Você está na página 1de 315

CLNICA MDICA

MEDICINA CELULAR E MOLECULAR


I

SRIE CLNICA MDICA


MEDICINA CELULAR E MOLECULAR
1.
2.
3.
4.
5.
6.
7.
8.
9.
10.
11.
12.
13.
14.
15.
16.
17.

II

Bases Moleculares da Biologia, da Gentica e da Farmacologia.


Bases Moleculares da Biologia em Cardiologia e Medicina de Urgncia
Bases Moleculares da Biologia em Endocrinologia
Bases Moleculares da Biologia em Gastroenterologia e Nutrio
Bases Moleculares da Biologia em Reumatologia
Bases Moleculares da Biologia em Geriatria
Bases Moleculares da Biologia em Imunologia e Alergia
Bases Moleculares da Biologia em Pneumologia
Bases Moleculares da Biologia em Nefrologia e Urologia
Bases Moleculares da Biologia em Transplante
Bases Moleculares da Biologia em Ginecologia e Obstetrcia
Bases Moleculares da Biologia em Aids e Doenas Infecciosas
Bases Moleculares da Biologia em Patologia
Bases Moleculares da Biologia em Hematologia
Bases Moleculares da Biologia em Dermatologia
Bases Moleculares da Biologia em Neurologia e Psiquiatria
Bases Moleculares da Biologia em Doenas Ocupacionais

CLNICA MDICA
MEDICINA CELULAR E MOLECULAR
Volume 1 Bases Moleculares da Biologia, da Gentica e da Farmacologia

NESTOR SCHOR
Professor Livre-Docente, Titular da Disciplina de Nefrologia da Universidade Federal
de So Paulo, Escola Paulista de Medicina, UNIFESP-EPM

MIRIAN APARECIDA BOIM


Biomdica, Pesquisadora Associada e Professor Afiliado da Disciplina de Nefrologia
da Universidade Federal de So Paulo, Escola Paulista de Medicina, UNIFESP-EPM

OSCAR FERNANDO PAVO DOS SANTOS


Professor Adjunto da Disciplina de Nefrologia da Universidade Federal
de So Paulo, Escola Paulista de Medicina, UNIFESP-EPM

So Paulo Rio de Janeiro Ribeiro Preto Belo Horizonte

III

EDITORA ATHENEU

So Paulo

Rua Jesuno Pascoal, 30


Tels.: (11) 3331-9186 223-0143
222-4199 (R. 25, 27, 28 e 30)
Fax: (11) 223-5513
E-mail: edathe@terra.com.br

Rio de Janeiro

Rua Bambina, 74
Tel.: (21) 2539-1295
Fax: (21) 2538-1284
E-mail: atheneu@atheneu.com.br

Ribeiro Preto

Rua Baro do Amazonas, 1.435


Tel.: (16) 636-8950 636-5422
Fax: (16) 636-3889

Belo Horizonte Rua Domingos Vieira, 319 Conj. 1.104

PROJETO GRFICO: Equipe Atheneu


CAPA:
Magma Comunicao e Design

Dados Internacionais de Catalogao na Publicao (CIP)


(Cmara Brasileira do Livro, SP, Brasil)
Medicina celular e molecular: bases moleculares da biologia, da gentica
e da farmacologia/editores Mirian Aparecida Boim, Nestor Schor, Oscar
Fernando Pavo dos Santos. So Paulo: Editora Atheneu, 2003.
(Coleo clnica mdica: v. 1)
Vrios colaboradores.
1. Biologia celular 2. Biologia molecular 3. Doenas genticas
4. Farmacologia molecular 5. Gentica mdica 6. Patologia molecular I. Boim,
Mirian Aparecida. II. Schor, Nestor. III. Santos, Oscar Fernando Pavo.
IV. Srie
CDD-611.01815
NLM-QZ 40

03-4770

ndices para catlogo sistemtico:


1. Patologia celular e molecular: Cincias mdicas

611.01815

CLNICA MDICA: MEDICINA CELULAR E MOLECULAR


VOLUME 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA
Schor, N.; Boim, M. A.; Santos, O. F. P.
Direitos reservados Editora ATHENEU So Paulo, Rio de Janeiro, Ribeiro Preto, Belo Horizonte, 2003

IV

Colaboradores

ANTONIO JOS LAPA


Professor Titular do Departamento de Farmacologia, Universidade Federal de Minas Gerais

BENTO C. SANTOS
Disciplina de Nefrologia, Departamento de Medicina, Universidade Federal de So Paulo,
Escola Paulista de Medicina, UNIFESP-EPM. Laboratrio Clnico do Hospital Israelita
Albert Einstein. Centro de Dilise Einstein

BIANCA BORSATTO-GALERA
Professora-Doutora- Chefe da Unidade de Gentica Mdica e Biologia Molecular,
Faculdade de Medicina de Cuiab, UNIC-MT

CADEN SOUCCAR
Livre-Docente em Farmacologia, Universidade Federal de So Paulo, Escola Paulista
de Medicina, UNIFESP-EPM

CAROLINA F. MOURA DE SOUZA


Especialista em Gentica Clnica e Mestre em Gentica Mdica pelo Departamento de
Gentica da Universidade Federal do Rio Grande do Sul, UFRGS

CATARINA SEGRETI PORTO


Doutor em Cincias, Ps-Doutorado em Biologia da Reproduo da Universidade
Federal de So Paulo, Escola Paulista de Medicina, UNIFESP-EPM

GUSTAVO TURECKI
MD PhD, Director, McGill Group for Suicide Studies Professor, Departments of Psychiatry
and Human Genetics, Douglas Hospital McGill University, Montreal, Canad

HELENA BONCIANI NADER


Professor Titular da Universidade Federal de So Paulo,
Escola Paulista de Medicina, UNIFESP-EPM

IDA VANESSA D. SCHWARTZ


Especialista em Gentica Clnica e Mestre em Gentica Mdica pelo Departamento de
Gentica da Universidade Federal do Rio Grande do Sul, UFRGS
V

ITA PFEFERMAN HEILBERG


Professor Adjunto da Disciplina de Nefrologia, Universidade Federal
de So Paulo, Escola Paulista de Medicina, UNIFESP-EPM

JOS FRANCO DA SILVEIRA FILHO


Professor Adjunto, Livre-Docente, Departamento de Micro, Imuno e Parasitologia,
Universidade Federal de So Paulo, Escola Paulista de Medicina, UNIFESP-EPM

LENY TOMA
Doutor Departamento Bioqumica, Universidade Federal de So Paulo,
Escola Paulista de Medicina, UNIFESP-EPM

LUCIA DE OLIVEIRA SAMPAIO


Professora Adjunta IV da Universidade Federal de So Paulo,
Escola Paulista de Medicina, UNIFESP-EPM

MRCIA REGINA MACHADO DOS SANTOS


Pesquisador Ps-Doutorado da FAPESP, Departamento de Micro, Imuno
e Parasitologia, Universidade Federal de So Paulo, Escola Paulista
de Medicina, UNIFESP-EPM

MARIA CHRISTINA WERNECK DE AVELLAR


Professora Adjunta 4, Setor de Endocrinologia Experimental, Departamento
de Farmacologia, Universidade Federal de So Paulo, Escola Paulista
de Medicina, UNIFESP-EPM

MARIA ISABEL MELARAGNO


Professora Adjunta da Disciplina de Gentica do Departamento de Morfologia,
Universidade Federal de So Paulo, Escola Paulista de Medicina, UNIFESP-EPM

MARIA SALETE DE ABREU CASTRO


Professora Doutora, Departamento de Farmacologia, Universidade
Federal de Minas Gerais, UFMG

MARIA TERESA RIGGIO DE LIMA-LANDMAN


Professora Adjunta da Universidade Federal de So Paulo,
Escola Paulista de Medicina, UNIFESP-EPM

MARLIA DE ARRUDA CARDOSO SMITH


Professora Livre-Docente e Adjunta, Chefe da Disciplina de Gentica
do Departamento de Morfologia, Universidade Federal de So Paulo,
Escola Paulista de Medicina, UNIFESP-EPM
VI

MARIMLIA A. PORCIONATTO
Professora Doutora do Departamento de Bioqumica, Disciplina de Biologia Molecular,
Universidade Federal de So Paulo, Escola Paulista de Medicina, UNIFESP-EPM

MARTIN R. WHITTLE
MD, PhD Genomic Engenharia Molecular Ltda.

MIRIAN APARECIDA BOIM


Biomdica, Pesquisadora Associada e Professor Afiliado da Disciplina
de Nefrologia da Universidade Federal de So Paulo, Escola Paulista de Medicina,
UNIFESP-EPM

NESTOR SCHOR
Professor Livre-Docente Titular da Disciplina de Nefrologia, Universidade Federal
de So Paulo, Escola Paulista de Medicina, UNIFESP-EPM

NOBUKO YOSHIDA
Professor Titular da Universidade Federal de So Paulo,
Escola Paulista de Medicina, UNIFESP-EPM

ROBERTO GIUGLIANI
Professor Titular do Departamento de Gentica Mdica da Universidade Federal
do Rio Grande do Sul, UFRGS, e Chefe do Servio de Gentica Mdica
do Hospital de Clnicas de Porto Alegre

ROSELY OLIVEIRA GODINHO


Professor Adjunto da Universidade Federal de So Paulo,
Escola Paulista de Medicina, UNIFESP-EPM

SANG WON HAN


PhD. Professor Adjunto do Departamento de Biofsica, Universidade Federal
de So Paulo, Escola Paulista de Medicina, UNIFESP-EPM

SLVIA REGINA CAMINADA DE TOLEDO


Professora Visitante Doutora da Disciplina de Gentica do Departamento de Morfologia
da Universidade Federal de So Paulo, Escola Paulista de Medicina, UNIFESP-EPM
e Chefe do Servio de Gentica do Instituto de Oncologia Peditrica

SIMONE MAFALDA RODRIGUES CAMARGO


Doutor em Nefrologia, Cincias Bsicas, Disciplina de Nefrologia, Universidade
Federal de So Paulo, Escola Paulista de Medicina, UNIFESP-EPM
VII

SPENCER LUIZ MARQUES PAYO


Assistente-Doutor e Chefe do Hemocentro da Faculdade de Medicina
de Marlia, FAMEMA-SP

THEREZA CHRISTINA MONTEIRO DE LIMA


Doutora em Fisiologia Humana pela Universidade de So Paulo, USP.
Departamento de Farmacologia, Centro de Cincias Biolgicas,
Universidade Federal de Santa Catarina

YARA M. MICHELACCI
Doutora em Cincias, Livre-Docente, Universidade Federal de So Paulo,
Escola Paulista de Medicina, UNIFESP-EPM

VIII

e-mail dos Editores e Colaboradores

NESTOR SCHOR
e-mail: nestor@nefro.epm.br

Maria Isabel Melaragno


e-mail:melaragno.morf@epm.br-

MIRIAN APARECIDA BOIM


e-mail: mirian@nefro.em.br

Maria Teresa Riggio de Lima-Landman


e-mail:tlandman.farm@infar.epm.br

OSCAR FERNANDO PAVO DOS SANTOS


e-mail: pavao@nefro.epm.br

Marlia de Arruda Cardoso Smith


e-mail:macsmith.morf@epm.br

Antonio Jos Lapa


e-mail: ajlapa.farm@infar.epm.br

Marimlia A. Porcionatto
e-mail: marimelia.bioq@epm.br

Bento C. Santos
e-mail: bsantos@nefro.epm.br

Martin R. Whittle
e-mail: mwhittle@genomic.com.br

Bianca Borsatto
e-mail:bbgalera@yahoo.com.br

Mirian Aparecida Boim


e-mail: mirian@nefro.em.br

Caden Souccar
e-mail : csouccar.farm@infar.epm.br

Nestor Schor
e-mail: nestor@nefro.epm.br

Catarina Segreti Porto


e-mail: porto.farm@infar.epm.br

Nobuko Yoshida
e-mail: nyoshida@ecb.epm.br

Gustavo Turecki
e-mail: gustavo.turecki@mcgill.ca

Roberto Giugliani
e-mail:rgiugliani@hcpa.ufrgs.br

Helena Bonciani Nader


e-mail: hbnader.bioq@Epm.br

Rosely Oliveira Godinho


e-mail: godinho.farm@infar.epm.br

Ita Pfeferman Heilberg


e-mail: ipheilberg@nefro.epm.br

Sang Won Han


email: sang@biofis.epm.br

Jos Franco da Silveira Filho


e-mail: franco@ecb.epm.br

Slvia Regina Caminada de Toledo


e-mail:genetica@graacc.org.br

Leny Toma
e-mail: ltoma.bioq@unifesp.epm.br

Simone Mafalda Rodrigues Camargo


e-mail: simarc@usa.net

Lucia de Oliveira Sampaio


e-mail: losampaio.bioq@Epm.Br

Spencer Luiz Marques Payo


e-mail:slmpayao@famema.br-

Mrcia Regina Machado dos Santos


e-mail: mrmachados@ecb.epm.br

Thereza Christina Monteiro de Lima


e-mail: thereza@farmaco.ufsc.br

Maria Christina Werneck de Avellar


e-mail: avellar.farm@infar.epm.br

Yara M. Michelacci
e-mail: yara.bioq@epm.br

Nota: Os e-mails foram includos como forma de troca de informaes, inclusive crticas e sugestes entre
os leitores e os autores e colaboradores, tendo em vista o aprimoramento do presente trabalho, bem como
o esclarecimento aos leitores em suas dvidas e questionamentos.

IX

Dedicatria

Dedicamos este livro:

queles que geram e propagam o conhecimento cientfico.

Ao meu neto, Raul Schor Toledo, simbolizando uma nova gerao promissora e
vida de conhecimentos para o bem-estar da humanidade.
Nestor Schor

minha famlia, sempre presente.


Aos meus alunos de ps-graduao que me permitem vibrar e crescer.
Mirian Aparecida Boim

Aos Professores Horcio Ajzen e Miguel Cendoroglo Neto, exemplos que procuro
seguir: probidade, dignidade e competncia mdica.
Oscar Fernando Pavo dos Santos

XI

XII

Apresentao

A pretenso desta Srie abranger as principais disciplinas da clnica mdica que apresentam
ntida interseco com as cadeiras bsicas na sua prtica mdica no que diz respeito aos conceitos
e informaes recentes de biologia celular e molecular.
Como de se esperar, no o seu objetivo apresentar a ltima evidncia desta enorme e muito
produtiva rea de pesquisa, pois pela prpria caracterstica de um livro, o tempo de sua publicao
distancia-se dos ltimos avanos e, mais ainda, nem todos os ltimos avanos j foram confirmados
e aceitos pela comunidade cientfica internacional.
Assim, nesta Srie, apresentamos instrumentos para o que alunos de graduao e ps-graduao,
bem como mdicos atuantes nas diferentes especialidades, tenham acesso informaes bsicas
e clnicas da biologia celular e molecular.
A Srie est organizada em dois mdulos. O primeiro deles est voltado para aspectos
eminentemente bsicos, de formao biolgica na rea mdica, de interesse para todos os
estudiosos desta cincia explosiva. Para cumprir este objetivo, apresentamos trs partes, a saber:
1. Bases da biologia celular e molecular; 2. Doenas e bases genticas e 3. Mecanismos celulares
e moleculares da farmacologia mdica. Estas partes perfazem 38 captulos.
O segundo mdulo composto de 22 partes com 239 captulos, correspondentes s principais
disciplinas clnicas, com exceo da parte sobre AIDS, que pela sua peculariedade foi destacada
de sua natural parte de Doenas Infecciosas e Parasitrias e a parte sobre Transplante, por ser
uma rea multidisciplinar. Assim, alm destas duas partes, sero disponibilizadas as partes
restantes em volumes subseqentes, agrupando as reas com maior interface possvel, permitindo
ao leitor escolher os volumes de maior interesse.
Os volumes a serem publicados em seqncia abrangem as reas: Aids, Cardiovascular,
Dermatologia, Doenas Infecciosas e Parasitrias, Doenas Ambientais e Ocupacionais,
Endocrinologia, Geriatria, Gastroenterologia, Ginecologia e Obstetrcia, Hematologia,
Imunologia e Alergia, Medicina de Urgncia, Nefrologia, Nutrio, Oftalmologia,
Otorrinolaringologia, Patologia Clnica, Pneumologia, Reumatologia, Transplante, Psiquiatria
e Neurologia e Urologia.
Pretende-se tambm que em cada volume a Parte I seja reeditada, pois possibilitaria ao leitor
interessado diretamente em alguma seo de clnica, ter acesso para consulta dos aspectos mais
bsicos deste maravilhoso mundo novo da cincia: a Biologia Celular e Molecular.
So Paulo, inverno de 2003
Nestor Schor
Mirian Aparecida Boim
Oscar Fernando Pavo dos Santos
XIII

XIV

Agradecimentos

Os Editores da Srie, os Editores das Partes e os Autores dos captulos desta obra no poderiam
deixar de registrar seu agradecimento Editora Atheneu pelo desprendimento ao desafio em
viabilizar uma coleo desta magnitude, ou seja, publicar em uma rea nova e de difcil dimenso
um nmero nada trivial de 277 captulos, apresentados em dois mdulos, que se desdobram de
trs a 22 partes, respectivamente, envolvendo nesta tarefa centenas de pesquisadores.
A representao deste hercleo empreendimento cientfico e educacional de origem totalmente
brasileira, de estimular e valorizar autores/pesquisadores no deixa de ser uma homenagem ao
cientista brasileiro que com todas as suas dificuldades, enfrentando as intempries peculiares da
pesquisa, a qual se somam tantas outras problemticas ainda presentes no nosso Pas; no
obstante, consegue produzir uma obra de carter original, como contribuio da universidade
pblica brasileira para a nossa comunidade estudantil e cientfica da rea mdico-biolgica.
Parabns, Atheneu, por sua coragem editorial!
So Paulo, inverno de 2003
Editores e Autores

XV

XVI

Introduo

Nestas ltimas dcadas um nmero significativo de informaes em nvel mdico-biolgico tem


chegado ao alcance de profissionais desta rea.
Entretanto, como estas informaes so recentes, no dispomos de um veculo que apresente os
principais procedimentos, facilitando, com isso, o aprendizado, de tal maneira que o profissional
possa suprir eventuais lacunas em sua formao e, assim, desenvolver condies de aprendizado
contnuo.
ntida a mudana editorial, refletindo a atividade em pesquisa, das revistas especializadas em
medicina/biologia. Notamos que a maioria de artigos publicados, mesmo nas revistas voltadas
predominantemente para enfoque clinico, o componente biologia celular e molecular
predomina. Metodologias e mesmo a linguagem cientfica sofreram uma enorme modificao.
Assim, esta Srie Clnica Mdica: Medicina Celular e Molecular pretende oferecer as bases
celulares e moleculares para que o aluno de graduao ou de ps-graduao e mesmo para que
os mdicos especialistas da mais diferentes reas de atuao possam adquirir conhecimentos
fundamentais na rea mdico-biolgica.
claro que a velocidade da pesquisa desta rea impede que uma obra deste porte apresente os
ltimos artigos ou as mais recentes descobertas, mas nossa inteno que o leitor desenvolva
uma base cientfica suficientemente slida para melhor compreender e discernir as novas
informaes.
So Paulo, inverno de 2003
Nestor Schor
Mirian Aparecida Boim
Oscar Fernando Pavo dos Santos

XVII

XVIII

Sumrio

PARTE 1 BASES DA BIOLOGIA CELULAR E MOLECULAR


Coordenadores: Mirian A. Boim e Helena Bonciani Nader

Biomolculas, 3

Princpios da Biologia Molecular do Gene, 31

Hereditariedade, Genes e DNA, 53

Replicao, Reparo e Rearranjos do DNA Genmico, 69

Expresso e Traduo da Informao Gentica, 85

Sntese, Estruturao e Distribuio de Protenas, 93

Sinalizao Celular, 103

Lucia O. Sampaio
Leny Toma
Yara M. Michelacci
Helena B. Nader
Marimlia A. Porcionatto

Jos Franco da Silveira


Mrcia R. Machado dos Santos

Yara M. Michelacci
Helena B. Nader
Marimlia A. Porcionatto
Lucia O. Sampaio
Leny Toma

Yara M. Michelacci
Helena B. Nader
Marimlia A. Porcionatto
Lucia O. Sampaio
Leny Toma

Mirian Aparecida Boim

Bento C. Santos

Nobuko Yoshida

XIX

Ciclo Celular, 113

Oncogenes e Genes Supressores de Tumor, 121

Marimlia A. Porcionatto
Lcia O. Sampaio
Leny Toma
Yara M. Michelacci
Helena B. Nader

Helena B. Nader
Marimlia A. Porcionatto
Lcia O. Sampaio
Leny Toma
Yara M. Michelacci

10

Mecanismos de Morte Celular: Apoptose versus Necrose, 133

11

Polimorfismos Genticos: Implicaes Clnicas, 141

12

DNA Recombinante, 147

13

Biologia Molecular como Instrumental Mdico, 163

Simone Mafalda Rodrigues Camargo


Nestor Schor

Ita Pfeferman Heilberg

Leny Toma
Yara M. Michelacci
Helena B. Nader
Marimlia A. Porcionatto
Lcia O. Sampaio

Martin R. Whittle

PARTE 2 DOENAS E BASES GENTICAS


Coordenador: Marlia de Arruda Cardoso Smith

14

A Anlise de Caracteres Determinados Geneticamente, 191

15

Os Cromossomos Humanos, 203

16

A Anlise Molecular do DNA para Diagnstico e Prognstico, 215


de Doenas Genticas

Marlia de Arruda Cardoso Smith


Spencer Luiz Marques Payo

Maria Isabel Melaragno


Bianca Borsatto

Gustavo Turecki

XX

17

A Anlise Bioqumica do Produto Gnico para o Diagnstico,


Prognstico e Tratamento de Doenas Genticas, 225
Ida Vanessa D. Schwartz
Carolina F. Moura de Souza
Roberto Giugliani

18

Terapia Gnica, 231

19

Gentica do Cncer, 245

Sang Won Han

Slvia Regina Caminada de Toledo

PARTE 3 MECANISMOS CELULARES E MOLECULARES


DA FARMACOLOGIA MDICA
Coordenadores: Antonio Jos Lapa e Rosely Oliveira Godinho

20

Mecanismos Celulares da Atividade Farmacolgica, 257

21

Simpatomimticos e Simpatolticos, 273

22

Colinomimticos e Colinolticos, 279

23

Bloqueadores da Transmisso Neuromuscular Esqueltica, 285

24

Anestsicos Locais, 289

25

Anti-hipertensivos, 293

26

Diurticos, 297

27

Antiarrtmicos, 301

28

Drogas Utilizadas na Insuficincia Cardaca, 305

29

Inibidores da Secreo cida e Drogas Antilcera Pptica, 309

Rosely Oliveira Godinho

Maria Christina Werneck de Avellar

Caden Souccar

Caden Souccar

Caden Souccar

Maria Teresa R. Lima-Landman

Maria Teresa R. Lima-Landman

Antonio Jos Lapa

Antonio Jos Lapa

Caden Souccar

XXI

30

Emticos, Antiemticos, Laxativos e Antidiarricos, 315

31

Andrgenos e Antiandrgenos, 319

32

Estrgenos/Antiestrgenos e Progestinas/Antiprogestina, 325

33

Antiinflamatrios Esteroidais e No-esteroidais, 337

34

Analgsicos Opiides, 343

35

Ansiolticos, 349

36

Antipsicticos, 353

37

Antiepilpticos, 357

38

Antidepressivos, 361

XXII

Caden Souccar

Maria Christina Werneck de Avellar

Catarina Segreti Porto

Maria Salete de Abreu Castro


Rosely Oliveira Godinho

Maria Salete de Abreu Castro

Thereza Christina Monteiro de Lima

Thereza Christina Monteiro de Lima

Thereza Christina Monteiro de Lima

Thereza Christina Monteiro de Lima

BIOMOLCULAS

Cap.

Biomolculas
Lucia O. Sampaio
Leny Toma
Yara M. Micchelacci
Helena B. Nader
Marimlia A. Porcionato

Na natureza existem 81 elementos estveis,


estando apenas 15 deles presentes em todos os
seres vivos e sendo os mais abundantes o hidrognio, oxignio, carbono e nitrognio.
Como mostrado na Tabela 1.1, se descontarmos a gua que corresponde a 70% do peso total
do corpo humano, a composio de tomos no
organismo bastante diferente da encontrada na
crosta terrestre e na gua do mar. Todos os seres
vivos apresentam uma composio de elementos
bastante semelhante, que se mantm praticamente
constante durante a vida dos organismos e que
difere consideravelmente do meio que os cercam. A Tabela 1.1 tambm nos mostra que, excluindo-se as molculas de gua, o hidrognio e
o carbono so responsveis por aproximadamente 80% dos tomos que constituem o ser humano, sendo esta tambm a constituio de todos
os organismos vivos. A predominncia do carbono na matria viva sem dvida o resultado
da tremenda versatilidade qumica deste tomo
quando comparado com os outros elementos.
O carbono tem a habilidade singular de formar
um infinito nmero de compostos, como resultado de sua capacidade de fazer quatro ligaes
covalentes estveis (incluindo simples, dupla e
tripla ligaes) combinada a sua habilidade de

formar cadeias (C-C) de extenso ilimitada (lineares, ramificadas ou cclicas). Assim, dos mais
de 10 milhes de compostos qumicos conhecidos at o momento, quase 90% so substncias
orgnicas, isto , que contm tomos de carbono em sua estrutura. A qumica dos organismos vivos est, portanto, organizada ao redor
do elemento carbono que corresponde a aproximadamente 60% do peso seco (38% do total de
tomos) das clulas.
Aos esqueletos de carbono, podem estar ligados conjuntos de tomos com caractersticas peculiares, chamados grupos funcionais.
Os grupos funcionais conferem s molculas a
que esto ligados propriedades qumicas diferentes. A Fig. 1.1 representa os principais grupos funcionais encontrados nas biomolculas,
que podem ser multifuncionais, ou seja, apresentarem dois ou mais grupos funcionais em
sua estrutura.
As molculas orgnicas nos organismos vivos so geralmente grandes e formadas de um
conjunto de molculas menores ligadas entre
si formando as chamadas macromolculas. Os
seres vivos so constitudos basicamente de
quatro tipos de macromolculas:

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Tabela 1.1
Composio do Corpo Humano, Crosta Terrestre
e gua do Mar
Corpo
Humano

Crosta
Terrestre

gua do
Mar

70

96

% H2O*

% de tomos**
H

41

47

Cl

49

38

Si

28

Na

42

Al

Mg

Fe

Ca

cA

Ca

outros 11

outros 9

outros 1

*Valores dados como porcentagem do peso total.


**Valores dados como porcentagem do total de tomos
excluindo-se os constituintes das molculas de gua.

1. Protenas (polipeptdeos) polmeros de


aminocidos.
2. Carboidratos (acares) monossacardeos e polmeros de monossacardeos.
3. Lipdeos macromolculas hidrofbicas
contendo longas cadeias (lineares ou cclicas) de hidrocarboneto na forma de
cido graxo ou isoprenides e derivados.
4. cidos nuclicos polmeros de nucleotdeos (sero tratados em captulo especfico)

AMINOCIDOS E PROTENAS
Protenas so as macromolculas mais abundantes da clula, sendo formadas por uma longa
cadeia de aminocidos unidos entre si por ligaes peptdicas.

Aminocidos
So os blocos constituintes das protenas e
se caracterizam por apresentarem dois grupos
funcionais ligados ao mesmo carbono (carbono
): uma amina e uma carboxila. A Fig. 1.2 mostra a estrutura geral de um aminocido, e a Fig.
1.3 mostra a estrutura da glicina (nico aminocido que no apresenta um grupo R no car-

Fig. 1.1 Principais grupos funcionais encontrados nas


biomolculas. Todos os grupos esto mostrados em sua forma no-ionizada.

bono ) e da prolina (nico aminocido que no


possui um grupo amina ligado ao carbono ).
A identidade e as propriedades qumicas de cada
aminocido so determinadas pela natureza da
cadeia lateral (grupo R) covalentemente ligada ao carbono . Dependendo do tipo do grupo
R ligado, podemos encontrar na natureza 20
diferentes aminocidos. A Fig. 1.4 nos mostra
esses aminocidos classificados segundo a polaridade de seus grupos substituintes.

Isomeria ptica dos Aminocidos


Com exceo da glicina, o carbono de
todo aminocido assimtrico, ou seja, est ligado a quatro diferentes grupos de tomos (grupo
amina, grupo carboxila, grupo R e hidrognio). Um carbono assimtrico determina a isomeria ptica de um composto, que pode,
portanto, se apresentar sob duas formas opticamente ativas: ismero D ou ismero L.
Estes ismeros so imagens especulares um do
outro e tm a caracterstica de desviar o plano
da luz polarizada para lados opostos. Se, por
exemplo, o ismero L desvia a luz polarizada
de x graus para a esquerda, o ismero D desviar este plano para a direita com um ngulo
do mesmo valor.
Por conveno, quando um aminocido
colocado com sua carboxila para cima e gru-

BIOMOLCULAS

Cap.

Fig. 1.2 Estrutura geral de um aminocido. Todos os


aminocidos (com exceo da prolina) tm a mesma estrutura geral, isto , que apresentam 1 amina (NH2) e 1
carboxila (COOH) ligadas ao mesmo carbono (carbono
), diferindo apenas no que diz respeito constituio do
grupo R. Em pH fisiolgico, a amina e a carboxila encontram-se na forma protonada (+) e desprotonada (-),
repectivamente.

po R para baixo, dizemos que este aminocido D quando sua amina est representada
para direita e L quando est para a esquerda
(Fig. 1.5).
Os aminocidos que ocorrem nas protenas
so todos da forma L, embora existam na natureza alguns D aminocidos, como, por exemplo, os presentes na parede celular de bactrias
e alguns antibiticos.
O nmero de ismeros pticos (I) de um composto orgnico depende do nmero de carbonos
assimtricos (n) da molcula I =2n.
Entre os 20 aminocidos existentes, apenas
dois deles tm outro carbono assimtrico alm
do carbono : a treonina e a isoleucina. Estes
aminocidos apresentam um segundo carbono
assimtrico (o carbono ) e portanto podem existir sob a forma de 22=4 ismeros pticos: dois
ismeros D (D-Ile/Thr e D-allo-Ile/Thr) e
dois ismeros L (L-Ile/Thr e L-allo-Ile/Thr).
A Fig. 1.6 mostra a representao dos ismeros
pticos de trs diferentes aminocidos incluindo os da isoleucina.

Fig. 1.3 Estrutura da glicina que no apresenta um grupo R substituinte e da prolina que o nico aminocido
cujo carbono se liga a um grupo imida, em vez de amina
(grupo R ligado a amina e gerando um grupo imida).

Ligao Peptdica
Para formar protenas os aminocidos devem se unir entre si atravs de ligaes covalentes, resultantes de uma reao de desidratao
envolvendo o grupo amino de um aminocido e
o grupo carboxila do outro. A Fig. 1.7 representa de forma esquemtica a unio entre dois aminocidos formando um dipeptdeo.
Na ligao peptdica a ligao covalente C-N
usualmente representada por uma simples ligao, mas apresenta caractersticas de dupla
(C = N) em decorrncia da ressonncia de um
par de eltrons que , na realidade, compartilhado pelos tomos de nitrognio e oxignio como
mostrado na Fig. 1.8a. Como resultado da ressonncia entre as duas formas, e a conseqente caracterstica de dupla, a ligao peptdica planar
e rgida, apresentando, entretanto, livres rotaes
ao redor dos eixos Ca-C (ngulo ) e N-Ca (ngulo ), como esquematizado na Fig. 1.8b. Como
conseqncia dos diferentes ngulos de toro (
e ) que os eixos rotatrios podem assumir, os
planos de duas ligaes peptdicas consecutivas
podem sofrer deslocamentos variveis sendo, entretanto, algumas conformaes estericamente
proibidas. Os valores normalmente permitidos

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Fig. 1.4 Grupo R dos 20 aminocidos mais comuns classificados segundo sua polaridade em quatro classes.

Fig. 1.5 Isomeria ptica de um aminocido. Com exceo da glicina, o carbono de todo aminocido assimtrico (*)
e pode, portanto, se apresentar sob duas formas opticamente ativas: ismero D ou ismero L. Estes ismeros so imagens
especulares um do outro e tm a caracterstica de desviar o plano da luz polarizada para lados opostos. Por conveno,
quando desenhamos o aminocido como na figura (COOH para cima e R para baixo) representamos a forma D com
o grupo NH2 (n) para direita e L com o NH2 para a esquerda.

BIOMOLCULAS

Cap.

Fig. 1.6 Representao dos ismeros pticos da srie D e Lda valina, leucina e isoleucina. A valina e a leucina tm
apenas um carbono assimtrico (Ca) e, portanto, dois ismeros pticos (D e L), sendo um a imagem especular do outro
(enantimeros). A isoleucina tem dois carbonos assimtricos (Ca e Cb) e quatro ismeros pticos: D-Ile, L-Ile (enantimeros), D-allo-Ile e L-allo-Ile (enantimeros).

Protenas
So polmeros de aminocidos covalentemente ligados entre si por ligaes do tipo amida, envolvendo a amina de um resduo e a
carboxila do outro. So, portanto, constitudas
de uma cadeia de ligaes peptdicas (regies
planares) unidas umas s outras atravs de tomos de carbono (Ca) ao qual tambm esto ligadas as chamadas cadeias laterais (grupos
R) dos diversos aminocidos (Fig. 1.10).
As protenas ou peptdeos so usualmente
representados como uma seqncia linear dos
aminocidos que a constituem na ordem correta, iniciando pela extremidade aminoterminal (aminocido que contm o grupo -NH2
livre) e terminando com a carboxiterminal (aminocido que contm o grupo -COOH livre).
Fig. 1.7 Formao de uma ligao peptdica entre dois
aminocidos envolvendo a carboxila do aminocido 1 e a
amina do aminocido 2 numa reao de desidratao.

para os dois ngulos de toro esto limitados a


trs pequenas regies, como mostra o mapa conformacional esquematizado na Fig. 1.9 (diagrama de Ramachandran).

A estrutura primria do citocromo c humano (104 resduos) est abaixo representada utilizando-se para os aminocidos a abreviao de
uma letra:
H2N-GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAA
NKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE-COOH

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Fig. 1.8 Caractersticas da ligao peptdica: a) estrutura de ressonncia do par de eltrons entre o tomo de oxignio e de nitrognio b) plano da ligao amida e pontos
de rotao entre esse plano e dois carbonos consecutivos: rotao no eixo C C=O () e eixo C N ().

seqncia de aminocidos que caracteriza


uma determinada protena damos o nome de estrutura primria.

Fig. 1.9 Diagrama de Ramachandran. ngulos de toro e estericamente permitidos para a polialanina
(retngulos amarelos) e estruturas secundrias mais comumente encontradas nas protenas (crculos verdes): hlice (). folha -pregueada paralela (2) e antiparalela
(1). hlice do colgeno (C).

por resduos similares (ex.: GluAsp, LysArg,


LeuIle etc.).

Conformao

Para um mesmo indivduo, a seqncia de


aminocidos de uma determinada protena
sempre a mesma e o molde que codifica essa
estrutura primria est guardado no ncleo da
clula como molculas de cido desoxirribonuclico (DNA).

As cadeias polipeptdicas podem assumir


diferentes arranjos espaciais, enrolando-se e/ou
dobrando-se em estruturas tridimensionais que
podem ser descritas levando-se em conta dois
aspectos: 1) estrutura secundria e 2) estrutura
terciria.

Dentro da mesma espcie, entretanto, a estrutura primria de uma protena nem sempre
totalmente invarivel. Aproximadamente 25% das
protenas humanas so polimrficas, ou seja,
apresentam dentro da populao alguma variao na seqncia de seus resduos sem prejuzo
da funo.

A estrutura secundria de uma protena


pode ser entendida como o arranjo no espao
dos tomos que formam a cadeia peptdica propriamente dita (...CaCONHCa...),
e a conformao das cadeias laterais (grupos
R) dos aminocidos no faz parte desta estrutura. Vrios tipos de estruturas secundrias
podem ocorrer nas protenas, mas as mais freqentemente encontradas so trs: -hlice (),
folha -pregueada () e hlice do colgeno (C).
Esses trs arranjos secundrios formam estruturas peridicas que se repetem a intervalos regulares de 5.4(), 7.0() e 86.1(C) angstrons e
que ocorrem a cada 3.6(), 2.0() e 30.0(C)
resduos.

Entre diferentes espcies encontramos, muitas vezes, protenas homlogas, que desempenham geralmente a mesma funo, como o caso
da citocromo c. A estrutura primria desta protena foi determinada em mais de 50 espcies
animais e/ou vegetais, sendo verificado que aproximadamente 30% de seus resduos so invariveis (aminocidos iguais na mesma posio em
relao ao polmero). Mesmo entre os aminocidos que variam, muitos deles so substitudos

As Figs. 1.10 e 1.11 mostram esquematicamente a estrutura de uma cadeia polipeptdica


arranjada em -hlice e folha -pregueada

BIOMOLCULAS

Cap.

Fig. 1.10 Cadeia polipeptdica. Polmero de aminocidos unidos por ligaes peptdicas em uma determinada seqncia.

(a estrutura do colgeno no ser discutida neste captulo).


Na -hlice a cadeia contendo as ligaes
peptdicas est enrolada como numa espiral sendo cada volta constituda por 3,6 resduos de
aminocidos e a distncia entre cada elo (passo
da hlice) de 5.4A. A estrutura estabilizada por
pontes de hidrognio de 2.8A envolvendo o oxignio da carbonila (C=O) de uma ligao peptdica e o hidrognio da amida (NH) de outra
ligao peptdica distante quatro resduos na seqncia da cadeia.
Com relao aos ngulos de toro, como
vimos no diagrama de Ramachandran da Fig.
1.10, a -hlice apresenta f= 57 e y= 47. Os
grupos R dos aminocidos, como dissemos,
no tm participao direta na formao da
-hlice e esto todos voltados para o lado externo da espiral como mostra a Fig. 1.11.
Na folha -pregueada a cadeia contendo as
ligaes peptdicas est dobrada numa estrutura
em ziguezague, sendo cada prega constituda
por 2.0 resduos de aminocidos e a distncia
entre duas arestas do mesmo lado de 7.0 (Fig.
1.11). A formao -pregueada tambm estabilizada por pontes de hidrognio que ligam regies da cadeia polipeptdica, que podem estar
associadas num arranjo paralelo (pontes ligam
regies que correm na mesma direo) ou antiparalelo (pontes ligam regies que correm em
direes opostas). A Fig. 1.12 mostra a disposio das pontes de hidrognio nos arranjos paralelo e antiparalelo que apresentam em relao
cadeia peptdica uma orientao perpendicular
(ponte medindo 3.3 ) e oblquo (ponte medindo 3.5 ) respectivamente. Com relao aos ngulos de toro, temos para a conformao
-pregueada paralela os valores de = 119 e
= +113, e para a antiparalela = 139 e =
+135. Os grupos R dos aminocidos esto orientados perpendicularmente ao plano da folha

Fig. 1.11 Estrutura secundria das protenas . Os planos formados pelos tomos que constituem as ligaes peptdicas podem sofrer deslocamentos uns em relao aos
outros, formando diferentes arranjos entre os quais os mais
freqentes so os conhecidos como -hlice (formao em
espiral) e folha -pregueada (formao em ziguezague). A
figura nos mostra um esquema dessas configuraes sob
dois ngulos.

dobrada, estendendo-se alternadamente para os


lados opostos deste plano (Fig. 1.11).
Uma nica cadeia protica pode apresentar
uma ou mais tipos de estrutura secundria. Embora existam protenas globulares constitudas
apenas de -hlice (mioglobina, citocromo c) ou
folha -pregueada (concanavalina A), a maioria
delas apresenta ambas as estruturas na mesma

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

molcula (em mdia 31% de -hlice e 28% de


folha -pregueada).
Tomando-se como exemplo uma protena genrica constituda de 150 aminocidos (aproximadamente 15.000 Da), e considerando-se as
dimenses de -hlice e de folha -pregueada ilustradas na Fig. 1.11, podemos estimar que o comprimento dessa protena esticada seria:
Se constituda apenas de -hlice 1,46
angstrons por resduo (5,4/3,7) x 150 resduos = cadeia de 219 angstrons de comprimento.
Se constituda apenas de folha -pregueada 3,50 angstrons por resduo (7/2) x
150 resduos = cadeia de 525 angstrons de
comprimento.
Se constituda de 50% de regies em -hlice e 50% em folha -pregueada = cadeia de 372 angstrons de comprimento.
A maioria das protenas contendo de 100 a
200 aminocidos, entretanto, mede aproximadamente apenas 30 angstrons, o que implica que
essas cadeias encontram-se dobradas sobre si
mesmas formando uma espcie de novelo ou
glbulo. As protenas, portanto, independentemente de sua estrutura secundria podem se
apresentar de forma fibrilar (esticada) ou globular (dobrada). A Tabela 1.2 nos mostra alguns
tipos de protenas e suas dimenses estimadas
(quando totalmente esticadas) e reais.
A maneira com que a estrutura secundria
de uma protena se arranja no espao tridimensional conhecida como estrutura terciria. Estrutura terciria de uma protena, portanto, o
arranjo tridimensional de todos os tomos da
protena, incluindo os da cadeia lateral e qualquer outro grupo prosttico (outros tomos ligados protena que no so aminocidos).
Algumas das interaes entre cadeias laterais de
aminocidos esto representadas na Fig. 1.13 e

Fig. 1.12 Pontes de hidrognio que estabilizam as conformaes em -hlice e folha -pregueada. A estrutura
secundria de uma protena estabilizada por pontes de
hidrognio. As -hlice so geralmente enroladas para direita (d), mas tambm podemos ter o sentido inverso (e). As
folhas -pregueada podem se associar de forma paralela (a
com b) ou antiparalela (b com c) sendo a conformao paralela menos estvel (pontes de hidrognio mais distorcidas).

so muito importantes na determinao do arranjo tercirio da cadeia protica.

Interao Entre Protenas


Duas ou mais cadeias peptdicas podem interagir entre si formando agregados moleculares (oligmeros). As vrias molculas proticas
que constituem o complexo multimrico se unem
atravs de ligaes no-covalentes como s representadas na Fig. 1.13, que se estabelecem en-

Tabela 1.2
Estrutura
Secundria
-hlice

No de
Resduos

Tamanho
Estimado

500

730

Tamanho real
Fibrilar

Globular

-queratina 700

Actina 40
Tubulina 40

folha -pregueada

10

250

875

Fibrona da seda 900 Concanavalina A 40

BIOMOLCULAS

tre as subunidades (interaes intermoleculares).


Ao arranjo formado pela interao entre as diversas subunidades de um oligmero d-se o
nome de estrutura quaternria. O nmero de cadeias proticas de um oligmero pode variar (ex.:
lcool desidrogenase = 2, aldolase = 3, piruvato
quinase = 4 insulina = 6 glutamina sintetase =
12, apoferrina = 24), e as subunidades que o
constituem podem ser todas iguais (lactato desidrogenase = 4) ou diferentes (hemoglobina =
2+2). A Fig. 1.14 mostra o exemplo de um
heterodmero.

gao (estrutura 4ria) de cadeias proticas podem ser, portanto, facilmente desfeitas. A perda
da estrutura tridimensional de uma protena
acompanhada pela perda de sua atividade biolgica, sendo esse processo conhecido como desnaturao (Fig. 1.16).
As protenas podem ser desnaturadas de vrias maneiras: calor, variao de pH, variao
da fora inica do meio, uso de detergentes
(desfazem foras hidrofbicas) e outros reagentes como uria e cloreto de guanidina (desfazem pontes de hidrognio). Se o meio volta s

Fig. 1.13 Foras que estabilizam a estrutura terciria e quaternria de protenas atravs do grupo R (cadeias laterais) de
seus aminocidos.

Em resumo, a maneira com que a cadeia de


aminocidos de uma determinada protena (estrutura primria) se enrola e se dobra (estruturas secundrias e tercirias), e a forma com que
duas ou mais dessas cadeias podem interagir para
formar agregados (estrutura quaternria) esto
esquematicamente representadas na Fig. 1.15.

Desnaturao de Protenas
A estrutura primria de uma protena depende da formao de ligaes peptdicas, que so
covalentes. As estruturas secundrias, tercirias
e quaternrias dessas cadeias, entretanto, so
mantidas atravs de foras fracas (no covalentes) como, por exemplo, pontes de hidrognio,
atraes eletrostticas, interaes hidrofbicas,
pontes com ons metlicos de coordenao etc.
A conformao (estrutura 2ria e 3ria) e a agre-

Subunidade

Subunidade
C
N

H
C

C
N
N
C
Protena oligomrica
(heterodmero)
Fig. 1.14 Estrutura quaternria de uma protena oligomrica constituda de duas cadeias proticas diferentes. As
subunidades so unidas por ligaes fracas (no-covalentes) e podem ser dissociadas facilmente.

11

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Fig. 1.15 Conformao de uma protena. A cadeia protica formada por uma seqncia de aminocidos ligados
covalentemente (estrutura primria), que pode se enrolar de vrias maneiras (estrutura secundria) sendo os arranjos mais
estveis os conhecidos como -hlice e folha -pregueada (a mesma cadeia pode conter estruturas secundrias diferentes, em
diferentes regies). O arranjo secundrio pode permanecer linear como um bastonete (forma fibrilar) ou dobrar-se vrias
vezes sobre si mesmo como num novelo (forma globular). A maneira como a estrutura secundria se arranja no espao
formando bastes ou novelos constitui a estrutura terciria de uma protena. Uma ou mais cadeias proticas podem, eventualmente, formar agregados funcionais, sendo o arranjo conformacional resultante desta interao intermolecular conhecido
como estrutura quaternria.

condies fisiolgicas, a protena desnaturada


pode tambm voltar sua conformao nativa
e, portanto, reaver sua atividade biolgica. Embora a renaturao de uma protena possa ser
conseguida espontaneamente in vitro, como
conseqncia da informao contida em sua
prpria estrutura primria, o dobramento de
uma protena na clula feito de forma diferente. Recentes estudos mostraram a existncia de uma famlia de protenas conhecida como
chaperones, que parecem ser essenciais para a
conformao e associao corretas das prote-

12

nas in vivo. Os chaperones, portanto, no s


aceleram certas etapas do dobramento, mas
tambm impedem e corrigem interaes incorretas ou prematuras.

CARBOIDRATOS
Carboidratos so as biomolculas mais
abundantes da Terra. O nome carboidrato (carbono hidratado) deriva de sua frmula emprica
(C H2O)n, onde n 3. Na realidade, podemos
definir carboidrato de forma mais precisa como

BIOMOLCULAS

Cap.

Fig. 1.16 Desnaturao de uma protena. A conformao espacial de uma protena (estrutrura secundria, terciria e
quaternria) estabilizada por foras fracas (no-covalentes) que podem ser dissociadas facilmente (variao de temperatura, pH, fora inica etc.) Este processo de desenrolamento, desdobramento e dissociao oligomrica conhecido
como desnaturao, e pode ser revertido se as condies do meio voltarem ao normal.

Fig. 1.17 Estrutura bsica dos carboidratos da srie das aldoses e cetoses. Os carboidratos possuem no mnimo trs
tomos de carbono, sendo um deles substitudo por uma carbonila e os outros por agrupamentos hidroxilas.

poliidroxialdedos ou poliidroxicetonas e substncias que, por hidrlise, geram estes compostos. A Fig. 1.17 ilustra a estrutura geral das
unidades bsicas de carboidrato, mostrando tratar-se de compostos contendo uma carbonila
(C=O) e pelo menos dois agrupamentos hidroxilas (-OH). A carbonila pode estar na forma de aldedo ou cetona, o que caracteriza as
duas principais sries de acares: as aldoses e
as cetoses, respectivamente. Por conveno os
carbonos que constituem as unidades de car-

boidratos so numerados a partir do terminal


mais prximo da carbonila. No caso das aldoses, portanto, o carbono da carbonila sempre
o nmero 1, e no caso das cetoses, sempre o
nmero 2.
Como j vimos, o menor carboidrato deve
conter pelo menos trs tomos de carbonos
(treose), sendo as hexoses (C=6) os acares
mais abundantes na natureza. A Fig. 1.18 nos
mostra o nome dos acares contendo trs, quatro, cinco e seis carbonos das duas sries. As di-

13

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Fig. 1.18 Tipos de grupos R que podem substituir a estrutura bsica das aldoses e cetoses representadas na Fig. 1.17,
e nome dos carboidratos encontrados em cada classe.

Fig. 1.19 Isomeria ptica das treoses. O nico acar que no possui isomeria ptica a cetotreose (diidroxicetona)
pois no possui carbono assimtrico. A aldotreose (gliceraldedo), por outro lado, possui 1carbono assimtrico (*) e portanto pode se apresentar sob duas formas opticamente ativas: ismero D e ismero L. O D e o L -gliceraldedo so imagens
especulares um do outro e tem a caracterstica de desviar o plano da luz polarizada com a mesma intensidade mas para
lados opostos. No caso do gliceraldedo, o ismero D desvia a luz polarizada para a direita (dextrgero) e o L para a
esquerda (levrgero).

14

BIOMOLCULAS

ferenas estruturais entre os compostos da mesma classe (mesma srie e mesmo nmero de carbonos) sero analisadas aps o entendimento da
estereoqumica das unidades bsicas que constituem os carboidratos.

Estereoqumica dos Carboidratos


(isomeria ptica)
Como vimos anteriormente quando nos referimos aos aminocidos, um carbono assi-

mtrico (ligado a quatro diferentes grupos de


tomos) determina a isomeria ptica de um
composto.
Na Fig. 1.19 temos representados os dois
carboidratos mais simples, ou seja, a aldotreose (tambm conhecida como gliceraldedo) e a
cetotreose (diidroxicetona). Ao analisarmos
suas frmulas estruturais, vemos que apenas o
gliceraldedo apresenta carbono assimtrico (o
carbono no 2), podendo, portanto, apresentar
isomeria ptica.

Fig. 1.20 Isomeria ptica das hexoses. As aldo-hexoses possuem quatro carbonos assimtricos* e, portanto, podem-se
apresentar sob 16 formas opticamente ativas, sendo oito na forma D (hidroxila de C-5 voltada para direita) e oito na forma
L (hidroxila de C-5 voltada para esquerda). A posio relativa das demais hidroxilas dos carbonos assimtricos (C-2, C-3,
C-4) determina os outros ismeros pticos da aldo-hexose (glicose, manose, galactose, idose, alose altrose, gulose e
talose). As ceto-hexoses posuem trs carbonos assimtricos (oito estereoismeros), sendo metade deles da forma D e a
outra metade na forma L (OH de C-5 para a direita e esquerda, respectivamente). A posio das hidroxilas dos carbonos
C-3 e C-4 define os outros ismeros (frutose, psicose, sorbose e tagatose).

15

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Por conveno, quando a frmula de um


acar representada na forma vertical, com
o carbono nmero 1 para cima, dizemos que
este ismero D quando a hidroxila do ltimo carbono assimtrico est voltada paro o
lado direito e L quando est para a esquerda. No caso do gliceraldedo, o ltimo carbono assimtrico (C-2) tambm o nico e
temos, portanto, apenas dois ismeros pticos (2n = 21 = 2): o D-gliceraldedo e o Lgliceraldedo.
Se analisarmos agora os acares contendo
seis tomos de carbono (Fig. 1.20) notaremos
que as aldexoses apresentam quatro carbonos
assimtricos (16 ismeros pticos), e que as
cetexoses apresentam apenas trs (oito ismeros pticos). Metade destes ismeros pertence
srie L, pois apresentam a hidroxila do ltimo carbono assimtrico (C-5) voltada para a
esquerda, e a outra metade srie D (OH de
C-5 para a direita).
Dentro de cada srie de hexoses (L ou D),
as hidroxilas dos demais carbonos assimtricos
podem tambm estar voltadas para direita ou
esquerda, e em cada caso temos um tipo de ismero diferente. As aldexoses podem, portanto,
dependendo da posio das hidroxilas de seus
carbonos assimtricos, se apresentar sob a forma
de ismeros D ou L de oito tipos de acares:
glicose, manose, altrose, idose, alose, gulose,
galactose e talose. No caso das cetexoses temos,
para cada srie (D ou L), quatro ismeros diferentes: frutose, psicose, sorbose e tagatose. A
Fig. 1.21 nos mostra os ismeros pticos da
srie D das aldo e cetexoses e as posies relativas de seus OH em relao molcula da glicose e frutose, respectivamente. A cada um dos
ismeros da srie D temos um correspondente
ismero na srie L, resultando num total de 16
espcimes opticamente ativas de aldexoses e oito
de cetexoses.
Seguindo-se o mesmo raciocnio temos 12
ismeros pticos para as pentoses (forma D e
L da ribose, arabinose xilose, lixose ribulose e
xilulose) e seis para as tetroses (forma D e L
da eritrose, treose e eritrulose).
Com rarssimas excees (cpsula das bactrias, por exemplo), os carboidratos encontrados na natureza so da forma D.

16

Estrutura Cclica dos Acares


(Formas Anomricas)
Em soluo aquosa e pH neutro, menos de
0,1% das molculas de acar est com seus
grupos carbonila livres.
Nestas condies e a partir de um determinado nmero de carbonos, a carbonila tende a
reagir com uma das hidroxilas da mesma molcula do acar formando uma estrutura cclica
chamada hemiacetal. As carbonilas (C-1 das aldoses e C-2 das cetoses) tendem a reagir com
hidroxilas dos carbonos C-4 ou C5, formando,
portanto, anis de cinco ou seis elementos. A
Fig. 1.22 nos mostra a ciclizao da D-glicose,
na qual a carbonila de C-1 reage com a hidroxila de C-5 formando um anel de seis membros, contendo cinco carbonos e um oxignio.
Ao se estabelecer a ligao carbonila-hidroxila,
cria-se um novo carbono assimtrico na molcula (C-1), e a D-glicose pode se apresentar,
agora, sob a forma de 32 estereoismetros (2n
= 25 = 32). No momento em que o acar se
cicliza, a hidroxila criada a partir da antiga carbonila pode ficar de um lado ou outro da molcula, formando, portanto, ismeros do tipo
(OH de C-5 para direita) ou (OH de C-5
para esquerda). Os ismeros pticos do tipo
/ s aparecem quando a cadeia est fechada
e so conhecidos como anmeros, pois sua conformao diz respeito posio relativa da hidroxila do carbono anomrico, que vem a ser o
antigo carbono da carbonila na cadeia aberta.
Os acares quando na forma aberta so
apresentados na frmula de projeo de Fischer
(cadeia linear posicionada verticalmente com a
carbonila para cima) e quando ciclizados so
normalmente representados na frmula de projeo de Haworth. As regras para converso da
frmula de Fischer para a frmula de Haworth
esto sumariadas na Fig. 1.23.
A Fig. 1.24 mostra como representar a estrutura da D- e L-glicose na frmula de projeo de Fischer e de Haworth, e a Fig. 1.25 nos
mostra estas mesmas frmulas para D-ribose e
D-frutose.
importante mencionar que, para maior
simplicidade, a frmula de projeo de Haworth
considera os anis do anel formado na ciclizao dos acares como planares, o que no acon-

BIOMOLCULAS

Cap.

Fig. 1.21 Aldo e ceto-hexoses da srie D. A D-glicose o composto orgnico mais encontrado na natureza (como
polmeros de celulose e amido) e, portanto, definiremos todas as hexoses a partir dela. A D-glicose : uma aldo-hexose
6 carbonos, sendo o carbono 1 um aldedo e os outros substitudos por hidroxilas, est na forma D hidroxila de C-5
(carbono assimtrico mais distante da carbonila) para a direita glicose tem o C-2 e C-4 do mesmo lado de C-5 e C3 do lado oposto. Se, a partir da D-glicose, invertemos apenas a hidroxila de C-2, temos a D-manose; se invertermos C-2
e C-3, temos a altrose; se invertemos C-2, C-3 e C-4 teremos a D-idose e assim por diante. A D-frutose o acar mais
comum entre as cetoses e um ismero de funo da D-glicose (a carbonila passa e C-1 para C-2 transformando o grupo
aldedo em cetona). A partir da D-frutose podemos, alterando-se a posio relativa dos OH de C-3 e/ou C-4, obter as
outras ceto-hexoses. Para se transformar qualquer acar da forma D em L necessrio inverter os OH de todos os
carbonos assimtricos, gerando uma estrutura que a imagem especular da anterior e que, portanto, desvia o plano da luz
polarizada com a mesma intensidade, porm em sentidos opostos.

tece nem para as piranoses nem para as furanoses.

Mutarrotao e Poder Redutor


dos Acares
Como j foi dito, quando em soluo, menos de 1% das molculas de acar est na forma aberta. A imensa maioria delas assume a
forma hemiacetlica (cclica), entretanto, as formas e no esto fixadas na molcula. As duas
formas esto sempre se interconvertendo uma
na outra num processo dinmico conhecido
como mutarrotao. A glicose, por exemplo,
quando em soluo aquosa em pH neutro, atin-

ge o equilbrio apresentando a seguinte proporo de suas formas anomricas:


D-glicose

D-glicose

D-glicose

33%

< 1%

33%

A proporo da mistura de anmeros na soluo varia com o tipo de acar e com as condies do meio (solvente, pH, temperatura etc.).
Esta interconverso das formas anomricas possvel graas abertura da cadeia, pois
quando a ligao hemiacetlica se desfaz, o
carbono anomrico perde a assimetria, pode

17

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Fig. 1.22 Ciclizao da D-glicose (reao hemiacetal intramolecular). Quando em soluo, a D-glicose se cicliza
atravs de uma reao hemiacetlica entre a carbonila e a hidroxila de C-5. Neste processo o carbono 1 passa a ter
assimtrico e portanto, os 16 ismeros identificados na forma aberta do acar podem agora se apresentar como duas
estruturas diferentes apresentando atividades pticas distintas. Essas duas novas formas isomricas ( e ) criadas como
conseqncia da reao hemiacetlica intramolecular so chamadas de enntiomeros. Se no momento da ciclizao o OH
do novo carbono assimtrico (C-1) estiver voltado para a direita, teremos o ismero e em caso contrrio o ismero .

se virar e, eventualmente, refazer a ciclizao


com a hidroxila voltada para o outro lado. Se,
no entanto, o OH do carbono anomrico (na
forma cclica ou ) reagir e se ligar a um
radical qualquer, o anel fica trancado numa
forma anomrica especfica. Nesta condio
(OH do carbono assimtrico substitudo por
um grupo qualquer), no existe mais mutarrotao e o acar assume uma forma anomrica fixa. O grupo substituinte pode ser de
natureza varivel, como, por exemplo, outro
acar; uma protena; um lipdeo; grupos
metil, fenil, sulfato, fosfato etc.
Ao se bloquear a abertura do acar, o grupo carbonila passa a no existir na soluo e,
portanto, sua antiga capacidade redutora desaparece. As unidades bsicas dos acares quando em sua forma no-substituda so redutoras,
isto , seus grupos aldedo ou cetona quando
expostos na forma aberta do acar tm a capacidade de se oxidar a cido carboxlico, liberando eltrons (carbonila carboxila+el) que
podem reduzir outros compostos. Quando o OH
do carbono anomrico reage de forma a se ligar
a outro agrupamento, o poder redutor do acar desaparece.

18

Derivados de Monossacardeos
Os acares estudados at agora (ver Fig.
1.18) so chamados de monossacardeos e constituem as unidades bsicas de todos os carboidratos encontrados na natureza. Na natureza esses
monossacardeos podem se apresentar na forma
pura, ou seja, contendo apenas carbono oxignio e hidrognio (frmula emprica [CH2O]n),
ou como derivados destas estruturas, nas quais
um ou mais grupos hidroxila so modificados
ou substitudos por outros grupos funcionais.
Alguns dos derivados mais comuns dos monossacardeos so os dioxi-acares, aminoacares, carboxi-acares e steres de acares. A
Fig. 1.26 define essas classes de derivados dando alguns exemplos.

Ligao Glicosdica
(Di, Oligo e Polissacardeos)
Os monossacardeos, ou derivados, podem
tambm ligar-se covalentemente uns aos outros
atravs de ligaes covalentes formando oligo ou
polissacardeos. A ligao entre os monossacardeos feita atravs de uma reao de condensa-

BIOMOLCULAS

Cap.

