhecidas como mais
tradicionaisengenharia,porexemplo.
No que tange ao aumento de oportunidades de atuao para os designers na rea
automotiva questo cinco 16 profissionais 64% acreditam que houve um aumento
destas oportunidades. Do total, 7 profissionais 28% defenderam que este aumento
existe,maspoderiamelhorar,e2participantesnmeroequivalentea8%responderam
queemsuaviso,nohouveaumentodeoportunidadesnarea,comomostraoGrfico6.

212

Grfico6Aumentodeoportunidadesparaosdesignersnareaautomotiva

Fonte:Aautora,2013.

Osparticipantesendossaramoaumentodeoportunidadesnarea,asquaistmse
concretizado, no somente atravs da instalao de novos estdios anexos s subsidirias
das indstrias de automveis multinacionais, mas tambm por meio da atuao cada vez
maior dos designers no ramo de autopeas ou mesmo nos estdios anexos aos vrios
fornecedoresdaindstriatecidos,plsticos,pneus,entreoutros.Aindadeveseconsiderar
as oportunidades que surgem paralelamente s montadoras, a partir de iniciativas
individuais dos prprios designers, que por vezes, optam por sair da indstria e atuar seja
em escritrio prprio ou no sistema de consultoria A con Design e a AmoritzGT so
exemplosdessapostura.
Questionados na sexta pergunta sobre a autonomia para a criao e
desenvolvimentodeprojetos,salvoasinterfernciasjconhecidasporpartedasmatrizes,
do total de 25 participantes, 7 profissionais 28% declararam ser esta satisfatria,
enquanto 15 profissionais a maioria, correspondente a 60% acreditam que o nvel de
autonomia para propor inovaes poderia melhorar, sendo que 3 participantes 12%
consideraminsatisfatriaaautonomiaemsuaprticaprofissional.OGrfico7apresentaa
distribuiodasfrequncias.

213

Grfico7Autonomiaparaacriaoedesenvolvimentodeprojetos

Fonte:Aautora,2013.

Assumindoquehsubmissoemrelaomatriz,odescontentamentoemrelao
autonomia do designer dentro da empresa foi destacado no prteste pela maioria dos
entrevistados. Tal posicionamento foi reafirmado pelos entrevistados da segunda fase,
sendoomesmoperceptvelpelofatodeamaioriadosparticipantesterescolhidoaopo
poderiamelhorar.
Astimaquestotevecomoobjetivoconhecerapercepodosdesignersemrelao
crescente tendncia de desenvolvimento de projetos globais. O Grfico 8 revela que tal
tendncia vista por 17 participantes 68% da amostra como um aspecto positivo, em
contrapartida,8participantes32%apercebemcomoumaspectonegativo.

Grfico8Tendnciadedesenvolvimentodeprojetosglobais

Fonte:Aautora,2013.

214

Emboranafasedeprtesteosprojetosglobaistenhamsidoapontadoscomoparte
dapolticaindustrial,aqualdificultaumamaiorautonomianasunidadessubsidiriasnoque
sereferecriaodenovassoluesdedesign,nessasegundafasefoipossvelobservarque
a maioria da categoria percebe tal tendncia como um aspecto positivo, seja devido
oportunidadedeatuarforadopas,oumesmodevidochancequeodesigneosdesigners
brasileirostmdemostrarseupotencialnodesenvolvimentodegrandesprojetos.
Quantoaosaspectosnegativosenfrentadosnavivnciadiriadaprticaprofissional
questo oito dos sete aspectos apresentados foi solicitado aos participantes que
escolhessem os trs mais percebidos por eles como aspectos negativos em sua vivncia
profissionaldiria.
As sete opes apresentadas foram: Intervenes constantes das demais reas
modificando o projetoe as intenes do design; Reticnciadas demaisreas emrelao
rea do design; Presso por inovao constante em reduzido espao de tempo; M
comunicao entre as reas envolvidas no projeto e o design; Limitaes tcnicas e de
custos; Alinhamento de todas as variveis do projeto; Falta de um centro de pesquisas em
design avanado dentro do departamento de design, visando desenvolvimentos em
adiantado,partedosprazosdefinidoscombasenademandadelanamentoseDficitna
formaodosdesigners.
Das 75 respostas fornecidas, os trs aspectos mais votados corresponderam a 49
escolhas66%dototal.EmprimeirolugaraMcomunicaoentreasreasenvolvidasno
projeto e o design com 18 votos correspondendo a 37% foi apontada como o aspecto
maisnegativopercebidonaprticaprofissionaldentrodosestdios,seguidodeLimitaes
tcnicas e de custos, com 16 votos 33% e Intervenes constantes das demais reas
modificandooprojetoeasintenesdodesign,com15votos30%comopodeservisto
noGrfico9.

215

Grfico9Aspectosnegativospresentesnaprticaprofissional

Fonte:Aautora,2013.

OstrsaspectosvistoscomonegativosnarotinadeprofissionalM comunicao
entre as reas envolvidas no projeto e o design; Limitaes tcnicas e de custos e
Intervenesconstantesdasdemaisreasmodificandooprojetoeasintenesdodesign
tambmforamdestacadosnoprteste,todavia,aosolicitarqueosdesignersescolhessem
entretodososaspectosostrsmaisdifceis,ficaclaroqueexcluindooaspectodelimitaes
tcnicas e de custos, os outros dois mais votados dizem respeito falta de
interdisciplinaridade e as relaes que dessa advm, com o predomnio para a m
comunicao entre as reas, configurando um obstculo significativo para uma prtica
desejvel.
A questo de nmero nove indagava os participantes sobre aspectos os quais
promoveriam a melhoria de sua prtica profissional. Diante das seis opes apresentadas,
foisolicitadoaosrespondentesqueoptassempelastrsasquaiseramemsuapercepoas
melhorias mais necessrias e importantes no exerccio de suas atividades. Essas seis
alternativas compreenderam os seguintes temas: Mudana de postura da empresa em
relaoaodesign(valorizandomaisoseupapel);Posicionamentododesigncomointegrante
deumcentrododesenvolvimentodeprodutos;Maiorreconhecimentoporpartedasdemais
reas em relao ao design e suas atribuies; Foco do desenvolvimento priorizando o
usurio (e no somente na concorrncia); Criao de um centro de pesquisa em design

216

avanado dentro do departamento de design e Melhorias na formao dos designers


(aprimorandoaspectostcnicos,degestoecomunicao).
Das 75 respostas obtidas, os trs aspectos mais votados corresponderam a 58
escolhas 78% do total. Devido ao empate para as opes um e quatro as quais foram
tambmasmaisvotadasambasforamconsideradascomoosaspectosmaisimportantes
navisodosdesignersparaamelhoradaprticaprofissional.
Tais opes so, respectivamente, Mudana de postura da empresa em relao ao
design (valorizando mais o seu papel) e Foco do desenvolvimento priorizando o usurio (e
nosomentenaconcorrncia),cadaqualrecebeu17votos29%cada,totalizando58%.A
segunda opo mais votada foi Maior reconhecimento por parte das demais reas em
relaoaodesignesuasatribuies,com13votos23%eaterceirafoiCriaodeum
centro de pesquisa em design avanado dentro do departamento de design com 11 votos
computados19%.OsdadosestodistribudosnoGrfico10.

Grfico10Melhoriasnaprticaprofissional

Fonte:Aautora,2013.

Quanto s melhorias para sua rotina profissional, a escolha das trs mais
importantes,considerandooempatededuasemprimeirolugar,asquaiseramMudanade
postura da empresa em relao ao design (valorizando mais o seu papel) e Foco do
desenvolvimentopriorizandoousurio(enosomentenaconcorrncia),easopesMaior
reconhecimento por parte das demais reas em relao ao design e suas atribuies e
Criao deum centro de pesquisaem designavanado dentrododepartamentode design

217

como segundo e terceiro lugar respectivamente, refletiram a percepo de que o


reconhecimentoeavalorizaodoprofissionaldesignernaindstriadeautomveis,sem
dvida,aprincipalmelhoriaalmejadapelosparticipantes.
Ostrsaspectosindicadospelasquatroalternativasmaisvotadassoclaramente
componentes dessa valorizao, os quais foram, da mesma maneira, muito destacados na
fase de prteste. As melhorias almejadas passam pela mudana de postura da empresa;
pelorespeitoaosprazosnecessriosnodesenvolvimentodeprojetoscentradosnousurioe
no apenas na concorrncia; pelo maior reconhecimento das demais reas em relao ao
design e pela criao de um centro de pesquisas interno, o qual permitisse aos designers
desenvolver no apenas produtos acabados, mas tambm viabilizar inovaes parte do
velozcalendriodelanamentos.
Quantoaofuturodaprofissoquestodezosparticipantesforamconvidadosa
se posicionar em acordo ou desacordo, a partir de afirmaes originadas com base nos
relatos em profundidade captados na primeira fase da pesquisa. As afirmaes e os
posicionamentos dos designers so reveladas a seguir, com os respectivos resultados
apresentadosnaformadegrficoseposteriordiscusso.
Para a sentena, A curto e mdio prazos o mercado e a produo brasileiros no
sofrero muitas modificaes, 14 participantes 56% declararam concordar e 11
participantes44%discordaramGrfico11.

Grfico11Acurtoemdioprazosomercadoeaproduobrasileirosnosofreromuitasmodificaes

Fonte:Aautora,2013.

A afirmativa seguinte, O designer ter papel fundamental para a melhoria e o


desenvolvimento do produto carro, da mobilidade em geral e da sociedade, obteve a

218

concordnciade23profissionais92%eadiscordnciade2participantes8%como
mostraoGrfico12.

Grfico12Odesignerterpapelfundamentalparaamelhoriaeodesenvolvimentodoprodutocarro,da
mobilidadeemgeraledasociedade.

Fonte:Aautora,2013.

No que se referem terceira afirmativa, A atuao do profissional depender de


polticaspblicaseficientes,empresasresponsveisesociedadeconsciente,20profissionais
80%declararamconcordarcomamesma,sendoque5participantes20%declararam
sediscordantes.OGrfico13revelaadistribuiodefrequncias.

Grfico13Atuaodoprofissionaldependerdepolticaspblicaseficientes,empresasresponsveise
sociedadeconsciente

Fonte:Aautora,2013.

219

AltimaafirmativaSetornarnecessriaacriaodecentrosdepesquisaemdesign
avanadonosquaisaparticipaododesignerseressencialobteveaconcordncia de 22
participantes,correspondendoa88%.Amesmaafirmativateve3profissionaisdiscordantes
12%comorevelaoGrfico14.

Grfico14Setornarnecessriaacriaodecentrosdepesquisaemdesignavanadonosquaisa
participaododesignerseressencial

Fonte:Aautora,2013.

A anlise das quatro afirmativas componentes da questo dez A curto e mdio


prazos, o mercado e a produo brasileiros no sofrero muitas modificaes; O designer
ter papel fundamental para a melhoria e o desenvolvimento do produto carro, da
mobilidadeemgeraledasociedade;Atuaodoprofissionaldependerdepolticaspblicas
eficientes,empresasresponsveisesociedadeconscienteeSetornarnecessriaacriao
de centros de pesquisa em design avanado nos quais a participao do designer ser
essencial permitem inferir que, quanto ao futuro da profisso, as posturas so bem
delineadasereafirmamasanterioresverificadasnaprimeirafasedapesquisa.
Deacordocomosdesigners,omercadoeaproduobrasileirosnosofreromuitas
modificaes nos prximos anos, principalmente pela lentido com que o governo e os
usuriosbrasileirospercebem,acompanhameexigemmudanasdeposturaporpartedas
indstrias automotivas. Todavia, qualquer que seja a modificao implantada no futuro, o
designer ter papel fundamental, no que se refere melhoria e ao avano dos produtos
voltadosmobilidadeeaoseuuso.
Aatuaododesignernosprojetosfuturosenasadaptaesnecessriasaessesno
dependersomentedeseuempenhoprofissional,antesdevertercomopontos deapoio

220

polticaspblicaseficienteseempresasresponsveis,aliadasaumamudanadeposturapor
parte dos prprios usurios, os quais devem ser conscientes de suas necessidades e mais
exigentesdopontodevistadequalidadedoproduto.Ainda,segundoosdesigners,nessee
para esse futuro, com base na atual velocidade de mudanas dos projetos e da crescente
concorrncia, ser necessria a criao de centros de pesquisa em design avanado, nos
quais sua participao ser significativa, descobrindo e viabilizando novas maneiras de se
pensareconstruirocarroeamobilidadecomoumtodo.
Os dados obtidos nas duas fases da pesquisa fomentam as consideraes que se
seguem,asquaisforamtecidasapartirdohistricodoautomvelnoBrasil,daspercepes
dos designers participantes da pesquisa e do cenrio atual no qual tais profissionais
encontramse inseridos. Por fim, a partir dessas consideraes, sero constitudas
recomendaes percebidas como pertinentes s instituies de ensino formadoras dos
designers e s indstrias empregadoras dos profissionais formados, no sentido de que
ambas,emconjunto,trabalhemparaequacionarosobstculossobreosquaispodemagir,
contribuindoparaoavanodaprofissoeseumaiorreconhecimento.

221

222

CONSIDERAESFINAIS

A presente pesquisa objetivou levantar e analisar como os designers atuantes em


empresasdosetorautomobilsticonoBrasilpercebemosaspectosqueenvolvemsuaprtica
profissional no desenvolvimento de automveis na atualidade, e que perspectivas
profissionaisfuturaanteveemparaareadedesignautomotivo.
Demodomaisespecfico,pretendeuseinvestigarcomoessesaspectosinfluenciam
no desempenho dos profissionais e no processo de design de automveis. Buscouse
tambmque,aofimdapesquisa,fossemobtidosindicadoressobreaatividadeprofissional
com vistas a fundamentar a elaborao de recomendaes as quais contribuam para a
melhoriadaformaoprofissionaledaposteriorprticadosdesignersnareaautomotiva,
colaborando tambm para a produo e divulgao dos conhecimentos nesta rea do
design,aindatimidamenteexplorada.
Considerando a investigao como um todo, acreditase que tais objetivos foram
alcanados.Paralelamente,nodecorrerdessedesenvolvimento,novasquestesdepesquisa
foramencontradas,asquaismereceriamtornaremseobjetosdenovosestudos,sendoque
ocampododesignautomotivoconstituiumtemaoqualapresentavriosaspectospassveis
de abordagem por parte da pesquisa em design. Importa ressaltar que, em nenhum
momentopretendeuseesgotloaqui.
Na busca por conhecer mais sobre a atuao do designer no meio automotivo, a
realizaodapesquisapermitiuaprofundarosconhecimentos,nosomentesobreahistria
do automvel no Brasil, como tambm conhecer os muitos nomes responsveis por
construiressahistria.
Desdeasinstalaesdasprimeirasmontadoras,passandopelosmodelosproduzidos
pelas mesmas e pelos desenvolvimentos empreendidos paralelamente a essas, tornouse
perceptvelovolumedeprofissionaisbrasileirosenvolvidosnodesenvolvimentodocarrono
Brasil,osquaisporvezesdedicaramboapartedesuavidapessoaleprofissionalnainteno
de contribuir de alguma maneira para que o design automotivo brasileiro obtivesse
reconhecimento. Neste meio, merecem destaque as sucessivas tentativas de produo e
comercializao de projetos e a instalao de fbricas brasileiros. Propostas de veculos
comooAruanda1960,deautoriadeAriAntniodaRocha;oItaipu1974,deautoria
de Joo Amaral Gurgel e o MiniPuma 1974, de autoria de Milton Masteguin foram

223

importantes iniciativas de se repensar a mobilidade no Brasil, as quais poderiam ter


beneficiado o sistema de transportes brasileiro. A extino de propostas como essas,
resultantedafaltadeapoioeconmico,contudo,revelouasfalhasemtermosdeempenho
governamentalnoincentivosoluesdemobilidadenacionais.
Outro ponto de destaque no desenvolvimento da pesquisa foi a constatao da
tmidaproduodeliteraturavoltadaaoestudododesigndeautomveisedaatuaodo
designernessemeio.Emboraareasejaatualmentemuitoprocuradapelosestudantesde
design e pelos profissionais recmformados, muito pouco se aborda e se discute sobre a
profisso e seus profissionais no mbito acadmico brasileiro. Existem vrios estudos
voltadossmaisdiversasreasdodesignmobilirio,txtil,embalagem,grfico,editorial,
vesturio e acessrios so alguns exemplos e aos mais diversos produtos resultantes
dessas especialidades. O carro, contudo, apesar do importante espao que ocupa no
segmento dos objetos de uso Humano, permanece pouco explorado em amplas e mais
profundasdiscusses.
Comocrescimentomesmoquelentodeoportunidadesnosetoraliadoaofato
dos designers automotivos brasileiros conquistarem destaque nos cenrios nacional e
internacional, alm do necessrio envolvimento desses profissionais na criao e
aprimoramento de projetos para a mobilidade, tornase importante que a comunidade
acadmica tambm direcione esforos no sentido de desenvolver um maior nmero de
pesquisas,contribuindoparaaproduodenovosconhecimentosacercadotema.Ampliar
as discusses sobre o automvel e sobre os profissionais envolvidos na sua produo
contribui para a inovao constante do produto e para o fortalecimento da categoria dos
designers, na medida em que traz luz novas reflexes e possibilidades de atuao e
desenvolvimento dos projetos. Como resultado, ampliase tambm a divulgao da
produo do conhecimento para designers, usurios, estudantes, docentes e para a
sociedadecomoumtodo.Assim,apresentepesquisaintencionacontribuirmesmoquede
maneirainicial,paraaconstruodessecenrio.
Ametodologiaqualitativa/quantitativautilizadapermitiuconheceraspercepesdos
designers sobre os mais variados aspectos de sua prtica, em um primeiro momento
registrando as impresses mais especficas e detalhadas na viso de alguns profissionais
tomadascomoprteste,e,emumsegundomomento,obtendoaspercepesdacategoria
demaneiramaisampla,apartirdosparmetrosobtidosnasprimeirasentrevistas,osquais

224

foramaplicadosaumaamostradouniversodedesignersautomotivosematividadenoBrasil
noformatodequestionriosonline.
Alm da escassez de referncias bibliogrficas referentes ao tema, cabe destacar a
dificuldade em conseguir a colaborao dos designers no decorrer da pesquisa. Durante a
primeirafase,ocontatocomosoitodesignersparticipantessedeudemaneirareceptivae
rapidamenteforamobtidososdadosnecessrios.
Nasegundafase,entretanto,mesmoseguindoasmesmasetapasdeapresentaoe
contatorealizadasnaprimeirafase,aresistnciaporpartedosprofissionaismostrousebem
maior,sendonecessriooenviodelembretessinalizandoaimportnciadesuaparticipao
em um estudo voltado exatamente para ampliar a percepo de sua categoria e atuao
profissional.Percebese,portanto,quehumareticnciaporpartedosprofissionais,noque
concerne ao estabelecimento de relaes entre a indstria e a pesquisa acadmica, que
precisasersuperada.urgentequeosprofissionais,asempresaseasinstituiesdeensino
superior,relacionadasreadodesigneincentivadorasdodesignautomotivoassumam
a importncia de contribuir mutuamente para o avano dos campos nos quais atuam,
permitindose uma maior abertura no que tange ao intercmbio de conhecimento e
disponibilidadedeatuaoconjunta,sejaproduzindopesquisaoumesmoparticipandodela.
Superados os obstculos que se apresentaram no decorrer da pesquisa, a
oportunidadedeentraremcontatocomasconcepesdosprofissionaissobreosvariados
aspectos, os quais permeiam sua atuao, forneceu um rico material a ser discutido na
buscaporcomporumpanoramadaprofissodedesignerautomotivonoBrasileapartirdo
mesmoinferirsugestesquecontribuamparaaprofisso.
Embora exista na atualidade um aumento de oportunidades para designers que
busquem a rea do design automotivo, a mesma ainda no absorve a quantidade de
profissionais dispostos a atuar nela e, uma vez atuantes, os mesmos enfrentam srias
dificuldades, as quais englobam desde o preparo tcnico at as relaes interpessoais
inerentesprtica.
Os designers atuam de maneira interdisciplinar e embora muitos tenham revelado
seudescontentamentoemrelaoaestaabordagemprincipalmentedevidoaofatodea
mesmanoserdesenvolvidademaneiraadequada,amaioriaaenxergacomoumaspecto
positivo e necessrio para o desenvolvimento de um projeto to complexo quanto o de
veculos. Foi possvel observar queo conhecimento ereconhecimento dos designers e sua

225

atuaoporpartedosdemaisprofissionaisedepartamentosaindaseconstituiumabarreira
significativa a ser transposta por eles em seu diaadia. Uma das possveis causas dessa
dificuldade em atuar interdisciplinarmente pde ser detectada no momento em que os
designers apontaram a m comunicao entre as reas envolvidas no projeto como o
aspectomaisnegativodaprticaprofissional.
Tambm a autonomia para projetar no Brasil foi declarada como um aspecto da
prtica que poderia ser melhorado. Admitindose a interveno da matriz como decisiva
paraosrumosdosprojetos,osdesignersconsideraramque,porvezes,muitasdassolues
quegostariamoupoderiamproporseperdemoupermanecemapenasnocampodasideias,
nosomentepordependerdeaprovaodamatriz,mastambmpelaresistnciadeoutros
profissionaisedaprpriadiretoriaempermitirmaioresavanos.Nessecenrio,atendncia
de desenvolvimento de projetos globais vista de maneira positiva para a maioria dos
entrevistados no apenas pelas oportunidades que surgem para que os designers tomem
contatocomnovastecnologiasepotenciaisdedesenvolvimentojuntosmatrizes,pormeio
do intercmbio de conhecimentos, mas tambm se fundamenta no fato de que muitos
desenvolvimentos,naatualidade,solideradosnosomentepelasmatrizescomooutrora,
mastambmpelassubsidiriasdasmesmas,FordeVolkswagendoBrasilsoosexemplos
mais recentes. Tal postura oportuniza um exerccio maior de autonomia, ao permitir que
plantasfabrisinstaladasemdiversospasesproponhamsoluesdeprojeto,possibilitandoa
aos designers buscar atender a requisitos de qualidade de alto padro para o produto
brasileiro,considerandoacomplexidadeeadiversidadedecontextosnoqualodesignerse
insereesobreosquaisoprodutoporeleprojetadodesempenharimportantepapelnavida
dosusurios.
Das percepes apresentadas nessa pesquisa, as melhorias mais urgentes, na viso
dos designers, passam por uma mudana de postura da empresa em relao ao Design
valorizandomaisoseupapelepelofocododesenvolvimentodosprodutospriorizandoo
usurioenosomenteaconcorrncia.Taismelhoriassosintomticasdadesvalorizao
de dois aspectos, os quais deveriam ser atores importantes no desenvolvimento de
produtos:oDesigneousurio.SeamudanadeposturadaempresaemrelaoaoDesign
nosentidodevalorizlomaissefaznecessria,entendesequeodevidovaloratividade
eaosseus profissionaisnotemsidoumarealidadenaprticaprofissional.Ditoisto,se o
focododesenvolvimentoresideprincipalmentenasuperaodaconcorrncia,relegandoao

226

usurioumlugarabaixodomercado,oentendimentosobreaimportnciadoDesigneseu
papel revelase tambm equivocado, impactando diretamente na atuao do designer.
Percebese,portanto,queoprimeirofatorvalorizaonoadequadaaoDesignoriginao
segundo desvio das intenes do Design como projeto voltado ao usurio, para projeto,
visandoapenasolucrosendoesteconsequnciadiretadoprimeiro.
Emumsetorresponsvelpordesenvolverprodutoscomplexosetecnologiadeponta
comooautomotivo, taisimpressesexpressaspelosdesignerssinalizamque,mesmona
grandeindstria,oDesigncomocampodoconhecimentoaindasofreasconsequnciasde
posturasqueoveemcomoumadornoestticoimportanteparaoaumentodasvendas.Isso
se torna crtico na medida em que se aplica a um produto pelo qual o Homem se atrela
emocionalmente e que responsvel por sua mobilidade e principalmente segurana nos
diferentes usos cotidianos. Devemse tomar tais indicativos como srios reflexos de uma
posturaempresarialquenecessitaserrevistaomaisrpidopossvelcomvistasamelhoraro
desempenho do designer, resultando em um produto cada vez mais aprimorado, tendo o
usuriocomooatormaisimportantedoprojeto.
Navisodamaioriadosdesigners,nofuturoacurtoemdioprazos,omercadoea
produo brasileiros no sofrero muitas modificaes, mas o designer ter papel
fundamentalparaamelhoriaeodesenvolvimentodoprodutocarro,damobilidadeemgeral
edasociedade.Entretanto,serimprescindvelqueodesigneratuanteestejaconscienteda
necessidade de se repensar antes os sistemas de mobilidade, para alm do automvel,
levando em considerao aspectos maiores no desenvolvimento de produtos para a
mobilidade,aointegrarcuidadosrelacionadosaomeioambienteevidadoserhumano.
Entretanto, sua participao depender em grande parte no apenas do
posicionamento das empresas que os empregam, mas tambm de polticas pblicas
eficientes s quais trabalhem a favor do desenvolvimento urbanstico e virio, tornandoo
adequado em termos de acesso e mobilidade principalmente nos grandes centros.
Tambmsuaatuaodependerdeumamudananoperfildosconsumidores,osquaisse
mostrem mais conscientes de seus direitos e proporcionalmente exigentes quanto
qualidade dos produtos que compram em relao ao preo praticado pelo mercado,
exigindomaisdoqueojapresentadoepopularmenteconhecidocomocarroemergente.
Tambm como resultado das frustrantes experincias vivenciadas na prtica pela
falta de interdisciplinaridade, pautada pela cobrana por inovao constante em curto

227

espaodetempoalmdosentravesdeatuaoconjuntademuitosprofissionaisemum
mesmo projeto, agravadas pela dificuldade na comunicao e nas relaes interpessoais
advindas dessa prtica uma das perspectivas mais apontadas pelos designers como
importantes para o futuro da profisso seria a criao de Centros de Pesquisa &
Desenvolvimento Inter/Transdisciplinares nos quais a participao do designer seria
essencialcomopesquisadorenoapenasprojetista.
A estrutura desses centros teria carter inter/transdisciplinar adequado diferente
da falta de interdisciplinaridade verificada atualmente e detectada por essa pesquisa e
compreenderiaumaequipeformadapormembrosdereaschaveenvolvidasnoprojetodo
veculodesign,planejamentodoproduto,engenharia,compras,custos,marketing,entre
outros. Tais profissionais, trabalhariam de maneira totalmente integrada como propem
os conceitos de inter e transdisciplinaridade paralelamente aos desenvolvimentos do
produtoprevistosemcalendrio,eque,respondemaomercadoprospectandotendncias,
testandomateriaiseviabilizandoinovaes.
A adoo desse centro/laboratrio de Pesquisa & Desenvolvimento avanado
poderia originar um espao de experimentao, visando constituir a unidade do
conhecimento como instrumento para o desenvolvimento e aprimoramento constante do
projetodoprodutocarro.Nessescentros,aparteinventivaedetestesparaainovaoseria
adiantada em relao ao calendrio oficial de lanamentos e entregaria para o
departamento de Design solues a serem utilizadas dependendo do tempo de
desenvolvimentodasmesmasemprojetosimediatosefuturos.Talcenriopermitiriaaos
designers atuantes fora do centro avanado, variadas opes de projeto j testadas,
aprovadas, custeadas e prontas para uso nos projetos de calendrio, agilizando o
desenvolvimento do produto e sua entrada na linha de montagem alm de desenvolver
soluesemlongoprazo.
Tendo em vista o panorama apresentado, algumas consideraes e at mesmo
propostas se fazem pertinentes no sentido de que essa pesquisa possa contribuir para a
mudana das posturas vigentes, visando superar alguns desafios histricos e profissionais
impostos para a prtica dos designers de automveis e detectados no decorrer da
investigao. A partir das percepes coletadas e analisadas, verificouse que tanto a
formaonauniversidadequantoaformaocontinuadaouainexistnciadessaltima

228

empreendida no mercado de trabalho, exercem influncias importantes na atuao e no


desempenhodosdesigners.
parteosaspectossobosquaisnosepodeagirpromovendomudanasefetivas
como, por exemplo, a poltica das matrizes em relao s subsidirias os demais pontos
destacadospelosentrevistadosrevelaramaexistnciadelacunasnasfasesdeformaoe
posterioratuaodentrodaindstria.Taispercepesindicamqueumamudana,noque
tange interao entre instituio de ensino e indstria seria benfica e contribuiria para
ummelhordesempenhoprofissionaleconsequentereconhecimentodosdesigners.
Como dito, no se pretende esgotar as possibilidades de ao, mudanas ou
melhorias,antes,buscaseapresentarmesmoquedemaneirainicialalgumasreflexes
que possam auxiliar na tomada de decises inerentes aos dois principais espaos
responsveis pelos rumos da profisso: a universidade como responsvel pela formao
inicial e continuada atravs de programas de psgraduao e a indstria como rea
responsvel pela prtica e pela formao continuada em atuao visando promover um
maiorreconhecimentododesignereseupapelnaindstriaautomobilstica.
No que se refere formao dos designers, a pesquisa revelou a necessidade do
aprimoramento da formao tcnica dos alunos, abordando processos produtivos,
discutindo a realidade do desenvolvimento de projetos ao considerar os obstculos
comumenteencontradosnaprticaprofissional.Tambmfoiidentificadaaurgnciaemse
trabalharcompetnciasformativascomoacomunicaointerpessoaleogerenciamentode
conflitos,umavezqueambasinfluenciamdiretamenteodesempenhodosdesignersdentro
da prtica interdisciplinar e originam uma barreira considervel possibilidade de uma
abordagemtransdisciplinar.
Alm dos aspectos formativos, seria importante que as instituies de ensino
superior ampliassem a pesquisa e a disseminao de conhecimentos acerca do campo do
designdeautomveisemobilidade,formandonosomentemodeobraparaaindstria,
mas tambm pesquisadores dedicados ao tema, fortalecendo como consequncia esse
campodepesquisaaindatimidamenteabordado.
Noobstanteasbarreirasimpostasporvezespelasprpriasempresas,tambmcabe
s instituies de ensino superior encontrar meios de ao junto indstria para alm da
preparao dos alunos, para competir nos atuais concursos de design promovidos por
algumas montadoras, visando encontrar novos estagirios e possveis futuros designers

229

automotivosporexemplo,oTalentoVolkswagenDesigneoConcursoFordNovosTalentos
do Design. Muitos so os fatores envolvidos e impeditivos para uma interao maior
entreUniversidade/indstriataiscomoaquestodosigiloindustrial,agestodaproduo
deinovaocolaborativa,apatentecompartilhadaemesmoaadequaodoregimentodas
instituiesdeensinoedasintenesdasmultinacionais,nosentidodebuscarageraode
conhecimentoemconjunto.
Taisfatores,contudo,devemserponderadosporambososlados,visandoaoganho
comum que a parceria Universidade/indstria pode promover para o avano do design
automotivo, da formao dos futuros designers e da aplicao efetiva da pesquisa na
produo da inovao industrial. Alm desses fatores, a transposio dos obstculos
permitiria que dessa interao resultasse tambm uma ampla difuso, para os demais
departamentosdaindstria,sobreoqueodesignequaloseupapel.
Por conseguinte, cabe s indstrias posicionarse no sentido de promover uma
aberturaparaasinstituiesdeensino,buscandofirmarparceriasouconvniosnosquaisa
troca de conhecimentos seria uma constante, tanto para os alunos interessados na rea
nos nveis de graduao e psgraduao quanto para a indstria, que passaria a ter
contato direto com as pesquisas produzidas no mbito acadmico as quais de maneira
importante,poderiamcontribuirparaodesenvolvimentodeseusprojetos.
Umavezabertasasviasdeinterao,umformatopossveldesertrabalhadodentro
das montadoras para alm das oportunidades de estgio para estudantes seria a
constituiodegruposdeestudo,aprincpiointernosaosestdiosdedesign.Adinmicade
trabalho nos encontros desses grupos compreenderia reunies peridicas entre
pesquisadoresemdesigneosprincipaisprofissionaisresponsveistantopelodepartamento
dedesign,quantopelosdemaisdepartamentosenvolvidosnosprojetosdeveculos.
Na ocasio desses encontros, seriam apresentadas e discutidas as produes em
termosdepesquisanareadodesignacadmicaeindustrialasquaispoderiamauxiliar
nosomenteosdesignersaaprimorarseurepertrioesuaargumentaonogerenciamento
das adversidades e situaes de conflito, como tambm as demais reas a compreender
melhor a funo do design e dos designers dentro da empresa, uma vez que a falta de
conhecimento e reconhecimento do design por parte das demais reas revelouse um
aspecto grave detectado nessa investigao e que impacta diretamente na prtica
interdisciplinardesseprofissional.

