Escolar Documentos
Profissional Documentos
Cultura Documentos
Peptides
journal homepage: www.elsevier.com/locate/peptides
Nano Biomemdical and MEMS Technology Division, National Nano Device Laboratories, Hsinchu, Taiwan
Agricultural Biotechnology Research Center, Academia Sinica, Taipei, Taiwan
c
Institute of Biotechnology and Department of Life Sciences, National Tsing Hua University, Hsinchu, Taiwan
b
A R T I C L E I N F O
A B S T R A C T
Article history:
Received 10 November 2008
Received in revised form 2 February 2009
Accepted 3 February 2009
Available online 13 February 2009
Several natural antimicrobial peptides including cecropins, magainins and melittins have been found to
kill cancer cells. However, their efcacy may not be adequate for their development as anticancer agents.
In this study, we used a natural antimicrobial peptide, cecropin B (CB), as a template to generate a novel
anticancer peptide. Cecropin B is an amphipathic and polycationic peptide derived from the hemolymph
of Hyalophora cecropia with well-known antimicrobial and cytolytic properties. The signature pattern of
cecropins is W-x-(0,2)-[KDN]-x-{L}-K-[KRE]-[LI]-E-[RKN] (PROSITE: PS00268), and this signature
sequence is located at N-terminus of CB. CB1a was constructed by repeating the N-terminal ten amino
acids of CB three times and including a hinge near C-terminus. The circular dichroism spectra showed
that CB1a is unstructured in aqueous solution, but adopt a helical conformation in membrane-like
environment. The solution structure of CB1a in a polar solvent was also studied by NMR. CB1a formed a
helixhingehelix in 20% HFIP solution, and it was found the bent angle between two helical segments
was induced ranging from 608 to 1108. A heparin-binding motif is located in the central part of helix 1.
Isothermal titration calorimetry reveals the association constant of CB1a bound to low molecular weight
heparin is 1.66 105 M1 at physiological ionic strength at 25 8C. Binding of CB1a to heparin produces a
large conformational change toward a more structural state. CB1a demonstrated promising activity
against several cancer cells but low toxicity against non-cancer cells. The IC50 of CB1a on leukemia and
stomach carcinoma cells were in the range of 28-fold lower than those of CB. Besides, CB1a exhibited
low hemolytic activity against human red blood cells. Due to these properties, CB1a has the potential to
become a promising anticancer agent.
2009 Elsevier Inc. All rights reserved.
Keywords:
Cecropin B
Antimicrobial peptide
Anticancer activity
Heparin-binding motif
CD
NMR solution structure
ITC
1. Introduction
Hundreds of natural peptides have been found to show
antimicrobial properties that can kill a wide spectrum of Grampositive and Gram-negative bacteria, protozoa and fungi and can
potentially act as antibiotics [20,21,23]. Most of these antimicrobial peptides (AMPs) have cationic and amphipathic properties
[22,32] that allow interaction with bacterial cytoplasmic membrane. Some of AMPs which have also been found to have the
ability to kill cancer cells, include cecropins [13,51], magainins
[3,14,35,59], melittins [43,44], and human LL-37 [16,29].
Cecropins are a family of antimicrobial peptides which are
widely found in the immune hemolymph of Hyalophora cecropia
[6,27,28]. They were constructed/synthesized of 3439 amino
acids and have high sequence homology [51,54]. The sequences of
natural cecropins have basic residues in their N-terminal segments
and hydrophobic residues in their C-terminal segments. Among
the cecropin family (cecropins A, B, D, E and F), cecropin B (CB)
possesses the strongest antimicrobial activity [27]. Derivatives of
CB, cecropin B1 (CB1) and cecropin B3 (CB3), were created to
investigate the effects on cells and synthetic liposomes [11,55].
CB1 was constructed by replacing the C-terminal segment with Nterminal sequence of CB, and CB3 was constructed by replacing the
N-terminal segment with C-terminal sequence of CB. Previous
studies showed that CB and its analogues can disrupt membranes
[11,12,55,56], and some of them have the ability to kill cancer cells
840
CB
CB1aa,b
CB1
CB3
Melittin
Magainin II
Sequence
Net charge
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
KWKVFKKIEK KWKVFKKIEKAGPKWKVFKKIEK-NH2
KWKVFKKIEKMGRNIRNGIVKAGPKWKVFKKIEK-NH2
AIAVLGEAKALMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
GIGAVLKVLTTGLPALISWIKRKRQQ-NH2
GIGKFLHSAKKFGKAFVGEIMNS-NH2
+7
+12
+11
+3
+5
+3
a
The underlined residues show the repeating sequence of the N-terminal
cecropin ngerprint segment of CB.
b
The sequence of heparin-binding motif in CB1a is in bold italics.