Fig. 1.23 Regras bsicas para converter acares da frmula de projeo de Fischer (cadeia aberta e horizontal) para
Haworth (representao na forma cclica).

o envolvendo o OH hemiacetlico do carbono


anomrico (C-1 das aldoses ou C-2 das cetoses)
de um acar e qualquer outra hidroxila alcolica
de outro resduo. Nesta reao, temos a eliminao de uma molcula de gua e a formao de
uma ligao covalente chamada de ligao glicosdica. A Fig. 1.27 nos mostra a formao de quatro dissacardeos, formados a partir de duas
molculas de D-glicose.
Ao se formar a ligao glicosdica, o OH do
carbono anomrico, envolvido na condensao,
fica fixo em uma forma especfica ( ou ), no
apresentando, portanto mutarrotao. Estando
impedido de abrir sua cadeia, este resduo deixa
de expor sua carbonila, perdendo desta forma, a

capacidade de oxidar outros compostos. O segundo resduo envolvido na ligao continua apresentando seu carbono anomrico no-substitudo
e, portanto, redutor. medida que mais monossacardeos vo sendo adicionados, mais ligaes
so formadas (envolvendo sempre o OH de um
carbono anomrico) e a cadeia formada apresentar em sua forma completa, um nico resduo
no substitudo. O terminal da cadeia que apresenta o resduo com carbono anomrico livre
denominado terminal redutor, sendo a outra extremidade chamada de terminal no-redutor.
A maioria dos carboidratos encontrados na
natureza ocorre como polissacardeos, ou seja,
polmeros de alto peso molecular. Eles tambm

19

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Fig. 1.24 Formas e da D-glicose hemiacetlica


representadas na frmula de projeo de Haworth. forma piranosdica anel de 6 elementos; isomeria D/L
D -grupo externo ao anel (C-6) para cima L -grupo externo ao anel (C-6) para baixo; isomeria / - OH
de carbono anomrico (C-1) no mesmo plano (cis) em relao a C-6; - OH de carbono anomrico (C-1) no plano
oposto (trans) em relao a C-6; outros OH de carbonos
assimtricos direita (Fischer) - para baixo (Haworth);
esquerda (Fischer) - para cima (Haworth). Note bem: para
se transformar um acar da forma D em seu enantimero
L (imagem especular), deve-se inverter as hidroxilas de todos os carbonos assimtricos (no basta mudar apenas a
hidroxila do ltimo carbono assimtrico).

so conhecidos como glicanos e diferem uns


dos outros quanto composio de seus monossacardeos, tamanho da cadeia e tipos de
ramificaes, se existentes. Os polissacardeos
podem conter apenas um tipo de monossacardeo (homopolissacardeos) ou apresentar diferentes acares em sua composio
(heteropolissacardeos). O tipo de ligao entre
os resduos tambm pode variar e a cadeia polimrica pode se apresentar na forma linear ou
ramificada. A Fig. 1.28 mostra a estrutura geral,
localizao preferencial e possvel papel biolgico dos principais polissacardeos encontrados na
natureza. Vrios polissacardeos se apresentam
ligados covalentemente a protenas ou lipdeos

20

Fig. 1.25 Formas D-ribose e D-frutose representadas na frmula de projeo de Fischer e Haworth. A ribose
e frutose se ciclizam na forma furanosdica, reagindo o carbono da carbonila com C4 e C-5, respectivamente.

formando uma classe de compostos conhecida


como glicoconjugados. Os proteoglicanos, glicoprotenas, peptideoglicanos, glicolipdeos e lipopolissacardeos so alguns dos representantes
destes carboidratos complexos. Maiores detalhes
sobre a caracterizao e o papel biolgico dos
glicoconjugados no sero apresentados neste
captulo.

LIPDEOS
Os lipdeos representam um grupo quimicamente diverso de compostos sendo a caracterstica comum entre eles sua insolubilidade
em gua. So, portanto, macromolculas hidrofbicas, contendo longas cadeias (lineares ou cclicas) de hidrocarboneto na forma de cido
graxo ou isoprenides e derivados.
Os lipdeos podem, devido a sua diversidade estrutural, ser classificados de vrias formas.
Em nossos estudos, dividiremos este grupo de
substncias hidrofbicas em duas classes principais: os formados a partir de cidos graxos (tri-

BIOMOLCULAS

Cap.

Fig. 1.26 Principais derivados de monossacardeos encontrados na natureza.

glicerdeos, fosfolipdeos, glicolipdeos e eicosanides), e os formados a partir de isoprenides


(terpenos lineares e colesterol). A Fig. 1.29 mostra a estrutura esquemtica dessas duas unidades bsicas que podem constituir as biomolculas
lipdicas. A longa cadeia de hidrocarboneto, presente tanto na estrutura dos cidos graxos quanto
nos poliisoprenides, confere a essas molculas
o carter hidrofbico que caracteriza os compostos lipdicos.

Lipdeos Formados a Partir


de cidos Graxos
Os cidos graxos so cidos carboxlicos
(carga negativa em pH fisiolgico) com longas
cadeias de hidrocarbonetos (caractersticas hidrofbicas), sendo, portanto, compostos anfipticos, isto , apresentam uma poro polar
(solvel em gua) e uma regio apolar (insol-

vel em gua). A cauda polar linear (cidos graxos ramificados s ocorrem em bactrias), constituda de um nmero par de carbonos, podendo
ou no apresentar insaturaes (duplas ligaes).
O nmero e a posio das insaturaes podem
variar, mas quando presentes assumem sempre
a configurao cis.
A Fig. 1.30 nos mostra uma relao dos
principais cidos graxos saturados e insaturados que ocorrem na natureza e a Fig. 1.31
apresenta, de forma esquemtica, a estrutura
de dois exemplos desses compostos.
Alguns cidos graxos poliinsaturados, necessrios para processos vitais da clula, no so
sintetizados em mamferos e devem, portanto,
ser ingeridos na dieta. Entre os cidos graxos
essenciais mais importantes esto o linoleico e
linolnico.
Os cidos graxos raramente so encontrados na forma livre, aparecendo geralmente na

21

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Fig. 1.27 Dissacardeos derivados da D-glicose. Quando duas molculas de monossacardeos se unem para formar um
dissacardeo, temos uma condensao entre o OH do carbono anomrico de um resduo e um OH alcolico do outro
resduo. No caso dos quatro dissacardeos aqui mostrados, a ligao glicosdica entre as duas molculas de D-glicose pode
envolver o carbono anomrico na forma a (maltose, isomaltose e trealose) ou b (celubiose), e o OH de C-4 (celubiose e
maltose), C-6 (isomaltose) ou C-1 (trealose). Celubiose: D-glicose (b14) D-glicose; Maltose: D-glicose (a14) Dglicose; Isomaltose: D-glicose (a16) D-glicose; Trealose: D-glicose (a1 a1) D-glicose; Outros dissacardeos importantes: Lactose: D-galactose (b14) D-glicose; Sacarose D-glicose (a1b2) D-frutose; Obs.: a frutose e a trealose so
dissacardeos sem poder redutor, pois a ligao glicosdica envolve o OH do carbono carbonlico de seus dois resduos.

forma esterificada. Na maior parte dos casos, os


cidos graxos se ligam s hidroxilas do glicerol
(acilglicerdeos) ou amina da esfingosina (esfingolipdeos).
Entre os lipdeos derivados do glicerol temos os triacilglicerdeos (lipdeos altamente hidrofbicos), e os fosfoacilglicerdeos (lipdeos
anfipticos). A Fig. 1.32 nos mostra os principais tipos de lipdeos derivados da esterificao
de cidos graxos e glicerol.

gtica de suas clulas. So estruturas formadas


de trs cidos graxos esterificados a uma nica
molcula de glicerol. Os cidos graxos que constituem estes compostos podem ser iguais (gorduras simples) ou diferentes (gorduras mistas).
Quando se estabelece a ligao ster entre a carboxila dos cidos graxos e hidroxilas do glicerol,
estes dois compostos perdem sua polaridade e
se transformam numa macromolcula hidrofbica, essencialmente insolvel em gua.

Triacilglicerdeos

In vitro, as gorduras podem ser quebradas


por hidrlise alcalina, num processo conhecido
como saponificao, liberando o glicerol e sais
de cidos graxos (sabes). Sendo de natureza
anfiptica, os sabes se ligam s gorduras atra-

Os triacilglicerdeos (gorduras neutras) so


os derivados do glicerol mais abundantes nos
animais e constituem a principal reserva ener-

22

BIOMOLCULAS

Cap.

Fig. 1.28 Principais polissacardeos encontrados na natureza.

Fig. 1.29 Estrutura esquemtica de um cido graxo e um terpeno. Os lipdeos podem apresentar em sua estrutura
molculas de terpenos e/ou cidos graxos, bem como derivados cclicos destes compostos. cidos graxos: so cidos
carboxlicos (carga negativa em pH fisiolgico) com longas cadeias de hidrocarbonetos (caractersticas hidrofbicas);
Terpenos: polmeros de isopreno (alcano insaturado e ramificado de cinco tomos de carbono) com caractersticas hidrofbicas.

vs de sua cauda polar e dissolvem na gua formando micelas.


In vivo, a hidrlise das gorduras so realizadas atravs de enzimas de especificidades diversas chamadas lipases.

Fosfoacilglicerdeos
Os fosfoacilglicerdeos (fosfoglicerdeos)
tambm so os derivados do glicerol que se liga,
neste caso, a duas molculas de cidos graxos e
uma molcula de cido fosfrico (Fig. 1.33). A

23

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

NOME

SMBOLO(1)

ESTRUTURA

12:0
14:0
16:0
18:0
20:0

CH3(CH2)10COOH
CH3(CH2)12COOH
CH3(CH2)14COOH
CH3(CH2)16COOH
CH3(CH2)18COOH

16:1 (9)
18:1 (9)
18:2 (9,12)
18:3 (9,12,15)
20:4 (5,8,11,14)

CH3(CH2)5CH=CH (CH2)7COOH
CH3(CH2)7CH=CH (CH2)7COOH
CH3(CH2)4(CH=CHCH2)2(CH2)6COOH
CH3CH2(CH=CHCH2)3(CH2)6COOH
CH3(CH2)4(CH=CHCH2)4(CH2)2COOH

cidos graxos saturados


cido lurico
cido mirstico
cido palmtico
cido esterico
cido araqudico
cidos graxos insaturados
cido palmitoleico
cido olico
cido linolico
cido linolnico
cido araquidnico

(1)X:Y (a). [no de carbonos: no de insaturaes (Dposio de insaturao)]


Fig. 1.30 cidos graxos biolgicos mais comuns. Os cidos graxos mais comumente encontrados nos lipdeos naturais
tm cadeias de 12 a 24 carbonos, sendo os nomes, frmulas e smbolos de alguns das estruturas mais freqentes relacionadas na figura acima. Nos cidos graxos insaturados, a primeira dupla fica entre o C-9 e C-10, e nos poliinsaturados as
vrias duplas so geralmente separadas umas das outras por trs tomos de carbono. As propriedades fsicas dos cidos
graxos esto largamente relacionadas com o tamanho e grau de insaturao de suas cadeias: solubilidade em gua:
inversamente proporcional ao tamanho da cadeia e diretamente proporcional ao no de insaturaes. ponto de fuso:
diretamente proporcional ao tamanho da cadeia e inversamente proporcional ao no de insaturaes.

de se ligar ao glicerol, pode tambm se esterificar com outro composto formando diferentes
tipos de fosfoacilglicerdeos: fosfatidilcolina (lecitina), fosfatidiletanolamina (cefalina), fosfatidilglicerol e difosfatidilglicerol (cardiolipina)
fosfatidilserina e fosfatidilinositol (Fig. 1.34). Em
cada um desses compostos, a composio de cidos graxos pode variar bastante, mas em geral
eles contm um cido graxo saturado na posio C-1 do glicerol e um insaturado em C-2. Os
fosfoacilgliceris so importantes componentes
das membranas biolgicas.
Fig. 1.31 Estrutura esquemtica do cido olico e esterico. Os dois cidos graxos aqui representados tm uma
cauda hidrofbica constituda de 18 tomos de carbono,
entretanto, a cadeia do cido esterico saturada e o do
cido olico insaturada (dupla entre carbono 9 e 10). Nos
cidos graxos saturados os carbonos da estrutura tm total
liberdade de rotao, resultando numa cadeia bastante flexvel e tendendo a adotar uma conformao linear. Ao contrrio, as cadeias insaturadas apresentam sua dupla ligao
usualmente na configurao cis, o que ocasiona uma dobra
na cadeia como mostrado no esquema.

estrutura formada (cido fosfatdico) tem caractersticas anfipticas, pois apresenta uma regio
polar (cido fosfrico) e uma hidrofbica (cauda dos cidos graxos). O cido fosfrico, alm

24

Entre os lipdeos derivados da esfingosina


temos as esfingomielinas e os glicolipdeos. A
Fig. 1.34 nos mostra a estrutura genrica destes
esfingolipdeos, comparando-se com os acilglicerdeos. A estrutura fundamental dos esfingolipdeos a ceramida, que formada por um
cido graxo ligada ao aminogrupo da esfingosina por uma ligao do tipo amida.
Nas esfingomielinas a hidroxila de C-1 da
ceramida se esterifica com um cido fosfrico,
que, por sua vez, tambm se liga a uma molcula de colina. A estrutura final se assemelha muito fosfatidilcolina, sendo estes dois fosfolipdeos
encontrados preferencialmente nas faces nocitollicas das membranas biolgicas.

BIOMOLCULAS

Cap.

Fig. 1.32 Lipdeos formados por steres de cidos graxos com glicerol. O glicerol um lcool contendo trs hidroxilas que podem se esterificar com cidos orgnicos
ou inorgnicos. No caso das gorduras (triglicerdeos) temos a ligao do lcool com trs cadeias de cidos graxos
que podem ser saturadas ou insaturadas, podendo ocorrer
em qualquer combinao. Ao se esterificar, a cabea polar
do cido carboxlico perde sua carga negativa e o triacilglicerdeo formado passa ento a apresentar caractersticas altamente hidrofbicas. Uma das hidroxilas do glicerol
pode, por outro lado, se esterificar com um cido fosfrico
formando agora o cido fosfatdeo e o lipdeo formado
passa a ter caractersticas anfipticas (cauda apolar constituda pelas duas cadeias de hidrocarboneto e cabea polar constituda do grupo fosfato). O grupo fosfato do cido
fosfatdico encontra-se geralmente esterificado a outros grupos polares (R) constituindo uma famlia de lipdeos conhecida como fosfoacilglicerdeos.

Glicolipdeos
Nos glicolipdeos a hidroxila de C-1 da ceramida se liga diretamente hidroxila do carbono anomrico do acar. Dependendo do tipo
de carboidrato unido ceramida, podemos ter
quatro tipos bsicos de glicolipdeos: cerebrosdeos (um monossacardeo neutro); sulfatdeos
(um monossacardeo sulfatado); globosdeos
(um oligossacardeo neutro) e gangliosdeos (um
oligossacardeo contendo um ou mais resduos
de cido silico).

Fig. 1.33 Os agrupamentos polares neutros ou carregados positivamente que podem se esterificar ao cido fospatdico formando os vrios tipos de R-fosfoacilglicerdeos.

Eicosanides
Uma outra classe de lipdeos formada a partir de cidos graxos a dos eicosanides, que
constituem um importante grupo de mediadores com efeitos diversos. Os eicosanides
so todos derivados do cido araquidnico, um
cido graxo poliinsaturado de 20 tomos de carbono (grego: eikosi = 20). A sntese destes compostos comea na membrana plasmtica, onde
a fosfolipase A2 hidrolisa a liberao do cido araquidnico de seus fosfolipdeos (Fig. 1.35). Uma
vez liberado no citosol, esse cido graxo pode
seguir dois caminhos diferentes:
Ser substrato de lipoxigenases, produzindo
cidos graxos hidroperoxi- e hidroxi-substitudos, que mais tarde sofrem uma desidratao e vrias reaes de transferncias
para formar nos leucotrienos.

25

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Fig. 1.34 Lipdeos derivados de cidos graxos esterificados ao glicerol (triacilglicerdeos e fosfoacilglicerdeos) ou
esfingosina (esfingomielina e glicolipdeos). Alm dos lipdeos derivados do glicerol, temos tambm uma outra classe de
lipdeos no qual uma cadeia de cido graxo se liga a um lcool de cadeia longa chamado esfingosina, formando um
composto conhecido como ceramida. A ceramida pode, por sua vez, se esterificar com outros grupos funcionais formando:
enfingomielina ceramida (esfingosina + cido graxo) + cido fosfrico + colina; glicolipdeos ceramida (esfingosina + cido graxo) + carboidrato.

Ser substrato da prostaglandina-sintase, levando sntese dos substratos cclicos do


cido araquidnico, as prostaglandinas e os
tromboxanos.
Os eicosanides fazem parte de uma famlia
de hormnios de ao local e esto envolvidos
em processos diversos, como inflamao, dor,
febre, processos reprodutivos, formao de cogulo e regulao da presso sangnea, entre
outros.

26

Lipdeos Formados a Partir


de Isoprenides
Os isoprenides so derivados do isopreno,
um alcano insaturado e ramificado de cinco tomos de carbono. A unio entre as unidades bsicas de isopresos pode ser feita atravs de
ligaes tipo cabea com cauda ou cauda com
cauda, como mostra a Fig. 1.36. Os terpenos
so, portanto, uma classe de lipdeos formados
pela combinao entre duas ou mais unidades

BIOMOLCULAS

Cap.

Fig. 1.35 Eicosanides. Em resposta a certos sinais hormonais, a fosfolipase A2 libera cido araquidnico dos fosfolipdeos de membrana que serve como precursor para formao dos eicosanides. prostaglandinas: C8 e C-12 do cido
araquidnico se juntam formando um anel de cinco tomos de carbono; tromboxanes: C8 e C-12 do cido araquidnico
se juntam e um tomo de oxignio incorporado, formando um anel de seis tomos; leucotrienos: a partir do cido
araquidnico, seguem outra via biossinttica que resulta numa estrutura contendo uma srie de trs duplas conjugadas.

Fig. 1.36 Estrutura do isopreno e das ligaes tipo cabea-cauda e cauda-cauda. Dependendo do nmero de
unidades de isoprenos do polmero podemos ter os diversos tipos de terpenos: n = 2 monoterpenos; n = 3 sesquiterpenos;
n = 4 diterpenos; n = 6 triterpenos; n > 8 poliprenides.

27

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Fig. 1.37 Caminhos biossintticos de alguns dos principais isoprenides encontrados na natureza: Os terpenos lineares e cclicos so sintetizados a partir do isopreno ativado (isoprenil difosfato).

Fig. 1.38 Colesterol e seus derivados : vitamina D, cidos biliares e hormnios esterideos.

28

BIOMOLCULAS

Fig. 1.39 Anel ciclopentanoperidrofenantreno.

de isoprenos ligados linearmente, e que podem,


eventualmente, se fundir em anis, formando
estruturas cclicas. Plantas e animais usam o isoprenil difosfato (isopreno ativado) para a sntese de seus terpenos lineares e cclicos (Fig. 1.37).
As unidades geralmente so polimerizadas uma
a uma at trs unidades (farnesol), podendo,
posteriormente, seguir duas vias biossintticas
distintas: uma em que as cadeias continuam cres-

cendo via adio de isoprenos (dolicol, ubiquinona, vitaminas A, E e K, por exemplo), e outra
que envolve a polimerizao tipo cauda com
cauda de molculas de farnesol, formando escaleno e, posteriormente, os esterides.
Os esterides so compostos que apresentam
em sua estrutura, o anel ciclopentanoperidrofenantreno, que uma estrutura contendo trs anis de
seis carbonos (A, B, e C) e um anel de cinco carbonos (D) fundidos:
O colesterol um importante esteride, e
apresenta em sua estrutura apenas um grupo
hidroflico representado por um OH (ligado ao
carbono 3 do anel A) que pode estar esterificado, ou no, com uma molcula de cido graxo.
A Fig. 1.39 nos mostra a estrutura do colesterol
e os principais esterides sintetizados a partir
dele: hormnios esterides, vitamina D e cidos
biliares.

29

Cap.

PRINCPIOS DA BIOLOGIA MOLECULAR DO GENE

Cap.

Princpios da Biologia
Molecular do Gene
Jos Franco da Silveira
Mrcia R. Machado dos Santos

CROMOSSOMOS, GENES E DNA


As atividades vitais da clula viva so coordenadas por entidades denominadas genes, que
codificam os caracteres hereditrios ou genticos do indivduo, como, por exemplo, tipo de
sangue, altura, peso, cor de olho e cabelo, sensibilidade a certas drogas, etc. O meio ambiente
pode ter influncia decisiva na expresso dos
genes, de maneira que dizemos que a interao
dos genes (gentipo) com o meio ambiente resulta no fentipo do indivduo. Um fentipo pode
ser resultante da expresso de um par de genes
(por exemplo, grupo sangneo ABO) ou de vrios genes (por exemplo, altura).
Os genes esto presentes em todas as clulas
do organismo, com exceo daquelas que perderam o ncleo durante a diferenciao celular, como
o caso das hemcias. Porm, nem todos os genes
so expressos igualmente em todas as clulas. Na
verdade, cada tipo celular caracteriza-se pela expresso de determinados tipos de genes. Alteraes nos genes podem levar a mudanas dramticas
na fisiologia celular, como, por exemplo, a transformao de uma clula normal em maligna.
Os genes esto localizados em estruturas
filamentosas, longas, localizadas no interior

do ncleo celular denominadas cromossomos


(Fig. 2.1). No cromossomo, os genes esto
dispostos linearmente, isto , um ao lado do
outro, enfileirados tal como as contas de um
colar. Os dados disponveis indicam que o
cromossomo corresponde a uma enorme
molcula de DNA. As bactrias e os vrus possuem apenas um cromossomo que geralmente
circular, isto , as extremidades da molcula
de DNA esto ligadas entre si. Nos demais
organismos (protozorios, fungos, metazorios), normalmente existem mais de um cromossomo por ncleo. As clulas humanas
possuem 23 cromossomos, os quais esto distribudos aos pares nas clulas germinativas e
somticas. Por este motivo, estas clulas so
conhecidas como clulas diplides e designadas por 2n = 46. Por outro lado, os gametas
so haplides (n = 23), isto , o gameta possui
uma cpia de cada cromossomo. Com a fuso
do vulo (n = 23) e espermatozide (n = 23) restaura-se o estado diplide no zigoto (2n = 46).
Na diviso celular, os cromossomos so duplicados e distribudos s clulas-filhas. Na mitose, as clulas parentais (clulas-mes) e as
filhas apresentam o mesmo nmero de cro-

31

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

2
P

30nm

C5
O

A
T

C5
O

C
O

3
O

5C

C5
O

DNA
5C

C5

Protenas
Histonas

5C

A
O

3
5C

200nm

30nm

Fig. 2.1 A relao entre o cromossomo e a molcula de DNA. Cromossomo metafsico mostrando a participao da
molcula de DNA na sua constituio. Na figura est representada apenas a molcula de DNA constituinte de uma das
cromtides homlogas.

mossomos, logo, a mitose uma diviso eqitativa. Na meiose, as clulas-filhas recebem apenas uma cpia de cada cromossomo, logo, a
meiose uma diviso reducional. Ela ocorre nas
clulas germinativas gerando os gametas (vulo
e espermatozide). Na meiose ocorre a recombinao gentica (crossing-over ou permutao),
evento fundamental para a manuteno da variabilidade gentica das espcies.
O conjunto de genes de um organismo constitui o seu patrimnio hereditrio ou gentico e
denominado genoma. No caso da espcie humana, o genoma corresponde ao conjunto completo de cromossomos haplides que contm
toda a informao gentica de um indivduo.

32

ESTRUTURA DO DNA E REPLICAO DO


DNA
Quimicamente, o gene constitudo pelo
cido desoxirribonuclico (DNA). O DNA um
polmero formado por monmeros denominados nucleotdeos (Fig. 2.2). O nucleotdeo apresenta na sua constituio um grupamento
fosfrico (P~P~P), um acar do tipo pentose
(desoxirribose) e uma base nitrogenada. A base
nitrogenada pode ser uma purina (adenina ou
guanina) ou uma pirimidina (timina ou citosina). As bases nitrogenadas so designadas abreviadamente por A (adenina), T (timina), C
(citosina) e G (guanina). Na molcula de DNA,

PRINCPIOS DA BIOLOGIA MOLECULAR DO GENE

os nucleotdeos esto ligados entre si atravs


da ligao fosfodister (Fig. 2.3) que envolve o
grupo fosfrico situado no carbono 5 da pentose de um nucleotdeo com a hidroxila situada
no carbono 3 da pentose do nucleotdeo vizinho. Na cadeia do DNA, encontramos duas extremidades denominadas extremidades 5 e 3.
O nucleotdeo presente na extremidade 5 caracteriza-se pela presena de um grupo fosfrico (P~P~P) livre, isto , o grupo fosfrico
presente no carbono 5 no participa da ligao

fosfodister. Na extremidade oposta ou extremidade 3, a hidroxila (OH) do carbono 3 do


ltimo nucleotdeo est livre, isto , ela no
est comprometida com a ligao fosfodister, portanto, um novo nucleotdeo s pode
ser adicionado na posio 3. Durante a sntese da cadeia de DNA, a enzima DNA polimerase sempre adiciona um novo nucleotdeo na
posio 3 (Fig. 2.4). Desta maneira, dizemos
que a sntese do DNA ocorre sempre no sentido
de 5 para 3 (5 3).

O
C

CH3

HN

CH

O
O

5
OCH2

O P O
Fosfato

Base nitrogenada

4C

C1
Desoxiribose

H
3C

C2

OH

NH2

C
N

HC

N
HN

CH
N
Adenina

Guanina

C
HN

CH
N
H
Uracila

NH2

N
H

H2N

HN

CH

N
H

C
N

CH

CH

CH3
C

N
H
Timina

C
O

CH
CH
N
H
Citosina

Fig. 2.2 Estrutura do nucleotdeo. Nucleotdeos componentes da molcula de DNA. Abaixo esto representadas as
bases nitrogenadas encontradas nos cidos nuclicos. Notar que timina e uracila encontram-se no DNA e no RNA, respectivamente.

33

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

A molcula de DNA consiste em duas cadeias (fitas) complementares do DNA, unidas


lado a lado pelas pontes de hidrognio (ligaes
fracas direcionadas) entre as bases nitrogenadas formando uma dupla hlice (Fig. 2.5). De
maneira simplista, pode-se dizer que a molcula seria comparvel a uma escada, onde cada
degrau seria constitudo por um par de bases
nitrogenadas (A-T ou G-C) e o corrimo formado por desoxirriboses (acar) e fosfatos.
Deve-se salientar que as cadeias so complementares (elas no so iguais), isto , a adenina de uma cadeia pareia com a timina da cadeia
complementar e a guanina com citosina. Na
interao entre guanina e citosina participam
trs pontes de hidrognio, enquanto entre timina e adenina existem duas pontes de hidrognio. Pode-se tambm notar que as cadeias
esto dispostas em sentido antiparalelo, isto ,
uma cadeia corre no sentido de 5 para 3, enquanto a outra corre no sentido de 3 para 5.
As cadeias so mantidas unidas entre si por pontes de hidrognio entre as bases nitrogenadas.
Como mostrado na Fig. 2.5, as cadeias complementares do DNA formam uma dupla hlice regular.

A duplicao da molcula de DNA catalisada por uma enzima denominada DNA polimerase. Na sntese do DNA, ocorre a separao
das duas cadeias da dupla hlice (desnaturao)
e cada uma das cadeias serve de molde para a
sntese das novas cadeias pela enzima DNA polimerase (Fig. 2.6). A cadeia recm-sintetizada ser complementar cadeia molde. Este
modelo de replicao foi demonstrado experimentalmente e conhecido como replicao
semiconservativa do DNA.
Para o incio da replicao necessrio que
a fita molde contenha uma pequena regio de
dupla fita conhecida como primer ou iniciador.
O primeiro nucleotdeo da cadeia a ser sintetizada ser adicionado na posio 3 do primer
ocorrendo ento a extenso da cadeia de DNA
pela adio de outros nucleotdeos. Como foi
discutido acima, a DNA polimerase adiciona um
novo nucleotdeo na posio 3 do nucleotdeo
da cadeia que est sendo sintetizada (Fig. 2.4).
Desta maneira, voltamos a insistir no conceito
de que a cadeia de DNA sintetizada no sentido 5 3 de maneira que o ultimo nucleotdeo
adicionado cadeia ter a hidroxila na posio
3 livre.

O
O
O
P
O

O
3

3 OH

O
5
P

Ligao
fosfodister

P
O

5
P

P
O

3 OH

3 OH
Fig. 2.3 Ligao fosfodister. Esquema mostrando a ligao entre dois nucleotdeos atravs da ligao fosfodister. A
ligao ocorre entre o grupo fosfrico (P~P~P) do carbono 5 da desoxirribose de um nucleotdeo com a hidroxila (OH) do
outro nucleotdeo.

34

PRINCPIOS DA BIOLOGIA MOLECULAR DO GENE

Cap.

Base
P
O

O
Acar

DNA Polimerase

O
5
Ligao Fosfodister

3 OH

O
Adio de um novo nucleotdeo
na extremidade 3 da cadeia

Pirofosfato

O
3 OH

Fig. 2.4 Sntese de DNA pela enzima DNA polimerase. Notar que a cadeia tem duas extremidades: a extremidade 5
na qual encontra-se um grupamento fosfrico (P~P~P) e a extremidade 3 onde h uma hidroxila (OH).

importante salientar que a DNA polimerase tambm possui a capacidade de reconhecer


os seus prprios erros e corrigi-los. Quando um
nucleotdeo adicionado na posio errada (por
exemplo, um T onde deveria estar um G), ela
percebe o erro, remove o nucleotdeo e adiciona
o nucleotdeo correto. Desta maneira, a DNA
polimerase, alm da atividade biossinttica (polimerase), tem tambm atividade de exonuclease, isto , que permite a remoo do nucleotdeo
incorreto na cadeia.

O FLUXO DA INFORMAO GENTICA NA


CLULA: CDIGO GENTICO, RNAS E
PROTENAS
A informao gentica est contida nas seqncias de nucleotdeos da molcula de DNA,
o que significa dizer que cada gene possui uma
seqncia de nucleotdeos prpria e especfica.
Desta maneira, dois genes diferentes apresentam seqncias de nucleotdeos diferentes. Em
uma famlia gnica, como, por exemplo, no caso
dos genes que codificam a globina, os diferentes
membros da famlia apresentam uma razovel
homologia entre si no nvel da seqncia de nucleotdeos.

A mensagem contida no gene (DNA) transmitida ao citoplasma da clula atravs do RNA


mensageiro (RNAm) em um processo conhecido como transcrio. Nos ribossomos, a mensagem contida no RNAm decodificada, ou seja,
traduzida, originando uma protena especfica.
Esta etapa denominada traduo. Desta maneira, o fluxo da informao gentica segue o
caminho indicado abaixo:
gene (DNA) RNAm Protena
O RNAm sintetizado por uma enzima denominada RNA polimerase que utiliza como
molde uma das fitas do DNA em um processo
denominado transcrio gnica. Notar que apenas uma das cadeias do DNA serve como molde
para a sntese do RNA (Fig. 2.7). Portanto, o
RNA exatamente igual a uma das cadeias do
DNA, excetuando-se a timina que substituda
por uracila no RNA. A cadeia ou fita de DNA
que contm a informao denominada cadeia
ou fita codificadora (Fig. 2.7).
A seqncia de nucleotdeos do DNA e
conseqentemente do RNAm contm a informao necessria para a sntese de uma prote-

35

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

A)

B)

20A

3
5

C
O

V
o
l
t
a

OH

A
O

P
O

C 34A
o
m
p
l
e
t
a

3,4A

C
O
P

P
O

Corrimo
Acar/Fosfato

P
O
Cavidade
maior

O
PP

P
O

Cavidade
menor

P
O

O
5

OH

Eixo central

C)

()
(+)
N-H-----O
() (+)
N-----H-N

Desoxiribose

Citosina

CH3

N
N
N

() (+)
O-----H-N

Guanina

H
N

(+) ()
N-H----N

Desoxiribose

N
N

Desoxiribose

() (+)
O----H-N

Desoxiribose

O
Timina

Adenina

Fig. 2.5 Estrutura do DNA: a dupla hlice. (A) A dupla hlice, segundo o modelo de Watson & Crick. (B) Esquema
mostrando que os degraus so constitudos por bases nitrogenadas e os corrimes por acar (desoxirribose) e fosfato. (C)
Pontes de hidrognio entre as bases nitrogenadas.

na. As protenas so constitudas por unidades


conhecidas como aminocidos, existindo 20 tipos diferentes de aminocidos que podem ser
encontrados em uma protena. A cadeia polipeptdica formada por uma seqncia linear de
aminocidos. O RNAm contm a informao gentica que determina a ordem e os tipos dos aminocidos presentes em uma dada protena. A
informao gentica est contida no chamado
cdigo gentico (Tabela 2.1). O cdigo gentico

36

o alfabeto usado pelos seres vivos para codificar e transmitir as informaes contidas nos genes. O cdigo gentico formado de quatro letras
compostas pelas bases nitrogenadas presentes no
DNA (A, T, G, C). No cdigo gentico as palavras so formadas pela combinao de trs bases
nitrogenadas, existindo, portanto, 16 combinaes possveis. Desta maneira, os aminocidos
presentes nas protenas so codificados por uma
combinao de trs bases nitrogenadas. Cada

PRINCPIOS DA BIOLOGIA MOLECULAR DO GENE

Nova
Molde

Molde
C--G
T--A

C--G
T--A

G-C
T--A
A--T
C-G

G-C
T--A
A--T
C-G
A--T
C--G

A--T
C---G
T

A
T

A--T
C-G
T--A
C-G
A--T
C-G
T--A
T--A
C-G

Fig. 2.6 A replicao do DNA. As cadeias da molcula-me (em cinza claro) se separam e serve de molde (template) para a sntese da nova cadeia (em cinza escuro).
Notar que a fita recm-sintetizada (em cinza escuro) complementar fita molde.

uma destas combinaes conhecida como cdon. Por exemplo, o cdon AGG codifica o aminocido arginina. Pode ocorrer de um mesmo
aminocido ser codificado por cdons diferentes, por isto, o cdigo gentico dito degenera-

do. Existem alguns cdons que no codificam


nenhum aminocido, mas, pelo contrrio, indicam o fim da mensagem. Eles so conhecidos
como cdons de terminao (stop codon). Em
todas as mensagens, o primeiro cdon (ATG)
codifica o aminocido metionina e designado
como cdon de iniciao.
No RNAm maduro, podemos definir uma
regio denominada fase de leitura aberta (ORF=
open reading frame) que codifica um polipeptdeo especfico. A ORF definida pela presena
de um cdon ATG no seu incio, finalizando com
um cdon de terminao (Fig. 2.8). Deve-se notar que o RNAm contm regies que no so
codificadoras, ou seja, no so traduzidas. A
regio situada na poro 5 do RNAm a montante (upstream) do cdon de iniciao e a regio situada na poro 3 do RNAm a justante
(downstream) ao cdon de terminao no so
codificadoras. Estas regies so conhecidas
como regies no traduzidas (UTR = untranslated region). Alm disso, nos RNAm dos eucariotos existe a adio de uma cauda de adenina
na poro 3 do RNAm (cauda poli A).

O CONCEITO DE GENE
(GENOMA, PROJETO GENOMA)
De maneira geral, pode-se dizer que um
dado gene corresponde a um trecho de uma
molcula de DNA que codifica uma protena
ou um RNA (RNA ribossmico, transportador etc.). Alm das regies UTR j citadas,
muitos genes dos organismos eucariticos so

Fitas complementares de DNA

G G C T
A A T
C
T C

A G G T
3
5

T A T T

T C C
C T A

3
U
U
A
U U
G G
G C
U G C G A A T A A A
A

G A

T
5

Fita de RNA
Fig. 2.7 Transcrio gnica (sntese de RNA). Notar que a fita superior do DNA a fita codificadora. A composio de
bases do RNA exatamente igual a da fita superior do DNA, substituindo-se timina (T) por uracila (U) no RNA. medida
que a sntese progride, a molcula de RNA separa-se do DNA.

37

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Tabela 2.1
O Cdigo Gentico. A Combinao de Trs Nucleotdeos (Cdon) Codifica um
Aminocido ou Sinaliza o Fim da Sntese de Cadeia Polipeptdica

2a base

1a
base

UUU
UUC
UUA
UUG

CUU
CUC
CUA
CUG

AUU
UC
AUA
AUG

GUU
GUC
GUA
GUG

C
UCU
UCC
UCA
UCG

Phe
Leo

Leo

Ile
Met

Ser

UAU
UAC
UAA
UAG

CCU
CCC
CCA
CCG

Pro

CAU
CAC
CAA
CAG

ACU
ACC
ACA
ACG

Thr

AAU
AAC
AAA
AAG

Ala

GAU
GAC
GAA
GAG

GCU
GCC
GCA
GCG

Val

3a
base

G
UGU
UGC
UGA
UGG

Tyr
Fim
Fim

CGU
CGC
CGA
CGG

His
Gin

AGU
AGC
AGA
AGG

Asn
Lys

CGU
GGC
GGA
GG

Asp
Glu

Cys
Fim
Trp

Arg

Ser
Arg

Gly

U
C
A
G
U
C
A
G
U
C
A
G
U
C
A
G

interrompidos por seqncias no codificadoras denominadas introns.

racterizado pela seqncia de nucleotdeos deste trecho.

importante salientar que existem no genoma muitas seqncias de DNA que no so


propriamente seqncias codificadoras, como,
por exemplo, as regies intergnicas e as seqncias repetidas (micro- e minissatlites, retrotranposons, retroposons etc.). No homem,
somente cerca de 8% do genoma constitudo
por genes tal como definido acima. O restante
do genoma humano constitudo por seqncias de DNA correspondentes aos introns, regies intergnicas, cpias de retrovrus e
seqncias repetidas de funo desconhecida.

O tamanho de uma seqncia de DNA ou


de um gene pode ser expresso em nmero de
pares de bases (pb), pois, como foi visto, o DNA
constitudo por repeties de bases nitrogenadas (nucleotdeos). O tamanho de um gene est
relacionado com o produto por ele codificado
(protena ou RNA estrutural), como pode tambm estar relacionado com o tipo de processamento ao qual o seu transcrito submetido.
Assim, pode-se encontrar genes constitudos por
150pb ou genes com mais de 50.000pb.

Na realidade o conceito de gene no definitivo, adaptando-se s novas informaes sobre a estrutura e organizao do genoma. Mas
de toda maneira, o gene sempre corresponde a
um trecho de uma molcula de DNA e ele caRNAm
5 CAUGG...UCG
UTR
Protena

AUG

AAC AAA GAU

Met

Asn

Lys

Asp

O tamanho ou complexidade do genoma de


um organismo tambm pode ser expresso em
nmero de pares de bases. A bactria Escherichia
coli possui um nico cromossomo constitudo por
4.639.221pb, um genoma relativamente pequeno e simples quando comparado com o dos ma-

AGU UUU
Ser

Phe

AGG CUA
Arg

Leu

UAA

GGCA... AAA(n) 3
UTR

Fim

ORF
Fig. 2.8 Estrutura do RNAm. As regies 5 e 3 no-traduzidas (UTR = Untranslated Region), a fase de leitura aberta
(ORF = Open Reading Frame), os cdons de iniciao (ATG) e terminao (TGA) e a cauda poli-A esto indicados.

38

PRINCPIOS DA BIOLOGIA MOLECULAR DO GENE

mferos. O genoma haplide humano constitudo por 3 bilhes pb que formam os 23 cromossomos. Por exemplo, os cromossomos 1 e 21 do
homem so constitudos por 300 milhes pb e 50
milhes pb, respectivamente. A seqncia completa de nucleotdeos do genoma de alguns vrus
e microorganismos (vrias bactrias, levedura) foi
determinada e est disposio em banco de dados (GenBank, National Center for Biotechnology Information, http://www.ncbi.nlm.nih.gov),
assim como a maior parte dos genes seqenciados de diferentes organismos.
A seguir sero discutidos as tcnicas e os
procedimentos de clonagem gnica, ou seja, do
isolamento dos genes de um dado organismo. O
conjunto das tcnicas de clonagem gnica e de
outros tipos de manipulao do material gentico tem sido denominado tecnologia do DNA recombinante ou tambm de Engenharia Gentica.

CLONAGEM GNICA: PRINCPIOS,


ESTRATGIAS E FERRAMENTAS
Princpios e Estratgias
Entende-se por clonagem gnica, o isolamento, amplificao e purificao de um gene
ou de genes, a partir do material gentico de um
dado organismo. Isolar um gene presente em
poucas cpias no genoma humano , sem dvida alguma, uma tarefa colossal. Procura-se uma
seqncia de DNA em um universo formado por
3 bilhes pb. Uma gota de gua no oceano! Porm, esta tarefa foi simplificada e, at certo ponto, banalizada pelo advento da tecnologia do
DNA recombinante.
A clonagem gnica envolve basicamente trs
etapas distintas. A primeira etapa consiste na
escolha do DNA a ser usado no processo de
clonagem. O DNA pode ser isolado diretamente dos cromossomos do organismo de interesse,
nesse caso, ele designado como DNA genmico. Outra possibilidade utilizar molculas
de DNA copiadas a partir molculas de RNA
mensageiro, atravs de uma enzima denominada transcriptase reversa. As molculas obtidas
desta maneira so conhecidas como cDNA
(DNA complementar).
A escolha do tipo de DNA a ser usado, genmico ou cDNA, depende da finalidade do estudo.

Por exemplo, se o pesquisador est interessado


em estudar a seqncias de aminocidos de uma
dada protena ou obt-la em quantidades suficientes para estudos imunolgicos, clnicos etc.,
recomendvel utilizar o cDNA. Por outro lado,
se o pesquisador est interessado em estudar as
regies regulatrias de um dado gene ou mapeamento do mesmo no cromossomo, recomendvel o uso do DNA genmico.
A segunda etapa consiste na ligao das
molculas de DNA em um vetor apropriado e
introduo em uma clula hospedeira. Nesta fase
do processo, tem-se em mos uma populao
de molculas de DNA, na qual supostamente
est includo o gene de interesse. Na maioria
dos casos, o gene de interesse est presente em
quantidades diminutas, insuficientes para sua deteco. Portanto, necessrio que as molculas
de DNA sejam amplificadas, para que o gene de
interesse possa ser identificado pelos mtodos
disponveis.
Em geral, o material a ser clonado amplificado em bactrias, as quais so organismos de
fcil cultivo e manipulao, que se multiplicam a
cada 30 minutos. O artifcio usado fazer com
que a bactria, ao duplicar seu prprio material
gentico tambm duplique o DNA introduzido.
Para tanto, os fragmentos de DNA a serem clonados so inseridos nos chamados vetores, os
quais so molculas de DNA capazes de invadir e
propagar-se dentro das bactrias.
Como ser discutido mais adiante, os vetores mais comuns so os plasmdeos e vrus
bacterianos (bacterifagos). Nesta etapa do processo, o pesquisador deve escolher o vetor mais
apropriado para as suas finalidades. Os fragmentos de DNA so introduzidos e duplicados na
clula hospedeira pelo veculo de clonagem, ou
seja, o vetor. Ao final desta etapa tem-se uma
populao de bactrias recombinantes, cada uma
delas contendo um fragmento de DNA exgeno, oriundo do organismo em estudo. A essa
coleo de bactrias recombinantes portadoras
de genes de um dado organismo d-se a denominao genoteca ou biblioteca.
A terceira etapa consiste no isolamento do
gene de interesse atravs de um arsenal de tcnicas genticas, bioqumicas e imunolgicas.
Novamente, cabe ao pesquisador a escolha do
mtodo de seleo mais adequado para o isolamento do gene de interesse.

39

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

As etapas descritas aqui sero discutidas com


mais detalhes nos itens a seguir.

Ferramentas do DNA Recombinante:


Enzimas Modificadoras do DNA, Vetores e
Clulas Hospedeiras
Enzimas Modificadoras do DNA
Sabe-se atravs de mensuraes fsico-qumicas e figuras de microscopia eletrnica que a
molcula de DNA longa, fina e razoavelmente retilnea, lembrando um longo filamento. A
estrutura linear e filamentosa facilita a manipulao da molcula de DNA, permitindo o isolamento de fragmentos da molcula atravs do
uso de enzimas especficas ou quebra com agente
fsico (ultra-som, luz ultravioleta etc.).
Atualmente, a disponibilidade de enzimas
modificadoras do DNA permite que as molculas de DNA sejam manipuladas e alteradas no
tubo ensaio, criando-se novas molculas de
DNA. Fragmentos de DNA, de mesma ou diferente origem, podem ser ligados entre si atravs
enzimas especficas originando novas molculas
de DNA, as quais so denominadas molculas
recombinantes. A tecnologia que permite que
estas molculas recombinantes sejam criadas,
modificadas, replicadas e expandidas, recebeu a
denominao tecnologia do DNA recombinante. O conjunto de tcnicas e procedimentos que
permite essa manipulao tambm conhecido
como Engenharia Gentica.
No metabolismo do DNA (sntese e degradao) esto envolvidos um grande nmero de
enzimas, com diferentes especificidades e funes. Estas enzimas constituem ferramentas valiosas da tecnologia do DNA recombinante. Entre
as enzimas de uso corrente na clonagem gnica
pode-se citar as: a) nucleases (exonucleases e endonucleases de restrio), b) polimerases, c) ligases, d) quinases e fosfatases, e) metilases, etc.
O mecanismo de ao destas enzimas est esquematizado na Fig. 2.9.
Como foi discutido anteriormente, a sntese
do DNA catalisada por uma enzima denominada DNA polimerase. Esta enzima sintetiza uma
nova fita de DNA utilizando como molde (template) a fita complementar da molcula existente (Figs. 2.4 e 2.9). Para que ocorra a sntese, a
molcula de DNA deve ser desnaturada, ou seja,

40

as fitas devem ser separadas atravs do rompimento das ligaes que mantm a dupla hlice.
A desnaturao feita atravs de aquecimento
(90oC) ou tratamento alcalino das molculas de
DNA, originando assim uma preparao de DNA
contendo molculas simples fita.
Ambas as fitas podem servir de molde para
a sntese de novas molculas. Alm da fita molde, necessria a presena de um iniciador ou
primer, ou seja, um pequeno fragmento de DNA
simples fita complementar fita molde. Nas
manipulaes in vitro, os iniciadores podem
ser criados pela ao de uma dada enzima
(por exemplo, RNase H), ou produzidos em
mquinas de sntese de oligonucleotdeos e adicionados ao tubo de reao. A produo de iniciadores por RNase H ser discutida na sntese
de cDNA e a dos iniciadores sintticos no artigo sobre PCR.
O crescimento da cadeia de DNA sempre se
faz no sentido 5 para 3, ou seja, um novo nucleotdeo adicionado cadeia atravs da ligao do seu grupo fosfrico, presente no carbono
5 da desoxirribose, com a hidroxila do carbono
3da desoxirribose do ultimo nucleotdeo presente na cadeia em crescimento.
A transcriptase reversa um tipo de DNA
polimerase capaz de sintetizar uma nova fita de
DNA utilizando como molde um RNA mensageiro, portanto, trata-se de uma DNA polimerase RNA dependente (Fig. 2.14). Como qualquer
DNA polimerase, ela necessita de um iniciador
e adiciona nucleotdeos na posio 3 do nucleotdeo remanescente na cadeia. Como anteriormente citado, a cadeia de DNA simples fita
sintetizada a partir do molde de RNA denominada cDNA (DNA complementar).
As endonucleases de restrio, tambm conhecidas como enzimas de restrio, tiveram um
papel fundamental no desenvolvimento da tecnologia do DNA recombinante. Estas enzimas
so nucleases que reconhecem seqncias especficas de nucleotdeos, cortando a molcula de
DNA em regies especficas (Fig. 2.10, Tabela
2.2). A denominao endonucleases de restrio origina-se do fato de a atividade da enzima
estar restrita apenas regio da molcula que
contm a seqncia de nucleotdeos por ela reconhecida. A maioria das enzimas de restrio
foi isolada de bactrias e so denominadas com
as abreviaes das espcies das quais foram

PRINCPIOS DA BIOLOGIA MOLECULAR DO GENE

Cap.

Endonuclease

Exonuclease

primer
5

DNA polimerase

Fita molde

Ligase

5
P
Fosfatase
OH
3

3
OH

P
5

5
OH

3
OH

OH

OH
5

5
OH

3
OH

OH
3

OH

3
OH

Quinase
OH
3

P
5

Fig. 2.9 Enzimas modificadoras do DNA. Esquema mostrando o mecanismo de ao de algumas enzimas modificadoras do DNA utilizadas em Engenharia Gentica. Em negro esto representadas as bases nitrogenadas; em verde esto
representados a desoxirribose e o fosfato, unidos entre si pelas ligaes fosfodister.

isoladas, por exemplo, EcoRI (Escherichia coli),


HindIII (Haemophilus influenzae).
As enzimas de restrio disponveis reconhecem seqncias de quatro, seis ou oito nucleotdeos. De maneira geral, em uma dada molcula
de DNA a probabilidade de encontrar-se stios
contendo uma dada seqncia de quatro nucleotdeos (um stio a cada 256 nucleotdeos) maior
do que a probabilidade de encontrar-se stios contendo uma seqncia de seis nucleotdeos (um
stio a cada 4.096 nucleotdeos) ou oito nucleotdeos. Desta maneira, o nmero de fragmentos
obtidos aps digesto do DNA com HaeIII (stio

de reconhecimento composto por quatro nucleotdeos) ser bem maior daquele obtido na digesto com EcoRI (seis nucleotdeos).
Uma outra caracterstica das enzimas de restrio o fato de elas cortarem a molcula de
DNA gerando extremidades coesivas ou extremidades cegas (blunt ends) (Fig. 2.10). Fragmentos de DNA contendo extremidades coesivas
compatveis podem ser ligados entre si gerando
novos fragmentos. Fragmentos obtidos pela digesto com BamHI podem ser ligados a outros
fragmentos digeridos pela mesma enzima ou
com fragmentos obtidos com a enzima Sau3AI

41

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Vetor

Inserto

G AATTC
CTT AAG

3
G A A TTC
CTT AAG

3
3

Sau 3AI

C
G CTAG

3
G AT C

Inserto

3
C G AT C
G CTAG

3
C C CG G G
G GG C C C

Hae III
3

Sma I

GG
CC

G G CC
C CG G

CC C
G GG

Ligase

G A A TTC
C TT AA G

Vetor

G AT C
CTGG

Ligase
5

Bam HI

AA TTC
G

Eco RI

G
CTT AA

Inserto

C G AT C C
G CT AGG

Eco RI
5

Vetor

Ligase
5

G G CC C
C C G GG

Fig. 2.10 Molculas de DNA recombinante. Diagrama esquemtico mostrando a gerao de molculas de DNA recombinante in vitro, aps digesto com enzimas de restrio compatveis e ligao das molculas resultantes com a enzima
DNA ligase. Notar que foi includa no esquema a ligao entre fragmentos de DNA digeridos com enzimas de restrio
(HaeIII, SmaI) que originam extremidades blunt-ends.

Tabela 2.2
Enzimas de Restrio
Origem

Enzima

Stio de Reconhecimento

Escherichia coli

Eco RI

5-GAATTC - 3
-CTTAAG-

Coesivas

Eco RV

5-GATATC- 3

Blunt ends

Bacillus
anyloliquefaciens H

Bam HI

5 -GGATCC- 3
-CGTAGG-

Coesivas

Haemophilus aegytius

Hae III

5 -ggcc- 3

Blunt ends

Staphylococcus aureus

Sau 3AI

5 -GATC- 3

Coesivas

Nocardia
otitids-caviarium

Not I

5 -GCGGCCGC- 3
-CGCCGGCG-

Coesivas

(Fig. 2.10). A figura mostra que Sau3AI reconhece uma seqncia de quatro nucleotdeos que
est contida dentro da seqncia de seis nucleotdeos reconhecida pela BamHI, logo, as extremidades geradas com Sau3AI so compatveis com
as de BamHI. As seqncias reconhecidas pelas
enzimas BamHI e Sau3AI so isoesquizmeros.

42

Extremidades

Fragmentos com extremidades cegas podem ser ligados entre si, mesmo que tenham sido
gerados por diferentes enzimas de restrio,
como, por exemplo, EcoRV e HaeIII. Assim, so
muitas as maneiras disponveis de fragmentar-se o DNA e reconstruir novas molculas
(Fig. 2.10). A unio de dois fragmentos de DNA

PRINCPIOS DA BIOLOGIA MOLECULAR DO GENE

ocorre atravs da formao de ligaes fosfodister entre as extremidades dos mesmos, catalisadas por enzimas denominadas DNA ligases. A
T4 DNA ligase, codificada por um gene presente no bacterifago T4, uma das ligases mais
utilizadas na rotina dos laboratrios.
Uma situao muito comum na clonagem
de genes aquela em que fragmentos de DNA
de um dado organismo, obtidos por digesto com
uma enzima de restrio (por exemplo, EcoRI),
devem ser ligados ao DNA de um plasmdeo bacteriano, o qual tambm foi digerido com EcoRI.
Como a ligase no distingue os fragmentos, haver sempre uma frao considervel de produtos de reao contendo fragmentos resultantes
da ligao de plasmdeos entre si ou fragmentos
resultantes da ligao de fragmentos de DNA
do organismo em questo. A ligao indesejvel
entre estes fragmentos pode ser evitada, tratando-se previamente um dos fragmentos com uma
enzima denominada fosfatase, que remove especificamente os grupamentos fosfricos das extremidades do DNA. Os fragmentos destitudos
de grupamentos fosfricos (fragmentos defosforilados) so incapazes de ligar-se entre si, embora sejam capazes de ligar-se aos fragmentos
fosforilados presentes na reao. Este artifcio
largamente usado na clonagem de genes.
Como citado no incio deste item existe uma
grande variedade de enzimas modificadoras do
DNA, que possuem diferentes especificidades e
mecanismos de ao. Apesar da enorme utilidade destas enzimas na tecnologia do DNA recombinante, apenas foram abordadas as enzimas
comumente utilizadas na construo de bibliotecas ou genotecas.

Vetores e Clulas Hospedeiras


Os vetores so os veculos de clonagem que
permitem que os fragmentos de DNA a serem
clonados sejam introduzidos e propagados em
uma clula hospedeira adequada. As clulas hospedeiras ou receptoras devem permitir a entrada
e propagao do vetor, sem causar alteraes
no DNA que est sendo clonado. As clulas hospedeiras devem ser clulas de fcil manipulao,
crescimento rpido e constituio gentica bem
conhecida. Neste perfil enquadram-se determinadas linhagens de bactrias, leveduras, clulas
de cultura de tecido de mamferos e insetos.

Deve-se salientar que muitos genes, inicialmente, so clonados em bactrias e, posteriormente,


transferidos para um outro hospedeiro.
Os vetores mais utilizados so os plasmdeos
e os vrus de bactrias e de clulas eucariticas.
O plasmdeo uma molcula de DNA, em geral
pequena (menos de 10.000 pb) e circular, portadora de uma regio denominada origem de replicao, a qual permite sua replicao dentro
da clula hospedeira (Fig. 2.11). Em um plasmdeo existem algumas regies que so importantes no processo de clonagem: origem de
replicao, stio de clonagem, marcas de resistncia a antibiticos, regies homlogas aos primers de seqenciamento etc.
Os plasmdeos de clonagem possuem uma
origem de replicao que permite a sua replicao e propagao em bactrias. Existem plasmdeos que tm diferentes origens de replicao,
podendo ser propagados tanto em bactrias
como em um outro tipo celular, como, por exemplo, levedura, clulas de cultura de tecido de
mamferos ou insetos, ou mesmo em tecidos de
mamferos.
Os stios de clonagem so as regies onde se
pode inserir os fragmentos de DNA exgeno. O
stio de clonagem possui seqncias reconhecidas pelas enzimas de restrio mais usuais.
Quando se tem vrios stios de restrio disposio para a clonagem, diz-se que o vetor
portador de um polylinker. Em muitos plasmdeos a insero de um fragmento de DNA exgeno leva a uma alterao do fentipo da clula,
o qual pode ser facilmente detectado e um indicativo da insero de um fragmento de DNA
no stio de clonagem. Por exemplo, em alguns
plasmdeos o stio de clonagem fica no interior
do gene que codifica uma enzima, de modo que
a insero de DNA exgeno anula a atividade
enzimtica.
Os plasmdeos carregam genes que codificam resistncia a antibiticos, o que fundamental para a manuteno dos mesmos na clula
hospedeira. As marcas de resistncia a antibiticos so extremamente teis na identificao, seleo e manipulao em geral dos plasmdeos
recombinantes. De maneira geral, os plasmdeos acomodam com facilidade fragmentos com
menos de 10.000 pb. Cabe ao investigador escolher o plasmdeo mais adequado a sua finalidade.

43

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

O bacterifago ou fago lambda um vrus de


bactrias que tem sido largamente utilizado em
clonagem gnica. O genoma do fago lambda
constitudo por uma nica molcula de DNA com
cerca de 40.000 pb.
Existem duas maneiras de se inserir um
fragmento de DNA exgeno no fago. Uma delas consiste em substituir um trecho do DNA
do fago por um fragmento de DNA exgeno,
cujo tamanho pode variar de 9.000pb a
23.000pb. Neste caso, elimina-se uma regio
do DNA do fago no-essencial sua sobrevivncia na clula hospedeira, sendo o vetor conhecido como vetor de substituio. A outra
opo consiste em adicionar ao DNA do fago o
fragmento de DNA (menor que 8.000 pb) que

A)

se deseja clonar. Neste caso, o vetor conhecido como vetor de insero.


As molculas de DNA fgico recombinantes
so utilizadas para construir partculas virais in
vitro em uma reao conhecida como encapsidao in vitro (Fig. 2.15). Em ltima anlise,
partculas virais so geradas no tubo de ensaio
e, a seguir, utilizadas para infectar bactrias. A
infeco de bactrias com fagos costuma ser um
processo mais eficiente do que a transformao
quando se leva em conta o nmero de recombinantes obtidos.
O plasmdeo e o fago lambda so os vetores
mais apropriados para o isolamento e estudo
de um gene em particular e construo de genotecas ou bibliotecas de um dado organismo.
Porm, com o rpido desenvolvimento da tecnologia do DNA recombinante, outros vetores
com finalidades diversas foram construdos e
aperfeioados, como, por exemplo, o fago filamentoso M13, os cosmdeos, os YACs, BACs e
vetores derivados de vrus de clulas eucariticas. No presente artigo, ser abordada a clonagem em plasmdeos e fago lambda. Contudo,
importante salientar que o racional e estratgias
utilizadas na clonagem nestes vetores podem ser
aplicados aos outros vetores.
Para que uma clula seja utilizada como clula hospedeira ou receptora em clonagem gnica ela deve preencher uma srie de requisitos:

B)

Hind II
Sph I
Pul I
Sol I
Xiba I
BomHI
Smal
Kpnl
Sac I
EcoRI

Cap.

O plasmdeo introduzido na clula hospedeira submetendo-se a bactria a um choque trmico na presena de fosfato e clcio.
Este processo conhecido como transformao
(Fig. 2.12). A transformao tambm pode ser
realizada submetendo-se as bactrias a um campo eltrico que promove o aparecimento de poros temporrios na membrana celular, por onde
penetram as molculas de DNA. Este processo
conhecido como eletroporao. Aps a transformao as bactrias so plaqueadas em agar
slido contendo meio nutritivo e antibiticos. As
colnias contendo plasmdeo so recuperadas e
analisadas.

Sntese de DNA
Recombinao

IacZ
Genes do
capsdeo

Genes da
cauda

Lisogenia

att int xis cBi N cl cro dl

AmpR
Stio
cos
ori

48kb

Lise
OP QSR
Stio
cos

Mapa gentico do bacterfago

2,69 kb
Mapa do vetor plasmdio pUC 18

Fig. 2.11 Vetores tpicos de clonagem. (A) plasmdio pUC18, mostrando stios de clonagem (polylinker), origem de
replicao (ori), gene de resistncia ao antibitico ampicilina (Amp R) e o promotor lac. (B) Fago lambda gt10 (vetor de
insero), mostrando o nico stio de clonagem EcoRI.

44

PRINCPIOS DA BIOLOGIA MOLECULAR DO GENE

Vetor plasmdio

DNA genmico

Cap.

Eco RI
Tei

ori

Eco RI

Eco RI

Eco RI

Ligao

Transformao em
E. coli

E. coli contendo
plasmdio recombinante
Seleo com antibiticos

E. coli contendo
plasmdio selvagem

Seleo de recombinantes

Fig. 2.12 Clonagem de DNA genmico em plasmdio (construo de biblioteca genmica). Digesto do plasmdio e
DNA genmico com enzimas compatveis (EcoRI), ligao com a enzima DNA ligase, transformao de bactrias competentes, seleo com o antibitico tetraciclina, identificao e amplificao dos clones recombinantes.

crescimento rpido (tempo de gerao curto), fcil


manipulao, estrutura gentica bem conhecida.
As clulas hospedeiras, em geral, possuem uma
srie de mutaes no seu sistema de recombinao gentica que garantem a propagao e a estabilidade do vetor.

clula hospedeira vai depender dos objetivos do


trabalho. Geralmente, a clonagem de um dado
gene feita em bactria e, posteriormente, segundo as necessidades o gene clonado transferido para um outro hospedeiro.

Existem clulas hospedeiras que permitem


que os genes clonados sejam expressos, garantindo a recuperao em larga escala dos produtos destes genes, por exemplo, protenas. As
bactrias so as clulas hospedeiras mais utilizadas em Engenharia Gentica. Porm, existem
disposio dos pesquisadores outros hospedeiros, como clulas de cultura de tecido de mamferos e insetos, leveduras etc.). A escolha da

CONSTRUO DE BIBLIOTECAS
OU GENOTECAS
Biblioteca ou genoteca uma coleo de fragmentos de DNA de um dado organismo, clonados e propagados em um hospedeiro adequado
(bactria, levedura, clula de cultura de tecido).
Para que uma biblioteca seja representativa, qualquer gene do organismo estudado deve estar re-

45

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

presentado na genoteca. Em outras palavras, a


probabilidade de se encontrar um dado gene deve
ser igual ou superior a 99%.