230

Ainserodadinmicadeconstituiodosgruposdeestudodentrodasmontadoras
configura uma proposta de ao que aproximaria universidade e indstria e constituiria
tantouminstrumentodeformaodenovosdesignersparaomercadoeparaapesquisa
emdesignautomotivobemcomoparaaformaocontinuadadosdesignersematuao.
Paralelamente, ampliaria a possibilidade de prticas semelhantes nas demais reas
correlatas ao projeto Engenharia, Marketing, Comunicao entre outras de modo que
essas tambm fossem objeto de estudo dos prprios designers, na inteno de
instrumentalizar os diferentes atores no apenas sobre os aspectos que caracterizam sua
readeformao,mastambmasdemaisreascomasquaisestaroemconstantecontato,
na inteno de prevenir os variados obstculos que se fazem no exerccio da prtica do
designeredosdemaisprofissionais.
Comoconsequnciadessaaproximao,ointercmbiodeconhecimentospermitiria
Universidade compreender melhor as demandas do mercado de trabalho na indstria
automotivae,emcontrapartida,garantiriaaestaltimaconhecerarealidadedascondies
de formao de seus futuros profissionais nas instituies de ensino superior.
Paralelamente, ambas teriam acesso aos resultados de importantes pesquisas voltadas ao
projetodocarro,aprojetosfuturosvoltadosmobilidadeeprofissodedesignerdemodo
amplo, favorecendo tambm a produo conjunta de conhecimentos de maneira que
formaoeprticasemantenhamemsintonia.
O Diagrama 5 representa de maneira sinttica as relaes possveis de serem
estabelecidas entre universidade e indstria, tendo como referncia a literatura estudada,
os dados apresentados e as anlises resultantes dos mesmos. Importa ressaltar que o
contedo do diagrama abre a possibilidade de estudos futuros, visando aprofundar ainda
maisasreflexesdiantedosdesafiospresentesnaprticadodesignerautomotivo.

231

Diagrama5RelaespossveisdeseremestabelecidasentreUniversidadeeIndstriavisandomelhoriada
prticadodesignerautomotivoeoreconhecimentodaprofisso

Fonte:Aautora,2013.

Esperase que a presente pesquisa contribua para a divulgao das discusses e


reflexes acerca do campo do design automotivo no Brasil, no somente no mbito
acadmico, mas tambm industrial. Esperase ainda que as inferncias aqui apresentadas
sirvam de base para futuras investigaes empenhadas em buscar novos caminhos para o
aprimoramento qualitativo da profisso de designer automobilstico, considerando as
relaesqueenvolvemodesign,asociedade,auniversidade,asempresasedentrodessas
asdemaisreaseostantosoutrosprofissionaisosquaistrabalhamcomodesignereparaa
concretizaodeprojetosemdesign.
Porfim,esperasequeapresentepesquisasejaumconvitereflexoporpartedos
designers,paraqueabuscapormelhorarasieasuaprticasejaumaconstante,semperder
devistaaimportnciadesuaaocomoprodutordeumdosobjetosdeusomaispresentes

232

navidadoserHumanoequeselembrem,diariamente,derealizaressaaocomfocono
somentenomercadodoproduto,masanteseprincipalmente,comfoconasociedade.

233

234

REFERNCIAS

AMATUCCI, M; SPERS, E. E. The Brazilian biofuel alternative. International Journal of


AutomotiveTechnologyandManagement.Vol10,No1,p.3755,2010.Disponvelem:
<http://www.inderscience.com/info/inarticle.php?artid=31455>.Acessoem:28dez.2012.

ANFAVEA ASSOCIAO NACIONAL DOS FABRICANTES DE VECULOS AUTOMOTORES BRASIL.


Indstria Automobilstica Brasileira 50 anos. So Paulo, 2006. 194 p. Disponvel em:
<http://www.anfavea.com.br/50anos.html>.Acessoem:09fev.2012.

ANFAVEA ASSOCIAO NACIONAL DOS FABRICANTES DE VECULOS AUTOMOTORES BRASIL.


Automotive Guide 2010: catlogo. So Paulo, 2010. 176 p. Disponvel em:
<http://www.anfavea.com.br/catalogos.html>.Acessoem:17abr.2012.

ANFAVEA ASSOCIAO NACIONAL DOS FABRICANTES DE VECULOS AUTOMOTORES BRASIL.


Empresas
associadas.
So
Paulo,
2012.
Disponvel
em:
<
http://www.anfavea.com.br/associadas.html>.Acessoem:17abr.2012

ANFAVEA ASSOCIAO NACIONAL DOS FABRICANTES DE VECULOS AUTOMOTORES BRASIL.


Anurio da Indstria Automobilstica Brasileira 2013. So Paulo, 2013. 162 p. Disponvel em:
<http://www.anfavea.com.br/anuario.html>.Acessoem:05jul.2013.

BALCET, G; CONSONI, F. L. Global technology and Knowledge Management: product


developmentinBraziliancarindustry.InternationalJournalofAutomotiveTechnologyand
Management.Vol7,No2/3,p.135152,2007.Disponvelem:
<http://www.inderscience.com/info/inarticle.php?artid=14971>.Acessoem:28dez.2012.

BARBETTA,P.A.Estatsticaaplicadascinciassociais.Florianpolis:EditoradaUFSC,2001.

BARDIN,L.Anlisedecontedo.Lisboa:Edies70,2011.

BEREZOVSKY, S. Karmann Ghia TC. Quatro Rodas, So Paulo, mar.2004. Disponvel em: <
http://quatrorodas.abril.com.br/classicos/brasileiros/conteudo_140432.shtml#galeria>.
Acessoem:10dez.2012.

BONSIEPE,G.Design,CulturaeSociedade.SoPaulo:Blucher,2011.

BOTELHO,R.D.;CMARA,J.J.D.Umaexperinciaacadmicaemdesignautomotivo.Actasde
Diseo,BuenosAires,ano3,v.6,n.6,p.124125,mar.2009.

BRASIL. Ministrio do Desenvolvimento, Indstria e Comrcio Exterior. Decreto estabelece


asregrasdoInovarAuto,novoregimeautomotivobrasileiro.Braslia:2012.Disponvelem:
< http://www.desenvolvimento.gov.br/sitio/interna/noticia.php?area=1&noticia=11857>.
Acessoem:28jul.2013.

235

BRITO, E.A. Mundo descobre que carro brasileiro inseguro; custo no desculpa, diz
NCAP.
Uol
Carros,
So
Paulo,
13
mai.2013.
Disponvel
em:
<
http://carros.uol.com.br/noticias/redacao/2013/05/13/imprensainternacionaldescobre
quecarrobrasileiroeinseguro.htm>.Acessoem:15mai.2013.

BUARQUE, S. Esta cidade j poderia existir no Brasil. Quatro Rodas. So Paulo, abr.1979.
p.5258.Disponvelem:<http://quatrorodas.abril.com.br/acervodigital/home.aspx>Acesso
em:01nov.2013

CAMANZI, E; CARSUGHI, C; DEL CORSO, F; FERREIRA,R. Emerson: vou correr mais quatro
anos entrevista. Quatro Rodas. So Paulo, dez.1977. p.140144. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/home.aspx>Acessoem:28out.2013

CAMPOS,A.ACDesign,2013.Disponvelem:<http://www.anisiocampos.com/design.html>.
Acessoem:10out.2013

CARANDDRIVER.ConheaosirmosPavone,designersdoVWUp!eJetta.CarandDriver.
SoPaulo,11jul.2012.Disponvelem:<
http://caranddriverbrasil.uol.com.br/carros/especial/conhecaosirmaospavonedesigners
dovwupejetta/2595>.Acessoem:11set.2013

CARDOSO,M.A.;KISTMANN,V.B.;Modularizaoedesignnaindstriaautomotiva:ocaso
domodeloFoxdaVolkswagendoBrasil.RevistaProduoOnline,v.9,n.1,p.146169,mar.
de
2009.

Disponvel
em:
<http://www.producaoonline.org.br/index.php/rpo/article/viewFile/197/316>. Acesso em:
10jul.2012

CARDOSO,R.UmaintroduohistriadoDesign.SoPaulo:EditoraBlucher,2008.

CARDOSO.R.Designparaummundocomplexo.SoPaulo:CosacNaify,2012.

CARVALHO,E.G.Globalizaoeestratgiascompetitivasnaindstriaautomobilstica:uma
abordagem a partir das principais montadoras instaladas no Brasil. Revista
Gesto&Produo, v.12, n.1, p.121133, janabr. 2005. Disponvel em
<http://www.scielo.br/pdf/gp/v12n1/a11v12n1.pdf>.Acessoem:10jul.2012

CAMARGO. O.S. As mudanas na organizao e localizao da indstria automobilstica


brasileira (1996 2001). 2006. 323p. Tese (Doutorado em Economia), Centro de
Desenvolvimento e Planejamento Regional da Faculdade de Cincias Econmicas,
Universidade Federal de Minas Gerais, Belo Horizonte. Disponvel em: <
http://cedeplar.ufmg.br/economia/teses/2006/OTAVIO_SILVA_CAMARGO.pdf> Acesso em:
05ago.2012.

CESAR, J. Anfavea rebate artigo sobre carros mortais no Brasil. Carplace. So Paulo, 15
mai.2013. Disponvel em: <http://carplace.virgula.uol.com.br/anfavearespondeaartigosobre
carrosmortaisnobrasil/>Acessoem:15mai.2013.

236

COELHO,L.A.L.Conceitoschaveemdesign.RiodeJaneiro:EdPUCRioNovasideias,2008.

DE MORAES, D. Anlise do design brasileiro: entre mimese e mestiagem. So Paulo:


EdgardBlcher,2006.

DIRIODOCOMRCIO,INDSTRIA&SERVIOS.FiatlananovoUnoemiramercadolatino
americano.DCIIndstria.SoPaulo,mai.2010.Disponvelem:<
http://www.dci.com.br/industria/fiatlancanovounoemiramercadolatinoamericano
id220108.html>.Acessoem:12set.2013

DIAS, A.V.C. Descentralizao do desenvolvimento de produtos globais no setor


automotivo: proposies para a participao brasileira. In: XXI Encontro Nacional de
Engenharia de Produo, 2001, Salvador. Anais eletrnicos. Salvador: ABEPRO/ FTC,
UNIMEP,
UFRGS,
UFSC,
2001.
Disponvel
em:
<
http://www.abepro.org.br/biblioteca/ENEGEP2001_TR52_0798.pdf>. Acesso em: 11
jul.2012.

DIAS, A.V.C; SALERNO,M.S. Construindo competitividade por meio da organizao do


desenvolvimento de produtos globais: proposies a partir de estudos de caso no setor
automotivobrasileiro.In:XXIIIEncontroNacionaldeEngenhariadeProduo,2003,Ouro
Preto. Anais eletrnicos. Ouro Preto: ABEPRO/ UFOP, 2003. Disponvel em: <
http://www.abepro.org.br/biblioteca/ENEGEP2003_TR0502_1378.pdf>. Acesso em: 11
jul.2012.

ESCOREL,A.L.Oefeitomultiplicadordodesign.SoPaulo:EditoraSENACSoPaulo,2000.

FELTRIN,L.Designtupiniquim:Montadorasdesenvolvem,noBrasil,carrosparaomercado
mundial.RevistaPIB:PresenaInternacionaldoBrasil.SoPaulo:EditoraTotum,2013.
Disponvelem:<http://www.revistapib.com.br/noticias_visualizar.php?id=1045>.Acesso
em:11ago.2013

FIAT AUTOMVEIS. Fiat Institucional. Disponvel em: <http://www.fiat.com.br/mundo


fiat/institucional.jsp.>Acessoem:20jul.2012.

FORD MOTOR COMPANY. Ford Kinetic Design, 2013. Disponvel em:<


http://www.ford.pt/VeiculosPassageiros/KineticDesign>.Acessoem:10set.2013.

FORTY,A.Objetosdedesejodesignesociedadedesde1750.SoPaulo:CosacNaify,2007.

FRAINER, D.M. A estrutura e a dinmica da indstria automobilstica no Brasil.


UniversidadeFederaldoRioGrandesoSulFaculdadedeCinciasEconmicas.PortoAlegre:
2010. Programa de PsGraduao em Economia. Tese. Disponvel em:
<http://www.lume.ufrgs.br/bitstream/handle/10183/30638/000766269.pdf?sequence=1>A
cessoem:17ago.2013

237

GENERAL
MOTORS
DO
BRASIL.
Sobre
a
GM.
Disponvel
em:
<http://www.chevrolet.com.br/UniversoChevrolet/sobreagm/acompanhia.html.> Acesso
em:20jul.2012.

HESKETT,J.Desenhoindustrial.RiodeJaneiro:JosOlympio,2006.

HESKETT,J.Design.SoPaulo:tica,2008.

HYUNDAI MOTORS BRASIL. Material de divulgao em ponto de venda do modelo iX35,


2010.
Disponvel
em:<
http://www.hyundai.com/ba/en/wcm/groups/public/@ba/documents/unclassifiedcontent/i
x35katalog.pdf>.Acessoem:10set.2013

IBUSUKI,U;KOBAYASHI,H;KAMINSKI,P.C.Localisationofproductdevelopmentbasedon
competitiveadvantageoflocationandgovernmentpolicies:acasestudyofcarmakersin
Brazil. International Journal of Automotive Technology and Management. Vol 12, No 2,
p.172196,2012.Disponvelem:
<http://www.inderscience.com/info/inarticle.php?artid=46861>.Acessoem:28dez.2012.

KINDERSLEY,D.Olivrodocarro:enciclopdiavisual.RiodeJaneiro:GloboEditora,2012.

LAMM, M.; HOLLS, D.A Century of Automotive Style: 100 Years of American Car Design.
LammMoradaPubCo,1996.306p.

LANDIM,P.C.Design,empresa,sociedade.Braslia:CulturaAcadmica,2010.

LARICA, N.J. Design: de transportes: Arte em funo da mobilidade. Rio de Janeiro: 2AB/
PUCRio,2003.

LATINNCAP. Latin New Car Assessment Programme, 2013. Disponvel em:<


http://www.latinncap.com/po/explicacoesdostestes>.Acessoem:18ago.2013

LOBACH,B.DesignIndustrialBasesparaaconfiguraodosprodutosindustriais.1.ed.
SoPaulo:EdgardBlucher,2001.
LOBINI.Lobini:aempresa,2013.Disponvelem:<http://www.lobini.com.br/site/index.php
>.Acessoem:9set.2013.

MARCONI, M. A.; LAKATOS, E. M. Tcnicas de pesquisa: planejamento e execuo de


pesquisas, amostragens e tcnicas de pesquisa, elaborao, anlise e interpretao de
dados.7ed.SoPaulo:Atlas,2009.

MAGALHES, A. Ford apresenta Ka Concept. Auto Esporte, So Paulo, 13 nov.2013.


Disponvel em: < http://revistaautoesporte.globo.com/Noticias/noticia/2013/11/ford
apresentakaconcept.html>.Acessoem:14nov.2013.

238

MANERA,R.MiniPuma:umcarrobrasileiroquepoderfazer20km/litro.QuatroRodas,So
Paulo,
ano
15,
n.174,
jan.
1975,
p.2429.
Disponvel
em:
<
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:12mai.2014.

MATSUBARA,V.CheryassumeoperaesnoBrasil.QuatroRodas,SoPaulo,27mar.2012.
Disponvel em: < http://quatrorodas.abril.com.br/noticias/cheryassumeoperacoesbrasil
319043_p.shtml>.Acessoem:10dez.2012.

MEYER. G.C. Quem os designers pensam que so? Notas de um discurso profissional.
Revista D Revista acadmico cientfica da Faculdade de Design UniRitter Graduao e
PsGraduao.Vol3,no3,2011.Disponvelem:
<http://seer.uniritter.edu.br/index.php/revistadesign/article/viewFile/420/255>.Acessoem:
07jul.2012.

MIYAKE,D.I;NAKANO,D.ImplementationofCorporateProductionSystemsintheBrazilian
autoindustry:managingknowledgethroughpractice.InternationalJournalofAutomotive
TechnologyandManagement.Vol7,No2/3,p.153167,2007.Disponvelem:
<http://www.inderscience.com/info/inarticle.php?artid=14972>.Acessoem:28dez.2012.

MORAES, B. Santa Catarina deve abrigar a fbrica da BMW. Quatro Rodas, So Paulo, 20
out.2012. Disponvel em: < http://quatrorodas.abril.com.br/noticias/fabricantes/bmwtera
fabricasantacatarinadizagencia708305.shtml>.Acessoem:10dez.2012.

MOREIRA,M.E.ConheaahistriaeascriaesdocentrodedesigndaVW.BDExpert.com.
So Paulo, 17 mai.2011. Disponvel em: < http://www.bdxpert.com/2011/05/17/deixamos
deservisitantesparafazermospartedaforcaintelectual/#>.Acessoem:12set.2013

MORENO,J.C.Daspranchetasaoscomputadores.QuatroRodas,SoPaulo,ano34,n.409,
ago.1994,p.6875.Disponvelem:<http://quatrorodas.abril.com.br/acervodigital/>Acesso
em:28ago.2013.

MORITA, F. Segredos do Design automotivo na viso da AmoritzGT. So Paulo: SENAISP


editora,2013a.

MORITA, F. Fernando Morita: entrevista. Bauru, 2013b. Entrevista concedida por email a
CarolinaVaitiekunasPizarroem31out.2013.

MOZOTA,B.Bde;KLOPSCH,C.;COSTA,F.C.X.da.Gestododesign:usandoodesignpara
construirvalordemarcaeinovaocorporativa.PortoAlegre:Bookman,2011.

NEGRI, J.A.; LEMOS,M.B. (Orgs.) O ncleo tecnolgico da indstria brasileira. Ipea. FINEP.
ABDI,
Vol.1.
Braslia:
2011.
Disponvel
em:
<http://www.abdi.com.br/Estudo/NucleoTecnologicoVolume1.pdf>. Acesso em: 27
ago.2013
NICOLESCU,B.Manifestodatransdisciplinaridade.SoPaulo:TRIOM,2005.

239

NORMAN,D.A.DesignEmocional:porqueadoramos(oudetestamos)osobjetosdodiaa
dia.RiodeJaneiro:Rocco,2008.

OLIVEIRA, D.F. Mensurando o valor da marca, a reputao e a identidade no setor


automotivo. 2006. 156p. Dissertao (Mestrado em Administrao), Centro de Ps
Graduao e Pesquisa em Administrao, Universidade Federal de Minas Gerais, Belo
Horizonte. Disponvel em: < http://dspace.lcc.ufmg.br/dspace/bitstream/1843/CSPO
6WQQ5D/1/Dissertacao+Daniela.pdf>Acessoem:05ago.2012.

ONO,M.M.DesigneCultura:sintoniaessencial.Curitiba:EdiodaAutora,2006.

ONO,M.M.Designindustrialediversidadecultural:sintoniaessencial.Estudosdecasosnos
setores automobilstico, moveleiro e de eletrodomsticos no Brasil. 2004. 1200 p. Tese
(Doutorado em Arquitetura e Urbanismo), Faculdade de Arquitetura e Urbanismo,
Universidade
de
So
Paulo,
So
Paulo.
Disponvel
em:
<http://www.designcultura.org/menu/teses/tese01/tese01.php.>Acessoem:08fev.2012.

PADILHA, A. Criador do Fox desvenda o design. Jornal da Cidade de Bauru, Bauru, 13


mai.2010.EntrevistacomLuizAlbertoVeiga.CadernoGeral,p.8.

PIZARRO,C.V;LANDIM,P.C.ApesquisaemDesignAutomotivonoBrasil:evidnciasdotema
noP&DDesigneCIPED.In:10CONGRESSOBRASILEIRODEPESQUISAEDESENVOLVIMENTO
EMDESIGN.2012,SoLus.Anais...SoLus:UFMA,2012.1CDROM.

PHILLIPS,P.L.Briefing:Agestodoprojetodedesign.SoPaulo:EditoraBlucher,2008.

PROFF,H. What will happen to Brazilian automotive subsidiaries after their parent
companies make the transition to electric mobility? International Journal of Automotive
TechnologyandManagement.Vol11,No4,p.356375,2011.Disponvelem:
<http://www.inderscience.com/info/inarticle.php?artid=43167>.Acessoem:28dez.2012.

QUATRO RODAS. So Paulo, ano 5, n.55, fev. 1965, p. 4344. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:17ago.2013.

_______________. So Paulo, ano 7, n.73, ago. 1966, p.99102. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:18ago.2013.

_______________. So Paulo, ano 7, n.83, jun. 1967, p.2833. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:20ago.2013.

_______________. So Paulo, ano 9, n.102, jan. 1969, p.7073. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:30ago.2013.

_______________. So Paulo, ano 11, n.123, out. 1970, p.110117. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:10set.2013.

240

_______________. So Paulo, ano 11, n.141, abr. 1972, p.6067. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:15set.2013.

_______________. So Paulo, ano 14, n.164, mar. 1974, p.3641. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:18set.2013.

_______________. So Paulo, ano 16, n.186, jan. 1976, p.6. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:20out.2013.

_______________. So Paulo, ano 23, n.276, jul. 1983, p.9698. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:21out.2013.

_______________. So Paulo, n.361, ago. 1990, p.3642. Disponvel em: <


http://quatrorodas.abril.com.br/acervodigital/>Acessoem:28out.2013.

_______________. So Paulo, ano 34, n.411, out. 1994, p.5058. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:30out.2013.

_______________. So Paulo, ano 36, n.435, out. 1996, p.5465. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:01nov.2013.

_______________. So Paulo, ano 38, n.459, out. 1998, p.5670. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:01nov.2013.

_______________. So Paulo, ano 40, n.483, out. 2000, p.8099. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:03nov.2013.

_______________. So Paulo, ano 42, n.507, out. 2002, p.4155. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:03nov.2013.

_______________. So Paulo, ano 44, n.531, out. 2004, p.5082. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:04nov.2013.

_______________. So Paulo, ano 46, n.556, set. 2006, p.5471. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:04nov.2013.

_______________. So Paulo, ano 48, n.584, nov. 2008, p.60101 Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:07nov.2013.

_______________. So Paulo, ano 50, n.609, out. 2010, p.5069. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:10nov.2013.

_______________. So Paulo, 2012. Especial Salo do Automvel 2012. Disponvel em: <
http://quatrorodas.abril.com.br/acervodigital/>Acessoem:11nov.2013.

241

RACHID, A. Relations between small and large auto parts manufacturers in Brazil.
InternationalJournalofAutomotiveTechnologyandManagement.Vol1,No2/3,p.335346,
2001.Disponvelem:
<http://www.inderscience.com/info/inarticle.php?artid=54>.Acessoem:28dez.2012.

ROBERTI,B; MATSUBARA,V. Design: fator determinante na compra de um carro.Quatro


<
Rodas,
So
Paulo,
mai
2012.
Disponvel
em:
http://quatrorodas.abril.com.br/reportagens/designfatordeterminantecompracarro
684842.shtml>.Acessoem23ago.2013.

ROCHA,A.A.AriAntniodaRocha:entrevista.Bauru,2013.Entrevistaconcedidaporemail
aCarolinaVaitiekunasPizarroem19nov.2013.

SAMPIERI, R.H; COLLADO, C.H; LUCIO, P.B. Metodologia de Pesquisa. 3. Ed. So Paulo:
McGrawHill,2006.

SCAVARDA, L.F; BARBOSA, T.P.W; HAMACHER,S. Comparao entre as tendncias e


estratgiasdaindstriaautomotivanoBrasilenaEuropa.RevistaGesto&Produo,v.12,
n.3,
p.361375,
set.dez.
2005.
Disponvel
em
<
http://www.scielo.br/pdf/gp/v12n3/28025.pdf>.Acessoem:11jul.2012.

SCHNEIDER,B.DesignUmaintroduo:odesignnocontextosocial,culturaleeconmico.
SoPaulo:EditoraBlcher,2010.

SILVA,J.C.R.P.etal.OfuturododesignnoBrasil.SoPaulo:CulturaAcadmica,2012.

SPARKE,P.ACenturyofCarDesign.Barron's,2002.

SPARKE,P.Diseoyculturaumaintroducindesde1900hastalaactualidad.Barcelona:
EditorialGustavoGiliGGDiseo,2010.

TOLEDO,J.C.de;FERRARI,F.M;ALLIPRANDINI,D.H;MARTINS,R.A;MARTINS,M.F;SILVA,
S. L. Product development process in the Brazilian autoparts industry: management
practicesandtrends.InternationalJournalofAutomotiveTechnologyandManagement.Vol
4,No1,p.4061,2004.Disponvelem:
<http://www.inderscience.com/info/inarticle.php?artid=14971>.Acessoem:28dez.2012.

VENTURA,T. Volkswagen lana o up! Como o Fusca do sculo XXI. Portal Vrum. Belo
Horizonte,
4
fev.2014.
Disponvel
em:
<
http://estadodeminas.vrum.com.br/app/noticia/noticias/2014/02/04/interna_noticias,4905
4/volkswagenlancaoupcomoofuscadoseculo21.shtml>.Acessoem:4fev.2014.

VIEIRA,A;GARCIA,F.C.Gestodoconhecimentoedascompetnciasgerenciais:umestudo
de caso na indstria automobilstica. RAE eletrnica, v. 3, n. 1, Art. 6, jan.jun. 2004.
Disponvel em <http://www.scielo.br/pdf/%0D/raeel/v3n1/v3n1a07.pdf>. Acesso em: 11
jul.2012.

242

VIEIRA, J.L. A histria do automvel: a evoluo da mobilidade, vol. 1. So Paulo: Alade


Editorial,2008.

_______________________________________________________ vol.3. So Paulo: Alade


Editorial,2010.

VINHOLES, T. A pequena Pioneira. Auto Esporte. So Paulo, jun. 2008. Disponvel em: <
http://revistaautoesporte.globo.com/Revista/Autoesporte/0,,EMI439110138,00
A+PEQUENA+PIONEIRA.html>.Acessoem27ago.2013.

WITGEN,J.Ecosport,JettaeFocussooscarrosmaissegurosdoBrasil.Exame.com.So
Paulo,27nov.2013.Disponvelem:< http://exame.abril.com.br/seu
dinheiro/carros/noticias/ecosportjettaefocusobtemnotamaximaemcrashtest>.Acesso
em:28nov.2013

WOMACK,J.P.;JONES,D.T.;ROSS,D.Amquinaquemudouomundobaseadonoestudo
do Massachussetts Institute of Technology sobre o futuro do automvel. Rio de Janeiro:
Elsevier,2004.

