Você está na página 1de 14

LEPTINA: FUNCION, METODOS DE SEPARACION Y PREDICCION DE SU

ESTRUCTURA SECUNDARIA.
Universidad de Sucre, Programa de Biologa, Facultad de Educacin y Ciencias
Mara Paula Canchila Verbel y Marfiela Martnez Sierra.

INTRODUCCION
El trmino leptina deriva de la palabra griega leptos, que significa "delgado". Esta
hormona fue descubierta en 1994 por Jeffrey M. Friedman y colaboradores, en la
Universidad Rockefeller, mediante el estudio de ratones obesos e hiperfgicos,
mutantes para el gen ob (ratones ob/ob). La mutacin del gen ob en estos ratones
provoca la carencia de leptina srica, la cual est ligada a infertilidad, obesidad y
diabetes. La leptina fue la primera hormona identificada entre las liberadas por los
adipocitos. La cantidad de leptina producida es directamente proporcional a la
cantidad de tejido adiposo [9]. Esta adipoquina no slo informa al cerebro sobre el
nivel de almacn energtico, sino que tambin est involucrada en el control del
metabolismo energtico en la periferia, de la reproduccin, del metabolismo seo y
de la inmunidad. La leptina fue descubierta en el contexto de sus efectos sobre el
control de la alimentacin y del gasto energtico. Aunque en un principio se pens
que la leptina actuaba slo sobre ciertos centros hipotalmicos, en la actualidad le
ha sido asignada una mayor diversidad de funciones. La leptina es una protena
que se libera principalmente del tejido adiposo y que se vincula a la presencia de
diabetes y esterilidad, as como al desarrollo de obesidad. Tras su descubrimiento,
la mayora de las investigaciones en torno a la leptina se centraron en su papel
como factor regulador del peso corporal. Sin embargo, estudios posteriores
describieron una amplia distribucin de receptores para esta hormona en diversos
tejidos perifricos, abrindose, as, un vasto campo de investigacin sobre las
funciones biolgicas de esta hormona. La leptina participa en procesos fisiolgicos
tan diversos como la reproduccin, inmunidad o angiognesis. [11]
En este trabajo se realiza una breve investigacin acerca de los rasgos ms
importantes y caractersticos sobre esta protena atendiendo a ciertos parmetros
que permiten identificarla y ubicarla de cierto modo.

Familia y Dominio
La leptina es una protena de la familia de las citocinas y su receptor, similar al de
stas. Aunque existen al menos seis isoformas del receptor, la forma activa
corresponde al subtipo ObRb, asociado fundamentalmente con el sistema JAK2STAT3 y con otras cascadas de sealizacin intracelular. [12]

La estructura proteica de la leptina consta de un conjunto de 4 hlices que la hace


similar a la superfamilia de citoquinas de 4 hlices agrupadas de cadena larga y
posee una similitud estructural con la IL-6, las interleuquinas 12 (IL-12) y 15 (IL15), el factor de estimulacin de colonias de granulocitos (G-CSF), oncostatina M
(OSM), prolactina (PRL) y hormona del crecimiento (GH). Adems el receptor de
leptina (ObR), es un miembro de la familia de receptores de citoquinas de clase I y
su estructura primaria muestra homologas con las subunidades de sealizacin
de los receptores tipo IL-6 que incluyen gpl30, como el receptor de la IL-6, IL-11,
IL12, del factor inhibidor de leucemia (LIFR), el factor neurotrfico ciliar (CNTF), de
la cardiotropina 1 (CT-1), G-CSF (G-CSFR), OSM y de PRL (Fig. 1). [12]

Fig. 1. Similitudes estructurales entre el receptor de la leptina, ObR, y los receptores de citoquinas
de clase I. Una molcula de leptina se une a cada ObR, formando un complejo tetramrico de dos
receptores y dos molculas de leptina necesarios para la sealizacin. Las figuras negras
representan los dominios conservados de la familia de receptores de citoquinas de clase I. CNTF:
factor neurotrfico ciliar CT-1: cardiotropina 1; Leptin: leptina; IL-6, IL-11: interleuquinas 6 y 11; LIF:
factor inhibidor de leucemia; LIFR: receptor del factor inhibidor de leucemia; OBRL: isoforma larga
del receptor de leptina; OBRs: isoforma corta del de leptina; OSM: oncostatina; OSMR: receptor de
oncostatina.