RNA total
AAAAA

2
Oligo (dT)
celulose

AAAAA

TTTTT
AAAAA

TTTTT

AAAAA
TTTTT

RNAm Pdi (A)


hibridiza com
oligo (dT)

AAAAA
TTTTT

AAAAA
TTTTT

NaCL 100mM

Eluio de RNAr e RNAt

Bibliotecas Genmicas
O DNA extrado do ncleo das clulas denominado DNA genmico ou cromossmico. O
DNA genmico pode ser obtido rompendo-se
as clulas na presena de detergentes, seguindo-se extrao com solventes orgnicos (fenol,
clorofrmio).
Em geral, o DNA digerido com enzimas
de restrio ou com Dnase I, escolhidas pelo pesquisador levando-se sempre em conta os objetivos do trabalho e os stios de clonagem existentes
no vetor (Fig. 2.12). A digesto com enzimas de
restrio pode ser total ou parcial, variando-se o
tempo de incubao com a enzima. Os fragmentos a serem inseridos no vetor podem ser purificados atravs de eletroforese em gel de agarose,
escolhendo-se apenas os fragmentos de tamanho adequado ao vetor escolhido.

Tris 10mM
EDTA 1mM

Eluio do RNAm Poli (A)

AAAAA

AAAAA

AAAAA
AAAAA
AAAAA

AAAAA
AAAAA
AAAAA

Fig. 2.13 Isolamento e purificao do RNAm poliadenilado (RNAm poli-A) atravs de cromatografia de afinidade
em coluna de oligo (dT) celulose. O RNA total extrado do
organismo de interesse (tecido, clulas em cultura) aplicado em colunas de oligo (dT) celulose. A cauda poli A (resduos de adenina) do RNAm hibridam com os resduos de
timina presentes na resina (oligo dT celulose). O RNAm poliA eludo com soluo apropriada.

46

Desta maneira, conhecendo-se a complexidade do genoma e o tamanho dos fragmentos


clonados pode-se estimar o nmero de clones
recombinantes necessrios para que uma biblioteca seja representativa. De acordo com a origem do DNA, as bibliotecas so denominadas
a) genmica, se o DNA clonado for o DNA nuclear ou cromossmico; b) cDNA, se o DNA clonado for copiado do RNAm pela transcriptase
reversa.

Fragmentos de tamanho igual ou inferior a


23.000 pb podem ser clonados em fago lambda.
Os plasmdeos e o fago filamentoso M13 acomodam com facilidade fragmentos menores que
10.000pb. Como ser discutido em outro captulo, fragmentos com tamanho igual ou superior a 40.000 pb devem ser clonados em vetores
especialmente desenvolvidos para acomodar
grandes fragmentos de DNA como os YACs (yeast artificial chromosome), BACs (Bacterial Artificial Chromosome) e cosmdeos.
muito comum na construo de bibliotecas submeter-se o DNA genmico a uma digesto parcial com uma enzima que corta
freqentemente o DNA, como, por exemplo, a
Sau3AI. Este procedimento aumenta a probabilidade de um dado gene estar presente nos

PRINCPIOS DA BIOLOGIA MOLECULAR DO GENE

fragmentos a serem inseridos no vetor. Por


exemplo, se um dado gene estiver contido em
fragmento EcoRI de 30.000pb, ele no poder ser clonado em fago lambda (tamanho mximo 23.000pb). Certamente, dentro deste
fragmento existem muitos stios para Sau3AI,
que podem ser utilizados para gerar fragmentos
de tamanho adequado para clonagem em fago
lambda atravs de digesto parcial com Sau3AI.
Aps a insero dos fragmentos de DNA em
um vetor apropriado, o material a ser clonado
introduzido e propagado em bactrias ou em leveduras no caso dos YACs. Como foi discutido
anteriormente, a introduo do material a ser clonado uma etapa crucial na construo de genotecas de um dado organismo, existindo vrios
protocolos de transformao (plasmdeos, BACs,
YACs, fago filamentoso M13) e encapsidao in
vitro (fago lambda, cosmdeo) que permitem a
constituio de genotecas representativas.
Para que uma genoteca de DNA genmico
de um dado mamfero (por exemplo, o homem)
construda em fago lambda seja representativa
so necessrios 810.000 fagos recombinantes
contendo fragmentos de DNA humano de cerca de 17.000pb. Em uma genoteca deste porte,
a probabilidade de se detectar um gene qualquer maior que 99%. Os fagos citados aqui
podem ser estocados em um pequeno tubo de
ensaio em um volume menor do que 0,5ml. De
certa maneira, o DNA recombinante permite
que o patrimnio hereditrio do homem seja
estocado em um tubo de ensaio, o qual pode
ser conservado por muitos anos na geladeira.

Construo de Bibliotecas de cDNA


As bibliotecas de cDNA contm fragmentos
de DNA copiados pela transcriptase reversa tendo como molde as molculas de RNAm. Desta
maneira, em uma genoteca de cDNA esto representados apenas os genes que codificam para
protenas e que esto sendo expressos na clula
ou tecido do qual o RNAm foi extrado. A genoteca de cDNA pode ser a opo mais correta
quando se quer clonar um gene que codifica uma
dada protena, visando estudar-se a seqncia
de aminocidos desta protena, seus efeitos biolgicos, produo em larga escala etc.
A primeira etapa da construo de uma genoteca de cDNA consiste na extrao do RNAm

da clula ou do tecido desejado, utilizando-se


mtodos em que o material biolgico lisado na
presena de substncias denaturantes de protenas, como fenol, clorofrmio, isotiocianato de
guanidina, detergentes, etc. A seguir, o RNAm
separado dos outros RNAs (tRNA, rRNA, etc.)
atravs de cromatografia em uma coluna de oligo (dT)-celulose, ou seja, uma resina contendo
celulose acoplada a resduos de oligo (dT) (nucleotdeo desoxi-timidina) (Fig. 2.13). Os RNAm
possuem na extremidade 3' uma cauda contendo muitos resduos do nucleotdeo adenina, a
qual denominada cauda poli-A. Desta maneira, quando o RNA celular cromatografado na
resina de oligo (dT), as caudas de poli-A presentes nos RNAm hibridam-se com os resduos
de T, separando os RNAm dos outros RNAs celulares. Os RNAm so eludos da coluna, constituindo uma frao enriquecida em RNAm
denominada RNA poliadenilado.
As etapas de sntese e clonagem do cDNA
esto esquematizadas nas Figs. 2.13 a 2.15. A
preparao contendo o RNA poliadenilado
(RNAm) usada para a sntese do cDNA simples fita em uma reao catalasida pela transcriptase reversa. Oligonuclucleotdeos sintticos
contendo resduos de timina [oligo (dT)] so
utilizados como iniciadores ou primers para a
sntese do cDNA simples fita (Fig. 2.14). Eles
hibridam com os resduos da cauda poli-A dos
RNAm, servindo como primer para a ao da
enzima transcriptase reversa. O cDNA simples
fita mantm-se ligado molcula de RNAm originando um hbrido RNAm/cDNA. Esse hbrido o
substrato de uma enzima denominada RNase H,
a qual digere especificamente o RNAm. A RNase H no digere totalmente o RNAm, deixando
pequenas regies intactas, as quais serviro de
primers para a sntese da segunda fita de cDNA.
A segunda fita do cDNA catalisada pela
DNA polimerase, utilizando os primers originados acima. Deve-se salientar que existem outras
alternativas de gerao de primers para a sntese
da segunda fita, como a utilizao de uma mistura de hexanucleotdeos aleatrios (contendo
todas as combinaes possveis entre os nucleotdeos) ou a utilizao regio de dupla fita em
forma de grampo situada na extremidade da fita
de cDNA. A segunda fita tambm pode ser sintetizada via PCR, utilizando-se a Taq DNA po-

47

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

limerase e oligonucleotdeos. Essa alternativa


utilizada para fins especficos e ser discutida
no final deste captulo.
O cDNA dupla fita incubado com enzimas que reparam as suas extremidades (por
exemplo, T4 DNA polimerase) e, a seguir, adiciona-se s suas extremidades oligonucleotdeos
sintticos contendo stios de enzimas de restrio compatveis com os stios de restrio existentes no vetor (plasmdeo ou fago) a ser
utilizado na clonagem. Estes oligonucleotdeos
podem ser de dois tipos: linkers ou adaptadores.
Os adaptadores no necessitam ser digeridos com
enzimas de restrio, pois j apresentam extremidades coesivas.
Na etapa seguinte, as molculas de cDNA
so inseridas no stio de clonagem do vetor
(plasmdeo ou fago) e propagadas em bactrias
(Fig. 2.15), como visto no item anterior. O isolamento dos clones recombinantes ser descrito
no item a seguir.

Isolamento de Clones
Recombinantes em Bibliotecas
de cDNA ou Genmicas
As estratgias de isolamento de clones recombinantes so essencialmente as mesmas, quer
tratar-se de uma biblioteca de cDNA ou genmica. Algumas delas sero discutidas a seguir.

Isolamento de Clones Recombinantes com


Sondas Radioativas atravs de Hibridao
de cidos Nuclicos
Entende-se por sonda uma seqncia de
DNA ou um oligonucleotdeo utilizado para o
isolamento de um gene de interesse (Fig. 2.16A).
Se existe alguma informao sobre a seqncia
de nucleotdeos do gene de interesse, pode-se
sintetizar oligonucleotdeos com base na seqncia de nucleotdeos conhecida e utilizar esses oligonucleotdeos marcados radioativamente no
rastreamento das genotecas. Como muitos genes so razoavelmente conservados na escala
evolutiva, pode-se isolar um dado gene de uma
espcie conhecendo-se a seqncia de nucleotdeos do gene homlogo de outra espcie.
Existem situaes em que se dispe da protena purificada, mas nada se sabe sobre a se-

48

qncia de nucleotdeos do gene que a codifica.


A seqncia de aminocidos de alguns fragmentos desta protena pode ser obtida atravs das
tcnicas de microsseqenciamento. Conhecida
a seqncia de aminocidos pode-se predizer a
seqncia de nucleotdeos que codifica esses aminocidos e, conseqentemente, sintetizar os oligonucleotdeos correspondentes.
As genotecas so plaqueadas em placas de
Petri contendo agar slido nutritivo. As colnias
(no caso dos plasmdeos, cosmdeos, fagos M13,
YACs, BACs) ou placas de lise (fago lambda)
presentes na placa de Petri so utilizadas para
gerar rplicas em filtros de nitrocelulose ou nilon. Os filtros, por sua vez, so tratados com
solues adequadas e hibridados com a sonda
radioativa. Aps a hibridao, os filtros so
expostos em filmes de raios X e revelados. Os
clones recombinantes contendo seqncias homlogas sonda utilizada vo formar hbridos
radioativos, os quais vo originar um sinal positivo no filme de raios X, permitindo sua identificao e isolamento (Fig. 2.16A).

O Gene de Interesse Expressa uma


Protena Contra a Qual se Tem Anticorpos
ou uma Protena que Possui Alguma
Atividade Biolgica
(Enzima, Hormnio, etc.)
Neste caso, a biblioteca deve ser construda em um vetor de expresso (fago lambda
ou plasmdeo), o qual permite a clonagem e a
expresso do gene de interesse. O vetor de expresso possui um gene que codifica uma protena, em geral bacteriana, o qual est sob o
controle de uma regio denominada promotor.
A expresso da protena depende da ativao
do promotor. O artifcio consiste em inserir-se
o gene de interesse em um stio localizado dentro do gene que codifica a protena acima. Neste
caso, quando o promotor ativado tem-se a
produo de uma protena hbrida ou de fuso,
a qual contm parte da protena que estava sob
o comando do promotor mais a protena que se
deseja clonar e expressar.
A estratgia mais utilizada gerar anticorpos contra a protena que se deseja clonar e
utiliz-los em um rastreamento imunolgico das

PRINCPIOS DA BIOLOGIA MOLECULAR DO GENE

5
RNAm

3
AAAAAA
TTTTTTTT

5
RNAm
cDNA

AAAAAA
TTTTTTT
5

Cap.

Anelamento
oligo (dT)

Extenso
Transcriptase reversa
hbrido RNA/DNA

primers RNA
cDNA

AAAAA
TTTTTT

cDNA

Degradao do molde
Rnase H

Sntese da segunda fita


DNA polimerase I
+ dNTPs + DNA ligase

cDNA dupla fita

Fig. 2.14 Sntese de cDNA. Sntese de cDNA (cDNA simples fita) pela transcriptase reversa utilizando-se oligo dT como
primer e o RNAm poli-A como molde. Degradao do RNAm molde com Rnase H gerando primers para a sntese da
segunda fita do cDNA. Sntese do cDNA dupla fita com a enzima DNA polimerase.

genotecas. O procedimento semelhante ao


descrito no item anterior. As bibliotecas so plaqueadas, rplicas de nitrocelulose contendo os
clones recombinantes, so preparadas e incubadas com os anticorpos dirigidos contra a protena de interesse. A seguir, utilizam-se tcnicas
comuns de deteco de complexo antgeno-anticorpo, como por exemplo, conjugados ligados a peroxidase (Fig. 2.16B). Aps a revelao,
as bactrias produtoras da protena de interesse so identificadas e isoladas.
Se a protena de interesse tem alguma atividade biolgica, por exemplo enzimtica, podese montar um ensaio para deteco da atividade
desta enzima tal como se procedeu no rastreamento imunolgico. Evidentemente, existem
muitas outras alternativas de isolamento de clones recombinantes. As citadas nos itens anteriores so as mais comuns.

Isolamento de Clones Recombinantes


atravs de PCR
Quando a seqncia de nucleotdeos de um
gene parcial ou totalmente conhecida pode-se
gerar oligonucleotdeos baseados nestas seqncias, os quais sero utilizados como primers em
reaes de PCR (Polymerase Chain Reaction).
Esta estratgia tem sido muito utilizada no isolamento de recombinantes. Amostras contendo
quantidades mnimas de DNA dos clones recombinantes so desnaturadas, incubadas com
primersespecficos para o gene de interesse e
amplificadas atravs da Taq DNA polimerase. O
material analisado atravs de eletroforese em
gel de agarose e hibridao. Muitas vezes, o produto da reao de PCR clonado em um vetor
apropriado e seqenciado, para confirmar-se se
realmente ele tem a seqncia de nucleotdeos
do gene de interesse.

49

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Eco RI
A A A A A
T T T T T

cDNA

Eco RI metilase

Me

gt10

A A A AA
T T T T T

Adaptadores Eco RI

Me

CG A A T T CG
GC T T A A GC

Eco RI
GA AT T C
CT TA A G

Me
Stio cos

AA A AA
TT T T T

Me
Me

Eco RI

AA T T C G
GC

Extremidades coesivas

Stio cos

DNA ligase

Eco RI

Adaptadores
ligados

G
C T TA A

A A A A A C G
T T T T T GC T T A A

A AT T C
G

Ligao

Me

Sem inserto

Stio cos anelado

cDNA
DNA de fago recombinante

Empacotamento da partcula
fgica in vitro

E. coli infectada

Tapete bacteriano

Placa de fago

Fig. 2.15 Clonagem de cDNA em fago lambda gt10. Linkers EcoRI so adicionados s extremidades das molculas
de cDNA dupla fita pela enzima DNA ligase. A seguir, as molculas de cDNA e do vetor gt10 so digeridas com a enzima
de restrio EcoRI gerando extremidades compatveis. Vetor e inserto so ligados entre si pela DNA ligase gerando uma
longa molcula de DNA (concatamero linear). No processo de encapsidao (gerao de partculas fgicas), uma molcula recombinante (DNA do fago + inserto) introduzida em uma partcula fgica ou um vrus.

CLONAGEM DE UM GENE
ATRAVS DE PCR
O desenvolvimento e o aprimoramento da
tecnologia de PCR permitiram o desenvolvimento de novos protocolos de clonagem de um dado
gene ou de algumas regies do mesmo. Para
tanto necessrio ter informaes sobre a seqncia de nucleotdeos do gene de interesse. Oligonucleotdeos correspondentes a regies
conhecidas do gene so usadas no processo de
amplificao por PCR. Em geral, regies de 100pb
at 5.000pb podem ser amplificadas por PCR.
A amplificao pode ser feita utilizando-se
o DNA genmico ou cDNA. Amostras conten-

50

do algumas nanogramas de DNA podem ser utilizadas para amplificao de um gene de interesse. Aps a reao de PCR, a banda amplificada
correspondente ao gene clonada em um plasmdeo ou fago filamentoso, tal como descrito nos
itens anteriores. Deve-se salientar que o PCR
adequado para se clonar um gene especificamente, mas no para gerar genotecas representativas de todos os genes do organismo.
muito comum utilizar-se o PCR para isolar uma regio do gene, a qual posteriormente utilizada como sonda para o isolamento do
gene completo em uma biblioteca de cDNA ou
genmica.

PRINCPIOS DA BIOLOGIA MOLECULAR DO GENE

A) Rastreamento com sonda radioativa


Cap.

Genoteca
(colnias de bactrias contendo
diferentes fragmentos de DNA eucaritico)

Sonda
DNA genmico marcado
com 32p
Hibridao

Isolamento do fago
recombinante

Deteco por auto-radiografia


filme de Raio X

Clone

Placa original (me)

B) Imuno seleo de fagos recombinantes

Carimbo da placa em filtro

Rastreamento como soro


contendo anticorpo de interesse

Deteco de clones recombinantes com


imunoglobulinas acopladas peroxidase

Fig. 2.16 Isolamento de clones recombinantes. A) Rastreamento com sondas genticas radioativas e B) Imunosseleo
com anticorpos especficos.

BIBLIOGRAFIA
1. Darnell J, Lodish H, Baltimore D. Molecular Cell
Biology, Scientific American Books, New York,
1986.
2. Farah SB. DNA: Segredos e Mistrios. Editora Sarvier,
S. Paulo, Brasil, 1997.
3. Innis MA, Gelfand DH, Sninsky JJ, White TJ. PCR
Protocols: a guide to methods and applications,
Academic Press, New York, 1990.
4. Lewin B. Genes V, Oxford University Press, Oxford,
1994.

5. Maniatis T, Fritsch EF, Sambrook. Molecular Cloning:


A Laboratory Manual, Cold Spring Harbor, Segunda
Edio, 1989.
6. Watson JD, Hopkins NH, Roberts JW, Steitz JA, Wriner
AM. Molecular Biology of the Gene, 4th Edition,
The Benjamin/Cummings Publishing Company,
Menlo Park, California, Volumes 1 and 2, 1987.
7. Watson JD, Gilman M, Witkowski J, Zoller M. Recombinant
DNA. 2nd ed. W.H. Freeman and Company, Scientific
American Books, New York, 1992.
8. White BA. PCR Protocols: Current methods and
application, Methods in Molecular Biology, 15:1,
1993.

51

HEREDITARIEDADE, GENES E DNA

Cap.

Hereditariedade,
Genes e DNA
Yara M. Michelacci
Helena B. Nader
Marimlia A. Porcionatto,
Lucia O. Sampaio
Leny Toma
Estima-se que cerca de 30 milhes de espcies habitem hoje a Terra e que muitas vezes esse nmero j tenham vivido no passado
e estejam extintas. Existe uma enorme diversidade entre esses seres, classificados em seis
grandes categorias ou Reinos, definidos com
base em suas caractersticas: Archaebacteria,
Eubacteria, Protista, Fungi, Plantae e Animalia. Exemplos de organismos desses reinos so
apresentados na Fig. 3.1. So seres muito diferentes entre si. Mesmo se compararmos os
indivduos de uma mesma espcie, no encontraremos dois iguais. Como so mantidas, adquiridas e transmitidas as caractersticas de cada
espcie e de cada indivduo? Em outras palavras, quais so as bases da hereditariedade?
A unidade bsica dos seres vivos a clula.
Todos os organismos so compostos por clulas e todas as clulas vm de clulas preexistentes essas duas afirmativas constituem a teoria
celular. Tambm existem muitos tipos de clulas, sendo as menores e mais simples as clulas
procariticas, dos organismos dos reinos Archaebacteria e Eubacteria. As clulas dos organismos
dos demais reinos so eucariticas, isto , clulas que apresentam um ncleo verdadeiro, deli-

mitado pela membrana nuclear, que o separa


do restante da clula, o citoplasma. Nas clulas
eucariticas no existe ncleo, mas uma regio
nucleide. A Fig. 3.2 mostra micrografias eletrnicas de uma clula procaritica e de uma
eucaritica. No ncleo das clulas eucariticas
e na regio nucleide das procariticas ficam armazenadas as informaes genticas do organismo, responsveis pela manuteno e transmisso
de suas caractersticas.
Cerca de 300 trilhes de clulas (3x1014)
constituem o corpo humano adulto. Todas elas
so derivadas de uma nica clula a clulaovo ou zigoto. Durante o processo de transformao dessa nica clula no indivduo
adulto, seu ncleo d origem a mais de 100
trilhes de ncleos, cada um contendo basicamente a mesma informao gentica do ncleo da clula-ovo. Como isso acontece?
Todos os organismos herdam de seus pais a
informao gentica que especifica sua estrutura e funo. Da mesma forma, todas as clulas
vm de outras clulas, de modo que o material
gentico deve ser replicado e passado de uma
clula para a sua descendente, a cada diviso
celular. Assim, a questo de como a informao
gentica mantida, replicada e transmitida de

53

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Fig. 3.1 Exemplos de seres vivos dos diferentes Reinos: A: Eubacteria bactrias aderidas ponta de uma
agulha hipodrmica; B: Protista: Paramecium; C: Fungi; D: Plantae; E: Animalia.

clula para clula e de organismo para organismo central em biologia. Conseqentemente, a


elucidao do mecanismo de transmisso gentica e a identificao do DNA como o material gentico foram descobertas importantssimas para
o conhecimento atual da biologia molecular.

AS DESCOBERTAS DE MENDEL
Desde os primrdios da humanidade sabemos que muitas de nossas caractersticas, como
cor dos olhos e forma da face, so herdadas
de nossos pais. claro que tais caractersticas
no so restritas aos seres humanos e muito
antes do nascimento da cincia que estuda a
hereditariedade, a gentica, o homem j procurava melhorar a qualidade de vegetais e animais
domsticos atravs de cruzamentos. Baixos relevos e esculturas dos assrios e dos babilnios

54

revelam seus conhecimentos em medicina veterinria e demonstram que sabiam que as tamareiras se reproduzem sexualmente. O Cdigo de
Hammurabi (c. 1800 a.C.) menciona a polinizao manual das tamareiras femininas com
plen colhido das masculinas. Entretanto, as
caractersticas genticas s foram efetivamente
analisadas quando cruzamentos controlados foram feitos entre invidduos com caractersticas
bem definidas. Isso foi realizado, pela primeira
vez, pelo monge austraco Gregor Johann Mendel (1822-1884).
Algumas observaes que Mendel considerou teis para o seu trabalho haviam sido feitas
no final do sculo XVIII pelo botnico alemo
Josef Gottlieb Klreuter. Klreuter estudou muitas plantas por polinizao cruzada e produziu
hbridos (descendentes de pais geneticamente
diferentes). Apesar de alguns de seus hbridos

HEREDITARIEDADE, GENES E DNA

B
Cap.

Membrana
nuclear

Ncleo

Regio nucleide

Fig. 3.2 Micrografias eletrnicas de uma clula procaritica (esquerda) e de uma clula eucaritica. Na clula eucaritica, alm do ncleo existem inmeras organelas citoplasmticas.

apresentarem caractersticas intermedirias entre os pais (seguindo o pensamento vigente na


poca), outros no eram intermedirios, mas se
pareciam muito com um dos pais.
Outro dado importante, recm-descoberto
na poca, que um gameta feminino deve se
combinar com um gameta masculino para que
ocorra a fecundao. Por outro lado, o papel dos
cromossomos como portadores da informao
gentica era desconhecido e os processos de
mitose e meiose ainda no haviam sido descobertos.
Esse era o estado da arte em gentica quando Mendel iniciou seu trabalho, para o qual estava muito bem qualificado. Havia estudado fsica,
qumica e matemtica na Universidade de Viena
e provavelmente foi isso que o levou a aplicar
mtodos experimentais quantitativos ao estudo da
hereditariedade.
Mendel investigou os princpios bsicos da
hereditariedade num perodo de nove anos, cruzando ervilhas de diferentes morfologias. Seus
resultados foram divulgados numa conferncia,
em 1865, e publicados em detalhes, em 1866.
Apesar dessa publicao ter sido distribuda a
120 bibliotecas e separatas terem sido enviadas
a, no mnimo, 40 renomados bilogos da poca,

o trabalho ficou esquecido por mais de 30 anos,


ou porque as bases fsicas de sua teoria s foram
entendidas aps a descoberta da meiose ou porque os bilogos no estavam habituados a pensar em termos matemticos e no entenderam
nem a matemtica simples utilizada por Mendel. Ento, em 1900, as descobertas de Mendel
vieram luz, como resultado de experimentos
independentes realizados pelo holands Hugo de
Vries, pelo alemo Karl Correns e pelo austraco Erich von Tschermak. Todos citaram o trabalho de Mendel, de 1866.
Mendel escolheu a ervilha para seus estudos
devido facilidade de cultivo, possibilidade de
se fazer polinizao controlada e disponibilidade de variedades com diferentes traos hereditrios (traos passados de uma planta para a
que nascia da sua semente). Numa primeira etapa, foram selecionados espcimens com traos
hereditrios bem definidos: ervilha de flores
brancas s dava descendentes de flores brancas.
Mendel concentrou-se nos sete pares de traos
contrastantes apresentados na Fig. 3.3. Coletava o plen de uma planta contendo um trao,
digamos semente lisa, e colocava no estigma
(rgo feminino) de outra contendo o outro trao, semente rugosa. As plantas doadoras e re-

55

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Forma da semente
Cap.

Lisa

Rugosa

Cor da semente
Amarela

Verde

Cor da flor
Prupura

Branca

Forma da vagem

Inflada

Com constrices

Cor da vagem

Verde

Amarela

Posio da flor

Axial

Terminal

Altura do caule

Alto

Ano

Fig. 3.3 Traos hereditrios estudados por Mendel.

ceptoras do plen eram a gerao parental, designada por P. As sementes formadas eram, ento,
plantadas e as plantas que nasciam constituam
a gerao filha F1. Estas eram examinadas quanto
aos traos escolhidos e contadas. Ento, essas
plantas se autopolinizavam (cruzamento mono-

56

hbrido) ou eram cruzadas com as parentais novamente (cruzamento di-hbrido), dando a segunda gerao, F2.
No primeiro experimento, Mendel estudou
espcimens que diferiam por um nico trao.
Usou plen de plantas que produziam sementes
rugosas para polinizar plantas que produziam
sementes lisas. Tambm fez o cruzamento recproco: plens de plantas que produziam sementes lisas para fecundar plantas que produziam
sementes rugosas. Foram obtidas 253 plantas
em F1 e todas produziam sementes lisas. como
se o trao rugoso tivesse desaparecido. Essas
sementes se autopolinizaram, produzindo 7.324
sementes F2, das quais 5.474 eram lisas e 1.850
eram rugosas. Mendel observou que o trao
semente lisa dominante porque foi expresso
sobre o trao semente rugosa, que ele chamou recessivo. Nos demais traos estudados, um
sempre foi dominante e o outro recessivo: em F1
apenas um dos traos aparecia, mas o outro voltava a aparecer em F2. Mais importante, a relao entre os dois traos em F2 era sempre a
mesma: aproximadamente 3:1 isto , de F2
tinham o trao dominante e , o recessivo.
Esses resultados vo contra a teoria amplamente aceita na poca de que a hereditariedade
um fenmeno de mistura. Segundo essa teoria, as sementes de Mendel deveriam ter uma
aparncia intermediria, levemente rugosa. Alm
disso, essa teoria era incapaz de explicar o reaparecimento das sementes rugosas em F2. Mendel props uma teoria particulada, segundo a
qual os elementos responsveis pela hereditariedade estariam presentes em unidades definidas,
que retm sua integridade em presena de outras unidades. Seus dados numricos indicam
que cada ervilha contm duas dessas unidades
para cada caracterstica, cada uma proveniente
de uma planta parental. Cada gameta contm
uma unidade, e o zigoto resultante, do qual todas as clulas do adulto derivam, contm duas.
A unidade de Mendel hoje chamada gene.
A aparncia fsica de uma caracterstica o
seu fentipo. Mendel sups corretamente que o
fentipo fosse resultado do gentipo, ou constituio gentica do organismo que apresenta o
fentipo. As diferentes formas de um gene so
chamadas alelos.
Numa segunda srie de experimentos, Mendel usou espcimens que diferiam por dois tra-

HEREDITARIEDADE, GENES E DNA

os e realizou com elas cruzamentos di-hbridos. Seus resultados levaram segunda lei de
Mendel: Alelos de diferentes genes segregamse independentemente durante a formao dos
gametas. interessante notar que todos os genes que Mendel estudou localizam-se em cromossomos diferentes.
Alguns genes tm alelos que no so nem
dominantes nem recessivos. Nesses casos, o heterozigoto apresenta um fentipo intermedirio
entre os fentipos parentais, semelhante ao previsto pela antiga teoria da hereditariedade por
mistura. claro que as partculas hereditrias,
os genes, no se misturam e essa herana pode
ser perfeitamente entendida pelo modelo mendeliano.

OS GENES LOCALIZAM-SE
CROMOSSOMOS

NOS

Mais ou menos na mesma poca em que


Mendel fez suas observaes, descobriu-se tambm que a hereditariedade transmitida atravs
do vulo e do espermatozide. Porm, a relao
entre gene e cromossomo s veio em 1902, dos
trabalhos desenvolvidos pelo americano Walter
Sutton. Estudando a meiose, ele props que o
material gentico se localizasse no ncleo, uma
vez que os dois gametas devem contribuir com a
mesma quantidade de material gentico para a
formao da clula-ovo e, como o espermatozide tem pouco citoplasma em relao ao ncleo, a conjectura lgica foi atribuir ao ncleo o
papel de conter os determinantes hereditrios de
uma clula. Logo depois, os cromossomos foram evidenciados dentro do ncleo, atravs do
uso de corantes especiais (chromo-, do grego,
cor) e verificou-se que as clulas de uma determinada espcie contm um nmero constante
de cromossomos. Poucos anos depois, demonstrou-se que nos espermatozides e nos vulos o
nmero de cromossomos exatamente a metade (haplide ou N) do encontrado nas clulas
somticas (diplide ou 2N). Durante a mitose
(o processo de diviso celular), a partio dos
cromossomos exata: cada clula recebe uma
cpia de cada cromossomo. Em contraste, na
meiose (formao dos gametas), o nmero de
cromossomos reduzido metade (N). O processo de fecundao restaura o nmero de cromossomos 2N caracterstico das clulas

somticas de cada espcie, um cromossomo de


cada par vem do pai e outro, da me. Portanto,
os cromossomos comportam-se exatamente
como deveriam se fossem os responsveis pelos
genes de Mendel.
A primeira caracterstica a ser atribuda aos
cromossomos foi a determinao do sexo. O trabalho foi feito na Universidade Columbia, nos
EUA, onde Nettie Stevens e Edmund Wilson
descobriram, em 1905, os chamados cromossomos sexuais. Esses pesquisadores demonstraram
que um cromossomo, chamado X, est presente
em duas cpias nas fmeas mas apenas em uma
cpia nos machos, que tambm contm um cromossomo Y, morfologicamente diferente. Na
formao dos gametas, todos os vulos contm
obrigatoriamente um cromossomo X, mas os espermatozides podem conter um cromossomo
X ou um Y. A fecundao do vulo por um espermatozide contendo cromossomo X gera uma
fmea (XX), enquanto a fecundao por um espermatozide contendo cromossomo Y gera um
macho (XY). Era natural especular, ento,
que todas as caractersticas, no apenas as
que determinam o sexo, estivessem localizadas
nos cromossomos. A confirmao inicial veio
logo depois, entre 1910 e 1915, dos trabalhos
de Thomas Hunt Morgan, com cruzamentos da
mosca de frutas Drosophila melanogaster, que
demonstrou a relao entre uma forma mutante
de uma caracterstica (olho branco) e o sexo.
Cruzando moscas de olho vermelho (forma selvagem, no-mutada) com moscas de olho branco, Morgan verificou que olho vermelho
dominante, visto que s aparecem moscas de
olho vermelho em F1. Contudo, em F2, a relao
entre moscas de olho vermelho e moscas de olho
branco um 3:1 imperfeito e com uma caracterstica interessante: todas as moscas de olho
branco so machos. Para verificar se havia algum problema de inviabilidade das fmeas de
olho branco, Morgan cruzou as moscas de F1
(heterozigotas) com os machos de olho branco
e obteve moscas de olho vermelho e branco,
machos e fmeas. A resposta a esse enigma est
no sexo: o gene para cor do olho est no cromossomo X. Como as fmeas tm dois cromossomos X, s aparece olho branco quando os dois
codificam essa forma; os machos tm apenas um
cromossomo X (e um cromossomo Y). Nos anos
seguintes, muitos outros mutantes foram mapea-

57

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

dos no cromossomo sexual ou nos outros cromossomos (autossomos).


Cap.

Em 1903, Hugo de Vries sugeriu que houvesse troca de material gentico entre os cromossomos para explicar o fato de haver mais
segregao entre caractersticas do que o nmero de cromossomos e, em 1909, o citologista F.
A. Janssens apresentou as evidncias experimentais para essa sugesto (crossing over).
Portanto, no incio do sculo se determinou
que a informao gentica estava contida nos
cromossomos. Mas em que tipo de molcula?
Qual a natureza qumica das molculas responsveis por essa memria hereditria?

QUAL A NATUREZA QUIMCA

DOS

GENES?

Durante os mesmos anos em que Mendel


fazia seu trabalho com ervilhas, o qumico suo
Friedrich Miescher tentava identificar a composio qumica dos ncleos celulares. Mischer
realizou seus estudos em pus de bandagens removidas de ferimentos de soldados e descobriu
que o ncleo contm grandes quantidades de
protenas e de um novo composto, que hoje chamamos DNA cido desoxirribonuclico. Entretanto, a gentica e o DNA no se encontraram
at 1944.
Em 1941, G. W. Beadle e E. L. Tatum concluram que um gene responsvel por uma
enzima. Trabalhando com o fungo Neurospora
crassa, um organismo simples que pode ser cultivado em laboratrio a partir de um nico esporo, isolaram mutantes que s cresciam quando
uma vitamina ou um aminocido era adicionado
ao meio. Concluram que faltava uma enzima e,
por isso, o organismo era incapaz de sintetizar
esse composto simples. Entretanto, a natureza
qumica do gene era ainda desconhecida.
A histria da biologia est repleta de casos
em que a pesquisa num campo contribui para
outro, aparentemente no relacionado. Um
exemplo o trabalho do mdico ingls Frederick Griffith. Na dcada de 1920, Griffith estava
estudando o comportamento do Streptococcus
pneumoniae, ou pneumococcus, um dos agentes
que causa pneumonia no homem. Identificou
duas cepas, designadas S, que produzia colnias brilhantes e lisas (smooth) em cultura, e R,
cujas colnias eram rugosas (rough). Quando a

58

cepa S era injetada em camundongo, ele morria


em 24 horas (Fig. 3.4). Quando a cepa R era
injetada, a doena no aparecia. Em outras palavras, a cepa S virulenta (causa doena) e a
cepa R no-virulenta. Na tentativa de obter uma
vacina contra a pneumonia, Griffith inoculou camundongos com pneumococcus S mortos pelo
calor e os animais no desenvolveram a doena.
Entretanto, quando os animais foram inoculados com uma mistura de bactrias vivas da cepa
R (no-virulenta) e bactrias mortas da cepa S,
todos morreram de pneumonia. O sangue desses camundongos estava repleto de bactrias vivas, muitas das quais da cepa S. Griffith concluiu
que, em presena dos pneumococci S mortos,
alguns dos pneumococci R haviam sido transformados em organismos virulentos. Alguma
substncia do pneumococcus S morto, chamada

Injeo
Camundongo
morre

Cepa S viva

Injeo

Camundongo
saudvel

Cepa R viva
Injeo

Calor

Cepa R
viva

Cepa S morta
pelo calor
Injeo

Mistura de
cepa R viva e
cepa S morta

Camundongo
saudvel

Camundongo
morre

Bactria de cepa S vivas


isoladas do camundongo
morto

Fig. 3.4 Experimento de Griffith demonstrando a transformao gentica do pneumococcus da cepa R, no-virulenta, na cepa S, virulenta.

HEREDITARIEDADE, GENES E DNA

na poca princpio transformante, causou uma


modificao nas clulas R. Portanto, esse princpio carregava informao gentica.
Contudo, a identificao da natureza qumica do princpio transformante s ocorreu em
1944, atravs dos experimentos clssicos de
Oswald Avery, Colin MacLeod e MacLyn McCarty, com o mesmo Streptococcus pneumoniae.
Eles trataram amostras do princpio transformante de modo a destruir diferentes tipos de substncias: protenas, cidos nucleicos, carboidratos
e lipdeos e depois testaram as amostras para verificar a presena da atividade transformante. A
resposta era sempre a mesma: se o DNA fosse
destrudo, a atividade transformante era perdida.
Todos os demais componentes eram dispensveis. Na etapa final, os autores demonstraram que
DNA altamente purificado das amostras de princpio transformante era muito ativo na induo
de transformao. Apesar de conclusivos, esses
resultados no foram prontamente aceitos pela
comunidade cientfica, que acreditava que as molculas que carregavam a informao gentica
eram protenas.
Em 1952, Alfred Hershey e Martha Chase,
estudando a infeco de bactrias por vrus bacterifagos, demonstraram que apenas o DNA
do vrus e no sua poro protica penetra
na clula bacteriana para iniciar uma infeco.
Portanto, a informao gentica que causa a formao de novos vrus est no DNA e no na
protena.
No ano seguinte, 1953, o fsico ingls Francis H. C. Crick e o geneticista americano James
D. Watson, ambos no laboratrio Cavendish da
Universidade de Cambridge, na Inglaterra, usaram a tcnica de construo de modelos moleculares desenvolvida pelo qumico Linus Pauling
e deduziram a estrutura em dupla hlice do
DNA. Os dados que permitiram a eles chegarem a esse modelo foram: a) Erwin Chargaff e
seus colaboradores separaram e quantificaram
as quatro bases em DNAs de muitas espcies
diferentes e de diferentes tecidos de um mesmo
organismo e verificaram que sempre a quantidade de adenina igual quantidade de timina
e a quantidade de citosina sempre igual de
citosina. Esses dados sugerem pares de bases;
b) Maurice Wilkins e Rosalind Franklin obtiveram imagens de raios X de fibras de DNA que
sugeriram uma estrutura em hlice. Watson e

Crick tambm foram influenciados pela descrio das pontes de hidrognio, por Linus Pauling, e pela a hlice, um elemento comum na
estrutura secundria de protenas. Os resultados de medidas de densidade e construo de
modelos sugeriram que existissem duas cadeias
polinucleotdicas na molcula. Os estudos de
modelagem tambm levaram concluso que as
duas cadeias do DNA correm em sentidos opostos, isto , so antiparalelas e formam uma hlice que gira para a direita. Desses estudos tambm
surgiram dados quanto distncia entre bases
adjacentes 0,34nm e o passo da hlice
3,4nm (cerca de 10 pares de bases).

ESTRUTURA DO DNA
A identificao do DNA como a molcula
que carrega a informao gentica nos cromossomos imediatamente focalizou a ateno dos
pesquisadores na sua estrutura. S se conhecendo a estrutura do DNA poder-se-ia chegar a
compreender como essa molcula carrega a informao gentica e como faz cpias idnticas
de si mesma. No incio, os pesquisadores imaginaram que estruturas peculiares a cada gene
pudessem existir, de modo que foi um grande
alvio quando se descobriu que a estrutura fundamental do DNA a dupla hlice e que todos
os genes tm, basicamente, a mesma estrutura,
resultando as diferenas da ordem em que se
colocam as quatro unidades do DNA, os nucleotdeos (Fig. 3.5).
Agora, mais de 40 anos aps a descoberta
da dupla hlice, j se verificou que a estrutura
do DNA no to simples como se pensou. Hoje
no se fala mais na estrutura do DNA, mas em
estruturas do DNA.

Base
nitrogenada

Fosfato

Acar

Fig. 3.5 Diagrama esquemtico de um nucleotdeo trifosfato.

59

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

A Dupla Hlice
Cap.

O DNA um polmero e, como todo polmero, constitudo por unidades menores que
se ligam umas s outras. As unidades construtivas ou building blocks que constituem o DNA
so os desoxirribonucleotdeos. Nucleotdeos so
compostos formados por um acar ao qual se
ligam um resduo de cido fosfrico e uma base
nitrogenada. No DNA, o acar a 2-desoxirribose, uma pentofuranose. O grupamento fosfato fica ligado ao carbono 5 do acar e a base
liga-se ao carbono 1, atravs do OH glicosdico.
Para que no haja confuso quanto numerao dos tomos de carbono na base e no acar,
os carbonos do acar so designados pelo nmero acrescido de linha (1, 2, etc.). Existem
quatro bases: adenina (A), timina (T), guanina
(G) e citosina (C), sendo que adenina e guanina
so bases pricas, enquanto timina e citosina so

bases pirimdicas. A Fig. 3.6 mostra as estruturas dos quatro principais desoxirribonucleotdeos
do DNA.
Na cadeia polinucleotdica, os acares so
unidos por ligaes 3 5 fosfodister (Fig. 3.7),
formando o chamado esqueleto de acar-fosfato ou backbone, que muito regular. Por outro lado, a seqncia de bases ao longo das
cadeias altamente variada. Tanto as bases pricas como as pirimdicas so planas, relativamente insolveis em gua e tendem a empilhar,
de modo mais ou menos perpendicular direo do eixo da hlice. As duas extremidades da
cadeia so diferentes: uma tem um grupamento
fosfato no carbono 5 livre e a outra tem o OH
do carbono 3livre. Essas extremidades so chamadas, respectivamente, 3 e 5.
O DNA formado por duas cadeias, mantidas juntas por pontes de hidrognio entre pares

Fig. 3.6 Estruturas qumicas dos principais nucleotdeos do DNA.

60

HEREDITARIEDADE, GENES E DNA

Extremidade 5

Ponte de
hidrognio

Timina

H2C5

C
H

N
C
C

Desoxirribose

H
H

H
O

H C

O
G

O
H

C C

H2C5

Citosina

3
O

Desoxirribose

H2C5

N
C
N

Adenina

N
N

H C

3
O

C C

O
H

Cap.

H C

H
OH

N
C
O

N H

Desoxirribose

Guanina
N
H
C C
C
H N

C N
C N
H N
H
Desoxirribose
O

Extremidade 3
Fig. 3.7 Ligaes fosfodister na cadeia de DNA e extremidades 3 e 5.

de bases. Esse pareamento especfico: adenina pareia com timina e guanina, com citosina
(Fig. 3.8). Entre adenina e timina (par AT) formam-se duas pontes de hidrognio e entre guanina e citosina (par GC), trs. A especificidade
de pareamento das bases resulta numa relao de
complementaridade entre as seqncias de bases
das duas cadeias. Como A s pareia com T e G
com C, as quantidades de A e T so iguais, assim
como as quantidades de G e C. Entretanto, a relao A+T/G+C varia de espcie para espcie,
sendo igual a 1,7 para o homem. Na dupla hlice,
as duas cadeias pareadas so antiparalelas, isto ,
a extremidade 5 de uma pareia com a extremidade 3 da outra e vice-versa (Fig. 3.9).
As duas ligaes glicosdicas que ligam o par
de bases a seus acares correspondentes no so
diretamente opostas umas s outras (Fig. 3.8).
Isso faz com que os dois esqueletos de acarfosfato no sejam igualmente espaados ao longo do eixo da hlice, de modo que as duas fendas
que se formam na hlice entre esses esqueletos

Fig. 3.8 Pontes de hidrognio entre adenina-timina e


guanina-citosina. Observe que as ligaes glicosdicas com
desoxirribose no so diretamente opostas.

tm tamanhos diferentes (Fig. 3.9). Formam-se,


ento, uma fenda maior ou principal e uma fenda menor ou secundria, que interagem de modos diferentes com protenas e outras molculas.
Quando molculas de DNA dupla fita so
aquecidas acima da temperatura fisiolgica (at
quase 100C), suas pontes de hidrognio se rompem e as cadeias complementares se separam.
Esse processo chamado desnaturao. O DNA
com alto contedo de GC mais resistente
desnaturao que molculas ricas em AT, visto
que cada par GC unido por trs pontes de hidrognio, enquanto cada par AT mantido por
duas pontes. Em temperaturas intermedirias, o
DNA pode ser parcialmente desnaturado. O
DNA desnaturado pode se renaturar, de modo
que hbridos podem se formar.

Outras Conformaes do DNA


H duas formas bem caracterizadas de DNA
com hlice girando para a direita, chamadas

61

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

A-DNA e B-DNA. Elas diferem entre si pela distncia necessria para completar uma volta da
hlice e pelo ngulo que as bases fazem com o
eixo da hlice. A conformao B mais longa e
mais fina, com um dimetro de 2,34nm e uma
distncia de 0,34nm entre os pares de bases,
orientados perpendicularmente ao eixo da hlice. Para completar um passo da hlice so necessrios dez pares de bases (3,4nm).
Separando os dois esqueletos de acar-fosfato, h duas fendas bem evidentes. O B-DNA se
converte no A-DNA inclinando-se os pares de
bases cerca de 30, de modo que a distncia
entre os pares de bases passa a ser 0,23nm e o
dimetro, 2,55nm. So necessrios 11 pares de
bases para completar um passo da hlice, que
tem 2,53nm. A fenda entre os esqueletos de acar-fosfato no A-DNA mais profunda e mais
fina que a fenda maior do B-DNA. Em soluo,
geralmente o DNA assume a conformao B. A
conformao A aparece quando pouca gua est
disponvel para interagir com a dupla-hlice. O
hbrido DNA-RNA tambm assume a conformao A, assim como o RNA dupla fita, que aparece em regies dos tRNAs e rRNAs e em RNAs
de vrus.
DNA contendo resduos alternados de purina e pirimidina pode formar uma hlice que gira
para a esquerda. Nesse caso, a ligao entre a
base e o acar est na configurao anti para os
resduos de pirimidina e na configurao syn para
os resduos de purina (Fig. 3.10). No DNA com
hlice que gira para a direita, a ligao glicosdica
sempre anti. a configurao diferente dos nucleotdeos de purinas que faz a hlice girar para a
esquerda. As configuraes alternadas anti-syn
do ao esqueleto do DNA um aspecto em ziguezague. Por isso, essa configurao chamada ZDNA. O Z-DNA uma hlice mais fina (1,84 nm
de dimetro) e mais longa (0,38nm entre as bases) que o B-DNA. O passo da hlice de 4,56nm
e compreende 12 pares de bases. Apenas uma fenda profunda, correspondente fenda menor do
B-DNA caracteriza a superfcie externa do ZDNA. Em soluo, as seqncias alternadas de
purina-pirimidina assumem a conformao Z
apenas em altas concentraes de ctions. A metilao de resduos de citosina tambm favorece a
transio de B-DNA para Z-DNA. A Fig. 3.11
mostra o B-DNA e o Z-DNA.

62

0,34nm
G

A
G

3,4nm

G
C

G
A

G
Fenda
menor

A
G

A
C

Fenda
maior

Fig. 3.9 Estrutura em dupla hlice do DNA.

Metilao do DNA
Uma pequena frao dos resduos de citosina do DNA da maioria dos cromossomos de
eucariotos contm grupos metil ligados ao carbono 5 (5-metilcitosina ou m5C). Esses grupos
so adicionados por enzimas especficas, as DNA
metilases, aps a incorporao dos resduos de
citosina s cadeias de DNA.
Grupos metil podem, tambm, ser adicionados a resduos de adenina, formando 6-metiladenina. Em clulas procariticas, adenina
metilada mais comum que citosina metilada,
enquanto em eucariotos, quase todos os grupos
metil so adicionados a resduos de citosina.
Esses dados j indicam que a estrutura do
DNA no homognea: certas seqncias de

HEREDITARIEDADE, GENES E DNA

bases, metiladas ou no, determinam diferentes


conformaes, que podem ser reconhecidas por
protenas que interagem com o DNA. O padro
de metilao do DNA tambm importantssimo
para os procedimentos da engenharia gentica,
como ser visto em outros captulos deste livro.

Superenrolamento
Molculas lineares de DNA podem girar livremente uma cadeia em torno da outra. Entretanto, quando as duas extremidades de uma
molcula de DNA ligam-se covalentemente, formando uma molcula circular, o nmero de vezes que uma cadeia gira em torno da outra
fixado. Esse nmero chamado linkage number.
Quando a estrutura circular fica perfeitamente
assentada sobre uma superfcie plana, sem alterar a geometria da dupla hlice, ela dita relaxada. Se, entretanto, antes de unir as extremidades,
uma fita girar em torno da outra no sentido do
enrolamento ou do desenrolamento, aps a unio
o DNA apresentar uma tenso, que poder ser
relaxada de trs maneiras (Fig. 312): a) a tenso
poder ser anulada se a hlice se enrolar sobre si
mesma, gerando um superenrolamento ou supercoil. Nesse caso, a fita de DNA no mais plana. Se o superenrolamento resultar de uma
diminuio no linkage number, dizemos que
um superenrolamento negativo. Esse o tipo de
estrutura normalmente encontrado na natureza.
Se o superenrolamento resultar de um aumento
no linkage number, chamado superenrolamento
positivo; b) se a tenso resultar de desenrolamento, ela pode se concentrar num ponto especfico do anel, onde as bases ficam no-pareadas;
c) estruturas alternativas podem ser geradas,
como DNA cruciforme, triplex ou Z-DNA. Existem enzimas que catalisam a mudana no linkage number de molculas de DNA. Essas enzimas
so chamadas topoisomerases.
As molculas de DNA cromossmico de procariotos, de plasmdeos, DNA mitocondrial e
DNA de cloroplastos so circulares, enquanto as
molculas de DNA cromossmico de eucariotos
so lineares.

CROMOSSOMOS E CROMATINA
Nas clulas, geralmente o DNA ocorre complexado a protenas especficas, formando a

cromatina. Em eucariotos, as protenas mais proeminentes que se ligam ao DNA so as histonas. Histonas so protenas relativamente
pequenas, ricas em arginina e lisina, que se agregam para formar estruturas elipsides em torno das quais o DNA se enrola. Essas estruturas
so chamadas nucleossomos. Cada nucleossomo formado por um octmero de histonas
centrais: H2A, H2B, H3 e H4, duas cpias de
cada. O DNA fica enrolado em torno desse
complexo, num superenrolamento negativo,
dando duas voltas em torno do octmero de
histonas, com pontos de entrada e sada do
nucleossomos muito prximos um do outro.
A esse complexo, chamado partcula central,
est associada, externamente, uma molcula
de histona H1 (Fig. 3.13). Nucleossomos adjacentes so conectados entre si pela molcula
de DNA. O DNA entre dois nucleossomos adjacentes chamado DNA de ligao e sua extenso pode variar de 0 a 80 pares de bases
(pb). A composio dos nucleosomos lado a
lado, ou fibra de 10nm, constitui o primeiro nvel de compactao da cromatina. A fibra de
30nm representa o segundo nvel de compactao e formada pelo enrolamento da fibra de
10 nm (Fig. 3.14). Essas estruturas formam os
cromossomos. Um cromossomo eucaritico
uma nica molcula de DNA enrolada em torno das histonas. Durante a interfase, quando a
clula no est se dividindo, os cromossomos
no so individualizados microscopia ptica,
mas os nucleossomos podem ser vistos microscopia eletrnica. Quando a clula vai entrar em diviso, os cromossomos se duplicam
e, depois, se enrolam muito, reduzindo seu
comprimento de centmetros para nm (10.000
vezes, pelo menos). Tornam-se, ento, visveis
microscopia ptica, mostrando a aparncia
duplicada que estamos acostumados a ver.
O DNA uma molcula muito, muito grande. A Tabela 3.1 mostra o nmero de cromossomos de clulas eucariticas e o tamanho do seu
genoma. As bactrias tm apenas uma molcula
de DNA cromossmico, embora molculas de
DNA extracromossmico tambm possam estar
presentes. Essas molculas de DNA so circulares e tambm apresentam superenrolamento negativo. Nos organismos eucariticos, vrias
molculas de DNA existem no ncleo, constituindo seus cromossomos.

63

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Carbono
Cap.

Hidrognio
Oxignio
Nitrognio
Fsforo

Desoxiguanilato no B-DNA
conformao anti

Desoxiguanilato no Z-DNA
conformao syn
Fig. 3.10 Conformao do desoxiguanilato no B-DNA (anti) e no Z-DNA (syn).

O genoma da maioria dos eucariotos


maior e mais complexo que dos procariotos.
Isso no surpreendente, porque esperar-seia encontrar mais genes em organismos mais
complexos. Entretanto, o tamanho do genoma
de muitos eucariotos no parece estar relacionado com sua complexidade gentica. Por exemplo, o genoma do lrio contm mais de dez vezes
mais DNA que o genoma humano e o lrio no
dez vezes mais complexo que o homem. Esse
aparente paradoxo foi resolvido pela descoberta que os genomas eucariticos contm no apenas genes funcionais, mas tambm grande
quantidade de seqncias que no codificam protenas. A diferena de tamanho entre o genoma
humano e o genoma de E. coli tambm no

64

devida ao nmero de genes. Estima-se que o


genoma humano contenha aproximadamente
100.000 genes, s 25 vezes mais que o genoma
de E. coli. A complexidade do genoma eucaritico resulta da abundncia de vrios tipos de seqncias no codificantes.

Estudando a Estrutura do DNA


Quando se determinou o tamanho do DNA
eucaritico, muitos biologistas moleculares ficaram
to desanimados que mudaram de campo de trabalho. Era impossvel determinar a estrutura e a
organizao de molculas to grandes, em especial do DNA eucaritico. Novas metodologias precisavam ser desenvolvidas para que se pudesse

HEREDITARIEDADE, GENES E DNA

Z-DNA

Superendrolamento
negativo

B-DNA

Cap.

Fenda
menor

Bases no-pareadas
Fenda
maior

DNA relaxado

DNA cruciforme

Fenda
menor

Fig. 3.12 DNA relaxado e DNA no-relaxado. A tenso pode ser relaxada de trs maneiras: gerando superenrolamento, concentrando a tenso numa regio que fica
com bases no-pareadas ou gerando estruturas alternativas, como DNA cruciforme.

Fig. 3.11 Z-DNA e B-DNA.

determinar a seqncia de bases de um pedao de


um gene, depois de um gene inteiro e, depois, de
um cromossomo inteiro. Mesmo o pequeno DNA
de um vrus no podia ser seqenciado inteiro.
O primeiro cido nuclico a ser seqenciado no foi um DNA, mas um RNA transportador. Em 1964, na Universidade Cornell, o tRNA
da alanina de levedura foi seqenciado e, em
1975, quando o RNA cromossmico do vrus
MS2 foi seqenciado, pela primeira vez foram
determinados os cdons que especificam cada
aminocido das trs protenas codificadas pelo
vrus. O seqenciamento do DNA, contudo, no
era possvel porque as DNases que existiam eram
inespecficas e quebravam o DNA aleatoriamente, em fragmentos dos mais diferentes tamanhos.
A idia geral que nunca seriam encontradas enzimas que quebrassem o DNA de modo
mais especfico. A nica indicao de que podia

ser de outra forma vinha de uma observao,


feita em 1953: se o DNA de uma cepa de E. coli
fosse introduzida em E. coli de outra cepa, raramente ele funcionava geneticamente, sendo logo
degradado a fragmentos menores. Como a bactria reconhecia e degradava o DNA estranho?

2 molculas de cada:
H2A, H2B, H3 e H4
DNA

HI

11nm
Fig. 3.13 Nucleossomo.

65

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Partcula central
do nucleossomo

30nm
10nm

DNA

Fig. 3.14 Fibras de cromatina. O enrolamento do DNA em nucleossomos gera uma fibra de cromatina de aproximadamente 10nm de dimetro. A cromatina mais condensada formando a fibra de 30nm, contendo cerca de 6 nucleossomos
por volta.

Tabela 3.1
Nmero de Cromossomos e Tamanho do Genoma de Clulas
Organismo

Nmero de
Cromossomos

Tamanho do Genoma
(Mb)a

Tamanho do
Genoma (mm)

Bactria (Eschericchia coli)

4,7

1,6

Levedura
(Saccharomyces cerevisiae)

16

14

4,8

70

23,8

10

5.000

1.700,0

15.000

5.100,0

12

50.000

17.000,0

165

56,1

R (Xenopus laevis)

18

3.000

1.020,0

Galinha

39

1.200

408,0

Camundongo

20

3.000

1.020,0

Co

39

3.000

1.020,0

Homem

23

3.000

1.020,0

Dictyostelium
Milho
Cebola
Lrio
Mosca de fruta
(Drosophila melanogaster)

a
Tanto o tamanho do genoma como o nmero de cromossomos refere-se s clulas haplides. Mb = milhes de pares
de bases.

Em 1966, estudando a estrutura do DNA


de um vrus modificado, que sobrevivia em E.
coli, verificou-se a presena de bases metiladas,
ausentes no DNA no modificado. Ser que a
metilao impede a ao de DNases?
A situao era essa no final da dcada de 60,
quando Stewart Linn e Werner Arber, trabalhando em Genebra, na Sua, isolaram uma enzima

66

que metilava DNA no-metilado e uma endonuclease de restrio, que quebrava o DNA no-metilado. Nos anos seguintes, endonucleases e as
metilases que as acompanhavam foram isoladas de
outras duas cepas de E. coli, abrindo a possibilidade de existirem muitas enzimas stio-especficas.
Essas primeiras enzimas, contudo, embora
reconhecessem seqncias especficas no-me-

HEREDITARIEDADE, GENES E DNA

tiladas, quebravam o DNA aleatoriamente, no


apenas na regio reconhecida. Um pouco mais
tarde, endonucleases que reconhecem e quebram
o DNA em pontos especficos foram descobertas. A primeira foi isolada de Haemophilus influenzae por Hamilton Smith, em 1970, na Johns
Hopkins University. Essa endonuclease de restrio, chamada HindII, quebrava DNA E. coli
e de bacterifago (um vrus), mas no quebrava
o DNA da prpria bactria. A enzima altamente
purificada quebra a seqncia abaixo, onde Pu
significa qualquer purina e Py, qualquer pirimidina:
(5)GTPyPuAC(3)
(3)CAPuPyTG(5)
Desde ento, endonucleases de restrio foram isoladas de centenas de cepas de bactrias,
especficas para mais de 150 stios de clivagem
diferentes. Essas enzimas reconhecem seqncias de quatro a oito bases. Os fragmentos gerados quando um DNA quebrado por uma
endonuclease de restrio podem ser separados
por eletroforese em gel de agarose. Enzimas diferentes geram diferentes fragmentos de restrio a partir do mesmo DNA.
Quando os primeiros fragmentos de restrio surgiram, ainda no havia mtodo que
permitisse seqenci-los diretamente. Uma descoberta muito importante foi que possvel fazer eletroforese em gel de poliacrilamida e
separar fragmentos que diferem entre si por ape-

nas um par de bases (bp). Grande avano veio


com o estabelecimento de metodologias que permitem o seqenciamento de fragmentos de DNA
de 100 a 500bp. O primeiro foi desenvolvido
por Fred Sanger em 1975, um mtodo enzimtico. Logo em seguida, em 1977, Allan Maxam
e Walter Gilbert, na Universidade Harvard, desenvolveram outro mtodo que se baseia numa
degradao qumica do DNA. Fred Sanger desenvolveu, mais tarde, um segundo mtodo com
base em tcnicas enzimticas.
Hoje, genomas completos de alguns organismos j foram seqenciados e o Projeto Genoma, um projeto de cooperao internacional,
j publicou o primeiro rascunho de toda a seqncia do genoma humano.

Bibliografia
1. Cooper GM. The Cell: A Molecular Approach. ASM Press
and Sinauer Associates, Inc, 1997.
2. Lodish H, Baltimore D, Berk A, Zipursky SL, Matsudaira
P, Darnell J. Molecular Cell Biology. Third Edition.
Scientific American Books, 1995.
3. Purves WK, Orians GH, Heller HG. Life. The Science
of Biology. Fourth Edition. Sinauer Associates, Inc.,
W. H. Freeman and Co, 1995.
4. Watson JD, Gilman M, Witkowski J, Zoller M.
Recombinant DNA. Second Edition. Scientific
American Books, 1992.
5. Watson JD, Hopkins NH, Roberts JW, Steitz JA, Weiner
AM. Molecular Biology of the Gene. Fourth Edition.
The Benjamin/Cummings Publishing Company, Inc,
1988.

67

Cap.

REPLICAO, REPARO E REARRANJOS DO DNA GENMICO

Cap.