ZIBOVICIUS,M;MARX,R;SALERNO,M.S.Acomprehensivestudyofthetransformationof
the Brazilian automotive industry. International Journal of Automotive Technology and
Management.Vol2,No1,p.1023,2002.Disponvelem:
<http://www.inderscience.com/info/inarticle.php?artid=54>.Acessoem:28dez.2012.

ZILBER, S. N; VASCONCELLOS, E. The adoption of ebusiness from a strategic perspective:


the case of the Celta at General Motors Brazil. International Journal of Automotive
TechnologyandManagement.Vol5,No4,p.411429,2005.Disponvelem:
<http://www.inderscience.com/info/inarticle.php?artid=14971>.Acessoem:28dez.2012.

REFERNCIASCONSULTADAS

ABDIAGNCIABRASILEIRADEDESENVOLVIMENTOINDUSTRIAL.EstudoProspectivoSetorial
Automotivo.Braslia,2009.137p.Disponvelem:
<http://www.abdi.com.br/Paginas/estudo.aspx?f=Automotivo>.Acessoem:28out.2012.
ABDIAGNCIABRASILEIRADEDESENVOLVIMENTOINDUSTRIAL.Estudossetoriaisde
inovaoAutomotivo.Braslia,2008.101p.Disponvelem:
<http://www.abdi.com.br/Paginas/estudo.aspx?f=Automotivo>.Acessoem:28out.2012.
CALDAS, D. Observatrio de sinais: teoria e prtica da pesquisa em tendncias. Rio de
Janeiro:EditoraSenacRio,2004.

CHIZZOTTI,A.Pesquisaemcinciashumanasesociais.SoPaulo:Cortez,2003.

DEMORAES,D.Metaprojeto:odesigndodesign.SoPaulo:Blucher,2010.

243

FORD
MOTOR
COMPANY.
Sobre
a
Ford.
Disponvel
em:
<http://www.ford.com.br/sobre_ford.asp.>Acessoem:20jul.2012.

VOLKSWAGEN
DO
BRASIL.
Histria
da
Volkswagen.
Disponvel
em:
<http://www.vw.com.br/pt/institucional/VolkswagenBrasil/volkswagen_do_brasil.html.>
Acessoem:20jul.2012.

WITHELEY.N.Odesignervalorizado.RevistaArcosDesign.Vol.1,nonico,1998.Disponvel
em:<http://www.esdi.uerj.br/arcos/arcos01/0105.artigo_nigel%2863a75%29.pdf>.Acesso
em:07jul.2012.

244

246

ApndiceB

UNIVERSIDADE ESTADUAL PAULISTA


FACULDADE DE ARQUITETURA, ARTES E COMUNICAO

O PAPEL DO DESIGNER NA INDSTRIA AUTOMOTIVA NO BRASIL:


PROCESSOS E PRTICAS Bauru, SP

Termo de Consentimento Livre e Esclarecido


(Terminologia obrigatria em atendimento Resoluo 196/96 CNS-MS)

As informaes contidas nesta declarao tm por objetivo firmar um


acordo por escrito, no qual o sujeito autoriza sua participao, bem como
a utilizao dos dados que sero obtidos, para fins exclusivamente
acadmicos e cientficos, com pleno conhecimento da natureza da
pesquisa, com a capacidade de livre arbtrio e sem qualquer coao.
O objetivo dessa pesquisa traar um panorama sobre a atividade do
designer na indstria automotiva no Brasil.
No so previstos desconfortos e/ou riscos, uma vez que as
atividades simuladas so tpicas e comuns da Atividade Diria de qualquer
indivduo e, alm disso, sero esclarecidas todas as variveis da pesquisa,
antes, durante, e aps sua execuo. O sujeito poder se recusar a
participar ou retirar o seu consentimento em qualquer fase da pesquisa,
sendo garantido e assegurado a privacidade da identificao do mesmo.
Eu,
________________________________________________, estou
de acordo em participar como voluntrio deste estudo/pesquisa,
autorizando a divulgao dos dados, nica e exclusivamente para fins
acadmicos e cientficos, conforme proposto para levantamento.
Este Termo de Consentimento Livre e Esclarecido atende a
Resoluo 196/96CNS-MS.
Bauru, ______ de _______________________ de 2012.
__________________________________
Voluntrio
__________________________________
Pesquisadora

Carolina Vaitiekunas Pizarro


Rua Paulino Raphael, n 2-6
Jd Amrica Bauru SP
CEP: 17017-330
Telefone: +55 (14) 3879-0450

Departamento de Design
FAAC UNESP
Av. Eng. Luiz Edmundo Carrijo Coube, s/n
Bauru SP - CEP: 17033-360
Telefone: +55 (14) 3103-6062

NUPECAM
FAAC UNESP
Av. Eng. Luiz Edmundo Carrijo Coube, s/n
Bauru SP - CEP: 17033-360
Telefone: +55 (14) 3103-7065

247

ApndiceC

UNIVERSIDADE ESTADUAL PAULISTA


FACULDADE DE ARQUITETURA, ARTES E COMUNICAO

O PAPEL DO DESIGNER NA INDSTRIA AUTOMOTIVA NO BRASIL:


PROCESSOS E PRTICAS Bauru, SP

Autorizao de uso de imagem


As informaes contidas nesta declarao tm por objetivo firmar um
acordo por escrito, no qual o sujeito autoriza o uso de imagens de sua
autoria na forma de sketches automotivos para fins exclusivamente
acadmicos, cientficos e de uso restrito para ilustrar o projeto grfico da
dissertao resultante do presente estudo, com pleno conhecimento da
natureza da pesquisa e com a capacidade de livre arbtrio, sem qualquer
coao.
O objetivo desta pesquisa traar um panorama sobre a atividade do
designer na indstria automotiva no Brasil.
O sujeito poder se recusar a participar ou retirar o seu
consentimento em qualquer fase da pesquisa, sendo garantido e
assegurado o crdito ao autor das imagens por ele fornecidas tanto no
texto da dissertao, quanto anexo a cada imagem utilizada por meio da
preservao da assinatura original que acompanha cada obra.
Eu,
________________________________________________, estou
de acordo em participar como voluntrio deste estudo/pesquisa,
autorizando a divulgao das imagens de minha autoria, nica e
exclusivamente para fins acadmicos e cientficos na forma desta
dissertao, conforme proposto acima.
Bauru, ______ de _______________________ de 2013.
__________________________________
Voluntrio
__________________________________
Pesquisadora
Carolina Vaitiekunas Pizarro
Rua Paulino Raphael, n 2-6
Jd Amrica Bauru SP
CEP: 17017-330
Telefone: +55 (14) 3879-0450

Departamento de Design
FAAC UNESP
Av. Eng. Luiz Edmundo Carrijo Coube, s/n
Bauru SP - CEP: 17033-360
Telefone: +55 (14) 3103-6062

NUPECAM
FAAC UNESP
Av. Eng. Luiz Edmundo Carrijo Coube, s/n
Bauru SP - CEP: 17033-360
Telefone: +55 (14) 3103-7065

248

ApndiceD
UNIVERSIDADEESTADUALPAULISTAJLIODEMESQUITAFILHO
FACULDADEDEARQUITETURA,ARTESECOMUNICAO
ProgramadePsgraduaoemDesign

Ttulodapesquisa:OpapeldodesignernaindstriaautomotivanoBrasil:processose
prticas

Entrevista:

1. Nome.
2. Suaformao(graduaoeps,casohaja).
3. HquantotempotrabalhacomDesignautomotivo?
4. Emsuaopinio,noqueconsisteotrabalhododesignerdeautomveis?
5. Combaseemsuaexperincia,comovocvaprofissodedesignerautomotivono
Brasilnaatualidade?
6. Sendo o design uma atividade interdisciplinar, em sua opinio como se do estas
relaesdentrodaempresa,eatquepontoelasinterferemnaprticadosdesigners
emrelaoaoprojeto?
7. Qualseriaonvelderelaodesejvelentreodesigneasdemaisreasenvolvidasno
projeto?
8. Qual a sua opinio acerca da autonomia dos designers brasileiros no
desenvolvimentodosprojetos?
9. Falesobreosprincipaisdesafiosenfrentadospelosdesignersautomotivosbrasileiros
nodiaadiadaprofisso.
10. Quaisseriamosaspectosaseremtrabalhadosparamelhorarasuaprtica?
11. Em sua opinio, tendo em vista os grandes avanos tecnolgicos e tambm os
obstculosreferentesmobilidadenaatualidade(porexemplo,preservaodomeio
ambiente; mobilidade em grandes cidades; interao com os demais meios de
transportepblico,entreoutros),qualseropapeldodesignerautomotivonoBrasil
nosprximosanos?

249
ApndiceE

UNIVERSIDADEESTADUALPAULISTAJLIODEMESQUITAFILHO
FACULDADEDEARQUITETURA,ARTESECOMUNICAO
ProgramadePsgraduaoemDesign

Ttulodapesquisa:OpapeldodesignernaindstriaautomotivanoBrasil:processose
prticas
Questionrio

1.Nome_____________________________________________________________________

2.Suaformao(graduaoeps,casohaja)________________________________________

HquantotempotrabalhacomDesignautomotivo?______________

3. A interdisciplinaridade (atuao conjunta com diversas reas) inerente na profisso de designer


vocvcomoumaspecto:
()Positivo()Negativo

4. Em sua opinio o papel desempenhado pelos designers automotivos conhecido/reconhecido


pelos
demais
profissionais/departamentos
da
empresa?
()Sim()Empartes,poderiamelhorar()No

5.Vocconsideraquehouveumaumentodasoportunidadesdeatuaoparaosdesignersnarea
automotiva?
()Sim()Empartes,poderiamelhorar()No

6.Noqueserefereautonomiaparaacriaoedesenvolvimentodeprojetos(salvoasinterferncias
j
reconhecidas
por
parte
das
matrizes)
em
sua
viso
ela
:
()Satisfatria()Poderiamelhorar()Insatisfatria

7.Acrescentetendnciadedesenvolvimentodeprojetosglobaisvoccomoumaspecto:
()Positivo()Negativo

8.Dasopesaseguir,escolhaapenastrsquesopercebidasporvoccomoaspectosNEGATIVOS
nasuavivnciadiriadaprticaprofissional:
()Intervenesconstantesdasdemaisreasmodificandooprojetoeasintenesdodesign
()Reticnciadasdemaisreasemrelaoreadodesign
()Pressoporinovaoconstanteemreduzidoespaodetempo
()Mcomunicaoentreasreasenvolvidasnoprojetoeodesign
()Limitaestcnicasedecustos
()Alinhamentodetodasasvariveisdoprojeto
( ) Falta de um centro de Pesquisa & Desenvolvimento Inter/Transdisciplinar avanado dentro do
departamentodedesignvisandodesenvolvimentosemadiantado,partedosprazosdefinidoscom
basenademandadelanamentos
()Dficitnaformaodosdesigners

250

9.Dasopesaseguir,escolhaapenastrsquesovistasporvoccomoMELHORIASimportantes
parasuaprticaprofissional:
()Mudanadeposturadaempresaemrelaoaodesign(valorizandomaisoseupapel)
()Posicionamentododesigncomocentrododesenvolvimentodeprodutos
()Maiorreconhecimentoporpartedasdemaisreasemrelaoaodesignesuasatribuies
()Focododesenvolvimentopriorizandoousurio(enosomentenaconcorrncia)
()CriaodeumCentrodePesquisaemdesignavanadodentrododepartamentodedesign
()Melhoriasnaformaodosdesigners(aprimorandoaspectostcnicos,degestoecomunicao)

10. Quanto ao futuro da profisso, com base nas afirmaes abaixo, assinale as alternativas que
correspondemsuaviso:

Acurtoemdioprazosomercadoeaproduobrasileirosnosofreromuitasmodificaes
()Concordo()Discordo

O designer ter papel fundamental para a melhoria e o desenvolvimento do produto carro, da


mobilidadeemgeraledasociedade
()Concordo()Discordo

Atuao do profissional depender de polticas pblicas eficientes, empresas responsveis e


sociedadeconsciente
()Concordo()Discordo

Setornarnecessriaacriaodecentrosdepesquisaemdesignavanadonosquaisaparticipao
dodesignerseressencial
()Concordo()Discordo

251

ApndiceF
UNIVERSIDADEESTADUALPAULISTAJLIODEMESQUITAFILHO
FACULDADEDEARQUITETURA,ARTESECOMUNICAO
ProgramadePsgraduaoemDesign

OPAPELDODESIGNERAUTOMOTIVONOBRASIL:PROCESSOSEPRTICAS

Entrevistado:Designer1[D1]
Montadora:Montadora1[M1]
Gravaotelefnica
Data:04/09/2012
Durao:21min.

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34

Nome
D1
Suaformao(graduaoeps,casohaja)
Graduao em Desenho Industrial com habilitao em projeto de produto em
instituiopblicadoestadodeSoPaulo.
HquantotempotrabalhacomDesignautomotivo?
[pausa]Desde...de...[pausa]bomeuentreinaM1em2006comoestagirioeno
finalde2007fuiefetivado,entoquase5anosprofissionalmenteassim.
Emsuaopinio,noqueconsisteotrabalhododesignerdeautomveis?
Nogeralassim?Comminhasprpriaspalavras?[pausa]
Sim,bom,pramimotrabalhododesignerdeShapetantointeriorquantoexterior
criarosprodutosquerepresentamprincipalmentealinguagemdamarca.ocarto
devisitasdaempresa,assim,oquevaidaracaradaempresa,oprodutoquea
gente...queodesignercria.Entoresumindo,opapeldodesignerseracarada
empresaederepresentarosvaloresdaempresaenquantomarcamesmo.
Combaseemsuaexperincia,comovocvaprofissodedesignerautomotivo
noBrasilnaatualidade?
Achoqueobrasileirottendooportunidadesnosltimostempos,etemcondioe
precisa competir no mesmo nvel que os designers do exterior ento, assim... a
gente tem sido muito cobrado em questo de qualidade, de desenvolvimento
tcnicomesmo,eatartsticosabe.Assim...hojeemdiaagentenomaisum...
assimumprofissionalisolado,agentetexpostoglobalmente.
Sendoodesignumaatividadeinterdisciplinar,emsuaopiniocomosedoestas
relaes dentro da empresa, e at que ponto elas interferem na prtica dos
designersemrelaoaoprojeto?
Tem[pausa]soduascoisasassim,principalmenteengenhariaemarketing,queso
as principais reas que a gente interage. Ento a engenharia interfere muito no
aspectotcnicomesmodeviabilizaroqueagentefaz...e......temmuitadiscusso
e muita assim... briga at, s vezes, pra viabilizar o que a gente quer... s vezes a
genteganhaesvezesagenteperde,mastemmuito...essetrabalhoconstante
sabe?diaadiafazendoestetrabalhosabe?Ecomomarketing...[pausa]soos
inputs que eles passam pra gente sobre o que o consumidor espera vai, digamos
assim, qual o perfil do consumidor ento a gente recebe a informao dele e
trabalhaemcimadisso.

252

35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81

Qualseriaonvelderelaoidealentreodesigneasdemaisreasenvolvidasno
projeto?
...[pausa]quemeupontodevistaassim,nosodesignerquetemquesero
profissionalcriativo...oengenheiro,eletemquesercriativotambm,praacharas
soluesquenonecessariamentesoasqueelefazhdezouquinzeanosento...
domesmojeitoqueodesignertemquepuxarpracriarcoisasnovas,oengenheiro
tambmtemqueteressacabeadedesenvolvimentomesmo,debuscaronovoe
de viabilizar coisas novas, e no simplesmente fazer mais do mesmo. E... ento
assim... do ponto de vista do designer... com a experincia vai agregando mais
conhecimentotcnicoquevaifacilitandotambmahoradasuacriao...e...mas
assim...no...[pausa]issonumestgiomaisadiantadoassim,enonaparteda
criao em si, mais na parte de viabilizao para transformar o produto em
realidadesabe?
Qual a sua opinio acerca da autonomia dos designers brasileiros no
desenvolvimentodosprojetos?
Assim,agentetemumaautonomia,masaomesmotempoagenterespondenuma
estruturamuitomaior,ento...essaquestoqueeudissequeagentetemquese
expornomercadoglobaldentro...deumaempresamultinacional,temsidoassim,
a gente tem uma autonomia... tem que criar as coisas, mas tem muito direcional
quevemdeforaprajustamentetalinhadocomamarcatodasabe?Agenteno
cria mais um produto brasileiro, a gente cria um produto mundial... ento, assim
fogedombitopasassimsabe?...Agenteahagentebrasileiroentoagentevai
criarumprodutocomcaradeBrasil,no,agentetemquecriarumprodutoque
agradeatodososmercadoscerto?...eaitem,issotemaparteboaqueaparte
dessaexposiomesmodevoctrabalharnumnvelmuitomaior,deumproduto
que vai alcanar muito mais gente. Alcana milhes de pessoas no mundo inteiro
nosummercado,ento...esseoladopositivo.Oladonegativoquesvezes
vocacabatendoqueseguirodirecionalquenemsempreoagradvel,assim,pra
gente dentro da nossa cultura, mas faz parte do trabalho receber esse tipo de
informaosabe.
Fale sobre os principais desafios enfrentados pelos designers automotivos
brasileirosnodiaadiadaprofisso.
assim...[pausa]apartedacriao,queinerenteaprofisso,vocsemprevai
ter que ter e sempre um desafio voc buscar o novo... ento... voc nunca vai
ficarrefazendooquevocjfez,cadadiavocvaiterquecriarumacoisanovaese
exercitarpraisso,praviabilizarisso.
Pramimpessoalmenteosdesafiosso...hojeemdiasomaistcnicosassim,alm
da criao voc tem muito desafio tcnico pra conseguir realmente... no impor,
masconseguirviabilizaroquevoctpensando.Entoissoqueumdesafioque
voc vai... com o tempo voc vai agregando conhecimento e isso vai te ajudando
nas discusses, nessas discusses que eu falei e no dia a dia voc vai tendo mais
segurana pra no eu sei que isso d ento... sabe? Voc comea... [pausa] o
poderdebarganhamaior,eaomesmotempotambmconseguir...[pausa]...
assim do ponto de vista da empresa... voc entender a estrutura da empresa
como um todo sabe? De organizao, de hierarquia, assim num nvel muito mais
alto, do nvel das discusses em termos de negcios financeiros... muitas vezes a
gente...quandovocmaisnovovocnoentendeporquequeocarafazBeno

253

82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128

faz A, e com o tempo voc comea a ver porque que as decises so tomadas
daquelaforma.Edopontodevistadodesigneremsi,assim...nodiaadiamesmo,
um ponto que acho muito importante a relao pessoal... assim com os outros
profissionais.
O designer automotivo principalmente, ele no faz... assim, ele no faz um carro
sozinho, impossvel de se fazer um carro sozinho, ento uma equipe muito
grande envolvida e como voc disse uma equipe multidisciplinar, ento... por
exemplo,omeudiaadiaeutenhoquetrabalharassimobsico...trabalharcomo
engenheiro,comoalisadorqueummodeladordesuperfcieeummodeladorde
clay.Entoassim,essestrssoassiminteraesconstantesqueeutenhoqueter,
isso dentro do estdio, e eu tenho que saber lidar com eles assim... de como ...
desde de tudo o que voc imagina, de como falar as coisas pra conseguir se
expressareelesentenderemoquevoctpedindo,atoorganizacionaldascoisas.
Tudoissotemqueirorganizandonasuacabeae...socoisasassim,quefogem...
digamos assim, do mbito educacional da faculdade de design vai. So coisas que
voc no aprende na faculdade, so coisas que... voc vai ter que ir... vai
desenvolvendocomotemposabe?
Certo,eatnessasnegociaesinterpessoaisassimquetambmseresolvem
as crises que voc falou anteriormente das reas diferentes, dos profissionais
diferentes?
Tudoisso...influenciamuito,nessahoraqueessasrelaesvofalarmaisalto
assim...decomonegociar,decomosaberlidarcomcadapessoadiferente.
Quaisseriamosaspectosaseremtrabalhadosparamelhorarasuaprtica?
Ahh... que acho que varia de empresa pra empresa, cada empresa vai ter seu
mtododetrabalhoeseusdefeitos.Pramimassim,oquedificultacemporcentoas
coisas a comunicao. As falhas de comunicao pros designers assim. So
projetosgrandesqueagentetrabalhaqueenvolvemmuitagente,muitodinheiro,
temmuitapressoporcausadeprazo,dequalidade,entoqualquervrgulaforado
lugaracabagerandoatraso,acabagerandoestresse,acabagerandoummontede
coisa que... at tempo de... assim, acaba tirando at seu tempo de criao sabe...
porque voc acaba criando um negcio que no vai funcionar por causa de uma
besteirinhasabe?Daivoctemquerefazertudosvezes...entoassimumponto
crticocomunicao.Masdopontodevistadodesignemsitrabalhando,nodiaa
dia...achoquenoBrasilemsiagentetemquemelhoraressaquestodesaber
trabalhar dentro de uma empresa mundial assim sabe... assim de nvel tcnico,
desdequandovocsaidafaculdadeassim...[pausa].
Infelizmenteagentesaidafaculdademuitodespreparado...pormaisqueosalunos
tenhamboavontade,tenhamvontadedeaprender,osprofessorestenhamvontade
deensinar,agentemuitodefasadoemrelaoaoquesaidasfaculdadesdefora
sabe... eu j tive experincia em outros pases e... e realmente gritante a
diferena, a gente aprende tudo na raa... quando consegue entrarna rea que
voccomea...praticamentecomeadozero.
Em sua opinio, tendo em vista os grandes avanos tecnolgicos e tambm os
obstculos referentes mobilidade na atualidade (por exemplo, preservao do
meioambiente;mobilidadeemgrandescidades;interaocomosdemaismeios
detransportepblico,entreoutros),qualseropapeldodesignerautomotivono
Brasilnosprximosanos?

254

129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175

que assim, acho que essa discusso dentro da estrutura das montadoras ela
acontece num nvel mais alto... que seria um nvel de... que a gente fala design
avanadoqueapartedeconceito.
InfelizmentenoBrasilosestdiosqueagentetemaquisomaisdeproduoquea
gente fala... ento so... [pausa] a gente t trabalhando pra daqui cinco anos, no
mximooitoanosvaidigamosassim...chutandobemalto.
Essadiscussoacabasendonummbitoassimdedesignavanadoaconteceassim...
daqui vinte anos... ento acho assim... dentro da mobilidade... eu no sei se a
gentevaitertanto...odesignemsivaitertantoimpactonopais.Euconcordoassim
que o carro no a soluo pros problemas assim, meuponto de vista pessoal,
nodaempresa,...ocarronoasoluodotransporteassim,damobilidade.
Ocarrovaiterquedeixardeseromeiodetransporteassimdodiaadiaparaser
um... assim... digamos... no luxo, mas aquela coisa que voc vai usar quando
precisa... pra usos especficos, at pra um uso de lazer certo? E cabe tanto aos
designers trabalhar algumas questes nessa relao, mas tambm cabe muito ao
pessoaltantopolitico,urbanistaresolveresseproblema...certo?
Achoqueocarroacabasendoassimumdesejoquetodomundotem,ocarrotem
esseapeloemocional,equemuitagentegostadecarro,eapaixonadoporcarroe
acaba tendo esse apelo emocional e acaba vendo nisso uma... digamos assim, o
carrohojeemdianoBrasil,oqueagentevnaspesquisasqueocarrolibertao
consumidordotransportepblicosabe?Eaiacabagerandoumproblema,porque
voc sai do nibus... do congestionamento dentro do nibus desconfortvel, mas
vai t no congestionamento de qualquer jeito, s que voc vai t um pouquinho
mais confortvel porque voc vai t na sua bolha ali vai, digamos assim. Ento
assim, o papel do designer acho que entraria no mbito muito maior assim de
discusso das empresas, e a gente v que tem no mercado... t tendo algumas
experinciasemrelaoaisso...demontadorafazendobicicletaeltrica,quepossa
integrar ao carro... esse tipo de coisa assim, pra no deixar o carro como um
produtoisoladoassim.
Eporexemplotomandovocporbase,nosprximosanosvoccontinuandosua
carreira, como voc imagina que ser seu trabalho aqui no Brasil, digo
especificamente considerando o mercado brasileiro, considerando como as
montadorasestoproduzindoaquinoBrasil,comovocacreditaqueser?
Omeudesejoeaminhaexpectativapoderrealmenteparticiparmaisativamente
desse mercado global sabe? Se a gente pensar assim... antigamente teria que sair
do pas para ter oportunidade digamos assim, e experincia assim mais de
qualidade,diferenciada.Hojeemdiaachoquenotonecessrioassim.Algumas
coisassim,masameuvernoprecisasairdopaspraterumaboacarreiracomo
designer entendeu? Acho que tem perspectiva e tem espao pro profissional
brasileirocontinuaraquinoBrasil,mascriarnummbitoglobalsabe?Anoserque
seja vontade pessoal. Mas os estdios no Brasil esto se preparando, esto
trabalhando j nesse aspecto pra voc manter assim, o digamos assim... os
profissionaisbrasileirosaquimesmosabe,eaagentetempotencialpracriarcoisas
quevoserutilizadasnomundointeiro.
Gostariadeteceralgumasconsideraesfinais?
Achoquevalidofalar...quandoeutavanafaculdadesempretinhaumadiscusso
sedesignautomotivodesignoustylingsabe?Entoumadiscussoquesempre

255

176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208

acontece, porque sempre tem aquela coisa assim, o design... o designer, tem que
ser... [pausa] tem que fazer alguma coisa que seja forma e funo sempre e... e
muitagentequetdeforadaindstriaveachaqueocarrosforma...que
tipoahhfrescurinha,ocarafazoqueelequereboa.
Ameuverdificilmentevocvaiterumproduto...[pausa]beleza,ocarrotemestilo,
temquetrabalharformasbonitasetc...masnonecessariamentetemqueserum
carroformaefunonosentidoBauhausdacoisa,deserquadradinho,redondinho
eacabousabe?Deformasimples.Masachoqueodesafiododesignerautomotivo
tcnico, de voc viabilizar as ideias, viabilizar seu sketch ali dentro de todas as
restriesquevoctem,desderegulamentaoatdecomplexidadedeproduo,
socoisasassimquefogemdombitoque...assim,dequemnuncapisoudentrode
umestdioautomotivosabecerto?Porquetemmuitacomplexidadeenvolvidado
pontodevistadaquela...assim,quedesenhoindustrialnoartesanatosabe?
Temqueserproduzidoemsrie,temquefazermilhesporanomesmoeacabou!
Ento qualquer coisa que interfira nisso a gente tem que dar um jeito de driblar
digamos assim, ento esse um... assim, o... [pausa] o designer automotivo nem
sempreouvidonoBrasil,achoquepassaporesseaspectoassim,atporseruma
rea restrita voc acaba no tendo... assim as pessoas no tem noo realmente,
nopormvontadeouqualquercoisa,masacabanotendoacessoaoquque
essarea....eassim...todomundoageassimahno,beleza,areamaislegalou
seil...porque...sabeselporque,mastemmuitagentequeachaquelegalessa
rea,eassimgeraassimumencantosabe?
Paraaprovarqualquercoisinhaquevocvaifazerumsacrifciorealmente,evoc
tem que ficar ali trabalhando, trabalhando e trabalhando pra fazer as coisas
acontecerem ento digamos assim, no que nem a gente brinca aqui do luxo e
glamour,notemnadadissosabe?
muitotrabalhomesmo,sangueesuor,eagentenoBrasilpelasdeficinciasquea
gente tem... de aprendizado e tal, a gente acaba tendo que se virar nos trinta
mesmoefazerdetudoumpouco,esvezesmuitomaisdoqueumprofissionalno
exteriorfaz.Agente...porexemplo...[pausa]lforaocara...temumcaraquefazs
renderingeoutroquesfazdesign,agentetemquefazertudo,agentetemque
fazer apresentao, rendering, ir pro clay s vezes modelar alguma coisa, ento a
genteacabatendoquesermaispolivalentedoqueosoutros...deoutrasreas.

256

UNIVERSIDADEESTADUALPAULISTAJLIODEMESQUITAFILHO
FACULDADEDEARQUITETURA,ARTESECOMUNICAO
ProgramadePsgraduaoemDesign

OPAPELDODESIGNERAUTOMOTIVONOBRASIL:PROCESSOSEPRTICAS

Entrevistado:Designer2[D2]
Montadora:Montadora1[M1]
Gravaotelefnica
Data:05/09/2012
Durao:20mine21seg.