841
842
and 543 HeNe laser beam for FITC-labeled peptide and iso-electric
point (PI), respectively. Images were processed with Adobe
Photoshop 6.0.
2.10. Fluorescence-activated cell sorter (FACS) analysis
NCI-H520 and NCI-H661 cells grown on a 60-mm dish were
incubated with 10 mM FITC-CB1a at 4 8C or at 37 8C for 30 min.
After the incubation, cells were washed with PBS solution and were
treated with trypsin for 10 min [40]. The cells were centrifuged at
1000 rpm for 10 min and then washed with PBS solution. After
washing, the cells were resuspended in 500 ml PBS, ltered
through a 30 mm pore size lter, and analyzed by using
FACSCalibur (Becton Dickinson, Franklin Lakes, NJ). FITC uorescence was detected in FL1 channel (ex 488 nm/em 530 nm).
2.11. Hemolysis assay
Fresh venous blood was stored in an EDTA bottle. The plasma was
removed by centrifugation at 15,000 g for 5 min. The pellet of red
blood cells (RBCs) was washed with sterile Dulbeccos phosphate
buffer saline (D-PBS) four times. The stock solutions of peptides were
diluted to 1, 10, 25, 50, 150 and 200 mM with D-PBS buffer in an
Eppendorf tube (200 ml each containing 5 ml RBC solution). The
solutions were then centrifuged at 3000 g for 5 min. The supernatant
was collected. The amount of hemoglobin released from the dead
RBCs killed by peptides or anticancer agents in the solutions was
determined by measuring their absorption at A414nm. Zero hemolysis
(blank) and 100% hemolysis were determined in D-PBS buffer and 1%
Triton-X 100, respectively. Based on these two reference points, the
percentages of hemolysis of human RBCs at various concentrations
of peptides were obtained.
3. Results
3.1. Circular dichroism measurements
CD spectra were used to study the content of peptide secondary
structures. The conformational behavior of CB1a and other CB
analogues in aqueous buffer and HFIP/water solution was
investigated by using a CD spectrometer. Fig. 1A presents the
Far-UV CD spectra of CB1a at room temperature in HFIP/water
mixtures at various ratios (v/v, from 0% to 40%). The results showed
that CB1a had the highest helical content in 40% HFIP/H2O solution.
At between 15% and 30% of HFIP/H2O, the CD spectra of CB1a retain
a very similar shape to that of CB1a in 40% of HFIP/H2O. In aqueous
solution, the CD spectrum of CB1a showed a negative band around
200 nm, which is typical for the back bond of a peptide in a random
coil conformation. These observations indicated that signicant
negative ellipticities of CB1a at 208 nm and 222 nm in the presence
of lipid-mimetic solvent HFIP and that the peptide had folded into
an a-helical conformation. This conformational change from a
random-coil in aqueous buffer to an a-helix structure in
membrane-mimetic environments is common for many membrane-binding peptides [5,33]. In contrast, in solution containing
less than 15% of HFIP/H2O, the shapes of CD spectra were
dramatically similar to that of CB1a in aqueous solution (0% of
HFIP/H2O). Fig. 1B presents the CD spectra of CB analogues in 40%
HFIP. The results indicated that CB3 has the highest helical
propensity. In the same condition, comparing to CB, CB1a and CB1,
CB3 has higher helical content.
3.2. NMR analysis
Two-dimensional 1H NMR spectroscopy was used to study
structure of CB1a in polar solvent d-HFIP. Both TOCSY and NOESY
spectra were collected for CB1a at 303 K, pH 4.9. Spin systems for
each amino acid were identied based on a TOCSY spectrum with a
mixing time of 90 ms. Sequential assignment of the residues was
achieved using the NOESY spectrum obtained with a mixing time
of 150 ms. The amide resonance of the N-terminal lysine was not
observed. Fig. 2A represents the NOSEY spectrum of CB1a in 20% dHFIP.
a
a
b
The riched H (i)-HN(i + 3) and H (i)-H (i + 3) NOE connectivities denote the a-helical structures. The available daN (i,i + 4) NOE
connectivities are shown for residues 421 of CB1a. These NOE
connectivities indicate the presence of a regular a-helical
conformation. Summaries of the sequential and medium-range
NOEs observed for CB1a in 20% d-HFIP are depicted in Fig. 2B.