Existen al menos 6 formas de corte y empalme alternativas con dominios


citoplasmticos de diferentes longitudes, conocidas como ObRa, ObRb, ObRc,
ObRd, ObRe y ObRf . Estos receptores son glicoprotenas de membrana con
dominios de fibronectina tipo III en la regin extracelular y con un mdulo de 200
aminocidos compartidos que contienen 4 residuos conservados de cistena y 2
motivos del tipo citoquina de unin a la membrana proximal, Trp-Ser-XaaTrp-Ser.
El ObRa es la isoforma predominante en la mayora de los tejidos y clulas,
incluyendo rin, hgado, pulmn y bazo. Las isoformas cortas del receptor en
general, parecen mediar el transporte intracelular y la degradacin de la leptina en
el interior de los lisosomas. [13]

Funcin biolgica
La leptina es un regulador hormonal de muchos procesos biolgicos y como tal
interviene en la fisiopatologa de un amplio nmero de enfermedades. La leptina
participa en procesos tales como regulacin del peso corporal, de la alimentacin
y del gasto energtico, reproduccin, crecimiento, funcin inmune, tono vascular y
probablemente muchos otros an por determinar. La leptina desempea una
funcin importante en la iniciacin de la pubertad y en el mantenimiento de la
funcin reproductiva. Tanto en humanos como en roedores, est implicada en la
liberacin de la hormona liberadora de gonadotropina (GnRH) en el hipotlamo y
la secrecin de la hormona luteinizante (LH) y la hormona folculo estimulante
(FSH) en la hipfisis anterior (Yu y cols., 1997). La administracin de leptina a
ratas prepuberales acelera el comienzo de la funcin reproductiva y en pacientes
deficientes en leptina, la administracin de la hormona restaura la liberacin de la
GnRH, la LH y el desarrollo puberal. La leptina acta en el hipotlamo de la rata
estimulando la secrecin de GnRH in vivo, modulando indirectamente la liberacin
de GnRH a travs de la reduccin de expresin de NPY y CART. El efecto de la
leptina en la secrecin de GnRH tambin podra estar mediado a travs de las
neuronas productoras de kisspeptina. La leptina tambin tiene efectos directos en
las gnadas en los testculos, es capaz de modular la proliferacin, la
diferenciacin de clulas germinales y la esteroidognesis por mecanismos
autocrinos y paracrinos. La leptina tambin modula la produccin de esteroides en
el ovario de la oveja. La obesidad causada por una deficiencia gentica de la
sealizacin de la leptina, puede cursar con hipogonadismo hipogonadotrfico, ya
que se apagan el ciclo. Adems, en esta clase de hipogonadismo se ha observado
que existe una deficiencia de la actividad aromatasa en humanos. [10] [8]

Proceso metablico
La leptina se ha asociado con un amplio nmero de procesos patolgicos que
incluyen cncer de diversos tipos, as como tambin enfermedades psiquitricas,
hipertensin arterial, diabetes mellitus no insulinodependiente, transtornos
reproductivos, insuficiencia placentaria, inmunodeficiencias y osteoartritis. [9]
Uno de los mecanismos propuestos de homeostasis energtica es que la grasa
corporal es regulada por un mecanismo de retroalimentacin negativo de
adiposidad, en el que est involucrada la leptina. Los niveles de leptina se
correlacionan con la adiposidad, disminuyendo acusadamente con la restriccin
calrica, e incrementndose con la sobrealimentacin. La leptina es transportada
al cerebro a travs de la BBB por un sistema de transporte saturable mediado por
el ObRa, que est expresada prominentemente en los plexos coroideos, y acta