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33

Nome
D2
Suaformao(graduaoeps,casohaja)
GraduaoemDesigneminstituioprivadadoestadodeSoPaulo.
HquantotempotrabalhacomDesignautomotivo?
Ahh...[pausa]oitoanos.
Emsuaopinio,noqueconsisteotrabalhododesignerdeautomveis?
Ento,euvoufalarespecificamentedaminharea[pausa]Porquedentrododesign
automotivotemvriasreasn?AreaemqueeutrabalhoareadeColor&Trim,
eusoudesignerdeColor&Trimquecoreacabamento.
Entotudoaquiloqueaparentenoveculosejaexterno,internonsfazemosa...o
desenvolvimentodestesmateriais,aaprovao,apesquisadetendncias,adepois
quando o produto j t em desenvolvimento a gente desenvolve o que a gente
aprovoulatrs,comtodososfornecedores.
Ento faz todos os fornecedores de plstico chegar na mesma cor que a gente
aprovou l atrs, todos os fornecedores de tecido, vinyl pra fazer todo mundo
chegarnaaparnciaqueagentequer,ento...ounastexturas,ounosacabamentos
de tintas, ou... [pausa] e por a vai... algo mais especfico assim, a rea de
Color&Trim.
Combaseemsuaexperincia,comovocvaprofissodedesignerautomotivo
noBrasilnaatualidade?
Humm... eu vejo que t em crescimento... assim, no s na M1 mas em outras
montadoras, ... esto montando equipes de design dentro da indstria
automobilstica como lder de design de programas globais... quase todas as
montadoras esto no caminho de programas globais e... esto [pausa] permitindo
osdesignersbrasileirosalideraremessesprogramas...
Entoademandatendeacrescerassim,deprofissionaispraessasreas.
Sendoodesignumaatividadeinterdisciplinar,emsuaopiniocomosedoestas
relaes dentro da empresa, e at que ponto elas interferem na prtica dos
designersemrelaoaoprojeto?
Ai... olha [pausa] o nosso... assim, falando no mbito de Color&Trim, a gente lida
realmentecomtodasasreas,elidabastantecomengenharia,comcompras,com
os designers de Shape e tal. Eu no sei se uma caracterstica do profissional de

257

34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80

designousealgoqueagentevaiaprendendonaraa,masagentepercebequea
gentetemumavisomacrododesenvolvimentoqueajudamuito,entoofatoda
gente saber processos de... [pausa] de... processos de fabricao, diferentes
materiaisesuppliers...nosei...acreditoquepraumprogramaissoajuda,essa
interao com todas as outras reas assim, ajuda a gente a ter uma viso um
pouquinhoengenharstica,masagentetemtambmaquelacoisadeproporcoisas
novas, de criatividade, ento assim a gente acaba sendo um aglutinador de
informaesdoprograma.
Agentetemumavisobastantemacrodetodoodesenvolvimento,entosvezes
odesignerdeshapetpropondoumacoisaquel...lnofuturo,naprticavaidar
problemapragenteaprovaroacabamentodaquelapea,entoassim...bomque
existe essa interao com todas as reas, mas eu acho que aquilo que a gente
aprende nessa funo de multidisciplinar ajuda profissionalmente na indstria
automotiva.
E em relao interferncia das outras reas nas definies do projeto? Como
vocvisso?
Ahh... ento isso s vezes atrapalha na parte criativa da coisa n? Ento,
principalmente custos por exemplo, [risos] a gente prope materiais ou
acabamentos,quehoraquevaivertemumcustoque...ouocustoprapassarnas
SPECS...queaindstriaautomobilsticatemtestesmuitorigorososparatecido,pra
acabamento.
Ento assim, s vezes a gente quer propor uma coisa que trendy, ... que seria
uma inovao mas que pra passar na.... em todas as especificaes de testes a
gentevaireduzindoaquelacoisamaravilhosaqueeranocomeo[risos]eissoacaba
atrapalhando. E custos tambm, porque vira e mexe precisa ir cortando pra ter o
valordocarroqueeleprecisaetnofinal,oposicionamentocomaconcorrncia,e
a ento acaba tambm denegrindo vai, aquilo que a gente props no comeo...
achoquesoasduascoisasquemaisinterferemnonossodesenvolvimento.
Qualseriaonvelderelaoidealentreodesigneasdemaisreasenvolvidasno
projeto?
Ento,ideal,queatseriameusonhodedepartamento[risos]seriaagentepoder
trabalharemavanado...eaquinaM1infelizmentenonossodepartamentoacoisa
... so poucas pessoas ainda pro tanto de programas globais que a gente t
desenvolvendo,agentenoconseguetrabalharemavanado...semttrabalhando
proprograma,noseisevocentendeporexemplo,assimquevoclderdeum
programa voc vai cuidar por exemplo do [cita um modelo da marca] como eu
liderei o Color&trim desse carro, ento voc j tem que criar e desenvolver
especifico pra aquele carro, ento j t dentro daquela realidade, ahh tem que
passar em tais e tais testes, tem que ter tais e tais custos, ento o seu
desenvolvimentoficarestritoaessarealidade.
O ideal seria que a gente pudesse antes, de chegar um programa, ou ter uma
pessoa, um time, ou a gente mesmo na folga de um programa pro outro que at
ento nunca acontece... seria a gente desenvolver em avanado coisas que olha
temessatendncia...comoqueeupossofazerpraque......praaplicarissoem
um programa real ento assim voc t trabalhando assim... [pausa] checando as
opesepodendover,porquetemmuitacoisaquenahoradovamosverahhno
pode mais porque a ferramenta j t pronta, ento no pode... vai ter que ser

258

81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127

pintura, voc no pode escolher um outro acabamento mais moderno, mais


diferenciado pra uma pea porque a engenharia j foi no arroz com feijo, ento
assim, no d tempo de a gente propor uma coisa nova... a gente conhece
acabamentosdiferentes,maspra...[pausa]agenteteriaqueterumgrupo,umtime
emavanadopraviabilizar,praquenahoraquecheganoprogramafalarolhaem
vezdevocpensarnoarrozcomfeijo,vamosporumapimentinha,umcoentro
[risos]sabeassim?
Seria ento como se existisse uma clula de pesquisa mesmo, um escritrio de
pesquisaanexoaodesignsdesenvolvendoinovao?
Exatamente!Ahh...aeuqueriafazerparte[risos]
Qual a sua opinio acerca da autonomia dos designers brasileiros no
desenvolvimentodosprojetos?
Ahh... eu diria que ainda... ainda no t totalmente satisfatria pelo fato de que
pelomenosnaM1t,programasglobaisalgomuitonovoaquit,eprao[citaum
modelorecmlanadopelaempresa]foioprimeiroprogramaglobal,o...eufaloos
cdigos[risos],o[citanovamenteomodelo],onovo[citanovamenteomodelo]
quetlanando.
Elefoioprimeiroprogramaglobalqueagenteliderou,entoclaroquetodasas
outrasregiesestofazendoomesmocarroquevaiserproduzidoemChina,ndia,
eacoisavaicrescendoetaleBrasil....[pausa]foiaprimeiravezqueagentetava
propondo uma coisa global e que tinha que ser os mesmos acabamentos e fazer
todomundoliteralmentealinharoququevaisertendnciadetextura,decor,de
acabamento, de tecido, o carro exatamente o mesmo pra todas essas regies
assim,tirandopequenosdetalhesdefeaturesassim,deopesdecatlogossevai
airbag ou no, mas assim, o montante de acabamento ... [pausa] precisou estar
alinhadoeclaroqueaprimeiravezquevocdumdesafiodessepra...sejapra
qualquerregio,asoutrasreas,tipo,asoutrasregiesqueestavamacostumadasa
fazer o trabalho, ou que tem a responsabilidade de aprovar um projeto desse,
elas...no que elas no confiem, mas elas acompanham mais de perto, elas ficam
um pouco ressabiadas assim ser que esse caras realmente sabem fazer? ento
assim,oqueeusintoqueagentemostrou quesabefazer,masque...foimuito
difcilprateressaconfianaentendeu?
Achoquehojeaconfianaaindaprecisacrescer,aautonomiaprecisaaumentar,
muitodifcil,muitodifcildizerqueexisteautonomiacompleta,porque,...uma...
so...osgostossvezesdivergemdeumaregiopraoutraequandovocfalaem
programaglobal,omundointeirodandopitaco[risos]...atgentequeno...o
carro no vai lanar naquela regio, mas como so pessoas chave no
desenvolvimentodoprodutoelastambmvodaraopiniodelas,porqueelasno
esto acostumadas por exemplo com um carro B ou um carro pra regio ... de
Brasil, China e ndia, algum sei l da Europa que t acostumado com aquela
mentesupertop,comcoisassuperassim...tambmdpitaco,entoassimfalarem
autonomiaaindaumpoucocomplicado.
Ainda algo que precisa crescer, mas como a coisa t comeando... e a gente t
mostrando que sabe entregar o que se espera num programa desse, pelo menos.
Quenemontemeuliamatriada...comofosseuma[citaumapublicaoperidica
voltadaaodesigndeautomveis]umarevistadecarrodandia,sobreolanamento
do[citaummodelorecmlanadopelaempresa]l,foisuperpositivoassim,ocara

259

128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174

falandoassim......comaspalavrasdelefalandoassimseaM1acertarnopreo
dessecarro,vaiseroveiculoM1maisvendidonandiaentoassim,pramimque
trabalhou no projeto desde o comeo... ... alinhou com todo esse pessoal sobre
acabamento...ouvirumnegciodessemuitolegal.
Ento assim, acho que... acho que estamos mostrando pro mundo que a gente
consegue fazer... ento pode ser que a nossa autonomia cresa, mas falando de
procedimentosdeprogramaglobal,agentesabequepitacosviroeodesignerque
trabalhanoramoautomotivotemqueteressahumildadedeouvircriticadetudo
quelado,deouviropiniesdivergentes,econduzirodesenvolvimentodamelhor
forma assim. No que voc tenha que ceder a todo e qualquercomentrio assim,
massevoctemtodoodirecionalbaseadonumapesquisaquejustifiqueoporqu
que voc t indo, ento voc mostra qual que a tendncia e justifica, mas que
nem sempre, nem toda a batalha voc vai ganhar, vai ter batalha que voc vai
perderque...boralquenofinaldascontasvaidarcerto.
Fale sobre os principais desafios enfrentados pelos designers automotivos
brasileirosnodiaadiadaprofisso.
Ahh... os desafios acho que... um pouco isso que eu falei assim [pausa] , de
trabalhar com muita informao, a demanda muito grande, existe uma srie de
burocraciasinternas,decoisasquesvezesdesanimamoprofissionaldedesignque
quando entra imaginaque criao, desenvolvimento, no sei o que, e no...
temmuitareunioprafalardetiming,otempoquevoctemquedesenvolveruma
certacoisa,ouprafalardeumasriedecoisasmaisengenharsticasdacoisaeque
odesignemsi,acriao,osbriosdacoisamaravilhosaficameiodelado.Ento,o
desafioquecomtodoessetempo,comtodasessasburocraciaseprocedimentos
internosvocaindaconsigafazerumbomtrabalho.Desenvolverumbomtrabalho
comodesigner,achoqueissooprincipal.
Quaisseriamosaspectosaseremtrabalhadosparamelhorarasuaprtica?
Ahh... eu acho que cai um pouco na resposta que eu j disse assim, se tivesse
aquele...seil,ncleodepesquisaqueagentepudessegastarumpoucomaisde
tempo apressando esse tipo de coisa, em vez de s... a estrutura eu acho, a
estruturadodepartamentotinhaquemudarumpouco,agentesepararmaisaquilo
queseriatrabalharcomdesign,ouatenderoprograma,e...e...balancearmelhoro
teutempo,praquecomodesignervocpossacriarmais,possafazerumtrabalho
maisrobustodedesign.
Lidar mais com design menos com a parte administrativa da coisa n?
Profissionaisseparadosquelidassemdiretamentecomaengenharia,diretamente
comcompras,pranosobrecarregartantovocsseriaento?
oidealseriatalvez...queclaroqueaestruturaacabaampliandomuito.Mas
quepudessehaverrepresentativosdessas...[pausa]pessoas,representantesdessas
reasparaqueguiassemosdesignerseelespudessemusarotempodelesmaispra
designseriao...achoqueseriaoidealassim.
Em sua opinio, tendo em vista os grandes avanos tecnolgicos e tambm os
obstculos referentes mobilidade na atualidade (por exemplo, preservao do
meioambiente;mobilidadeemgrandescidades;interaocomosdemaismeios
detransportepblico,entreoutros),qualseropapeldodesignerautomotivono
Brasilnosprximosanos?
fundamental, e comea assim da nossa rea de Color&Trim pra... e vai

260

175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193

cascateandopratodasasoutrasassim,noquesitosustentabilidadeseagenteno
comea a desenvolver novos materiais, se a gente sempre trabalha l pra...
programaslprafrente,ento...estamosem2012vaiserumprogramapraseil,
daquidoisanos...seagentenopegaprapararemudaromindsetassim,acabea,
de que tem que desenvolver coisa que tem porcentagem de fio PET, ou
porcentagemdealgoreciclvel,ouquenodanifiquetanto,cruciallprafrente
queagentevaitsendomaisoumenossustentveisassim...edamesmaformaa
partedemobilidade.
claro que a M1 tem um time de concepts... no fica no Brasil... fica em vrias
cidades,ficanaChina,emLondres,temnaAlemanhae...[pausa]eachoquetem
nosEstadosUnidos.Temtimesdeconceptsquepensamemcarrosfuturos,carros
praessequesitodegrandescidadesassim,emmobilidadeetal...eprecisamesmo
ter gente pensando nisso porque o mundo evolui, o trnsito aumenta ento...
[pausa]masinfelizmenteaspropostasqueessetimefaznochegamuitonagente
aqui,elesconversamentreelese...masserialegalsederepentetivesseumncleo
deconceptsaquitambm.
Gostariadeteceralgumasconsideraesfinais?
No porque acho que a entrevista foi mais por conta do panorama mesmo do
designernaindstriaautomobilstica,euachoqueisso.

261

UNIVERSIDADEESTADUALPAULISTAJLIODEMESQUITAFILHO
FACULDADEDEARQUITETURA,ARTESECOMUNICAO
ProgramadePsgraduaoemDesign

OPAPELDODESIGNERAUTOMOTIVONOBRASIL:PROCESSOSEPRTICAS

Entrevistado:Designer3[D3]
Montadora:Montadora2[M2]
Gravaotelefnica
Data:14/09/2012
Durao:50min36seg.

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33

Nome
D3
Suaformao(graduaoeps,casohaja)
Ento,aminhaformaovamosdizerassim,diferentedaformaodosdesigners
dehoje...porquemesmoeutendomuitosanosdeexperincianarea,quandoeu
comecei a pensar em ser designer nem existia a palavra design. A minha primeira
contrataodentrodessareavinhaescritolestilistadeautomveis.Ento,...
a minha formao no nada formal vamos dizer assim... ela se constitui
basicamente do seguinte, de experincia e lgico de alguns cursos que eu fiz,
mas...queacaboumelevando...meformandoemdesigner.
Masnohouve,eununcafizumaescoladedesign.Entoaminhaformao,vamos
dizerassimquecontribuiupramelevarporessecaminhoseiniciounoSENAI,que
um curso tcnico, onde eu aprendi, esse SENAI foi patrocinado por uma indstria
automobilsticaeaespecialidadeeramodelaotcnica.
Entoeutrabalhei...estudeitrsanos,estudeietrabalheitrsanosnessaprofisso,
aprendi essa profisso e ela... na realidade ela me deu uma base... tcnica muito
importantenaminhaformaocomodesigner.Eventualmenteumaformaoque
hoje,osdesignersqueestudememumaescolaqualquerqueseja,elenovaiter
umaformaotcnicatofortequantoaqueeutivequandofizoSENAI.Entono
SENAIeuaprendialerprofundamentedesenhoortogonal,odesenhotcnico,...
eu aprendi tcnicas, processos de fabricao de peas... por exemplo fundio,
construo de ferramentas pra... pra prensar a chapa, que o carro constitudo
praticamente disso, ento trabalhei na linha de produo, trabalhei na
ferramentaria, trabalhei na modelao, trabalhei na rea de prensa... quero dizer,
essaformao...essaprimeirafasequeeutivenodesignelamedeuumaformao
tcnica e uma viso muito grande do processo de se criar um automvel, mesmo
nosendoumdesigner.
Poroutrolado,eu...depoisdissoeubusqueiaEscoladeBelasArtes,foiumcurso
bsicoelivredepintura,histriadaarte,eutambmfiqueipraticamentetrsanos
dentrodaescola,entoissoreforoubastanteaminhapartevamosdizer,artstica
dedesigner.Tambmfizumcursoderegncia,musical.Evocpodefalarpramim
ahh mas msica no tem nada a ver com design no, no tem nada a ver
diretamente no, mas ela sempre acabou lapidando o meu lado vamos dizer,

262

34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80

artstico,porquepramim,noseisevocvaiperguntarissomaisprafrente,mas
pramimdesignernarealidadeessajunoentrearteetcnica...t.
Entoessaexperincia,vamosdizeracadmicaqueeutive,elamelevourealmente
aformar,amedarumaboabasepramimserumdiaumdesigner.Edepoistodoo
restodaminhaformaoelaveioonthejobvamosdizerassim,trabalhandodentro
daindstriaautomobilstica,eutrabalheimuitosanoscomoilustradortcnico,que
consistia em... vamos dizer assim... em ilustrar a montagem de um automvel.
Ilustraremperspectivaexataa...como...doququefeitoumautomvel,como
montado um automvel, como so as fases de produo e de montagem de um
automvel.Eissoacabouentomedandoumavisocompletaetotaldoquque
um automvel, no s da casquinha, que a responsabilidade do design, mas
tambm da parte... vamos dizer de toda a parte construtiva, processos, como o
processo da linha de montagem e tal. Ento juntando todas essas experincias
realmente o ideal n? Passei mais de dez anos da vida aprendendo o que um
designerantesdemeformarpelaprimeiravezemeinserir.
HquantotempotrabalhacomDesignautomotivo?
[pausa]euprecisavaconsultarmashmaisdevinteanosjqueeuatuo.
Emsuaopinio,noqueconsisteotrabalhododesignerdeautomveis?
Ento... eu... [pausa]o trabalho do designer ... lgico em qualquer rea, mas
especificamente na rea automobilstica, absolutamente importante, hoje em
dia... ... na realidade o designer por fazer essa casquinha... a parte visvel do
automvel,eletemaresponsabilidadededefinirapartevisveldoautomvel.
Masissomuitocomplexoporqueexistem[pausa]portrsdessacascaexistetoda
uma srie de... ... de vamos dizer assim, aspectos tcnicos, que voc tem que t
consciente e tem que trabalhar junto com as reas que desenvolvem toda essa
parte tcnica do carro. Ento consiste em... eu diria cinco por cento de criao,
criao eu diria do ponto de vista livre, e noventa e cinco por cento de trabalho
duro.Trabalhoduropraqueaquelecincoporcentodaqueletrabalhodacriao,ele
consigaserviabilizadotecnicamente.
Combaseemsuaexperincia,comovocvaprofissodedesignerautomotivo
noBrasilnaatualidade?
Ento,esseumassuntobastantepolmico...porqueagenteouvefalar...agente
sempretemumatendnciadeficarolhandooBrasil...falandodoBrasil,massevoc
for ver direitinho no existe nenhuma companhia de automvel brasileira no ?
Todasascompanhiasdeautomveis,todososautomveisvendidonosBrasil,so
companhias no brasileiras, ento por exemplo a M2 uma companhia [cita a
nacionalidadedaempresa],aM1[citaanacionalidadedaempresa],aM3[citaa
nacionalidade da empresa]... e assim por diante, a M4 [cita a nacionalidade da
empresa], o que acontece que existe no Brasil ramificaes dessas empresas, e
porissocomplicadaessacoisa...comoeuvejoodesigndeautomveisnoBrasil.
PracomearoBrasilnotemumacompanhiadeautomveis,ponto,[pausa]todas
as companhias, so companhias estrangeirasque esto fixadas aqui.Algumas tem
estdiosdedesign,queeudiriaquatrooucinco,porai...[pausa]existemgrandes
estdios como o da M2 por exemplo, M1, M3 e M4 e existem estdios menores,
queestosefixandoaquinoBrasil,entootrabalhobastanterestritoefechado
como no mundo inteiro, o designer de automveis tem um campo de atividade
bastante restrito, bastante fechado no mundo inteiro, mas no Brasil mais ainda.

263

81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127

Porque... [pausa] quanto aos estdios...voc vai perceber se fizer uma contagem,
dosdesignersbrasileiros,profissionaisautomotivostrabalhandodentrodaindstria
automotiva voc vai chegar em um nmero pequeno de 400 [pausa] 200 ou 300
pessoas,seil400dentrodeumapopulaodenoseiquantosmilhesdepessoas
quetemosnoBrasilhoje.
Ento um campo restrito e bastante competitivo, pra cada vaga que aparece
existeumabrigamonstruosapraquemvaificarcomessavagaento...umramo
difcildeseatuarnoBrasil,porexemploumacoisaqueat[pausa]nofazmuito
sentido,porqueexistemtantasescolasdedesenho...[pausa]dedesenhoindustrial
oudedesignpraterummercadodedesign,principalmenteodeautomveis,to
pequeno.
foimaisnessesentidomesmoaquesto,deprocurarsaberasuavisosobrese
elaestmaisvalorizada,menosvalorizada,faltandoprofissionaisousobrando...
Ahh sim... a...[pausa] a profisso bastante valorizada, justamente por ser
de...[pausa]vocvaiencontraressaprofissosomenteemempresasmultinacionais
muitobemestruturadas,empresasquetemprocessosbastanteestruturados,tem
empresas que funcionam muito bem, que valorizam muito o ser humano, e que
cuidam dos seus funcionrios de uma maneira exemplar vamos dizer assim, mas
tem essa coisa... uma profisso que um pouco limitada...[pausa] bastante
limitada.
Sendoodesignumaatividadeinterdisciplinar,emsuaopiniocomosedoestas
relaes dentro da empresa, e at que ponto elas interferem na prtica dos
designersemrelaoaoprojeto?
...[pausa]porquesvezeseassim,agentesempretematendnciadefalaroque
que as outras reas interferem e dificultam a vida do designer... e quando na
realidadedeveriaserdiferentequalaformaodessedesignerparaatenderos
clientes dele que so as outras reas?. Ento a tendncia do designer sempre
falarahhessaengenhariaump...quenoseioque;porqueaproduomuito
chataenoaceitanadaeassimpordiante,eaielestravamotrabalhododesigner.
Arealidadecompletamentediferente,odesignerquetemqueser...vamosdizer
assim,temqueserprofissionalsuficientepraconseguiratendertodososrequisitos,
todas as necessidades de todas as reas e encima disso... levando tudo isso em
consideraoconseguirfazerumtrabalhobom.
Ento ... [pausa] hoje em dia cada vez mais as companhias esto conscientes da
importncia do trabalho do designer... muito mais que no passado, todo dia o
designer...odesignelesemostrou,eletidocomoaprimeiraousegundarazode
compra.Aprimeiratalvezseriaocusto...opreodoproduto,queimpedequetodo
mundousufruadoprodutoeasegundacoisa...porquequeumcaracompraalguma
coisa ou algum carro? Primeiro ele vai comprar baseado no dinheiro que ele tem
disponvel... na faixa que ele pode dispor de dinheiro, ento o primeiro o custo
mesmo,eaquinoBrasilprincipalmenteosegundofatorodesign.
Ento essa uma profisso muito importante, e que mesmo assim, ela... [pausa]
mesmo com toda essa importncia, ainda ela tem dificuldades... [pausa] uma
profissomuitodifcilporquenormalmentetodososdesignersquesaemdaescola
tem um pensamento... muito vamos dizer assim, muito ingnuo da funo do
designer.
Eleachaquedesenhar,fazersketchesbonitosserumdesigner,enaverdadeno

264

128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174

nada disso. O designer ele tem que... pra realizar as ideias dele, ele tem que t
muito consciente, tem que ter um conhecimento tcnico profundo, tanto de
produtoquantodastcnicasdedesenvolvimentoetemquelidarcomaescultura
do automvel, com a forma do automvel, mas sempre levando em considerao
todososprocessosindustriais,porquesevocfizerumaformaqueinviveldeser
fabricadaentoelano...vocnuncavairealizar.
Ento,muitoimportanteodesignerterumaformaoprofundatcnica,e......
demaneiraapoderdesenvolveroprodutodeleoua...formaqueeletquerendo
desenvolver e chegar... se ele tiveresse conhecimento tcnico ele pode ter maior
sucesso,se elenotiveresseconhecimentoprofundo,apartetcnica,apartede
processos,semprevai...vamosdizerassimperturbarele.
Qualseriaonvelderelaoidealentreodesigneasdemaisreasenvolvidasno
projeto?
No existe uma relao ideal n? A coisa vai acontecendo... mas o designer
sempreoprimeirodafila.Eleocaraquecomeacomtodoodesenvolvimento.
Ento ele tem no comeo... o sonho dele, mas paralelamente j existe um outro
grupo que no caso aqui da M2, tambm j t atento ao design que a parte de
packagequeapartequevaideterminarotamanho,aergonomia,vaitligado
toda a parte interna, mecnica desse produto, e que est trabalhando j paralela
apartecriativaedepoisvaiexistirentoajunodessasduas...vamosdizerassim,
matrias.Umaqueaformapuraeaoutraquetodaapartedetudooqueest
envolvido dentro de um automvel, que complicadssimo... o produto mais
complicadodefazeremaissofisticadoqueoserhumanonormalpodeadquirir,so
maisdetrsmilpeaspraumprodutos,esetemqueobservartodasessasfacetas
doproduto,ondevocenvolveergonomia,vocenvolvesegurana,aerodinmica,
prpriaviabilidadetcnica,sequnciademontagemeetc.
Voc tem que atender ao mesmo tempo as aspiraes do marketing... ento, o
designeuvejocomoocentrodetodoodesenvolvimentodeumproduto,eleest
no centro. Ele a parte que aglutina, os desejos de todas as reas, ele o
aglutinador,eporissomesmoeleimportantssimoeporissomesmoodesigner
temumaresponsabilidadecadavezmaior...dentrodaindstria.
Issomuitodifcilde......[pausa]dacompetnciaque...euvoltoainsistirnesse
ponto,osdesignersestomuitopoucopreparadosquandoelessaemdaescola.A
escola ela abrange o assunto design de uma maneira muito superficial, e muito
acadmicavamosdizerassim.
Qual a sua opinio acerca da autonomia dos designers brasileiros no
desenvolvimentodosprojetos?
... [pausa] isso depende de cada companhia...da filosofia e estratgia de cada
companhia... muitas companhias... como eu disse pra voc... chegou de novo
naquele ponto sobre o design brasileiro a palavra brasileiro um acidente, ele
poderia ser brasileiro, alemo, um americano...tanto faz. Por qu? Porque no
existeumaindstriabrasileira,masonveldeautonomiadependedaestratgiade
cadacompanhia.
Existem companhias aonde a estratgia d muito mais liberdade para as regies
ondeelasdesenvolvemautomveis,existeessavertente...decompanhiasquedo
maisliberdade,ecompanhiasquedomenosliberdade.Naverdadeaautonomia
muito relativa, porque a maioria das companhias tem... por serem companhias

265

175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221

estrangeiras,elasdeveriam,comonocasodaminhacompanhia,ela,sendoadona,
ela... define a linha de... o conceito de design, a linha de design. Ento essa
autonomia nossa, no que uma autonomia pequena, mas ns somos
ferramentas dentro dessas mquinas de desenvolvimento de automveis e que
seguemumalinhadeterminadapelamatriz.Euentendooquevocquerdizer...se
euteriacondiesaquinoBrasildedesenvolverumcarrodamaneiraqueeuacho?
No.
NoporqueeunosouaM2,eutrabalhoparaaM2...eaM2temumcentrode
designmundial,quealisedefinemosparmetros...dodesignM2.
...aquestofoimaisnosentidodeidentificarseosprofissionaisaquidoBrasil,
se eles tem flexibilidade montar um projeto no inteiramente do jeito que se
quer, mas a flexibilidade justamente de conseguir negociar, de conseguir
contribuircomumpensamentoouumjeitodeprojetarbrasileiromesmoestando
emumacompanhiamultinacional...
Ahh...entendi,issorealmenteimportante,nsconseguimoshoje,depoisdemuito
trabalho junto matriz, de ter uma voz ativa. Porque eles mesmos esto
percebendoqueimpossvelvocfazercarronoBrasilsevocumcidado[citaa
nacionalidadedaempresa],queviveem[citaopasdeorigemdaempresa]etem
umaviso[citaanacionalidadedaempresa].
impossvel,porqueexistemcertascaractersticasquesseaplicamapasescomo
o Brasil. um pas que tem um clima diferente, um pas continental, de tamanho
continental, tem um clima que diferente de [cita o pasde origem da empresa],
alis ele tem todos os climas aquidentro, que tem o de [cita o pasde origem da
empresa]tambm,mastambmtemumequivalenteaodesertodoSaara,eletem
umclimatemperado,ento...diferentedel.
Voc tem tambm aqui no Brasil ... vamos dizer assim, diferentes situaes
completamenteinerentesaoautomvel,vocquermaisqueaestradaemrelao
aoautomvel...asruasemrelaoaoautomvel.oqueh...oquehmaisperto,
do ambiente versus o produto, o automvel tem que rodar em cima de uma
estrada, e se voc olhar as estradas e ruas do Brasil elas so nicas vamos dizer
assim...porquenstemosaquiboasestradas(queoqueacontecebastanteem
So Paulo) ento temos estradas boas, mas ao mesmo tempo aqui em So Paulo
ruasruins,ruasprojetadasdeumamaneiracatica,eforadeSoPaulovoctem
estradasmuitoruinsenarealidadevoctems18%detodaagradedeestradasdo
Brasilelassopavimentadas.
Sevocforpensarquaissobempavimentadasachoquenochegaa10%.Ento,
a voc tem todo o resto... sei l mais de 80% das estradas do Brasil, elas nem
asfalto tem, so estradas no pavimentadas. Ento voc que.. no d pra ficar
pensandoempegarumcarrodaEuropaepeeleaquinoBrasil...elenosai,no
conseguenemsairdolugar.Elevaiencalhar...dependendodolocalqueelevaiser
levado,vaiestourarpneus,quebrarasrodas,novaiconseguirpassaremlombada,
no vai conseguir dobrar uma rua por causa do ngulo de inclinao das vias
ento... o Brasil tem, a China, os pases emergentes principalmente, tem
caractersticasprprias.
importante, hoje o designer brasileiro tem voz ativa dentro da matriz suficiente
pra alertar sobre isso. Ento ao mesmo tempo que a gente quer ter produtos ao
mesmonveldaEuropa,nstemosumoutroambientequenuncavaiserigualaoda