Replicao, Reparo e
Rearranjos do DNA Genmico
Yara M. Michelacci
Helena B. Nader
Marimlia A. Porcionatto,
Lucia O. Sampaio
Leny Toma
Apesar da enorme diversidade que existe
entre os seres vivos que habitam a Terra, eles
compartilham vrias propriedades bsicas e,
talvez, a mais fundamental delas seja a capacidade de se reproduzirem. Todos os organismos
herdam de seus pais a informao gentica que
especifica sua estrutura e funo, e todos os
seres vivos so formados por clulas, que sempre advm de clulas preexistentes. Mesmo no
corpo humano, formado por trilhes de clulas, todas se originam de uma nica clula a
clula-ovo gerada pela fecundao de uma
clula feminina por uma masculina. Essa clula passa por mltiplos ciclos de diviso celular,
dando origem aos trilhes de clulas do organismo adulto. Cada vez que a clula se divide,
seu genoma inteiro deve ser replicado e passado s clulas-filhas. Portanto, a questo de
como a informao gentica replicada e transmitida de clula para clula e de organismo para
organismo central em biologia.

induzidos por fatores ambientais, como radiaes, por exemplo.

Um equipamento enzimtico complexo


necessrio para replicar as enormes molculas
de DNA que constituem os cromossomos procariticos ou eucariticos. Alm disso, mecanismos foram desenvolvidos para corrigir erros
ou danos que eventualmente ocorram no DNA,

A descoberta da complementaridade de bases entre as duas fitas do DNA A-T, C-G


imediatamente sugeriu a soluo para o problema da replicao do material gentico: as
duas fitas poderiam se separar e servirem de
molde para a sntese de novas fitas complemen-

Apesar da grande importncia da replicao


precisa e da manuteno do DNA, o genoma
celular no esttico. A recombinao entre cromossomos homlogos durante a meiose importantssima para gerar variao gentica entre
os indivduos; acredita-se que rearranjos das seqncias de DNA tambm tenham contribudo
para a evoluo, atravs da criao de novas
combinaes de informaes genticas; alm
disso, alguns rearranjos so programados para
regular a expresso de genes durante a diferenciao celular e o desenvolvimento do organismo. Um exemplo notvel desse ltimo caso, no
homem, o rearranjo dos genes que codificam
anticorpos durante o desenvolvimento do sistema imune.

REPLICAO

DO

DNA

69

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

tares (Fig. 4.1). Esse modelo chamado replicao semiconservativa porque uma das fitas
parentais conservada em cada molcula-filha
de DNA.

Adenina
Timina
Guanina
Citosina

Fita parental
molde

Fitas novas
Fig. 4.1 Replicao semiconservativa do DNA.

Bactria crescida em
meio contendo 14N

Suporte direto para esse modelo da sntese


de DNA foi apresentado por Matthew Meselson
e Frank Stahl em 1958, atravs de marcao do
DNA com istopo que altera sua densidade (Fig.
4.2). Inicialmente, E. coli foi cultivada em presena do istopo 15N, mais pesado que o istopo normal 14N. O DNA pesado, marcado com
15N, pode ser separado do DNA normal por centrifugao de equilbrio em gradiente de densidade de CsCl. Em seguida, a E. coli que havia
crescido em presena de 15N foi transferida para
meio contendo 14N e replicou mais uma vez. O
DNA foi extrado e verificou-se que sua densidade era intermediria, entre o DNA marcado
com 15N e o DNA normal, contendo 14N.
O isolamento de uma enzima de E. coli capaz de catalisar a replicao do DNA in vitro,
usando outro DNA como molde, mais uma vez
demonstrou que o modelo estava correto. Apesar de essa enzima, chamada DNA polimerase,
ser essencial para a sntese da nova fita de DNA,
catalisando a incorporao de nucleotdeos a
uma molcula de DNA complementar ao molde, o processo de replicao muito mais do
que uma simples reao enzimtica. Outras protenas esto envolvidas e mecanismos so necessrios para reduzir a freqncia de erros.
Processos especiais so necessrios para iniciar
a replicao e para replicar as extremidades dos
cromossomos eucariticos, lineares.

Bactria crescida em
meio contendo 15N

Bactria para meio


contendo 15N para uma diviso

E. coli

Extrao do DNA

Extrao do DNA

DNA
leve (14N)
DNA
pesado (15N)

Extrao do DNA

DNA
hbrido (uma fita 15N e
outra 14N)

Fig. 4.2 Representao esquemtica do experimento de Meselson e Stahl, demonstrando a replicao semiconservativa do DNA.

70

REPLICAO, REPARO E REARRANJOS DO DNA GENMICO

DNA Polimerases

A Forquilha de Replicao

DNA polimerase foi isolada pela primeira vez


por Arthur Kornberg e col., em 1956, de extratos de E. coli. Ironicamente, entretanto, essa
primeira DNA polimerase (hoje chamada DNA
polimerase I) no a principal enzima responsvel pela replicao do DNA em E. coli. Atravs do emprego de mutantes, demonstrou-se que
existem trs DNA polimerases em E. coli, chamadas DNA polimerase I (a primeira isolada),
DNA polimerase II e DNA polimerase III. A principal responsvel pelo processo de replicao
a DNA polimerase III, embora a DNA polimerase I tambm seja necessria. O papel da DNA
polimerase II ainda desconhecido. Portanto, o
processo de replicao em E. coli envolve duas
DNA polimerases, cujos papis discutiremos a
seguir.

A primeira vez que se viu uma molcula de


DNA no processo de replicao foi num experimento realizado por John Cairns, no qual E. coli
foi cultivada em presena de timidina radioativa
e o DNA foi observado por auto-radiografia. As
molculas de DNA de procariotos so circulares
e, durante a replicao, essas molculas contm
duas forquilhas de replicao, representando os
pontos de sntese de DNA. Em cada forquilha,
as duas fitas do DNA parental so separadas e
duas novas fitas so sintetizadas (Fig. 4.4).

Clulas eucariticas contm cinco DNA polimerases, chamadas , , , e . A polimerase


localiza-se nas mitocndrias, catalisando a replicao do DNA mitocondrial. As outras quatro enzimas localizam-se no ncleo e so,
portanto, candidatas a envolvimento no processo de replicao do DNA nuclear. As DNA polimerases , e so mais ativas em clulas que
esto se dividindo, sugerindo que efetivamente
funcionem na replicao. A polimerase , ao
contrrio, igualmente ativa em clulas em repouso e em diviso, sugerindo que seu papel
principal esteja relacionado aos mecanismos de
reparo do DNA.

A sntese de fitas de DNA complementares a


ambas as fitas da molcula parental impe algumas dificuldades ao entendimento da bioqumica da replicao do DNA. Como as duas fitas do
DNA so antiparalelas, a sntese contnua de duas
fitas na forquilha de replicao exigiria que uma
fita fosse sintetizada no sentido 5 3 e a outra, no sentido 3 5. Mas todas as DNA polimerases conhecidas sintetizam apenas no sentido
5 3. Como, ento, sintetizada a outra fita
de DNA?

Atravs de duas abordagens experimentais


replicao de vrus em extratos de clulas e
leveduras mutantes demonstrou-se a participao das polimerases e no processo
de replicao do DNA. A polimerase talvez
funcione em alguma via de reparo essencial
sobrevivncia das clulas.

Esse enigma foi resolvido por experimentos


que demonstraram que apenas uma das fitas
sintetizada de modo contnuo, no sentido da replicao do DNA; a outra formada a partir de
pequenos segmentos, pedaos descontnuos, que
so sintetizados de trs para frente em relao
ao sentido do movimento da forquilha de replicao. Esses segmentos, chamados fragmentos
de Okasaki, so posteriormente unidos por ao
da DNA ligase, formando uma fita inteira de
DNA. A fita sintetizada de modo contnuo chamada fita lder (leading strand), uma vez que
sua sntese expe o molde para a sntese dos fragmentos de Okasaki (fita retardada ou lagging
strand).

Todas as DNA polimerases conhecidas


apresentam duas propriedades em comum, que
tm importantes implicaes no processo de
replicao (Fig. 4.3). Primeiro, todas as DNA
polimerases polimerizam DNA apenas na direo 5 para 3, adicionando desoxinucleotdeos
trifosfato (dNTP) hidroxila 3 da cadeia nascente. Segundo, as DNA polimerases s adicionam nucleotdeos a uma fita j iniciada e ligada
ao molde por pontes de hidrognio, sendo incapazes de iniciar a sntese de DNA a partir de
dNTPs livres.

Surge, ento, outra questo: uma vez que as


DNA polimerases so incapazes de iniciar a sntese sem um iniciador (primer), como comea a
sntese dos fragmentos de Okasaki? A resposta
que pequenos segmentos de RNA funcionam
como iniciadores para a replicao do DNA. Uma
enzima chamada primase sintetiza pequenos segmentos de RNA (3 a 10 nucleotdeos) complementares ao molde, na forquilha de replicao.
Os fragmentos de Okasaki so, ento, sintetizados como extenso desses primers de RNA por
DNA polimerases.

71

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Primer ou
iniciador

Cap.

Fita molde

DNA
polimerases

Direo do
crescimento
da cadeia

Fig. 4.3 Atividade de sntese da DNA polimerase. A DNA polimerase catalisa a polimerizao de nucleotdeos na
direo 5 3, e necessitam de uma fita j iniciada (primer ou iniciador) para sua atividade, sendo incapazes de iniciar
a sntese de DNA a partir de dNTPs livres. Uma ligao fosfodister formada entre um grupo hidroxilar 3 livre da fita em
elongao e o deoxiribonucleosdeo 5-trifosfato. O pirofosfato eliminado.

Origem de
replicao
Forquilha
de replicao

Forquilha
de replicao

Fita parental
Fita nova

Fig. 4.4 A forquilha de replicao e sua natureza bidirecional.

Para formar uma fita contnua de DNA, os


primers de RNA devem ser removidos, substitudos por DNA e os segmentos devem ser ligados entre si. Em E. coli, os primers de RNA so
removidos pela ao combinada de uma enzima
chamada RNase H, que degrada o RNA de hbridos RNA-DNA, e de DNA polimerase I. A
DNA polimerase I atua como exonuclease, hidrolisando DNA e RNA tanto no sentido 3 5
como no sentido 5 3. A ao da polimerase
no sentido 5 3 remove nucleotdeos da ex-

72

tremidade 5 dos fragmentos de Okasaki, permitindo que sejam substitudos por desoxirribonucleotdeos (Fig. 4.5). Em seguida, a DNA
ligase une os fragmentos.
Em eucariotos, outras enzimas removem o
RNA iniciador e a DNA polimerase preenche
as falhas. Como em procariotos, os fragmentos
so unidos entre si pela DNA ligase.
Portanto, as diversas DNA polimerases desempenham diferentes papis na forquilha de
replicao. Em procariotos, a DNA polimerase

REPLICAO, REPARO E REARRANJOS DO DNA GENMICO

RNA
iniciador
Cap.

DNA
polimerase I

DNA
ligase

Remoo do RNA pela atividade


exonuclesica 5-3
Preenchimento da falha com DNA

Unio dos fragmentos de DNA

Fig. 4.5 Sntese da fita retardada ou descontnua de DNA. Inicialmente, a primase sintetiza pequenos segmentos de
RNA, que servem de primers para a DNA polimerase. Em seguida, a atividade exonuclesica 5-3 da prpria DNA polimerase remove o RNA iniciador e preenche a lacuna com DNA. Estes so unidos pela DNA ligase.

III a principal polimerase na replicao, funcionando tanto na sntese da fita lder como dos
fragmentos de Okasaki, pela extenso dos primers de RNA. A DNA polimerase I remove os
primers e preenche as falhas entre os fragmentos de Okasaki. Em clulas eucariticas, vrias
DNA polimerases tambm so necessrias. A
DNA polimerase forma um complexo com a
RNA primase e parece funcionar junto com a
primase na sntese de fragmentos curtos de RNADNA, que funcionam como iniciadores (ou primers) dos fragmentos de Okasaki. A DNA
polimerase pode, ento, sintetizar ambas as fitas, estendendo os primers de RNA-DNA sintetizados pelo complexo primase-DNA polimerase .
Alm disso, a DNA polimerase capaz de preencher as falhas entre os fragmentos de Okasaki, aps a remoo do RNA iniciador. A DNA
polimerase e tem funo ainda desconhecida no
processo de replicao do DNA.
Alm das DNA polimerases e primase, outras protenas atuam na forquilha de replicao.
Uma classe de protenas liga-se s DNA polimerases, aumentando sua atividade e fazendo que
se mantenham ligadas ao DNA molde. Tanto a
DNA polimerase III de E. coli como a DNA polimerase de eucariotos esto associadas a dois

tipos de protenas acessrias protenas do sliding clamp e protenas brace que reconhecem
o ponto de juno primer-molde, ligam-se a ele
e formam um anel em torno do DNA molde.
Esse anel mantm a associao entre a polimerase e o molde, permitindo a sntese ininterrupta de milhares de nucleotdeos.
Outras protenas desenrolam o DNA e estabilizam as regies de DNA fita nica. As helicases so enzimas que catalisam o desenrolamento
do DNA parental, adiante da forquilha de replicao, com hidrlise de ATP. Ento, as SSBP
(single-stranded DNA binding proteins) estabilizam o DNA desenrolado, mantendo-o como fita
nica estendida, de modo que possa ser copiada
pela polimerase.
medida que o DNA parental se desenrola,
o DNA frente da forquilha de replicao forado a girar. Essa rotao poderia levar a molcula a se enrolar sobre si mesma, bloqueando a
replicao. Esse problema solucionado pelas
topoisomerases, enzimas que catalisam a quebra
e a religao de fitas de DNA. H dois tipos de
topoisomerases: as do tipo I quebram apenas uma
fita de DNA e as de tipo II catalisam quebras simultneas em ambas as fitas. Essas quebras permitem que as fitas girem livremente uma em torno

73

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

da outra, de modo que a replicao possa ocorrer


sem enrolar o DNA adiante da forquilha. Embora os cromossomos eucariticos sejam lineares,
tambm as topoisomerases so necessrias. Caso
contrrio, o cromossomo todo teria que girar continuamente durante a replicao.
As enzimas que participam da replicao do
DNA atuam de modo coordenado, sintetizando as fitas lder e retardada simultaneamente,
na forquilha de replicao. Forma-se um dmero da DNA polimerase replicativa (polimerase
III em E. coli e polimerase em eucariotos),
cada uma com suas protenas acessrias apropriadas. Uma molcula da DNA polimerase atua
na sntese da fita lder e a outra, dos fragmentos de Okasaki. Acredita-se que o molde da fita
retardada faa uma volta, de modo que a polimerase engajada na sua sntese mova-se na
mesma direo da outra subunidade, que sintetiza a fita lder. A Fig. 4.6 mostra um modelo
da forquilha de replicao.
A fidelidade da sntese garantida pelas prprias DNA polimerases, que ajudam a selecioEtapa 1
5 3

Etapa 2
5 3

Complexo de
replicao

RNA
iniciador
Fragmento
de Otasati

3 5

3 5
Etapa 4
5 3

Etapa 3
5 3

Polimerase
e ligase

3 5

Fragmento
de Otasati

3 5

Fig. 4.6 Representao esquemtica da forquilha de


replicao mostrando a formao da fita retardada.

74

A existncia da reviso pode explicar o fato


de o DNA s crescer pela extremidade 3. Quando DNA sintetizado no sentido 5 3, a energia necessria polimerizao vem da hidrlise
do grupo trifosfato de um desoxirribonucleotdeo livre, que adicionado ao grupo 3-hidroxila da cadeia nascente. Se o DNA crescesse pela
extremidade 5, a energia para a polimerizao
viria da hidrlise do terminal trifosfato de um
nucleotdeo j incorporado ao DNA. Isso eliminaria a possibilidade de reviso, uma vez que a
remoo de um nucleotdeo errado tambm removeria o grupo trifosfato, necessrio como fonte de energia para a elongao subseqente.
A capacidade de discriminao da base correta, bem como com a atividade de reviso das
DNA polimerases, permite que ocorra apenas
um erro a cada 109 pares de bases no processo
de replicao do DNA. Mecanismos adicionais
atuam na correo de erros que eventualmente
ocorram (ver Reparo do DNA, mais adiante).

Origem de Replicao

3 5

3 5

nar a base correta a inserir na nova fita. Alm


disso, as DNA polimerases tm atividade de reviso ou proofreading. As DNA polimerases tm
atividade exonuclesica 3 5, que atua no sentido oposto ao da sntese do DNA e que participa da reviso do DNA recm-sintetizado. Se uma
base incorreta for incorporada, ela ser removida pela atividade 3 5 exonuclesica, que reconhece bases pareadas erroneamente na
extremidade da cadeia em crescimento. Essa
atividade, presente nas DNA polimerases I e III
de E. coli e e de eucariotos, aumenta a preciso de replicao de 100 a 1.000 vezes.

Tanto em procariotos como em eucariotos,


a replicao tem incio em seqncias especficas chamadas origem de replicao (Fig. 4.7).
Essas seqncias so reconhecidas por protenas que se ligam a elas e que iniciam o processo.
A primeira origem de replicao definida foi a
de E. coli e uma seqncia nica no cromossomo da bactria. Consiste de 245 pares de bases, s quais se liga, inicialmente, uma protena
iniciadora, que reconhece seqncias especficas dentro da origem. Essa protena comea a
desenrolar o DNA e recruta outras protenas envolvidas na replicao. Helicase e SSBP continuam a desenrolar o DNA, expondo o molde, e

REPLICAO, REPARO E REARRANJOS DO DNA GENMICO

EUCARIOTOS: vrios cromossomos lineares, cada um com vrias origens de replicao


Origens de
replicao
Cap.

PROCARIOTOS: um cromossomo circular e DNA extracromossmico, cada um com uma s origem


de replicao.
Origem de
replicao
Origem de
replicao

Cromossomo
DNA
extracromossmico

Fig. 4.7 Origem de replicao em procariotos e eucariotos.

a primase inicia a sntese da fita lder. Duas forquilhas de replicao se formam e migram em
sentidos opostos, ao longo do cromossomo circular de E. coli.
Em vrus SV40, a replicao inicia-se por
uma protena codificada pelo vrus chamada
antgeno T, que se liga origem e tambm funciona como helicase. SSBP necessria para estabilizar o molde desenrolado e o complexo DNA
polimerase -primase inicia a sntese do DNA.
Em cromossomos eucariticos, ao contrrio do que ocorre com genomas virais ou bacterianos, onde existe apenas uma origem de
replicao, existem muitas origens de replicao.
Em clulas de mamferos, as origens esto espaadas a intervalos de 50 a 300kb. Portanto, o genoma humano tem cerca de 30.000 origens de
replicao. O segmento do cromossomo servido
por uma origem chamado de replicon. As origens de replicao eucariticas mais bem estudadas so as de levedura e so chamadas ARSs ou
autonomously replicating sequences.

Replicando as Extremidades dos


Cromossomos: Telmeros e Telomerases
Como as DNA polimerases atuam sobre primers apenas no sentido 5 3, elas so incapazes de copiar a extremidade 5 de molculas
lineares de DNA at o fim. Uma vez que os cromossomos eucariticos so lineares, sempre um
segmento da extremidade 5 no seria replicado. Como conseqncia, em ciclos sucessivos
de replicao, o cromossomo iria se encurtando progressivamente. Para evitar esse problema, um mecanismo especial evoluiu para
replicar as extremidades dos cromossomos lineares das clulas eucariticas. Essas extremidades, chamadas telmeros, consistem em
seqncias simples repetidas (tandem repeats).
A enzima capaz de catalisar a sntese dos telmeros chama-se telomerase e composta por
RNA e protena. Essa enzima uma transcriptase reversa, uma classe de DNA polimerases
que sintetizam DNA a partir de um molde de

75

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

RNA. A telomerase carrega seu prprio molde


de RNA, que complementar seqncia repetitiva do telmero. O RNA pareia com a extremidade da molcula de DNA, servindo de
molde para gerar uma nova seqncia repetida. Em seguida, a enzima move-se ao longo do
DNA, pareando com a nova extremidade gerada. Depois, a fita complementar sintetizada.

Outros Mecanismos de Replicao do


Genoma: Crculo Rolante e Transcrio
Reversa
O bacterifago tem um capsdeo icosadrico acoplado a uma cauda que termina em fibras adesivas. Seu genoma constitudo por uma
molcula de DNA fita dupla, linear, de 48kb, com
12 nucleotdeos fita simples, nas duas extremidades. Estas regies so chamadas regies ou
stios cos. Quando o fago infecta uma clula de
E. coli, a molcula cicliza pelos stios cos, formando uma molcula de DNA circular.
Para replicar, o fago usa as enzimas da bactria e duas enzimas codificadas por ele, que reconhecem a origem de replicao do fago. Essas
protenas fazem papis anlogos aos das protenas
que reconhecem a origem de replicao do cromossomo de E. coli. A replicao, ento, prossegue pelo mecanismo do crculo rolante (Fig. 4.8).
Resultam da formas multimricas de DNA, unidas pelos stios cos, chamadas concatmeros. Estes so, ento, quebrados no stio cos e as partculas
virais podem ser organizadas novamente.
J os retrovrus so vrus cujo genoma constitudo por RNA. Quando o genoma do vrus
invade uma clula, inicialmente deve ser feita uma

cpia em DNA do RNA viral. A sntese do DNA


usando RNA como molde catalisada por uma
enzima codificada pelo vrus chamada transcriptase reversa. Em seguida, o RNA degradado e
uma segunda fita de DNA, complementar primeira, sintetizada e o DNA dupla fita integra-se ao genoma do hospedeiro. Molculas de
RNA so transcritas, dando origem a novas partculas virais.

MUTAES
Mutaes so modificaes sbitas e hereditrias que ocorrem no material gentico. Mutante o organismo que apresenta forma ou
funo alterada, como resultado da ocorrncia
de uma mutao.
A maioria das mutaes que ocorrem so
deletrias. No entanto, acredita-se que as mutaes sejam, tambm, a base da variabilidade, que
permite a seleo de indivduos mais adaptados
a determinado ambiente, levando ao processo de
seleo natural.
Todos os organismos sofrem um determinado nmero de mutaes chamadas espontneas.
A taxa de ocorrncia de mutaes espontneas
depende da espcie, mas pode ser aumentada
pela presena de agentes mutagnicos, que causam mutaes induzidas.
As mutaes podem ser to sutis a ponto de
s poderem ser detectadas por anlise gentica
ou bioqumica, mas tambm podem ter conseqncias graves, levando a alteraes morfolgicas grosseiras ou, at, letais. As mutaes teis
para estudo da gentica dos processos biolgicos
so as mutaes condicionais, isto , mutaes

Novas molculas de DNA unidas pelos stios cos


formando um concatmero

Fig. 4.8 A replicao do DNA em fago lambda atravs do crculo rolante.

76

REPLICAO, REPARO E REARRANJOS DO DNA GENMICO

que so letais em determinada condio do ambiente, como falta de um nutriente ou mudana


de temperatura, mas so viveis em outra condio, as chamadas condies permissivas.
Alm disso, as mutaes podem ocorrer tanto nas clulas germinativas, o que significa que
sero transmitidas descendncia, como nas
somticas, quando s afetaro aquele indivduo.

Modificao Tautomrica e Pareamentos


Raros entre as Bases
As quatro bases nitrogenadas que aparecem
no DNA podem apresentar, alm de suas for-

mas mais estveis, formas tautomricas mais


raras. Assim, a timina e a guanina podem aparecer na forma ceto, mais estvel, ou na forma
enol, mais rara. Por sua vez, a citosina e a adenina podem ocorrer na sua forma amino, mas tambm na forma tautomrica imino, rara (Fig. 4.9).
Se alguma dessas bases estiver na forma tautomrica rara no momento da replicao do DNA,
um pareamento errado de bases pode ocorrer:
a citosina, na sua forma imino, pode parear com
adenina (o par correto seria citosina com guanina) e a guanina, na forma enol, pode parear
com a timina (Fig. 4.10). Isto levaria a uma
mutao.

Fig. 4.9 As bases nitrogenadas e suas formas tautomricas.

77

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Fig. 4.10 Pareamento de bases com formas tautomricas.

Tipos de Mutaes

Mutaes Induzidas por Radiao

Esse tipo de mutao que acabamos de descrever uma mutao puntual, que afeta um
s par de bases. Pode haver, tambm, uma mutao que seja decorrente da adio ou da deleo de um nucleotdeo. Se isto ocorrer no
meio de uma seqncia que codifica uma protena, pode haver um deslocamento na leitura
(frameshift), de modo que toda a estrutura da
protena fica alterada, a partir do ponto onde
ocorreu a mutao.

Radiaes ionizantes e radiao ultravioleta


so capazes de induzir mutaes. As radiaes
ionizantes so os raios X, raios csmicos e radiaes emitidas por istopos radioativos de vrios elementos: radiao alfa, beta e gama. So
radiaes de alta energia que interagem com
os tomos da matria atingida por elas e removem eltrons, transformando os tomos em
ons. Os efeitos das radiaes ionizantes so
proporcionais dose de radiao. A mesma dose
pode ser obtida num tempo curto, com uma radiao intensa, ou num tempo prolongado, com
radiao baixa.

As mutaes tambm podem ser silenciosas ou


neutras. O cdigo gentico degenerado, isto ,
para a maioria dos aminocidos h mais de um cdon. Se houver uma mutao puntual com troca de
uma base mas o novo cdon continuar codificando
o mesmo aminocido, dizemos que houve uma
mutao silenciosa. Se mudar o aminocido mas
isto no afetar as propriedades da protena, dizemos que houve uma mutao neutra.

78

A radiao ultravioleta (UV) no to potente. Ela atinge apenas as camadas mais expostas fonte de UV e no promovem ionizao,
mas so capazes de gerar radicais livres, altamente reativos. A radiao UV atinge o DNA e
estimula alguns tipos de reaes. Por exemplo,

REPLICAO, REPARO E REARRANJOS DO DNA GENMICO

Ligaes atravs dos


C5 e C6 de cada anel
Ligaes
duplas
reativas

Cap.

Radiao UV

Timinas adjacentes

Dmeros de timina (TT)

Grupos
reativos

Radiao UV

Produto 6-4
timina-citosina

Timina adjacente
a citocina

Fig. 4.11 Mutao induzida por radiao UV.

entre timinas adjacentes podem se formar ligaes covalentes entre C5 e C6, gerando dmeros
de timina numa cadeia do DNA. Entre uma timina e uma citosina adjacentes tambm pode
ocorrer reao, com formao de um produto
ligado covalentemente (Fig. 4.11). O DNA, neste
ponto, apresenta uma leso.

Mutaes Induzidas por Agentes


Qumicos
Entre os agentes qumicos que induzem
mutaes, podemos destacar os anlogos s bases nitrogenadas, os agentes que provocam modificaes qumicas no DNA, os corantes
aromticos, como a acridina, que se encaixam
no DNA e provocam uma deformao e os agentes alquilantes, que modificam as bases.
O 5-bromouracil um anlogo da timina e,
como ela, pode ocorrer na forma ceto e na forma enol. A diferena que a forma enol do 5bromouracil mais estvel e permanece mais
tempo nessa forma, pareando com guanina, e
no com adenina. Assim, se 5-bromouracil for

incorporado ao DNA no lugar da timina, aumenta a incidncia de mutaes puntuais.


Outro agente mutagnico o cido nitroso.
Ele reage com as bases que tm grupamento
amino: citosina e adenina. A partir da citosina,
forma-se uracil e, a partir da adenina, forma-se
hipoxantina. A hipoxantina pareia com citosina
e uracil pareia com adenina, induzindo troca de
bases.
Os corantes que se inserem no DNA provocam a insero de nucleotdeos, induzindo mutaes por deslocamento na leitura (frameshift).
As nitrosaminas e a nitrosoguanidina so
agentes alquilantes, isto , agentes que transferem grupos metil ou etil para as bases do DNA.
Por exemplo, a guanina pode ser convertida em
6-O-metilguanina que, em vez de parear com
citosina, pareia com timina.

REPARO

DO

DNA

Portanto, muitos tipos de mutaes podem


ocorrer no DNA. Vrios desses erros, naturais

79

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

ou induzidos por radiaes ou agentes qumicos, podem ser corrigidos, usando os recursos
do reparo do DNA.
Cap.

Os mecanismos de reparo podem ser divididos em duas classes gerais: a) reverso direta da
reao qumica responsvel pelo dano ao DNA;
b) remoo das bases danificadas e sua substituio por DNA novo.

Reverso Direta da Leso ao DNA


Algumas leses no DNA podem ser reparadas
pela correo direta do erro, particularmente a formao de dmeros de pirimidinas, que resultam da
exposio a radiao ultravioleta (Fig. 4.11), e
resduos de guanina alquilados, que resultam da
adio de grupos metil ou etil posio O6 do
anel da purina por agentes alquilantes.
O fato de a exposio irradiao UV solar
ser a principal causa de cncer de pele humano
ilustra a importncia das leses causadas ao DNA
por esse tipo de radiao. A formao dos dmeros de pirimidina deforma a estrutura do DNA e
bloqueia tanto a transcrio como a replicao.
Um mecanismo de reparo dessa leso a reverso direta da reao de dimerizao. O processo
chamado fotorreativao enzimtica porque a
energia utilizada para a reao luz visvel. Assim, os dmeros de timina e os produtos da reao de timina com citosina vizinhas so revertidos
a sua forma original, pela ao de uma enzima
chamada fotoliase. Curiosamente, entretanto,
esse mecanismo no universal. Muitas espcies,
incluindo a humana, no apresentam esse mecanismo de reparo do DNA.
Outra forma de reparo direto envolve o dano
resultante da reao entre agentes alquilantes e
o DNA. A formao de O6-metilguanina pode
ser reparada por uma enzima chamada O6-metilguanina-metiltransferase, que reconhece a O6metilguanina na fita dupla do DNA e remove o
grupamento metil, transferindo-o para uma cistena do seu stio ativo. Tambm remove grupos
metil de resduos de fosfato da cadeia de DNA.
Contudo, no h meios de remover o metil da
enzima, de modo que uma molcula de enzima gasta para cada grupo metil removido.
Enzimas que catalisam esse tipo de reparo so
amplamente distribudas entre procariotos e eucariotos, incluindo o homem.

80

Reparo Por Exciso


Apesar de os mecanismos de reverso direta
serem eficientes para tipos especficos de danos
ao DNA, o reparo por exciso mais geral e
permite reparar muitos tipos de alteraes qumicas no DNA. Os mecanismos de reparo por
exciso so os mais importantes, tanto para clulas procariticas como eucariticas. O DNA
danificado reconhecido e removido, seja como
bases livres ou nucleotdeos, e a falha resultante
preenchida com DNA novo. Trs mecanismos
so includos no reparo por exciso: reparo por
exciso de base, reparo por exciso de nucleotdeo e reparo de pareamento errado (mismatch).
O reparo do DNA contendo uracil um bom
exemplo de reparo por exciso de base. Uracil
pode aparecer no DNA por incorporao em
lugar da timina ou por desaminao de citosina.
A exciso de uracil catalisada pela DNA-glicosilase, capaz de reconhecer o uracil e remov-lo.
A enzima tambm capaz de reconhecer outras
bases anormais, como hipoxantina (formada por
desaminao de adenina), dmeros de pirimidina e purinas alquiladas. Essa reao gera base
livre e um stio apirimidnico ou apurnico (AP)
um acar sem base ligada. O stio AP reparado por uma enzima chamada AP endonuclease, que quebra a ligao fosfodister do
nucleotdeo sem base e a falha preenchida por
DNA polimerase e DNA ligase.
O reparo por exciso de nucleotdeo usado
para corrigir uma gama de danos ao DNA ainda
maior. Nesse caso, a base danificada (por exemplo,
um dmero de timina) removida como parte de
um oligonucleotdeo, contendo a leso (Fig. 4.12).
O espao, ento, preenchido por DNA polimerase e DNA ligase. Esse , talvez, o mais importante dos mecanismos de reparo do DNA e
depende de vrias enzimas e protenas. No homem, os genes do reparo por exciso de nucleotdeos foram identificados, em grande parte, em
indivduos que sofrem de doenas genticas em
que os mecanismos de reparo do DNA esto
afetados, especialmente o xeroderma pigmentoso, uma doena que afeta uma a cada 250.000
pessoas. Os indivduos so extremamente sensveis radiao UV e desenvolvem mltiplos cnceres de pele em regies do corpo expostas ao
sol. Em 1968, J. Cleaver demonstrou que, nesses pacientes, o reparo por exciso de nucleotdeos est deficiente. Sete genes de reparo

REPLICAO, REPARO E REARRANJOS DO DNA GENMICO

Cap.

Fig. 4.12 Reparo por exciso de nucleotdeo.

diferentes foram j encontrados mutados em


casos de xeroderma pigmentoso, bem como em
outras patologias, como a sndrome de Cockayne e a tricotiodistrofia.
Um terceiro tipo de sistema de reparo por
exciso reconhece bases pareadas erroneamente, incorporadas durante a replicao do DNA.
O sistema percorre o DNA em busca de pares
errados e os corrige, restaurando a seqncia
original. Em E. coli, a fita recm-sintetizada
diferenciada da fita parental pela metilao de
resduos de adenina na seqncia GATC. A fita
nova ainda no foi metilada e pode ser reconhecida. Uma protena, chamada MutS, liga-se
base pareada erroneamente. Em seguida, ligase MutL. A ligao de MutL ativa a ligao de
MutH, que cliva a fita no metilada no lado opos-

to a um stio de metilao. MutS e MutL, juntamente com helicase e exonuclease, removem a


poro da fita no-metilada que contm a base
errada. A falha , ento, preenchida pela DNA
polimerase e selada pela ligase. Em eucariotos, existe um sistema semelhante, embora o
mecanismo de identificao da fita recm-sintetizada ainda no seja conhecido. A importncia desse sistema de reparo ilustrada pelo
fato de mutaes nos genes humanos homlogos de MutS e MutL serem responsveis por
um tipo comum de cncer de clon (hereditary
nonpolyposis colorectal cancer ou HNPCC), uma
das doenas hereditrias mais comuns, afetando uma a cada 200 pessoas. A relao entre
HNPCC e reparo de pareamento errado foi descoberta em 1993.

81

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Reparo aps a Replicao

Cap.

Se houver um dmero de timina na fita-molde


de DNA que no foi reparado, o sistema de replicao bloqueado e s recomea bem depois, deixando uma falha, com um segmento de DNA fita
nica. Uma protena chamada RecA liga-se a essa
seqncia. Nesse caso, no h mais fita complementar para servir de molde para o reparo e um
dos mecanismos utilizados pela clula o do reparo por recombinao, que utiliza outra molcula de
DNA homloga como molde.
Em procariotos em rpida diviso, normalmente h mais de uma molcula de DNA por
clula, uma vez que o DNA est replicando
mais rpido que a diviso celular. Assim, uma
molcula pode servir de molde para a outra. Em
eucariotos, a maioria das clulas diplide, contendo duas cpias de cada cromossomo, com
seqncias homlogas ou quase. A regio do
DNA lesado, fita nica, pareia com um segmento da seqncia homloga na outra molcula de
DNA. Uma nuclease, ento, corta a outra molcula e um anelamento extenso entre a molcula
lesada e a outra pode acontecer. A ramificao
migra, ultrapassando o ponto da leso. A leso
pode, agora, ser reparada por exciso e a fenda
na outra molcula preenchida pela DNA polimerase.
Outro mecanismo possvel o reparo passvel de erro. Nesse caso, a falha oposta ao DNA
danificado preenchida por DNA recm-sintetizado. Como esse DNA sintetizado sobre um
molde danificado, essa forma de reparo pouco
precisa e leva a mutaes freqentes. S usado por bactrias submetidas a condies letais,
como exposio radiao, por exemplo.

RECOMBINAO

TRANSPOSIO

Recombinao
Recombinao gentica a troca de seqncias entre duas molculas de DNA. Existem dois
tipos bsicos de recombinao:
Recombinao homloga geral pode ocorrer em qualquer local do DNA e exige homologia entre as duas molculas que vo trocar
pedaos. O melhor exemplo deste tipo de recombinao o crossing-over que acontece
na meiose.

82

DNA fita nica

DNA recoberto por RecA

Ligao de RecA

Ligao ao DNA dupla-fita


Complexo sem pareamento de bases

Alinhamento de regies homlogas


Troca de fitas

Fig. 4.13 Papel da protena Rec A nos mecanismos de


recombinao.

Recombinao stio-especfica: ocorre em


seqncias especficas. No h necessidade
de homologia e um exemplo a insero e a
exciso de um fago no genoma de uma bactria.
Mas como duas molculas de DNA podem
ser quebradas e unidas sem que ocorram mutaes devido a perda ou ganho de nucleotdeos no
ponto da quebra? Na recombinao homloga,
como era de se esperar, esse alinhamento feito
por pareamento de bases entre fitas complementares de DNA. Fitas nicas so trocadas entre
molculas de DNA homlogas. O anelamento
pode prosseguir por longas distncias e pode
acontecer de a segunda fita tambm se romper e
trocar de uma molcula para outra ou no.
A recombinao requer enzimas especficas
alm de outras protenas que tambm participam
de outros processos do metabolismo do DNA. Em
E. coli, a protena central envolvida na recombinao homloga, chamada RecA, liga-se a DNA
de fita nica, formando um filamento de DNAprotena. Como essa protena tem dois stios de

REPLICAO, REPARO E REARRANJOS DO DNA GENMICO

ligao ao DNA, a RecA que recobre o DNA de


fita nica liga-se, ento, a uma segunda molcula
de DNA de fita dupla e forma um complexo sem
pareamento de bases. Segue-se a formao de
pares de bases complementares, com gerao de
um heterodplex. Vemos na Fig. 4.13 o papel da
protena RecA nos mecanismos de recombinao.
A maior parte dos eventos de recombinao
em E. coli tambm requer a enzima RecBCD,
formada por um complexo de trs protenas. O
complexo de protenas RecBCD migra sobre o
DNA. Quando encontra uma seqncia chamada stio Chi (5-GCTGGTGG-3), provoca uma
quebra na cadeia. A protena RecA, ento, complexa com o DNA fita nica e promove seu anelamento com outra molcula de DNA homloga.
Ao contrrio do que ocorre na recombinao homloga geral, a recombinao stio-especfica ocorre entre seqncias especficas de DNA
que, geralmente, s so homlogas num trecho
pequeno do DNA. A interao principal nesse
processo mediada por protenas que reconhecem as seqncias-alvos especficas no DNA, e
no por pareamento de bases complementares.
O prottipo da recombinao stio-especfica
o bacterifago . A infeco de E. coli inicia-se
pela injeo do DNA do fago que, depois, tornase cclico no interior da clula hospedeira. Na infeco ltica, o DNA replica e dirige a sntese das
protenas do fago. O DNA viral empacotado e
as partculas virais so liberadas aps a lise da
clula. Na infeco lisognica, o DNA se recombina com o genoma do hospedeiro formando um
profago integrado ao cromossomo de E. coli. O
DNA do integrado no dirige a sntese das protenas virais, mas se replica juntamente com o restante do genoma bacteriano. A integrao resulta
de recombinao stio-especfica entre seqncias especficas nos genomas do fago e de E. coli
chamadas attP e attB, respectivamente. O processo catalisado por uma enzima codificada pelo
vrus chamada integrase, que reconhece ambas as
seqncias attP e attB. A integrase cliva em pontos especficos dentro dessa seqncia, gerando
caudas de DNA de fita nica desencontradas. Depois, ela catalisa a troca de fitas e a ligao, que
resulta na recombinao e integrao do DNA
do fago .
Em vertebrados, recombinao stio-especfica crtica para a produo de imunoglobulinas pelo sistema imune, responsvel pelo

reconhecimento de substncias estranhas e


pela proteo contra agentes infecciosos. Por
exemplo, cada gene de cadeia leve de imunoglobulina consiste em uma regio constante
(C), uma regio de ligao (J, de joint) e uma
regio varivel (V). H cerca de 250 regies
V, que so separadas de J e C por 20 kb no
DNA da clula precursora. Durante o desenvolvimento dos linfcitos B, recombinao stio-especfica une uma regio V a uma das
quatro regies J. Esse rearranjo ativa a transcrio, resultando na formao do transcrito
primrio contendo a regio VJ, juntamente
com as demais regies J e a C. As regies J
remanescentes (que no sero utilizadas) e o
ntron entre J e C so removidos por splicing
do RNA, gerando o mRNA funcional.

Transposio
A descoberta que os genes eucariticos
podem mudar de lugar veio de estudos realizados por Barbara McClintock, na dcada de
1940, em milho. Foram descritos elementos
genticos que podiam mudar de uma localizao para outra no genoma, alterando a expresso de genes adjacentes. Quase trs dcadas
se passaram, entretanto, antes das bases fsicas do trabalho de McClintock serem elucidadas pela descoberta de elementos transponveis
em bactrias.
Ao contrrio da recombinao, que requer
ao menos um pequeno segmento homlogo, a
transposio envolve o movimento de seqncias pelo genoma, sem nenhuma exigncia de
homologia.
Em procariotos, alguns plasmdeos tm capacidade de se inserirem no cromossomo da
bactria e, depois, podem sair novamente. Esses
plasmdeos codificam enzimas, chamadas transposases, que promovem sua insero no cromossomo. H dois grupos de plasmdeos desse tipo:
os que carregam apenas os genes responsveis
pela transposio e os que carregam esses genes
mais outros genes, por exemplo, que codificam
resistncia a antibiticos.
Elementos de eucariotos que se movem por
transposio so chamados elementos transponveis ou transposons. Porm, em eucariotos
existem vrios tipos diferentes de elementos

83

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

transponveis, classificados de acordo com sua


estrutura.
Cap.

H transposons anlogos aos de procariotos, que


codificam enzimas e protenas responsveis por sua
transposio. Essa transposio pode ser replicativa, quando uma nova cpia da seqncia feita e
inserida num novo local, ou no-replicativa, quando a seqncia removida de um local e inserida
em outro.
Outros transposons propagam-se atravs
de RNA e so chamados retrotransposons ou
retroposons. Alguns deles so semelhantes a retrovrus porque apresentam seqncias LTR.
Outros no apresentam seqncias LTR, mas
apresentam seqncias de poli-A, indicando
que so derivados de mRNAs celulares. Nesse
ltimo grupo incluem-se seqncias muito freqentes no genoma eucaritico, como as seqncias LINES (long interpersed sequences)
e SINES (short interpersed sequences) e os
pseudogenes processados. As seqncias LINES e SINES so capazes de codificar sua

84

prpria transposio e existem muitas cpias


no genoma. Os pseudogenes processados, ao
contrrio dos pseudogenes, no apresentam
seqncias intervenientes. Existem em poucas
cpias no genoma e no codificam sua prpria transposio.

BIBLIOGRAFIA
1. Cooper GM. The Cell: A Molecular Approach. ASM
Press and Sinauer Associates, Inc, 1997.
2. Lodish H, Baltimore D, Berk A, Zipursky SL, Matsudaira
P, Darnell J. Molecular Cell Biology. Third Edition.
Scientific American Books, 1995.
3. Purves WK, Orians GH, Heller HG. Life. The
Science of Biology. Fourth Edition. Sinauer
Associates, Inc., W. H. Freeman and Co., 1995.
4. Watson JD, Gilman M, Witkowski J, Zoller M.
Recombinant DNA. Second Edition. Scientific
American Books, 1992.
5. Watson JD, Hopkins NH, Roberts JW, Steitz JA, Weiner
AM. Molecular Biology of the Gene. Fourth Edition.
The Benjamin/Cummings Publishing Company,
Inc., 1988.

EXPRESSO E TRADUO DA INFORMAO GENTICA

Cap.

Expresso e Traduo da
Informao Gentica
Mirian Aparecida Boim

A maneira mais simples de compreenso de


como a gentica molecular tem papel fundamental em todos os processos biolgicos, baseia-se
no chamado dogma central, o qual prediz as
duas principais leis para a perpetuao da vida,
a diviso celular e a sntese de protenas. A diviso mittica da clula, e, portanto, a proliferao celular, s possvel porque o DNA ou a
molcula-me capaz de se auto-replicar,
transferindo as informaes genticas para as
clulas-filhas. Alm disso, o DNA contm o cdigo gentico que predetermina a seqncia de
aminocidos que compor uma determinada
protena. A realizao dessas funes vitais feita
atravs de trs mecanismos bsicos: replicao
(do DNA), transcrio (do RNA mensageiro) e
traduo (do cdigo gentico), conforme esquematizado na Fig. 5.1.
O mecanismo de auto-replicao, tema abordado em detalhes no Captulo 4, responsvel
pela duplicao de todo o DNA, necessria para
a diviso celular. Por outro lado, os mecanismos
responsveis pela sntese protica incluem o processo de transcrio de fragmentos de DNA, os
quais constituem os genes, em RNAs mensageiros (RNAm) e a sua traduo em uma seqncia
de aminocidos. Os processos de transcrio do

DNA e traduo do RNAm esto diretamente


envolvidos no mecanismo de expresso dos genes.
Assim, a relao entre DNA, RNA e protena estabelece que a cadeia de DNA serve como
molcula-molde tanto para a sntese de uma fita
de DNA durante o processo de diviso celular
(processo de replicao) como para a sntese de
RNAs mensageiros como um processo intermedirio para transmitir a informao gentica necessria para a sntese das protenas atravs dos
processos de transcrio e traduo.
As molculas de DNA e de RNA so compostas pelas chamadas bases nitrogenadas ou
nucleotdeos, incluindo adenina, citosina, guanina, timina (timina exclusiva do DNA) e uracila
(exclusiva do RNA). Estas bases encontram-se
ligadas umas s outras, formando a fita de DNA
ou RNA, atravs de ligaes fosfodister. Por
outro lado, uma fita se liga a outra fita de DNA
para formar a dupla fita, atravs de pontes de
hidrognio. importante ressaltar que as molculas de citosina (C) e de guanina (G) se ligam
atravs de trs pontes de hidrognio, enquanto
as molculas de adenina e timina se ligam atravs de duas pontes de hidrognio. Esta relao
qumica entre as molculas resulta em um pareamento especfico entre elas, onde C se liga

85

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

transcrio
DNA
Cap.

traduo
RNAm

PROTENA

replicao

Fig. 5.1 Dogma central.

tre si. Na replicao, todo DNA duplicado e a


dupla fita de DNA se separa e cada uma das fitas serve como molde resultando em duas fitas
duplas de DNA. J no processo da transcrio,
somente um pequeno fragmento da molcula de
DNA, o qual contm o gene de interesse, se separa e apenas uma das fitas serve como molde
para a sntese do RNA mensageiro, conforme
esquematizado na Fig.5.2. Por esse motivo, o
RNA composto por uma fita simples e no
dupla como o DNA.

DOS GENES S PROTENAS

Fig. 5.2 Duplicao do DNA versus transcrio do


RNAm.

exclusivamente com G e A com T. Esta propriedade conhecida como complementaridade, o


que propicia em ltima anlise que a sntese de
DNA ou RNA seja feita utilizando-se uma das
fitas-me como molde. Assim, durante o processo de sntese, tanto de DNA como de RNA,
quando existir uma citosina (por exemplo) na
molcula-me, uma guanina ser incorporada na
molcula filha que est sendo sintetizada e, da
mesma forma, quando houver uma adenina (no
DNA) uma timina (quando a fita-filha for um
DNA) ou uma uracila (quando a fita filha for
um RNA) ser incorporada.
A composio qumica do DNA e do RNA
semelhante, porm no idntica. As bases esto
ligadas a um esqueleto de acar, uma pentose,
que no caso do DNA uma desoxirribose e do
RNA uma ribose.
Embora os mecanismos de replicao e
transcrio resultem na sntese de fitas complementares, so processos bastante diferentes en-

86

O genoma humano composto por seis bilhes de nucleotdeos formando imensas molculas de DNA, as quais so distribudas em 23
pares de cromossomos. Assim, cada cromossomo composto por molculas de DNA contendo milhares de genes, os quais codificam todas
as protenas necessrias para o funcionamento
das clulas. Estimava-se que o genoma humano
possusse cerca de 100.000 a 300.000 genes,
porm com a finalizao do seu seqenciamento, esta estimativa caiu para 30.000 a 50.000
genes, que controlam todos os aspectos da embriognese, desenvolvimento, crescimento, reproduo e metabolismo, ou seja, controlam
essencialmente todos os processos biolgicos.
Os genes so classicamente definidos como
as regies do DNA que codificam as protenas.
Esses segmentos ou regies codificadoras se distribuem ao longo da fita de DNA de tal forma
que alguns genes se localizam prximos uns dos
outros, enquanto outros apresentam maior distanciamento entre si. Entretanto interessante
notar que as regies codificadoras representam
apenas 10% de todo o DNA genmico, sendo o
restante seqncias silenciosas. A razo para isso
, muito provavelmente, evolutiva, ou seja, medida que genes foram sendo incorporados ao genoma ao longo da evoluo, estes traziam consigo
seqncias no codificadoras que tambm eram
incorporadas.

O CDIGO GENTICO
A informao gentica contida no DNA (genes) transmitida ao citoplasma e ento usada
para determinar a seqncia de aminocidos que
compem as protenas. A transferncia desta

EXPRESSO E TRADUO DA INFORMAO GENTICA

informao do ncleo para o citoplasma feita


atravs da sntese do RNAm, o qual contm uma
seqncia de bases complementar ao respectivo
gene. Como o RNAm sintetizado pelo processo da transcrio, ele freqentemente referido
como transcrito. Os RNAs mensageiros contm o cdigo gentico que determina uma seqncia de aminocidos, onde cada conjunto de
trs bases compe um cdon o qual codifica um
aminocido. A Fig. 5.3 mostra um exemplo de
um gene fictcio, originando um RNAm e a seqncia de aminocidos respectiva.

Tabela 5.1
Cdigo Gentico
1 Posio

Assim, a molcula de RNAm composta


por quatro bases, e cada conjunto de trs bases codificam um aminocido, e, portanto, quatro bases combinadas trs a trs resultam em 64
combinaes diferentes, ou seja, 64 aminocidos. Porm apenas 20 aminocidos compem
todas as protenas, o que significa que um determinado aminocido pode ser codificado por
mais de um cdon. Este fenmeno conhecido
como degenerncia do cdigo gentico.

Podemos observar pela Tabela 5.1 que a


maioria dos aminocidos possuem duas a seis
combinaes diferentes ou cdons. Assim, a fenilalanina, por exemplo, pode ser codificada tanto pelo cdon UUU como pelo UUC. A nica
exceo o aminocido metionina, cujo cdon
(ATG) determina o incio do gene.

ANATOMIA

DO

3 Posio

Fen
Fen
Leu
Leu

Ser
Ser
Ser
Ser

Tir
Tir
Stop
Stop

Cis
Cis
Stop
Trp

U
C
A
G

Leu
Leu
Leu
Leu

Pro
Pro
Pro
Pro

His
His
Gln
Gln

Arg
Arg
Arg
Arg

U
C
A
G

Iso
Iso
Iso
Met

Tre
Tre
Tre
Tre

Asn
As
Lis
Lis

Ser
Ser
Arg
Arg

U
C
A
G

Val
Val
Val
Val

Ala
Ala
Ala
Ala

Asp
Asp
Glu
Glu

Gli
Gli
Gli
Gli

U
C
A
G

Cap.

rm as bases contidas nos ntrons no so codificadoras, uma vez que elas so excludas durante o processo de amadurecimento do
RNAm. A funo dos ntrons ainda no est totalmente esclarecida, porm sabe-se que eles
podem conter polimorfismos, os quais embora
no interfiram na seqncia de aminocidos que
formaro a protena, so capazes de influenciar
o nvel de expresso do gene, conforme detalhado no Captulo 11.

GENE

Um gene composto por segmentos chamados xons e ntrons. Os xons contm as


seqncias que codificam os aminocidos, po-

DNA

2 Posio

A transcrio de um gene se inicia pelo primeiro xon, o qual contm uma seqncia inicial
fixa para todos os genes. Essa seqncia for-

.......... ATG

CCC

CTC

AAC

GTT .......

.......... TAC

GGG

GAG

TTG

CAA .......

transcrio
RNAm

AUG CCC
CUC
AAC GUU
....................................................................
cdon

PROTENA

MET

PRO

LEU

ASP

VAL

traduo

Fig. 5.3 Do DNA protena.

87

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

mada pelas bases ATG, as quais determinam o


incio do gene ou o start codon (Tabela 5.1). Este
cdon codifica o aminocido metionina.
Cap.

O nmero de xons e ntrons bastante varivel entre os genes, havendo, inclusive, genes
(raros) que no apresentam ntrons. Porm, na
presena de vrios xons, estes so intercalados
pelos ntrons. Ao contrrio da seqncia nica
que determina o incio de um gene, existem trs
diferentes cdons que determinam o final do
gene, UAG, UAA e UGA, seqncias essas tambm conhecidas como stop codons, que interrompem a traduo do RNAm na protena
correspondente.

IMPLICAES FISIOLGICAS E
FISIOPATOLGICAS DA EXPRESSO GNICA
Embora todas as clulas somticas de um
indivduo possuam exatamente o mesmo genoma, ou seja, os mesmos genes, estes se encontram diferentemente expressos em cada tipo de
clula. Tal fenmeno que caracteriza os diferentes tipos celulares, pois as clulas de cada
rgo expressam determinadas protenas especficas daquele rgo ou mesmo dentro de um
subtipo celular em um mesmo rgo, conferindo um fentipo especfico. Assim, um neurnio
diferente de uma clula epitelial porque, embora o conjunto de genes seja o mesmo, eles se
expressam de forma diferente. Existem os genes
cuja expresso definida como constitutiva,
ou seja, genes que se expressam independentemente do tipo celular, pois desempenham funes bsicas, como, por exemplo, os genes que
codificam protenas do citoesqueleto, da cadeia
respiratria, de reparo do DNA, etc. Ao contrrio, os genes cuja expresso definida como induzvel codificam protenas especficas de cada
tipo celular, conferindo portanto um fentipo
correspondente. O nvel de expresso tambm
fator importante na diferenciao do tipo de clula, ou seja, o quanto que uma clula produz de
uma determinada protena pode torn-la diferente de outra clula. Alm disso, vale salientar que o
nvel da expresso gnica varia em determinadas
situaes fisiolgicas e/ou fisiopatolgicas. Por
exemplo, h protenas que so expressas ou sintetizadas apenas na infncia e desaparecem na vida
adulta, ou seja, o gene est ativo ou ligado durante a infncia e inativo ou desligado na vida

88

adulta. Mais ainda, durante os processos fisiopatolgicos ocorrem modificaes na expresso de


determinados genes que podem estar muito ou
pouco expressos, quando comparados com uma
situao de normalidade. De maneira geral estas
modificaes que determinam a resposta fisiolgica e/ou fisiopatolgica da clula a um determinado estmulo. Assim, o processo de ativar ou
desativar um determinado gene est fundamentalmente relacionado com as funes celulares em
cada momento ou situao durante a vida de um
indivduo.

Como um Gene se Expressa


O mecanismo de ativao de um gene bastante complexo e se inicia com a ligao de uma
protena indutora em certas regies do DNA
denominadas promotoras, as quais esto prximas e antecedem os genes.
A abundncia de um determinado RNAm
geralmente se correlaciona com os nveis de
sntese da protena correspondente, processo
normalmente referido como expresso gnica. Os
nveis de RNAm so regulados por processos
altamente complexos que requerem seqncias
especficas do DNA, referidas como elementos
de controle. Estes elementos esto intimamente
envolvidos na iniciao do processo de transcrio, antecedem o incio do gene e so chamados
de promotores, pois promovem a transcrio do
gene e, portanto, a sua expresso. Outros elementos de controle da expresso dos genes incluem
os supressores (inibem a transcrio gnica) e os
potencializadores, que aumentam a expresso de
um determinado gene. Assim, estes elementos
so fundamentais no controle da expresso dos
genes, sendo responsveis por manter ou no
um determinado gene ativo, muito ativo ou inativo, conforme esquematizado na Fig. 5.4.
Quando um gene estimulado ou ligado,
sua seqncia ser traduzida em uma protena,
permanecendo neste estado at que algum sinal
o desligue. Um mecanismo bastante comum de
regulao o feedback negativo, ou seja, o aumento na sntese da protena codificada por aquele
gene pode ser suficiente para inativar o gene respectivo. Este mecanismo de controle de ativao/
inativao do gene mantm o suprimento de uma
determinada protena em relao ao seu consumo em nveis balanceados. Assim, o mecanismo

EXPRESSO E TRADUO DA INFORMAO GENTICA

que regula a atividade de um gene , geralmente,


um sinal externo ao ncleo. Este processo bastante complexo e no totalmente entendido, mas
envolve uma cascata de reaes que culminam
com a ativao de enzimas capazes de fosforilar
(fosfatases) ou defosforilar (quinases) as protenas que se ligam s seqncias regulatrias dos
genes, ativando-os ou desativando-os.

TRANSCRIO

DE UM

GENE

A transcrio de um gene envolve primariamente a sntese do RNA mensageiro, que catalisada pela enzima RNA polimerase, conforme
esquematizado na Fig. 5.5.
A transcrio de um gene no depende apenas da enzima RNA polimerase. Mais do que
isso, o primeiro passo para que um gene seja
expresso, ou seja, transcrito, a ligao de uma
protena indutora ou fator de transcrio
seqncia promotora do gene (promotor). Estes fatores de transcrio se ligam a seqncias
especficas do promotor, principalmente na seqncia TATAAA, tambm conhecida como
TATA box. Esta seqncia comum maioria
dos promotores de genes de clulas eucariotas.
Assim, o fator de transcrio, que uma pro-

tena, possui stios de reconhecimento desta seqncia. A ligao do fator de transcrio ao


TATA box propicia a ligao da enzima RNA
polimerase ao stio de iniciao da transcrio
do gene e a sntese do RNAm comea.
Este processo de sntese gera uma fita complementar ao DNA que o originou. Esta fita compe um RNAm imaturo, contendo seqncias
complementares ao xons e ntrons. O prximo
passo envolve um processo de rearranjo da molcula recm-sintetizada, onde os ntrons so retirados e os xons rejuntados. Este mecanismo
conhecido como splicing do RNAm. Assim, apenas os xons faro parte do RNAm maduro e,
portanto, s eles sero traduzidos em uma seqncia de aminocidos.
Adicionalmente, o RNAm contm seqncias de nucleotdeos, nos dois extremos da regio de codificao, as quais formam as regies
no traduzidas ou UTR (untranslated regions).
Estas regies esto envolvidas na regulao da
mensagem ou da expresso do gene, estabilidade e outras funes do RNAm.
Outro processo importante que ocorre, ainda dentro do ncleo, a incorporo de uma
cauda de poliadeninas na recm-formada molcula de RNAm. Acredita-se que a cauda de po-

Fig. 5.4 Ativao e inativao de um gene.

89

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Fita de DNA

Cap.

liadeninas confira estabilidade do RNAm durante


sua sada do ncleo em direo ao ribossomo
onde ele ser traduzido. interessante notar que
cauda de poliadeninas caracterstica prpria
dos RNAs mensageiros, no estando presente
nos demais tipos de RNAs, transferidor ou ribossmico. A Fig. 5.6 esquematiza o processo
de transcrio e amadurecimento do RNAm.

Fita de RNA

Adenina
Timina
Guanina
Citosina
Uracila

TRADUO DO RNAm EM
DE AMINOCIDOS
RNA polimerase

Fig. 5.5 Mecanismo de sntese do RNAm: transcrio.

UMA

Aps ser processado e modificado, o RNAm


maduro est pronto para sair do ncleo e no citoplasma chegar ao ribossomo, onde ser traduzido em uma seqncia de aminocidos,
atravs de leitura sucessiva dos cdons que compem aquele RNAm. Neste processo esto envolvidos o ribossomo, que constitudo por
protenas enzimticas e por RNAs ribossmicos
(RNAr), alm dos RNAs transferidores (RNAt).
O RNAt constitudo por uma fita de RNA com
cerca de 80 nucleotdeos, em forma de cruz, onde

DNA
Exon

Exon

Intron

Intron
Sinal de
trmino

Regio
promotora
Transcrito primrio
Exon

Intron

Exon

Intron

Exon

Intron

Exon

Intron

Cap
AAA...A
Cauda de poli A
Remoo dos ntrons
(splicing)
Cap
AAA...A

RNAm maduro

Cap
Exon

Exon

Fig. 5.6 Mecanismo de transcrio e splicing do RNAm.

90

Exon

Exon

Exon

SEQNCIA

Exon

AAA...A

EXPRESSO E TRADUO DA INFORMAO GENTICA

Cap.