en ncleos especficos del control de la ingesta como el Arc, para inducir la


reduccin de la ingesta e incrementar el gasto energtico.
La accin anorxica de la leptina est mediada por la activacin de las neuronas
hipotalmicas POMC/CART en el Arc, que incrementan la produccin de -MSH,
para inhibir la ingesta, y de PACAP en el VMN. La leptina simultneamente,
suprime la actividad de las neuronas NPY/AgRP del Arc, contribuyendo as a
disminuir la ingesta. Con el envejecimiento, los niveles de leptina decrecen; este
hecho parece ser independiente del ndice de masa corporal. La secrecin de
leptina tambin parece estar regulada por factores hormonales diferentes, que
incluyen glucocorticoides, insulina, y esteroides sexuales. [9]

Qu es la leptina?
La leptina es una hormona involucrada en la regulacin del peso corporal. El
nombre de leptina deriva de la raz griega leptos que significa delgado, lo que se
debe a su evidente funcin en el control del peso corporal a travs de la regulacin
del apetito y la termognesis (proceso por el cual se quema grasa). [10]

Quin la produce?
Tiene su origen en diversos tejidos, principalmente en el tejido adiposo (grasa
corporal) y es secretada a la sangre, por donde viaja hasta el cerebro y otros
tejidos, causando prdida de grasa, disminucin del apetito u otras funciones,
dependiendo del lugar donde acte.
Los complejos sistemas que regulan la fisiopatognesis de la obesidad han sido
objeto de intensas investigaciones en los ltimos aos. Esto se debe a que la
obesidad es un trastorno de elevada prevalencia a nivel mundial, sobre todo en los
pases industrializados y est considerado como uno de los principales problemas
de salud.
En condiciones normales cuando se produce un aumento de grasa en el
organismo, la leptina acta sobre el hipotlamo (una glndula en el cerebro) para
disminuir el apetito y aumentar el metabolismo basal. [6]
En las personas obesas aumenta la secrecin de leptina llegando a alcanzarse
valores cuatro veces mayores que en los no obesos, lo cual refleja un estado de
resistencia a la leptina (es decir la hormona esta pero no puede actuar).
Esta hormona es secretada al torrente sanguneo principalmente por el tejido
adiposo, el estmago y algunas clulas del hgado. Tambin es sintetizada por la
placenta durante el embarazo y es secretada a la circulacin materna, por lo que

su concentracin se eleva durante el embarazo normal, sobre todo en el segundo


y tercer trimestre.
La presencia de leptina gstrica (en el estmago), y su respuesta al alimento,
sugieren la participacin de esta hormona en el control agudo de la ingesta. [11]
La leptina realiza la mayora de sus efectos metablicos mediante la interaccin
con sus receptores especficos localizados en el sistema nervioso central y en
tejidos perifricos.
Adems de la existencia de receptores de leptina en el cerebro, se encuentran en
rganos perifricos, lo que ampla su radio de accin en cuanto a los tejidos
perifricos se encuentran en pulmn, rin, hgado, pncreas, corteza adrenal,
ovarios, testculos, msculo esqueltico, clulas hematopoyticas, tejido adiposo y
tracto gastrointestinal. [7]

