Escolar Documentos
Profissional Documentos
Cultura Documentos
usually proteins but RNA can also act as enzymes under specific conditions as well
catalysts are compounds that increase the rate of reactions without being
consumed in the reaction
in biological systems, the concentrations of reactants are usually very low and
significant activation energy barriers exist. Therefore, most biochemical
reactions would occur too slowly to permit life in the absence of catalysts.
Note that in the enzyme catalyzed reaction, the rate of product formation levels
off with time. This is because the reaction has reached equilibrium: substrate
is still being converted to product but product is also being converted into substrate
at a rate such that the product remains constant.
10-6 s-1
The equilibrium constant for the reaction is given by the ratio of the rate constants
[P]
[S]
10-4
10-6
100
in other words, when the reaction is at equilibrium the ratio of product to substrate
is 100:1
the presence of an enzyme catalyzing the reaction will not alter this ratio (equilibrium).
but it may reduce the time to reach this equilibrium from hours or centuries to seconds
or a fraction of second
orotidine monophosphate
conversion to
uridine monophosphate
by
OMP decarboxylase
half-life of OMP in absence of enzyme = 78 million years
half-life of OMP in presence of enzyme = 18 milliseconds
many of the reactions that occur in cells will occur spontaneously (-G) but occur
too slowly for life processes
the G is about -2872 kJ/mol and a large amount of heat is liberated in this
spontaneous reaction.
The equilibrium for this reaction is far on the right side of the above equation
because thermodynamically, the products are less energetic and therefore more stable
and less ordered.
The presence of glucose is not favored in this universe (at least in the presence of
oxygen) yet a bottle of glucose can sit on a shelf for hundreds of years and not
become substantially oxidized.
Note that a spontaneous reaction will proceed where the products have less
energy than the reactants (substrate) and G is the free energy change
between the product and the reactant.
Note that the enzyme does not alter the free energy change in a reaction which
is why it does not alter the equilibrium associated with a reaction - only the rate.
when two chemicals react, the ability to form a transition state intermediate
and eventual product relies on two main conditions:
adding an external source of heat energy is one way to provide the required
kinetic energy to substrate molecules such that they are able to form
the transition state intermediate
an enzyme reduces activation energy by binding two reactants, bringing
them physically together in a orientation that permits reaction.
the active site accommodates only specific substrates on the basis of size, shape,
and chemical characteristics of the substrate
the induced fit model describes that both the structure of the enzyme and the
substrate is changed upon binding
Amino acid side-chains interact with substrate molecules through weak forces
such as ionic, hydrogen-bonding, and van der Waals interactions.
the active site binding pocket or cleft is where several amino acid side chains that
play instrumental roles in chemical catalysis coincide
Protein Evolution
as species diverge from one another, mutations will inevitably and independently
occur in the genes that encode proteins.
N
N
N
N
MYFGHATFRVVARFPLKMNKYTWYHCNPCKACIYTGDEGGAKIADENS
MDKWAKWFMVAARGLCADDKLAQRHVQLCQACKMAADELNWEIALPAV
MSVKLGCWQVLARDEDSTGKAFERHVEICQACKLMADEAGSEIAYCVV
MDEWAVNFMVVARHLAADQRLANRHVADCQACKAWADDKQMEIVFQAV
Note that not all amino acids have similar importance in the protein. Some are
important for structure (pink) and some are active site catalytic residues (blue) and
these are largely conserved.
Some amino acids at specific positions are not conserved at all, indicating they
are not overtly important to the protein or enzyme
C
C
C
C
some enzymes function on their own while some have co-factors intimately
associated with their structure
A Holoenzyme forms
when the Apoenzyme form
of the protein binds its
co-factor
for enzymes that require co-factors, the protein lacking the co-factor is inactive
this is the central reason why vitamins and certain metal ions are essential for life
Thiamine, Vit B1
Riboflavin, Vit B2
Niacin
Vitamin B6
Pantothenic acid
Vit B12
Folic acid
The catalytically important amino acids and the co-factors define the active site
of the enzyme and interact with substrate, the transition state intermediate
and products formed
Active site amino acid side chains of the enzyme Cytochrome P450
and its co-factor Heme interacting with its substrate camphor
Active site amino acid side chains specifically interact with substrate molecules
as shown in the active site of Ribonuclease (an enzyme that hydrolyzes RNA
molecules to free ribonucleotides).
Types of catalysis
The Chemical Mechanisms of enzymatic catalysis