Fig. 5.7 Traduo do RNAm.

na extremidade inferior existem trs nucleotdeos


chamados anticdon, os quais so complementares ao cdon especfico na cadeia de RNAm.
Do lado oposto, na extremidade superior, o RNAt
carrega o aminocido correspondente quele
anticdon. A funo do RNAr auxiliar a ligao entre o RNAm e o RNAt.
Durante a traduo, como esquematizado
na Fig. 5.7, o ribossomo inicialmente se liga ao
primeiro cdon (start codon) da molcula de
RNAm (AUG), o qual especifica o aminocido
metionina (este aminocido pode ser posteriormente removido da cadeia de polipeptdeo). O
ribossomo se move ao longo da cadeia de RNAm
decodificando cada cdon, promovendo a ligao
ao RNAt ao RNAm atravs da ligao cdon/anticdon. Quando o RNAt se ligar ao RNAm, o
aminocido incorporado cadeia de polipeptdeo nascente. Este processo ocorre sucessivamente at o ribossomo atingir o cdon de termino
(stop codon) na molecula de RNAm, quando a
traduo e formao da cadeia de polipeptdeo
cessa. O polipeptdeo ento liberado para o citoplasma, porm antes deste peptdeo se tornar

uma protena funcional, ele submetido a importantes processos de amadurecimento, conhecidos como modificaes ps-traduo,
conforme detalhado no Captulo 6.
Em resumo, o processo de sntese protica, o qual iniciado atravs da ativao gnica, altamente sofisticado e submetido a um
rigoroso controle, pois dele depende o funcionamento normal da clula e, portanto, do organismo. Como abordado neste captulo, este processo
envolve inmeros passos que podem ser suscetveis a erros. Alm disso, a maneira como uma
clula, um rgo ou um indivduo sintetizam suas
protenas depende de uma srie de fatores, incluindo os genticos e ambientais.

BIBLIOGRAFIA
1. Drlica K. Uderstanding DNA and gene cloning: A guide
for the curious. John Wiley & Sons, Inc. New York,
1992.
2. Rothwell NV. Understanding Genetics: A molecular
approach. Wiley & Sons, Inc. New York, 1993.
3. Watson JD, Gilman M, Witkowski J, Zoller M.
Recombinant DNA, 2 o. ed., Nova York, Ed.
W.H.Freeman & Co, 1992.

91

SNTESE, ESTRUTURAO E DISTRIBUIO DE PROTENAS

Cap.

Sntese, Estruturao e
Distribuio de Protenas
Bento C. Santos

Em grande parte, clulas so feitas de protenas, que constituem mais de 50% do seu peso
seco. As protenas determinam a forma e a estrutura da clula e tambm servem como principal elemento de reconhecimento molecular e
catlise. Embora o DNA armazene as informaes necessrias para fazer uma clula, este tem
discreta influncia nos processos celulares. DNA
e RNA so cadeias de nucleosdeos quimicamente similares. Em contraste, as protenas
so formadas por 20 aminocidos distintos,
com caractersticas e propriedades qumicas
diferenciadas. Essa variedade permite uma
enorme versatilidade de propriedades qumicas das protenas, o que habilita estes compostos a exercerem suas mltiplas atividades
celulares com especificidade.

SNTESE PROTICA

E SUA

LOCALIZAO FINAL

Traduo das Protenas


Apesar da sua importncia fisiolgica as protenas no se auto-organizam, dependem dos cidos nuclicos para sua formao. A informao
est contida no DNA na forma da seqncia de
bases A, G, C e T. Trs nucleotdeos formam um
cdigo trplice, que vai ser utilizado na seleo de
um aminocido. A seqncia desse cdigo trplice usada como base para determinao do tipo
e ordem de aminocidos componentes da prote-

na a ser sintetizada. Por sua vez essa seqncia


de aminocidos governa sua estrutura espacial e,
por conseguinte, sua funo biolgica.
Uma enzima interage com a fita de DNA no
ncleo da clula e causa a abertura da dupla hlice em um determinado segmento, tipicamente
com cerca de 1.000 nucleotdeos, onde a transcrio do cdigo realizada. Uma imagem em
espelho feita em uma molcula de RNA, chamada RNA mensageiro (RNAm), que passa atravs de poros nucleares atingindo o citoplasma
da clula.
Uma das pontas da molcula do RNAm adere ao ribossomo, estrutura complexa formada por
cerca de 100 protenas. A molcula do RNAm
move-se pelo ribossomo e o processo de traduo realizado em consrcio com outro tipo de
RNA, RNA transportador (RNAt). O RNAt tem
duas cabeas, uma das quais liga-se a um aminocido e outra aos pares de bases do RNAm.
Ao mover-se pelo ribossomo o RNAm determina o aminocido a ser agregado cadeia peptdica formando a nova protena.

Localizao das Protenas


As clulas dos eucariontes tm uma estrutura
altamente organizada. Exemplos da localizao
heterognea de protenas estendem desde o ovo
at as clulas mais diferenciadas. A assimetria

93

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

inicial na distribuio das protenas no ovo de certas espcies parece ser elemento essencial no desenvolvimento do organismo. Ainda, funes de
certas clulas especializadas so determinadas por
arranjos macromoleculares de determinadas protenas. Localizao condio essencial para a
estrutura interna das clulas eucariontes, e um
dos maiores determinantes dessa estrutura a capacidade de protenas localizarem-se em locais
apropriados. Podemos classificar as protenas pelo
seu local de sntese e sua localizao final:
Protenas citoslicas no esto localizadas em
nenhuma organela celular em particular. So
sintetizadas e permanecem no citosol, onde
funcionam como centros catalticos, agindo
sobre os metablitos dissolvidos no citosol.
Estruturas macromoleculares construdas a
partir de protenas citoslicas (algumas vezes incorporando outros componentes) podem estar localizadas em algum local
particular no citosol (ex.: centrolos).
Protenas nucleares precisam ser transportadas do seu local de sntese no citosol para
o envelope nuclear. Muitas das protenas
nucleares so componentes da cromatina,
mas outras so parte de estruturas nucleares especficas.
Organelas citoplasmticas contm protenas
sintetizadas no citosol e transportadas especificamente para (e atravs) da membrana da
organela (ex.: mitocndria).
O citoplasma contm uma srie de corpos
membranosos, incluindo o retculo endoplasmtico, aparelho de Golgi, endossomos
e lisossomos. O conjunto desses corpos
tambm chamado de sistema reticuloendotelial. Protenas que se localizam nesses compartimentos so inseridas atravs
das membranas do retculo endoplasmtico
e posteriormente direcionadas para sua localizao especfica pelo sistema de transporte do aparelho de Golgi.
Protenas que so secretadas pelas clulas
so transportadas para a membrana plasmtica, atravessando-a e sendo posteriormente liberadas para o exterior. Sua sntese
inicia-se da mesma maneira que as protenas associadas ao sistema reticuloendotelial, porm passam inteiramente atravs do
sistema em vez de localizarem-se em algum
stio especfico.

94

Em termos de localizao as protenas podem ser divididas em dois grupos: aquelas associadas com membranas e aquelas no associadas
com membranas. Cada grupo pode ainda ser
subdividido, dependendo se a protena associase com uma estrutura ou membrana celular em
particular.
Protenas que no esto associadas membrana so liberadas no citosol assim que sua sntese completada pelo ribossomo. Algumas
protenas continuam livres no citosol numa forma quase solvel, outras se associam com estruturas citoslicas macromoleculares, como
filamentos, microtbulos, centrolos etc. Nesta
classe tambm se incluem as protenas nucleares (que chegam ao ncleo atravs de poros).
Os ribossomos onde essas protenas so sintetizadas so chamados ribossomos livres. A situao habitual para a protena sintetizada pelos
ribossomos livres a de permanecer no citosol;
para ser enviada para uma localizao especfica
necessrio um sinal apropriado, tipicamente
uma seqncia de aminocidos que possibilita
sua ligao com uma estrutura macromolecular
ou ser reconhecida pelo sistema de transporte
intracelular.
O processo de insero atravs de uma
membrana chamado translocao protica.
Protenas que se associam s membranas tomam uma de duas rotas. Protenas mitocondriais so liberadas no citosol e subseqentemente
associam-se membrana da organela. Essas
protenas so sintetizadas pelos ribossomos livres e contm sinais que possibilitam sua associao com a membrana apropriada. Porque
esse processo se d aps a sntese da protena
ser completada chamado de translocao pstraduo (Fig. 6.1).
Protenas que residem no sistema reticuloendotelial entram no retculo endoplasmtico
enquanto esto sendo sintetizadas. Como esse
processo ocorre concomitante sntese, chamado de translocao co-traduo. Nesse caso
os ribossomos ficam atrelados pelas protenas
membrana do retculo endoplasmtico, formando o chamado retculo endoplasmtico rugoso.
Posteriormente a essa associao inicial membrana-alvo, a protena pode ser direcionada para
outras membranas diferentes. O processo geral
de encontrar sua localizao final atravs de su-

SNTESE, ESTRUTURAO E DISTRIBUIO DE PROTENAS

Protena secretada

Protena de membrana

Cap.

Transporte vesicular

Sinal de reteno no Golgi


Protenas
citoslicas

Sinal de reteno no RE

Sinal mitocondrial

Ribossomos ligados

Ribossomos livres

Sinal nuclear

Transporte ps-traduo

Transporte co-traduo

Fig. 6.1 Distribuio e sntese das protenas. As protenas so sintetizadas inicialmente no citosol e sua translocao se
d em momentos diferentes da sntese. O local em que a protena vai se alojar definitivamente depende de um sinal
especfico, em geral uma seqncia de aminocidos com caractersticas fsico-qumicas especiais.

cessivos sistemas de membrana chamado de


trfego de protenas.

res especficos que asseguram a eficincia e fidelidade no processo.

ESTRUTURAO PROTICA

Protenas e Sua Estrutura Qumica

Protena e Forma
Sabemos que para a atividade fisiolgica das
protenas sua forma ou estrutura tridimensional fundamental, permitindo especificidade
nos processos celulares (ex.: reao antgenoanticorpo, enzima-substrato etc.). Esto envolvidos nesses processos de estruturao protica
aspectos fsico-qumicos e mecanismos celula-

Os aminocidos so os constituintes bsicos das protenas e so formados por um grupo


amino e um grupo carboxlico (Fig. 6.2), que
constituem o eixo central das protenas, e uma
cadeia lateral, que confere a identidade dos diversos aminocidos. As ligaes covalentes formadoras das cadeias polipeptdicas (ligao
peptdica) se do entre um grupo amino e um

95

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

A)

B)

Carbono

H
H

Cn + 1

C
C
Grupo
carboxlico
Cap.

Cn

N
H

Grupo
amino

C
Cadeia
lateral

C
R

Cn + 1
O

Fig. 6.2 Aminocidos e sua disposio no espao. Os aminocidos tm um grupo carboxlico e outro amino, que podem
rodar livremente no eixos estabelecidos pelo carbono a. A ligao peptdica ocorre entre os grupos carboxlico e amino de
aminocidos diferentes, a estrutura espacial adequada alcanada pela interao de caractersticas fsico-qumicas e
mecanismos celulares especiais (chaperones moleculares).

grupo carboxlico de aminocidos diferentes.


Muitas destas ligaes numa longa cadeia peptdica permitem a livre rotao de seus tomos
constituintes, conferindo grande flexibilidade ao
eixo protico central. A princpio, qualquer protena pode adquirir um nmero quase ilimitado
de conformaes. Entretanto, a maioria das cadeias polipeptdicas adquire uma conformao
nica e particular, determinada por sua seqncia de aminocidos. Isso ocorre porque o eixo
central e as cadeias laterais dos aminocidos associam-se umas s outras e com a gua, formando vrias ligaes no covalentes fracas.
Assumindo-se que resduos laterais especficos
esto presentes em posies cruciais da cadeia
peptdica, o conjunto de foras estabelecidas
determina uma conformao particularmente
mais estvel.
A estrutura final das protenas adquirida
aps algumas etapas em que temos:
Estrutura primria a seqncia de aminocidos de uma protena determina sua estrutura tridimensional nica. Em geral, protenas
com a mesma seqncia de aminocidos adotam estrutura similar. Contudo, a quantidade
de similaridade de seqncia de aminocidos que
assegurem que duas protenas tenham homologia nas suas estruturas difcil de predizer, ainda pequenas variaes estruturais localizadas
podem determinar importantes conseqncias
funcionais.
Estrutura secundria as cadeias polipeptdicas adquirem formas compactas que exclu-

96

em a gua do interior das protenas. Segmentos


da cadeia peptdica assumem formas regulares e
repetitivas que so determinadas por interaes
favorveis entre resduos adjacentes. Esses arranjos locais geralmente envolvem segmentos
curtos (cinco a 20 aminocidos) e so denominados estrutura secundria. As estruturas secundrias mais comuns incluem as a hlices,
fitas e retornos. Essas estruturas so estabilizadas por segmentos repetitivos de pontes de
hidrognio entre os oxignios e nitrognios da
cadeia principal.
Estruturas ternria e quaternria elementos da estrutura secundria arranjam-se espacialmente, trazendo resduos que so distantes
na seqncia primria em grande proximidade.
Arranjos espaciais que envolvem segmentos de
uma nica cadeia polipeptdica so chamados de
estrutura ternria. Algumas protenas agregamse a outras, formando oligomeros como dmeros e trmeros etc. Estrutura quaternria descreve
este arranjo de subunidades em protenas oligomricas. A aquisio da estrutura quaternria
ser referida como montagem das protenas.

Princpios da Estruturao das Protenas


Muitas protenas adquirem espontaneamente
a sua estrutura correta. Um dos fatores determinantes mais importantes da conformao correta das protenas a distribuio das cadeias
laterais polares e no-polares. As diversas pores hidrofbicas (no-polares) tendem a ser
conduzidas para o interior da molcula, o que

SNTESE, ESTRUTURAO E DISTRIBUIO DE PROTENAS

permite distncia do ambiente aquoso. Em


contrapartida, as cadeias laterais polares tendem
em arranjar-se na poro mais externa da molcula, espao no qual interagem com a gua e
outras molculas polares. Participam no arranjo
tridimensional das protenas as pontes de hidrognio estabelecidas entre as diversas ligaes
peptdicas e as pontes de dissulfeto estabelecidas entre cadeias laterais de cistena. Esse conjunto de interaes fsico-qumicas determina e
mantm o arranjo protico final.
In vitro, pequenos polipeptdeos geralmente adquirem espontaneamente sua estrutura
correta, porm, dentro da clula a aquisio eficiente da conformao espacial de protenas recentemente sintetizadas dependente de uma
maquinaria celular essencial, denominada chaperones moleculares (acompanhantes moleculares). Os chaperones moleculares so protenas
especializadas, que se ligam a outras protenas
em estados no-ativos (estrutura intermediria) e assistem-nas a alcanar sua conformao funcional, em muitos casos custa de
consumo de ATP.
Originalmente essas protenas foram identificadas por sua abundncia aps a exposio das
clulas ao calor, os chaperones em geral reconhecem as pores hidrofbicas das espcies
proticas no-ativas, superfcies que estariam
certamente escondidas nas espcies ativas, e
forma ligaes no-covalentes com estas, estabilizando-as e evitando a agregao multimrica
irreversvel. A liberao do peptdeo ocorre, em
muitos casos, pela mudana da conformao do
chaperone determinada pelo ATP, permitindo
passos subseqentes de modelao e biognese.
Quando esses passos falham em prosseguir produtivamente, reconhecimento e religao pelo
mesmo ou outro chaperone podem ocorrer, permitindo uma nova oportunidade para uma conformao produtiva ser atingida.

Sntese Protica Necessita de Chaperones


A proporo de protenas que so capazes
de autoconformao em relao quelas que
necessitam chaperones no conhecida. A habilidade dos chaperones moleculares em reconhecer conformaes proticas incorretas ou
intermedirias permite sua atuao em dois passos importantes da sntese protica:

Quando uma protena sintetizada ao deixar o ambiente do ribossomo para entrar no


citosol, esta se encontra apenas com sua estrutura primria finalizada (isto , sem a conformao espacial correta). A estruturao
espontnea comea ocorrer assim que as seqncias emergentes interagem com outras
regies da protena previamente sintetizadas.
Os chaperones moleculares influenciam nesse processo de estruturao direcionado para
uma estrutura espacial correta e mais produtiva (fisiologicamente ativa).
Quando uma protena denaturada (perde
sua estrutura) se formam interaes estveis
entre partes da protena que no interagem
quando da correta conformao. Essas ligaes so semelhantes quelas que ocorrem
quando a protenas so recm-sintetizadas.
Essas interaes so reconhecidas pelos chaperones moleculares, permitindo uma nova
restruturao ou encaminhando a protena
para degradao.
Os chaperones moleculares incluem protenas que esto envolvidas na estruturao de
protenas e na formao de estruturas macromoleculares, envolvendo mltiplas protenas. O
maior subgrupo envolve trs famlias de protenas, Hsp70 (protenas de cerca de 70kD),
Hsp60 (componente de um largo complexo macromolecular) e Hsp90 (que interage com alguns
fatores de transcrio). Essas heat shock proteins
ou chaperones auxiliam na conformao das protenas inteiramente sintetizadas no citosol, assim
como na conduo das protenas agregadas s
membranas para o seu destino final.

MODELAGEM DAS PROTENAS SECRETADAS


DE MEMBRANA
Erros genticos podem resultar da sntese
anormal de protenas, anormalidades na estrutura e processamento de protenas recm-sintetizadas ou mudanas nas propriedades funcionais
das mesmas. Embora a sntese de protenas inicie-se no citoplasma, muitas so destinadas a serem expressas na superfcie da clula (ex.:
molculas reconhecedoras de superfcie, canais
inicos, receptores e molculas de adeso). Ou
secretadas (hormnios, fatores de crescimento,
protenas da matriz extracelular e enzimas proteolticas). Protenas secretadas ou da superfcie

97

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

da membrana celular recm-sintetizadas so


transportadas para o retculo endoplasmtico,
rede membranosa no interior da clula, num
estado estrutural intermedirio. Quando estas
protenas deixam o retculo endoplasmtico para
mover-se pelo aparelho de Golgi e aguardar no
aparelho secretor, estas esto quase inteiramente
estruturadas e a maioria dos complexos compostos de vrias subunidades esto completamente
montados. O lmen do retculo endoplasmtico
serve, portanto, como stio essencial na maturao protica e seu ambiente bioqumico nico
para facilitar a tima modelagem e montagem
das protenas. A estrutura correta das protenas
um passo fundamental em determinar sua atividade biolgica e sua adequao na via celular
secretria (Fig. 6.3).
Dada a complexidade das reaes que determinam a estrutura das protenas e a necessidade de fidelidade e eficincia nesse processo,
no surpresa que falhas nessa etapa faam parte
de muitas doenas. Em vrias patologias congnitas (como a fibrose cstica, deficincia de -1
antitripsina e osteognese imperfeita), a estrutura tridimensional das protenas est alterada
por mutaes que resultam em defeitos no transporte intracelular.

Chaperones Moleculares no Retculo


Endoplasmtico
Um dos mais bem caracterizados chaperones moleculares do retculo endoplasmtico a
protena regulada por glicose de 78 kD grp 78
(tambm conhecida como BiP, protena ligadora de imunoglobulina). A BiP interage com inmeras protenas secretadas e de membrana
celular dentro do retculo endoplasmtico durante o curso de sua maturao. Contudo, essa
interao fraca e de curta durao enquanto a
modelagem protica prossegue normalmente.
Protenas que falham em adquirir sua estrutura
ou montagem adequadas formam associaes
estveis com o BiP, e essa ligao usualmente
seguida por degradao.
Outros chaperones moleculares esto presentes no retculo endoplasmtico como os membros da famlia das protenas reguladas pela
glicose. Grp170, grp94, Erp72,e grp58; calreticulina, e calnexina.

98

Chaperones Moleculares na Maturao


de Protenas
Calnexina e calreticulina podem associarse com outros chaperones moleculares no retculo endoplasmtico, como o BiP e grp94, para
formar uma matriz no lmen do retculo endoplasmtico. Esta matriz pode imobilizar temporariamente as protenas, permitindo tempo
suficiente dentro do lmen do retculo endoplasmtico para complementao da estruturao e retirada dos oligossacrides da cadeias
laterais. As enzimas envolvidas em vrias modificaes ps-traduo das protenas podem
tambm fazer parte desta matriz.
Portanto, o processo mltiplo de maturao
de protenas secretrias pode envolver a interao com uma rede dinmica de enzimas e chaperones moleculares do retculo endoplasmtico.
Sugere-se que a maturao protica desenvolvese numa linha de montagem composta por vrios
chaperones moleculares com especificidades diferentes. Na estruturao progressiva das protenas a disponibilidade de pontes de ligao aos
chaperones vai se modificando. Assim, a ligao
aos diferentes chaperones favoreceria estgios
distintos no processo de maturao.
Muitas protenas recm-sintetizadas que se
movem pelo retculo endoplasmtico so eventualmente secretadas ou inseridas em variadas
membranas celulares. A associao dos chaperones moleculares com seus substratos de curta durao. Entretanto, se as protenas no
adquirem sua estrutura adequada, como quando ocorre alterao do ambiente interno do retculo endoplasmtico ou a estrutura da protena
alterada pela presena de alguma mutao, a
associao da protena incorreta e do chaperones moleculares pode tornar-se estvel e prolongada. Em muitas circunstncias, as protenas
anormais no entram na via de transporte intracelular e so retidas no lmen do retculo
endoplasmtico. A reteno dessas protenas inadequadamente estruturadas serve como mecanismo de controle de qualidade, uma propriedade
nica das organelas da via secretria.

ALTERAES CONGNITAS NA ESTRUTURAO


E MONTAGEM DAS PROTENAS
Em muitos erros inatos do metabolismo,
mutaes resultam em protenas que no conse-

SNTESE, ESTRUTURAO E DISTRIBUIO DE PROTENAS

Membrana

Ribossomo

RNA mensageiro

5
Lumen
Cap.

1
Protena
Estrutura e
montagem
corretas

Estrutura e
montagem
incorretas

Chaperones

Mutaes
ou estresse

8
5
Dissociao dos
chaperones das
protenas

Acmulo de protenas
ligadas aos chaperones

12

9
Sntese de
novos
chaperones

10

11

Transporte
vesicular

Degradao
Aparelho de Golgi

Fig. 6.3 Participao dos chaperones do retculo endoplasmtico na estruturao das protenas. Durante a sntese,
protenas secretadas e ligadas membrana so translocadas para o lmen do retculo endoplasmtico durante a traduo
atravs de canal especfico (1). Estas protenas ligam-se aos chaperones (2) e iniciam o processo de estruturao, que
facilitado por chaperones e enzimas especficas (3). Aps o trmino da estruturao e das modificaes ps-traduo (5), as
protenas (7) dissociam-se dos chaperones (6) e so transportadas para o aparelho de Golgi atravs de transporte vesicular.
Quando a protena no adquire sua estrutura e montagem correta (4), estas se ligam perenemente aos chaperones moleculares e so retidas no retculo endoplasmtico (8). Essa reteno tambm sinaliza para sntese de novos chaperones moleculares
(12). As protenas mal formadas podem ser transportadas para fora do retculo endoplasmtico, pela mesma via que serviu de
entrada para o retculo endoplasmtico (9, 10) e encaminhadas para degradao no citoplasma (11).

guem adquirir estrutura espacial adequada ou


serem transportadas atravs das organelas celulares. Como resultado as protenas anormais so
incapazes de alcanar seu destino habitual. Em
muitas circunstncias, essas acumulam-se no re-

tculo endoplasmtico e posteriormente degradadas. Esse acmulo no retculo endoplasmtico e degradao envolvem a participao de
chaperones moleculares. A associao estvel
entre protenas anormais com chaperones mole-

99

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Tabela 6.1
Patologias Genticas Onde Ocorrem Alteraes na Estrutura das Protenas

Cap.

Patologia

Gene ou Protena
Afetada

Tipo de
Protena

Defeito Molecular

Fibrose cstica

Cystic fibrosis
transmembrane
conductance
regulator (CFTR)

Membrana

Estrutura anormal e reteno no retculo


endoplasmtico em associao com
calnexina e Hsp70, levando
degradao

Osteognese imperfeita

Colgeno tipo I

Secretada

Montagem inadequada e reteno


no retculo endoplasmtico associado
a BiP

Sndrome de Marfan

Fibrilina

Secretada

Montagem inadequada, levando a


ausncia de secreo ou secreo de
fibrilina no funcionante

Tromboastenia de
Glanzmann

O gene GIIb da
glicoprotena
plaquetria
receptora de
integrina IIb/IIIa

Membrana

Estrutura anormal da glicoprotena


receptora IIb, inabilidade de formar um
complexo com a glicoprotena IIIa,
reteno no retculo endoplasmtico e
degradao

Doena de von
Willebrand

Fator de von
Willebrand

Secretada

Estrutura anormal e ausncia de


secreo, transporte entre o retculo
endoplasmtico e o Golgi defeituoso

Deficincia
hereditria do fator VII

Fator VII

Secretada

Estrutura anormal e reteno no


retculo endoplasmtico em associao
com BiP

Deficincia da
protena C

Protena C

Secretada

Estrutura anormal e reteno no


retculo endoplasmtico em associao
com BiP.

Retinite pigmentosa
autossmica dominante
(cegueira hereditria)

Rodopsina

Membrana

Estrutura anormal e reteno no retculo


endoplasmtico

Deficincia de -1
antitripsina

-1 antitripsina

Secretada

Estrutura anormal e reteno no retculo


endoplasmtico em associao com
calnexina

Hipercolesterolemia
familiar tipo II

Receptor de
lipoprotena de
baixa densidade

Membrana

Estrutura anormal e reteno no


retculo endoplasmtico

Diabetes inspido
nefrognico congnito

Receptor de
vasopressina ou
protena do canal
de gua
(aquaporin)

Membrana

Estrutura anormal e reteno no


retculo endoplasmtico

Sndrome da glicoprotena
deficiente de carboidrato

Desconhecida

Vrias

Glicolisao insuficiente de certas


glicoprotenas, tornando-as no
funcionais ou levando ao acmulo do
retculo endoplasmtico

Hipotireoidismo com
bcio congnito

Tireoglobulina

Secretada

Defeito na estrutura ou montagem da


tireoglobulina (ou ambas), com reteno
no retculo endoplasmtico em possvel
associao com BiP.

100

SNTESE, ESTRUTURAO E DISTRIBUIO DE PROTENAS

culares, como BiP e calnexina, tem sido demonstrada em vrias patologias. A patologia molecular associada com genes mutantes envolve duas
caractersticas. As protenas anormais falham em
alcanar sua localizao normal (em geral a
membrana celular), no exercendo sua funo
biolgica. Associa-se o acmulo de protenas no
retculo endoplasmtico, determinando sua distenso e danos celulares srios (como a leso
nos hepatcitos em pacientes com deficincia de
-1 antitripsina). A lista de patologias que envolvem problemas na estruturao das protenas
cresce constantemente, nestas incluem-se enfisema hereditrio, fibrose cstica, hipercolesterolemia familiar, vrios distrbios da coagulao e
a osteognese imperfeita (Tabela 6.1).

CONCLUSO
A estruturao de protenas ligadas a membrana ou livres e sua distribuio adequada no
ambiente celular consiste num processo celular
complexo. Interaes fsico-qumicas e a atuao de maquinaria celular adequada so essen-

ciais para sua realizao. A importncia das


protenas no funcionamento celular alerta que
disfunes na sua sntese, armazenamento e distribuio podem participar em uma srie de doenas. O entendimento aprofundado dessa
atividade celular poder permitir novas abordagens teraputicas.

BIBILIOGRAFIA
Livros
1. Alberts BD, Bray J, Lewis M, Raff K, Roberts JD, Watson.
Molecular Biology of the Cell. Garland Publishing,
Inc, New York & London. p. 1291, 1994.
2. Lewin B. Gene VI. Oxford University Press and Cell
Press, Oxford. p. 1259, 1997.
Revises
1. Gething M, Sambrook J. Protein folding in the cell.
Nature. 355:33-45, 1992.
2. Hartl FU. Molecular chaperones in cellular protein
folding. Nature. 381:571-579, 1996.
3. Netzer WJ, Hartl FU. Protein folding in the cytosol:
chaperonin-dependent
and
independent
mechanisms. Trends Biochem Sci. 23 (2):68-73,
1998.
4. Kuznetsov G, Nigam SK. Folding of secretory and
membrane proteins. N Engl J Med. 339 (23):168895, 1998.

101

Cap.

SINALIZAO CELULAR

Cap.

Sinalizao Celular
Nobuko Yoshida

Nos organismos multicelulares, as clulas comunicam-se por meio de uma elaborada rede de
comunicao que coordena os mltiplos processos nos diversos tecidos e rgos, assegurando
assim o pleno funcionamento do organismo
como um todo. Essa sinalizao celular ocorre
por meio de uma grande variedade de molculas que incluem derivados de aminocidos, protenas, nucleotdeos, esterides, derivados de
cidos graxos.
A clula responde a uma determinada molcula sinalizadora (ligante) se possuir receptores
especficos para o ligante. Ao ligar-se a um receptor, presente na superfcie da clula-alvo ou
localizado internamente, a molcula sinalizadora desencadeia uma cascata de eventos intracelulares que altera o comportamento da clula.
Grande parte das molculas de sinalizao
secretada, podendo agir sobre clulas adjacentes ou localizadas a distncia, enquanto outras,
firmemente ligadas superfcie da clula sinalizadora, exercem o seu efeito por contato direto
clula-clula. Os neurotransmissores, que esto
envolvidos na conduo de impulsos eltricos de
uma clula nervosa para outra, so um exemplo
de substncias que afetam clulas que so adjacentes s clulas sinalizadoras. J os hormnios,
secretados por clulas endcrinas, so levados

pela circulao at as clulas-alvo especficas distribudas pelo corpo. As clulas podem tambm
secretar molculas sinalizadoras que se ligam a
seus prprios receptores.
Diferentes tipos de clulas podem responder
diferentemente a um mesmo ligante. Por exemplo, o neurotransmissor acetilcolina estimula a
contrao da clula muscular esqueltica, enquanto diminui o ritmo e a fora de contrao do
msculo cardaco, e tem o efeito de induzir em
clula acinar pancretica a exocitose de grnulos
secretores contendo enzimas digestivas.
Vamos discutir aqui as molculas de sinalizao, os receptores de superfcie celular, as vias de
transduo de sinal e a funo de mediadores intracelulares, assim como os mecanismos pelos
quais a interao ligante-receptor leva ativao
de fatores de transcrio e mudana na expresso gnica. Em vista do grande nmero de molculas sinalizadoras, receptores e mediadores
intracelulares, ser dada nfase s molculas cuja
funo em clulas animais bem conhecida.

MOLCULAS SINALIZADORAS
Entre as principais classes de molculas sinalizadoras incluem-se: a) pequenas molculas
lipoflicas que se difundem pela membrana plas-

103

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

mtica e interagem com receptores intracelulares, tais como hormnios esterides, hormnios
tiroidianos, retinides e vitamina D; b) molculas hidroflicas que se ligam a receptores da superfcie celular, como as catecolaminas, que so
derivados de aminocidos, e os hormnios peptdicos como insulina, fatores de crescimento e
glucagon. Essas molculas, algumas das quais
relacionadas na Fig. 7.1, ligam-se a seus receptores com alta afinidade, com KD da ordem de
10-12 a 10-6 M.
Os hormnios hidrofbicos, que circulam no
sangue ligados a protenas carreadoras, persistem na corrente sangnea ou nos fluidos tissulares durante horas ou dias e medeiam respostas
de longa durao. Eles regulam o metabolismo,
crescimento e diferenciao de tecidos especficos, atividade reprodutora, etc. Embora estruturalmente distintos, os esterides (que so
derivados do colesterol), os hormnios tiroidianos, os retinides e a vitamina D atuam por me-

canismos similares. A interao dessas molculas com os seus receptores, que podem estar localizados no citosol ou no ncleo, leva ligao
do receptor a seqncias de DNA que controlam a transcrio (Fig. 7.2), afetando desta maneira a expresso de genes especficos. Esses
receptores proticos so estruturalmente semelhantes, indicando que so codificados por membros de uma superfamlia de genes que evoluram
de um precursor ancestral comum. Cada uma
dessas protenas contm um domnio hidrofbico prximo poro C-terminal que presumivelmente se liga ao hormnio esteride, assim
como um domnio central que se liga ao DNA.
As molculas sinalizadoras solveis em gua
ligam-se a receptores da superfcie celular. Muitas delas so sintetizadas e armazenadas em vesculas secretrias, sendo liberadas das clulas
sinalizadoras por exocitose aps estimulao por
hormnio ou neurotransmissor. A ligao dessas molculas a receptores da superfcie celular

Molculas que se ligam a receptores nucleares

Progesterona

Testosterona

Molculas que se ligam a receptores de superfcie celular

Epinefrina

Insulina

Polipeptdeo composto de cadeias


A e B com 21 a 30 aminocidos
respectivamente

Fig. 7.1 Alguns exemplos de molculas sinalizadoras.

104

SINALIZAO CELULAR

leva, em muitos casos, a um rpido aumento na


concentrao de mediadores intracelulares, tambm denominados mensageiros secundrios. Entre as funes controladas por esses mensageiros
podem ser citadas a captao e utilizao de glicose, armazenamento e mobilizao de gorduras, secreo de produtos celulares, crescimento
e diferenciao de clulas, contrao e relaxamento de msculo liso, processos de liplise e
glicogenlise.

RECEPTORES
Embora os receptores que medeiam os processos de sinalizao pela membrana geralmente constituam menos que 0,01% da massa total
de protena na clula, sendo, portanto, extremamente difceis de serem purificadas, a sua caracterizao tem sido enormemente acelerada
pela utilizao da tecnologia do DNA recombinante. Grande parte dos receptores da superfcie
celular aqui referidos teve a sua seqncia de protena deduzida da seqncia de cDNA que a codifica e a expresso de cDNA em linhagens
celulares tem permitido a produo de protena
em grande quantidade, assim como o estudo de
sua funo. Os receptores localizados na superfcie celular podem ser agrupados basicamente em
trs superfamlias: a) receptores com sete segmen-

tos transmembrana; b) receptores com um s segmento transmembrana com atividade enzimtica


intrnseca ou sem atividade cataltica, mas diretamente associados com protena tirosina quinases
citoslicas; c) canais inicos (Fig. 7.3).

CANAIS INICOS

Cap.

As protenas de membrana que constituem


os canais inicos so formadas por associaes
de subunidades (Fig. 7.3). Essas estruturas oligomricas respondem a sinais apropriados e controlam a passagem de ons, e existem canais
distintos para K+, Na+ e Ca2+. A interao com
um ligante especfico tipicamente abre o canal
inico. Na sinalizao sinptica entre clulas
eletricamente excitveis, por exemplo, a ligao do neurotransmissor induz a abertura ou o
fechamento do canal inico transientemente,
alterando brevemente a permeabilidade a on da
membrana plasmtica e conseqentemente a excitabilidade da clula ps-sinptica.

Meio extracelular

Ligante

Ligante
Ligante

Domnio
cataltico
Receptor com
7 segmentos
transmembrana

on

Receptor
tirosina quinase
(guanilil ciclase)

Canal
inico

Citosol

Fig. 7.2 Efeito de molculas sinalizadoras lipoflicas.


Ligantes, como os hormnios esterides difundem-se atravs da membrana plasmtica e ligam-se a receptores intracelulares. Estes receptores ativados migram para o ncleo,
onde interagem com o DNA ou com fatores de transcrio,
e regulam assim a transcrio gnica.

Fig. 7.3 Principais classes de receptores da superfcie


celular. Os receptores com sete segmentos transmembrana
geralmente associam-se com a protena G atravs de sua
poro citoplasmtica. Entre os receptores com um nico
segmento transmembrana incluem-se as protenas com atividade tirosina quinase ou guanilil ciclase no seu domnio
intracelular. Os canais inicos, que consistem em vrias subunidades, permitem a entrada de on aps interao com
o ligante.

105

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

RECEPTORES DE SUPERFCIE CELULAR


ASSOCIADOS A PROTENA G

Cap.

Os membros da superfamlia de receptores ligados protena G so protenas integrais de membrana que consistem na nica
cadeia polipeptdica com sete segmentos hidrofbicos (20-25 aminocidos), em -hlice, inseridos na membrana (Fig. 7.3). Esses
receptores respondem a uma grande variedade
de molculas sinalizadoras, incluindo hormnios, neurotransmissores e mediadores locais.
Apesar de se ligarem a molculas estrutural e
funcionalmente muito variadas, os receptores
com sete segmentos transmembrana tm estrutura similar. Cada receptor tem uma seqncia N-terminal extracelular, cuja extenso
pode variar de menos de dez aminocidos at
vrias centenas, seguida de sete domnios hidrofbicos conectados por alas hidroflicas e
uma seqncia C-terminal intracelular. O stio de ligao das diversas molculas sinalizadoras que ativam essas protenas est contido
pelo menos em parte na regio inserida na
membrana. Rodopsina, a protena ativada pela
luz, os receptores olfatrios e os receptores e -adrenrgicos so alguns exemplos de receptores associados protena G.

PROTENAS G HETEROTRIMRICAS
As protenas G heterotrimricas, localizadas na
poro citoplasmtica da membrana plasmtica,
interagem com os receptores ligados ao agonista e
regulam uma gama de sistemas efetores e de mensageiros secundrios. Elas so compostas de subunidades , e codificadas por genes distintos.
So pelo menos 17 genes para G, quatro para
G e seis para G. No estado no ativado, a protena G existe como heterotrmero com GDP ligado
cadeia . Quando o receptor ativado pela interao com um ligante, ocorre a troca de GDP por
GTP em G, o que leva dissociao de G e G
e separao do receptor (Fig. 7.4). A ativao de
G promove a associao com uma protena efetora tal como a adenilil ciclase. Com a hidrlise de
GTP a ADP, pela atividade GTPase intrnseca da
G, esta dissocia-se da adenilil ciclase e reassociase com o dmero G, regenerando assim o complexo G inativo. Os processos regulados pela
protena G podem ser estimulados ou inibidos.
Assim, por exemplo, a adenilil ciclase ativada em
seguida interao com a subunidade da protena G estimulatria (Gs), enquanto a interao
com Gi inibe a enzima.
A maioria dos receptores associados protena G ativa uma cadeia de eventos que altera a

Ligante

Adenilil
ciclase

Receptor
Protena G

Receptor
Protena G

Adenilil
ciclase

Fig. 7.4 Ativao de receptores associados protena G. A mudana conformacional do receptor, resultante da interao com o seu ligante, leva troca de GDP por GTP em G acarretando a dissociao de G e G. O complexo G (GTP)
promove a associao com a protena efetora, por exemplo adenilil ciclase. Com a hidrlise de GTP a ADP, pela atividade
GTPase intrnseca da G, esta dissocia-se da enzima e reassocia-se com o dmero G, regenerando assim o complexo
G inativo.

106

SINALIZAO CELULAR

concentrao de um ou mais mediadores intracelulares. O AMP cclico (cAMP), sintetizado por


adenilil ciclase a partir de ATP, um dos mediadores mais utilizados e regula funes to variadas quanto transcrio gnica, mitognese,
contrao muscular e atividade de canal inico.
Para funcionar como mediador intracelular, sua
concentrao intracelular (normalmente 10-7 M)
deve ser capaz de mudar rapidamente em resposta a sinais externos e, a rpida sntese de
cAMP, induzida pelo ligante, deve seguir-se a sua
rpida destruio por uma ou mais cAMP fosfodiesterases, que hidrolisam cAMP a adenosina
5-monofosfato. Com a dissociao do ligante
de seu receptor, a ativao da adenilil ciclase
revertida como resultado da atividade GTPase
de Gs. O que se observa em pacientes com clera ilustra bem a importncia dessa atividade
GTPase da protena G. A toxina bacteriana catalisa a ADP-ribosilao de Gs, tornando-a incapaz de hidrolisar GTP e fazendo com que a
adenilil ciclase ligada Gs alterada permanea
em estado ativo. A prolongada elevao de cAMP
dentro das clulas epiteliais do intestino causa
um grande efluxo de Na+ e gua que responsvel por severa diarria.

PAPEL DO cAMP NA REGULAO


METABLICA EM DIFERENTES TIPOS
CELULARES
O cAMP atua como mensageiro secundrio
em muitos processos ativados por hormnio. Em
virtualmente todas as clulas eucariticas estudadas, os diversos efeitos do cAMP parecem ser
mediados por protena quinases cAMP-dependentes (PKAs). Essas enzimas so molculas
tetramricas compostas de duas subunidades reguladoras e duas subunidades catalticas. A ligao de cAMP s unidades reguladoras de PKA
causa a dissociao e ativao de subunidades
catalticas, que transferem o grupo fosfato terminal do ATP para grupo hidroxila em resduos
de serina, treonina e tirosina de substratos proticos, modificando dessa maneira a atividade
de muitas enzimas em vrios tipos celulares. A
fosforilao de muitas enzimas aumenta a sua
atividade cataltica, enquanto a de outras resulta
na diminuio de atividade. A resposta de um
tipo particular de clula depende da especificidade do substrato dessas protenas quinases.

Nas clulas hepticas e musculares, por exemplo, a elevao no nvel de cAMP induzida por
epinefrina aumenta a converso de glicognio em
glucose 1-fosfato, atravs da inibio de sntese
do glicognio e da estimulao da glicogenlise.
A PKA ativada por cAMP fosforila a glicognio
sintase, que convertida em uma enzima menos
ativa, e assim a sntese de glicognio inibida.
Por outro lado, a PKA fosforila e ativa a glicognio fosforilase quinase. Esta, por sua vez, fosforila a glicognio fosforilase, convertendo-a na forma
ativa que degrada glicognio a glucose 1-fosfato.
Todo esse processo revertido quando a epinefrina removida e o nvel de cAMP cai, sendo a
reverso mediada por fosfatase que remove os
resduos de fosfato das trs enzimas.
Em clulas adiposas, a ativao de receptores
-adrenrgicos desencadeia um aumento do cAMP
citoslico e a ativao de PKA. A enzima ativada
hidrolisa triacilgliceris a cidos graxos, que so
liberados para o sangue e ligam-se albumina,
Dessa forma, os cidos graxos so transferidos para
outros tecidos, como corao, msculos e rins,
onde so utilizados como fonte de ATP.

RECEPTORES
CICLASE

COM

ATIVIDADE GUANILIL

Relativamente poucos receptores com atividade guanilil ciclase so conhecidos. Esses receptores, que esto presentes nas clulas renais e nas
clulas musculares lisas dos vaso sangneos, possuem um domnio extracelular que interage com o
ligante, um nico segmento transmembrana em hlice e um domnio cataltico intracelular (Fig. 7.3).
Uma variedade de peptdeos estimula os receptores
com atividade guanilil ciclase, entre eles os peptdeos natriurticos atriais (ANPs), que so secretados
pelas clulas musculares no trio do corao e regulam a homeostase e a funo cardiovascular. A
ligao de ANP ao seu receptor ativa a guanilil ciclase e conseqentemente a produo de cGMP.
Por sua vez, o cGMP ativa a protena quinase
cGMP-dependente, que fosforila protenas especficas nos resduos serina ou treonina.

RECEPTORES COM ATIVIDADE TIROSINA


QUINASE (RTKS)
Hormnios peptdicos como insulina e fatores de crescimento (da epiderme, fibroblasto,

107

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

hepatcito, clula nervosa) ligam-se a receptores com atividade tirosina quinase (RTKs). Todos os RTKs so constitudos de um domnio
extracelular contendo o stio de ligao molcula sinalizadora, um domnio hidrofbio consistindo na nica hlice inserida na membrana,
e um domnio intracelular com atividade cataltica (Fig. 7.3). A atividade tirosina quinase dos
RTKs induzida pela interao com o ligante,
que leva dimerizao da maioria dos RTKs e
fosforilao de mltiplos resduos de tirosina
no seu domnio citoplasmtico (Fig. 7.5).
As tirosinas fosforiladas de RTKs funcionam como stios de ligao para diferentes
classes de protenas intracelulares, entre elas
as protenas adaptadoras que acoplam os
receptores ativados a outras molculas sinalizadoras e s enzimas envolvidas nas vias de sinalizao. Cada uma dessas protenas liga-se
a um stio fosforilado diferente do receptor,
por meio de domnios conservados denominados SH2, presentes nas protenas sinalizadoras intracelulares distintas estrutural e
funcionalmente. Cada domnio SH2, com a
sua seqncia nica de aminocidos, determina os resduos de tirosina especficos aos quais
se liga. Uma vez ligadas, muitas dessas prote-

nas tornam-se elas prprias tirosina fosforiladas, como o caso da fosfolipase C-, sendo conseqentemente ativadas. Diferentes
RTKs ligam diferentes combinaes de molculas sinalizadoras e assim desencadeiam respostas diferentes.

PAPEL DAS PROTENAS RAS NAS


DE SINALIZAO INTRACELULAR
POR RTKS

CASCATAS
ATIVADAS

As protenas Ras, pertencentes superfamlia de GTPases monomricas, desempenham


papel importante na transmisso de sinais de
muitos RTKs at o ncleo, que resulta na estimulao do crescimento e diferenciao celular.
Assim como outras GTPases, a protena Ras alterna dois estados conformacionais. Ela ativa
quando GTP est ligado a ela e inativa quando
GDP est ligado. A transio entre estado ativo
e inativo da protena Ras, que se ancora na membrana plasmtica no seu lado citoplasmtico,
regulada por protenas ativadoras de GTPase que
aumentam a hidrlise de GTP ligado a Ras, inativando-a, e por protenas que promovem a perda de GDP e a captao de GTP. As protenas
Ras mutantes, que ligam, mas no so capazes

Fig. 7.5 Ativao de protena tirosina quinases (RTKs). A interao com o seu ligante induz a dimerizao e ativao da
maioria de RTKs, o que resulta na autofosforilao de resduos de tirosina do domnio citoplasmtico. As tirosinas fosforiladas de RTKs so reconhecidas, de maneira especfica, por diferentes classes de protenas intracelulares que possuem
domnios conhecidos como SH2. Essas protenas so, por sua, vez fosforiladas e ativadas. Como diferentes RTKs ligam
diferentes combinaes de molculas sinalizadoras, desencadeiam respostas diferenciadas.

108

SINALIZAO CELULAR

de hidrolisar GTP, esto associadas com muitos


tipos de cncer humano.
Grande parte do que se conhece hoje sobre
as cascatas de sinalizao desencadeadas por
RTKs e intermediadas por Ras resultante de
estudos bioqumicos e genticos em mosca Drosophila, verme Caenorhabditis elegans e mamferos. A ativao de RTK pela ligao de um fator
de crescimento, por exemplo, promove a associao do receptor com a protena intracelular
GRB2 que, por meio de seu domnio SH2, reconhece os resduos de tirosina fosforilados. Essa
associao induz a relocalizao da protena citoplasmtica Sos, aproximando-a de Ras ligada
membrana plasmtica (Fig. 7.6). Ras ento
ativada e liga-se serina/treonina quinase Raf,
que fosforila MEK, uma quinase que fosforila
resduos serina e tirosina. MEK ativa MAP quinase, uma outra serina/treonina quinase. Quando ativada, a MAP quinase migra para o ncleo
e fosforila diferentes protenas, entre elas fatores de transcrio que regulam a expresso de
protenas envolvidas no ciclo celular e na diferenciao (Fig. 7.6).

OUTROS MENSAGEIROS SECUNDRIOS


IMPORTANTES
Alm de cAMP, cujas sntese e degradao
so reguladas por diversos receptores ligados
protena G, mas no por RTKs, trs outras molculas Ca2, inositol 1,4,5-trifosfato e 1,2diacilglicerol funcionam como mensageiros
secundrios nas vias de sinalizao iniciadas tanto por receptores com sete segmentos transmembrana como por RTKs.

CLCIO

COMO

SEGUNDO MENSAGEIRO

Grande parte dos ons Ca2+ da clula seqestrada na mitocndria, retculo endoplasmtico e outras vesculas citoplasmticas. A
concentrao de Ca2+ livre no citosol da clula
muito baixa (<10-7 M) e para manter esse baixo
nvel de Ca2+ a clula dispe de uma Ca2+-ATPase
que bombeia ons Ca2+ para fora da clula pela
membrana plasmtica, ou para o lmen dos compartimentos intracelulares que armazenam Ca2+.
Quando a clula ativada por um sinal extracelular, os nveis de Ca2+ citoplasmtico podem au-

Cap.

Fig. 7.6 Ativao de Ras e a cascata de protena quinases. RTK ativado associa-se protena GRB2, que por meio
de seu domnio SH2 reconhece os resduos de tirosina fosforilados. Em seguida, a GRB2 liga-se protena Sos, que
interage com RAs.GDP gerando a forma ativa Ras.GTP. Uma
srie de protena quinases fosforilada em cascata aps
ligao da protena Raf a Ras.GTP, culminando na gerao
de MAP quinase ativa. Esta fosforila diversos fatores de
transcrio que regulam a expresso gnica.

mentar transientemente e desencadear uma srie


de respostas celulares, como, por exemplo, exocitose de vesculas sectetrias e liberao de insulina em clulas do pncreas, contrao
muscular, proliferao celular e transformao,
degradao de glicognio em clulas musculares e hepticas, fertilizao, sinal neuronal, etc.
O Ca2+ pode ligar-se a diversas protenas intracelulares. Uma delas, conhecida como calmodulina, altamente conservada e encontrada em
todas as clulas eucariticas, medeia muitos efeitos do Ca2+. Cada molcula de calmodulina liga
quatro ons Ca2+ formando o complexo Ca2+/
calmodulina, que no possui atividade enzimtica, mas se liga a outras protenas na clula, alterando as suas atividades. Entre as enzimas
ativadas pelo complexo podem ser citadas a
cAMP fosfodiesterase, que degrada cAMP, e vrias protenas quinase que, por sua vez, fosforilam outras protenas-alvo. Em muitas clulas, o
complexo Ca2+/calmodulina ativa a Ca2+-ATPa-

109

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

se da membrana plasmtica que bombeia Ca2+


para fora da clula.

INOSITOL 1,4,5-TRIFOSFATO (IP3) INDUZ A


LIBERAO DE CA2+ DO RETCULO
ENDOPLASMTICO
Cap.

A estimulao de receptores de superfcie


em clulas hepticas, musculares, adiposas e
outras, induz a liberao de Ca2+ do retculo
endoplasmtico de maneira dependente de IP3.
Esta molcula, gerada pela hidrlise de fosfatidil inositol-4,5-bifosfato (PIP2) mediada pela
fosfolipase C, solvel em gua e se difunde
rapidamente pelo citosol. Na superfcie do retculo endoplasmtico, o IP3 liga-se a um receptor IP3-especfico que um canal de Ca2+.
A ligao de IP3 induz a abertura do canal permitindo a sada do Ca2+ para o citosol (Fig. 7.7).
O aumento de Ca2+ citoslico, juntamente com
IP3, faz com que mais canais de Ca2+ se abram
e mais Ca2+ seja liberado, num processo de
feedback positivo possivelmente responsvel pelos complexos padres de ondas e oscilaes
de Ca2+. O significado biolgico dessas oscilaes de Ca2+, que podem persistir enquanto os
receptores da superfcie celular estiverem ativados, no est claro.
Dentro de um segundo de sua formao,
grande parte do IP3 hidrolisado a inositol 1,4bifosfato, incapaz de liberar ons Ca2+ do retculo endoplasmtico. Este processo, juntamente
com o bombeamento de Ca2+ de volta para o
retculo endoplasmtico, d fim resposta de
Ca2+. Uma parte do IP3 pode ser fosforilada
para formar inositol 1,3,4,5-tetrafosfato (IP4),
que pode mediar respostas mais lentas e prolongadas ou promover a reposio de reservatrios intracelulares de Ca2+ a partir do fluido
extracelular.
Alm de canais de Ca2+ IP3-dependentes,
as clulas musculares e os neurnios possuem canais de Ca2+ denominados receptores
de rianodina por causa de sua sensibilidade
rianodina, um alcalide de planta. Esses dois
receptores so estrutural e funcionalmente similares, existindo como tetrmeros, com as regies C-terminal cooperando para formar o
canal de Ca2+, e o domnio N-terminal livre no
citoplasma.

110

DIACILGLICEROL ATIVA PROTENA QUINASE C


Alm de IP3, a hidrlise de PIP2 por fosfolipase C gera um outro segundo mensageiro, o
1,2-diacilglicerol (DAG), que permanece associado membrana (Fig. 7.7). A principal funo de DAG ativar a protena quinase C (PKC),
uma enzima que est presente no citosol na forma inativa e translocada para a face citoplasmtica da membrana plasmtica, onde ativada
por ons Ca2+ e DAG. Em diferentes tipos de
clula, a PKC ativada fosforila especificamente
resduos serina ou treonina das protenas-alvo.
A PKC fosforila os canais de Ca2+ de clulas
nervosas no crebro, a glicognio sintase nas
clulas do fgado tornando-a inativa, tambm fosforila vrios fatores de transcrio e induz ou
reprime a transcrio de genes especficos.
DAG e IP3 so exemplos de mensageiros secundrios que agem de maneira coordenada para
produzir uma resposta celular plena. No caso
do metabolismo do glicognio, DAG medeia a
inibio da sntese de glicognio por meio da
ativao de PKC, enquanto IP3 induz um aumento de Ca2+ citoslico que resulta na ativao
de glicognio fosforilase quinase, uma enzimachave na glicogenlise.

ATIVAO DE FATORES DE TRANSCRIO


PELAS VIAS DE SINALIZAO ACOPLADAS A
RECEPTORES DA SUPERFCIE CELULAR
Muitos hormnios e fatores de crescimento
solveis em gua, que se ligam a receptores da
superfcie celular, tambm podem induzir mudanas de longa durao no comportamento
celular pela estimulao da expresso gnica.
Nesse processo de ativao, fatores de transcrio especficos so fosforilados em seus resduos
de serina, treonina ou tirosina por protena quinases. Essas enzimas podem ser estimuladas pela
interao do ligante tanto com receptores associados protena G quanto com RTKs.
A ligao de molculas sinalizadoras a receptores associados protena G, como j discutido, ativa a adenilil ciclase e leva ao aumento dos
nveis de cAMP. A ligao de cAMP s subunidades reguladoras de PKA libera as subunidades
catalticas que se translocam para o ncleo. Um
dos substratos nucleares majoritrios para PKA
o fator de transcrio CREB, uma protena que,

SINALIZAO CELULAR

Meio extracelular

ligante

Receptor
fosfolipase C
protena G

protena
quinase C

Cap.

canal de Ca2+

Retculo endoplasmtico
Ca2+

Fig. 7.7 Controle da liberao de Ca2+ por canais de Ca2+ IP3-dependentes. A interao de um ligante com o seu
receptor desencadeia a sua associao com a protena G heterotrimrica que, por sua vez, ativa a fosfolipase C, gerando
IP3 e DAG a partir de PIP2. IP3 difunde pelo citosol e interage com canais de Ca2+ sensveis a IP3, levando liberao de
Ca2+. DAG, que permanece na membrana, ativa protena quinase C.

na sua forma fosforilada, se liga a uma seqncia de DNA conhecida como elemento de resposta ao cAMP (CRE) e que est contida na
regio reguladora de muitos genes. A CREB,
fosforilada em um nico resduo de serina, aumenta a transcrio desses genes induzidos por
cAMP. Entre os genes de clulas de mamfero
ativados por CREB incluem-se o gene da somatostatina em certas clulas endcrinas, e genes
do fgado codificando vrias enzimas envolvidas
na gliconeognese. Outras vias de transduo
de sinal, alm daquela envolvendo cAMP, podem
estar tambm associadas com CREB. Em determinadas clulas, a ativao de quinase estimulada
por Ca2+/calmodulina, decorrente do aumento
nos nveis de Ca2+ citoslico, fosforila CREB e
induz a transcrio gnica.
Quando ativados, os receptores de citocinas,
pertencentes superfamlia que inclui os receptores para interferon e que no tm atividade
protena quinase intrnseca, associam-se por meio
de seu domnio citoplasmtico com protena quinases presentes no citosol. Essas enzimas fosforilam os resduos tirosina de fatores de transcrio
STATs, que ento dimerizam e vo para o ncleo.
So diferentes STATs, cada qual fosforilado por
um conjunto particular de protena quinases. Por

sua vez, so vrios os membros de protena quinases e cada um associa-se com um conjunto especfico de receptores de citocina, determinando
assim a especificidade da resposta. Por exemplo,
a ligao de interferon gama (IFN) a seu receptor faz com que este se associe a duas protena
quinases conhecidas como JAK1 e JAK2, e estas
fosforilam STAT1 que forma um homodmero que
se liga a uma seqncia especfica de DNA e induz a transcrio gnica.
Os estudos sobre transduo de sinal em
diversos organismos, da bactria ao homem,
prosseguem em ritmo acelerado e o avano no
conhecimento sobre os mecanismos de sinalizao, que regulam praticamente todos os processos
biolgicos, tem sido enorme. Recentemente, os
achados resultantes da pesquisa sobre criptocromos e os receptores rfos tm sido destacados.
Os criptocromos, os fotorreceptores inicialmente
caracterizados em plantas e que so requeridos
para o crescimento em resposta luz azul, parecem desempenhar um papel importante nos ritmos circadianos no somente em plantas, mas
tambm em moscas e mamferos. Por outro lado,
alm de ampliar a compreenso sobre vias de
sinalizao, a descoberta de que alguns receptores rfos regulam vias metablicas essenciais e

111

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

a identificao de ligantes naturais e sintticos


para esses receptores, pela estratgia da endocrinologia reversa, podem abrir perspectivas
para o desenvolvimento de novas drogas para o
tratamento de uma srie de doenas.

BIBLIOGRAFIA
Cap.

1. Alberts B, Bray D, Lewis J, Raff M, Roberts K, Watson


JD. Molecular Biology of the Cell. Garland
Publishing, New York & London, 1994.
2. Berridge MJ. Inositol triphosphate and calcium signaling.
Science 361:315-325, 1993.

112

3. Cashmore AR, Jarillo JA, Wu, Liu D. Cryptocromes:


Blue light receptors for plants and animals. Science,
284:760-765, 1999.
4. Garrett RH, Grisham CM. Molecular Aspects of Cell
Biology. Saunders College Publishing, Fort worth,
1995.
5. Kliewer SA, Lehmann JM, Wilson TM. Orphan nuclear
receptors: shifting endocrinology into reverse.
Science 284:757-760, 1999.
6. Lodish H, Baltimore D, Berk A, Zipursky SL,
Matsudaira P, Darnell J. Molecular cell biology.
Scientific American Books, New York, 1995.
7. Watson S, Arkinstall S. The G-protein linked receptor
Facts Book. Academic Press, London, 1994.

CICLO CELULAR

Ciclo Celular

Cap.

Marimlia A. Porcionatto
Lcia O. Sampaio
Leny Toma
Yara M. Michelacci
Helena B. Nader

ASPECTOS GERAIS
A manuteno de um organismo vivo se d
por uma srie de processos celulares e bioqumicos que esto submetidos a rigorosos controles. Dentre esses processos est a diviso celular,
essencial para o crescimento e desenvolvimento
normal do organismo.
A proliferao celular importante em pelo
menos duas situaes: primeiro, durante a embriognese, em que existe a necessidade de formao de clulas que iro constituir o novo
organismo; e segundo, quando o organismo j
formado precisa repor clulas perdidas, natural
ou acidentalmente.
A diviso celular o mecanismo pelo qual as
clulas se reproduzem, gerando, a partir de uma
clula-me, duas clulas-filhas idnticas. Essas
clulas-filhas podem, por sua vez, crescer e se
dividir, dando origem a uma populao de clulas. Veremos, neste captulo, como uma clula
normal se divide e discutiremos os processos
bioqumicos envolvidos no estmulo e no controle da proliferao celular.
A diviso celular deve ser rigorosamente controlada de maneira a assegurar que as clulas

passem por todas as fases do ciclo celular e que


tambm mantenham seu contedo gentico intacto. Nos eucariotos a progresso atravs do
ciclo celular controlada em dois nveis: externamente, pelos fatores de crescimento, hormnios e seus respectivos receptores, que ativam
cascatas de sinalizao intracelular, gerando,
como resposta, a diviso; e, internamente, pelo
balano das atividades das protenas quinases,
fosfatases e ciclinas. Falhas no controle dos processos envolvidos na diviso celular levam, em
geral, morte celular por apoptose ou transformao maligna.
A importncia da proliferao controlada das
clulas pode ser claramente compreendida quando analisamos a embriognese. Nesse processo,
aps a fertilizao, ocorrem milhes de divises
celulares seguidas de diferenciao celular. Todos esses eventos devem ser muito bem controlados e coordenados para que se forme um novo
organismo. Da mesma maneira, no processo de
reposio celular existem mecanismos de controle que indicam quando necessrio que se
iniciem as divises celulares e tambm quando
esse processo deve cessar.

113

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

CICLO CELULAR

Cap.

Podemos dividir o ciclo celular em duas etapas bem definidas. Uma delas a interfase, perodo em que ocorre crescimento celular e
duplicao dos cromossomos e organelas celulares. O outro perodo a mitose propriamente
dita, processo pelo qual a clula divide o material duplicado durante a interfase entre as duas
clulas-filhas.

Fases do Ciclo Celular


Uma clula eucaritica em cultura, por exemplo, fibroblasto humano, se divide a cada 24 horas, aproximadamente. A mitose pode ser
acompanhada por microscopia e possvel visualizar cada fase desse perodo: prfase, metfase,
anfase e telfase. Entretanto, antes da mitose,
durante a interfase, as clulas esto aparentemente paradas, ou seja, no possvel, com a tecnologia disponvel atualmente, visualizar modificaes
no citoplasma ou no ncleo da clula durante essa
fase. Porm, durante a interfase, a clula est em
franca atividade, sintetizando os componentes que
iro constituir as clulas-filhas. A mitose propriamente dita dura, em geral, uma hora, em praticamente todos os tipos celulares, enquanto a interfase
tem uma durao varivel, dependendo do tipo
celular analisado.
A replicao do DNA ocorre durante um determinado perodo da interfase, denominado fase
S (S de sntese de DNA) que dura, em mdia,
oito horas. Entre o final da mitose, tambm denominada fase M, e o incio da fase S, h um
intervalo, chamado de fase G1 (G de gap = intervalo), cuja durao varia de clula para clula. Um segundo intervalo existe entre o final da
fase S e o incio da fase M, denominado fase G2.
Portanto, a interfase composta da sucesso das
fases G1, S e G2 (Fig. 8.1)1.
Clulas que no esto proliferando, tambm
denominadas quiescentes, esto em um estado
especial de G1 chamado de G0.