Distance constraints were derived by the NOEs and were used to
carry out the structure determination. Deviations from the
reference random coil values for the a-protons chemical shifts
also provided information on the conformational status of a
peptide or protein. The a-proton chemical shift index (CSI) [58]
result strongly supports the helical conformation of the peptide.
There are two helical segments spanning residues 421 and 2532.
When H/D exchange NMR experiments were performed, some
slow exchange amide protons were observed in the TOCSY spectra.
The high protected protons can be obtained after 12 h H/D
exchange. These amide protons form hydrogen bonds with the
backbone carbonyl groups, which were also used as constraints in
the structure calculations.
843
Fig. 2. NOESY spectrum and NOE connectivities of CB1a. (A) NOESY spectrum of HNa
H connectivities. Spectrum was recorded on 600 MHz NMR at 150-ms mixing time
of CB1a (3 mM) in 20% d-HFIP at 30 8C. (B) Schematic representations of short-range
and medium-range interactions of NOEs observed for CB1a in 20% d-HFIP. NOE
intensities are indicated by the thickness of the bars. Slow exchange amides are
represented as lled circles. The highly protected proton (slow exchange) was taken
into account after 12 h exchange. The small (J < 6.0 Hz) coupling constants are
represented as lled circles.
844
Table 2
Summary of structural constraints and structure statistics.
NOE constraints
Intraresidues (ji jj = 0)
Sequential (ji jj = 1)
Medium range (2 2 ji jj24)
Long range (ji jj > 4)
Hydrogen bond constraints
Dihedral angles
Total constraint numbers
79
145
126
0
16
54
420
0
0
0.00235 0.000042
0.412 0.003
0.270 0.006
0.0347 0.0005
0.398 0.051
54.340 0.806
0.384
1.306
Helix 2 (2532)
Backbone
Heavy atoms
0.346
1.513
Ramachandran statistics
Most favoured region (%)
Additionally allowed (%)
Generously allowed (%)
Disallowed (%)
87.4
11.4
0.7
0.5
changed from a strong negative band near 198 nm (Fig. 4A, solid
line) to a negative band centered at 215 nm (Fig. 4A, dash line). This
is an indication that the CD spectrum of CB1a shifted from a
random coil (in aqueous solution) to an a/b structure (in heparin
solution). Further experiments were conducted to study the
conformational changes exhibited by CB1a in the presence of
heparin by systematically increasing the content of heparin in
solution. A three-phase shift of ellipticity at 215 nm was observed
when heparin was mixed with CB1a at different heparin
concentrations. The results indicated that the secondary structure
of the peptide changed between the two stages.
Table 3
IC50a values of various peptides and doxorubicin on different cell lines.
Peptide designation
CB1a
CB
Melittin
Magainin II
DOX
a
Cancer cells
Non-cancer cells
Stomach carcinoma
Leukemia cells
Lymphoblast
Tissue cell
Lung cell
AGS
HL-60
CCRF-CEM
NCI-H520
RPMI-7666
3T3
WI-38
5.6 0.5
>50
0.6 0.1
28.7 5.0
4.1 0.4
6.7 1.1
18.5 1.7
0.8 0.1
38.3 3.2
0.2 0.0
4.4 0.3
11.7 1.3
0.5 0.1
32.9 0.9
0.4 0.1
22.7 0.2
58.8 2.0
14.1 0.7
46.9 2.7
<10
35.9 0.2
>100
2.6 0.2
>100
<10
>100
>200
4.5 0.2
> 50
1.9 0.1
>50
>50
6.0 0.1
>50
2.0 0.7
>100
>100
5.8 0.5
>100
<10
The results are the average of at least three experiments and mean deviations are shown. The unit used for the IC50 value is mM.
845
Fig. 5. ITC titration of CB1a and CB with heparin. Titration calorimetry of (A) CB1a and (B) CB with heparin solution in phosphate buffer containing 150 mM NaCl at 25 8C. Top
panel shows the experimental trace of heat energy absorbed per injection. Bottom panel indicates the integrated heat energy for each injection. The heat energy of dilution
was subtracted from the control for calculation of the binding isotherm.
activities of CB1a against AGS and leukemia cell lines are about 8fold and 23 fold stronger than that of CB, respectively. Melittin
showed cytotoxic effects against cancer cells as well as non-cancer
cells. CB1a and CB are highly potent against cancer cells but not
against normal mammalian cells. DOX showed good activity
against both cancer cells and normal mammalian cells.