266

222
223
224
225
226
227
228
229
230
231
232
233
234
235
236
237
238
239
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
258
259
260
261
262
263
264
265
266
267
268

Europa.Nuncavaiser...noenuncavaiserpormotivospolticos...sciopolticos.
Fale sobre os principais desafios enfrentados pelos designers automotivos
brasileirosnodiaadiadaprofisso.
Eu vejo assim...[pausa] o principal desafio do designer o de conseguir sempre
renovaroDNAdamarca.difcildecompararassim...mashojeemdiaoprincipal
desafio no fazer uma escultura mirabolante porque cada marca tem o seu
cartereasuafilosofiaeodesigneroresponsvelporisso.oresponsvelpor
fazeressa...essafilosofiaestarsempreemevoluo,masnuncaperderdevistao
DNA da marca, aquilo que mais importante... aquilo que a marca representa.
Entonoadiantaeufazerumcarrocomcarade[citaonomedeumconcorrente]
seeunosou[citaonomedeumconcorrente],eusou M2.Ento meudesafio
fazerum[citaonomedaempresa],semprefielaum[citaonomedaempresa],com
caractersticasdoDNAdelemascadavezapresentareledeumamaneirarenovada.
Esseograndedesafio.
Quaisseriamosaspectosaseremtrabalhadosparamelhorarasuaprtica?
...[pausa]euachoque...ograndedesafioestarpreparadoprapodernegociar,e
pra poder negociar por exemplo com a rea tcnica, voc precisa ter um
conhecimento tcnico profundo... [pausa] no adianta falar ahh eu quero essa
superfcieassimsevocnahoraquevocvaianalisarvocvaifalarbomissono
saidaforma,novaiconseguirmontar,novaiconseguirproduzirapea.
Ento a primeira coisa formao intelectual e tcnica do designer. Porque o
designer hoje em dia... eu encaro os designers brasileiros e muitos europeus
tambm,americanos...meio...elesqueremsersuperstars,aprimeiracoisaquet
nacabeadeledeserumapessoafamosaporqueeledesigner.Eissoaltima
coisaqueinteressa.
Aprofissododesignerumaprofissodura,noficaremcimadeumpalconum
show,apresentandooprodutodele.No,Issonoamissododesigner.
A misso do designer ter conhecimento suficiente pra gerar um produto que
possaserbonito,masqueatendaatodasaspremissastcnicas,demarketing,de
produo,denegcio.Porqueissomaisimportantequetudonofim...odesigner
est servio de uma companhia e no final o objetivo dela o negcio, fazer
dinheiro.
Essa a viso que os designer no tem. O designer tem s uma viso purista da
forma e uma viso de que o designer um superstar. Ento um pensamento
totalmenteerrado,odesignernoumsuperstar,odesignerummeioescravose
voltar, no digo na Idade Mdia mas... l em Roma vai...nos ureos tempos de
Roma, os grandes designers... por exemplo, Michelangelo que foi um dos maiores
artistasdetodosostemposcriouobrasfantsticaserealizouobrasquevodurar
euachoqueeternamentepelaimportnciadaobraedotrabalhodele.Eleeraum...
um cidado de terceira categoria, ele era um trabalhador braal, e isso... mesmo
depoisdostemposmodernos,issocontinuaassim.
O designer,ele um funcionrio, que faz um trabalho braal,ele fazum trabalho
fsico...hojeemdiacadavezmenos...ofsicotquasemovimentaromouse...mas
elefazumtrabalhointelectualefsico.Eleconstricoisas.Entopramimeleum
cidadodeterceiraclassedentrodosistema,eleocaralembaixoquetemque
sevirarprafazerascoisas.
Aprimeiraclassesemprevaitlemcimanospolticos,nosfinanceiros...comoera

267

269
270
271
272
273
274
275
276
277
278
279
280
281
282
283
284
285
286
287
288
289
290
291
292
293
294
295
296
297
298
299
300
301
302
303
304
305
306
307
308
309
310
311
312
313
314
315

emRoma,osqueficavamlrodeandooimperador.Nofaznada,sfazpoltica...
esses so os cidados de primeira categoria, como so hoje tambm assim os
nossospolticos.E...narealidadeosdesignerstemafunodetrabalhadorbraal,
comoosconstrutoresdaspirmides...eletlpondopedraemcimadepedrapra
nofimterumproduto.
Essavisoaminhaviso,seiqueumavisomeiotenebrosamas...[risos]
Porquequandosefalaemsuperstar,noexistesuperstarmaiorqueoMichelangelo
no?Elefoiumgrandecara,masavidadelefoimuitopior,eeleestavasemprel
noestdiodele...ficouseteanospenduradonaCapelaCistinaprarealizarumaobra
que s ele podia fazer, ningum mais... ele era o cara, mas ele era um cara de
terceira categoria, ele no tava l do lado do papa sentado tomando vinho e
comendocarneiro,eletavalpenduradonumandaime,numaescuridoiluminada
por vela e fez uma das maiores... demorou sete anos pra fazer uma das maiores
obrasprimas,maseleeraumtrabalhador.
E assim que eu vejo o designer, o designer no um superstar, muito pelo
contrrio,eleumtrabalhadorduroetemqueproduzir,temquefazerotrabalho
delequemuitoimportanteeoquevaivenderocarro,masquandoeletermina
um ele comea outro e isso vai continuar durante toda a vida profissional dele, e
poucos designers famosos, o cara que trabalhou nele, que foi l, que ralou no
estdio,muitopoucosdelesvochegarasubirnumpalcopraapresentaroproduto.
Outro dia mesmo eu estava fazendo um design review sobre a Ferrari Testarossa,
hoje um dos cones da Ferrari, e porque, porque estava sendo comemorado...
vamosdizerassimeraumahomenagemmortedoPininfarina...ealifuandona
histria toda do carro, voc vai perceber que o Pininfarina ele no ps um dedo
nessecarro.
Esse carro foi desenhado por um cara no estdio, foi elequem tevea ideia desse
carro, ele que ralou l pra fazer acontecer, e algum chefe de estdio que acabou
levando secundariamente o louro... ele foi o grande... na realidade no foi o
Pininfarina,foiochefedoestdio,oseildasquantasl,masnemfoiele,nemesse
carafoi...foiumoutro,abaixodele,umdesignerquetinhafeitoocarro.Essecara
nunca nem apareceu o nome dele, entendeu. Apareceu e no fim foi o Pininfarina
que subiu no palco e at hoje leva a fama de ter construdo todos esses carros
maravilhosos.
Querodizer,oPininfarinateveumafunoprimordialno...eleconseguiurealizar
isso, ele tinha a viso global, ele conseguiu mexer os palitinhos na poltica, com
todososfornecedores,comtodaacompanhiaemsiprafazercomqueessecarro
acontecesse.Masosdesignersmesmonoapareceram.
Em sua opinio, tendo em vista os grandes avanos tecnolgicos e tambm os
obstculos referentes mobilidade na atualidade (por exemplo, preservao do
meioambiente;mobilidadeemgrandescidades;interaocomosdemaismeios
detransportepblico,entreoutros),qualseropapeldodesignerautomotivono
Brasilnosprximosanos?
Nstemosessapreocupao,umapreocupaoquenodehoje,odesigner...
eletemquetligadoaisso,eletemquetentando...eletemessamissotambm
depensarsobreissomas...oqueeuvejoassim,comoeudisse,odesignerum
funcionrio, o funcionrio de uma empresa e pra ele poder desenvolver alguma
coisa, que esteja relacionada ao meio ambiente, a empresa tem que ter essa

268

316
317
318
319
320
321
322
323
324
325
326
327
328
329
330
331
332
333
334
335
336
337
338
339
340
341
342
343
344
345
346
347
348
349
350
351
352
353
354
355
356
357
358
359
360
361
362

filosofiademeioambiente.
Entoissotemquevirldecima,aempresaquetcontratandoessedesigner,ela
temqueserumpontoderefernciaemrelaoaomeioambienteeaM2temisso.
Ela tem vrias aes que so ligadas prpria fbrica, como tambm ligadas ao
produto. Ento ns observamos hoje em dia... j h muito tempo que a gente
observa por exemplo diferentes materiais, que sejam sempre fceis de... por
exemplodevoctiverdoismateriaisdiferentesemumapea,essesdoismateriais
temquesesepararfacilmenteprareciclagem,issofazpartedaconstruodessas
peas, ns pesquisamos materiais alternativos, por exemplo o Curau que voc
deve conhecer que tem origem em fibras naturais, agora ns estamos
desenvolvendo materiais de tecidos de bancos, eles tem uma base de PET, so
construdoscomomesmomaterialdagarrafaPETentoexistemvrias...odesigner
ele tambm tem como misso pensar nisso, mas a coisa toda t... eu vejo que
muitomaisfortequandoaempresatemessamentalidade,issoumexemploeo
queeuvejo...tambmdependemuitodoqueogovernovaiquererfazercomesse
pas.
Entofalarhojeporexemplo...falardecarroeltriconesse...noBrasilumapiada
t...umapiadamuitogrande...
Nemamatrizenergticaatualsuportaria...
E no s isso, pra voc ter um carro eltrico voc tem que ter estradas boas,
porque ns temos quepensar o seguinte, o carro eltricoele tem uma bateria ali
embaixo uma coisa monstruosa, uma bateria enorme e ela muito sensvel, por
exemplochoque...sevoctemumcarroeltricoeabaterianoassoalhosevoc
pegarumlombadaviolentanolocaldessabateriaequebraressabateria,vocpode
causarumaexploso...sevocestivernumcarrodessedentrodeumaenchente...
imagine...umsecadordecabeloligadoemumabanheira.
Entocomovocvaievoluir,dopontodevistadomeioambiente...euachoqueum
primeirograndepassoestnamaneiracomooprpriogovernovailidarcomissoe
darcondiespraqueissoacontea.Falarsobrecarroeltricomotivodepiada.
Euestoufalandosdocarroeltricomasenfim...tudobememcertosambientesele
absolutamentevivel.Na[citaopasdeorigemdaempresa]porexemploelesj
tem dois mil e poucos postos de abastecimento na rua, assim como tem os
parqumetrosvocjencontraospontosdecarga,enquantovocvaiemumaloja
vocdeixaseucarrocarregando,ento...essapartesocial...ogovernotemquet
preocupadoemcriarcondiespraqueissoaconteae...noBrasilissovaidemorar
bastanteviu.
Mas eu diria que dependendo dessa vontade poltica, dependendo do perfil da
companhia, o designer de longe vai ter um papel muito importante, o papel de
novamenteestandolnocentro,detodasasmatriasdetodasasdisciplinasque
envolvem o design de automveis, ele vai t no centro pra ajudar a definir junto
com os parceiros um produto que seja interessante, que seja bonito, que seja
confortvel,quesejaseguroodesignervaiterumpapelmuitograndeemrelaoa
isso.
Gostariadeteceralgumasconsideraesfinais?
Eu sempre... meu discurso ultimamente t sendo mais ou menos bater um pouco
nos designers [risos], nos jovens designers...meio que sacudir eles pra fazer... pra
tirardecimadelesessacoisadequeodesignerumartista...odesignernoum

269

363
364
365
366
367
368
369
370
371
372
373
374
375
376
377
378
379
380
381
382
383
384
385
386
387
388
389
390
391
392

artista,odesignerumtcnico,umcaraquetemumagranderesponsabilidadee
por isso mesmo ele tem que crescer, ele tem que estudar, ele tem que se
aprofundardentrodaprofissodele...eletemqueserumcaracompleto.Serbom
emdesenho,mastambmtemqueserbomemtransferirodesenhopromodelo,
ele tem que ser bom no relacionamento com os parceiros, ele tem que ter
conscinciasocial,eletemquesabermuitosobremoda,sobretodaaquelahistria
que voc j conhece. Ele tem que estar por dentro das coisas, acompanhar
tendncias,entoeletemgrandesresponsabilidadeseissoqueeletemquelidar.
Poroutroladoasescolastambmelasdevemserconscientesdissoevamosdizer
assim,melhoraropadrodoensino,darmaiscondiespraqueessamatriaentre
emprofundidade,elavenharealmenteformardesignersdequalidade...enoolhar
s pro automvel. Porque o automvel como ns falamos na primeira pergunta
um meio muito restrito, eu diria pro designer brasileiro se preocupar mais com
outras coisas, se preocupar mais com outros produtos, ter essa viso de que tem
muito, praticamente tudo a ser feito. Qualquer produto que voc pegar feito,
manufaturado e criado no Brasil, voc vai perceber que existe ainda um outro
caminho ainda a percorrer pra aquilo, pra que aquele produto seja considerado
bomdopontodevistadodesign.Sevocpegalumsuportedefiltrodegua,que
voc compra na feira aqui no Brasil, voc vai que com o mesmo material, com a
mesma ferramenta, com a mesma tecnologia que voc fez aquela coisa,
completamenteerrada,sebaseandonoqueenonoquedeveriaser...poderiater
feito uma coisa boa, mas normalmente quem define o produto o dono da
fbrica...seil...atiasvezesouaprima.
temmuitoaserfeito...
Temmuitoaserfeito,umcampomuitobonitoemuitograndenoBrasil,maso
queeuvejo...comoeudiria...avocaodoBrasil,elanodesigndeproduto...a
vocao do Brasil outra. A vocao do Brasil pra mim gerar alimentos pro
mundo, pesquisar toda essa riqueza que ns temos por a... desenvolver a pesca,
aproveitar as nossas riquezas naturais, agricultura... essa a nossa vocao,
aproveitarmaisanossaterra,pelavariedadequenstemosaqui.

270

UNIVERSIDADEESTADUALPAULISTAJLIODEMESQUITAFILHO
FACULDADEDEARQUITETURA,ARTESECOMUNICAO
ProgramadePsgraduaoemDesign

OPAPELDODESIGNERAUTOMOTIVONOBRASIL:PROCESSOSEPRTICAS

Entrevistado:Designer4[D4]
Montadora:Montadora2[M2]
Gravaotelefnica
Data:19/09/2012
Durao:15min07seg.

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33

Nome
D4
Suaformao(graduaoeps,casohaja)
Graduao em Desenho Industrial com habilitao em projeto de produto em
instituiopblicadoestadodeSoPauloepsgraduaoemGestododesignem
instituioprivadadoestadodeSoPaulo.
HquantotempotrabalhacomDesignautomotivo?
...naindstriaautomobilsticamesmohseisanos.
Emsuaopinio,noqueconsisteotrabalhododesignerdeautomveis?
Bom eu acho que principalmente ... [pausa] pensar a mobilidade, pensar a
funo seja qual for o meio de transporte que v ser produzido, como isso pode
interagireserfuncional,agradvel,confortvelcomtodososatributosqueocliente
esperanouso.Entoeuachoque odesignerdeautomveltemqueentenderdo
contexto da mobilidade, do uso e de quem o consumidor especfico, tanto pra
aqueleautomvelouveculo,quantodentrodeledivididoporverses.
Combaseemsuaexperincia,comovocvaprofissodedesignerautomotivo
noBrasilnaatualidade?
Bom eu vejo que hoje ns temos estdios bem avanados pra vriasmontadoras,
ou outros tipos de locomoo e com designers com experincia internacional ...
[pausa] os prprios estdios esto cada vez mais interligados no mundo... nas
multinacionais e eu vejo que assim, so estdios que no s produzem hoje pra
necessidadelocaloudoBrasil,mastambmcontribuemcomprojetosglobais.
Ento eu acho que assim... foi uma necessidade da indstria que virou no fundo
uma coisa bacana, uma experincia boa pros designers que hoje trabalham pra
projetosqueatendemnosomercadobrasileiromastambmomercadoglobal.
Sendoodesignumaatividadeinterdisciplinar,emsuaopiniocomosedoestas
relaes dentro da empresa, e at que ponto elas interferem na prtica dos
designersemrelaoaoprojeto?
Bom, no meu ponto de vista fundamental...[pausa] eu acho que em qualquer
atuaoodesignernecessitaterumaatuaointerdisciplinarnaempresa,euacho
que at o designer centralizador dessas aes, ... o designer participa desde a
criao,eleoinputinicial,numbriefing,nocontatocomocliente,naobservao
nasclinicasetemqueacompanharoprojetoatonascimento.

271

34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80

Issoporqueelevaicentralizarasaesatabuscadaviabilidadetcnica,atfazero
produtoacontecernomercado,acompanharofuncionamento,possveismelhorias
etudomais,entoissodependedessa...dessafinalidade.Quantomaisodesignere
o departamento de design interagem com outras reas, de planejamento, de
marketing,decustos,finanas,maiseuachoque[pausa]demaisexcelnciavaiser
oprodutofinal.
E as relaes entre as reas, voc definiria de que maneira? Quando vocs
precisam de algo, quando vocs definem algo, como essa relao?
... eu acho que... hoje fundamental... eu acho que o design acaba sendo o
departamento corao da empresa, ele que movimenta as reas at em alguns
momentos, e... na verdade o dilema maior sempre vai ser ... unir o foco da
viabilidadetcnica,daproduodaqualidadedaproduoemsrie,comasideias
iniciasdodesign.Eapassaaserfunododesigneriralmdessasideiasiniciais,
conseguir negociar com as outras reas, acompanhar com as outras reas o
desenvolvimento tcnico das ideias. Ento acho que assim, qualquer dificuldade
nesse sentido cabe bastante aos designers sobrepor, achar caminhos pra que isso
acontea.
Qualseriaonvelderelaoidealentreodesigneasdemaisreasenvolvidasno
projeto?
Nomeupontodevistatemqueserdirio,euachoquenofuncionaumdesigner
que fica enclausurado no departamento de design, ele tem que t o dia inteiro
negociando, conversando com marketing entendendo todas as expectativas e
unindo o desenvolvimento porque se isso vai muito pra uma rea ou pra outra o
produto vai perdendo qualidade, ou vai perdendo preo, porque no adianta o
produto ser excelente e ter um preo no competitivo no mercado que ele vai
perder,entonomeupontodevistaodesignertemqueseenvolvernosprocessos
dacompanhiapraqueoprodutoganhe,praqueoconsumidorfinalganhe.
Qual a sua opinio acerca da autonomia dos designers brasileiros no
desenvolvimentodosprojetos?
Eu vejo que ... acho que uma relao dialtica... por um lado, toda a indstria
multinacional depende bastante da matriz, mas por outro lado isso gera benfcio
contrrio tambm. Ento ao mesmo tempo que os designers dependem da
aprovao da matriz eles tambm levam novidades que so implementadas l,
entopassaaserumatroca...nosum...simplesmenteumadependncia,mas
domeupontodevistaumatroca,agenteprecisadaaprovaodelesmasporoutro
ladoagentelevanovidadesquesomuitobemaceitasporl.
Fale sobre os principais desafios enfrentados pelos designers automotivos
brasileirosnodiaadiadaprofisso
Hoje eu vejo que a competitividade, ento justamente todos esses... toda a
movimentao do mercado global hoje... toda a indstria que movida pra
mobilidade vem crescendo muito no Brasil hoje tem a entrada de vrios novos
competidoreseissocriouumaloucuraporlanamentosnovos,porum...naminha
opinio tambm um exagero de lanamentos e de novidades que nem sempre o
prprioclienteacompanha,entotodomundoquerendoavanar,masantesde
avanar com inovao de verdade, todo mundo fazendo um monte de coisa que
nemsempreoqueclientequer.
omaisdomesmo?

272

81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121

Isso, mais do mesmo, ento ou a variao do mesmo tema, ou ento antecipar


lanamento,enemsemprettodomundopreocupadocomoconsumidormaisa
competio em si... ento acho que o desafio principal esse, no meio dessa
loucuratodacontinuarmantendofoconoconsumidornousonoconfortoqueo
queinteressanofinaldascontas.
Quaisseriamosaspectosaseremtrabalhadosparamelhorarasuaprtica?
Eu acho que exatamente nisso, no dia a dia todo mundo correndo com o
desenvolvimento e perdendo o foco do que o consumidor. Ento acho que o
designertemaobrigaodemanteraobservaonoconsumidor.Entomantera
observao e trazer pra companhia. As necessidades reais do consumidor. Ento
achoqueodesafioeametafinaltemquesersemanternessa,nosimplesmente
continuar fazendo, correndo e lanando sem olhar pra o que t acontecendo de
verdadenodiaadia.
Certo,entovocsentequevocssoatumpoucopressionadosnodiaadia...
Sim os tempos de desenvolvimento so cada vez menores, a quantidade de
lanamentos de verses cada vez maiores, ento assim tem aumentado.
Ficasufocante...
Sim.
Em sua opinio, tendo em vista os grandes avanos tecnolgicos e tambm os
obstculos referentes mobilidade na atualidade (por exemplo, preservao do
meioambiente;mobilidadeemgrandescidades;interaocomosdemaismeios
detransportepblico,entreoutros),qualseropapeldodesignerautomotivono
Brasilnosprximosanos?
Eu vejo que assim, o mundo inteiro t repensando mobilidade, e os pases
subdesenvolvidos esto sempre um passinho atrs... muitas vezes por falta de
investimento em tecnologia, ou por falta de know how tambm em alguns
aspectos...eaeuachoqueodesafioproBrasilvaiserjustamenteesse.Conseguir
alcanar ... [pausa] avano tecnolgico ou avano em meios de pensar a
mobilidadequenosoautomveldentrodessaloucuratoda.Entoomundot
mudando, as cidades esto apresentando varias outras necessidades e que vai
puxaressatransioemalgummomento.
Ningumsabeaocertoaindaqualvaiser,masalgumacoisajaparece...oaumento
dousodebicicletas,demotosoudeoutrosmeiosdelocomooissotemqueser
observado... em algum momento essa transio vai ter que acontecer. Talvez
acontea antes nos pases desenvolvidos, mas a hora que acontecer l a prpria
populao vai cobrar eu acho que acontea aqui. Ento acho que nos prximos
anos,eeuachoquelogo,tendeaacontecer...agenteesperoumuitotempoeagora
com a entrada de mais competidores no mercado isso tende a acontecer mais
rpido.
Gostariadeteceralgumasconsideraesfinais?
No,acreditoqueasperguntasforamsuficientes.

273

UNIVERSIDADEESTADUALPAULISTAJLIODEMESQUITAFILHO
FACULDADEDEARQUITETURA,ARTESECOMUNICAO
ProgramadePsgraduaoemDesign

OPAPELDODESIGNERAUTOMOTIVONOBRASIL:PROCESSOSEPRTICAS

Entrevistado:Designer5[D5]
Montadora:Montadora3[M3]
Gravaotelefnica
Data:03/10/2012
Durao:25min28seg.

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33

Nome
D5
Suaformao(graduaoeps,casohaja)
Desenho de moda em instituio privada do estado de So Paulo, com ps
graduaoemDesignEstratgico
HquantotempotrabalhacomDesignautomotivo?
H4anos
Emsuaopinio,noqueconsisteotrabalhododesignerdeautomveis?
Noqueconsiste...emquesentido?
Seriasevoctivessequedefiniraprofisso,seperguntassemparavocoquefaz
eoquecompetnciadeumdesignerdeautomveis?
Olhaeuvouatfalardissodeumaformageralporqueassim...hojeomeutrabalho
eleapesardeserdentrodareadedesignagentetrabalhacomColor&Trimque
uma rea assim, que cuida de tudo o que tem a ver com a aparncia do carro.
Ento,revestimento,pintura,tecido,peasdecorativas,texturasplsticas...tudoo
quetemavercomaparncia,masagentetemumaligaobemassimprximacom
oestdio...entoosdesignersquefazemrealmenteoShapedocarroquemudam
aslinhasquedesenhamocarrointerioreexterior.
O que eu sinto assim se eu for te descrever um pouco do que seria o design
automotivo, eu acho que conseguir claro com a ajuda de outras reas capturar
qual ... no necessariamente o espirito da poca porque a gente vai fazer um
projetopradaliquatrooucincoanos.Masassim,capturaroespiritodoquevaiser
daquelemomentoproqualocarrofoiprojetado,oescopodessecarro,apartirde
umdesejoqueesseconsumidor...porqueagenteentendequecadasegmentodo
automotivo,elevaidirecionadopraumconsumidorquepormaisqueaquelegrupo
seja bem diversificado... existem vrios pontos em comum de desejo mesmo de
produto,queaultrapassamuitoessacoisadofuncional,queocarrotelevardo
pontoAaoB.Masdesejoassim,essecarropramimelecomosefosseaminha
roupa,essecarropramimtemquemepassarrobustez,porqueeumesintomais
segura dentro de um carro robusto... ento voc capturar a essncia dessa
necessidadequeesseconsumidortem...evocprojetarocarropraqueelesejapra
mim compatvel com as inovaes que no seriam s inovaes de linha e
aparncia,mastambminovao tecnolgica,voctrazerissoprocarroporque o

274

34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80

carroelepraticamenteumaextensodocorpodessapessoa...quandoelatse
locomovendo,ou nosassimquandoultrapassaessacoisadosetransportar,se
locomover,quandotambmtemavercomaidentidadedapessoa,vocconseguir
imprimirissonesseobjeto...nesseobjetoquemuitofuncional.
Combaseemsuaexperincia,comovocvaprofissodedesignerautomotivo
noBrasilnaatualidade?
Olha [pausa] eu acho assim que at pelo fato da gente ter hoje todas as
montadoras,todasaspessoasquetrabalhamnumamontadora...existeuma...uma
vontade muito grande de aproveitar, por exemplo no caso da M3 que tem um
grandecentrodedesign,aproveitartodaessaestruturaprapodertrazerpraesses
carrosapesardetodasasbarreirashojequeexistem,politicas,osimpostosenfim,
aproveitartodaessaestruturapratrazerinovaocadavezmaispraessescarros,e
assim... ... hoje um profissional que trabalha numa indstria automotiva
certamente...assimpensandonanossareadedesignnogeral,certamenteagente
temmuitomaissuporte,agentetemumfortesindicato.
Ento assim, tem essesdois lados, tem um lado vocacionalque eu acho que voc
entranumcentrodedesignvocvqueaspessoassomuitoassim...dedicadas
mesmo, elas so pessoas que gostam de apresentar um projeto que no
meramente uma estratgia de nmeros... ela uma estratgia inspiracional, uma
estratgia que tem a ver no s com pesquisa do que est acontecendo no
mercado, mas pesquisa de tendncias ento um ambiente muito criativo... e eu
acredito que hoje na nossa rea uma rea assim que ela te d um suporte pra
vocconseguirsedesenvolver.
Sendoodesignumaatividadeinterdisciplinar,emsuaopiniocomosedoestas
relaes dentro da empresa, e at que ponto elas interferem na prtica dos
designersemrelaoaoprojeto?
Olha... teoricamente, o fato de voc ter ali engenharia, ... o grupo de design, o
grupodecompras,ogrupomaistcnico...deveriaserassim,teoricamente.Nossa
perfeito! um grupo multifuncional, assim... eu posso te dizer que isso traz mais
benefcios do que prejuzos, mas hoje assim, o ponto comunicao [risos] um
desafio dirio assim, porque voc tem um intent que comea ali, depois voc se
depara com as limitae... e ai voc tem que adaptar aquele projeto pra ele ser
vivel, mas no adaptar de forma que ele perca muito, e voc tem sempre um
perodoaliqueagentetrabalhacom...[pausa]existeumestilo,cadaempresacom
um estilo de trabalhar... a gente tem um estilo de timing hoje que ele super
acirrado, ento voc tem todos esses desafios mas no final acho que o saldo
positivo,apesardemuitasvezesagenteverassimquenotem...notemcomo
todomundosairganhando.
svezesagentetemqueabrirmodeumacabamentoouporqueelenovivel
financeiramente, ou porque ele no vivel em termos de engenharia ele no
funciona,oueleprecisariademaistempoprafuncionar,entoachonofinalosaldo
positivomasagrande...[pausa]assim...apimentadodiaadiasabe?essa
coisadevocconseguirsecomunicarcomasdiferentesreasemanteraqualidade
doproduto.
Qualseriaonvelderelaoidealentreodesigneasdemaisreasenvolvidasno
projeto?
Olha...euachoqueonveldeenvolvimentoelejtadequado,oqueasvezesa

275

81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127

gentecomentaassim,eissoassimagentesabendoqueumaopiniominha,oque
a gente comenta assim, que a gente v hoje, eu pelo menos ouo muito falar,
recentementeconcluumapseelatinhaumfoco...apseradesignestratgico,
elatinhaumfocoemdesignthinking,entodagentetercomosefossempequenos
gruposmultifuncionaisqueconseguissemanteciparprojetos...enessaantecipao
fazerumpoucodessesprocedimentoscriativos,devocalicomearcomumaideia
quenonecessariamenteumaideiadecarro,elapodeserumaideiaassimuma
proposio assim sabe,vamos supor, eu vou dar umexemplo falando at de uma
outra rea... ... hoje... [pausa] pera... deixa s eu pensar aqui... t muito rpido
[risos].
Ahhoje,porexemplo,imaginaqueagentetrabalhacomrelgio...hojeserqueo
consumidorelequerterorelgiodeleqeleusanodiaadiamaispulso,jqueele
temoiPod?
Imaginaquevocdependedeumrelgioprasobreviver,ejqueeletemoiPhone
serqueelequerrealmente?Oqueagenteprecisafazerpraessecaracontinuar
comprandonossorelgio?
Ento assim voc tem aquela equipe multifuncional... pensar no corpo e... e...
aquele objeto, relgio, ergonomicamente aonde ele seria mais adequado... aonde
eleseencaixaria.Entoassim,tentarpensarnesseprodutonodeumaformato
imediata como a gente precisa por questo de prazo mesmo, de voc ter o inicio
meiofimdeumprojetoederepentevocprecisachegarnumresultadofinalmuito
rapidamenteevocnotemtempodeultrapassaroobvio.Entoeuacreditoque
deveriaassim...seriamuitointeressanteagenteterrealmenteassimcomosefosse
um centro de design avanado sabe? No qual voc possa deslanchar com novas
ideiasmasassim,tendoosuportedetodasessareasquesovitais.
Funcionaria ento como um laboratrio de inovao promovendo novas
possibilidadesparaodesigntrabalhardepois.Jqueotempododesigncurto,
uma equipe que trabalhasse com inovao para abastecer o design com novas
possibilidades...
Exatamente,eudigoassim...darvazononecessariamenteaalgumacoisaque
fosse corporativa, mas alguma coisa que fosse um pouco mais fora disso, fora da
caixa.
Qual a sua opinio acerca da autonomia dos designers brasileiros no
desenvolvimentodosprojetos?
Olha... a autonomia ela mdia, porque assim, voc sempre tem um escopo...
ento voc pode propor, voc pode trazer novas ideias, mas no adianta, aquela
marca,elazelaporumaidentidade,entoassimocuidadomuitograndepravoc
de repente no trazer alguma coisa que talvez... um exemplo, essa ideia pode ser
muitolegalnumacessrio,masderepentenolegalemumcarroqueelejvai
sairprontodeproduo,entoagentesempreprecisa...submeterostrabalhos
lideranaprapoderassim,versenotemnenhumfiosoltonosentidodeahser
que aquele carro que a gente j tem no mercado, e a entrando com esse da no
portfliodaquiXanosserqueissodaivaificarcompatvelcomaidentidadequea
gentequerimprimiraquinoBrasil?.Entoassim,temtodoessecuidado...maseu
acho que uma rea em que voc consegue propor, voc consegue ainda trazer
ideias novas que podem ainda no ser utilizadas imediatamente mas elas esto
alocadas.