Qu funciones tiene adems de estar relacionada con la


obesidad?
Participa en la respuesta inflamatoria a la vez que modifica la funcin inmune, (es
decir est relacionada con el sistema inmunolgico) Interviene en la regulacin del
inicio de la pubertad y en la funcin de la reproduccin. Se ha demostrado que las
adolescentes extremadamente delgadas comienzan la pubertad de forma tarda,
por lo que se ha sugerido que la leptina informa al cerebro, sobre la cantidad de
masa grasa existente para el inicio de la pubertad femenina y la reproduccin. [9]
Tiene efecto de estimulacin de la funcin gonadal (glndulas sexuales), creando
una unin entre el tejido adiposo y la funcin de reproduccin. Esta unin puede
ser la que explicara la reduccin en la fertilidad encontrada en mujeres muy
delgadas, tales como atletas o bailarinas de ballet y que la secrecin de leptina
podra ser la seal a las gnadas cuando ya existe suficiente energa almacenada
para sostener un embarazo modifica el metabolismo de la glucosa. Estimula la
liplisis en el adipocito, provoca una modificacin del reparto de lpidos en el tejido
muscular [8].
Constituye una seal metablica fundamental que modula la secrecin de la
hormona del crecimiento. [8]

Secuencia de Leptina
MRCGPLYRFLWLWPYLSYVEAVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQ
RVTGLDFIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLL

AASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSP
GC
La leptina es un pptido glucosilado de 16 KD. Est constituido por 146
aminocidos y contiene un puente disulfuro necesario para su actividad biolgica.
Posee un alto grado de homologa entre especies (84% entre la leptina humana y
murina, por ejemplo)7, adems de compartir algunas similitudes estructurales con
las citocinas. Aunque es producida en respuesta a una diversidad de estmulos, no
se ha demostrado la existencia de depsitos intracelulares de esta hormona, lo
que sugiere que los estmulos actuaran sobre la sntesis, mas no sobre la
secrecin de la molcula. [7]
La leptina es una protena de 167 aminocidos, que incluyen un pptido seal de
21 aminocidos. Su estructura tridimensional presenta cuatro hlices alfa y un
puente disulfuro entre las cistenas en posicin 96 y 146, siendo este ltimo
necesario para la actividad biolgica de la hormona. [6]

TRABAJOS CON LA PROTEINA


Prediccin de estructura secundaria de la protena y el software utilizado
Para la prediccin de la estructura secundaria de nuestra protena se utiliz el
siguiente programa VMD: VMD (Molecular Dynamics visuales; Humphrey et al.,
1996) es un programa de visualizacin y el anlisis molecular diseado para
sistemas biolgicos tales como protenas, cidos nucleicos, asambleas bicapa
lipdica, etc. Es desarrollado por el Grupo de Biofsica Terica y Computacional de
la Universidad de Illinois en Urbana-Champaign. Entre los programas de grficos
moleculares, VMD es nico en su capacidad para operar en efciently de varios
gigabytes trayectorias de dinmica molecular, su interoperabilidad con un gran
nmero de paquetes de simulacin de dinmica molecular, y su integracin de la
estructura y la secuencia de informacin. [15]
Cdigo de la protena: LEP

Estructura de la Leptina.
Despus de obtener esto en el software se empieza a configura para que se
visualice la estructura secundaria y adems la secuencia de aminocidos para su
anlisis estructural.

Estructura secundaria de leptina.


Despus de obtener la estructura se abre la ventana de la secuencia de
aminocidos para ver y analizar los distintos tipos de estructura que esta contiene.

La ventana VMD de secuencia muestra las propiedades de la secuencia de la


protena, incluyendo el valor y la estructura secundaria, denotado por los cdigos
de color.
Con esto se cuantifica en una tabla segn los colores y las letras los tipos de
estructuras presentadas.
CDIGOS DE ESTRUCTURA SECUNDARIA.
Numero presentes en
Letra de representacin.
Estructura
leptina.
E
Cadena Beta
0
C
Cola
7
G
Hlice 3-10
2
B
Puente aislado
0
H
Hlice alfa
5
T
Giros
4
I
Hlice Pi
0

Las conformaciones espaciales que son accesibles pueden representacin en un


diagrama bidimensional. A este tipo de representaciones se les llama diagramas
de Ramachandran como los que se muestra a continuacion, en donde la primera
es un diagrama de Ramachandran en el que muestran las regiones restringidas a
los diferentes aminocidos y tambien se muestra en donde se sealan las
conformaciones preferidas en las cadenas proteicas.