Effects of CB, CB1, CB1a and melittin on human RBCs were also
examined (Fig. 8). It was found that CB1a exhibited less hemolytic
activity than melittin, CB, CB1 and doxorubicin. As shown in Fig. 8,
only about 18% of RBCs were lysed even after being treated with
CB1a at a concentration between 100 mM and 200 mM. While,
about 100%, 57%, 55%, and 18% of RBCs were lysed after being
treated by melittin, CB, CB1 and CB1a, respectively, at concentration of 200 mM.
4. Discussion
4.1. Structural characterization of CB1a
Using the PROSITE data base for sequence analysis [7,15,45],
where the signature pattern of cecropins is W-x(0,2)-[KDN]-x-{L}-
Fig. 6. Confocal images of cancer cells treated by CB1a. NCI-H661 (panels A and B) and NCI-H520 (panels C and D) cells were treated with 30 mM FITC-CB1a and observed
without xation by confocal laser scanning microscopy (scale = 20 mm). Cells were incubated with FITC-CB1a for 5 min (panels A and C) and for 1 hr (panels B and D). The
images indicated that CB1a stayed attached to the cell membrane in the beginning. After treated the cancer cells with FITC-CB1a for 1 hr, the peptide penetrated into the cell.
FITC-conjugated CB1a nally present in both the cytoplasm and nucleus of cells (panels B and D). The results show that CB1a has the ability to translocate into the cancer cells.
846
Fig. 7. Cellular uptake analyzed by FACS. NCI-H661 (A) and NCI-H520 (B) cells were incubated with FITC-CB1a (10 mM) at 4 8C (blue curves) or at 37 8C (red curves) for 30 min,
and treated with trypsin before FACS analysis [40]. The black curves correspond to cells incubated in the absence of the peptide. (For interpretation of the references to color in
this gure legend, the reader is referred to the web version of the article.)
Fig. 8. Hemolytic measurements. Hemolysis (%) of red blood cells versus the
hemolytic agents concentrations (mM) are shown for various lytic peptides such as
CB (open square), CB1 (open circle), CB1a(up-open triangle), Mel (melittin; doneopen triangle), and chemotherapeutic agent, Dox (open diamond).
847
Fig. 9. Helical wheel diagrams of N-terminal helices of CB1a and CB. The hydrophobic residues of CB1a (A) and CB (B) are shown in black box. CB has a more complete
amphipathic segment than CB1a does.
against non-cancer cells (Table 3). This high selectivity suggests that
CB1a has the potential to become a promising anticancer agent.
Generally, the anticancer activity of CB analogues against leukemia
cell lines followed the order CB1a > CB1 > CB > CB3. According to
the CD result (Fig. 1B), the helical propensity of CB1a and CB1 is less
than that of CB3 and CB indicating that the secondary structure
content is not important for anticancer activity. The positive charge
of the peptide may play a crucial role in the anticancer effect. Since
the net charge of CB1a, CB1 and CB are +12, +11 and +7, respectively.
The positive charge of anticancer peptides may allow stronger
binding to the negative charged membrane of cancer cells (e.g.,
phosphatidylserine) [37,38]. This is the reason why CB1a is more
effective against cancer cells than non-cancer cells. However, the
mechanism of action of cationic peptide is still not clear.
Previous studies indicated that heparin-binding peptides show
antimicrobial activity [1]. However, the current custom peptide,
CB1a, showed no signicant bacteriocidal effect with the comparison to CB (MIC of CB1a is about 128 mg/ml on E. coli ATCC 25922
compared with MIC of CB is 1 mg/ml). The amphiphatic distribution
may play a key role. The diagrams of helical wheels [41] of CB1as and
CBs N-terminal helices show that the amphiphatic character and the
hydrophilic face of CB1a are discrete (Fig. 9). The reduction in
amphipathicity and discrete hydrophilic face may partially explain
why CB1a has poor antimicrobial activity. Moreover, CB1a lacks the
amino acid sequence of the second section (MGRNIRNGIVK) of Nterminal helix in CB that might be the main enhancer of
antimicrobial activity. The complete helix 1 of CB seems to be
required for breaking the bacterial membrane. Previous studies also
report similar observations for cecropin A [2,26].