G0 e fase G1
Clulas diferenciadas, in vivo, por exemplo
hepatcitos e neurnios, podem permanecer
num estado no-proliferativo ou quiescente (G0)
por longos perodos de tempo. Clulas normais
em cultura tambm podem entrar em G0. A entra-

114

Fig. 8.1 Representao esquemtica das fases do ciclo


celular de uma clula eucaritica.

da de clulas em cultura no estado quiescente pode


ser obtida pelo cultivo das mesmas na ausncia total
ou parcial de fatores de crescimento. Culturas de
clulas normais quando atingem confluncia total
tambm entram em G0.
Clulas em G0 tm o DNA no duplicado
como as clulas em G1, porm, diferem em muitos outros aspectos. Em G0, a atividade de vrias enzimas e as velocidades de sntese de
macromolculas e de transporte transmembrana so mais baixas do que nas clulas em G12.
Na fase G1, as clulas se preparam para a
entrada na fase de sntese de DNA (fase S). Para
sair de G0 e entrar em G1 as clulas necessitam
de fatores de crescimento3. Os fatores de crescimento podem ser classificados em fatores de
competncia, que permitem que a clula inicie o
processo de diviso celular e em fatores de progresso, que fazem com que a clula progrida
atravs do ciclo celular4.

Fase S, Fase G2 e Fase M


Durante a fase S do ciclo celular todo o DNA
contido no ncleo deve ser duplicado completamente e com preciso. O ncleo induzido a
entrar em S por sinais moleculares que vm do
citoplasma5.
Um ncleo que completa a fase S e entra na
fase G2 tem seus cromossomos condensados e
segue para a mitose (fase M)6 Essa fase um

CICLO CELULAR

perodo de preparao para a produo de fatores cruciais que disparam a mitose. A fase M a
mitose propriamente dita, onde ocorre a separao das duas novas clulas formadas.

CONTROLE

DA

PROLIFERAO CELULAR

Levando-se em considerao o que foi exposto aqui, fica evidente que a proliferao celular um fenmeno bastante complexo que
envolve tanto fatores extracelulares (p. ex., os
fatores de crescimento) quanto fatores intracelulares (p. ex., as ciclinas). Para que uma clula
normal se divida, gerando clulas-filhas idnticas, necessrio que todos os mecanismos celulares funcionem corretamente e que haja um
controle muito rigoroso de todo o processo. Esse
controle feito em determinados pontos do ciclo que so chamados de pontos de verificao (checkpoints) (Fig. 8.2)7,8. Por exemplo, em
eucariotos a mitose dependente da completa
replicao do DNA. A falha ou eliminao desses controles pode resultar na morte celular, infidelidade na distribuio dos cromossomos ou
organelas, ou ainda num aumento da susceptibilidade a agentes nocivos clula, tais como
agentes que causam danos ao DNA.

FATORES

DE

CRESCIMENTO

Os fatores de crescimento foram inicialmente


descobertos quando se observou que fibroblastos em cultura proliferavam em meio suplementado com soro, mas no em meio contendo

Fatores de
competncia
(PDGF)

plasma. Um dos eventos da coagulao do sangue a liberao do contedo dos grnulos secretrios das plaquetas. Um dos componentes
desses grnulos foi identificado como o responsvel pelo efeito proliferativo sobre os fibroblastos em cultura. Esse composto, chamado PDGF
(Platelet-derived Growth Factor), uma glicoprotena que se liga a um receptor especfico que
est presente na membrana plasmtica das clulas, estimulando-as para a diviso.
A Tabela 8.1 apresenta alguns fatores de crescimento sintetizados por diferentes tipos celulares, mostrando os principais efeitos biolgicos
desses compostos. Em geral, clulas normais requerem mais de um fator de crescimento para
passar pelos pontos de restrio de G0/G1. Esses
fatores so conhecidos como fatores de competncia (quando agem no incio de G1) e fatores de
progresso (quando direcionam a clula atravs
de G1). Dentre os fatores de competncia est o
PDGF, enquanto que EGF (Epidermal Growth
Factor), IGF (Insulin-like Growth Factor) e FGF
(Fibroblast Growth Factor) esto entre os fatores
de progresso.
Alm do efeito proliferativo, alguns fatores de
crescimento so importantes na diferenciao e
sobrevivncia da clula, como, por exemplo, o
NGF (Nerve Growth Factor), que promove a sobrevivncia de neurnios.

CICLINAS
A compreenso dos eventos moleculares que
ocorrem no citoplasma durante o ciclo celular

Fatores de
progresso
(EGF)

Fig. 8.2 Pontos de verificao do ciclo celular de uma clula eucaritica.

115

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Tabela 8.1
Funes de Alguns dos Principais Fatores de Crescimento

Cap.

Fator de Crescimento

Composio

Principais Atividades

PDGF (platelet-derived
growth factor)

AA, AB ou BB
cadeia A = 125aa
cadeia B = 160aa

estimula a proliferao do tecido conjuntivo e


de clulas nervosas

EGF (epidermal growth


factor)

53aa

estimula a proliferao de vrios tipos celulares

IGF-I; IGF-II (insulin-like


growth factor)

70aa; 73aa

colaboram com PDGF e EGF;


estimulam a proliferao de adipcitos e clulas
do tecido conjuntivo

TGF- (transforming
growth factor b)

2 cadeias de 112aa

pontecializa ou inibe a resposta da maioria das


clulas a outros fatores, dependendo do tipo de
clula;
regula a diferenciao de alguns tipos celulares

FGF (fibroblast growth


factor)

acdico: 140aa
bsico: 146aa

estimula a proliferao de muitos tipos celulares,


incluindo fibroblastos, clulas endoteliais e
mioblastos

IL-2 (interleukin-2)

153aa

estimula a proliferao de linfcitos T

NGF (nerve growth


factor)

tem avanado muito nos ltimos anos. Estudos


feitos em fungos e embries de eucariotos nomamferos identificaram uma srie de protenas
que tm papel regulatrio durante o ciclo.
Outros experimentos revelaram que essas protenas regulatrias tambm esto presentes e ativas em clulas de mamferos. Dentre essas
molculas a primeira a ser descrita e estudada foi
uma quinase com peso molecular de 34 kDa, que
conhecida por diversos nomes, entre eles quinase p34, MPF quinase (M-phase promoting factor
kinase) e quinase cdc2/28*10-12. Em clulas de
mamferos o papel dos genes relacionados ao

*cdc = cell division control genes: genes que foram identificados em diferentes espcies de fungos (CDC para genes
de Saccharomyces cerevisiae e cdc para genes de Schizosaccharomyces pombe). A nomenclatura cdc2/28 refere-se
aos genes de levedura que esto relacionados com o controle da diviso celular nesses organismos. Os primeiros
genes foram identificados em mutantes sensveis temperatura, e atualmente so conhecidos mais de 50 genes. O
gene CDC2, em leveduras, codifica para a subunidade cataltica da DNA polimerase III, enquanto o gene CDC28
codifica para uma protena que se associa s ciclinas e possui homlogos em todos os eucariotos.

116

promove o crescimento de axnio;


garante a sobrevivncia de neurnios

cdc2/28 parece estar associado mitose e tambm passagem do ponto de restrio em G1.
A atividade enzimtica da quinase p34 em
eucariotos inferiores flutua durante o ciclo celular, embora a protena p34 esteja presente num
nvel constante. A atividade dessa quinase maior
nas fronteiras entre G1 e S, e na transio da
fase G2 para M1.
Nesses pontos especficos do ciclo celular,
a quinase ativa fosforila determinadas protenas-alvo, resultando no direcionamento da
clula para as fases S ou M. Embora este controle ainda no tenha sido demonstrado conclusivamente, pode-se especular sobre quais
protenas-alvo devam ser fosforiladas pelas
quinases nas fronteiras G1/S e G2/M. Por exemplo, quando a clula entra na fase M, diversas
modificaes celulares acontecem, incluindo o
desarranjo do envelope nuclear, a condensao
dos cromossomos, e a perda da adeso ao substrato resultando no arredondamento da clula.
Quando a clula se direciona para a mitose, alguns dos candidatos a substrato para a quinase
p34 so a histona H1 e as laminas nucleares13.
Da mesma maneira, alvos potenciais das qui-

CICLO CELULAR

Cap.

Fig. 8.3 Perfil de sntese e degradao de ciclinas correlacionado com a variao da atividade enzimtica da quinase p34.

nases na transio G1 S incluem vrias enzimas e polimerases envolvidas na sntese de


DNA.
As protenas responsveis pela ativao das
quinases nas transies G1 S e G2 M so
chamadas de ciclinas. As ciclinas so sintetizadas e acumuladas durante cada ciclo celular,
quando ento se ligam e ativam as quinases dependentes de ciclina ou cdks (cyclin-dependent
kinases) (Fig. 8.3)14,15.
No caso das clulas de mamferos, a cdk
p34cdc2, juntamente com sua subunidade regu-

latria, a ciclina B, controla a entrada e a sada


da clula na mitose, e seu estudo tem servido como
paradigma para a investigao de outras ciclinas
e cdks16. O controle da atividade desse complexo
se d atravs de uma srie de fosforilaes e desfosforilaes do complexo ciclina-cdk.
A ciclina B no pode ser detectada no incio
de G1, no entanto, sua sntese contnua durante
a interfase, at atingir um determinado nvel justamente quando a clula chega transio G2M.
Nesse ponto, a ciclina ativa a quinase p34 resultando na entrada da clula na fase M. Aproxi-

Fig. 8.4 Papel das fosforilaes e desfosforilaes dos resduos de treonina (Thr) e tirosina (Tyr) na ativao da quinase
p34 nas diferentes fases do ciclo celular.

117

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Fig. 8.5 Sntese e degradao da ciclina B ao longo do ciclo celular.

madamente na metade da mitose, a ciclina degradada, a quinase p34 inativada por fosforilao e os eventos do incio da mitose so revertidos
durante a telfase: os cromossomos descondensam, o envelope nuclear refeito e as clulas aderem ao substrato15.
De fato, o controle da atividade do complexo ciclina-cdk se d por fosforilaes e desfosforilaes da quinase. Por exemplo, a p34
fosforilada nos resduos de treonina 14 (T14),
tirosina 15 (Y15) e treonina 167 (T167), formando um complexo inativo com a ciclina. Essas duas fosforilaes s ocorrem quando a p34
est ligada a ciclina, e a remoo desses dois

grupamentos fosfato essencial para a ativao


do complexo. A fosforilao da tirosina 15 inibe
a atividade da quinase, e a fosforilao da treonina 167 necessria para a atividade. Quando
os resduos T15 e T167 esto fosforilados o complexo inativo, mostrando uma dominncia da
fosforilao inibitria (Fig. 8.4).
A degradao das ciclinas ocorre por protelise mediada por ubiquitinao (Fig. 8.5). No
final da mitose, o complexo ciclina B-cdk promove a ativao do sistema de poliubiquitinao
que, atravs da adio de ubiquitina ciclina,
levar sua degradao com a conseqente inativao da cdk. A adio de ubiquitina direcio-

Fig. 8.6 Seqncia de aminociods das caixas de destruio das ciclinas.

118

CICLO CELULAR

Cap.

Fig. 8.7 Formao dos complexos ciclina-cdks nas diferentes fases do ciclo celular.

nada por uma seqncia de nove aminocidos,


chamada de caixa de destruio que comum
s ciclinas (Fig. 8.6)16.
Existe um mecanismo similar ocorrendo na
transio G1 S. As ciclinas dessa fase, as ciclinas D, tambm so sintetizadas e degradadas de
maneira oscilatria, ou seja, elas comeam a ser
sintetizadas e degradadas no incio de G1, atingem um pico no final dessa fase, quando ento
ativam a quinase p34 e a sntese de DNA15. A
Fig. 8.7 mostra como as quinases dependentes
de ciclinas interagem com as ciclinas durante a
progresso da clula atravs do ciclo celular.

BIBLIOGRAFIA
1. Armelin HA. Peptide growth factors and cell cycle
control. Biomed. Pharmacother. 44:103-108, 1990.
2. Balczon R, Gard AL, Goodman SR, Kayes SG, Zimmer
WE, Goodman AL. Cell Division. In Medical Cell
Biology (S.R. Goodman, ed.), JB Lippincott Co.,
Philadelphia, USA, pp. 169-184, 1994.
3. Budd ME, Campbell JL. DNA polymerases delta and
epsilon are required for chromossomal replication
in Saccharomyces cerevisae. Mol. Cell Biol. 13:496505, 1993.

4. Cooper GM. MPF and progression to metaphase. In:


The Cell: A Molecular Approach. ASM Press,
Washington, D.C., pp. 579-581, 1997.
5. Cooper GM. Protein degradation. In: the cell: a
molecular approach. Asm press, washington, d.c.,
pp. 305-307, 1997.
6. Evans T, Rosenthal ET, Youngblom J, Distel D, Hunt T.
Cyclin: a protein specified by maternal mRNA in
sea urchin eggs that is destroyed at each cleavage
division. Cell, 33:389-396, 1983.
7. Hartwell LH, Weinert TA. Checkpoints: controls that
ensure the order of cell cycle events. Science,
246:629-634, 1989.
8. Hunter T. Braking the cycle. Cell, 75:839-841, 1993.
9. Laskey R, Fairman MP, Blow JJ. S phase of the cell cycle.
Science 246, 609-614, 1989.
10. Murray A. Cyclin ubiquitination: the destructive end of
mitosis. Cell, 81:149-152, 1995.
11. Norbury C, Nurse P. Animal cell cycles and their control.
Annu. Rev. Biochem, 61:441-470, 1992.
12. Nurse P. Ordering S phase and M phase in the cell cycle.
Cell, 79:547-550, 1994.
13. Pardee AB. G1 events and regulation of cell proliferation.
Science, 246:603-608, 1989.
14. Sherr CJ. Mammalian G1 cyclins. Cell, 73:1059-1065,
1993.
15. Sherr CJ. G1 phase progression: cycling on cue. Cell,
79:551-555, 1994.
16. Sorger PK, Murray AW. S-phase feedback control in
budding yeast independent of tyrosine
phosphorylation of p34cdc28. Nature 355:365-368,
1992.

119

ONCOGENES E GENES SUPRESSORES DE TUMOR

Oncogenes e Genes
Supressores de Tumor

Cap.

Helena B. Nader
Marimlia A. Porcionatto
Lcia O. Sampaio
Leny Toma
Yara M. Michelacci
INTRODUO
Cncer um processo invasivo decorrente
da transformao celular que pode ser caracterizado por vrios parmetros, como comprometimento das propriedades de crescimento e
diferenciao celulares, instabilidade genmica,
perda da senescncia normal e invaso dos tecidos adjacentes. O comportamento dessa clula
transformada e a resposta do hospedeiro so os
responsveis pelas manifestaes da doena. O
cncer , portanto, um distrbio gentico provocado por mutao ou deleo em alguns genes que codificam protenas capazes de estimular
e controlar o crescimento e a diviso celular; estes
genes mutados so chamados de oncogenes. Os
genes normais (no-mutados) so chamados de
proto-oncogenes. Os proto-oncogenes codificam
protenas que so importantes para a regulao
do crescimento e proliferao celular.
As primeiras informaes sobre as alteraes
genticas envolvidas no cncer vieram dos estudos de certos vrus animais em cultura de clulas animais. Clulas em cultura comportam-se
de uma maneira preordenada. Elas crescem formando uma monocamada confluente em placa
de cultura, no crescem umas sobre as outras,

exibindo, portanto, densidade de saturao,


podendo ser replicadas por um determinado
nmero de ciclos, morrendo a seguir. Na transformao celular, as clulas apresentam poucos
requisitos para fatores de crescimento, perdem
a densidade de saturao, passam a crescer umas
sobre as outras, de forma descontrolada, adquirindo a capacidade de crescimento independente de ancoragem e tornam-se imortais ao
perderem a expectativa de vida predeterminada.
No cncer, as clulas tumorais perdem a inibio de crescimento normal e continuam a se
multiplicar de uma maneira descontrolada. Devido a vrias semelhanas, a transformao de
clulas em cultura considerada equivalente ao
cncer em cultura. Cabe, no entanto, lembrar
que a aquisio dessas caractersticas em cultura no garante que a clula transformada gere
tumor quando transferida para um hospedeiro
apropriado, o que sem dvida reflete o complexo ambiente in vivo no qual a clula transformada tem que sobreviver para produzir o tumor.

VRUS

QUE

CAUSAM TUMOR

No incio do sculo XX, Rous observou que


o homogenato obtido de um sarcoma de gali-

121

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

nha, totalmente livre de clulas, era capaz de induzir novos tumores em galinhas. A presena inequvoca de vrus em tumores s foi confirmada
dcadas depois atravs dos experimentos pioneiros de Rous. Experimentos posteriores mostraram que outros vrus, como o de sarcoma de
Rous (RSV), podiam ser captados por clulas
animais em cultura, que passavam a apresentar
ento um fentipo tumoral.

dos genes celulares. Os genes estruturais (gag e


env) esto envolvidos no empacotamento do
RNA viral nascente em partculas que brotam da
superfcie da clula para infectar novas clulas.
Ainda, o RNA do genoma viral processado para
gerar os mensageiros das glicoprotenas do envelope, codificadas pelo gene env. Tumores originados por retrovrus com essas caractersticas
estruturais so raros.

Vrus que causam tumor podem ser identificados como vrus RNA ou DNA, de acordo com
o contedo de seu material gentico, de genoma
da partcula infectante. Como j mencionado, o
primeiro vrus de RNA (retrovrus) causador de
tumor foi descrito em 1911 por Peyton Rous,
como um agente filtrvel capaz de induzir sarcomas em galinhas (Rous Sarcoma Virus ou
RSV). Muitos outros vrus de RNA ou retrovrus capazes de induzir tumor foram descritos
para diversas espcies, como ratos, camundongos, gatos, galinhas e primatas. No entanto, a
relao direta entre vrus de RNA e cncer em
humanos s foi estabelecida para alguns vrus,
como o caso do vrus HTLV-1 que responsvel pela forma adulta de leucemia/linfoma de clulas T, que ocorre de forma endmica no Japo,
no Caribe e mais espordica em outras partes
do mundo. Embora os vrus oncognicos sejam agentes etiolgicos para algumas formas
de neoplasias em humanos, a maioria dos tumores no homem mostra pouca evidncia do envolvimento viral.

Outros retrovrus contm genes especficos


para induo da transformao celular. O vrus
do sarcoma de Rous (RSV) um prottipo desse tipo viral. Comparando-se o vrus RSV com o
vrus de leucose de aves (ALV) que no causa
tumores, foi possvel demonstrar a presena de
um gene responsvel pela capacidade de induo de tumor pelo vrus RSV. Como RSV induz
sarcoma, seu oncogene foi denominado src, que
codifica uma tirosina quinase de 60kDa, que no
necessria para a replicao viral. Esse oncogene encontra-se ausente no vrus ALV (Fig. 9.2).

A capacidade tumorignica de diferentes retrovrus varia consideravelmente. A maioria desses vrus contm apenas trs genes que esto
envolvidos na replicao viral e no desempenham papel na transformao celular (Fig. 9.1).
O DNA do provrus integrado ao DNA celular
transcrito para originar o RNA do genoma do
vrus, que servir para formar novas partculas
virais e de mensageiro para os genes gag e pol. A
transcrio assegurada por um promotor no
final do genoma viral, localizado dentro de uma
seqncia denominada repetio terminal longa
(LTR, long terminal repeat) presente nas extremidades do genoma viral integrado. LTRs contm sinais regulatrios que asseguram que os
mRNAs sejam corretamente poliadenilados e traduzidos. A transcrio direcionada por fatores
de transcrio celulares que reconhecem seqncias no LTR que so homlogas s seqncias

122

Logo aps a descoberta dos oncogenes virais, foi observado que cpias desses genes ou
genes quase idnticos tambm eram encontrados nos nossos cromossomos. A identificao
da origem de oncogenes presentes em retrovrus foi um passo decisivo na caracterizao dos
genes-alvo na transformao celular. Estudos de
hibridizao de oncogenes de retrovrus com
DNA e RNA celulares demonstraram que essas
seqncias so originadas de genes celulares, que
so expressos em clulas normais e no infectadas. Durante a infeco viral, pode ocorrer recombinao com o DNA da clula hospedeira
por um processo conhecido como transduo
viral, fazendo com que o vrus adquira seqncias da clula hospedeira. Em algumas situaes,
essa recombinao pode levar a uma perda do
controle de crescimento da clula infectada. Esses resultados mostraram que a contrapartida celular dos oncogenes retrovirais est envolvida
com funes crticas comuns a todas as clulas
de eucariotos. Uma comparao detalhada dos
oncogenes virais e celulares mostrou a existncia de muitas mutaes puntuais, bem como a
presena de genes truncados e genes quimricos resultantes da fuso vrus-hospedeiro. Essas
mudanas levam a alteraes na expresso ou
na atividade da protena viral quando comparada celular. Estudos realizados com vrus contendo o gene celular selvagem mostraram que

ONCOGENES E GENES SUPRESSORES DE TUMOR

Cap.

Fig. 9.1 Genoma de um retrovrus tpico.

Fig. 9.2 Genoma do vrus de leucose de aves (ALV) e do vrus do sarcoma de Rous (RSV).

os mesmos foram incapazes de induzir tumores,


enfatizando a importncia das modificaes para
a transformao nos genes virais.
Os vrus de DNA podem causar tumor dependendo do hospedeiro. A infeco viral em
clulas permissivas, que correspondem a do hospedeiro natural, no leva transformao celular. Nessas clulas ocorre a replicao do vrus,
lise celular e liberao de novas partculas virais.
Por outro lado, para as clulas no permissivas,
nas quais a replicao do DNA viral est bloqueada, pode ocorrer transformao. O genoma viral pode se integrar ao DNA celular, e a

expresso de determinados genes virais resulta


na transformao da clula infectada. O entendimento dos mecanismos bsicos da transformao por vrus de DNA foi resultante dos
estudos com os vrus SV40 (simian virus 40) e
polioma. Os genomas desses vrus so divididos em duas regies. A regio precoce expressa imediatamente aps a infeco e necessria
para a sntese do DNA viral. A regio tardia s
expressa aps o incio da replicao do DNA viral, e compreende genes que codificam componentes estruturais da partcula viral. A regio
precoce do SV40 codifica duas protenas com pe-

123

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

sos moleculares de 17kDa e 94kDa denominadas,


respectivamente, antgenos T pequeno (small T) e
grande (large T). Para o vrus do polioma, alm
desses dois antgenos, observa-se a expresso de
uma terceira protena de 55kDa, designada como
antgeno T mdio (medium T). Estudos de transfeco de clulas com os diferentes cDNAs dessas
regies mostraram que os antgenos T (grande e
mdio) esto relacionados com a transformao
celular. Esses antgenos estimulam a diviso das
clulas hospedeiras com a finalidade de produzir
as enzimas necessrias para a replicao viral. Esse
estmulo de proliferao celular pelos produtos dos
genes da regio precoce pode levar transformao se o DNA viral for integrado e expresso em
clulas no permissivas.
O vrus do papiloma e adenovrus so exemplos de vrus de DNA envolvidos com a induo
de tumores benignos e malignos em humanos.
Aparentemente, todos induzem a transformao
alterando a regulao do ciclo celular, interferindo com as atividades das oncoprotenas Rb e p53.

ONCOGENES
Oncogenes celulares (c-oncogene) ou proto-oncogenes so os homlogos celulares dos
oncogenes virais. Os produtos desses genes so
oncoprotenas que esto envolvidas nos processos normais de crescimento e diferenciao, especialmente na proliferao celular.
Proto-oncogenes so parte normal e essencial
do nosso material gentico que pertencem a um
grupo de genes envolvidos no crescimento e diviso celulares necessrios ao bom funcionamen-

to da clula. Na verdade, so mudanas nesses


genes que podem levar ao desenvolvimento do
cncer. Como j descrito, as verses modificadas dos proto-oncogenes celulares so os oncogenes presentes nos vrus da transformao.
Proto-oncogenes podem se tornar oncogenes, isto , desencadear a formao de tumores,
como resultante de mutaes, delees, inseres
ou superexpresso (Fig. 9.3, Tabela 9.1). A identificao de produtos de proto-oncogenes e de
genes supressores de tumor envolvidos no controle do ciclo celular possibilitou novos entendimentos de como a ativao de oncogenes ou a
perda de genes supressores de tumor podem levar ao crescimento desordenado e constituio
gentica anormal das clulas transformadas. Um
grande nmero de oncogenes foi identificado.
Foram denominados por nomes com trs letras,
como, por exemplo, ras, src e myc (Tabela 9.2).

Tabela 9.1
Mecanismo de Ativao de Oncogenes
Representativos em Tumores Humanos
Oncogene

Mecanismo
de Ativao

abl, bcl, lyl,c-myc, PML

translocao

erb, gli, c-myc, L-myc,


N-myc, K-sam

amplificao

gip, gsp, Ha-ras, Ki-ras,


N-ras

mutao puntual

hst, ret, trk

rearranjo do DNA

Insero de
seqncia viral
Translocao

ONCOGENE

PROTO-ONCOGENE

Mutao espontnea
Amplificao

Fig. 9.3 Mecanismos envolvidos na transformao de proto-oncogenes em oncogenes.

124

ONCOGENES E GENES SUPRESSORES DE TUMOR

Tabela 9.2
Oncogenes em Tumores Humanos
Oncogene

Tumor

Produto do Gene

abl

Leucemia mielide crnica e linfoctica aguda

Tirosina quinase

bcl-1

Linfomas de clula B e mielomas mltiplos

Ciclina D1

bcl-2

Linfomas indiferenciados e foliculares

Protena de membrana citoplasmtica

bcl-3

Leucemias linfocticas crnicas de clula B

Fator de transcrio

erb-B1

Carcinoma de clula escamosa; astrocitoma

Receptor de fator de crescimento

neu/erb-B2

Carcinoma de mama, ovrio e estmago

Receptor de superfcie para fator


de crescimento

gip

Carcinoma de ovrio e glndula adrenal

gli

Gliobastoma

gsp

Adenoma de hipfise; carcinoma de tireide

GDP/GTP transdutor de sinal


citoplasmtico

hst

Carcinoma de estmago

Fator de crescimento

myc

Linfoma de Burkitt; carcinoma de pulmo,


mama e colo uterino

Fator de transcrio celular

L-myc

Carcinoma de clulas pequenas de pulmo

Fator de transcrio celular

N-myc

Neuroblastoma; carcinoma de pulmo

Fator de transcrio celular

raf

Carcinoma de estmago

Serina/treonina quinase citoplasmtica

Ha-ras

Carcinoma de bexiga, clon, pulmo e


pncreas; melanoma

Protena ligante de GDP/GTP

Ki-ras

Leucemia mielide aguda e linfoblstica;


carcinoma de tireide; melanoma

Transdutor de sinal

N-ras

Carcinoma de trato genitourinrio e tireide;


melanoma

Transdutor de sinal

ret

Carcinoma de tireide

Receptor de superfcie celular

K-sam

Carcinoma de estmago

sis

Astrocitoma

src

Carcinoma de clon

trk

Carcinoma de tireide

Receptor de fator de crescimento

jun, fos

Vrios tipos de tumores

Fator de transcrio

O crescimento celular usualmente resulta de


um sinal, tal como a ligao de um hormnio a
um receptor da superfcie celular. Quando o
receptor recebe a mensagem de crescimento celular, ele o transmite ao ncleo atravs do citoplasma. O sinal leva ento replicao do DNA.
Mutaes que afetam qualquer etapa da via de

Cap.

transduo de sinal poderia levar a clula a estar


constantemente instruda para dividir. Por exemplo, muitos receptores respondem a sinais externos pela sua prpria fosforilao e/ou de
outras protenas. Se um receptor sofrer uma
mutao de tal forma a permanecer fosforilado
de permanente, na presena ou no de sinaliza-

125

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

o, a clula comportar-se-ia como se estivesse


constantemente instruda para se dividir. Tal
mudana gentica promoveria crescimento celular descontrolado. Alguns oncogenes identificados na transformao viral sofreram mutaes
com esse tipo de efeito.

Cap.

A definio mais ampla de oncogenes inclui


qualquer entidade gentica que promove o desenvolvimento de tumor. Todos os oncogenes so
semelhantes com relao ao fato de que codificam protenas envolvidas no controle da diviso
celular, tais como:

fosforilao leva a uma diminuio na adeso


celular e conexina, um componente das junes
gap envolvido na comunicao clula-clula, que
inibido pela fosforilao da tirosina. So exemplos de oncogenes relacionados com receptores
que apresentam atividade de tirosina quinase: erbB que corresponde forma truncada do receptor
de EGF (Fig. 9.4), kit ao receptor da forma truncada do fator de crescimento da clula precursora hematopoitica e fms ao receptor mutado do
fator CSF (Colony Stimulating Factor).

Protenas Quinases
Ligantes
Protenas que so encontradas no lado exterior das clulas e apresentam homologia com
fatores de crescimento. Por exemplo, o protooncogene c-sis codifica o fator de crescimento
PDGF (platelet Derived Growth Factor). Clulas que contm o gene cis mutado produzem altos nveis de PDGF, que se liga aos receptores
de PDGF na superfcie das clulas resultando
numa constante estimulao para proliferao
celular. O oncogene hst codifica o fator de crescimento relacionado com a famlia FGF (Fibroblast Growth Factor).

Desempenham um papel central na via de


transduo de sinal intracelular, onde catalisam
a fosforilao de protenas especficas, modulando assim a atividade biolgica. Os efeitos das
protenas quinases so revertidos por protenas
fosfatases especficas. O equilbrio entre fosforilao por protenas quinases e desfosforilao
por protenas fosfatases importante na regulao de muitos processos celulares. Muitos pro-

Receptores de Superfcie Celular com


Atividade de Tirosina Quinase
Protenas semelhantes ao receptor tipo I, que
ligam fatores de crescimento e hormnios, tipo
insulina. Esses receptores contm um domnio
de tirosina quinase na face interna da membrana celular. Esses domnios so ativados pela ligao do hormnio na poro extracelular do
receptor, e ento pela fosforilao de resduos
de tirosina em outras protenas. O receptor, em
geral, sofre autofosforilao. Outras protenas
ao se ligarem aos resduos de tirosina fosforilada, tornam-se ativadas tambm, e assim transmitem o sinal para outras partes da clula.
Mudanas nos proto-oncogenes desses receptores induzem a alteraes na atividade de tirosina quinase, seja por mutaes no domnio
quinase do receptor que afeta a autofosforilao, ou superexpresso do receptor devido amplificao gnica. Alm dos componentes da
cascata de transduo de sinal, as tirosinas quinases tm como substratos integrinas, onde a

126

Fig. 9.4 Mecanismo de ativao do proto-oncogene


erb B.

ONCOGENES E GENES SUPRESSORES DE TUMOR

dutos de proto-oncogenes so protenas quinases. As protenas quinases codificadas por proto-oncogenes podem ser subdivididas em vrios
grupos diferentes, dependendo do seu modo de
ativao ou do tipo de substrato. Enzimas do
grupo da protena quinase A (PKA) so ativadas
por cAMP (AMP cclico), do grupo das protenas quinases G (PKG) por cGMP, das protenas
quinases C (PKC) por diacilglicerol (DAG) e das
quinases calmodulina dependente por ons clcio. Uma outra classificao baseada no tipo
de resduo de aminocido que fosforilado. Assim, existem as tirosinas quinases especficas e
serinas/treoninas quinases especficas.

Protenas da Famlia Serina/Treonina


Quinases
Regulam a estabilidade de complexos proticos que controlam a meiose e a mitose no
ciclo celular (c-mos) ou transduo de sinal citoplasmtica (c-raf) (Fig. 9.5). A fosforilao da
protena Raf aumenta rapidamente em clulas
quiescentes estimuladas por mitgenos, levando a um aumento da atividade de serina/treonina quinase. Foi demonstrado que a protena Raf
um importante intermedirio na sinalizao celular que atua entre a protena Ras e as MAP
quinases (Mitogen-Activated Protein) que fosforilam as protenas nucleares, para modular a expresso gnica.

Protenas da Famlia Tirosina Quinases


Ligadas Membrana no Citoplasma
O produto do oncogene src que corresponde
a uma tirosina quinase citoplasmtica.

Protenas da Famlia Tirosina Quinases


Presentes no Ncleo
O produto do oncogene c-abl.

Protenas que Ligam GTP


So encontradas tanto na membrana como
no espao intracelular das clulas normais. As
protenas G localizadas na membrana esto envolvidas nos efeitos dos receptores de membrana do tipo III, que correspondem aos receptores
que apresentam sete hlices transmembrana, e
assim transmitem os sinais extracelulares ao sistema efetor localizado dentro da clula. Protenas G intracelulares esto envolvidas no controle
da sntese e transporte de protenas. Protenas
G ligam GTP, hidrolisando-o lentamente a GDP,
o que as converte a um estado inativo. O protooncogene ras codifica para protenas que ligam
GTP, ou protenas G. Durante a transduo de
sinal, a protena G liga GTP e ativada, sendo
desativada pela clivagem de GTP a GDP, resultando no trmino do sinal estimulatrio. Formas mutadas de protenas codificadas pelo
proto-oncogene ras so capazes de ligar GTP
com eficincia, mas incapazes de quebrar essa
molcula, ou seja, mutaes que levam inativao da atividade de GTPase. Portanto, clulas
contendo essa protena mutada esto constantemente recebendo sinais estimulatrios, resultando numa proliferao descontrolada. O
oncogene ras resultante de uma mutao puntual no proto-oncogene ras (Fig. 9.6). Mutaes
em outros oncogenes da famlia da protena G:
gsp (protena G estimulatria) e gip (protena G
inibitria) foram encontradas em muitos tumores humanos.

Receptores Hormonais Nucleares


Esto envolvidos nos efeitos de molculas
sinalizadoras lipoflicas (hormnios esterides,
tiroxina) regulando a transcrio de genes especficos. Vrios proto-oncogenes pertencem a essa
famlia de ligantes que controlam fatores de
transcrio.

Fig. 9.5 Mecanismo de ativao do proto-oncogene raf.

127

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Fig. 9.6 Mutao puntual no oncogene ras.


Cap.

9
Fatores de Transcrio
Algumas oncoprotenas esto relacionadas
com fatores de transcrio que regulam a proliferao em resposta a estmulos por fatores de
crescimento (myc, N-myc, L-myc, fos, jun) e a
diferenciao (erb-A, gli, receptor do cido retinico). Oncogenes de fatores de transcrio envolvidos na proliferao celular so membros da
famlia de genes de resposta imediata, cuja expresso rapidamente ativada quando clulas
quiescentes so expostas a mitgenos. Essas protenas so necessrias para iniciar a cascata de
eventos que dirige a clula atravs das fases G1 e

S do ciclo celular. A ativao da diviso celular


por fatores de crescimento nem sempre envolve
estmulo na sntese de fatores de transcrio. Protenas da famlia REL so expressas nas clulas
em repouso e no estimulam a transcrio porque se encontram inibidas por inibidores citoplasmticos. O estmulo por fatores de crescimento
leva liberao das protenas REL dos seus inibidores com subseqente translocao para o
ncleo e ativao da transcrio.

GENES SUPRESSORES

DE

TUMOR

Estudos com pacientes com cncer evidenciaram que, alm dos proto-oncogenes, outro

Tabela 9.3
Genes Supressores de Tumor em Humanos

128

Gene

Tumor

Produto do Gene

rb-1

Retinoblastoma; osteossarcoma; carcinoma


de duto mamrio; carcinoma de pulmo

Protena que liga DNA, possvel regulador


de transcrio

p53

Astrocitoma; carcinoma de mama, clon,


pulmo e tireide; osteossarcoma; e outros

Fator de transcrio (protena que se liga a


uma regio especfica do DNA)

WT-1

Tumor de Wilms, rabdomiossarcoma,


carcinoma mamrio e de pulmo;
hepatoblastoma

Protena que liga DNA, possvel regulador


de transcrio

DCC

Carcinoma de clon

Receptor de superfcie celular

NF1

Neurofibroma tipo 1

Interage com protena ras, induz hidrlise


do GTP

APC

Carcinoma colorretal; polipose


adenomatosa familial

Protena citoplasmtica

FAP

Carcinoma de clon

MEN-1

Tumores de paratireide, pncreas,


hipfise e crtex adrenal

MLM

Melanoma familial

ONCOGENES E GENES SUPRESSORES DE TUMOR

tipo de gene est envolvido no aparecimento e


desenvolvimento de certos tipos de cncer. Esses genes, chamados de genes supressores de
tumor, ou antioncogenes, atuam de maneira diferente dos oncogenes (Tabela 9.3). As protenas codificadas pelos genes supressores de tumor
esto envolvidas na represso do crescimento e
diviso celulares. Portanto, perda ou mutao nos
antioncogenes pode levar ao crescimento descontrolado devido remoo dos mecanismos
que regulam a diviso celular de maneira inibitria. Esse tipo de gene no faz parte da cadeia
de sinalizao que diz clula para se dividir, e
sim est envolvido no bloqueio do crescimento e
da diviso celulares. Essas protenas repressoras
aparentemente devem ser inativadas antes que o
cncer se desenvolva.
Como seria esperado, mutaes em oncogenes que levam ao cncer so distintas das
mutaes em genes supressores de tumor que
levam ao cncer. Nos oncogenes, as mutaes
ativam protenas que promovem o crescimento
descontrolado. Esse tipo de mutao inclui uma
mudana num nico aminocido que leva a uma
forma alterada da protena, multiplicao do gene
dentro do cromossomo para promover maior atividade, ou alterao das regies de controle do
gene levando perda de regulao da sua expresso ou a uma regulao errada. Essas mutaes tm uma tendncia a serem dominantes;
a presena de uma cpia normal do oncogene
no consegue estabelecer a forma mutada ativa-

da. Por exemplo, a translocao do cromossomo 9,22 que leva ativao do gene abl causa
leucemia, embora o gene abl normal permanea na outra cpia do cromossomo. Os vrus causadores de tumor foram capazes de transformar
clulas em cultura, muito embora essas clulas
tivessem cpias normais dos proto-oncogenes.
Entretanto, a perda da funo normal da
protena necessria para os genes supressores
de tumor promoverem cncer. Por essa razo,
mutaes em genes supressores tendem a ser
recessivas; uma boa cpia do gene pode fornecer a protena ativa. Pode-se prever que indivduos que herdam uma cpia de uma mutao
recessiva tm maior probabilidade de desenvolver cncer durante suas vidas.
O primeiro gene supressor de tumor identificado foi o gene do retinoblastoma. Estudos de
pacientes com retinoblastoma hereditrio mostraram que uma cpia de um determinado gene
estava inativada em todas as suas clulas e que
ambas estavam inativadas nos tumores. Uma
comparao com outros pacientes cujo retinoblastoma no era hereditrio mostrou que o
mesmo gene, agora denominado gene retinoblastoma (rb) tambm estava inativada nessas clulas tumorais. Como a perda da funo de rb era,
aparentemente, necessria para o desenvolvimento do tumor, concluiu-se que o produto do gene
rb deveria suprimir o desenvolvimento do tumor.
Os dados sugerem que o produto do gene rb
bloqueia, por mecanismos ainda no esclareci-

Fig. 9.7 Mutaes no proto-oncogene p53.

129

Cap.

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Tabela 9.4
Oncogenes e Genes Supressores de Tumor Associados a Tumores Humanos
que Codificam para Ciclinas

Cap.

Gene

Tumor

Mecanismo de Ativao

Ciclina A

Carcinoma hepatocelular

Insero do vrus da hepatite B

Ciclina D (ciclina G1)


D11S28TE
PRAD 1
bcl1

Adenoma benigno de paratireide


Tumores malignos de clula B
Cncer de mama, esfago e clula B

Rearranjo do DNA (11q13)


Rearranjo do DNA (11q13)
Amplificao

dos, a expresso dos genes que estimulam o crescimento celular. O gene rb codifica para uma
protena que regula outras protenas que, por sua
vez, esto envolvidas com a transcrio do DNA.
A perda da protena Rb por deleo ou mutao
resultaria numa constante sntese de mRNA levando a um crescimento descontrolado. Os resultados sugerem que a atividade da protena Rb
deva ser regulada pela quinase p34.
Sabemos atualmente que crianas com retinoblastoma hereditrio herdam de seus pais uma
cpia inativa do gene rb. Cada clula nos seus
organismos tem somente uma cpia boa do gene
rb. Nessas crianas, basta uma clula da retina
sofrer uma mutao na outra cpia do gene rb,
para o tumor poder ento se desenvolver. Em
indivduos geneticamente normais, uma nica
clula da retina teria que sofrer duas mutaes
independentes para que ambas as cpias de rb
fossem abolidas, o que apresenta uma baixa probabilidade de acontecer. Retinoblastoma um
cncer raro. A maioria dos casos ocorre em famlias, que aparentemente transmitem o gene defeituoso.
Mutao em um outro gene supressor de tumor, p53, est associada com um cncer hereditrio diferente, que constitui a sndrome de
Li-Fraumeni. Em geral, membros de famlias com
essa sndrome desenvolvem em idade precoce,
tumores mltiplos de mama, crebro, ossos, leucemia e outros tecidos. Pacientes com sndrome
de Li-Fraumeni herdam uma cpia defeituosa do
gene p53, em que cada clula de seus organismos
tem uma nica cpia boa do gene. Aparentemente, inativao dessa cpia boa em diferentes tipos
celulares pode levar ao cncer.
O gene p53 tambm importante em tumores no hereditrios. Estudos de alteraes ge-

130

nticas em clulas cancerosas mostraram que


mutaes em p53 esto presentes nos mais diferentes tipos de cncer do que qualquer outra alterao gentica relacionada ao cncer (Fig. 9.7).
A protena p53 uma protena nuclear que parece estar envolvida com a regulao da diviso
celular. Em clulas com p53 normal, a protena
p53 bloqueia a diviso celular, aparentemente,
at que o dano no DNA tenha sido reparado.
Por outro lado, clulas com falta da p53 normal
dividem, e a replicao do DNA danificado leva
a alteraes nas seqncias de DNA dos cromossomos das clulas-filhas. Assim, clulas com falta da atividade da p53 aparentemente podem
acumular mutaes a uma velocidade muito
maior do que as clulas normais. Se uma dessas
mutaes levar ativao de oncogene, o resultado pode ser cncer.
Anlise gentica de famlias com cncer
hereditrio e de indivduos com cncer est
levando a identificar loci nos cromossomos associados com o desenvolvimento do cncer.
Entretanto, o quadro gentico da maioria dos
cnceres at o presente no permite uma interpretao clara dos dados.

CICLINAS, ONCOGENES E GENES


SUPRESSORES DE TUMOR
A capacidade dos oncogenes em estimular a
proliferao celular e a dos genes supressores de
tumor em inibir mostram que esses genes tm
papis-chave na regulao do ciclo celular (ver
Captulo 8). A progresso da clula atravs do
ciclo celular governada por um complexo de
protenas quinases contendo subunidades regulatrias denominadas ciclinas, e subunidades catalticas denominadas quinases dependentes de

ONCOGENES E GENES SUPRESSORES DE TUMOR

ciclina (cdk, cyclin dependent kinases). Algumas


ciclinas esto relacionadas com oncogenes e genes supressores de tumor (Tabela 9.4).

BIBLIOGRAFIA
1. Aitalo K, Schwab M. Oncogene amplification in tumor
cells. Adv Cancer Res 47: 235-281, 1986.
2. Bishop JM. Molecular themes in oncogenesis. Cell 64:
235-248, 1991.
3. Bishop JM.The discovery of Proto-oncogenes. FASEB J
10: 362-364, 1996.
4. Bos JL. Ras oncogenes in human cancer: A review.
Cancer Res 49: 4682-5689, 1989.
5. Cantley LC, Auger KR, Carpenter C, Duckworth B,
Graziani A, Kapeller R, Soltoff S. Oncogenes and
signal transduction. Cell 64: 281-302, 1991.
6. Ellis MJC, Sikora K. Molecular biology of cancer. In
Molecular Biology in Medicine, Editores Cox TM,
Sinclair J, 149-171, 1997.
7. Hollstein M, Sidransky D., Vogelstein B, Harris CC. p53
mutations in human cancers. Science 253: 49-53,
1991.

8. Hunter T. The proteins of oncogenes. Sci Am 251: 7079, 1984.


9. Klein G. The approaching era of the tumor suppressor
genes. Science 254: 1643-1649, 1987.
10. Knudson AG. Antioncogenes and human cancer. Proc Natl
Acad Sci USA 90: 10914-10921, 1993.
11. Levine AJ. The tumor suppressor genes. Ann Rev
Biochem 62: 623-651, 1993.
12. Lowy DR, Willumsen BM. Function and regulation of
Ras. Ann Rev Biochem 62: 851-891, 1993.
13. Marcu KB, Bossone SA, Petel AJ. Myc function and
regulation. Ann Rev Biochem 61: 809-860, 1992.
14. Marshall CJ. Tumor suppressor genes. Cell 64: 313-326,
1991.
15. Murakami MS, Strobel MC, Vande Woude GF. Cell cycle
regulation, oncogenes, and antineoplastic drugs. In
Malignant Transformation, Editores, Ed., 1990, 3-14.
16. Ponder BAJ. Inherited predisposition to cancer. Trends
Genet 6: 213-216, 1991
17. Riley DJ, Lee EY-HP, Lee W-H. The retinoblastoma
gene: more than a tumor suppressor. Ann Rev Cell
Biol 10: 1-29, 1994.
18. Weinberg RA. The retinoblastoma protein and cell cycle
control. Cell 81: 323-330, 1995.
19. Weinberg RA. Tumor suppressor genes. Science 254:
1138-1146, 1991.

131

Cap.

MECANISMOS DE MORTE CELULAR: APOPTOSE VERSUS NECROSE

Mecanismos de Morte Celular:


Apoptose versus Necrose

Cap.

Simone Mafalda Rodrigues Camargo


Nestor Schor
At aproximadamente 20 anos atrs s se
definia uma via de morte celular em situaes
patolgicas, a necrose. Durante a dcada de 1970
o patologista John Kerr e colaboradores estudando atrofia e hiperplasia heptica descreveram
uma outra forma de morte, a qual chamaram de
necrose com encolhimento (shrinkage necrosis). As caractersticas desta forma de necrose
eram: a) ausncia de processo inflamatrio; b)
clulas pequenas; c) citoplasma contido em vesculas, algumas contendo ncleo com cromatina condensada; d) citoplasma levemente
corado, indicando que os lisossomos ainda estavam intactos. Posteriormente a este grupo de
pesquisadores se juntou o embriologista Allison
Crawford que chama a ateno do grupo para
as descobertas de Glchmanm do comeo da dcada de 1950, sobre a morte celular programada, que era nada mais que o mesmo fenmeno
s que presente numa situao fisiolgica.
O grupo ento decide chamar a necrose por
encolhimento de apoptose, palavra originria do
grego clssico, que era o termo utilizado por
Homero para descrever a queda das folhas no
outono (dropping off ou falling off), isso com o
intuito de tentar expressar renovao e no a
morte propriamente dita. Apesar do fenmeno
descrito e chamado de apoptose na dcada de
1970 ser o mesmo j descrito por embriologistas na dcada de 1950 como morte celular programada, foi durante o estabelecimento da

terminologia apoptose que se verificou que ele


poderia aparecer tanto em situaes fisiolgicas
como em situaes patolgicas.
O termo morte celular programada ou
apoptose tm sido diferenciados entre a morte que ocorre em situaes fisiolgicas decorrentes de informao gentica caracterstica das
clulas (clulas da pele, ovrios, espermatozides etc.) e aquela que ocorre em situaes patolgicas e induzida por um fator externo. O
termo suicdio celular tambm bastante utilizado e suscitou uma discusso interessante sobre o papel do suicdio de algumas clulas num
organismo pluricelular e de um suicida na comunidade, que parecem ser reaes totalmente
antagnicas.
Com a descrio das caractersticas da morte
por apoptose e as diferenas com relao necrose entenderemos melhor as vantagens que ela
tem sobre a ltima em algumas situaes, como
na embriognese. As vias bioqumicas da apoptose so bastante intrincadas e ainda esto sendo estudadas. A apoptose tambm bastante
estudada em patologias em que h diminuio
da morte celular (cncer) ou que tem aumento
exacerbado (SIDA). A manipulao da via de
morte tem sido bastante cogitada como uma
maneira de se conseguir melhores resultados teraputicos, principalmente na quimioterapia do
cncer.

133

10

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

CARACTERSTICAS MORFOLGICAS

Situaes Fisiolgicas e Patolgicas


em que Ocorre Apoptose

Necrose

Cap.

10

Na necrose h intumescimento da clula,


que caracterstica desta via de morte e decorrente da falncia dos mecanismos de transporte da membrana. As organelas, em especial
a mitocndria, tambm se apresentam intumescidas. A perda da integridade da membrana
plasmtica pode permitir a entrada de enzimas
proteolticas para o citosol e tambm a liberao do material intracelular e desencadeamento de reao inflamatria.

Apoptose
Morfologicamente, a clula em apoptose se
caracteriza por diminuio de tamanho, envolvendo tanto o citoplasma como o ncleo. A
membrana citoplasmtica e as organelas se
mantm ntegras, mas h formao de vacolos. A alterao morfolgica mais caracterstica aparece no ncleo quando a cromatina
condensada se redistribui perifericamente. A
clula diminui de tamanho, o material intracelular dividido em corpos cercados pela prpria
membrana citoplasmtica (corpos apoptticos),
que so absorvidos pelas clulas vizinhas ou
macrfagos residentes.

H inmeras situaes fisiolgicas em que


se observa a ocorrncia de apoptose em organismos pluricelulares.
Durante a fase final de diferenciao atpica
de algumas clulas (perda do ncleo de eritrcitos, das clulas do cristalino, modificaes dos
queratincitos para formar a pele); no turnover
de tecidos que se dividem com maior velocidade,
na manuteno da homeostase celular (ductos
mamrios durante o ciclo menstrual, tero); involuo (crtex adrenal de ratos, ductos mamrios aps desmame, folculos ovarianos em atresia,
tecido alveolar ao redor do dente quando este
nasce); linfcitos T, clulas K e natural killer induzem morte de clulas-alvo por apoptose.
H vrias situaes patolgicas em que se
pode encontrar diminuio ou aumento da apoptose. A diminuio da apoptose, ou seja, perda
da capacidade de morte uma caracterstica das
clulas tumorais. Podemos observar aumento da
apoptose em casos de derrame, infarto, sndrome da imunodeficincia adquirida (SIDA) por
induo imprpria de apoptose em clulas T
CD4, em algumas glomerulonefrites.

Mecanismos Moleculares
Os primeiros estudos sobre os mecanismos
de morte por apoptose foram feitos em nemat-

Tabela 10.1
Diferenas entre as Caractersticas Morfolgicas da Apoptose e da Necrose

134

Caractersticas

Apoptose

Necrose

Tamanho das clulas

Permeabilidade da membrana
celular

Normal

Perdida precocemente

Brotamentos na membrana celular

Precoces e caractersticos

Ausentes

Morfologia das mitocndrias

Normal

Intumescida com perda das cristas

Cromatina nuclear

Condensada e fragmentada

No condensada e fragmentada

Formao dos corpos apoptticos

Caracterstico

Ausente

Trmino

Fagocitada rapidamente por


clulas vizinhas

Lise

Aparncia nos cortes de tecidos

Difcil de detectar

Leso das clulas e ao redor,


fcil de detectar

MECANISMOS DE MORTE CELULAR: APOPTOSE VERSUS NECROSE

Tabela 10.2
Genes Identificados em Nematdeo que
Apresentam Correspondente nos Mamferos
Nematdeo Mamiferos

Funo

Ced-3

ICE (1992)

Apoptose

Ced-4

Apaf-1 (1997)

Apoptose

Ced-9

Bcl-2 (1986)

Inibio apoptose

deo, Caenorhabditis elegans, onde foram identificados trs genes que podiam ser responsveis
pela morte (ced-3 e ced-4) ou pela manuteno
da vida (ced-9). Nos mamferos esses genes foram identificados e as protenas que eles transcrevem so caspase-1, molcula de apf-1 e bcl-2,
respectivamente. Outro mecanismo descrito nos
mamferos o dos receptores de membrana da
famlia do TNF. Estes receptores permitem a
morte de algumas clulas e so especialmente
importantes no sistema imune.

Receptores da Famlia do TNFa


Os receptores do TNF, dos quais os mais
conhecidos so TNFR1 e CD95 ou fas, so
amplamente distribudos nos tecidos. Eles tm
uma poro extra e outra poro intracelular; a
poro extracelular reconhece seus antgenos
(TNF ou fas) que so apresentados pelas clulas de defesa, macrfagos, linfcitos T CD8+
ou natural killer. A parte intracelular difere um
pouco de um receptor para outro, ambos tm a
capacidade de ativar a cascata de caspases e levar a clula morte; no caso do TNFR1, por
mecanismos desconhecidos, a clula pode optar
por morrer ou simplesmente desencadear resposta inflamatria mediado por NF. Ainda h
outros receptores chamados DR3, DR4 ou DR5.
O receptor DR3 semelhante ao receptor de
TNF (TNFR1) e tem como ligante a molcula
de apo3L que tambm se parece com TNF. Este
complexo pode levar a clula igualmente morte por apoptose ou a uma resposta inflamatria.
A grande diferena entre os dois que, neste
caso, o ligante expresso em muitos tecidos e o
receptor expresso no fgado, bao e sangue
perifrico. Os receptores DR4 ou DR5 so similares ao CD95, tm com ligante o apo2L/
TRAIL e levam a clula morte rapidamente.

Como seu similar, eles esto amplamente distribudos em todos os tecidos. Junto deles tambm
pode se encontrar outros dois receptores falsos
(DcR1 2), que se ligam ao apo2L protegendo o
tecido da morte. Em algumas situaes pode haver a superexpresso do DR45 e levar a clula
morte.

Caspases
As caspases so proteases com resduos de
cistena (c-) e que clivam seus substratos sempre depois de um resduo de cido asprtico
(-aspase). Elas foram identificadas como protenas homlogas quelas transcritas pelo gene
ced-3 no C. elegans. Nos mamferos elas j so
dez descritas e clivam diferentes substratos, podendo ser eles partes da clula ou outras prcaspases. Elas so encontradas nesta forma de
pr-caspase no citoplasma e podem ser levadas
a ficar ativas por diversas vias. Elas podem agir
numa reao em cadeia, onde a hierarquia comea com as caspases iniciadoras (caspases-8,
-9 e -10), que por sua vez ativam as propagadoras1 e estas as executoras (caspases-2, -3, -7,
-6). Os receptores da famlia do TNF induzem
morte por ativao destas proteases (caspase-8)
pelas suas pores intracelulares. Assim como
quimioterpicos e radiao, podem tambm induzir a ativao deste mecanismo (caspase-9),
em presena de ATP, de uma molcula de apaf-1
modificada e de citocromo c liberado pela mitocndria quando esta foi lesada. H evidncias
de que o citocromo c liberado pelo poro de
permeabilidade transacional (PT) da mitocndria e que este pode ser regulado pelas protenas
da famlia bcl-2 (bax, bcl-2 e bcl-XL).
As caspases tm inibidores, como a protena
codificada pelo gene do vrus cowpox, a CrmA
(Cytokine Endogen Modifier) e a p35, tambm
produto de gene viral (baculovrus) que parece
atenuar a apoptose agindo na via das caspases.
As protenas da famlia IAP (Inhibitor Apoptosis
Protein) so endgenas e tm-se demostrado que
inibem a atividade das caspases-3 e -7, mas no
das caspases-1, -6 e -8, como, por exemplo, as
protenas XIAP e a survivina. H tambm inmeros inibidores sintticos das caspases disponveis no mercado
As caspases podem ser ativadas por diferentes vias, e acredita-se que sejam a via final de
todas as vias de apoptose:

135

Cap.

10

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Fas/CD95, TNF, Apo3L,


Apo2L/TRAIL

Quimioterpicos
radiao
Agentes
antiapoptticos
bcl-2, IAPs

Cap.

Receptores de morte

Leso da mitocndria

pr-caspase-8 ativada

liberao de citocromo c, pr-caspases-3, -2 e -6

10

citocromo c se liga apaf-1 na presena de ATP

pr-caspase-9 ativada

Caspases efetoras,
-3, -2, -6, -7

Caspases agem em seus


substratos e levam as clulas
morte por apoptose
Fig. 10.1 Esquema da ativao das caspases.

Famlia de Protenas do bcl-2 (B-cell


Lymphoma/leukemia Gene Product-2)
As protenas da famlia bcl-2 foram descritas
como homlogas daquelas determinadas pelo gene
ced-9 no modelo do C. elegans. Nesta famlia temos 15 protenas divididas em trs classes, similares a bcl-2, que promovem a vida, e bax e bik que
levam a clula morte. O mecanismo pelo qual essas protenas impedem a morte pode ser por inativar alguns adaptadores necessrios para a ao das
caspases, como a molcula de apaf-1, ou a liberao do citocromo c da mitocndria. O mecanismo
pelo qual elas podem levar morte a formao de
poros em membranas lipdicas, tais como da mitocndria. Tambm proposta a ativao da caspase1 diretamente pelas protenas da famlia bax.

P53
Um outro gene bastante conhecido no processo de apoptose o gene supressor de tumor

136

que codifica a protena p53. Esta protena est


intimamente ligada com a manuteno da integridade do DNA durante a diviso celular, mais
especificamente com o checkpoint em G1/M
quando a clula decide entrar ou no na fase de
sntese de uma nova dupla fita. Se o DNA est
integro a clula entra em S e a diviso segue o
seu curso normal. Por outro lado, se alguma leso encontrada durante a diviso, o gene p53
rapidamente ativado pela protena codificada
pelo gene ATM (Ataxia-telangiectasia-mutated).
A protena p53 checa o DNA e decide se a diviso deve continuar, ou devem ser ativadas protenas de reparo, ou ainda ocasionar a ativao
do mecanismo de morte celular. Quando isto
decidido, uma protena p21 estimulada, e esta
por sua vez se liga ao complexo ciclinaD/cdc2 e
no permite que este complexo fosforile um outro complexo formado pela protena Rb-E2F.
Tambm inativa a protena PCNA (Proliferating
Cell Nuclear Antigen), atuando durante a diviso celular, e desta maneira impede a continua-

MECANISMOS DE MORTE CELULAR: APOPTOSE VERSUS NECROSE

Tabela 10.3
Localizao dos Receptores da Famlia do TNF e dos seus Ligantes
Receptor

Local Receptor

Local Ligante

Ligante

TNFR

Tecidos em geral

Macrfagos
Linfcitos T

TNF ou linfotoxina

Fas, apo1, CD95

Tecidos em geral

Linfcitos T

FasL

Apo3, Dr3, TRAMP,


LARD

Bao, timo, sangue perifrico


Ativados por clulas T

Tecidos em geral

Apo3L, TWEAK

Apo2, DR5, TRAIL-2,


TRICK, KILLER

Tecidos

Tecidos, ativados
pelas clulas T

Apo2L, TRAIL

DR4

Idem DR5

Idem DR5

Apo2L, TRAIL

CAR1

Cap.

No identificado

Tabela 10.4
Famlia das Protenas est Dividida em
Pr-vida e Pr-apopttica

Pr-vida

Pr-apopttica

Subfamlia da bcl2:

Subfamlia bax:

Bcl-2, bcl-xL, bcl-W,


mcl-1, A1, NR-13, BHRF1,
LMW5-HL, ORF16, KS-bcl-2,
E1B-19K

Bax, bak, bok

Subfamlia
BH3/bik:
Bik, blk, hrk,
BNIP3, BimL,
Bad, Bid, EGL-1

o do ciclo. As clulas entram em apoptose por


ativao de genes da famlia bax ou ativando o
ciclo das caspases, como via final comum.

DIVERSAS MANEIRAS DE SE QUALIFICAR OU


QUANTIFICAR APOPTOSE E NECROSE
Necrose
Morfologicamente
Uma das maneiras mais comuns de se quantificar necrose morfologicamente, observandose as mudanas que a clula sofreu, e isto no
muito eficaz. Caracterizar uma clula necrtica
por microscopia eletrnica a melhor maneira.

Um outro mtodo, bastante usado em mtodos in vitro, a dupla marcao das clulas,
ou seja, um marcador para apoptose e um para
viabilidade celular, ou integridade da membrana. Por excluso, se as clulas tm baixa taxa de
apoptose e baixa viabilidade celular estas clulas
morreram de necrose. Ao contrrio, se estas clulas tm alta taxa de apoptose, conseqentemente morreram por apoptose, e podem ou no ter
sua taxa de viabilidade celular comprometida,
dependendo da fase em que ela se encontra.
Os corantes utilizados para verificar a viabilidade da membrana nos mtodos de excluso
so o trypan blue, o iodeto de propdeo e o brometo de etdeo. A membrana plasmtica s ser
permevel a estes corantes caso haja comprometimento de sua integridade.