Diagrama de Ramachandran.
Los diagramas de Ramachandran slo indican las conformaciones que estn
permitidas o prohibidas por interacciones estricas. La inclusin en la funcin de
potencial interatmico de funciones de interacciones dipolares (recuerdese la gran
polaridad del enlace peptdico) reduce an ms el nmero de conformaciones
accesibles en las cadenas polipeptdicas. Entre todas estas conformaciones
permitidas hay algunas que estn clarsimamente estabilizadas cuando se tienen
en cuenta la posibilidad de formacin de enlaces de hidrgeno entre las unidades
peptdicas de la cadena (NH...O). Estas conformaciones son principalmente la
hlice a (a helix) y la hoja (b sheet). [14]

Diagrama de Ramachandran en 3D

Mtodos de purificacin, extraccin y desnaturalizacin de


Leptina.
Extraccin de RNA de tejido graso perirrenal de cabra
La extraccin de RNA se realiza en un gramo de tejido graso mediante el
procedimiento descrito por Chomczynski y Sacchi (1987). La cuantificacin del
RNA se determina por el mtodo de absorbancia en la regin ultravioleta, con la
relacin 260/280 con el empleo del nanodrop, y para verificar la calidad del RNA
total se realiz una electroforesis en gel de agarosa-formaldehdo. [3]
AMPLIFICACIN POR RT-PCR DE LA SECUENCIA CODIFICANTE El cDNA
Se obtiene a partir de 5 g de RNA tratado con DNAsa I (Invitrogen). La reaccin
de sntesis se realiza en un volumen de 20 l que contena 0,5 mM de dNTPs, 8
pmoles del primer LEPTIN2R y 100 U de la transcriptasa reversa (SuperScript III,
Invitrogen). La reaccin se incuba por 1 h a 42 C y despus de inactivar la enzima
a 70 C por 15 min se procedi a realizar la amplificacin por PCR. La reaccin se
lleva a cabo en un volumen de 25 l que contena 50 mM de cada dNTP, 2 pmoles

de cada oligonucletido (LEPTIN2F y LEPTIN2R), 2 l de cDNA y 1.25 U de Taq


DNA polimerasa (Invitrogen, Foster city, USA). [3]
La reaccin se incuba durante 2 min a 94 C y cada ciclo de amplificacin
consistie de 40 s a 94 C, alineamiento por 25 s a 66 C, extensin por 50 s a
72 C; y una extensin final a 72 C por 5 min. Una muestra de 4 l se coloca en
un gel de agarosa al 1% para identificar la amplificacin. Se observa una banda a
la altura de 450 bp. [4]
EXPRESIN Y PURIFICACIN DE LA LEPTINA DE CABRA
La sntesis de la protena recombinante (pET15bgLeptin) por la cepa Rosetta
(DE3) se lleva a cabo mediante la aplicacin de IPTG (Isopropyl -D-1thiogalactopyranoside) a una concentracin final de 250 M. La protena
recombinante se obtiene por previa disolucin de los cuerpos de inclusin en
amortiguador Tris-HCl (10 mM), pH 8,0 que contiene 8 M de urea y 50 mM de
NaCl (12 h a 4 C en agitacin constante). Una vez solubilizada, la protena se
purifica en una cromatografa de afinidad (HiTrap chelating, Amersham pharmacia)
con el empleo del equipo AKTA FPLC [5]. Las fracciones colectadas se
monitorean a 280 nm y los picos de protena identificados se dializan con
amortiguador Tris-HCl (10mM), pH 8,0, que contiene 50 mM de NaCl y cantidades
decrecientes de urea (4; 2; 1, 0,5; 0,25 y 0,0 M). Para cada una de las
concentraciones decrecientes de urea, la dilisis se realiza a 4 C durante 8 h con
cambios cada 4 h. Para favorecer la renaturalizacin de la leptina la dilisis sin
urea se repite dos veces. Al trmino, la protena se alcuota y almacena a 20 C
hasta su uso. [1]
SDS-PAGE E INMUNOTRANSFERENCIA
El peso molecular de la protena recombinante purificada se analiza en geles de
poliacrilamida de acuerdo con el mtodo descrito por Laemmli (1970). Se utiliza un
gel al 12%, porcentaje cercano a lo descrito por Kling (2009) para leptina de
salmn. La protena presente en el gel se transfiere a una membrana de PVDF e
incuba con anti-gLeptina, 1:500 durante 24 h y luego la membrana se incuba por 2
h con un anticuerpo secundario (anti-rabbit IgG acoplado a fosfatasa alcalina)
1:20.000. La banda de protena inmunorreactiva se revela con 1 ml de azul de
tetrazolium en dimetilformamida y 1 ml de 5-bromo-4-cloro-3-indolilfosfato en DMF
disuelto en 100 ml PBS. Para la capacidad de unin de la protena recombinante a
receptores especficos localizados en el hipotlamo se emplean cortes histolgicos
del hipotlamo, estos se incubaron con el anticuerpo antihistidina como control
negativo, mientras que la unin de la leptina recombinante a los receptores se