To summarize, we have constructed a novel anticancer peptide
CB1a modied from natural antimicrobial peptide CB and
determined its anticancer activity and structural characters. The
polycationic property of CB1a demonstrated promising activity
against several cancer sell lines with low toxicity to the non-cancer
cells. In addition, the hemolytic side effect had been reduced. Due
to these properties, CB1a has the potential to become a promising
anticancer agent.
References
[1] Andersson E, Rydengard V, Sonesson A, Morgelin M, Bjorck L, Schmidtchen A.
Antimicrobial activities of heparin-binding peptides. Eur J Biochem 2004;271:
121926.
[2] Andreu D, Merrield RB, Steiner H, Boman HG. N-terminal analogues of
cecropin A: synthesis, antibacterial activity, and conformational properties.
Biochemistry 1985;24:16838.
[3] Baker MA, Maloy WL, Zasloff M, Jacob LS. Anticancer efcacy of Magainin2 and
analogue peptides. Cancer Res 1993;53:30527.
[4] Bax A, Davis DG. MLEV-17 based two-dimensional homonuclear magnetization transfer spectroscopy. J Magn Reson 1985;65:355.
[5] Bechinger B. Structure and functions of channel-forming peptides: magainins,
cecropins, melittin and alamethicin. J Membr Biol 1997;156:197211.
[6] Boman HG, Wade D, Boman IA, Wahlin B, Merrield RB. Antibacterial and
antimalarial properties of peptides that are cecropin-melittin hybrids. FEBS
Lett 1989;259:1036.
[7] Bucher P, Bairoch A. A generalized prole syntax for biomolecular sequence
motifs and its function in automatic sequence interpretation. Proc Int Conf
Intell Syst Mol Biol 1994;2:5361.
[8] Capila I, Linhardt RJ. Heparin-protein interactions. Angew Chem Int Ed Engl
2002;41:391412.
[9] Cardin AD, Weintraub HJ. Molecular modeling of protein-glycosaminoglycan
interactions. Arteriosclerosis 1989;9:2132.
[10] Chang DK, Cheng SF, Trivedi VD, Lin KL. Proline affects oligomerization
of a coiled coil by inducing a kink in a long helix. J Struct Biol 1999;128:
2709.
[11] Chen HM, Clayton AH, Wang W, Sawyer WH. Kinetics of membrane lysis by
custom lytic peptides and peptide orientations in membrane. Eur J Biochem
2001;268:165969.
[12] Chen HM, Leung KW, Thakur NN, Tan A, Jack RW. Distinguishing between
different pathways of bilayer disruption by the related antimicrobial peptides
cecropin B, B1 and B3. Eur J Biochem 2003;270:91120.
[13] Chen HM, Wang W, Smith D, Chan SC. Effects of the anti-bacterial peptide
cecropin B and its analogs, cecropins B-1 and B-2, on liposomes, bacteria, and
cancer cells. Biochim Biophys Acta 1997;1336:1719.
[14] Cruciani RA, Barker JL, Zasloff M, Chen HC, Colamonici O. Antibiotic magainins
exert cytolytic activity against transformed cell lines through channel formation. Proc Natl Acad Sci USA 1991;88:37926.
[15] Falquet L, Pagni M, Bucher P, Hulo N, Sigrist CJ, Hofmann K, et al. The PROSITE
database, its status in 2002. Nucleic Acids Res 2002;30:2358.
[16] Frohm M, Agerberth B, Ahangari G, Stahle-Backdahl M, Liden S, Wigzell H, et al.
The expression of the gene coding for the antibacterial peptide LL-37 is
induced in human keratinocytes during inammatory disorders. J Biol Chem
1997;272:1525863.
[17] Fuchs SM, Raines RT. Pathway for polyarginine entry into mammalian cells.
Biochemistry 2004;43:243844.
[18] Ghiselli R, Giacometti A, Cirioni O, Mocchegiani F, Orlando F, DAmato G, et al.
Cecropin B enhances betalactams activities in experimental rat models of
gram-negative septic shock. Ann Surg 2004;239:2516.
[19] Goncalves E, Kitas E, Seelig J. Structural and thermodynamic aspects of the
interaction between heparan sulfate and analogues of melittin. Biochemistry
2006;45:308694.
[20] Hancock RE. Cationic antimicrobial peptides: towards clinical applications.
Expert Opin Investig Drugs 2000;9:17239.