276

128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174

Fale sobre os principais desafios enfrentados pelos designers automotivos


brasileirosnodiaadiadaprofisso.
[pausa]Oprincipaldesafio...[pausa]Olha...agentetrabalhacomummercadoque
assim,pormaisquevoctenhanoseuportfliocarrosmaispremium,carrosdeum
segmento mais sofisticado, a maior parte desse portflio ele um portflio bem
otimizado.Entohojeassimumgrandedesafiovocconseguirinovar,sendoque
vocderepentenotemaliumrecursomuitoaltoprainvestirnaqueleprojeto.E
umoutrodesafiomuitograndeachoqueaperguntaquevocfeznocomeo.Essa
comunicaodessegrupomultifuncional.Muitasreas...trabalhandojuntas.
Quaisseriamosaspectosaseremtrabalhadosparamelhorarasuaprtica?
[pausa] Eu no sei se tem algum aspecto assim que claramente d pra falar ahh
issotinhaquemelhorar.Porqueboapartedissopartedodesenvolvimento...no
temmuitojeitoassim....notemcomoevitardeterminadascoisas.
Umacoisaqueeuachoquesempreagregapraqualquerempresa,qualquertimede
trabalho,independentedoqueeleproduz,euachoquesempreolharpraoque
t acontecendo no s na internet, a gente ficou um pouco viciado, a gente tem
acesso a um portal que especifico pra captar tenncias, mas assim viajarmais
sabe,olharoquetacontecendonaEuropa,olharoquetacontecendonasia,
...estudarmais,masassimnodiaadiamuitodifcilopinarsobreissoporqueeu
acho que o andamento de uma empresa tem a ver muito com a filosofia daquela
empresa.
Eeuachoqueaempresaelaseautoanalisaconstantementeento...enocasoda
M3queumamontadora,euachoquehojeseagenteforolharaestruturadaM3,
umaempresacomoqualqueroutramontadoraqueelatembastanteprocessos...
pra voc conseguir validar projetos, no s projetos.... validar novos materiais,
validar novos acabamentos... assim e ela vem, eu vejo assim que o caminho
sempre assim como otimizar... como voc melhorar e otimizar com menos
processos.
Eissoaeuacreditoqueelavaifazeravidainteira...enquantoexistir...nosaM3
qualquermontadoravaisempretentarotimizarseusprocessos,euachoqueissoai
seria uma sada. Cada vez mais reduzir a quantidade de papel sabe. Claro de uma
formainteligente,porquesempapelnotemcomovocevitar.
Em sua opinio, tendo em vista os grandes avanos tecnolgicos e tambm os
obstculos referentes mobilidade na atualidade (por exemplo, preservao do
meioambiente;mobilidadeemgrandescidades;interaocomosdemaismeios
detransportepblico,entreoutros),qualseropapeldodesignerautomotivono
Brasilnosprximosanos?
Sobreisso,euachoqueessepapelelevemsendodesempenhadoassim.Porquea
gente...hojemesmoeutavavendoqueteveumaexposioemsampasobrenovas
tecnologiasautomotivas...eaitinhalasempresas,tinhammuitasempresas,mas
mechamoumuitoaatenoumprojetoquefalavasobreumcarroqueconseguia...
como posso te falar... voc conseguia ... pegar aquele painel daquele carro e
transformar ele... ... bom, o que tinha l de carro eltrico...[pausa] ento acho
assimqueopapeldodesignerincorporaressascoisasnoprojeto,olharprocarro
nomaismeramentecomoumproduto,masassim...vocfaloudeinteraocom
outrosmeiosdetransporte,achoqueeletambmtrazeressesinputsqueagente
recebedomercado,daspesquisasquesoprofundassobreamobilidadeurbana,e

277

175
176
177
178
179
180
181
182
183

trazer isso pro seu projeto como necessidade. E eu acho que aos poucos cada
montadora vai entender em que frequncia ela vai implementar cada coisa, cada
tecnologia.
Maseuachoqueagentetemumpapelimportantesim,porquemuitasvezesum
time de marketing ou de marketing estratgico que sinaliza uma necessidade mas
assim, a ideia quem vende o time de design, que junto com esse outro grupo
conseguetornarvisualanecessidade.
Gostariadeteceralgumasconsideraesfinais?
No.

278

UNIVERSIDADEESTADUALPAULISTAJLIODEMESQUITAFILHO
FACULDADEDEARQUITETURA,ARTESECOMUNICAO
ProgramadePsgraduaoemDesign

OPAPELDODESIGNERAUTOMOTIVONOBRASIL:PROCESSOSEPRTICAS

Entrevistado:Designer6[D6]
Montadora:Montadora3[M3]
Gravaotelefnica
Data:04/10/2012
Durao:47min40seg.

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33

Nome
D6
Suaformao(graduaoeps,casohaja)
Graduao em Desenho Industrial com habilitao em Projeto de Produto em
instituiopblicadoestadodeSoPaulo.
HquantotempotrabalhacomDesignautomotivo?
Agora esse ms... no [pausa] no final do ano, oito anos... no desculpa, deixa eu
pensar bem... eu comecei em 2005 na M2 como estagirio... ento so oito anos
mesmo.
Emsuaopinio,noqueconsisteotrabalhododesignerdeautomveis?
Ahh... bom, o designer de automveis consiste ... em alm de agregar a parte
estticaqueoquetodomundoimaginainicialmente,gerarinovaoemtermos
de tecnologia, [pausa] e... deixa eu pensar [pausa] difcil pensar num negcio
assim...
Eu...deumamaneirainformalexatamenteisso,agregartecnologiaeinovao
pro produto e... aqui principalmente no Brasil, tambm acho que foi s um
pouquinho inovar, porque a engenharia muito amarrada assim, muito presa a
critrios e tecnologias j comprovadas e... e j testadas, ento muito difcil
convenceraengenhariaainovar,acriaralgonovoento...euachoqueopapeldo
designerautomotivojustamenteforaronovo...
arriscareproporsemprenovidades.Euentendoassim,quealgumascompanhias
tem isso como meta, de inovar, mas assim... ento eu acredito que o designer
automotivoeletemsempreesse...essavontadedecriarcoisasnovasassim,no
svisualcomoamaioriadaspessoaspensam.
Combaseemsuaexperincia,comovocvaprofissodedesignerautomotivo
noBrasilnaatualidade?
Ahh...euvejoqueumaprofissoquetcrescendo...masnomuitopornoter
tantasoportunidadesetantasempresascomestdioaquinoBrasil.Masdapoca
que eu era estudante pra hoje, nesses oito anos que se passaram que eu t
trabalhandonarea,euvejoqueaprofissotganhandomaisrespeitoemrelao
a prpria imagem que ns temos em relao as montadoras, aos outros
profissionais d rea, engenharia, marketing... so as reas que so ligadas ao
designassim.

279

34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80

E...[pausa]ointeressetmuito...ointeressesemprefoigrande,mashojeeuvejo
queexistemmaiscanaisabertosassim,maisescolasoferecendocursossobreisso,
maismatriassaindosobredesignautomotivo,ento...comoeudisseointeresse
semprehouve,masnuncahouvemuitasoportunidades.Entohojeeuvejoquet
crescendo, t crescendo bastante, s no cresce mais justamente pelas poucas
empresasmultinacionaisquehoje,noBrasil,temestdiodedesign.Entoeuvejo
assimaschinesastochegandoagora,seeunomeenganoa[citaonomedeuma
empresa concorrente] ela t h algum tempo j estudando abrir um estdio mas
assim,aindafaltaumpouco.Seexistissemmaisestdiosdedesignaquicomcerteza
euachoqueaprofissoiatermaisemaisespaoainda.
Mas assim, resumindo eu acho que t crescendo... t crescendo, t ganhando
importncia,nos...[pausa]tsendoreconhecidalfora.Principalmenteeuque
trabalhonaM3umestdioglobal,umdosestdiosglobaisdaM3eagentesabe
que l fora eles respeitam muito os designers brasileiros e aos poucos a gente t
conseguindoespaonamdiainternacionalnosconstruindocarrosdemercados
emergentesquesoaquelescarrosmaisbaratosassim,commenossofisticao,ea
gentetcomeandoaganharespaolfora.
Sendoodesignumaatividadeinterdisciplinar,emsuaopiniocomosedoestas
relaes dentro da empresa, e at que ponto elas interferem na prtica dos
designersemrelaoaoprojeto?
Bom,oqueeupossofalaraexperinciaqueeutenhodeM3eumpoucodeM2.
Euvejoque,pelo...eununcafuiprafora,nuncatrabalheifora,masassim...[pausa]
pelosrelatosdosmeusamigosequeagentesabequeacontece,euachoquelfora
o designer tem muito mais fora, tem poder de negociao. Aqui no Brasil ... o
designereleainda...comoeufaleieletganhandoreconhecimentomaseleainda
sofreumpouquinhodepreconceitoassim,preconceitonosentidodenoteruma
voztoativa,ou...[pausa]comopossodizer......amesmafora,omesmopeso
queaengenhariatemouomarketingtem.Ento......euvejoquehojenoBrasila
genteaindatemque...primeirodecideseascoisanaengenharia,depoisdecidem
ascoisasnomarketingedepoiselespassamissopragente.Enodeveriaserassim.
Eu acho que as discusses deveriam ser de forma equalizadas assim... o designer
proporcoisaspromarketing,omarketingtentarcorreratrsdoqueagenteprope,
a engenharia tambm aceitar um pouco mais das nossas ideias e no o contrrio.
Normalmente eles tentam jogar o package pra gente, tudo definido, tudo pronto
...nacabeadoengenheiroassim:odesignerfazacascadocarro,enobem
assim.
Agentesvezestemmuitasbrigasprincipalmentecomaengenharia,omarketing
nem tanto... o marketing tem uma mente mais aberta a gente consegue uma
negociaolegal.Masaengenhariaaindatravamuitootrabalhodosdesignersno
Brasil. A engenharia ela... ela por ter j uma tradio maior do que o design...
assim...antigamentenotinhaestdiodedesign,mastinhaoprdiodeengenharia,
[risos] ento eles j tem mais tempo de casa digamos assim, ento ... e... e os
pouqussimosdesignersqueexistiamantigamenteerajustamente......scuidava
daaparncia.
E hoje a gente sabe que no assim, hoje em dia todos os carros so iguais, as
tecnologiassoasmesmas,osfornecedoressoosmesmos,entooququetem
que diferencia um produto de uma companhia pra outra o design, no s a

280

81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127

aparncia, a inovao, o qu que a gente oferece a mais que vai chamar a


ateno do consumidor. E ainda a gente v que... eles ainda no perceberam isso
entendeu, eles ainda acham que a engenharia fala, o designer obedece e faz a
casquinhadocarroe...aindatumpoucodifcil
Aindanoperceberamqueodesignserianaverdadeoelementoaglutinadorde
todasasoutrasreasn...
Com certeza!! No porque eu sou designer mas eu vejo at que o designer ...
como eu falei, agora h pouco... como as tecnologias esto muito parecidas, os
fornecedoresssoosmesmoselefornecempratodasasmontadoras.Entono
existeumadiferenamuitograndeentre......detecnologia,e...agenteassim...a
diferenanodesign.Entoeunaminhaopinioachoqueodesignmuitomais
importante que engenharia, mas assim... s que t difcil ainda... um pouquinho
complicado.
Qualseriaonvelderelaoidealentreodesigneasdemaisreasenvolvidasno
projeto?
Ahh... eu no sei assim, no sei exatamente o que te falar mas na minha opinio
[pausa] .. eu acho que deveria ser uma discusso... ... como que eu posso
explicar...ahhteriaqueserumaconversadeigualpraigual,notemumtermoque
eupossotefalarassim,masdeveriaterassim......osprodutos,osnovosprodutos
e... as novas direes de criao de produto deveriam ser conversados de forma
igualeentrenstambm,entreengenharia,designemarketing...eaquiloqueeu
te falei, no existe ainda muito isso. Normalmente assim: o presidente estipula
umaverba;passaissopraengenharia;aengenhariausaessaverbaeoquesobraela
passaprodesignsobrouissoaquievocstemquesevirar.Enoassim...t...
euachoqueaconscinciadedesignjtemquepartirdiretodapresidncia,eela
distribuirdeformaigualessasmetaspraquetodasasreastrabalhememconjunto
prachegarnumprodutofinal.
Qual a sua opinio acerca da autonomia dos designers brasileiros no
desenvolvimentodosprojetos?
Voc diz o designer, o que fica na mesinha desenhando ou voc quer dizer o
designerdeformageralassim...
Vocporexemplo,oquevoc,epelosseuscolegaseetc.Comovocsenteessa
autonomia?
Olha complicado isso porque existe uma viso assim um pouco glamurosa e
romntica de que o designer que fez aquele carro, ahh o designer criou. Na
verdade isso no existe em companhia nenhuma, em nenhum lugar no mundo. O
quevoctemumadiretoria,voctemumaidentidadequevoctemqueseguir...
eentonstemosautonomiadeproporoqueagentequiser,squeobviamenteo
que a gente prope tem que seguir uma... uma linha de raciocnio que j meio
acertadadentrodacompanhia,enofinaldascontasquemescolheoSr.Diretor
ento...
Liberdadeprapropor,agentepodeproporoqueagentequiserassim,squeno
vaisermeiomalucodefazerumnegcio...ocaratfazendoumafrentecomum
quadrado e voc mostrar um tringulo que voc sabe que no vai aprovar
entendeu...Masassimnoexisteessacoisade...deodesigner...elecomeaocarro
do inicio ao fim. Normalmente o mesmo carro passa na mo de quatro designers
atsair...atirpraproduo.

281

128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174

Oqueaconteceoseguintetudodependedademandaquevoctemnoestdio.
Entoporexemplo,naM3comosomuitosdesigners(tememtornodetrinta),eu
noseiteprecisarosnmerosmastemmaisdetrinta,assimsomandoColor&Trim,
interior e exterior. Mas assim, desses trinta voc imagina tem time de interior e
timedeexterior.Entodividaadmaisoumenosdezoudozecadatime.
Umcarro...odesenvolvimentodeumcarrolevadetrsaquatroanos.Nessemeio
tempo a diretoria, sei l porque eles decidem ahh vamos mudar o time, ento
pegaumcaradooutrotime,tiraocaradaqueletimeepenooutro,entotemum
movimento interno... ento as vezes eu t pronto pra trabalhar num projeto e no
fimdoanoomeudiretormeresolvecolocarnotimedooutrogerente,aoqueeu
tavafazendocainamodeoutroeassimpordiante.
Ento na verdade... ... ns temos mais que obedecer ordens. O diretor decide
que a gente tem que seguir aquela linha e a gente meio que vai refinando... ns
somosa...comoeucostumobrincarlnaM3,nssomosamoquemoveomouse.
[risos]Naverdadeagentefazoqueochefemanda,obedecequemtemjuzo.Ento
temessacoisaqueagentetemque...ecuriosoporqueagenteacompanhamuito
assim nas mdias, notcias e tudo o mais e a gente sempre v o comentrio das
pessoas quando sai um carro, e normalmente quando o pessoal... quando o carro
noagradaopblico...opessoalcaimatando...porqueodesignerquedesenhou
essecarrodeviatbbado...porqueodesignerdaM3maluco,porqueodesigner
daM3noseioque...enoassim.
Quemfazocarroodiretor,seocarrosaiufeiooubonitoquemfezfoiporgostoe
ordem do nosso diretor! [risos] Ento a gente no tem essa autonomia que as
pessoasachamqueagentetem...dedesenharoqueagentequiser.Soprojetos
queenvolvemmilhes,bilhesdedlarese...ningumvaisermalucodedeixarna
modeumcaraspraelefazeroquequiser.
Fale sobre os principais desafios enfrentados pelos designers automotivos
brasileirosnodiaadiadaprofisso.
Olhaeu....existemvrios,masoqueeuposso...oquemevemnacabeaagora
justamente essa coisa da inovao. Eu trabalho numa companhia que na minha
opinio ela no... ela tem certo medo de ousar, algo... ser lder. Ahh... Eu at
compreendoporqueumacoisaqueamaioriadasmontadoras,principalmenteem
mercadosemergentessofremuitoisso.
Ela...difcilagenteconseguirfazeralgumiralm,ousar...no,vamosfazer!
Vamosnostornarlderdemercadoenoseguirolder.
EntopramimachoqueodesafiomaioraquinoBrasilagenteconseguirfazerum
carro [pausa] alm das expectativas do consumidor. difcil a gente conseguir
justificarpranossadiretoriaprapresidncia,oqueforquenostemosqueiralmdo
queexistehoje.Aprticahoje,possodizerdascompanhiasqueeutrabalhei...no
sei as outras, mas a prtica que ns enfrentamos hoje assim: o qu que o
concorrentetem,vamosmontarumcarroquetenhaomesmocontedoqueaquele
carro pra concorrer com ele. S que a gente fica nessa estratgia, a gente fica
semprecorrendoatrsdorabo,porqueoqueagentecopiahojedeumcarroquet
emproduo,essecarroqueagentetusandodereferncia.
Quandoele...quandonslanarmosumprodutoquefoibaseadonele,aquelecarro
jtalm,elejvaiserrelanadocommaisalgumacoisa,eadenovoagentefica
atrs.Davem:ahhnoolha...agorao[citaummodelodoconcorrente]vemcom

282

175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221

umacessrioincrvelnopainel,olhavamosfazerigual,aagentedemoratrsanos
pra desenvolver aquele acessrio igual, quando o carro lanado da ahh nossa!
fizeram um [cita o mesmo modelo do concorrente] novo agora ele vem com dois
acessriosnopaineleagenteficoucomums.Entendeu?Exemplificandodeuma
formabemgrosseira...
Ento a gente porque no ahh olha o [modelo do concorrente] tem um, ento
vamos fazer com dois! Vamos ir alm, vamos propor algo alm do que o
concorrentetemhoje.Daahhnodporqueocustonocobre,porqueagente
temquesebasearnoquetemnomercadohoje....umaestratgia[pausa]meio
equivocada,masassim...infelizmenteoqueagenteenfrentanonossodiaadia.
Agentetenta,quandosaiumprogramanovoolhavamosfazerumcarronovoea
vemaquelalistadecontedosenossaquebacana!.Avemummontedecoisas,
um monte de acessrios, um monte de cosias novas e a a gente comea a
desenhar...eanoseioququefazemlnadiretoria,napresidnciaedaahh
cortaramissoaqui...olhaagoranotemmaisoparalamas,agorasfarolepara
choque...ahhno...agoranotemmaisofarolagorasoparachoque.Ento
vaisabe...vaisemprecortandoagente,semprepodandonossacriatividade,anossa
vontadedemostraralgonovoeagenteacabasempreoferecendoumprodutoque
agentesabeopotencial.Porquestesdecustos,essacoisa,essadoenadecarros
emergentes. A gente tem que se livrar disso ahh no! Isso aqui pro mercado
emergente,issoaquino[citaummodelopremiumeuropeu]...poxavidaporque
quenopodeserum[citanovamenteomodelopremium]?Porquequenopode
fazeralgoalm?
Masassim,existemoutrasdificuldades,masaquemevemamenteagoraqueme
deixa mais assim entalado essa coisa que eu acabei de te falar. A gente no
conseguir propor algo alm porque a... eles decidem sempre parar no que j tem
hoje.
Quaisseriamosaspectosaseremtrabalhadosparamelhorarasuaprtica?
[pausa] Olha eu... sinceramente eu no sei porque... essas dificuldades que eu
relatei...elaenvolvecusto.dinheiro.
a....avontadequeacompanhiatemdecriarumprodutonovo,ento...issoj
umacoisadeestratgiaqueaindatmuitoacimadedesign,noexisteumasoluo
mgica.simplesmentevontadedacompanhia.Deinvestirentendeu.Estratgiada
companhia. O [cita o nome do presidente da montadora na qual trabalha] eles
traamasestratgiasdeleseissogeranossaconsequnciaaquidefazerumcarro
melhorouno.Ento...noexisteum...noumacoisaquetnonossombito,
uma
coisa
muito
maior
entendeu?
Mas um pouquinho de ousadia no faria mal no ? De acordo com o que voc
relatou...
ento...masaquelacoisa...assimnsvemososconcorrentesa[citaonomede
umaempresaconcorrente]tcrescendomuitohoje.......notvelodesignassim....
asorientais,a[citaonomedeoutraempresaconcorrente],a[citaonomedeoutra
empresa concorrente]... que mais... as prprias chinesas, que ainda tem muito o
queaprendermaistocrescendo.Porque?Vontadepoliticadeles!A[citaonome
deumaempresaconcorrente]falouolhanosqueremosserlderes,oququens
temos que fazer para ser lideres? ...ahh tem que investir em design e
engenharia...ahh legal. Ento eles vo l e contratam todos os engenheiros e

283

222
223
224
225
226
227
228
229
230
231
232
233
234
235
236
237
238
239
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
258
259
260
261
262
263
264
265
266
267
268

montam um prdio l na Europa, aonde esto os melhores engenheiros? na


Europa Gasta dinheiro e montam l na Europa. Ahh aonde esto os melhores
designers?NaAlemanha?montaumestdiolnaAlemanha.dinheiro!Dinheiro
trazdinheiro,entoavontadeda[citaonomedamesmaempresaconcorrente]foi
sair da mediocridade e se tornar lder. Pagaram, compraram design, compraram
engenhariaehojeelesestoondeesto.
Em sua opinio, tendo em vista os grandes avanos tecnolgicos e tambm os
obstculos referentes mobilidade na atualidade (por exemplo, preservao do
meioambiente;mobilidadeemgrandescidades;interaocomosdemaismeios
detransportepblico,entreoutros),qualseropapeldodesignerautomotivono
Brasilnosprximosanos?
No Brasil... [risos] eu vejo assim... ... ns... voltando a insistir nessa coisa de
mercado emergente. A minha viso que a gente ainda tem que se livrar desse
estigma,achoqueessaapalavracorreta...mecorrijaseeuestivererrado...desair
dessa....dessaimagemqueagentecarregadefazercarropramercadoemergente.
O que ns vemos que a Europa, a Europa ela sempre uma referncia de
inovaoemtecnologiaautomotiva.Elajtcaminhandopraisso,criandoprodutos
novos, inovadores, pensando em tudo isso que voc falou de ecologia, consumo
inteligente, sustentabilidade, mobilidade. Mas aqui a gente ainda, tem essa
dificuldadesabe.
NoBrasilfalandoaquidonossopaisinho,...euvejoqueaindanosprximosanosa
gente ainda vai continuar fazendo carros... ahh... pelados, carros com pouca
inovao,consumoalto.Agentesvaicomearacriarcoisasnovasdepoisque...o
mundointeirojtiverfazendoissoeogovernoprovavelmenteincentivar...elejt
buscando... t bem tmido ainda essa coisa de incentivo do governo em relao a
carroseltricosetudoomais.
Mas acho que se no partir [pausa] se a iniciativa no partir do governo e da
sociedade,ascompanhiasvocontinuarproduzindoosmesmoscarrosqueagente
tvendohojenarua.Porqueumaquestodelucrofcil.VejoqueoBrasilum
dos maiores mercados do mundo, de automveis, mas ele grande assim
justamenteporqueaquiascompanhiasconseguemfabricarumcarroprapassado,
com tecnologia limitada e velha, e... por um preo relativamente baixo... e
conseguemvenderissoaquimuitocaro.
O carro no Brasil muito caro, no imposto que nem todo mundo crucifica o
governo ahh o imposto. o imposto sim tambm, o imposto muito alto em
tudo no s em carro, em tudo, mas a margem de lucro das companhias so
muito altas em relao a outros pases. Ento pra eles isso aqui uma mina de
ouro!Praququeelesvoproduzirumcarroeltricoseelespodemproduzirum
carrocommotordo[citaummodeloforadelinhadadcadade1980],comomotor
da[citaoutromodeloforadelinha],evocontinuarvendendonoverdade?
Ento......temquepartir...euachoqueesseincentivo,dogovernoedasociedade.
Euacreditoquemaisnogovernodoquenasociedade.Porquenaminhaopinio
que... a sociedade brasileira ela ainda muito metida, muito... ... deslumbrada
assim...comascoisasquevemdeforaequesocaras.
Aspessoascompramcarrosporstatus,nocompramporinovao,nocompram
por mobilidade.... no existe essa conscincia no Brasil. Existem assim...
pouqussimaspessoasquepensamnissonahoradecomprarumcarro.Euachoque

284

269
270
271
272
273
274
275
276
277
278
279
280
281
282
283
284
285
286
287
288
289
290
291
292
293
294
295
296
297
298
299
300
301
302
303
304
305
306
307
308
309
310
311
312
313
314
315

pras coisas mudarem aqui no Brasil, as pessoas tem que mudar essa conscincia,
porque hoje no existe conscincia ecolgica, no existe conscincia ... de
mobilidade,essascoisastodasqueagenteachabonito,eouveaspessoasfalando...
igualexistenaEuropa...talvezumpouconosEstadosUnidos.
Aspessoasaquielascompramcarroporglamour,porstatus.Elapreferepagaroito
mil reais em um jogo de rodas do que pagar quatro num carro com airbag
entendeu? Ento, o governo t obrigando agora a partir de 2014, os carros
obrigatoriamente vo sair com airbag. Ento isso exemplifica o que eu acabei de
falar.Seogovernoexige,seviralei,asmontadorasfazem.Nolei?Praquque
elasvofazer?Elasvovender...entendeu?Porqueaspessoasahhningumquer
carrocomairbag...porquequeeuvougastarquatromilreaisemairbagseeuposso
pegaressedinheiroecomprarumjogoderodacromado,entendeu?!Oucolocar
um sonzo bacana pra ouvir funk no meu carro entendeu?! Ento essa
mentalidademuitomedocrenoBrasilsabe...muitoe...eeuachoquenovai
mudarentendeu?
Oscarrosnovomudar...seopblico...seoconsumidorexigirissoolhanovou
comprarseucarroporquenoachoeleseguro,jexistiriampadresnacionaisde
seguranacomoexistemnaEuropa,crashtestetudoomais.Laspessoasmeu...
seocarrotemtrsestrelasnocrashtestningumcompra!Aquioscarasnosabem
nem o que... qu que crash test? Pra quque serve isso?. Ento assim, no
existe essa coisa de ahh vou comprar um produto inovador, um produto que
sustentvel....
Meusintomuito...eupossoparecerumpoucoantipatritico,masarealidadeque
eu vejo, e a gente luta por coisas novas, por oferecer produtos novos, seguros,
sustentveis. a palavra da moda agora. Mas a gente sabe que a diretoria e a
presidncianovaicomprarnossaideia.Praqu?Elesvoterquegastarmaiseas
pessoasnovoligarpraisso.Elasgostamdecarroque...porexemplo...
Ahh! Essa semana mesmo... ns estvamos no estdio e ahh vamos dar uma
olhadano[citamodelodaconcorrnciarecmlanado]eno[citaoutromodeloda
concorrnciarecmlanado]?temumaconcessionriaaliperto,samosnahorado
almoo, pegamos o carro e fomos l ver o carro. Aquele [cita modelo da
concorrncia] um carro que pra mim um hatch pequeno, nem um hatch
mdio, um hatch pequeno... cheio de... jewel inserts... assim cheio de pecinha
brilhante...cromadinho...rodinhacromadinha...
Qualotermoquevocusou?
Jewel...dejia...jewelinserts...so...nsusamosissononossomeiopraquando
a gente quer deixar uma....incrementar uma pea, um carro...mas assim um
elemento visual, voc coloca um crominho, uma pecinha brilhante, um ledzinho...
pra parecer uma jia mesmo. Ento no caso do [modelo da concorrncia], um
carro, um hatch pequeno, tem um monte de perfumaria no carro, um monte de
bobagem,ummotorahhomotorturbo,tmas[pausa]ummotorzinho1.6...
um motorzinho de num sei quantos cavalos, no entendo muito dessa parte de
mecnicaeoscarastocobrandooitentaedoismilreaisnumcarrodesse!Ocarro
maltemportamalasentendeueaspessoascompram...jviummontenarua...por
quecompram?Porqueglamour,aspessoasqueremglamour,aspessoasquerem
statusolhaeletemumcarroquecustaoitentaedoismil.umaporcaria,um
carropequeno,nocabeningum,notemportamalas,masocarrodamoda...e