observan cuando se incuba previamente con la leptina recombinante y despus


con el anticuerpo antihistidina. [2]
DESNATURALIZACIN DE LA LEPTINA.
El perfil trmico del proceso consiste en un paso de desnaturalizacin inicial por 3
min a 94 C, seguido de 35 ciclos (desnaturalizacin a 94 C por 30 seg, iniciador
recalentado a 62 C durante 35 seg y extensin a 72 C por 1 min) y una extensin
final a 72 C durante 10 min. Los productos de PCR se separan y se reconocen
por electroforesis en gel de agarosa al 1.5 % teido con bromuro de etidio. Los
genotipos del gen de leptina se determinan mediante la tcnica de PCR-RFLP. [6]
El estudio del polimorfismo del gen de leptina y la digestin de los productos de
PCR se realizan con la enzima de restriccin BsaAI(Ppu21I) que identifica
secuencias 5' AC"!GT 3'. Fragmentos amplificados son digeridos por la
enzima BsaAI a 30 C durante 3 h con la siguiente mezcla reactiva: 8 l del
producto de PCR, 3 l del amortiguador de digestin 10X, 5 U (0.5 l) enzima de
restriccin y 8 l de agua desionizada. Los productos de digestin se separan por
electroforesis horizontal (70 voltios, 110 min) en gel de agarosa al 3 %, teido con
bromuro de etidio, y el tamao de los fragmentos digeridos se reconocen por
marcadores pBR322/BsuRI de ADN; los genotipos se determinan basados en la
diferencia de tamao de los fragmentos en el gel.[7]

CONCLUSIONES

De manera general y como fundamento principal se concluye el hecho de que


existen distintas maneras de trabajar con esta protena orientadas en algn
tema dentro de los procesos biolgicos presentados a largo del desarrollo de
la investigacin.
Individuos Obesos generalmente exhiben circulacin de leptina en ms alta
concentraciones que los individuos de peso normal y esto se debe a que los
individuos obesos poseen un mayor porcentaje de grasa corporal.
La leptina desempea una funcin importante en la iniciacin de la pubertad y
en el mantenimiento de la funcin reproductiva adems de solo pensar que es
importante en problemas de obesidad.
La secrecin de leptina acta como seal al cerebro, informando sobre el
tamao del tejido adiposo y actuando como factor saciante.
En el trabajo realizado con esta protena la amplificacin PCR juega un papel
un papel importante en el proceso de desnaturalizacin.
Los sujetos obesos presentan elevados los niveles de leptina, Tras la prdida
de peso, los niveles de leptina, que disminuyen por debajo del valor estimado

en funcin de la masa grasa, pueden indicar al cerebro la suficiencia de los


depsitos grasos
Adems de su aplicacin dentro del tratamiento de la obesidad esta hormona
tiene perspectivas de aplicacin en otras reas como es la prevencin de la
retinopata diabtica y del riesgo de trombosis vascular, as como alteraciones
en el sistema reproductivo, entre otras.