Apoptose
Praticamente todas as tcnicas de deteco
de apoptose se baseiam nas modificaes nucleares que ocorrem nas clulas, diminuio de
tamanho, condensao da cromatina ou fragmentao do DNA. Deve-se lembrar que para
quantificar apoptose ao menos dois mtodos
devem ser utilizados.

Morfologicamente
Pode-se qualificar ou mesmo quantificar as
clulas apoptticas com tcnicas morfolgicas, por

137

10

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

10

identificao das modificaes nucleares. Uma das


mais simples a colorao com hematoxilina.
Este corante marca o ncleo e permite que se
identifique os corpos apoptticos, ou mesmo
os ncleos com cromatina condensada e de pequeno tamanho. A microscopia eletrnica permite avaliar perfeitamente as modificaes que
ocorrem nas clulas, no entanto este mtodo
mais utilizado para confirmar as outras tcnicas, pois quantificar apoptose por esta tcnica
seria muito demorado devido a magnificao
conseguida.
Alguns corantes fluorescentes que se ligam
especialmente ao DNA nuclear ou cromatina e
podem ser utilizados. So eles: o Hoechst 33342
ou 33258, o DAPI. O Hoechst (excitao em
346 e emisso em 460nm) e o DAPI (excitao
em 350.3 e emisso em 461nm) se ligam a adenina-timidina e marcam tanto clulas normais
como apoptticas, que podem ser diferenciadas
pelas mudanas morfolgicas e pela intensidade
da fluorescncia.
Em clulas LLC-PK1 tratadas com cisplatina e coradas com Hoechst 33342, pode-se notar ncleos de clulas normais e apoptticos (Fig.
10.2 setas).

Imuno-histoqumica
A tcnica conhecida como TUNEL (Terminal Deoxynucleotidyl Transferase-mediated
dUTP-biotin Nick End Labeling). Esta tcnica
histoqumica marca a fragmentao de DNA in
situ, quando digoxigenina-deoxiuridina (dUTP)
inserido na terminao 3-OH pela enzima
deoxinucleotdeo terminal transferase (TdT)
que biotinilada, e depois pode ser reconhecida pela estreptoavidina complexada com uma
enzima (horseadish peroxidase ou fosfatase alcalina) e esta enzima aps quebrar seu substrato deixa marcada a lmina em marrom,
permitindo desta maneira o reconhecimento das
clulas apoptticas.
Clulas mesangiais de camundongo imortalizadas tratadas com cisplatina, fixadas e analisadas quanto a fragmentao do DNA pelo
mtodo de TUNEL. As clulas marcadas em
marrom apresentam fragmentao e, portanto, so consideradas apoptticas (Fig. 10.3).

138

Fig. 10.2 Ncleos de clulas normais e apoptticas.

Deteco da Fragmentao do DNA por


Eletroforese em Gel de Agarose
Durante o processo de apoptose o DNA
quebrado em fragmentos mltiplos de 180-200
pares de bases. Isto porque as DNAses ativadas
cortam a fita de DNA entre os nucleossomas,
dando aos fragmentos esta caracterstica de mltiplos. Quando este DNA extrado e aplicado a
um gel de agarose num sistema de eletroforese,
ele apresentar um aspecto de escada. Quando
ocorre a necrose, tambm h a quebra de DNA,
mas essa quebra se d de uma maneira desordenada e o aspecto do DNA na eletroforese de um
esfregao. As bandas podem ser quantificadas com
um densitmetro, desde que a mesma quantidade de DNA tenha sido utilizada.

Citometria de Fluxo
Outros mtodos utilizados para quantificar
apoptose so aqueles que se utilizam do citmetro de fluxo. Nestas tcnicas se utilizam corantes
fluorescentes e nelas pode ser analisado a fragmentao do DNA (iodeto de propdeo, Hoechst,
DAPI) ou alguns marcadores de membrana como
a anexina V.

MECANISMOS MOLECULARES ENVOLVIDOS


NA APOPTOSE
O estudo de eventos que ocorrem antes da
fragmentao do DNA e que so identificados
como os possveis mecanismo moleculares da
apoptose so estudados de diversas maneiras.

MECANISMOS DE MORTE CELULAR: APOPTOSE VERSUS NECROSE

Protenas da Famlia do Bcl-2

Fig. 10.3 Clulas opoptticas marcados pelo mtodo de


TUNEL.

Existem anticorpos para vrias das protenas desta famlia, e pode-se avaliar a expresso
delas por imuno-histoqumica ou por western
blot. Pode-se avaliar a expresso do RNAm tambm por PCR. Em estudos in vitro pode-se produzir animais transgnicos que superexpressam
ou mesmo animais knockout para estas protenas. Tambm se pode fazer a transfeco de clulas, e desta maneira estudar a seu envolvimento
na apoptose causada por determinado insulto ou
patologia.

P53
Vrias metodologias da biologia molecular
podem ser utilizadas para este fim, como
transfeco de clulas, TR-PCR (Transcriptase
Reverse-polymerase Chain Reaction), construo de animais knockout ou que superexpressem alguns genes.

Receptores de TNF/CD95

A expresso e o papel do gene p53, assim


como outros genes supressores de tumor (gene
retinoblastoma, Rb) e genes envolvidos no ciclo
celular, tm sido bastante estudados quanto a
sua capacidade de induzir a clula a entrar em
apoptose. Em especfico o gene p53, que codifica a protena p53, pode ser estudado por imuno-histoqumica; h no mercado seis anticorpos
monoclonais (ab-1 a -6) e um policlonal (ab-7),

O estudo do envolvimento destes receptores nas


vias de apoptose pode ser feito atravs da marcao destes por imuno-histoqumica, para averiguar se houve aumento de sua expresso durante
o insulto, tornando desta forma a clula mais
susceptvel a entrar em contato com seu ligante
apresentado pelas clulas de defesa. Tambm
para averiguar a capacidade de determinada linhagem de clula em experimento in vitro pode
se incubar as mesmas com anticorpo anti-fas
(CH-11) ou TNF e observar se as mesmas entram em apoptose. Estas clulas entraro, ou no,
em maior ou menor grau em apoptose dependendo do tipo de receptores que elas expressam.

Caspases
O envolvimento das caspases na via morte
pode ser estudado com inibidores destas enzimas, reversveis ou no, ou atravs da determinao de sua atividade adicionando ao meio
reacional o seu substrato. Tambm se pode verificar a expresso das caspases atravs de seu
RNAm ou mesmo atravs da avaliao da presena destas protenas ou de seus substratos
modificados por western blot.

Fig. 10.4 Clulas com caractersticas de tbulo proximal renal tratadas com fator de necrose tumoral (TNFa/
10ng/ml/24horas) apresentando padro de esfregao
caracterstico de necrose1; tratadas com estaurosporina
(0,1mM/8 horas) apresentando padro de degraus caracterstico de clulas apoptticas2; clulas-controle apresentando o DNA intacto3.

139

Cap.

10

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

que podem detectar a protena selvagem ou


mutada, dependendo das condies do teste (a
protena estar denaturada ou no). Tambm se
pode avaliar a quantidade de RNAm da p53. Em
experimentos in vitro pode-se produzir animais
transgnicos que superexpressam esta protena
ou animais knockout.

BIBLIOGRAFIA
Cap.

10

1. Ashkenazi, VM Dixit. Death receptors: signaling and


modulation. Science, 281(5381): 1305-8, 1998.
2. B Dietrich. Apoptosis and anti-apoptosis genes in the
Bcl-2 family. Arch Physiol Biochem, 105(2): 12535, 1997.
3. C. Harris. p53 tumor suppressor gene: at the crossroads
of molecular carcinogenesis, molecular
epidemiology, and cancer risk assessment. Environ
Health Perspect, 104 Suppl 3: 435-9, 1996.
4. DW Nicholson, NA Thornberry. Caspases: killer proteases.
Trends Biochem Sci, 22(8): 299-306, 1997.

140

5. F Li, G Ambrosini, EY Chu, J Plescia, S Tognin, PC


Marchisio, DC Altieri. Control of apoptosis and
mitotic spindle checkpoint by survivin. Nature,
396(6711): 580-4, 1998.
6. GM Cohen. Caspases: the executioners of apoptosis.
Biochem J, 326(Pt 1): 1-16, 1997.
7. M Barinaga. Death by dozens of cuts. Science, 280 (5360):
32-4, 1998.
8. M Bennett, K Macdonald, SW Chan, JP Luzio, R Simari,
P Weissberg. Cell surface trafficking of Fas: a rapid
mechanism of p53-mediated apoptosis. Science,
282(5387): 290-3, 1998.
9. MC Cummings, CM Winterford, NI Walker. Apoptosis.
Am J Surg Pathol, 21(1): 88-101, 1997.
10. Tamm, Y Wang, E Sausville, DA Scudiero, N Vigna, T
Oltersdorf, JC Reed. IAP-family protein survivin
inhibits caspase activity and apoptosis induced by
Fas (CD95), Bax, caspases, and anticancer drugs.
Cancer Res, 58(23): 5315-20, 1998.
11. Techniques in apoptosis. A users guide. Edited by
TG.Cotter and S.J. Martin. Portland Press Ltd,
London, UK. 1996.

POLIMORFISMOS GENTICOS: IMPLICAES CLNICAS

Polimorfismos Genticos:
Implicaes Clnicas

Cap.

Ita Pfeferman Heilberg

O fenmeno da existncia de duas ou mais


variantes de determinado gene, sem efeitos deletrios como os que ocorrem nas mutaes,
conhecido como polimorfismo gentico.
Cada clula do organismo sintetiza inmeras
protenas diferentes, incluindo enzimas, hormnios, receptores, e componentes estruturais responsveis por todos os processos do metabolismo
e desenvolvimento do organismo. A seqncia codificadora de bases de um determinado gene no
DNA especifica a seqncia de aminocidos na
cadeia polipeptdica da protena correspondente.
A alterao de um nucleotdeo na seqncia do
gene, ou mutao, pode levar alterao na estrutura e/ou funo da protena. Quando as alteraes do DNA no modificam a seqncia
primria de aminocidos de um polipeptdeo ou
quando ocorrem em regies do gene no codificadoras de protena, no se observa efeito fenotpico. Portanto, nem todas as protenas variantes
trazem conseqncias clnicas. A ocorrncia de
mais de uma verso de determinada protena
numa populao, ou seja, duas ou mais formas
estruturalmente distintas, geneticamente diferentes e relativamente comuns considerada um polimorfismo gentico.
Os genes esto em ordem linear ao longo
dos cromossomos, cada gene possuindo uma
posio precisa denominada locus. Cada locus
gentico abriga pelo menos um alelo, que uma

das possveis formas de um gene. Como existem


duas cpias de cada cromossomo (exceto X e Y
nos homens), existem no mnimo dois loci, ou
seja, duas cpias de cada gene. Se os dois alelos
presentes em cada gene so idnticos, o indivduo considerado homozigoto. Se os alelos diferem, heterozigoto. Se a presena de um alelo
anormal resulta em doena, significa que existe
uma mutao em tal alelo. O alelo mutante
pode ser dominante, co-dominante ou recessivo. Entretanto se o alelo, apesar de no usual,
no causar nenhuma anormalidade, esta forma
alternativa do alelo considerada um polimorfismo gentico.
Em sua maioria os genes so mais complexos do que apenas um locus por cromossomo
com um nico alelo comum. Podem existir mltiplos alelos para um locus nico, ou a funo
da protena pode depender de mltiplos loci.
Define-se ento polimorfismo gentico como
a ocorrncia de mltiplos alelos em um locus,
onde pelo menos dois alelos aparecem com freqncias superiores a 1%. Loci polimorfos so,
por conveno, aqueles nos quais pelo menos
2% da populao so heterozigotos.
A determinao dos tipos sangneos um
dos primeiros exemplos de variao de protena
determinada geneticamente, onde existem mltiplos alelos para um locus nico. No sistema

141

11

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

11

ABO, um indivduo pode possuir um dos trs


alelos, A, B ou O, em cada locus. Se o paciente
homozigoto AA ou BB, o tipo sangneo A ou
B, respectivamente. Se o indivduo heterozigoto para os alelos A ou B, o tipo sanguneo no
ser A nem B e sim AB. Neste exemplo, ambos
alelos so expressos e as protenas derivadas destes genes so expressas como antgenos na superfcie da hemcia. O tipo sangneo AB um
exemplo de herana co-dominante num sistema
de alelos mltiplos. Se o indivduo heterozigoto para A e O (ou B e O), o fentipo O silencioso, e apesar de ser um heterozigoto o indivduo
demonstra o fentipo A ou B. Como os diferentes tipos sangneos no so doenas, estes mltiplos alelos so considerados polimorfismos.
No curso da evoluo, a ocorrncia constante de variaes de nucleotdeos confinada no
s s seqncias codificadoras, mas tambm em
regies no codificadoras dos cromossomos e
at mesmo em seqncias extragnicas, tem garantido um alto grau de diversidade gentica
entre os indivduos. Como os produtos de muitas vias metablicas interagem, outra conseqncia importante do polimorfismo de protenas
propiciar uma constituio qumica geneticamente singular, que responde de maneira nica
a influncias ambientais, dietticas e farmacolgicas.
Os polimorfismos tm valor principalmente
por seu uso como marcadores genticos para
distinguir diferentes formas hereditrias de um
gene em estudos de famlias. Em gentica mdica, estes marcadores tm servido para: a) mapeamento de genes nos cromossomos por anlise
de ligaes; b) diagnstico pr-sintomtico e prnatal de doenas genticas; c) deteco de heterozigotos portadores de doenas genticas; d)
testes de paternidade e aplicaes forenses; e)
combinao de pares doador-receptor para
transplante de tecidos e rgos.
Na prtica clnica, a avaliao dos polimorfismos tem sido til na identificao de indivduos de alto risco, ou seja, com predisposio
para desenvolvimento de determinadas doenas
como diabetes melito, cncer, hipertenso arterial, osteoporose, etc. Tem sido sugerido que algumas variantes genticas contribuem para
diferenas na vulnerabilidade ao alcoolismo e
abuso de substncias. Considerando que cada
polimorfismo tem um impacto individual peque-

142

no no fentipo, a identificao de genes individuais contribuindo para determinada doena


representa um desafio maior do que grandes
anormalidades cromossmicas ou mutaes de
um gene especfico. A presena de alelos susceptveis em mltiplos alelos no leva necessariamente doena porque a interao com
fatores ambientais tambm tem papel importante na patognese. O conhecimento dos polimorfismos genticos pode auxiliar a selecionar
os pacientes candidatos a preveno de determinadas patologias.

POLIMORFISMOS DO COMPRIMENTO
FRAGMENTOS DE RESTRIO

DE

O polimorfismo das protenas, conforme j


mencionado, pode ocorrer em regies codificadoras, que correspondem a 5% do DNA genmico total. J a diversidade gentica de regies
no codificadoras, que no tm efeito sobre a
expresso gnica, ainda maior, uma vez que se
processa em 95% do DNA. O polimorfismo se
torna um polimorfismo do comprimento dos
fragmentos de restrio ou RFLP (Restriction
Fragment Length Polymorphism) quando a alterao na seqncia especfica do DNA decorrente de mutao hereditria ou adquirida faz
com que um stio de clivagem para uma enzima
de restrio aparea ou desaparea em determinado alelo. Enzimas de restrio, tais como a
BsmI , EcoRV, ApaI, TaqI etc. reconhecem seqncias especficas no DNA, cortando-o em
fragmentos e o tamanho dos fragmentos de DNA
depende ento da presena ou ausncia do stio
de clivagem.

POLIMORFISMO DO GENE DO
VITAMINA D (VDR)

RECEPTOR DA

Na Fig. 11.1 mostrada a identificao do


polimorfismo do VDR decorrente da variao
num stio de clivagem para a enzima BsmI. Por
conveno, quando o stio de clivagem est presente, o alelo recebe a denominao da letra
minscula correspondente enzima de restrio utilizada (b), e letra maiscula quando o stio de clivagem est ausente no alelo (B). No
alelo polimrfico, devido alterao de um nucleotdeo, a enzima BsmI no reconhece a seqncia e o stio de clivagem desaparece. Aps
amplificao da regio do DNA que contm o

POLIMORFISMOS GENTICOS: IMPLICAES CLNICAS

Cap.

Fig. 11.1 Polimorfismo do comprimento dos fragmentos de restrio. O polimorfismo do receptor de vitamina D (VDR)
decorre da variao num stio de clivagem para a enzima BsmI; no alelo b o stio est presente, e no alelo B, devido
alterao de um nucleotdeo, a enzima BsmI no reconhece a seqncia e o stio de clivagem desaparece. No indivduo BB,
o resultante fragmento de restrio detectado pela digesto do produto do PCR com a BsmI maior (tem 800 pares de
base), devido ausncia de corte nos dois alelos. No indivduo bb os fragmentos resultantes dos cortes em ambos alelos
tm 650 e 150 pares de base, respectivamente.

polimorfismo, o produto do PCR submetido


digesto com a enzima de restrio BsmI e as
bandas obtidas podem ser visualizadas em eletroforese em gel de agarose corado com brometo de etdio. No indivduo homozigoto BB, o
resultante fragmento de restrio detectado pela
digesto do produto do PCR com a BsmI maior
(tem 800 pares de base), devido ausncia de
corte nos dois alelos. No indivduo homozigoto
bb os fragmentos resultantes dos cortes em ambos alelos tm 650 e 150 pares de base, respectivamente. O indivduo heterozigoto Bb possui um
alelo com corte e um sem corte. O polimorfismo do comprimento dos fragmentos de restrio tambm pode ser evidenciado por southern
blot e hibridizao com sonda especfica.
O polimorfismo para BsmI do VDR ocorre
no ntron 7 e tem sido relacionado com a massa
ssea em alguns estudos. Indivduos com o gentipo bb parecem ter densidade ssea melhor
do que indivduos BB.

POLIMORFISMO DOS GENES DO SISTEMA


RENINA-ANGIOTENSINA (SRA)
Um dos polimorfismos conhecidos deste sistema o polimorfismo da enzima de converso
da angiotensina I (ECA) ou cininase II, que se

caracteriza pela presena ou ausncia de um


fragmento de 287 pares de bases que ocorre no
ntron 16 do gene da ECA. A presena do fragmento define o alelo de insero, alelo I, e sua
ausncia, a deleo, alelo D. O gentipo heterozigoto , portanto, denominado ID.
O polimorfismo I/D da ECA parece se relacionar com os nveis intracelulares e plasmticos
de enzima conversora. Esta diferena funcional,
que no seria caracterstica dos polimorfismos,
de modo geral resulta do fato de que a insero
dentro da regio reguladora do gene da ECA,
contm um elemento silenciador, cuja deleo
ativaria o gene. Tem sido descrito que indivduos com o gentipo DD possuem maior risco
de infarto do miocrdio e maior associao com
miocardiopatia hipertrfica do que os demais
gentipos. No que tange s doenas renais, o
polimorfismo I/D da ECA tambm tem sido associado ao prognstico da nefropatia por IgA
(doena de Berger). O gentipo DD tem sido
relacionado com maior comprometimento da
funo renal alm de maior progresso para
insuficincia renal crnica. Vrios estudos tentaram relacionar o polimorfismo I/D da ECA
com nefropatia em diabetes no-insulinodependente mas os resultados, com exceo populao asitica, no confirmaram tal associao.

143

11

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

11

Outros polimorfismos do SRA so os do


gene do receptor AT1 da angiotensina II e do
gene do angiotensinognio. O polimorfismo do
receptor AT1 decorre da substituio de um cido nuclico (A por C) na posio 1166
(A1166C) da regio 3UTR de um exon do gene
AT1. Homozigose para A1166C no tem sido
considerada como valor preditivo isolado para
maior risco de infarto do miocrdio mas teria
efeito sinrgico com o polimorfismo I/D da ECA
e pode representar um marcador de um locus
variante funcional. A hipertenso essencial no
segue uma herana mendeliana simples, e os polimorfismos da ECA, renina e do receptor AT1
no tm sido associados com hipertenso. Diferentemente, a mutao na qual a treonina substituda por metionina no resduo 235 do gene
do angiotensinognio (M235T) se associa no
s com concentraes plasmticas mais elevadas de angiotensinognio quanto com hipertenso arterial.

POLIMORFISMOS

DAS

VNTRS

Outra classe de polimorfismos caracterizados


por insero/deleo consiste numa srie de comprimentos de fragmentos allicos, relacionados
entre si por um nmero hipervarivel de seqn-

cias curtas de DNA, tipicamente de seis a oito


pares de bases, que se repetem de seis a 20 vezes
(Variable Number of Tandem Repeated, VNTR).
A funo destas repeties desconhecida, mas
a sua repetio ao acaso e peculiar a cada indivduo, ao longo do genoma, fornece o equivalente
a um nmero serial ou cdigo de barras para
identificao dos indivduos. Os marcadores mais
informativos de VNTR apresentam at vrias dzias ou mais de alelos. Desta forma, conforme
mostrado na Fig. 11.2, os marcadores podem ser
utilizados para anlise de ligaes genticas e identificao individual (medicina forense e verificao de paternidade) j que provavelmente no
existem dois indivduos no aparentados que compartilhem os mesmos alelos.

FINGERPRINTING

DE

DNA

Ao se usar como sonda uma seqncia


repetida compartilhada por diferentes polimorfismos de VNTRs, demonstra-se que o padro
de hibridizao de cada indivduo nico e serve como uma impresso digital (fingerprinting)
de DNA (Fig. 11.2), como se fosse um cdigo
de leitura de barras, conforme j mencionado.
Somente gmeos idnticos mostram um padro
indistinguvel um do outro.

Fig. 11.2 Mapeamento do padro de VNTR em trs regies diferentes (A, B e C) de dois indivduos para fingerprinting
de DNA. Uma enzima de restrio reconhece e corta seqncias entre dois stios de restrio liberando fragmentos de DNA
contendo as VNTRs. Por exemplo, na regio A, o paciente I apresenta seis repeties, enquanto o paciente II apresenta
somente duas repeties.

144

POLIMORFISMOS GENTICOS: IMPLICAES CLNICAS

ASSOCIAO DE GENTIPOS COM


PROGNSTICOS DE DOENAS
Existem algumas razes pelas quais um
determinado gentipo pode no se tornar um
preditor suficientemente acurado de prognsticos. No caso do polimorfismo I/D da ECA, a
amplificao do alelo I por PCR menos eficiente do que a do alelo D, levando superestimativa da freqncia do alelo D e, portanto, do
gentipo DD. Este problema pode ser contornado com a repetio da genotipagem atravs
de um PCR utilizando um primer especfico para
a regio de insero. Alm deste fator tcnico,
outros fatores tambm so importantes. Diferentemente de distrbios mendelianos simples,
o processo de progresso de vrias doenas renais resulta da interao de fatores genticos com
fatores ambientais. Adicionalmente, o impacto de
determinado gentipo pode ser tnue e quantitativo em vez de marcante e qualitativo, sendo
por vezes tecnicamente difcil de se identificar
um papel funcional direto. Por exemplo, se um
locus de susceptibilidade para uma determinada
doena for procurado em mais do que 20 stios
polimrficos de um gene, pelo menos um ser
provavelmente estatisticamente significante. De
maneira anloga, se mais do que 20 doenas forem investigadas para um determinado locus polimrfico do DNA, este locus servir de marcador

significante de susceptibilidade para pelo menos


uma doena. Portanto, uma vez que a anlise estatstica revela uma associao significante entre
um gentipo e um fentipo de doena, muito
importante que estenda a amostra da populao
estudada, usando os mesmos critrios de definio de um fentipo especfico, para que se elevem as chances de uma associao biolgica
verdadeira.

BIBLIOGRAFIA
1. Cooper GS, Umbach DM. Are vitamin D receptor
polymorphisms associated with bone mineral
density? A meta -analysis. J Bone Miner Res 11:
1841-1849, 1996.
2. Genetic Diseases, in Introduction to Molecular
Medicine, edited by Ross, DW Springer-Verlag, New
York, 2nd edition, 1996, pp. 85-110.
3. Kunz R, Bork JP, Fritsche L, Ringel J Sharma AM .
Association between the angiotensin-converting
enzyme insertion/deletion polymorphism and
diabetic nephropathy: a methodological appraisal
and systematic review. J Am Soc Nephrol 9:16531663, 1998.
4. Morrison NA, Qi JC, Tokita A, Kelly PJ, Crofts L, Nguyen
TY, Sambrook PN, Eisman JA : Prediction of bone
density from vitamin D receptor alleles. Nature
367:284-287, 1994.
5. Variao gentica, polimorfismo e mutao, em
Thompson & Thompson: Gentica Mdica, editado
por Thompson MW, McInnes RR, Willard HF,
Guanabara Koogan, Rio de Janeiro, 5a edio, 1993,
pp. 82-99.

145

Cap.

11

DNA RECOMBINANTE

DNA Recombinante
Cap.

Leny Toma
Yara M. Michelacci
Helena B. Nader
Marimlia Porcionatto
Lcia O. Sampaio

A tecnologia do DNA recombinante transformou a maneira como a pesquisa biolgica


realizada nos dias de hoje. Este conjunto de tcnicas, desenvolvido em meados de 1970, teve um
marco importante com o descobrimento de dois
tipos de enzimas, que permitiram a clonagem do
DNA. As do primeiro tipo so as chamadas enzimas de restrio, que clivam a dupla-hlice do
DNA em stios especficos, gerando um conjunto caracterstico e reprodutvel de fragmentos,
permitindo o isolamento de seqncias de DNA
de interesse.Um outro tipo de enzima, a DNA
ligase, capaz de ligar os fragmentos de DNA,
por exemplo, a uma molcula replicante de DNA,
ou vetor, produzindo o DNA recombinante. Este
DNA recombinante pode ser introduzido em
clulas apropriadas, normalmente, bactrias ou
vrus, por serem altamente replicativos. O isolamento e a identificao dos descendentes de uma
nica clula portadora de um mesmo DNA recombinante desejado, isto , um clone, permitem no s a obteno de quantidades ilimitadas
da determinada protena, como tambm o seu
seqenciamento nucleotdico e deduo dos aminocidos constituintes. Assim, qualquer segmento de DNA clonado pode ser reinserido em
vetores, e estes transformados em clulas, e testados para atividade biolgica.

Este grupo de tcnicas, coletivamente chamado de tecnologia do DNA recombinante,


tornou-se a abordagem dominante no estudo
de muitos processos biolgicos. Neste captulo, abordaremos vrias tcnicas que compem
a tecnologia do DNA recombinante. O poder
e o sucesso desta nova tecnologia trouxeram
muitos benefcios prticos, particularmente na
Medicina.

ENZIMAS

DE

RESTRIO

As enzimas de restrio so endonucleases


encontradas em bactrias, e seu papel biolgico proteger o genoma bacteriano de possveis
vrus invasores, clivando qualquer DNA exgeno. O DNA da prpria bactria no reconhecido por essas enzimas porque esses stios
se encontram metilados. Estas enzimas so altamente especficas e reconhecem de quatro a
oito nucleotdeos de ambas as fitas do DNA.
Algumas endonucleases de restrio produzem
quebras assimtricas, originando caudas curtas de DNA fita-simples nas duas extremidades. Estes terminais so conhecidos como
terminais coesivos, uma vez que cada cauda simples fita pode formar pares complementares

147

12

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

com a outra cauda produzida pela mesma enzima. Outras enzimas, ainda, geram terminais
retos ou cegos (Fig. 12.1). A DNA-ligase restaura ligaes fosfodisteres de ambos os terminais.
Mais de 90 endonucleases de restrio j
foram identificadas, purificadas, e esto hoje disponveis comercialmente. Seus nomes consistem
em abreviaes de trs letras do organismo do
qual foi isolado (por exemplo, Eco, para Escherichia coli, Hin para Haemophilus influenza, Hae
para Haemophilus aegyptius) seguido da desigCap.

nao da linhagem (se necessrio) e uma numerao romana (para distinguir diferentes enzimas de um mesmo organismo). Exemplos so
dados na Tabela 12.1.
A disponibilidade dessas enzimas possibilitou a construo de mapas de restrio, onde os
fragmentos gerados podem ser agora separados
em gel de agarose, e corados com brometo de
etdio. As bandas visualizadas com uma fonte de
luz UV podem ser fotografadas (Fig. 12.2). A
migrao relativa no gel, comparado a padres
de peso molecular, refletem o tamanho dos frag-

12
A)

Produo de terminais cegos


-N-N-A-G-C-T-N-N-N-N-T-C-G-A-N-N-

Alu I

-N-N-A-G
-N-N-T-C

C-T-N-NG-A-N-N-

terminal cego
B)

Produo de terminais coesivos


-N-N-G-A-A-T-T-C-N-N-N-N-C-T-T-A-A-G-N-N-

Eco RI

-N-N-G
-N-N-C-T-T-A-A

A-A-T-T-C-N-NG-N-N-

terminal coesivo
N, representa qualquer base.
Fig. 12.1 Formao de terminais coesivos e cegos pela clivagem de diferentes enzimas de restrio.

Tabela 12.1
Stios de Reconhecimento de Algumas Enzimas de Restrio
Enzima

Fonte

Stio de Reconhecimento

Terminais Coesivos e Cegos

Bam HI

Bacillus amyloliquefaciens H

GGATCC

Coesivo

Eco RI

Escherichia coli RY 13

GAATTC

Coesivo

Hind III

Haemophilus influenza Rd

AAGCTT

Coesivo

Hae III

Haemophilus aegyptius

GGCC

Cego

Hpa I

Haemophilus parainfluenzae

GTTAAC

Cego

Hpa II

Haemophilus parainfluenzae

CCGG

Coesivo

Mbo I

Moraxella bovis

GATC

Coesivo

Taq I

Thermus aquaticus

TCGA

Coesivo

Not I

Nocardia otitidis-caviarum

GCGGCCGC

Coesivo

Sfi I

Streptomyces fimbriatus

GGCCNNNNNGGCC

Coesivo

N, representa qualquer base.

148

DNA RECOMBINANTE

mentos. Ainda, a digesto incompleta em tempos variveis permite a deduo da organizao


relativa desses fragmentos na molcula de DNA
como um todo.

Bandas de DNA
fluorescentes

LUZ UV
Fig. 12.2 Visualizao de bandas de DNA em eletroforese em gel de agarose por colorao com brometo de
etdio e iluminao ultravioleta.

VETORES
So definidos como vetores molculas de
DNA que podem replicar quando introduzidos
a uma clula hospedeira, como as clulas bacterianas ou leveduras, e do qual possam ser isolados posteriormente. A clonagem de fragmentos
de DNA em vetores por meio de enzimas de restrio e DNA-ligase, conforme descrito aqui,
possibilita a propagao do fragmento clonado
juntamente com o vetor. Como as bactrias e
leveduras crescem facilmente no laboratrio,
enormes quantidades das seqncias de DNA
desejadas so obtidas concomitantemente. Vetores com alta capacidade de clonagem tm sido
desenvolvidos nos ltimos anos (Tabela 12.2).
No entanto, cada um deles apresenta suas vantagens e tambm limitaes.

PLASMDEOS
Plasmdeos so pequenas molculas de DNA
dupla fita, circulares, de ocorrncia natural em
bactrias, que podem replicar independentemente, sem estar associados a cromossomos. Normalmente carregam genes para inativao de
antibiticos, produo de toxinas e degradao
de produtos naturais. Algumas caractersticas
fundamentais so requeridas para que os plasmdeos sejam utilizados como vetores: 1) origem de replicao (seqncia de DNA que auxilia
a replicao da molcula de DNA, atravs de interaes com a DNA polimerase da clula hospedeira); 2) genes que conferem resistncia a
antibiticos, assim a bactria que carrega o plasmdeo pode ser selecionado (por exemplo, resistncia a ampicilina, tetraciclina); 3) poli-linker
ou seqncias de stios de clonagem mltiplas,
so seqncias sintticas, adicionadas aos plasmdeos naturais, e que contm uma cpia de
diversos stios de restrio diferentes (Fig. 12.3).
Plasmdeos, em geral, consistem em apenas
2 a 4kb de DNA, tamanho este que facilita a
anlise do fragmento de DNA inserido. Para ser
clonado num plasmdeo, um fragmento do inserto ligado a um stio de restrio apropriado no vetor e a molcula recombinante usada
para transformar E.coli. Colnias resistentes ao
antibitico, que contm DNA plasmidial, so
selecionadas. Tais bactrias contendo plasmdeo recombinante so colocadas para crescer
em grandes quantidades e seu DNA extrado
(Fig. 12.4). As molculas plasmidiais, que normalmente se apresentam em centenas de cpias
por clula, podem ser separadas do DNA cromossmico bacteriano; o resultado um DNA
plasmidial purificado, que apropriado para
anlise do inserto clonado.

Tabela 12.2
Vetores mais Utilizados em Clonagem Molecular
Vetor

Hospedeiro

Tipo de Clonagem

Tamanho do Inseto

Plasmdeo

Bactria

Genmica. cDNA

5-10kb

Bacterifago lambda

Bactria

Genmica.cDNA

< 20kb

Cosmdeos

Bactria

Genmica

< 50kb

Cromossomos artificiais

Levedura

Genmica

100-1.000kb

149

Cap.

12

Sac I

Eco RI

Kpn I

Sma I

Xba I

Bam HI

Pst I
Sal I

Sph I

Hind III

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Poli-linker

Iac Z

Cap.

Promotor
Iac

Amp R

12

Ori

Fig. 12.3 Um plasmdeo tpico. Em alguns plasmdeos o poli-linker est localizado dentro do fragmento do gene lac Z
de E. coli, que codifica -galactosidase. O poli-linker no interfere na sntese da enzima ativa. Quando E. coli so crescidas em presena de X-gal, um composto incolor, a clivagem de X-gal pela enzima produz um produto insolvel azul. Assim,
colnias de E. coli com plasmdeos que no tm inserto de DNA externo no poli-linker so azuis. Contudo, a insero de
DNA no poli-linker interfere ou termina a janela de leitura do gene lac Z; galactosidase no produzida e o plasmdeo
resultante produz colnias incolores que, assim, distinguem-se das outras na placa de gar.

BACTERIFAGO

LAMBDA

O fago lambda um vrus bacteriano de


DNA dupla fita, com cerca de 45kb. o vetor
ideal para insertos de DNA de aproximadamente
15kb de comprimento. A clonagem de grandes
fragmentos de DNA em fago possvel pelo fato
de um segmento de 15-25kb do DNA do fago
poder ser substitudo, sem comprometer sua replicao em E. coli. O empacotamento do DNA
do fago na partcula viral limitado pelo seu
comprimento total, que deve ser de aproximadamente 50kb.
A estrutura do fago muito simples, consistindo em DNA, ou ocasionalmente RNA,
que carrega genes para a replicao, rodeado
por uma capa de proteo ou capsdeo, composto por molculas proticas.

DNA
recombinante

+
Plasmdeo

Inserto
Transformao
da bactria

Bactria

Multiplicao do
DNA recombinante

Diviso de clula
hospedeira

O processo de infeco ocorre em trs etapas, mostradas na Fig. 12.5:


1) O fago adere na superfcie da bactria e
injeta seu DNA cromossomal dentro da clula.

150

Colnias bacterianas crescendo em meio slido


Fig. 12.4 Etapas bsicas da clonagem em plasmdeos.

DNA RECOMBINANTE

Partcula de fago
DNA
1. O fago se liga bactria
e injeta seu DNA

Molculas de DNA do fago

2. O DNA do fago replicado


Cap.

Lise celular

Componentes
do capsdeo

3. Compronentes do capsdeo so
sintetizados, novas partculas do fago
so montadas e liberadas

Novas
partculas
de fago

Fig. 12.5 Processo de infeco, replicao e lise da clula bacteriana por um bacterifago.

2) O DNA do fago replicado, geralmente com


enzimas especficas, codificadas por genes
presentes no cromossomo do fago.
3) Outros genes do fago direcionam a sntese
de protenas componentes do capsdeo, e
novas partculas de fago so montadas e liberadas da bactria.
O fago lambda pode replicar atravs de duas
vias, uma ltica e outra chamada lisognica.
Via Ltica
Alguns tipos de fagos possuem o ciclo
infectivo completo bastante rpido, possivelmente em menos de 20 minutos. Este tipo de
infeco rpida chamada ciclo ltico, uma
vez que a liberao das novas partculas de
fago est associada lise da clula bacteriana. Um aspecto caracterstico do ciclo de infeco ltico que a replicao do DNA do
fago seguida imediatamente da sntese das
protenas do capsdeo e o DNA do fago no
mantido na bactria hospedeira numa condio estvel.

A replicao do DNA do fago lambda se d


atravs de um mecanismo de crculo rolante onde
as novas fitas vo sendo continuamente desenroladas da molcula molde (template), gerando
vrios genomas lambda linear unidos por stios
cos (coesivos) (Fig. 12.6). As seqncias nucleotdicas dos stios cos so reconhecidas por
endonucleases especficas, que clivam o DNA,
produzindo um genoma lambda completo e linear. Portanto, durante a replicao de seu DNA
o fago lambda pode intercalar entre as formas
linear e circular (Fig. 12.7).

Ciclo Lisognico
A infeco lisognica caracterizada pela integrao do DNA do fago ao DNA cromossomal da bactria, mantidas assim por milhares de
divises celulares ou geraes. Algumas alteraes ambientais fazem com que o DNA do fago
seja liberado do genoma da bactria e o fago reverte o ciclo ltico e lisa a clula.

M13 FAGO

FILAMENTOSO

O fago filamentoso M13 possui um genoma


muito menor e mais simples do que o fago, com

151

12

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cos

Cos

Cos

Cos

Replicao por crculo rolante

Clivagem pela endonuclease


Endonuclease cliva no stio cos

Componentes proticos do capsdeo


Cap.

12

Novas partculas de fago


so montadas
Fig. 12.6 Replicao do DNA l atravs do crculo rolante.

Terminal coesivo

Forma linear do DNA

Terminal coesivo
C C CG

CCG C

G G G C G G C GA

Endonuclease

C GCC GC
CC
TG
G GCGGC
G
GA
C

Stio Cos

Forma circular do DNA


Fig. 12.7 Formas linear e circular do DNA l.

cerca de 6.407 nucleotdeos. um DNA circular, porm simples fita, o que o distingue dos outros fagos. O DNA do fago M13 injetado em E.
coli atravs do plus. Uma vez dentro da clula o
DNA simples fita usado como molde para sntese da fita complementar, resultando num DNA
dupla fita. Este DNA no incorporado no genoma bacteriano, mas replica at 100 cpias por

152

clula. Quando a bactria divide, cada filha recebe cpias do genoma do fago, que continua a replicar, mantendo um nmero determinado por
clula. Novas partculas de fago so continuamente montadas e liberadas, com cerca de 1.000 novos fagos sendo produzidos durante cada gerao
de uma clula infectada. Ao contrrio do fago lambda, o fago M13 no leva lise e morte celular.

DNA RECOMBINANTE

O aspecto mais atraente do fago M13 como


vetor de clonagem que os genes clonados em
M13 podem ser facilmente obtidos na forma de
fita simples. Essa forma requerida em diversas
situaes ou tcnicas, como seqenciamento de
DNA, mutagnese in vitro, ou mesmo, utilizado
como molde na obteno de sondas radioativas.
Outras convenincias so o tamanho pequeno, que facilita sua manipulao e tambm o fato
de que a forma replicativa dupla fita comportase como um plasmdeo, sendo facilmente obtido
de uma cultura de E. coli, e pode ser reintroduzido por transfeco.

COSMDEOS
So vetores sofisticados que renem caractersticas hbridas dos fagos lambda e plasmdeos bacterianos. Possuem a capacidade de
acomodar, ou empacotar grandes fragmentos
de DNA e introduzi-los em clulas bacterianas.
Infectam as bactrias de maneira semelhante a
de um vrus lambda, reassumem a forma circular e replicam-se como um grande plasmdeo.
Um cosmdeo possui um stio cos, um marcador de seleo, como o gene de resistncia a
um antibitico e uma origem de replicao. Os
cosmdeos no produzem placas, mas formam
colnias no meio de seleo, como um vetor plasmideal. Podem abrigar insertos de at 50kb.

CROMOSSOMOS ARTIFICIAIS

DE

LEVEDURAS

Cromossomos artificiais de leveduras (YACS,


Yeast Artificial Chromosomes) so cromossomos
lineares, normais em Saccharomyces cerevisae
(levedura de padaria), utilizados como vetores
para clonagem de fragmentos de DNA de at
1.000kb. Tal qual cromossomos normais, possuem centrmeros e telmeros, replicam-se e segregam-se no hospedeiro.

CONSTRUO

DE

BIBLIOTECAS

Bibliotecas Genmicas
Uma biblioteca genmica um conjunto de
clones recombinantes que contm todo o DNA
presente num organismo. Portanto, qualquer
gene desejado pode ser selecionado a partir da

biblioteca daquele organismo ou tecido. Um


exemplo de construo de uma biblioteca de
DNA genmico mostrada na Fig. 12.8. DNA
genmico humano parcialmente digerido com
uma enzima de restrio, como Sau3A. Assim,
fragmentos parcialmente clivados, com tamanho
adequado para clonagem (~20 kb), so selecionados por gradiente de sacarose, ou qualquer
outro mtodo de fracionamento por tamanho.
Estes fragmentos so, ento, ligados a braos de
bacterifago lambda, previamente tratados com
Sau3A ou Bgl II, que tambm Sau3A compatvel, de modo a complementar a extremidade
Sau3A dos fragmentos de DNA humano. Aps
empacotamento in vitro em partculas infecciosas
de bacterifago lambda, a biblioteca est pronta.
Este conjunto de DNA recombinante ser submetido ao processo de clonagem, isto , triagem
do clone que contm a seqncia desejada.

Bibliotecas de DNA Complementar


(cDNA)
Em eucariotos muitos genes so transcritos
em RNAm somente em determinados tipos celulares. As seqncias especficas de DNA, expressas como RNAm naquele tipo particular de
clula, podem ser clonadas sintetizando-se cpias de DNA a partir de RNAm isolado daquela
clula e, ento, clonando essas cpias de DNA
em plasmdeos ou bacterifago lambda. As cpias de DNA a partir dos RNAm so chamados
de DNA complementar (cDNA).
As vantagens de se utilizar bibliotecas de
cDNA so:
1. Representam apenas seqncias codificadoras, expressas como RNAm de um tipo celular, com a vantagem de apresentar ausncia
de ntrons presentes numa biblioteca de DNA
genmico.
2. Uma segunda vantagem seria a possibilidade
de enriquecer a biblioteca, utilizando tecidos com alta expresso e/ou expresso seletiva da protena de interesse.
A primeira etapa na construo de uma biblioteca de cDNA consiste em isolar RNA total
da clula ou tecido de interesse. Numa segunda etapa, RNAm so separados dos outros
RNAs ribossomais e transportadores, atravs de
uma caracterstica presente nos RNAm de eu-

153

Cap.

12

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Stios Bam HI
Vetor
Brao esquerdo

Brao direito

DNA genmico
humano

Digesto por Bam HI

Digesto parcial com Sau 3A


Fragmentos internos
Remoo de fragmentos internos
no essenciais replicao do fago

Cap.

Brao

12

Brao

Fragmentos de DNA
com ~20kb aps
digesto parcial

DNA ligase
Brao esquerdo

Inserto

Brao direito
Empacotamento in vitro no bacterifago
e infeco da E. coli

Biblioteca de fragmentos de DNA humano

Fig. 12.8 Construo de uma biblioteca de DNA genmico humano em fago lambda.

cariotos. Os RNAm de eucariotos possuem 50


a 250 resduos de adenilato, chamado de cauda de poli-A (Fig. 12.9). Esta cauda capaz de
parear pequenas seqncias sintticas de timidilato acopladas a uma matriz, em colunas chamadas de oligo-dTs. Uma vez que os outros
RNAs no se ligam coluna, eles podem ser
separados do RNAm, que por sua vez so recuperados por eluio em tampo com baixa
concentrao de sal.
A enzima transcriptase reversa, isolada de
retrovrus, utilizada para sintetizar uma fita de
DNA complementar para cada RNAm, utilizando primers de oligo-dT, que se hibridizam com a
cauda de poli-A no terminal 3.
Uma vez que as fitas simples de cDNA so
sintetizadas, os RNAm so removidos por tratamento com lcali, que hidrolisa RNA, mas no
DNA. Numa prxima etapa a DNA polimerase
usa o cDNA simples fita como molde para sintetizar a fita complementar, produzindo, assim,
uma dupla fita completa, correspondente a cada
RNAm da preparao original.

154

Pequenos segmentos de DNA dupla fita,


contendo stios de restrio para enzimas de restrio particulares so ligados a ambos terminais do cDNA dupla fita. Estes segmentos
chamados ligantes so selados atravs da DNA
ligase de bacterifago T4. Ligaes entre terminais cegos ou retos so menos eficientes que
entre terminais coesivos, mas podem ser maximizados com a adio de altas concentraes
desses ligantes na reao de ligao. O cDNA
dupla fita resultante, contendo o ligante em ambos terminais, so agora submetidos digesto
com a enzima especfica para o ligante, gerando, assim, um cDNA com terminais coesivos.
Este produto est pronto para ser ligado a um
vetor, seja um plasmdeo ou bacterifago, previamente tratado com a mesma enzima de restrio. Os vetores recombinantes so ento
submetidos eletroporao em E. coli (incluso
dos plasmdeos recombinantes na clula), ou
empacotados in vitro em partculas virais infectivas para E. coli. O conjunto de clones recombinantes daquele determinado tecido ou
clula est agora representado nessa biblioteca
de plasmdeos ou fago lambda.

DNA RECOMBINANTE

Cap.

Fig. 12.9 Sumrio do procedimento de construo do cDNA.

Identificao de Clones Especficos numa


Biblioteca Genmica ou de cDNA
Os mtodos mais comuns de se identificar
clones de interesse (screening) dentre os milhares
numa biblioteca, consiste em hibridizao com
sondas radioativas de DNA ou RNA, ou ainda
atravs da identificao da protena expressa.

Sondas de Oligonucleotdeos Sintticos


No caso de uma biblioteca de fago lambda,
E. coli so infectadas por vrions lambda recombinantes, e imediatamente plaqueadas e imobilizadas numa camada de gar nutritivo em placas
de Petri. Placas formadas no gar (halo mais claro), contendo vrions recombinantes so transferidos a membrana de nilon, como se fosse
um mata-borro. Parte das partculas virais em
cada placa adsorve na superfcie da membrana,
embora grande parte permanea nas placas, na
superfcie do gar da placa de Petri. Desta maneira, uma rplica da placa de Petri contendo
clones de lambda individuais so reproduzidos
na superfcie da membrana. A placa de Petri origi-

nal, contendo a coleo de clones lambda, refrigerada e guardada. A membrana , ento, incubada numa soluo alcalina, que desfaz os
vrions, liberando e desnaturando o DNA encapsulado. Este DNA fixado membrana por exposio luz UV atravs de cross-linking, ou
ento desnaturado no forno por duas horas. A
membrana incubada com a sonda radioativa
sob condies especiais de hibridizao. Sondas no hibridizadas so lavadas, e o filtro submetido a auto-radiografia.
A presena de um clone recombinante contendo DNA complementar sonda ir aparecer
como uma mancha escura no filme de raios X. A
posio dessa mancha no autoradiograma colocalizada na placa de Petri original, e a placa
identificada. As partculas virais da placa-me so
reinfectadas em E. coli, e replaqueadas, at serem clonadas, isto , esse processo se repete at
a obteno de placas livre de contaminao. Processo semelhante pode ser aplicado na identificao de clones de interesse numa biblioteca
construda em plasmdeos.
Sondas oligonucleotdicas especficas para
genes que codificam protenas no to abundan-

155

12

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

12

tes podem ser sintetizadas quimicamente, baseando-se na seqncia de aminocidos da protena de interesse. Uma vez que primers contendo
apenas 20 nucleotdeos so suficientes para a
construo da sonda e para a identificao dos
clones, apenas uma parte da protena necessita
ser seqenciada. Normalmente, a protena de
interesse precisa ser purificada, digerida com
uma ou mais proteases, resultando em peptdeos especficos. A seqncia de aminocidos aminoterminal determinado por degradao
seqencial de Edman. Baseando-se no cdigo
gentico, sondas de oligonucleotdeos codificando seqncias peptdicas determinadas podem
ser sintetizadas e marcadas radioativamente. Ao
se escolher quais seqncias peptdicas usar na
construo dos primers de oligonucleotdeos,
deve-se levar em considerao a degenerao do
cdigo gentico. Assim, peptdeos contendo arginina, leucina ou serina precisam ser evitados,
se possvel, uma vez que seis diferentes cdons
codificam para cada um desses aminocidos.

Clonagem em Vetores de Expresso


Clones de interesse tambm podem ser identificados atravs da deteco de protenas especficas. Para isso, vetores de clonagem especiais
so utilizados, como vetores de expresso lambda, na qual o DNA clonado transcrito em
RNAm, que por sua vez traduzido na protena
em questo.
Um exemplo de vetor de expresso lambda gt11, concebido para expressar altos nveis da
protena beta-galactosidase de E. coli. O nico
stio de restrio para EcoRI nesse vetor situa-se
perto do terminal 3 do gene da galactosidase.
Se um cDNA ou um fragmento de DNA genmico codificante de protena for inserido nesse
stio de EcoRI na orientao correta e no mesmo sentido da janela de leitura, ser expresso
como uma protena fundida galactosidase. Placas resultantes da infeco com lambda gt11 recombinante conter altas concentraes de tal
protena fundida. Estas protenas podem ser
transferidas e fixadas a uma membrana de nilon ou nitrocelulose, que ser incubada com um
anticorpo monoclonal que reconhece a protena
de interesse. Lavando-se o filtro, remove-se anticorpos no ligados protena fundida ligada

156

ao filtro. Os anticorpos ligados so detectados


incubando-se o filtro com um segundo anticorpo radioativo que se liga ao primeiro anticorpo.
Qualquer mancha que aparea no auto-radiograma utilizada para localizar placas na placa
master original, contendo o gene de interesse.

ANLISE

E SEQENCIAMENTO DO
CLONADO

DNA

Uma vez que um cDNA ou fragmento de


DNA genmico em particular foi clonado, ele
pode ser excisado do vetor com a mesma enzima utilizada para inseri-lo, ou com outras enzimas apropriadas. Assim, uma vez que o vetor foi
dissociado do DNA clonado, ambos so separados em eletroforese em gel de agarose, e o inserto eludo do gel, e agora est pronto para
ser introduzido num vetor conveniente para seqenciamento.

Mtodo de Maxam-Gilbert
O primeiro mtodo de seqenciamento foi
desenvolvido por Allan M. Maxam e Walter Gilbert no final de 1970. O mtodo envolve clivagem qumica especfica, aps marcao de um
dos terminais com 32P. A polinucleotdeo quinase catalisa a adio de 32P hidroxila terminal
5. O DNA marcado radioativamente ento clivado quimicamente em determinadas bases:
1. As purinas so destrudas pelo dimetilsulfato, que metila a guanina no N-7 e a adenina
no N-3. A ligao glicosdica de uma purina
metilada prontamente quebrada por aquecimento em pH neutro, o que deixa o acar sem a base. O aquecimento subseqente
em lcali leva clivagem do arcabouo em
G (clivagem s em guanina), enquanto o tratamento com cido diludo causa clivagem
tanto em A quanto em G (clivagem tanto em
adenina quanto em guanina).
2. A hidrazinlise cliva anis de T e C, que
seguido do tratamento com piperidina, que
remove ambas as bases modificadas (clivagem de timina e citosina). A hidrazinlise
em presena de NaCl 2M poupa T, seguido
de piperidina, que remove C (clivagem de
citosina).
Assim, o DNA pode ser clivado s em G, em
A e G, em C e T, e s em C. Os fragmentos de

DNA RECOMBINANTE

cada mistura so separados por eletroforese em


gel de poliacrilamida, que fracionam por tamanho molecular. O gel seco e submetido autoradiografia. Comparando-se as quatro colunas
correspondentes, a seqncia pode ser deduzida (Fig. 12.10).

Mtodo do Dideoxi de Sanger


Alguns anos mais tarde, Frederick Sanger e
seus colaboradores desenvolveram um segundo

mtodo de seqenciamento, que hoje o mais


utilizado. Este mtodo envolve a utilizao de
2,3-dideoxinucleosdeo trifosfato (ddNTPs)
(Fig. 12.11), que no possui o grupo hidroxila
3, responsvel pela elongao da cadeia; da
tambm serem conhecidos como o mtodo do
dideoxi.
Um DNA simples fita hibridizado com um
primer deoxinucleotdico sinttico e marcado radioativamente no terminal 5. O primer alon-

5 GGCC

Cap.

GACT 5
+[32P]dCTP

+[32P]dGTP
Fragmento Klenow
da DNA polimerase
I de E. coli

TUBO 1

TUBO 2

5 GGCC
3
GACT 5

5 GGCC
G
3
32p

32p
C
GACT 5

A+G

C+T

A+G

C+T

Eletroforese em gel de poliacrilamida


A+G C+T

Fundo

A+G

C+T

G
T
C
T
A
G
C
A
A
T
G

Seqncia

Topo

Fundo

G
A
G
A
T
C
G
T
T
A
C

Seqncia complementar

G
Topo

Auto-radiografia do gel
Fig. 12.10 Seqenciamento de DNA pelo mtodo de Maxam-Gilbert.

157

12

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Base

Mistura
de reao

O
Base

CH2
O

12

35
S 5
Primer universal
DNA polimerase
+ddGTP
+dATP
+dCTP
+dTTP

CH2

Cap.

DNA de interesse
5

O
H

H
OH

H
H

Deoxinucleosdeo
Trifosfato
(dNTP)

Fita molde
H

5
H

CC

Dideoxinucleosdeo
Trifosfato
(ddNTP)

35

S 5

Sntese
de DNA

35

S 5

G
35

S 5

G
35

Fig. 12.11 Estrutura do deoxinucleosdeo trifosfato e


dideoxinucleosdeo trifosfato.

S 5

G
(a) Bacterifago M13 recombinante

gado em quatro reaes separadas, contendo os


quatro deoxinucleosdeos trifosfatos normais
(dNTPs), mais um dos quatro dideoxinucleosdeos trifosfato (ddNTPs), numa proporo de
100 para 1. Uma molcula de ddNTP pode ser
adicionada no lugar de um dNTP normal correspondente, mas quando isto ocorre a elongao da cadeia pra porque ddNTP no possui a
hidroxila 3. Com o tempo, cada reao conter
uma mistura de cadeias prematuramente terminadas a cada ocorrncia de um ddNTP. Cada
mistura de reao submetida eletroforese em
gel de poliacrilamida, e os diferentes fragmentos so detectados por auto-radiografia. A deteco de bandas no filme de raios X em cada
uma das reaes permite ler diretamente a seqncia de bases no molde de DNA original
(Fig. 12.12). Uma vez que a seqncia de bases daquele fragmento determinado, primers
de fragmentos coincidentes so deduzidos e sintetizados baseando-se nesta seqncia, e assim
utilizados para seqenciar pores contnuas
desconhecidas.

MTODOS DE ANLISE

DO

CIDO NUCLICO

Tcnica de Southern Blot


Esta tcnica foi desenvolvida por Edward
Southern, cujo nome serviu de referncia tanto a

158

TUBO

ddG
Topo

TUBO

ddC

3 TUBO 4
ddA
ddT
Eletroforese em gel
de poliacrilamida
Seqncia

TUBO

C
A
G
G
T
C
T
T
G
A
C
A
C
C
G

Fundo

Auto-radiografia do gel

(b) Eletroforese em gel de poliacrilamida da


mistura de reao

Fig. 12.12 Seqenciamento de DNA pelo mtodo do


didesoxinucleosdeo trifosfato de Sanger.

este procedimento, quanto a outros derivados, por


analogia ao nome, como northern e western blot.
O mtodo permite identificar fragmentos de restrio de DNA especficos numa mistura complexa de fragmentos de restrio. O DNA de um
organismo digerido com uma enzima de restrio e os fragmentos resultantes so separados por
tamanho numa eletroforese em gel de agarose. O

DNA RECOMBINANTE

Pilha de papel

Papel
Whatman

Membrana de nitrocelulose
Tampo

Gel

Suporte
Fig. 12.13 Aparato de transferncia de fragmentos de DNA por capilaridade.

Cap.

tra de RNA total ou de RNA mensageiro desnaturado por tratamento com agentes como o
formaldedo, que asseguram o RNA na forma
linear, evitando formao de pontes de hidrognio entre as bases. Estes RNAs so tambm separados em eletroforese em gel de agarose,
transferidos a membrana de nitrocelulose ou
nilon, e desnaturados ou fixados membrana
por UV. O filtro exposto a sonda nucleotdica
radioativa de DNA e bandas visualizadas por
auto-radiografia. A intensidade das bandas obtidas so proporcionais quantidade de RNA
presente na mistura.

Reao em Cadeia da Polimerase (PCR)


Fig. 12.14 Ciclo bsico do PCR.

DNA desnaturado no gel em lcali, e transferido a uma membrana de nitrocelulose ou nilon


por capilaridade (Fig. 12.13). Este procedimento
preserva a distribuio dos fragmentos no gel,
criando uma rplica do gel no filtro; esses fragmentos de DNA so fixados na membrana por
reao cruzada em UV, ou ainda desnaturados
sob calor. O filtro incubado com uma soluo
de hibridizao, em condies especiais, na presena de sondas nucleotdicas radioativas, normalmente obtidas de fragmentos previamente
clonados. Os fragmentos de DNA complementares sonda hibridizam, e so co-localizados no
filtro atravs de auto-radiografia.

Tcnica de Northern Blot


Esta tcnica emprega o mesmo princpio de
southern blot para separao de RNA.Uma amos-

A tcnica da reao em cadeia da polimerase (Polymerase Chain Reaction PCR) foi concebida por Kary Mullis e colaboradores em 1984,
e desenvolvida na Cetus Corporation. A tcnica
conceitualmente muito simples e mimetiza o
processo natural de replicao do DNA in vivo.
Numa simples reao, permite a amplificao especfica de segmentos de DNA raros ou em pequenas quantidades numa mistura de DNA,
representando, assim, uma alternativa clonagem gnica. mistura da reao so adicionados os seguintes componentes seqncia-alvo:
1) um par de primers flanqueando a seqncia a
ser amplificada, 2) todos os quatro desoxirribonucleotdeos trifosfatos (dNTPs), e 3) uma DNA
polimerase termoestvel.
O mtodo baseia-se na repetio de trs etapas (Fig. 12.14), todas conduzidas sucessivamente sob condies controladas de diferentes
temperaturas, mantidas em aparelhos especficos para esse fim:

159

12

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Tabela 12.3
Protenas Humanas de Valor Teraputico
e que so Comercialmente Produzidas pela
Engenharia Gentica

Cap.

12

Fig. 12.15 Estrutura da molcula de insulina.

Etapa 1: a primeira etapa da reao envolve


a desnaturaco do DNA a 94C por 1 minuto.
Esta temperatura permite a separao das fitas
duplas de DNA, tornando-as simples fita, preparando assim o DNA para a etapa seguinte de
anelamento dos primers.
Etapa 2: a segunda etapa do ciclo envolve o
anelamento dos primers no terminal 3 do molde de DNA simples fita . Para isso a temperatura
diminuda para 50C por 1 a 1.5 minutos.
Etapa 3: a etapa de polimerizao envolve a
utilizao da Taq polimerase que funciona eficientemente entre 72-74C (2 minutos), adicionando bases nucleotdicas complementares ao
molde de DNA utilizado, iniciando a reao a
partir dos primers iniciadores.
Assim, ciclos repetidos de desnaturao, anelamento dos primers e polimerizao amplificam
rapidamente a seqncia de interesse. A cada ciclo o nmero de cpias da seqncia entre os
stios dos primers dobrada; portanto, a seqncia desejada aumenta exponecialmente.
A tcnica de PCR to eficiente em amplificar seqncias especficas, que DNA isolado de
uma nica clula humana pode ser analisada para
mutaes associadas com vrias doenas genticas. Este procedimento permite a recuperao
e rpida amplificao de seqncias inteiras en-

160

Protenas

Valor Teraputico

Fator VIII da
coagulao

Tratamento de hemofilia A

Insulina humana

Tratamento de diabetes

Interferon

Agente anticncer
Tratamento de hepatite B

Interleucina-2

Supresso de doenas
auto-imunes
Aumento de sobrevida de
transplantes cardacos

Eritropoietina

Tratamento de anemia

Hormnio do
crescimento

Tratamento de
deficincias do hormnio

Ativador do
plasminognio
tecidual

Tratamento de trombose
coronariana

tre quaisquer dois terminais cujas seqncias sejam conhecidas; a seqncia amplificada pode ser
ento ligadas a vetores de clonagem. Fragmentos
de ~2kb ou menos podem ser amplificados eficientemente; no entanto, com o desenvolvimento de outras polimerases mais eficientes, este
limite foi estendido.