285

316
317
318
319
320
321
322
323
324
325
326
327
328
329
330
331
332
333
334
335
336
337
338
339
340
341
342
343
344
345
346
347
348
349
350
351
352
353
354
355
356
357
358
359
360
361
362

fazemfiladeespera,epagamgio,aondejseviupagargionumcarro!Praque
isso?Entendeu...entoenquantoaspessoasnomudaremisso,eeuacreditoque
vai... no sei, se... no mudar nunca mas vai demorar muito pra mudar, as coisas
aquinoBrasilvocontinuardependendodelei.
No caso por exemplo... eu falo de lei porque existem algumas leis... por exemplo
emisso de poluentes, bom voc deve ter estudado isso a questo de emisso de
poluentessopadresqueogovernoexigedetemposemtempos.Entoexistea...
noseiquemregulaisso,seaABNTmasumrgoquedefineolhaapartirdetal
anotodososmotoresquevocsproduzempodememitirnomximonoseioql
de de CO2... de monxido de carbono, aqueles padres de engenharia. A a
montadorasecoa,ebotaaengenharadapratrabalharpraconseguirproduzirum
motor que emita aquele mnimo ali que o governo exigiu, caso contrrio ela no
pode vender o carro. Um exemplomais recente qeu posso citar por exemplo a
[citaummodelodaconcorrncia].A[citaomesmomodelo]eutavalnaM2ainda
trabalhandol,elesmodificaramomotorda[citaomesmomodelo], tiveramque
mexer no cmbio, trocaram o motor e a todo mundo nossa a [cita o mesmo
modelo]commotormaissilenciosoagora,maismoderninho.
Mas por qu? Porque eles quiseram? Ahh no vamos pegar a [cita o mesmo
modelo]evamosdarumarenovada!...quenada...porqueaquelemotorda[cita
omesmomodelo]elajnoiaatenderpra2008...elanoiaatenderumanorma
que o governo estipulou. Ento o que eles fizeram, eles adaptaram o motor do
[outromodelodamesmamarca]mexeramalinaestruturadele,nacomposiodo
carropracolocaraquelemotorporqueaquelemotoratendia.Entofoimeramente
umrequisitotcnico,nofoinadadevontadedeleseminovar.
Agoracomaquestodoairbaganoseioqueelesvofazer,porqueoairbagtem
que sair em 2014 em todos os carros, no sei o que eles vo fazer com a [cita
novamente o modelo da concorrncia]. Eu ouvi boatos, no sei se brincadeira,
masouviboatosdequeelesestavamtentandomontaraibagna[citanovamenteo
modelodaconcorrncia],[risos]maseuachoquenovaidar...seil...
Parecequearrumaramumpainel...iamfazernoseioquel...eufaleiahhvocs
todebrincadeira...masseilesperoquesejaumboato,esperoqueat2014o
[citaomesmomodelodaconcorrncia]virepeadecolecionador.Porqueagente
sabequeumcarroquenoseguroa[citaomesmomodelodaconcorrncia]
um carro que d um lucro altssimo pra M2 porque um carro, um projeto da
dcada de sessenta/setenta e meu, aquilo uma lata... uma lata gigante...
perigosonoseguroemnenhumponto,evenden?
Todomundocompraa[citaomesmomodelodaconcorrncia]eelesnogastam
nada pra montar... voc tem que ver a linha de montagem... nossa uma coisa
extraordinria.Omontadorpondoopezonajanela,puxandocordapraprendera
janela...bemarcaicomesmo.Masassim,vende,eavocvelano[citaumweb
sitedenotciasautomotivas]opessoalmetendoabocaporqueumavergonhaa
M2 vendendo um carro desse, aonde j se viu vendendo carro ultrapassado!. U
vergonha,vergonhadequemcompra!Seeuttevendendoumalatadeareiae
vocfalarquecompraeuvouvenderu!Noverdade?
Setemdemanda...
Vou falar olha no vou te vender porque sei que no um produto legal pra
voc....Noexisteisso!Existeummercado...umasociedadecapitalista.Seocara

286

363
364
365
366
367
368
369
370
371
372
373
374
375
376
377
378
379
380
381
382
383
384
385
386
387
389
390
391
392
393
394
395
396
397
398
399
400
401
402
403
404
405
406
407
408
409
410

falou que compra voc faz, e se no tiver ningum pra te dedurar, pra exigir de
voc...ahh...davoccontinua...issoai.
Gostariadeteceralgumasconsideraesfinais?
Olha,euachoquejfaleibastante,jfaleiatdemais[risos]...masaproveitandoo
ensejomelembreideumdetalhequeeuachoquemuitoimportantenoseise
vaiagregarnasuapesquisa,mas...
Euvejoaindaumpreconceito,pelomenosnspassamosnaminhafaculdade,no
detodososprofessores,masdeumoudoisquecriticarammuitoagente,nosa
gente,masasturmasanterioreseasposteriorestambmpornstrabalharmospor
essacoisadedesignautomotivo.
Nsfomosxingadosporalguns,tevebaixariasabe...algunsprofessoresnogostam
dessacoisadedesignautomotivoeporquestespessoais,profissionaiseunosei.
Eles passam essa imagem, tentam passar essa imagem negativa pros alunos,
dizendoquesonhoquepodedesistir.
Olha... eu tenho amigos que trabalham na M3 comigo que estudaram na [cita o
nomedauniversidade]equerelatamasmesmashistriasdeprofessorfalarolha
issosonho,desistedissoai,issobesteira,quemestiveraquipensandoemfazer
carropodeesquecer,issonodfuturo.Eissoumatremendabobagem!Muitos
meusamigos,aminhagerao,asoutrasturmastambm...todosquebuscaram
isso, batalharam nisso, esto trabalhando na rea. Ento no sonho, no
bobagem.difcilrealmente,noumareafcildeentrarigual...seiladvogado
ououtraprofissoquetemummonteporai,quevocquerabrirumescritrioe
vocabre.
Design automotivo no ahh vou abrir um estdio de design automotivo no
fcil, mas assim, apesar da dificuldade a gente consegue sim, a gente consegue
trabalhobastante.SenoconsegueaquinoBrasilconseguelfora.Tenhomuitos
amigos que to trabalhando fora, na Austrlia, na Europa, nos Estados Unidos, e
todos saram da [cita o nome da universidade] sabe? Sentaram na mesma
cadeirinha que o pessoal t hoje e no ... no ... impossvel no! Isso uma
dificuldadetambm.
Eu acho que... voc me perguntou no comeo quais so as dificuldade no Brasil
sobreodesignautomotivo...romperessepreconceitotambm,nauniversidade,
nasescolas,jcomeada,opreconceitojcomeadai,temmuitagentequerendo
tecolocarprabaixo,pratentarfazervocdesistir.
importante voc ter falado isso, porque tambm o designer automotivo
profissionalteveumaformaoprviaequandoaformaojcomeaumpouco
prejudicada de fato preocupante n? A pessoa se no tiver muita fora de
vontade e acreditar realmente... porque de repente, nem s no mbito
universitrio,vocescutaissodefamlia,deamigos,masnombitodaformao
profissionalmaispreocupanteainda,porquealiolocalondedeveriaflorescer,
deveriaserincentivadoenoocontrrio...
Claro,exatamente,seseupaiesuamenoacreditamemvoctudobem[risos]
masoprofessor!Vocentrounumauniversidade,eletaliprateorientar,prate
guiar,falarpravocdesistir,poxadainod.Daisacanagem.
Mas assim... ... existem... mas s reforando que no so todos t?! s alguns
seletosqueporquestespessoaise... outrosmotivos,tentamcolocaragentepra
baixoenopode....agentejsofreporquenoBrasilnoexistecursoespecificopra

287

411
412
413
414
415
416
417
418
419
420
421
422
423
424

isso,noexisteumauniversidadededesignautomotivo...e...comoexistelfora,
entoagentejtemquebailarcom...comessadificuldade,denoter,deterque
correratrs,ficarfazendocurso.
Hojeemdiaaindatemcursomasnaminhapocanemcursotinha,agenteusavade
refernciaas[citaumapublicaoperidicavoltadaaodesigndeautomveis]que
tem na biblioteca... isso na dcada de noventa. E a gente tem que se coar por
conta prpria e aprender o desenho em casa, porque at os professores... os
professorestemboavontade,maselestambmnosabemdesenharcarroporque
desenhodecarromuitoespecifico,muitocaracterstico.Vocpodefazerocurso
quefordedesenho,vocpodepegaroMauriciodeSouza,seil...umcara,grande
a do desenho. Manda desenhar um carro que ele no vai fazer nada, isso uma
coisa muito caracterstica, no que difcil mas que especifico. Ento os
professores tambm no tem ainda um conhecimento muito grande, e ainda
apareceumcarapratebotarprabaixo...ainod!Temquemudar.

288

UNIVERSIDADEESTADUALPAULISTAJLIODEMESQUITAFILHO
FACULDADEDEARQUITETURA,ARTESECOMUNICAO
ProgramadePsgraduaoemDesign

OPAPELDODESIGNERAUTOMOTIVONOBRASIL:PROCESSOSEPRTICAS

Entrevistado:Designer7[D7]
Montadora:Montadora4[M4]
Gravaotelefnica
Data:27/11/2012
Durao:26min19seg.

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33

Nome
D7
Suaformao(graduaoeps,casohaja)
GraduaoemDesenhoIndustrialeminstituiopblicadoestadodeSoPaulo.
HquantotempotrabalhacomDesignautomotivo?
... j estou indo pro meu quarto ano. Na verdade so mais de trs anos e meio.
Quatroanosacreditoqueeucompletoemmarodoanoquevem.
Emsuaopinio,noqueconsisteotrabalhododesignerdeautomveis?
Bom, basicamente voc ver quais as necessidades de uma empresa, ao que a
genteconsideranaverdadeaoque...queseriaogostopopular,aoqueaspessoas
entendempelabeleza,adequarsnecessidadesdevenderumprodutoqueesteja
em adequao com o que o consumidor pode encontrar. Que na verdade v de
encontrocomasnecessidadesdebelezaedepraticidadequeeletempravidadele.
Acreditoquesejaisso.
Combaseemsuaexperincia,comovocvaprofissodedesignerautomotivo
noBrasilnaatualidade?
Assim,aondeeuconheotantodoquenoBrasilquantolforaeuaprendiquea
gentenotmuitodistante...pradizerqueagentenotdistantedoquefeito
pelasmesmasempresas,epelasoutrasempresaslnoexterior.
Eu diria que no Brasil a gente praticamente tem as mesmas atribuies e as
mesmas... as mesmas oportunidades que os outros designers tem l fora. Eu no
vejo de maneira alguma como tipo... no Brasil ou l fora sejam alguma coisa
diferente.Euvejoasduascomonaverdadeamesmacoisa.
A profisso de designer no Brasil ela ... basicamente a mesma que ela no
mundo todo pra qualquer empresa. A gente aqui tem condies de... de projetar
carros que forem do zero e desenvolver os carros que forem do zero da mesma
formaqueaspessoastem...osalemestemdefazeressecarroousado,ositalianos
possuem, os americanos, da mesma forma os brasileiros esto pelo menos com o
mesmocacifedeknowhowecapacidadeprafazertantoquantoqualquerdesigner
queestejanoexterior.
Sendoodesignumaatividadeinterdisciplinar,emsuaopiniocomosedoestas
relaes dentro da empresa, e at que ponto elas interferem na prtica dos
designersemrelaoaoprojeto?

289

34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80

Olha, basicamente como eu acho que as relaes [pausa] bom eu vejo muito a
relaodaparteexata.Agentetsemprelidandomuitocomaengenhariaecomos
rigoresqueaengenhariateimpe,eachoqueissoalgoqueagentetemmuito
fortejuntocomodesignl.Elogicamenteagentetemtambmapartequearte,
quebasicamenteoextremoopostodaengenharia...agente...aartecomo...na
verdade como um todo a gente v... como a gente v em histria da arte na
faculdade,comoagentevcomplsticaetudoisso,elesso...naverdadeeuvejo
essas relaes bem bacanas mas elas sempre aparecem num momento sutil...
porquequandovoctcriandovoctemtodaaquelaplasticidade,aquelaliberdade
que as disciplinas humanas davam na faculdade, aquela base que as disciplinas
davamnafaculdadeporqueummomentobastantelivreeavocsvaiperceber
o quanto a profisso mesmo t ligada com as exatas conforme o projeto vai
andando,porqueagentetemasdificuldadesqueaempresapossui.
Na verdade a empresa no ... vamos dizer assim uma... no capaz de fazer
absolutamente tudo o que sai da cabea... ento a gente tem a historia do... das
necessidadesqueasmatemticas,queosarquivos3D,ostcnicosetudomaisque
tmuitomaisrelacionadoasexatasquetrazempragente.Entovamosdizerassim,
eu vejo essas relaes em momentos distintos da profisso, porque nem sempre
voc t preso pelas amarras das exatas, e nem sempre voc t livre pela...pela
liberdade das humanas. Eu na verdade no sei se eu consegui me expressar bem,
mas acredito que seja mais ou menos isso. Voc tem bastante do que o exato,
bastantedoqueoartsticomasissoemmomentosdistintosdeumprojeto.
E l pra frente voc ainda tem marketing, ainda tem todas as implicaes de
custos...
Exatamente...comcerteza.Agentesempretpresoemalgumadasgrandesreas,
masissoaconteceemmomentosdistintos.
Qualseriaonvelderelaoidealentreodesigneasdemaisreasenvolvidasno
projeto?
Olha... o ideal pra ser sincero acredito que o ideal era que todo mundo se
conversassebemdeprincpio.Porque...[pausa]naverdadeeunosei...eunosei
at que ponto bom que voc... sei l fique to liberto a ponto de voc fazer
exatamente da maneira que voc acha. Ainda que no fundo da sua cabea voc
tenha certeza que muitas daquelas coisas no vo funcionar... ... eu realmente
acreditoquebomquevocpossaterliberdadedeseexpressardamaneiraque
vocacha,mas...muitasdasfrustraesqueeuacabovendoqueaspessoastemno
trabalho por no conseguirem colocar aquilo que elas gostariam de fato, veio
justamente porque elas ficaram absolutamente soltas por uma boa parte do
processo e elas no conseguiram... vamos dizer assim... entender at que ponto
queelaspoderiamvamoscolocarassimviajar,praqueaquelaideiadela...eujvi
trabalhos de pessoas que realmente estavam espetaculares no papel mas que
infelizmenteeramabsolutamenteinviveis,imprticos,inconstruveis.
Entoachoquesetivesseumpouquinhomaisdeinteraodasexatasnocomeo
vocsebalizariaumpouquinhomelhorpraqueseutrabalhonofosserejeitadopor
contadeeleestaravanadodemaisporexemplo,ounocasomaisprafrentecomo
exatamenteocontrrio,setivesseumpouquinhodaarteinseridonasdificuldades
tcnicas,naspessoasquevotexecutandoessatcnicacomvoc,especialmente
engenheiros, eu acho que voc poderia tambm extravasar, puxar... passar um

290

81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127

pouquinhodasbordasdelesporcausadeumpensamentotambmtoquadrado.
Entoachoquerealmenteainteraodeveriaaconteceremtodooprocesso,eno
deixaremmomentosespecficoscomoterummomentopraarteagora,depoisvoc
vai ter um momento pra resolver os problemas ... matemticos, os problemas
exatos,edepoislnafrentevoctemdificuldadecomosproblemasdecustos.Eu
achoquevocdeixariadeterproblemasnafrentesetodomundoseconversasse
antes, no comeo de tudo. E isso vale pro comeo, meio e fim do projeto de
qualquerforma.
Umaspectodecomunicaomesmoento...
Exatamente! que a gente por ficar muito livre no comeo, isso at em alguns
projetos que eu participei voc acaba passando do ponto vamos dizer assim,
passando do ponto e... e enquanto isso outro, vamos dizer assim... numa
competioporumdeterminadoprojetoquetemcinco,dezdesignerscompetindo
pelomesmoprojeto,svezesalgumquenotmuitoembasadocomatcnicaele
acaba sendo... ele no acaba sendo levado muito a srio justamente porque ele
passouumpouquinhodaquiloqueoseuchefegostariadever,queelegostariade
algomaistcnico,maisfeasiblealevocacabapassandodoponto.Eanocaso,eu
acredito que existe uma penalizao pra esse designer por conta da falta de
comunicao.
Qual a sua opinio acerca da autonomia dos designers brasileiros no
desenvolvimentodosprojetos?
Bom,issoeu...jportertrabalhadoemduasempresasdiferenteseupossotedizer
que varia muito da poltica da prpria empresa. mais uma viso do seu chefe...
sobrecomogeriropessoaldele,degerirdeacordocomapoliticadaempresa,de
design,doquepropriamentedaprofissoemsi.
Por exemplo na M2 os critrios l so bastante rgidos, voc tem uma srie de
vamos dizer... eu no vou colocar normas porque no bem essa a palavra, mas
voc que voc tem que seguir uma cartilha pra que as coisas possam funcionar
dentrodaM2.
J na M4 voc tem vamos dizer... eu no vou dizer que o oposto porque voc
aindatemalgunscritrios,masaliberdadedecriaodentrodaM4absurdaem
comparaoM2,porqueaM2atporserumaempresa[citaanacionalidadeda
empresa]eserbemquadradocomoagentesabe,muitoengenheirovamosdizer
assim,avisomuitoengenheiradaM2vocficamuitopreso.
J na M4 voc tem uma liberdade que s vezes... a gente j conversou at
internamente,queatatrapalhaasvezesporquevocpodeatirarpratantoslados
que voc no sabe pra onde atirar...tipo voc pode tanta coisa que voc fica com
receio de viajar demais e passar do ponto sabe? uma liberdade realmente to
grandeevocnotemalinguagemprpriadaM4,vocacabameioperdido.Ento
nocasooqueeufalei,vocnotemuma...essaliberdadeelanotatreladana
verdadeprofissodedesignerautomotivomastmaisdeacordocomacasaque
vocestinserido.
Fale sobre os principais desafios enfrentados pelos designers automotivos
brasileirosnodiaadiadaprofisso.
Bom... desafio eu diria que... at meio difcil porque a gente trabalha, vamos
concordarnumaprofissoquebasicamenteadossonhos.
Agentetrabalhasentado,fazendooquegosta,porquenormalmentetodomundo

291

128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174

quetladoradesenhar,gostamuitodecarro,daculturadecarroemsi,ento
bem difcil voc reclamar de alguma coisa que no seja as dificuldades que so
inerentes prpria profisso que lidar por exemplo... eu, pelo que eu vejo, na
minha opinio difcil as vezes voc lidar com pessoas que no tem a mesma
vontadedefazeraquiloacontecerquevoctemsabe?
Voc,cheganumdeterminadonveldeempolgaoquesvezesmuitosuperior
ao de outras pessoas, e voc depende delas pra que o seu trabalho v pra frente
tipo... especialmente quando a gente trata com engenharia, porque engenheiro
adorafalarquemuitacoisanopode,quemuitacoisadifcil,etodomundosabe
queapesardesecontarissocomoumalenda...nolenda...nofolclore.
A gente mesmo, j chegou em ponto da gente saber que com um pouco de boa
vontade voc conseguiria ir alm, voc conseguiria pensar numa soluo que
pudessedarumavoltanaquiloquevocgostaria,naquiloquefosseumdesejodo
designer de fazer. Ento eu vejo que tipo... aonde... a dificuldade mesmo
quandovocesbarraemumproblemaquevocsabequemaishumanodoque
tcnico,equevoctdependendodaspessoasquenotemamesmavontadede
progredir,amesmavontadedefazeraquiloquevocacreditaacontecer.
Esvezes...muitoraronaverdadepeloqueeuvejo...svezesqueoquevoct
querendomesmoquevoctambmjtumpoucomaisembasadoemtcnica,
raroquandoumapessoadizquenopodevoctercertezaquenopodeporque
uma impossibilidade tcnica, e no na verdade uma impossibilidade humana de
querer fazer funcionar. Basicamente eu colocaria isso como a maior dificuldade,
porquedetudooqueeufaolamaiorraivadetodasvocsempreesbarrarem
algum que no t comprometido cem por cento com o trabalho, e que
sinceramentenoquerfazerfuncionardamaneiracomopoderiasermelhor,eaas
vezes o trabalho como um todo e a fbrica como um todo, acabam sendo
prejudicadosporisso.
um fator complicado porque isso ainda persiste... a gente v que mesmo em
empresas grandes com negcios de milhes como o caso das montadoras n,
que dependem hoje em dia do design afinal a tecnologia est equiparada ,
empresas que dependem do design para as vendas, algumas pessoas pelo que
voc relatou, ainda tm essa viso de l vem o designer com a ideia absurda,
quandonaverdade...
Exato!! Acho que voc t colocando muito bem, pra algumas pessoas voc t
querendofazerocarrovirarumbaloesairvoando...epoxanobemassim.
E na verdade a gente... a nossa formao justamente de congregar diferentes
reas.Agentepropealm,masaintenolapidartodomundojunto...
claro todo mundo, na verdade a fbrica inteira, ela t, teoricamente falando
lgico,elatcomprometidaemfazersempreomelhorproduto,damelhorforma,
comamelhorperformanceepreferencialmentecomomelhorvisual,masquando
a gente vai passando por diversas reas, diversas pessoas que so... realmente
muitaspessoasqueestoenvolvidasemummesmoprojeto,quandovocesbarra
emalgumquenotvamosdizerassimno estcemporcentocomprometido,
voccomoprofissional acabaficandoprabaixoporqueseutrabalho,eaquiloque
voc gastou dezenas, centenas de horas em cima pode ficar... vamos dizer assim
notobomquantovoctinhacertezanocomeoquedariapraficar.
Edaioqueeudisse,nemsempre...vocquasesempre,vocsabequenoso

292

175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221

impossibilidadestcnicas,massonaverdade...vamosdizerassim,difcilfalar
mas por desnimo mesmo de algumas pessoas. Isso o que eu vejo de mais
desafiadornaprofisso,porquederestanterealmentequasequeaprofissodos
sonhosmesmo.
Quaisseriamosaspectosaseremtrabalhadosparamelhorarasuaprtica?
Bom, eu acredito que basicamente se voc conseguisse juntar numa mesma
empresa ... pessoas que trabalhassem vamos dizer assim... deixa eu ver se eu
consigo me fazer entender, tipo se as diferentes reas da empresa escalassem
pessoasqueseil,elasacreditamquesomaisvisionriasdentrodecadareapra
que trabalhassem juntos em momentos que na verdade a gente chama de pr
projeto. Eu acredito que isso ajudaria muito e... que as pessoas no estivessem
pensando justamente nas dificuldades que voc vai ter no projeto, e sim nas
oportunidades que voc vai ter pro projeto. Porque falar simplesmente que um
projeto vai sair caro porque ele vai usar LED no farol, isso muito fcil sabe de
falar?
Agora chegar em mim e falar olha o engenheiro falou que impossvel dobrar a
lataanoseiquantosgrausporquevocnovaiconseguirconformidade,vocvai
acabar trincando a lataria do carro... sabe... algum que tivesse l para que
visionasseoquevaiser...oquevaiserpossvelparaaempresafazerdediferente
detodomundonoamanhsabe?
Inclusiveengenheironomeioe...pessoasdecontabilidade,pessoasdemarketinge
inclusivedesigners,porqueodesignersemprealgumquetpensandofrente,
mas o pessoal de engenharia, o pessoal de marketing, pessoal de compras, eles
basicamente trabalham com o presente. Voc chega com o projeto, e falam ns
precisamos calcular resistncia, precisamos calcular custos, precisamos calcular
possibilidadesdevendasentotipo,odesigner...queeuvejoumadasnicas
reasquetrabalhamcomoqueaindavaiser,enquantoasoutrasreasaindaesto
trabalhandomuitocomascoisasqueso.
Entoachoqueseil,sevocconseguissejuntarnummesmoambienteprapensar
pra frente todas as outras reas juntas, eu acho que isso ia realmente ser um
diferencialmuitolegal.Eufaloissonocasodaempresamesmo,queaspessoasno
esto ali para criar dificuldades ou pensar no qu que hoje no possvel, mas
quemsabeoququeamanhpodeserpossvel.
Como se fosse um pequeno ncleo de pesquisa dentro do prprio design por
exemplo...
Exato! Exatamente! Pra voc trazer para a realidade do design as outras reas,
porque o que eu falei... eles s... eles s chegam, eles s entram num projeto
quando o projeto t rolando. Os prprojetos, e as coisas que vem antes, os
conceitosbemdifcilquevocvejaopessoaldemarketingenvolvido,opessoalde
engenhariaenvolvido,pessoasdasreasvamosdizerduras.
Eles praticamente nunca to envolvidos em momentos em que ... que possvel
voc viajar numa ideia, que possvel voc pensar alm como o designer faz isso
basicamentetododia...
O que evitaria muitos problemas l na frente, quando j est tudo bem
adiantado...
Nossa!Inacreditavelmente...porquesetodomundojsoubessediantemotudoo
que j t sendo planejado, as coisas ficam de fato muito mais fceisat para que

293

222
223
224
225
226
227
228
229
230
231
232
233
234
235
236
237
238
239
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
258
259
260
261
262
263
264
265
266
267
268

notenhamsurpresasnodecorrerdoprojeto...
At para vocs designers, para dar uma freada naquilo que j se sabe que l na
frentedoprocessoapresentarproblema,comovocjrelatou...
Exato,sealgumfalarpravocquedeterminadocorte,ouvinco,ouprotuberncia
na lata impossvel, tipo o cara chega e fala sinto muito isso aqui invivel
tecnicamente por A+B+C, ningum em nenhuma empresa no mundo conseguiu
fazerissoathojeenoexistemsequerpesquisaspraconseguirfazeroquevoct
querendo evita de voc gastar energia, gastar inclusive sua lbia tentando
convenceroseuchefedequeaquilopossvel,dequeaquilovivelsabe.
Eu acho que s vezes balizaria um pouquinho mais e voc deixaria de gastar suas
fichas emcoisas que realmente so impossveis de serem conseguidas... acho que
issoseriaumplusbeminteressante.
Em sua opinio, tendo em vista os grandes avanos tecnolgicos e tambm os
obstculos referentes mobilidade na atualidade (por exemplo, preservao do
meioambiente;mobilidadeemgrandescidades;interaocomosdemaismeios
detransportepblico,entreoutros),qualseropapeldodesignerautomotivono
Brasilnosprximosanos?
Prximosvocquerdizercinco,dez,quinze,vinte...
Fiquevontadeparaescolhereseexpressar...
Olha eu acredito realmente que, pelo que eu tenho visto de projetos em
andamento, pelo prximos dez anos vou chutar, no sei se eu... eu apostaria at
quinze,oBrasilvaipraticamentecontinuarexatamentedamaneiracomot...tipo,
os designers vo continuar trabalhando da mesma forma porque os carros
brasileirosaindatemmuito,masmuitooque andar,temmuitooqueevoluirpra
chegar nos carros... especialmente nos carros europeus como a gente pode ver
hoje.
Porque eles de fato se preocupam demais com questes de segurana e
sustentabilidade econmica... tanto economia de materiais, como economia e
combustveis,comoeconomiadeespao.
Ento, o Brasil em si, na minha viso ainda tem muito cho ainda pra queimar,
mesmopraconseguirqueaprofissotenhaquebuscarocaminhomaiseficiente,o
caminho mais seguro l no futuro. Ento acho que tipo... o que a gente t vendo
hoje no Brasil... o que eu vejo o que a Europa taria vivendo h talvez dez, mais
anosaindaatrs.Entoatqueagenteconsigacaminharculturalmentepraquea
profisso tenha que mudar em algum aspecto, eu acho que a gente vai pelos
prximosmuitosanoscontinuartrabalhandoexatamentedamesmaforma.
Gostariadeteceralgumasconsideraesfinais?
...noseisealgumsejnofoidito...mas...umaprofissoquerealmenteela
gratificante.
Eladifcilvamosdizerassim,comoeujtinhadito,porcausadetantosproblemas
que voc acaba encontrando por dificuldades tcnicas e por dificuldades
econmicas,entotipoumaprofissoquetipo...queparecequerealmenteno
valeapenaatomomentoemquevocvoseuprodutonarua.
Dareadedesign,odesignautomotivoumadasquemaisdemorapraquevoc
veja o fruto do seu trabalho na rua. Eu vejo o design esportivo, design de moda,
design de calados, eu j vi muita coisa inclusive que amigos meus trabalharam e
todoselesveempraticamenteotrabalhodelesmuitodebatepronto.