BIBLIOGRAFIA
[1] Nilsson J, S Stahl, J Lundeberg, M Uhlen, P Nygren. 1997. Affinity fusion
strategies for detection, purification, and immobilization of recombinant
proteins. Review. Protein Expression and Purification 11, 1-16.
[2] Matteri RL, DA Papkoff, JR Swedlow, Y-S Chang. 1986. Isolation and
characterization of three forms of luteinizing hormone from the pituitary gland
of the horse. Biol Reprod 34, 571-578.
[3] Chomczynski P, N Sacchi. 1987. Single-step method of RNA isolation by
acid guanidinium thiocyanate-phenol-chloroform extraction. Anal Biochem
162,156-159.
[4] Kling P, I Ronnestad, SO Stefansson, K Murashita, T Kurokawa, BJ
Bjornsson. 2009. A homologous salmonid leptin radioimmunoassay indicates
elevated plasma leptin levels during of rainbow trout. Gen Comp Endocrinol
162, 307-312.
[5] Laemmli UK. 1970. Cleavage of structural proteins during the assembly of
the head of bacteriophage T4. Nature 227, 680-685.
[6] Javanrouh A, Banabazi MH, Esmaeilkhanian S, Amirinia C, Seyedabadi
HR, Emrani H. Optimization on salting out method for DNA extraction from
animal and poultry blood cells. 57th Ann Meet European Assoc Anim Prod.
September 17-20, 2006; Antalya, Turkey; 2006;101.
[7] Lien S, Sundvold H, Klungland H, Vage DI. Two novel polymorphisms in the
bovine obesity gene (OBS). Anim Genet 1997;28:45.
[8] Buyse M, Ovesj ML, Goot H, Guilmeau S, Pranzi G, Moizo L, Walker F,
Lewin MJ, Meister B and Bado A, 2001. Expression and regulation of leptin
receptor proteins in
afferent and efferent neurons of the vagus nerve. Eur J Neurosci 14:64-72.

[9] Caprio M, Fabbrini E, Isidori AM, Aversa A and Fabbri A, 2001. Leptin in
reproduction. Trends Endocrinol Metab 12: 65-72. Review.
[10] Catalano S, Mauro L, Marsico S, Giordano C, Rizza P, Rago V,
Montanaro D,Maggiolini M, Panno ML and And S, 2004. Leptin induces, via
ERK1/ERK2 signal,functional activation of estrogen receptor alpha in MCF-7
cells. J Biol Chem 279:19908-15.
[11] Bittencourt JC, Presse F, Arias C, Peto C, Vaughan J, Nahon JL, Vale W
and S
[12] Tartaglia LA, Dembski M, Weng X, Deng N, Culpepper J, Devos R,
Richards GJ, Campfield LA, Clark FT, Deeds J, Muir C, Sanker S, Moriarty A,
Moore KJ, Smutko JS, Mays GG, Wool EA, Monroe CA and Tepper RI, 1995.
Identification and expression cloning of a leptin receptor, OB-R. Cell 83:126371.
[13] Baumann H, Morella KK, White DW, Dembski M, Bailon PS, Kim H, Lai
CF and Tartaglia LA, 1996. The full-length leptin receptor has signaling
capabilities of interleukin 6-type cytokine receptors. Proc Natl Acad Sci U S A
93:8374-8.
[14]http://www.uib.cat/facultat/ciencies/prof/josefa.donoso/campus/modulos/mo
dulo3/modulo3_5_3.htm
[15] Humphrey, W., Dalke, A. and Schulten, K., .VMD - Visual Molecular
Dynamics,. J. Molec. Graphics, 1996, vol. 14, pp. 33-38.