[21] Hancock RE. Cationic peptides: effectors in innate immunity and novel antimicrobials. Lancet Infect Dis 2001;1:15664.
[22] Hancock RE, Chapple DS. Peptide antibiotics. Antimicrob Agents Chemother
1999;43:131723.
[23] Hancock RE, Patrzykat A. Clinical development of cationic antimicrobial peptides: from natural to novel antibiotics. Curr Drug Targets Infect Disord
2002;2:7983.
[24] Henriques ST, Melo MN, Castanho MA. Cell-penetrating peptides and antimicrobial peptides: how different are they? Biochem J 2006;399:17.
[25] Hileman RE, Fromm JR, Weiler JM, Linhardt RJ. Glycosaminoglycan-protein
interactions: denition of consensus sites in glycosaminoglycan binding
proteins. Bioessays 1998;20:15667.
[26] Holak TA, Engstrom A, Kraulis PJ, Lindeberg G, Bennich H, Jones TA, et al. The
solution conformation of the antibacterial peptide cecropin A: a nuclear
magnetic resonance and dynamical simulated annealing study. Biochemistry
1988;27:76209.
848
[45] Sigrist CJ, Cerutti L, Hulo N, Gattiker A, Falquet L, Pagni M, et al. PROSITE: a
documented database using patterns and proles as motif descriptors. Brief
Bioinform 2002;3:26574.
[46] Sipos D, Andersson M, Ehrenberg A. The structure of the mammalian antibacterial peptide cecropin P1 in solution, determined by proton-NMR. Eur J
Biochem 1992;209:1639.
[47] Sreerama N, Woody RW. Estimation of protein secondary structure from
circular dichroism spectra: comparison of CONTIN, SELCON, and CDSSTR
methods with an expanded reference set. Anal Biochem 2000;287:25260.
[48] Sreerama N, Woody RW. On the analysis of membrane protein circular
dichroism spectra. Protein Sci 2004;13:10012.
[49] Srisailam S, Arunkumar AI, Wang W, Yu C, Chen HM. Conformational study of a
custom antibacterial peptide cecropin B1: implications of the lytic activity.
Biochim Biophys Acta 2000;1479:27585.
[50] Srisailam S, Kumar TK, Arunkumar AI, Leung KW, Yu C, Chen HM. Crumpled
structure of the custom hydrophobic lytic peptide cecropin B3. Eur J Biochem
2001;268:427884.
[51] Steiner H, Hultmark D, Engstrom A, Bennich H, Boman HG. Sequence and
specicity of two antibacterial proteins involved in insect immunity. Nature
1981;292:2468.
[52] Tieleman DP, Shrivastava IH, Ulmschneider MR, Sansom MS. Proline-induced
hinges in transmembrane helices: possible roles in ion channel gating. Proteins 2001;44:6372.
[53] Tyagi M, Rusnati M, Presta M, Giacca M. Internalization of HIV-1 tat requires
cell surface heparan sulfate proteoglycans. J Biol Chem 2001;276:325461.
[54] van Hofsten P, Faye I, Kockum K, Lee JY, Xanthopoulos KG, Boman IA, et al.
Molecular cloning, cDNA sequencing, and chemical synthesis of cecropin B
from Hyalophora cecropia. Proc Natl Acad Sci U S A 1985;82:22403.
[55] Wang W, Smith DK, Chen HM. The effect of pH on the structure, binding and
model membrane lysis by cecropin B and analogs. Biochim Biophys Acta
1999;1473:41830.
[56] Wang W, Smith DK, Moulding K, Chen HM. The dependence of membrane
permeability by the antibacterial peptide cecropin B and its analogs, CB-1 and
CB-3, on liposomes of different composition. J Biol Chem 1998;273:274384.
[57] Wiseman T, Williston S, Brandts JF, Lin LN. Rapid measurement of binding
constants and heats of binding using a new titration calorimeter. Anal Biochem 1989;179:1317.
[58] Wishart DS, Sykes BD. The 13C chemical-shift index: a simple method for the
identication of protein secondary structure using 13C chemical-shift data. J
Biomol NMR 1994;4:17180.
[59] Zasloff M. Magainins, a class of antimicrobial peptides from Xenopus skin:
isolation, characterization of two active forms, and partial cDNA sequence of a
precursor. Proc Natl Acad Sci U S A 1987;84:544953.
[60] Zasloff M. Antimicrobial peptides of multicellular organisms. Nature
2002;415:38995.