294

269
270
271
272
273
274
275
276
277
278
279
280
281
282
283

Ento,parecequeodesignautomotivovocconseguedesanimarumpouquinhono
meio do processo porque ele bastante complicado, bastante difcil, tem muitos
custos e muito dinheiro envolvido ento pode parecer de comeo... que no
exatamente aquilo que as pessoas sonham durante a faculdade, que voc vai
desenharcarro,quevocvaifazerascoisas.
Realmente,existemmomentosquevocpodeficarbastantechateado,maseuacho
que quando voc v o seu trabalho na rua voc acha que... no fim voc sabe que
acabavalendoapenaporqueapesardetodasasdificuldades,pravocseinserirno
mercadoeadificuldadedevocvencerdentrodeumamontadora,umtrabalho
extremamente gratificante quando voc v que aquilo que voc trabalhou tanto
chegou na rua e as pessoas acabam desejando aquilo por qualquer que seja o
motivo.
Entoseeupudessedeixaralgumacoisatipo,apesardeserdifciltantopraentrar,
quantoprasemanter,tantoquantopravencerldentro,quandocheganofinale
vocvoseutrabalhopronto,achoquevaletodaapenadomundo[risos].

295

UNIVERSIDADEESTADUALPAULISTAJLIODEMESQUITAFILHO
FACULDADEDEARQUITETURA,ARTESECOMUNICAO
ProgramadePsgraduaoemDesign

OPAPELDODESIGNERAUTOMOTIVONOBRASIL:PROCESSOSEPRTICAS

Entrevistado:Designer8[D8]
Montadora:Montadora4[M4]
Gravaotelefnica
Data:30/11/2012
Durao:26min08seg.

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33

Nome
D8
Suaformao(graduaoeps,casohaja)
Graduao em design de produtos em instituio pblica do estado de Minas
Gerais.
HquantotempotrabalhacomDesignautomotivo?
Noinciodedezembroagorafazemquatroanos.
Emsuaopinio,noqueconsisteotrabalhododesignerdeautomveis?
, olha eu trabalho com Color&Trim, cores e acabamento, ento especificamente
assim na nossa rea, a gente traduzir o que t acontecendo em tendncias e
mercados de vrios setores, e traduzir isso em acabamentos pra indstria
automotiva...entoassim...muitasvezesagentetem...trabalhacomnormasou
comrestries,ou,naverdaderequisiestcnicasmaisprofundasdoqueoutros
setores.
Entoagentetemqueconseguirtraduzirissotudonumprodutodedesignquevai
ter uma durao maior, por exemplo no um celular, que vai ter uma vida til
muitomenoretal.Tudoissoagentetemqueobservar...umprodutoquetemque
talinhadocomomercado,comastendnciasetudoomaiseaomesmotempo
temqueterumadurabilidadeat...nosemtermosdematerial,masemtermos
estticos,muitomaior.E...pora.
Combaseemsuaexperincia,comovocvaprofissodedesignerautomotivo
noBrasilnaatualidade?
Olha,euachoquehojeaquinoBrasilainda...um...sebemqueeunoseisesno
Brasil sabe... mas ainda mais restrito. Porque a indstria automotiva ainda ...
aindasomenores...menoresnodaindstriaemsi,masmenoresdeestdiode
design e tal, se voc for ver todas as outras indstrias, aonde teria espao pra
designereuaindaachoqueaautomotivaamaisrestrita.
algoquenormalmentemuitagentequerentrarseil,enemsempreconseguee
acabamtambmpartindopraoutrasreasetal.
Ento eu ainda vejo isso... ainda vejo que um pouco restrito no Brasil.
Eemtermosdevalorizao,comovocv?
Valorizao [pausa] bom... tambm acho que lgico poderia ser melhor [risos]
porque,naverdadeemtermosdedesignemgeral,nosoautomotivo,noBrasila

296

34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80

genteaindavqueaculturadedesignnotobemconsolidada.Essaaminha
impresso. Em outros lugares a gente j tem um reconhecimento maior do
designer,nosdaquelacoisa...mais...[pausa]superficial...assimahhissotem
um design bonito e no sei o que..., mas do design realmente como pea
estratgicadentrodeumaempresa,quepodeatmudarorumodaempresa.
Sendoodesignumaatividadeinterdisciplinar,emsuaopiniocomosedoestas
relaes dentro da empresa, e at que ponto elas interferem na prtica dos
designersemrelaoaoprojeto?
Olha a interao realmente muito intensa ... o tempo todo ela acontece... o
tempo inteiro a gente t relacionado tanto com a engenharia, quanto com a
questodecustodoprojeto.
Bom, a gente tem que sempre, a gente j recebe o input de uma outra rea j,
ento...dareadeestratgiadelinhadeprodutoetal,entojcomeapora...
aomesmotempoessareaelatemque,...agentepodedarumsuportetambm,
porque a gente tambm pesquisa mercado, a gente tambm ... pode dar um
suporteassimno...agentetvendomuitoissonomercadoenoaquilo.
Ento a gente d uma... d uma ajuda. E a depois tem toda a questo de
engenharia,deergonomia,atdefuncionalidadedascoisas,daspropostasetudoo
mais, e depois lgico a questo de custos. Se o projeto no tem umcusto... ...
bom,comosedizfactvel[risos],elenosobrevive.
Entoassim,onossointeressetambmqueocustosejafactvel.Entootempo
inteiro a gente t pensando naquilo tudo, se relacionando e o que eu percebo
tambm que s vezes a rea de design ela tem uma flexibilidade maior de
pensamento, que faz s vezes o que parece pra uma rea ser impeditivo a gente
consegue pensar numa alternativa, numa soluo numa outra... at pelo nosso
interessedeverumacoisaacontecer.Entosefalamahhno,masissoaquino
pode dai a gente ahh no mas espera a, vamos ver, vamos estudar, e do outro
jeito? E tal? ento, realmente a gente tem esse papel de comunicao, com as
outrasreasmuitointensoeacabaatinfluenciandomesmo,numadeciso,numa
coisaquepoderianoirprafrentesefossesomenteumtcnico,pensandonaquilo.
Esse processo de relao entre o design e as outras reas, ele sempre se
desenvolvedeumamaneiramaisfcil...comonaverdade?Porquecomovoc
falou,osdesignerstemmaisliberdade,svezesenxergamporoutrasperspectivas
um mesmo problema, que se dependesse das reas tcnicas j teriam sido
cortados. Nesse sentido as relaes entre vocs do design e as outras reas so
maispacficasouconflitantes?
No,euachoque,claroexistemdasduasformas.Maseuvejoqueassim,agente
conseguetambmatravsdonossotrabalhoat......conquistarmesmoasoutras
reas,numsentidoassim,asprpriaspessoasqueestotrabalhandonaquiloapesar
de ver uma dificuldade, elas gostam da proposta, elas acham interessante, elas
queremqueaquilovprafrentetambm.
Entoagenteacaba...conquistandoali...eapessoarealmentefalanossaseria
muito bacana se isso fosse pra frente assim. Ento ela vai trabalhar pra aquilo
conseguirserfeito.Entoassim,agentetemvistoissoacontecereachoque...a
melhor forma de se trabalhar, no que acontea sempre, mas isso acho que
natural.
umreconhecimentono...

297

81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127

,interessanteporqueagentevassim,pessoas...quepoderiamterumamente
maisfechada,nosentido......no,issonovaidar....noqueelatambmgosta
doquetsendoproposto,elaenxergaque...poxaprecisafazeraquilofuncionar.
Qualseriaonvelderelaoidealentreodesigneasdemaisreasenvolvidasno
projeto?
Olha,euachoquetemquesersvezesatmais...maisconectado,maisligadodo
quehojeporque...[pausa]ahhnosei...asvezesagenteseachatambmmuito
importanteenemtanto...[risos]nosei.
Masoqueeuficovendoessascoisasassim,agentetemumavisodecoisasque
poxa seriam bacanas, uma viso de futuro at e de mercado. Futuro de mercado
no...porquebemambiciosoisso,masassim,algumasvezesagentevqueideias
queagentegostariamuitodelevarfrenteeelasnosolevadas,emseguidaelas
soapresentadasnomercadoporoutra...poralgumconcorrentequefor.
Da a gente fala poxa que pena que a gente no conseguiu levar adiante. Isso
acontece em qualquer mercado, mas assim ento eu acho que de repente se a
gente tivesse toda aquela importncia que em outros lugares a gente j v, em
outrospasestal,talvezagentefosselevadomaisemconsiderao.
Eissotambmachoqueumapartedanossa...dagenteseprofissionalizarcada
vezmais,pragentecomearrealmenteaserenxergadocomoprofissionais,como
pessoasquefazemessadiferena.
Entoachoqueissovaisendoconstrudoaospoucos,modelodoqueacontecea
nomundo.Masoidealseriaumainteraoatmaiormesmo.
Voc considera ento que falta dentro da prpria empresa no digo um
reconhecimento,masumconhecimentomesmodoquedesign.Porquevocat
comentouAhh noseiseagente seachaimportantedemais,masaprofisso
emsitemopapeldeagregarasdemaisreasparajuntosbuscaremomelhor.Mas
svezesdentrodaprpriaempresa,nasoutrasreasaindanovistodessejeito,
comovocmesmapontuouno?Faltaasoutrasreastambmentenderemum
poucomaisdoqueodesign...
Sim.Porqueassim,...sopilares.Sealgumcair,acoisanovaiandarlegal.Ento
assim,todasasreastemumaimportnciamuitograndelgico,mas realmente...
talvez seja questo de no reconhecimento, mas assim ahh no ento a rea
responsvelporisso,elafazisso,elacontribuicomisso,etc.Entovamosouvir....
Seil,...entenderaparticipaodeles.
Qual a sua opinio acerca da autonomia dos designers brasileiros no
desenvolvimentodosprojetos?
Olhaeuachoquebom[pausa]pelomenosdentrodeColor&Trimqueumacoisa
bem diferente de Shape design, externo, interno, o que seja. Eu vejo que a gente
temumaautonomiabemsatisfatria,porqueum...ramooColor&Trimqueele
muitomaisligadospeculiaridadesdolocal.
Entoassim,umtecido,umacor,muitomaisvariveldoqueumaformadeum
carro.Entoassim,numestadopintarcomobrancopredomina,aquelacoisaque
agenteconhece...eaquinemtanto...entorealmenteelamuitomaisligadas
culturas.Entoagenteacabatendoumaautonomiaabemboa.
Claro que alguma coisa ... faz parte da... da matriz, a nave me [risos]. E at
interessante porque assim, l na... na M4 [cita a matriz] a gente tem uma
experincia tambm de entender um pouco mais a fundo o que que a marca,

298

128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174

entolumpoucomaisintensoisso,oqueaM4.Umpoucodiferentedoque
aquitambm,entotemessadiferenadosmercados.
Mas interessante porque da a gente volta pra c e fala ahh ento agora eu
entendo bem o qu que a identidade da marca, e vou procurar agir mais de
acordocomissoainda.
Ento eu acho que no final das contas existe uma cooperao e existe uma
autonomianossasimsuficiente.
Fale sobre os principais desafios enfrentados pelos designers automotivos
brasileirosnodiaadiadaprofisso.
No dia a dia... eu ia falar que o primeiro entrar no mercado... [risos].
Fiquevontade...
ento, como eu falei... ... que ainda mais restrito lgico. Ento, at pra
comear a maioria t em So Paulo, ento a gente j v que mais restrito
realmente,noemtodolugarquevocencontra.
...bom,depois,achoqueestasquestesassim,deestarligadoaumaindstriaque
muitoexigente,isso...claro...entocomrelaoaprazosaqualidade,masisso
acaba tambm nos melhorando como profissionais, porque eu vejo que assim,
muitacoisaquevocdesenvolvepracquetemumaexignciamuitogrande,voc
vaiconseguirdesenvolvertambmparaoutrasindstriasquederepentenotem
tanta...tantorigordenormaeetc.
... depois... acho que so mais essas questes. A prpria questo de t muito
dentro, muito vinculado indstria, mas isso no em todos os casos, tem casos
queoescritriodedesignumpoucoseparado.Issotemvantagens,queagentet
aquivendooprocessoprodutivo,aqualquermomentoeuvoualievejoocarrona
linhasaindoetal,masaomesmotempoessaexignciadafbricaemsi,queeu
vejoqueodesignereleprecisaumpoucode...deestarnarua,deestarconvivendo,
deestarvendooutroscenrios.
Entoissoeuachofundamentalpragentedarumaventilada.
Apartedepesquisamesmon...
...pesquisa.Issooprofissionalcriativoemgeral...precisadeambientesdiferentes,
precisadessetipodeestmulo...isso.
Quaisseriamosaspectosaseremtrabalhadosparamelhorarasuaprtica?
Olhaeuachoque......agenteaindanoconstruiumuitoemtermosdehistricoe
conhecimentodentrodessareadeautomveis.Eprincipalmente,emColor&Trim.
A gente no tem no Brasil algum... sei l um curso de peso, alguma coisa mais
dedicadaaisso.Noexistemuitoesse...esseembasamento,masaomesmotempo
funonossacriarisso,porquequemtvivendoacoisaquevaicomearacriar
isso.
E... ento assim, uma coisa que a gente aprende, vai vivendo, vai tendo as
experinciasetudoomais,masque......vocnoencontramuitoa,apesardeser
uma indstria antiga e que deveria ter um histrico bem documentado e tudo o
mais,eupelomenosnovejomuitoassim.Euachoqueasinformaessvezesso
at difceis de se encontrar, porque no foram registradas. Se a gente quer
pesquisarahhcomoqueeraoColor&Trimlem...nadcadatal.Agentenemvai
encontrarmesmo,ahhnoeraassim,nemexistia,comoquefoi,tal....
Eu acho que nesse sentido, conhecimento, qualificao, por falta de... ... de
existiressetipodehistrico,algumacoisaassim.

299

175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200

De estrutura mesmo n, de material... eu estou enfrentado esta dificuldade


tambmnaelaboraodadissertao,justamenteporqueeuprocuroliteratura,
bibliografiaedifcilrealmenteencontrar...
euimagino...
Porissoumaricapartedotrabalhodizrespeitoestaconversacomvocs,pois
ouvindo de vocs sobre como o trabalho que eu posso estender o tema e
contribuirdealgumamaneira...Masrealmentenotem,nareaautomotivaem
si tanto de Color&Trim, quanto de Shape, quanto do prprio papel do
profissional...ascoisassobemdifceismesmonotemquaseregistro...
Sim,verdade.
Em sua opinio, tendo em vista os grandes avanos tecnolgicos e tambm os
obstculos referentes mobilidade na atualidade (por exemplo, preservao do
meioambiente;mobilidadeemgrandescidades;interaocomosdemaismeios
detransportepblico,entreoutros),qualseropapeldodesignerautomotivono
Brasilnosprximosanos?
Olhaeuachoqueonossopapelvaiserdegrandesincentivadores,edebotaressas
ideias pra frente, porque por essa nossa viso assim... de futuro, e de enxergar a
necessidadedousurioenooutrasnecessidades.Entoeuachoqueonossopapel
vaiserbemesse.
Eujvejoqueagenteconhece,agentesabe,agenteouve,masnoseisetemum
movimento assim mais forte sendo feito sabe? Na verdade eu acho que as coisas
somuitolentas,elasdemoramumpoucopraacontecer,entoonossopapelvai
ser bastante esse, de ir antecipando, de ir trazendo, ir forando pra coisa um dia
acontecermesmo.
Gostariadeteceralgumasconsideraesfinais?
...no,achoqueeunocomplementariano.

300

ApndiceG
UNIVERSIDADEESTADUALPAULISTAJLIODEMESQUITAFILHO
FACULDADEDEARQUITETURA,ARTESECOMUNICAO
ProgramadePsgraduaoemDesign

EntrevistaAriAntniodaRocha
19deNovembrode2013poremail.

1.Quandoteveincioseuenvolvimentocomareaautomotiva?
Desdemuitojovemtivegrandeinteresseporautomveiseavies.
Costumo brincar com UM FATO REAL, dizendo que meu av (materno), ao me levar da
maternidade at em casa num Marmon V16 (o VeeSixteen, com motor de 280 HP e
velocidademximaacimados200km/h),jnosegundodiadevida,mecontaminoupara
sempre...
Essaligaocomcarrossempreexistiu,alimentadapelapaixodemeuavporautomveis,
que despertou meu interesse. Mas tambm fui influenciado pelo convvio com pessoal da
rea,poismeupaiquetrabalhounaPirelli.FrequentavaaoficinadeLucianoBonini,umde
seusamigosenossovizinho,queerapilotoeconstrutordecarreteras.
Antesmesmodesaberquequeriaserdesigner,aprendimuitocomeles,Boniniemeuav
mostraramqueoautomveleraumamquinafascinanteeseuslimitestoamplosquanto
acriatividadedequemosprojetava.Naadolescnciaissofoificandomaisclaroparamim.
Passava grande parte do tempo a desenhar carros e, assim, pude perceber minhas
limitaes,oquemefezcomearalerintensivamenteeaprenderomximoquepodia.Logo
ganheioapelidodeAriAutomvel...
Da para a frente, busquei caminhos e a faculdade que mais se aproximasse de meus
objetivos, j que os cursos de Design ainda no eram ofertados no pas. A dvida foi
dissipandoquandoopteiporArquiteturanaUSPeconhecioProfessorVilanovaArtigas,de
quem fiquei amigo, tendo me convidado para conversar sobre o assunto, pois pretendia
introduziressareanaFAUUSP.

2. Fale sobre os principais projetos com os quais esteve envolvido e cite se possvel,
algumasparticularidadesdecomoeramosprocessoseprticasnaqueletempo.
Oprojetomaisimportante(eemblemtico)foioAruanda,consideradooprimeirocarro
conceitodoBrasileoprimeiromonovolume,nosentidoqueatualmenteseatribuiaesse
conceito.Mas,aotempodealuno,antesmesmodoAruanda(elaboradoaindano5anoda
FAUUAP), participei de projetos com Rigoberto Soler, como Carro Hbrido movido a ar
comprimido(1962noconstrudo).
O estgio realizado na montadora DKWVemag, em 1963/64, teve aspectos especiais: o
Gerente Industrial, Eng. Antonio de Pdua Santos, solicitou que estruturasse o
DepartamentodeDesign(lchamadoEstilo).
Depois do retorno da Itlia (prmio no Salo de Turim, 1965), foram realizados projetos
diversos de Design e Arquitetura. A atuao incluiu projetos de fbricas de mveis e seus
produtos,comoMveisdeCozinhaCoiro,CozinhasKitchens,MveisCarraro,etc.Osmais
significativosforamumDKWGT(1964/65);UmDinammetroparaaKratos(solicitaodo
STI/MCT1973);ProjetoBsicodeDesigndoTremdoMetrSP(linhavermelha1976).

301

Nos casos em que atuei, sempre houve um dilogo efetivo com os nveis tcnico e de
decisodasempresas.
Isso facilitava para chegar s solues adequadas, pois as solicitaes de tarefas a ser
cumpridas no se resumiam, como acontece hoje em que as equipes so numerosas na
maioriadasempresas,aoenviodebriefingselaboradosporumintermediador.
As nfases a ser adotadas eram definidas em conjunto e de forma interativa: a busca de
solues,apsdefinidasasopesmaispromissoras,eratestadanaprticaemmodelos(ou
diretamente em prottipos). Muitas vezes eu mesmo usei os finais de semana, para
experimentar algumas das solues elaboradas (como no caso dos bancos moldados, por
exemplo)diretamentenapistadetestes.OcontatopermanentecomaEngenhariafavorecia
naobtenoderesultadosviveis,tantotcnicaquantoeconomicamente.

3.Nasuaviso,apartirdesuaexperincia,quaisforamasprincipaismudanasemtermos
de processos de design que influenciaram aquele perodo e que contriburam para a
evoluododesigndeautomveisaquinoBrasil.
O fato de no haver escolas de design no Brasil, reduziu a possibilidade das empresas
adotaremprojetoslocais,poisalegavamqueoriscoquerepresentavaumaalteraodos
produtos,spodiaserjustificadacomSOLUESJTESTADASECOMPROVADAS(comprar
noexterior).Assimtevequeserrealizadoumrduotrabalhojuntoaosetorprodutivo,para
queessetipodetrabalhocomeasseaserfeito.
H fatores objetivos, como a introduo de uma prtica que, no Brasil, no era corrente
pois, as empresas brasileiras no demonstravam interesse e, nas subsidirias de empresas
estrangeiras,aspropostasdealterarodesigneram(literalmente)proibidas.
Tantoqueoplanejamentoparaanacionalizaodosveculosaquifabricados,foiprevista
emPERCENTUAISDESEUPESO.Issofoiumequvocotodanoso,quecomadinmicados
mercados de hoje, j NO TEMOS MAIS CHANCE de fabricar (em volume industrial) UM
VECULOGENUINAMENTENACIONAL.Rompemosabarreirapararealizaraquiosprojetosde
Design de Veculos, a ponto que um expressivo nmero de profissionais brasileiros esto
atuando no exterior; o marca Volkswagen, por exemplo, mantm mais que 2 dezenas de
conterrneos,nodepartamentoqueinformalmentechamamdeBrazilianCornerevrios
outrosnasdemaismarcasdogrupo.
EstaumasituaomuitodiferentedapocaemqueparafazeroVWSP2eaVWBraslia,
emqueRudolfLeiding,presidentedasubsidiriabrasileira,tevequetravarumaverdadeira
batalhacomogrupomaisconservadordoConselhodaVolkswagen,ligadoaocofundador
damarca,HeinrichNordhof.Suaargumentaovisandoadiversificaodemodelosfoito
convincente,queelefoiconduzidopresidnciamundialdaempresa.
OsempresriosemgeralnemsequerconheciamDesigneachavamapalavraestranha,a
pontodequeumdosDiretoresdaVemagcomentouqueparecianomederemdio...
Mesmoosmaiscultos,consideradosesclarecidos,dispunhamdepouqussimainformaoa
esse respeito. Os dirigentes das montadoras ditas nacionais, como a DKWVemag, no
tiveramchance,frenteacompetiodesigualcomasmarcasmundiais.ACoriaassumiu
posturasdiferentesdanossa.
Oprojetodedesenvolvimentoqueelaboraram,coordenadopelobrilhanteHyunghwanJoo,
que o denominou Educao e Desenvolvimento (nessa ordem, como fez questo de
enfatizar). Durante mais que duas dcadas, investiram pesadamente em Educao,
qualificandopessoalparaquefossemcapazesde,apartirda,promoverodesenvolvimento
dopasecriartecnologialocal,paraafabricaodeveculos.

302

Suaimplantaoabrangeuvriosmandatosegovernantes,querespeitaramesseprocessoe
deramcontinuidadesaes.Oresultadonsconhecemosbem.
Graas a esse esforo o pas se preparou e superou os desafios que estavam colocados,
assumindoumpapeldelideranamundial.

4. Em termos de indstria, polticas governamentais, tecnologia, mercado, processos e


praticas em design, daquela poca para os dias atuais, como o Sr. v as mudanas
ocorridasnarea.
De maneira geral, a industrializao do pas aconteceu de forma quase espontnea, sem
contarcomqualquertipodeprogramadeapoioe/ouestruturaodesseprocesso.
O poder pblico local, dependendo do maior interesse e conscientizao, criou condies
mais(oumenos)favorveisparaqueasindstriasmigrassemparao paseseinstalassem
entre ns. Entre as medidas verificadas, no caso de So Paulo, a oferta de energia e gua
abundantes,acompanharamaesparagarantiraformaoprofissional,emtodososnveis
de necessidade: criao de cursos de engenharia (e at mesmo de universidades); uma
amplagamadeescolastcnicas.
Mastambmdecursosvisandootreinamentoequalificaodemodeobra.Assimsurgem
USPeMackenzie,asEscolasTcnicas,Cursosdepreparaoetreinamentodepessoal,que
evoluram em entidades como o Senai, Senac, etc. Alguns empresrios e empreendedores
locais importaram indstrias (outros simplesmente as copiaram), que se juntaram
iniciativaestrangeira.
Em nenhum momento se verificou qualquer tipo de esforo/interesse, que estimulasse
alguma atitude genuinamente nacional, com desenvolvimento de novas alternativas, ou
tecnologias apropriadas. Isso seguiu, de certo modo, a forma de atuao das primeiras
empresasinstaladasnopas(Ford1919/GM1925),quesmontavamaquiseuscarros
fabricadosnosEUA.Essacondiofoideterminanteparaasaesqueseseguiram.
A poltica industrial definida nesse perodo de origem, influenciou o comportamento da
nossa indstria, sobretudo na rea automotiva (GEIA), para adoo de solues que no
contemplavamaspropostaseprojetoslocais.AcriaodosDepartamentosdeDesignno
foi simples, porque as matrizes no tinham interesse em que isso fosse feito aqui. Uma
exceo foi a Willys que criou a rea, depois estendida Ford. A VW chegou a proibir e
ameaarcompunioeatdemissosumria,quemnorespeitasseessaordem,atqueo
Leidigmudasseessequadro,comocitado.FoiquandosurgiramaBrasliaeoSP2.Noincio
essesdepartamentoseramchamadosdeEstilo,contandocompouqussimosfuncionrios,
queeramobrigadosafazertudo.Nohaviaaseparaonemmesmodeexterior/interior.

5.Noqueserefereaofuturodaprofisso,qualsuaopiniosobreopapeldosdesignersno
Brasilnosprximosanos?
Creioque,principalmentenareaautomotiva,aespecializaodefunessetornarainda
mais efetiva do que atualmente. Cada designer (ou grupo) tratar de um tema especfico,
sob a superviso de algum com noo do todo. Cada parte ser reunida s demais,
formando o corpo do projeto. Em geral, nas outras reas de atuao, os designers
enfrentarosituaessemelhantes,poisatosprprioscursossohojeoferecidosdemodo
acriarnichoshermticos.Bastaverificarapolticadasuniversidades.
Pelo fato de que, hoje, a maioria dos gestores da rea de Design nos rgos reguladores
federais (e alguns setoriais), constituda por BUROCRATAS QUE NADA ENTENDEM DE
DESIGN,nosevislumbrampossibilidadesdepromoverumaanliseefetivadoproblemae,

303

muitomenos,aaplicaodemedidasquepossamatenuaralgunsefeitosdanosos,comoa
pulverizaodaprofisso,numnmeroexageradodeespecialidades...

304

ApndiceH

UNIVERSIDADEESTADUALPAULISTAJLIODEMESQUITAFILHO
FACULDADEDEARQUITETURA,ARTESECOMUNICAO
ProgramadePsgraduaoemDesign

EntrevistaFernandoMorita
30deOutubrode2013poremail.

1.Quandoteveincioseuenvolvimentocomareaautomotiva?
Em 2001, quando participei do Concurso de Design da VW. Ganhei junto com Gabriel
ClementedoRioJ.,ArnaldoCruzeirodeMG.

2. Fale sobre os principais projetos com os quais esteve envolvido e cite se possvel,
algumasparticularidadesdecomoeramosprocessoseprticasnaqueletempo.
Numa montadora, existem diversos estgios de desenvolvimento do projeto,
grosseiramente falando: propostas, 3D ou clay 1:4, clay 1:1, viabilizao de produo, dai
parafrenteproduo.
NaVW,processodecriaovocpodeparticipardetodosquequiser,logofizpropostapara
vriosprojetos,noquerendodizerqueforamaprovados.
Jnafasede3DfuicomTouaregfacelift,novoFusca,naoindoparafrente.Clay1:4Novo
Santana, J na fase de clay 1:1, Touran facelift, e tambem o CrossFox, gen1.... Porm
nenhumprojetoeuleveiateofimatporqueeunofiqueimaisdeumanoemcadaestdio
(fiquei na AG, Volke, DCE, BR) J na AGT, passei por todos estgios com o LSPS e o
DoniRosset.

3.Nasuaviso,apartirdesuaexperincia,quaisforamasprincipaismudanasemtermos
deprocessosdedesignqueinfluenciaramsuaprticaequecontriburamparaaevoluo
dodesigndeautomveisaquinoBrasil.
Designautomotivo,sexisteseexistirmercado,logoquantomaisoBrasilevoluir,esairde
subdesenvolvidoeirparaascabeas,maisestdiosexistiram,maiseducaoexistir,emais
oportunidadesetrabalhoparatodos.Umacoisanofuncionasemaoutra,sendoassimeu
prefiro trabalhar em paralelo com a indstria, com a AmoritzGT fazendo design, e no IED,
criandonovosprofissionais.
Emtermostecnolgicos,semduvidao3Dirrevolucionaroprocessodedesenvolvimento,e
acelerlo.Poremsempreexistiraespaoparaoclay,umavezquecarrosempreserfsico.
Designsmudaquandoatecnologiamuda.

4. Em termos de indstria, polticas governamentais, tecnologia, mercado, processos e


praticas em design, daquela poca para os dias atuais, como o voc v as mudanas
ocorridasnarea.
Oquemudarcompletamenteacaradocarroaenergiaqueusaparasemovimentar,hoje,
aeltricaoqueasmontadorasestoapostando,denovo:engenharia+design.Quantoao
mercado, sem dvida, o Brasil s vai crescer e novas oportunidades aparecero, a nossa
gerao que vai revolucionar o pensar em design, em carro. O mundo esta passando uma
criseexistencial.Adaptaoeevoluo.

305

5Noqueserefereaofuturodaprofisso,qualsuaopiniosobreopapeldosdesignersno
Brasilnosprximosanos?
Exportao.designalemo:racional,preciso,tcnico,refinadodesignitaliano:emocional,
extico,purodesignfrancs:emocional,extremo,romnticodesignjapons:tecnolgico,
se refino, ousado design Ingls: elegante, refinado. Agora, e o brasileiro? Pois temos
outrasqualidadesqueomundo jpercebeuequer, sverquantosbonsprofissionaistemos
fora do Brasil. E isso tende a s aumentar. Para isso precisamos: Educao, Mercado,
Fornecedores,FabricanteseCultura.
Sobreoestilobrasileiro?
Arrojo,personalidade,emgeralmoldadopelogostomaiseuropeu.