APLICAES

DA CLONAGEM GNICA

A aplicao mais bem-sucedida da clonagem


gnica tem sido o desenvolvimento de protenas
animais em microorganismos transformados que
sintetizam verses recombinantes. Muitas protenas de valor farmacutico so sintetizadas por
animais em pequenas quantidades e sua purificao difcil e cara. A clonagem gnica oferece
a possibilidade mais barata e reproduzvel de produzir estas protenas atravs do crescimento em
larga escala de bactrias recombinantes.
Uma das primeiras protenas humanas a serem clonadas foi a insulina em 1978.
Quando o hormnio insulina no sintetizado em quantidades suficientes pelas clulas
beta das ilhotas de Langerhans no pncreas, re-

DNA RECOMBINANTE

sulta em diabetes melito. A insulina controla os


nveis de glicose no sangue, e sua deficincia se
manifesta como um complexo de sintomas, que
pode levar morte se no tratado.
Felizmente, muitas formas de diabetes podem ser aliviadas por um programa contnuo de
injees de insulina, assim suplementando a
quantidade limitada do hormnio sintetizado
pelo pncreas. A insulina utilizada no tratamento da diabetes tem sido obtida tradicionalmente
de pncreas bovino e suno. Apesar de ela ser
satisfatria, problemas podem surgir no uso contnuo. Um deles que a pequena diferena entre
a protena humana e animal pode levar a efeitos
colaterais desagradveis em alguns pacientes. Um
segundo problema que os procedimentos de purificao so difceis e contaminantes, potencialmente perigosos e no podem ser completamente
removidos. O mtodo mais satisfatrio seria usar
insulina humana para tratamento de diabetes, o
que obviamente impossvel.
Duas caractersticas da insulina humana facilitaram sua produo recombinante em E. coli.
Primeiramente, aps a traduo ela no modificada pela adio de acares, portanto, uma
insulina recombinante sintetizada por bactrias
seria supostamente ativa. A outra vantagem
quanto ao tamanho da molcula. A insulina
composta por dois polipeptdeos, um de 21 aminocidos (cadeia A) e outro de 30 aminocidos
(cadeia B). Em humanos, elas so sintetizadas
como um precursor chamado preproinsulina, que
contm os segmentos A e B ligados por uma terceira cadeia C, que precedida por uma seqncia lder. A seqncia lder removida aps
traduo e a cadeia C excisada, deixando os polipeptdeos A e B ligados um ao outro por pontes dissulfeto (Fig. 12.15).
Dois plasmdeos recombinantes foram construdos, um carregando o gene para a cadeia A e
outro o gene para cadeia B. Em ambos os casos
os genes foram inseridos ao lado e in frame do
lac Z no vetor tipo pBR 322. Os genes da insulina esto sob o controle do promotor forte lac,
e so expressos como uma protena fundida,
consistindo em poucos aminocidos de -galactosidase seguido dos polipeptdeos A ou B. Os
genes foram construdos de tal maneira que os
segmentos de -galactosidase e insulina estariam
separados por um nico resduo de metionina,
presente em ambas protenas fundidas. Os polipeptdeos poderiam assim, ser clivados do segmento de -galactosidase por tratamento com

brometo de cianognio, que quebra protenas nos


resduos de metioninas. As cadeias A e B purificadas so fundidas uma a outra por formao
de pontes dissulfeto em tubo de ensaio. Na realidade, na prtica esta ltima etapa mostrou-se
ineficiente.
Um aperfeioamento subseqente foi sintetizar toda a proinsulina, com as cadeias A, B e
C. Embora esta seja uma proposio mais desafiadora, o pro-hormnio tem a vantagem de dobrar espontaneamente na posio correta, que
facilita a formao de pontes dissulfeto. O segmento da cadeia C pode agora ser removido facilmente por uma clivagem proteoltica.
Existem protenas para as quais os benefcios da clonagem gnica so bvios. Entre elas
incluem-se os interferons, que esto presentes
no corpo em quantidade to pequena, uma vez
que so sintetizados em resposta a ataques virais, e sua purificao quase impossvel pelos
meios convencionais. A clonagem gnica ofereceu o nico meio vivel de obter grande quantidade dessas protenas.
Mais importante ainda, a clonagem gnica
pde fornecer preparaes ultrapuras das protenas com problemas de contaminao. Fator
VIII, uma protena da cascata da coagulao do
sangue, encontra-se deficiente na forma mais
predominante de hemofilia, e era obtida de doadores de sangue humano. Sua purificao envolvia dificuldades em remover partculas virais,
que podem estar presentes no sangue. Hepatite
e HIV poderiam ser passados a hemoflicos via
injees de fator VIII. A obteno do fator VIII
recombinante, livre de contaminaes, bem como
outras protenas listadas na Tabela 12.3, representa hoje uma realizao significante para a tecnologia da clonagem gnica.

BIBLIOGRAFIA
1. Alberts B, Bray D, Lewis J, Raff M, Robrets K, Watson
JD. Molecular Biology of the Cell. 2nd ed. New York:
Garland Publishing, 1989.
2. Brown TA. Gene Cloning, an introduction. 2 nd ed.
England: Van Reinhold Co. Ltd, 1987.
3. Devlin TM. Textbook of Biochemistry with clinical
correlations. 4th ed. New York: Wiley-Liss, Inc.,
1997.
4. Sambrook J, Fritsch EF, Maniatis T. Molecular Cloning:
a laboratory manual. 2nd ed. Cold Spring Harbor:
Cold Spring Harbor Laboratory Press, 1989.
5. Watson JD, Gilman M, Witkowski J, Zoller M.
Recombinant DNA. 2 nd ed. New York: W.H.
Freeman and Co., 1992.

161

Cap.

12

BIOLOGIA MOLECULAR COMO INSTRUMENTAL MDICO

Biologia Molecular como


Instrumental Mdico
Cap.

13

Martin R. Whittle

H pouca dvida que a PCR (polymerase


chain reaction; reao em cadeia de polimerase)
uma das tcnicas que mais revolucionou a
medicina nos ltimos tempos, tornando a medicina molecular um verdadeiro ramo da clnica
mdica. A maior parte deste captulo ser devotada a esta ferramenta, embora outras tcnicas
indispensveis sero abordadas.

PCR
Esta tcnica possui grande utilidade porque:
Permite que o cido nuclico-alvo seja especificamente selecionado.
Amplifica por milhares de vezes o alvo selecionado.
realizada em poucas horas, levando a resultados rpidos.

numa srie de ciclos. Estes princpios so ilustrados na Fig. 13.1.


Supondo que se deseje amplificar uma regio especfica de DNA com comprimento de
400bp no genoma de uma nica clula humana.
Comea-se com duas cpias iniciais pois a clula diplide e realizamos 40 ciclos de reao; o
fator de amplificao 240 = 1,1 1012 e, assumindo um eficincia de 80%, a massa do produto da PCR produzida ser de 0,38g de DNA, a
qual facilmente visualizada em um gel de agarose corado com brometo de etdio.
Usando as condies-padro de PCR, mantendo as concentraes de Mg2+, desoxinucleotdeos, DNA-alvo e primers dentro de limites
tpicos, a maioria das PCRs funciona bem. Na
ausncia de produto final, ou se mais de um produto for gerado, os seguintes fatores devem ser
considerados:

A especificidade da PCR obtida atravs do


uso de um par de primers (iniciadores) composto de oligonucleotdeos que, por terem um comprimento mnimo (21 bases) de uma seqncia
de bases nica, seguramente anelaro no DNAalvo somente em um dado ponto, visto que as
condies de temperatura e fora inica da soluo estejam apropriadas.

O desenho dos primers e suas temperaturas


de anelamento; atualmente programas de
computador auxiliam na escolha dos primers.

A amplificao da PCR exponencial e


obtida pelo emprego de polimerases de DNA
termoestveis que, a partir do par de primers,
copiam as regies do DNA-alvo mltiplas vezes

Anelamento no-especfico ocorrendo durante o preparo da reao, que pode ser evitado usando manobras como polimerases
recombinantes termoativadas, anticorpos

O uso de polimerases termoestveis diferentes.


A concentrao de Mg2+ e a fora inica na
reao.

163

Captulo

13

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

contra a polimerase, preparo no frio, seqestrantes de Mg2+, as quais travam a enzima


nesta fase inativa antes da amplificao.
A presena de inibidores da polimerase na
reao, especialmente se a fonte do DNAalvo estiver suja.
Na PCR, o cido nuclico-alvo o DNA. As
fontes de DNA so vrias; no caso de DNA genmico humano, elas atualmente incluem:
Leuccitos obtidos de uma amostra de sangue.

Cap.

13

DNA-alvo

Ciclo 1
desnaturar e
anelar primers

Estender a partir
dos primers

Clulas bucais obtidas usando uma escova


e/ou saliva.
Bipsia, especialmente no caso de tumor.
Tecido em bloco parafinado.

Ciclo 2
desnaturar e
anelar primers

Blastmeros ou glbulos polares isolados nos


casos de fertilizao in vitro.
Amostras forenses tal como osso cadavrico, esperma, ponta de cigarro usado.
Lembramos que o DNA mitocondrial
(mtDNA) tambm estudado, tanto em funo
das doenas causadas por mutaes que ocorrem nos genes mitocondriais, quanto pelas inferncias feitas em relao ao vnculo gentico
matrilinear.
Atualmente possvel purificar DNA de praticamente qualquer fonte biolgica, e o mesmo
dever estar ntegro e limpo para uso na biologia molecular. Todavia, atualmente simples
utilizar RNA como objeto de estudo, transformando-lo em cDNA por transcrio reversa e
diretamente usando este alvo, em um procedimento denominado RT-PCR. Isso obrigatrio
nas anlises de vrus de RNA, como HCV e HIV;
em outros casos existe a opo entre usar os tipos de cido nuclico. Alm de requerer um passo enzimtico adicional, o manuseio de RNA
mais difcil e necessrio trabalhar com amostras clnicas frescas. Por outro lado, toda ou a
maioria da parte codificadora do gene examinada numa s PCR. Mesmo assim, comum que
mutaes em um gene levem a transcritos mais
instveis do que o normal, que refletir na habilidade da RT-PCR amplificar esses alelos (convm
lembrar que estimado que 15% das mutaes
clinicamente relevantes ocorrem nos ntrons e
outras regies no-codificadoras dos genes).
Um outro ponto pertinente se refere s observaes de transcritos ilegtimos: foi a PCR que

164

Estender a partir
dos primers

Ciclo 3
desnaturar e
anelar primers

Estender a partir
dos primers

Fig. 13.1 Amplificao exponencial de DNA-alvo. O


trecho a ser amplificado especificamente definido por um
par de primers, cada um sendo incorporado no produto de
PCR resultante. As duas fitas de DNA original so estendidas alm do primer oposto, mas, aps alguns ciclos, o produto da reao predomina. H sempre um excesso de
primers em relao o DNA-alvo. Note que na Figura est
mostrado uma molcula de DNA-alvo dupla fita, enquanto
numa reao normal, haveria milhares de molculas-alvo.

BIOLOGIA MOLECULAR COMO INSTRUMENTAL MDICO

possibilitou a descoberta destas molculas. A


concluso que, na maioria dos tecidos, h expresso gnica da maioria dos genes, embora
em nveis baixssimos. A relevncia deste fenmeno para fisiologia humana permanece desconhecida. Porm, esses transcritos fornecem um
acesso anlise dos seus respectivos genes, independentemente do tecido estudado. Em alguns
casos esses transcritos ilegtimos foram amplificados por RT-PCR para se obter informaes
sobre mutaes nos genes em questo. Todavia
no foi estabelecido se esses transcritos fielmente
refletem a situao dos genes mutados.
O produto da PCR pode ser submetido a
vrios procedimentos e usado em diversas maneiras na medicina molecular, como mostrado
na Fig. 13.2.

amplificao atravs de eletroforese em gel. A


presena da banda no gel indica a existncia do
DNA-alvo na amostra clnica original, enquanto
sua ausncia confirma a no-existncia do DNAalvo. As seguintes situaes exemplificam a grande utilidade deste procedimento na microbiologia
clnica e na oncologia:
O diagnstico de tuberculose confirmado
pela cultura da bactria responsvel, Mycobacterium tuberculose, que normalmente leva
de quatro a seis semanas para crescer em
cultura in vitro. A PCR permite que este passo seja realizado em poucas horas.

Confirmao da Presena/Ausncia do
Produto da PCR

O diagnstico de encefalite devido ao vrus


herpes simplex deve ser feito o mais rpido
possvel para poder tratar com os antivirais
e evitar a possvel morte do paciente. Antes
da PCR, esse diagnstico era de difcil realizao, tanto clinicamente quanto nos laboratrios.

O produto da PCR normalmente possui um


comprimento esperado que visualizado aps

A deteco e o rastreamento de alguns tipos


de tumores pelos genes, os quais so por eles

RNA
(mRNA de tecido,
RNA de vrus)

13

ar
ic
rif
Pu

PCR

Presena ou
ausncia do
produto

Comprimento
do produto

Anlise do produto usando:


digesto
ASO hybridization
extenso de primer
OLA e LCR
ensaio de nuclease 5
SSCP
anlise de heterodplex
DGGE
PTT
seqenciamento direto

13

Captulo

Pu
rif
ic
ar
,R
T

DNA
(genmico, mitocondrial,
produto de PCR)

Cap.

Uso do produto
como sonda

Fig. 13.2 Os usos da PCR. As fontes de DNA-alvo para PCR so diversas, bem como as manipulaes posteriores do
produto resultante. Se desoxinucleotdeos marcados (com radioistopo ou com grupos fluorescentes) forem usados durante
a amplificao, o produto resultante tambm ficar marcado. RT significa transcrio reversa. As outras siglas so definidas no texto que segue.

165

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

13

expressos. O fentipo tumoral associado


com a ativao e desativao anormal de
muitos genes. Melanoma e adenocarcinoma
da prstata so cnceres nas quais so ativados genes que normalmente permanecem
silenciosos que ento produzem transcritos
e produtos proticos em quantidade aumentada e portanto detectvel; esses so a tirosinase e a PSA (prostate-specific antigen),
respectivamente. Esses transcritos podem ser
detectados no sangue aps RT-PCR e usados
tanto para confirmar o diagnstico, quanto
para o seguimento dos pacientes aps a cirurgia e/ou radioterapia realizadas para extirpar o tumor primrio.
RT-PCR usada rotineiramente para amplificar o produto de fuso entre o gene ABL e
parte do gene BCR quando h a translocao cromossmica t(9:22) em leucemia
mielide crnica. Desta maneira uma clula
leucmica pode ser detectada entre 106 clulas normais da medula ssea. Esta metodologia til no acompanhamento de
pacientes que fizeram transplante da medula ssea para detectar uma recorrncia das
clulas neoplsticas ps-operatria.
A exfoliao de clulas tumorais em urina
(no caso de cncer de bexiga) e em fezes
(no caso de cncer do pncreas e do colo
intestinal) pode ser acompanhada por PCR.
Nessas situaes, o nmero de clulas tumorais representa uma frao pequena de
todas as clulas presentes e a PCR realizada de um modo para seletivamente enriquecer o DNA mutante. Para isso, primers so
utilizados para que introduzam um stio de
restrio quando uma seqncia normal amplificada, mas no quando a seqncia mutante; a base deste princpio discutida no
item Digesto com enzima de restrio. Aps
PCR, os amplicons so tratados com a
respectiva enzima de restrio; um enriquecimento de duas ordens de magnitude conseguido dessa maneira. Os produtos de PCR
sobrando so novamente submetidos a uma
segunda amplificao para aumentar o sinal.
Obviamente, esta abordagem pressupe conhecimento da mutao em questo, e foi
aplicada a mutaes no gene K-ras em cnceres do trato digestivo.
A utilizao de rigorosos controles em todos os passos laboratoriais imprescindvel neste

166

tipo de ensaio, a fim de que sejam evitados resultados falso-positivos ou falso-negativos. No


laboratrio, vrios cuidados devem ser adotados para evitar a contaminao das PCRs: no
mnimo, o espao onde as amostras so recebidas e preparadas deve ser fisicamente separado
daquele onde a amplificao feita. O uso de
ponteiras que no permite que um aerossol da
soluo que est sendo manipulado entre nos
pipetadores, em si, recomendado. Alm disso,
possvel utilizar dUTP em vez de dTTP na PCR,
cujo produto resultante pode ser clonado e analisado normalmente. Porm, DNA de fita simples ou dupla contendo esta base degradado
pela enzima uracil N-glicosilase (UNG) e os
polinucleotdeos resultantes no conseguem mais
participar da amplificao. Sendo assim, UNG
est presente na fase pr-PCR para remover qualquer produto sobrando de amplificaes anteriores; ao iniciar a PCR, UNG desativada pelo
aumento na temperatura e a PCR prossegue normalmente.
Uma variante mais moderna deste ensaio consiste no monitoramento em tempo real do aparecimento do produto da PCR durante a amplificao,
dispensando sua eletroforese posterior. Se um dos
primers for fluorescente, o produto resultante tambm ser fluorescente e o aumento desta fluorescncia pode ser monitorado durante a ciclagem.
Este princpio ser discutido posteriormente no
item Monitoramento do aparecimento do produto
da PCR em tempo real.
Uma extenso deste ensaio leva PCR quantitativa que se utiliza da natureza exponencial da
amplificao, tal que o grau da amplificao seja
proporcional quantidade do DNA-alvo presente
na amostra inicial. Usando DNA-alvo controle
de quantidade conhecida, possvel construir
uma curva-padro que permite inferir a quantidade de DNA-alvo nas amostras clnicas. Este
tipo de ensaio usado rotineiramente na quantificao do vrus HIV no sangue dos pacientes
infectados por ele. A PCR monitorada em tempo real facilita ainda mais esta quantificao,
como descrito no item Monitoramento do aparecimento do produto da PCR em tempo real.
A visualizao da presena ou ausncia do
produto da PCR tambm usada para revelar a
existncia de mutaes especficas na DNA-alvo.
O princpio desta metodologia se baseia no fato
de que, se a ltima base do primer no seu extre-

BIOLOGIA MOLECULAR COMO INSTRUMENTAL MDICO

amplification of specific alleles), para detectar uma srie de mutaes conhecidas em genes causadores de doenas genticas mais
freqentes.

mo 3 no estiver pareada com a base complementar no DNA-alvo, no ocorrer extenso pela


polimerase. Portanto pode-se utilizar um primer cuja sua ltima base 3 hibridiza com uma
base do alvo, sofrendo uma mutao pontual conhecida. Neste caso, a amplificao no prosseguir, como ilustrado na Fig. 13.3.

Nestes kits, vrios produtos de PCR so necessrios para realizar esta genotipagem, e comum amplificar mais de um produto na mesma
PCR. Nesta PCR multiplex, existem exemplos
em que 15 produtos diferentes so amplificados
simultaneamente no mesmo tubo, para serem separados por eletroforese posteriormente. No
obstante, montar uma PCR multiplex dessa complexidade requer bastante tentativa e erro, pois,
alm de todas as temperaturas de anelamento
dos primers precisarem ser semelhantes, a concentrao de cada primer tem que ser alterada
individualmente quando um novo par de primers
for introduzido na reao.

costume usar dois pares de primers neste tipo de ensaio para aumentar a certeza do
resultado: um par que permite a amplificao
da seqncia normal, mas no da mutao, e
um outro em que um dos primers anela na mutao, permitindo sua amplificao, mas no
a amplificao da seqncia normal. Na prtica, um dos primers dos dois pares o mesmo.
Existem kits comerciais que utilizam esta estratgia, denominada ARMS (amplification refractory mutation system) ou PASA (PCR

Pareamento
completo

Cap.

13

Extenso mxima

ltima base 3
no-pareada

Extenso mnima

ltimas duas bases 3


no-pareadas

Nenhuma extenso

Captulo
Penltima base 3
no-pareada

13

Extenso razovel

Base normal

REAO PARA O ALELO


NORMAL
1

Base variante

Amplificao por PCR

No h amplificao

REAO PARA O ALELO VARIANTE


1

Base normal
3
No h amplificao

Base variante
3
Amplificao por PCR

Fig. 13.3 PCR alelo-especfico. O painel superior mostra a competncia da DNA polimerase estender a partir do
primer quando suas bases 3 forem parcialmente pareadas. O painel inferior mostra como isto aproveitado para seletivamente amplificar, em PCR alelo-especfico, regies contendo variantes usando trs primers diferentes. Primer 1 comum nas
duas reaes. Primer 2 anela completamente na seqncia normal mas no na seqncia variante pela sua base 3, enquanto
o inverso o caso para o primer 3. Aps PCR, os produtos so visualisados em gel aps eletroforese. Vrios alvos podem ser
amplificados simultaneamente em PCR multiplex.

167

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Anlise do Produto da PCR pelo seu


Comprimento
H situaes em que pacientes possuem locos no seu DNA genmico que so menores ou
maiores do que normal. Alm disso, todos indivduos possuem locos polimrficos onde o polimorfismo devido a uma srie de repeties de bases,
exemplificado pelos microssatlites (STRs: short
tandem repeats) e os minissatlites (VNTRs: variable number of tandem repeats); veja o Captulo
11. Estes locos so analisveis usando PCR para
amplificar os locos em questo e medir o comprimento dos produtos resultantes.
Cap.

13

Mutaes causadas por pequenas delees


ou inseres no DNA so detectveis por PCR.
A mutao DF508 no gene CFTR compe uma
deleo de 3bp e a principal mutao causadora da doena gentica recessiva fibrose cstica, presente aproximadamente em 70% dos
pacientes no norte da Europa, e em 40% dos
afetados no Brasil. O ensaio mais usado para
identificar essa leso envolve uma PCR da regio genmica contendo a mutao que normalmente resulta em um produto de 98bp. Na
presena da deleo o produto possui 95bp. As
duas possveis bandas so visualizadas aps eletroforese em gel de poliacrilamida, onde sempre
aconselhvel incluir um indivduo heterozigoto para interpretar os resultados com maior segurana.

cas e observando se o tamanho do produto resultante anormalmente maior que esperado.


Porm, a expanso de CGG no gene FMR1 exemplifica bem algumas das limitaes da PCR e algumas das solues usadas para contorn-las.
Indivduos normais possuem em mdia 29
repeties de CGG no gene FMR1, enquanto
pacientes com a sndrome podem ter milhares
dessas repeties e, nestes casos, o alvo no
amplificvel. Mesmo assim, regies contendo um
alto contedo de G e C como essas so difceis
de amplificar devido tendncia das fitas de DNA
se reanelarem nas temperaturas usadas. Para reprodutivelmente amplificar esses alelos (CGG)15
a (CGG)300, as seguintes modificaes so introduzidas na PCR:
Assegurar a desnaturao das fitas de DNA,
aquecendo-as a 95C durante 10 minutos e
iniciando a amplificao neste ponto.
Utilizar DMSO 50% na reao (outros compostos incluem betaine e trimetil cloreto de
amnia).
Utilizar o desoxinucleotdeo modificado 7deaza-2-dGTP na razo para dGTP de
0,75:0,25, em vez de 100% dGTP.
Utilizar Pfu polimerase em vez da convencional Taq polimerase.

H vrias doenas neurolgicas e neuromusculares causadas pela expanso de trincas


de bases dentro dos genes e quando a expanso
ultrapassa um determinado limite, a funo do
gene perdida (Tabela 13.1).

Isso mostra que as polimerases so capazes


de introduzir bases modificadas durante a sntese
de DNA. Desta maneira possvel gerar produtos da PCR marcados com grupos moleculares,
os quais permitem que os produtos sejam usados em outras situaes, como descrito posteriormente.

A PCR a ferramenta ideal para investigar


essas doenas, bastando somente fazer uma amplificao da regio genmica contendo as trin-

A amplificao de locos polimrficos se tornou rotineira na identificao humana e animal,


bem como na investigao de vnculo gentico

Tabela 13.1
Doenas Causadas pela Expanso de Trincas de Bases

168

Doena

Gene e sua Localizao


Cromossmica

Trinca que
Expande

Sndrome de X-frgil

FMR1: Xq27

CGG

Doena de Huntington

Huntingtina: 4p16

CAG

Ataxia espinho-cerebelar tipo I

SCA1: 6p22

CAG

Distrofia miotnica

Miotonina: 19q13

CTG

BIOLOGIA MOLECULAR COMO INSTRUMENTAL MDICO

nessas espcies. As STRs so os locos genticos


mais usados atualmente. Estes locos tambm so
extremamente importantes para o mapeamento
de genes defeituosos nas famlias que os transmitem, bem como nos projetos-genoma, onde
mapas dos genomas so gerados atravs de estudos de ligao gentica. Alm disso, em alguns
tipos de cnceres (por exemplo, cncer no-polipose do colo intestinal) esses locos demonstram
instabilidade no tumor, o que j indica a presena de genes defeituosos (hMLH1, hMSH2), que
so responsveis pelo reparo de DNA na clula.
Quando ocorre perda de heterozigose no tumor,
esses locos so ideais para expor esse fato, comparando os alelos de alguns locos de uma regio
cromossmica no tumor e em tecido normal.
Existem milhares desses locos de STRs ao longo
do genoma humano, que podem ser empregados desta maneira.
Nestes casos, os alelos dos locos so comumente amplificados usando um par de primers
onde um deles marcado com um grupo fluorescente no seu trmino 5. Os alelos amplificados so fluorescentes e so fracionados durante
eletroforese em gis desnaturantes de poliacrilimaida. Os alelos podem ser visualizados por instrumentos que varrem o gel para detectar a
fluorescncia durante ou aps a eletroforese.
Com a disponibilidade de quatro grupos fluorescentes diferentes, que foram desenvolvidos
para os seqenciadores automticos de DNA,
possvel visualizar alelos de locos genticos distintos, embora com tamanhos iguais na mesma
posio do gel. Por esse motivo, esses mesmos
seqenciadores de DNA so usados para ler os
gentipos dos indivduos estudados.
Quando os alelos a serem distinguidos diferem por duas ou trs bases em tamanho entre
um e os outros, necessrio ficar atento para
um fenmeno que pode atrapalhar a leitura correta dos tamanhos: comum a polimerase acrescentar um nucleotdeo adicional (quase sempre
um A) no trmino 3 do produto a ser gerado
embora no exista esta base no alvo. No existem regras claras que permitem a predio desta
ocorrncia, mas possvel minimiz-la:
Prolongando o ltimo passo de extenso a
72C para 30-60 minutos.
Acoplando uma molcula especial no trmino 5 do outro primer do par para impedir
esta adio.

Anlise do Produto da PCR por Outras


Metodologias
Crescentemente um dos objetivos na medicina molecular a caracterizao de mutaes
ou polimorfismos no DNA genmico (ou em
mRNA) e sua correlao com prognsticos. Isso
realizado em trs nveis:
No nvel populacional com objetivo de encontrar mutaes ou polimorfismos para
efeitos de screening gentico, para prevenir
as doenas genticas mais comuns.
No nvel de famlias transmitindo doenas
hereditrias, para definir a mutao responsvel e prestar aconselhamento gentico, bem
como o diagnstico pr-natal ou mesmo primplantao, como discutido no item PCR
no diagnstico gentico pr-implantao
(DGP), de doenas monognicas.
No nvel de tumores onde as mutaes nos
oncogenes ou genes supressores de tumor so
caracterizadas. Essa uma rea promissora,
dado que os primeiros estudos, realizados
com o gene p53 e cncer de mama, tm demonstrado que existe correlaes entre a posio no gene de algumas mutaes e o
comportamento do tumor nos pacientes; isso
influi no tratamento que as pacientes devero receber, por exemplo, se radioterapia ou
quimoterapia mais indicada. Alm disso, os
estudos moleculares complementam as anlises histopatolgicas do tecido tumoral; no
caso da p53, que quantificada por imunohistologia, os estudos moleculares fornecem
informaes adicionais quando o primeiro
tem resultado negativo.
A anlise de produto de PCR para esse fim
tem se desenvolvido muito nos ltimos tempos,
tal que existem vrias opes. No entanto, importante distinguir entre metodologias que buscam alteraes definidas, que ento fazem o
diagnstico, e aqueles que varrem o produto buscando alteraes desconhecidas; nessa ltima, o
produto ter de ser analisado mais para caracterizar a alterao especificamente. Em virtude do
maior volume de exames efetuado, ensaios diagnsticos devero:

Ser rpidos e baratos.


Ser realizadas por automao.
Ser 100% eficazes.
Evitar o uso de radioistopos e reagentes
txicos.

169

Cap.

13

Captulo

13

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Mtodos Diagnsticos

DIGESTO COM ENZIMA

Cap.

13

DE

RESTRIO

Se um polimorfismo ou mutao altera o


DNA-alvo e cria ou destri um stio de restrio, essa alterao pode ser detectada usando a
enzima de restrio em questo. Portanto este
ensaio consiste em amplificar por PCR a regio
do DNA-alvo que contm a alterao, digerindo-a com a enzima e analisando os fragmentos
resultantes por eletroforese em gel. bastante
desejvel que o alvo amplificado inclua um stio
de restrio constante que sirva como controle
da ao da enzima, se no um outro tipo de controle ter de ser usado. Uma outra desvantagem
desta abordagem que, freqentemente, a alterao no modifica stios de restrio e, por esse
motivo, as estratgias da ARMS (vide supra) e
de ARIP (vide infra) so mais versteis.

ANLISE DE RESTRIO INTRODUZIDA


PRIMER (ARIP)

POR

Aqui uma base que no pareia incorporada no primer, sendo situada prximo ao stio da
mutao. A regio incluindo a mutao amplificada por PCR e o produto resultante digerido por uma enzima de restrio apropriada. A
combinao da alterao no primer e daquela no
stio da mutao cria um novo stio de restrio,
como mostrado na Fig. 13.4.
Esta abordagem pode ser utilizada para criar
um novo stio de restrio, tanto no alelo normal quanto no alelo mutado. Em alguns casos
no possvel criar um novo stio de restrio
perto da mutao. Alm disso, uma outra desvantagem que a diferena em tamanho entre o
produto de PCR no digerido e digerido pequena, sendo em torno do tamanho do primer e,
por esse motivo, o tamanho do produto ter de
ser inferior a 300bp.

HIBRIDIZAO COM OLIGONUCLEOTDEOS


ALELO-ESPECFICOS (ASO: ALLELE SPECIFIC
OLIGONUCLEOTIDE HYBRIDIZATION OU
DOT-BLOT)
O produto de PCR fixado numa membrana
e hibridizado com oligonucleotdeos marcados
que anelaro somente se a seqncia complementar estiver presente nas condies da hibri-

170

dizao. Oligonucleotdeos que detectam a seqncia normal e a seqncia mutante so usados. Para cada mutao diferente uma
hibridizao nova necessria. A dificuldade experimental acertar as condies de hibridizao e lavagem para cada oligonucleotdeo, porm
uma metodologia til para procurar um nmero pequeno de mutaes definidas em um grande nmero de amostras.
No sistema inverso (reverse dot blot) quando o produto de PCR marcado usado como
sonda para hibridizar com oligonucleotdeos
contendo as seqncias de interesse fixados
numa membrana, vrias mutaes ou polimorfismos conhecidos podem ser buscados simultaneamente a partir de um produto de PCR. Isso
utilizado para procurar as mutaes mais comuns causadoras de fibrose cstica e para realizar
a tipagem dos alelos no sistema HLA humano.
Um exemplo mostrado na Fig. 13.5. Obviamente o produto de PCR deve hibridar com todos os oligonucleotdeos com igual eficincia
nas mesmas condies, a fim de se obter um
resultado confivel.
EXTENSO DO PRIMER POR NUCLEOTDEO NICO
Um primer anelado em um produto de
PCR, adjacente posio de uma mutao ou
polimorfismo conhecida: a DNA polimerase
utilizada para acrescentar um nucleotdeo adicional no trmino 3 do primer, dependendo da
presena ou no da alterao. O nucleotdeo adicionado marcado com radioatividade ou com
fluorescncia e, portanto, a reao pode ser quantificada em termos da incorporao da marcao, no necessitando eletroforese em gel.
Normalmente duas reaes paralelas so feitas:
uma com nucleotdeo marcado que seja complementar base normal, e outra onde ele seja
complementar base presente na alterao. Homozigotos so identificados por incorporao em
somente uma das reaes, enquanto heterozigotos tm incorporao nas duas reaes. conveniente realizar os passos em fase slida: o
produto da PCR contendo a regio de interesse
acoplado, via uma das fitas que possui o grupo
biotina, a uma superfcie de estreptavidina, comumente em placas de microtitulao. A fita
complementar removida e o primer a ser estendido anelado. O nucleotdeo marcado introduzido junto com a DNA polimerase para

BIOLOGIA MOLECULAR COMO INSTRUMENTAL MDICO

SEQNCIA VARIANTE

SEQNCIA NORMAL

Amplificar por PCR

Digerir com enzima


de restrio

Hind III
Produtos de
digesto

No h
digesto

Fig. 13.4 Anlise de restrio introduzida por primer. Um dos primers usados na PCR contm uma base alterada em
relao a seqncia do DNA-alvo complementar. O produto resultante da amplificao da seqncia variante possui um
stio de restrio, enquanto aquele resultante da seqncia normal no possui este stio. Esta a abordagem inicial descrita
para detectar o polimorfismo G20210A no gene da protrombina que leva a efeitos clnicos.

5
F

08

D
51
G5

N1

30

3K

X
42
G5

Cap.

13

H
17
R1

Oligonucleotdeo normal
Oligonucleotdeo mutante
Oligonucleotdeos fixados em membrana de nilon
Hibridizados com
produtos de PCR

Captulo

13

Normal

Heterozigoto
normal/G542X

Homozigoto F508

Heterozigoto composto
N1303K/ F508

Fig. 13.5 Reverse dot-blot. Cinco mutaes no gene CFTR causadoras da fibrose cstica so detectadas neste exemplo.
Produtos de PCR diferentes e marcados (normalmente com radioistopo ou com biotina), correspondendo s posies das
mutaes no gene, so gerados e hibridizados aos oligonucleotdeos fixados na membrana. Para assegurar a hibridizao
homognea de todos os produtos com todos os oligonucleotdeos, necessrio utilizar tetrametil cloreto de amnia (TMAC)
na soluo. Os oligonucleotdeos so fixados na membrana atravs de caudas de poli-dT para que eles sejam mais
disponveis para anelamento. comum ter que variar a quantidade de cada oligonucleotdeo fixado na membrana para se
obter sinais de hibridizao uniformes no fim do procedimento. Este sistema um precursor dos chips de hibridizao
descritos no item Chips e seqenciamento por hibridizao.

171

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

efetuar a extenso, sendo tal a incorporao


medida posteriormente. Estes passos so diagramados na Fig. 13.6. Esta tcnica permite a deteco de alelos que esto presentes com
freqncias menores que 50%; como exemplo,
foi utilizado com sucesso para detectar mutaes
(no cdon 12 de K-ras) presentes em tumores
onde clulas mutantes ocorrem numa frao de
0.05% em relao s clulas normais.

Cap.

13

OLA (OLIGONUCLEOTIDE LIGATION ASSAY:


ENSAIO DE LIGAO DE
OLIGONUCLEOTDEO) E LCR (LIGASE CHAIN
REACTION: REAO EM CADEIA DE LIGASE)
O princpio do OLA tem por base a observao de que, quando dois oligonucleotdeos
esto anelados na mesma fita de DNA e perfeitamente justapostos, eles podem ser ligados pela
enzima DNA-ligase. Uma base no-pareada na
juno entre os dois oligonucleotdeos suficiente para impedir essa ligao. Na prtica, o
ensaio utiliza dois oligonucleotdeos marcados
e mede a formao de uma molcula nica
criada pela ao da ligase. As duas molculas
hibridizam em um produto de PCR produzido
para fornecer a regio de interesse. Como ilustrado num exemplo da Fig. 13.7, um dos oligonucleotdeos marcado com um fluorforo no
seu trmino 3 enquanto o outro possui no biotina seu extremo 5.
Se os dois oligonucleotdeos forem ligados
pela ligase, uma nica molcula fluorescente
gerada, a qual pode ser captada por uma superfcie de estreptavidina (em um poo de uma
placa de microtitulao). Caso contrrio, o oligonucleotdeo fluorescente removido por lavagem. Quando dois fluorforos diferentes so
usados, um acoplado no oligonucleotdeo complementar seqncia normal e o outro complementar seqncia mutante, somente uma
reao feita e um controle interno da reao
est presente. Sendo assim, OLA uma metodologia ideal para lidar com grandes volumes
de testes com sistemas automatizados.
LCR representa uma modificao do OLA.
Aqui h amplificao dos oligonucleotdeos ligados devido a ciclos repetidos de desnaturao, anelamento dos oligonucleotdeos e ligao
usando uma DNA ligase termoestvel. Ao contrrio da PCR, no h sntese nova de DNA.

172

Na LCR, seis oligonucleotdeos so necessrios: dois para cada fita-alvo e mais dois que
detectam a seqncia variante, como mostrado
na Fig. 13.8.
O aumento do produto da LCR exponencial, como na PCR. Portanto, na LCR h amplificao e anlise combinadas em um passo,
enquanto na PCR seguido de OLA, dois passos
so necessrios. Alm disso, LCR exibe algumas dificuldades especficas: a principal a ligao alvo-independente que pode servir como
alvo nos ciclos seguintes, resultando em um
resultado falso-positivo. Este fenmeno determinado mais pela concentrao dos oligonucleotdeos presentes.

SEQENCIAMENTO

DO

PRODUTO DE PCR

Veja item Seqenciamento de DNA na medicina nuclear.

MONITORAMENTO DO APARECIMENTO
PRODUTO DA PCR EM TEMPO REAL

DO

Duas metodologias semelhantes so usadas:

Ensaio de Nuclease 5
A atividade 53 exonuclease da Taq polimerase aproveitada para remover um oligonucleotdeo especial, ou sonda, situado entre os dois
primers de amplificao. A sonda marcada com
dois grupos fluorescentes diferentes: um deles
(quencher) oculta a fluorescncia do segundo
(reporter) pela proximidade entre ambos. A sonda tambm possui seu trmino 3 fosforilado, o
que impede que ela atua como primer. Quando
os dois grupos na sonda so separados pela ao
53 exonuclease da polimerase, a fluorescncia do reporter desmascarada, o que reflete a
amplificao ocorrida especificamente do produto em questo, como mostra a Fig. 13.9.
A fluorescncia estimulada (por laser) e
medida durante a amplificao, necessitando
um termociclador modificado para tal. O grande impacto dessa metodologia na medicina
molecular ser na rea de PCR quantitativa, e
o nmero de molculas de DNA-alvo no incio da amplificao poder ser determinado
sem a realizao de outros procedimentos ps-

BIOLOGIA MOLECULAR COMO INSTRUMENTAL MDICO

Amplificao por PCR


usando um primer biotinilado

Captao por estreptavidina

Remoo de uma fita

Anelamento do terceiro primer


Cap.

13

Estenso pela polimerase


incorporando nucleotdeo marcado

Desligamento e
quantificao

A do primer marcado

Fig. 13.6 Extenso do primer por nucleotdeo nico. Esta metodologia tambm denominada minisseqenciamento.
O produto de PCR biotinilado transferido para uma placa de microtitulao cujos poos possuem uma camada de
estreptavidina para captar a molcula amplificada. Esta molcula desnaturada usando hidrxido de sdio e a fita no
presa removida por lavagem. Um terceiro primer anela na fita restante e Taq polimerase usada para acrescentar uma
nica base se existir pareamento da ltima base 3 do primer. Lavagem feita para remover o nucleotdeo no-incorporado e o primer desligado usando hidrxido de sdio e quantificado. Para cada variante sendo analisada, duas extenses
correspondentes so realizadas.

PCR e que, portanto, idealmente apropriado


para automao. Alm disso, a disponibilidade de vrios grupos fluorescentes permite a
realizao de PCR multiplex e, dessa forma, a
possibilidade de incluir controles internos.
Porm essa metodologia pode ser adaptada
para deteco de mutaes conhecidas, baseando-se nas tcnicas descritas aqui, como
ARMS, por exemplo. Ou seja, no seria necessrio realizar eletroforese aps a PCR, e os
dois possveis alelos numa amostra podem ser
detectados simultaneamente com o uso de fluorforos diferentes.

FARIS MOLECULARES (MOLECULAR BEACONS)


Este ensaio semelhante ao anterior embora ele no utilize a atividade exonuclease da
polimerase; ele requer um termociclador modificado. As sondas nesse caso tambm possuem

um grupo quencher e reporter em cada extremo


do oligonucleotdeo, mas este, no incio do ensaio, dobrado sobre si, formando um lao com
uma haste, aproximando os dois grupos que,
conseqentemente, no emitem fluorescncia.
Durante a PCR, a sonda abre-se e hibridiza-se
especificamente com o produto que est sendo
gerado, e passa a emitir fluorescncia proporcional ao nmero de amplicons presentes, como
apresentado na Fig. 13.10. Se no houver amplicons suficientes, os faris moleculares reassumem sua conformao original rapidamente
quando a temperatura diminui durante a ciclagem, at o ciclo seguinte. Esta tcnica foi mais
aplicada a genotipagem em tempo real em vez
da quantificao da amplificao da PCR. O uso
simultneo de vrios fluorforos numa PCR multiplex permite a genotipagem de diferentes variantes ao mesmo tempo, de uma maneira sujeita
automatizao.

173

Captulo

13

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

OLIGONUCLEOTDEO NO
PAREADO NO TRMINO 3

OLIGONUCLEOTDEO PAREADO

Usar DNA ligase

Capturar com estreptavidina

Sinal presente

Sinal ausente
Cap.

Biotina

13

Fluorforo

Fig. 13.7 OLA (oligonucleotide ligation assay). Os oligonucleotdeos marcados so anelados no produto de PCR. O
oligonucleotdeo do lado direito possui um fluorforo no seu trmino 3 e comum para as duas situaes mostradas; este
oligonucleotdeo fosforilado no seu trmino 5. O oligonucleotdeo do lado esquerdo, que biotinilado no seu extremo
5, ou anela completamente com o alvo, ou anela incompletamente, tendo seu trmino 3 no pareado. Na primeira
situao, a enzima DNA ligase capaz de ligar de maneira covalente (usando ATP como substrato) as duas molculas,
criando uma nova molcula, enquanto na segunda isto no ocorrer. Aps desnaturao, a nova molcula capturada
numa superfcie de estreptavidina e quantificada atravs do fluorforo presente nela.

OLIGONUCLEOTDEOS
COMPLETAMENTE ANELADOS

OLIGONUCLEOTDEOS
INCOMPLETAMENTE ANELADOS

Anelamento
ao alvo
desnaturado
Ligase
termoestvel

Desnaturar e anelar
oligonucleotdeos

Ligar e repetir
25 a 30 vezes

Fig. 13.8 LCR (ligase chain reaction). Os oligonucleotdeos assinalados por asteriscos so aqueles em comum, enquanto os quatro restantes detectam a seqncia normal e a seqncia variante. Somente quando um par de oligonucleotdeos
estiver completamente anelados ao alvo que ocorrer a ligao cclica com aumento exponencial do produto da LCR.

174

BIOLOGIA MOLECULAR COMO INSTRUMENTAL MDICO

Extenso a partir
do primer pela
Taq polimerase

Deslocamento da
fita da sonda

simplicidade de implantao. Porm, ela possui


duas desvantagens importantes: o produto da PCR
no deve ultrapassar uns 250bp, e a sua sensibilidade em torno de 50-95% para detectar as alteraes comumente vistas no DNA genmico. O
produto da PCR em questo ter de ser seqenciado posteriormente para identificar a alterao.

HA (HETERODUPLEX ANALYSIS)

Clivagem da sonda

Digesto da sonda

Fig. 13.9 Ensaio de nuclease 5. Na PCR est presente


uma sonda composta de um oligonucleotdeo contendo um
fluorforo R (reporter) no seu trmino 5 e um grupo apagador Q (quencher). Nesta situao o grupo Q impede que
o fluorforo R emita fluorescncia. Esta sonda anela entre
os dois primers de amplificao em uma das duas fitas de
DNA e deslocada e digerida pela ao 5 3 exonucleoltica da Taq polimerase que se aproxima. O fluorforo
passa a fluorescer quando for afastado do grupo Q, refletindo o progresso da amplificao.

Mtodos de Varredura
SSCP (SINGLE STRAND CONFORMATION
ANALYSIS)
Ao contrrio das metodologias anteriores, esta
no pressupe a existncia de uma alterao especfica no produto amplificado e, portanto, uma
tcnica de varredura para detectar alteraes desconhecidas que existem em heterozigose nas regies estudadas. O princpio da tcnica se baseia
no fato de que fitas simples de DNA com seqncias diferentes enovelam de maneiras diferentes e
migram com velocidades distintas em condies
apropriadas de eletroforese. Os dois produtos da
PCR, um deles contendo uma alterao, so desnaturados e submetidos eletroforese em gis
no-desnaturantes, como ilustrado na Fig. 13.11.
Essa metodologia bastante usada devido sua

Tambm uma tcnica de varredura para detectar alteraes desconhecidas que existem em
heterozigose nas regies estudadas. Aqui, o princpio da tcnica se baseia no fato de que fitas simples de DNA com seqncias diferentes se
re-anelam aps desnaturao, e fitas duplas de
DNA hbridas formadas migram com velocidades anmalas durante eletroforese em gis nodesnaturantes, como ilustrado na Fig. 13.12.

Cap.

13

Apesar de sua simplicidade, estudos recentes tm demonstrado que esta metodologia


superior SSCP em detectar alteraes desconhecidas no DNA-alvo, com uma sensibilidade
de 80% a 100%. O produto da PCR deve ficar
inferior a 1.000bp. O produto da PCR em questo ter de ser seqenciado posteriormente para
definir a alterao.
Captulo

DGGE (GENATURING GRADIENT GEL ELECTROPHORESIS)


uma tcnica de varredura para detectar alteraes no DNA-alvo, com uma sensibilidade
de quase 100% para produtos de PCR de tamanho entre 100 e 500bp. A tcnica permite a separao de fragmentos de DNA que se diferem
por um par de bases entre si. Esta separao
ocorre por causa das diferenas nas temperaturas de separao das fitas das molculas normais e mutantes. Quando esses fragmentos
migram no gel por eletroforese, eles encontram
uma concentrao crescente de desnaturante
(uria, formamida); ao serem expostos a um nvel crtico de desnaturante, a fitas comeam a se
separar, ento reduzindo significativamente sua
mobilidade. O ponto no qual a mobilidade diminui ser diferente para a molcula normal e a
mutante, como indicado na Fig. 13.13.
O comportamento de molculas de DNA em
gis DGGE pode ser modelado em computadores e, portanto, a identificao de mutaes em
um dado fragmento pode ser prevista com con-

175

13

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

Fluorescncia

DNA-alvo

13

1,0
0,8
0,6
0,4
0,2

1,0
0,8
0,6
0,4
0,2
0

Hbrido

Farol molecular

10

20

30

40

1,0
0,8
0,6
0,4
0,2
0
10
20
30
Ciclos trmicos

40

10

20

30

40

Fig. 13.10 Faris moleculares. O painel superior mostra como o farol molecular passa a emitir fluorescncia quando ele
hibridiza com o DNA-alvo que o produto de PCR sendo gerado. Quando fechado, o fluorforo R (reporter) est adjacente
ao grupo apagador Q (quencher) e no fluoresce, mas ao abrir para hibridizar, os dois grupos se afastam, permitindo que
o fluorforo irradie. Durante a PCR, o farol molecular no digerido pela ao 5 3 exonucleoltica da polimerase; isto
se deve ao fato que a molcula construda de ribonucleotdeos ou porque, assim que a polimerase comea a deslocar o
farol molecular, ele cai do alvo, escapando da digesto. O painel inferior mostra dois faris moleculares diferentes, cada
um possuindo um fluorforo distinto e que reconhecem seqncias-alvo diferentes, por exemplo, uma normal e uma
variante. Durante a PCR fcil distinguir estes dois alelos claramente e os trs possveis gentipos resultantes: dois homozigotos e um heterozigoto.

fiana. No entanto, por esse mesmo motivo, as


condies so diferentes para cada produto sendo estudado, o que impede uma implantao
padronizada no laboratrio clnico. Alteraes
em DNA homodplex e heterodplex so detectadas nessa metodologia. Porm, alguns equipamentos especializados so necessrios para
realizar este procedimento. O produto da PCR
em questo ter de ser seqenciado posteriormente para determinar a alterao.

CLIVAGEM

DE

MISMATCH POR RIBONUCLEASE

Um local numa fita dupla de RNARNA ou


RNADNA onde existe uma base ou bases nopareadas suscetvel a clivagem pela enzima
RNase A. Isso forma a base de um ensaio para
detectar variantes no produto de PCR quando
hibridizado com uma fita de RNA complementar, com seqncia normal, marcada radioativamente ou com fluorescncia. Os produtos da
clivagem so ento fracionados por eletroforese, dando uma indicao da posio da discre-

176

pncia no produto de PCR. Mutaes em mRNA


podem ser identificadas usando o mesmo princpio quando hibridizados com um produto de
PCR normal. Produtos de PCR tendo kilobases
em tamanho podem ser examinados desta maneira e a taxa de deteco em torno de 75%.
As desvantagens incluem a dificuldade em preparar o RNA marcado e a manipulao da amostra aps tratamento com RNase. O produto da
PCR em questo ter de ser seqenciado posteriormente para estabelecer a alterao.

CLIVAGEM QUMICA

DE

MISMATCH

Este mtodo depende do uso de dois compostos qumicos em duas amostras do heteroduplex formado entre o DNA mutante e o DNA
normal. Um deles, hidroxilamino, reage com
bases C no-pareadas, enquanto o outro, tetrxido de smio, reage com bases T no-pareadas. As duas fitas do DNA normal devem estar
presentes para fornecer as bases A e G que formam as molculas heteroduplex quando houver

BIOLOGIA MOLECULAR COMO INSTRUMENTAL MDICO

Amplicon com
seqncia variante

Amplicon com
seqncia normal

Amplicon com
seqncia variante

Amplicon com
seqncia normal

Desnaturar
e re-anelar
Desnaturar
e esfriar

OU

Eletroforese em gel
no-desnaturante
para separar as
quatro fitas simples

Fig. 13.11 SSCP: Embora os dois amplicons mostrados


diferem em somente uma base, as quatro fitas simples possuem seqncias distintas. Em gis no-desnaturantes as
quatro molculas assumem conformaes diferentes e, portanto, migram com velocidades diferentes durante a eletroforese. As conformaes adotadas dependem de vrios
fatores no gel, tal que a mobilidade de um dado fragmento
muda de um gel para outro mesmo em condies aparentemente idnticas. A eletroforese comumente realizada a 4C
para acentuar as diferenas nas conformaes.

bases T e C, devido a mutaes nas fitas de DNA


mutadas. Por esse motivo, a chance de detectar
as mutaes dobrada. A piperadina utilizada
para clivar o DNA nas posies das bases modificadas, como mostrado na Fig. 13.14. A PCR
usada para gerar os fragmentos de DNA em
questo; neste passo, se um dos primers forem
marcados (com fluorescncia, por exemplo), os
produtos da clivagem sero visualizados aps
eletroforese e uma boa estimativa da localizao
da mutao ser obtida. O produto da PCR em
questo ter de ser seqenciado posteriormente
para identificar a alterao. As vantagens desse
mtodo incluem uma taxa de deteco de alteraes na seqncia de 100% e a possibilidade
de examinar comprimentos de kilobases de DNA.
Por outro lado, o mtodo requer o emprego de
compostos nocivos e uma srie de manipulaes
das amostras.

TESTE

DE

PROTENA TRUNCADA (TPT)

Alguns genes precisam sofrer mutaes severas, como delees, inseres e mutaes

E
Cap.

13

Eletroforese em gel
no-desnaturante para
separar as quatro
molculas (dois
homodplex e dois
heterodplex)

Fig. 13.12 HA (heteroduplex analysis). Os dois amplicons mostrados diferem em somente uma base. Quando
eles so desnaturados e permitidos a reanelar, quatro molculas so geradas em propores iguais: dois homodplex como existia inicialmente e dois heterodplex. Os
heterodplex so molculas possuindo uma dobra ou um
afrouxamento no ponto onde as seqncias diferem. Durante eletroforese em gis no-desnaturantes as duas molculas homodplex migram com velocidades iguais; as duas
molculas heterodplex migram mais lentamente, ou como
uma banda s, ou como duas. Essa eletroforese normalmente realizada em gis de MDE que uma acrilamida
modificada.

nonsense, para resultar em um fentipo anormal; os transcritos desses genes mutados so


traduzidos para gerar protenas menores que
as normais e que provavelmente sero no-funcionais. Mutaes pontuais do tipo missense no
claramente levam a conseqncias deletrias e
podem at ser consideradas como polimorfismos. Genes de importncia clnica que aparentemente precisam sofrer tais mutaes severas
incluem: BRCA1 e BRCA2, envolvidos em cncer de mama e de ovrio hereditrio; APC, envolvido em cncer de clon hereditrio; NF1,
mutado em neurofibromatose; e DMD, que causa distrofia muscular de Duchenne quando mutado. O TPT foi desenvolvido para detectar
essas mutaes severas diretamente. Ele consiste em amplificar a regio de interesse por
PCR, mas um dos primers usados contm um

177

Captulo

13

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Amostra aplicada linearmente aqui

Eletroforese

Fitas
desnaturadas

Fitas
parcialmente
desnaturadas
Fitas
permanecem
aneladas

13

Mnimo
Gradiente de desnaturante

Mximo

Amostras
aplicadas

Gradiente de desnaturante

Mnimo

Eletroforese

Cap.

Fitas
heterodplex

Fitas
homodplex
normais e
variantes

Mximo

Fig. 13.13 DGGE. O painel superior mostra o que acontece quando uma amostra de DNA dupla fita aplicada
linearmente ao longo do incio de gel e submetido a eletroforese num gel que possui um gradiente horizontal de desnaturante. As duas fitas permanecem aneladas e migram rapidamente onde h pouco desnaturante, comparadas com fitas
desnaturadas que se encontram em regies de alta concentrao de desnaturante. Na fita dupla, a desnaturao comea
em domnios distintos que refletem a seqncia local; esses domnios crescem medida que a desnaturao progride. Uma
diferena de uma base entre dois fragmentos de DNA altera o ponto de desnaturao desses domnios. O painel inferior
mostra a migrao diferencial de duas molculas homodplex e duas heterodplex durante a eletroforese. Quando o
paciente for sabidamente heterozigoto, uma quantidade suficiente de molculas heterodplex gerada na PCR durante a
ciclagem para ser visto na DGGE; porm se o paciente for homozigoto para a variante, molculas heterodplex tm que ser
formadas misturando produtos de PCR do paciente com aqueles normais.

promotor da RNA polimerase T7 e um sinal de


iniciao de traduo eucaritico incorporado,
como mostra a Fig. 13.15.
O produto da PCR submetido a um sistema comercial de transcrio/traduo in vitro
junto com 35S-metionina; dessa maneira a pro-

178

tena produzida isotopicamente marcada e pode


ser visualizada aps eletroforese em gis de SDSpoliacrilamida. Protenas prematuramente truncadas devido a uma mutao severa, que geram
cdons de parada anormais, migraro mais rapidamente durante eletroforese, e o tamanho

BIOLOGIA MOLECULAR COMO INSTRUMENTAL MDICO

Cap.

13

Fig. 13.14 Clivagem qumica de mismatch: A qumica desta tcnica tem por base o mtodo Maxam-Gilbert para
seqenciar DNA. Na reao, as duas fitas de DNA contendo a seqncia normal (colorido) so marcados (com radioistopo ou grupo fluorescente) e usados como sonda. Este DNA anelado com a amostra de DNA sendo testado para gerar
molculas heterodplex. No painel superior uma variante G T detectada pela ao de hidroxilamina (H) e de tetrxido
de smio (OT) em somente uma das molculas heterodplex. No painel inferior uma variante C T detectada pela ao
de H e de OT nas duas molculas heterodplex. Porm, importante perceber que o ensaio visualiza somente as fitas
marcadas, aps sua eletroforese em gel. Todas as possveis mudanas de bases so detectveis utilizando este mtodo.

observado da molcula encurtada fornece um indcio da posio da mutao no DNA original,


embora a mutao responsvel pode estar longe
no lado 5 desse cdon. A vantagem deste mtodo em relao alguns outros que segmentos
bastante compridos de um gene (maiores que
1kb) podem ser analisados em um ensaio. Por
esse motivo conveniente que o cDNA, produzido por RT-PCR, seja analisado, uma vez que ele
contm vrios trechos contguos de seqncia
codificadora (o tamanho mediano de xons humanos 200bp). Para assegurar sucesso no caso
de produtos de PCR compridos, gerados a partir de RNA, talvez seja necessrio realizar duas
amplificaes por PCR consecutivas. O produto
da PCR em questo ter de ser seqenciado posteriormente para definir a alterao.

RAPD (Random Amplified Polymorphic DNA)


Nessa tcnica, utiliza-se uma concentrao
alta de somente um primer especfico, e a PCR
realizada em condies de baixa temperatura e
alta concentrao de Taq polimerase. Isso faz

com que produtos de PCR sejam gerados aps a


hibridizao do primer no alvo complementar,
bem como em locais no-especficos. Quando
feito com DNA genmico, o resultado uma srie
de produtos randmicos, porm reprodutveis,
que so visualizados em gel aps eletroforese,
denominados impresso digital. Na rea mdica essa tcnica tem sido empregada no rastreamento de cepas de bactrias e protozorios,
especialmente no contexto do surgimento de
cepas resistentes a antibiticos no ambiente hospitalar; cepas diferentes levam a padres de bandas distintas quando submetidas a RAPD. Esta
tcnica foi adaptada para detectar mudanas
numa nica base, em um trecho de um dado gene
humano: o padro pode mudar dramaticamente
nesses casos, mas a adaptao ter de ser mais
estudada a fim de definir a taxa de deteco de
mutaes em qualquer segmento do DNA-alvo.

PCR no Diagnstico Gentico Pr-Implantao


(DGP) de Doenas Monognicas
A PCR e tcnicas de fertilizao in vitro tm
sido combinadas para oferecer uma alternativa

179

Captulo

13

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

ao diagnstico pr-natal tradicional que utiliza


amniocentese ou anlise do vilo corial. O objetivo do DGP o de transferir, aps fertilizao,
somente zigotos sadios para o tero, em casos
em que o casal sabidamente possui mutaes
causadoras de uma doena gentica. H duas
abordagens, como ilustrado na Fig. 13.16.

Cap.

13

Uma envolve a retirada e anlise por PCR


(para as mutaes em questo) de um ou dois
blastmeros do embrio composto de oito clulas; se for afetado, o embrio no ser transferido para o tero, caso contrrio ser implantado.
Na segunda abordagem, o primeiro e o segundo
glbulo polar so removidos dos ocitos e analisados seqencialmente por PCR; somente zigotos que no possuem mutaes maternas so
transferidos (possveis mutaes paternas no
so procuradas nesta situao). A anlise do produto da PCR segue os mtodos j descritos aqui;
porm DGP representa um caso extremo do uso
dessa ferramenta, porque o DNA-alvo est presente em, no mximo, duas cpias no incio da
PCR. Questes de contaminao so prioritrias, e o DNA do pessoal do laboratrio no pode
ser permitido a ser amplificado em vez do DNA

da amostra. Alm disso, um dos problemas mais


importantes na anlise de blastmeros a falha
de amplificao alelo-especfico, que j levou ao
diagnstico errado nesse campo. Todos esses
casos ocorreram com heterozigotos compostos,
e, provavelmente, somente um dos alelos mutantes foi amplificado. Esse fenmeno ocorre
entre 7% e 30% das anlises, dependendo da
clula a ser estudada. A anlise seqencial dos
dois glbulos polares evita esse problema. Portanto, na anlise de blastmeros, necessrio
amplificar outros locos que sejam polimrficos
(normalmente STRs) simultaneamente, para
excluir a falha de amplificao alelo-especfico.
Todavia para parcialmente contornar a dificuldade de analisar o DNA de uma nica clula,
possvel efetuar uma pr-amplificao do genoma inteiro utilizando uma coleo de primers
menos especficos, em um procedimento denominado PEP (primer extension preamplification).
Aqui, primers de 15-mer so usados que so
compostos de todas as possveis combinaes de
bases; ou seja, h primers que contm 415 seqncias. Estudos preliminares mostram que essa
manobra auxilia a anlise, embora no seja usada na rotina clnica atualmente.

Fig. 13.15 Teste de protena truncada. Neste ensaio, o DNA-alvo recomendado cDNA que composto de um trecho
contguo de DNA que codifica para um produto protico; xons nicos so, na maioria, pequenos demais para serem
usados nesta metodologia. A PCR realizada usando um primer (para a fita forward) que contm a seqncia de promotor
da T7 RNA polimerase no seu lado 5; na parte 3 gene-especfico, o cdon ATG de iniciao deve estar em fase com a
fase de leitura da seqncia codificadora. Convm lembrar que, se o DNA-alvo for cDNA gerado a partir de mRNA por
transcrio reversa, um alelo mutante poder no ser detectado por causa de instabilidade do mRNA.

180

BIOLOGIA MOLECULAR COMO INSTRUMENTAL MDICO

Novidades na PCR
Duas sero mencionadas: a primeira referese a novos termocicladores que esto disponveis
para alguns setores, notavelmente na rea militar. Atualmente, possvel realizar os ciclos de amplificao muito rapidamente, com um volume de
reao reduzido e com mudanas de temperatura
que podem ser transmitidas quase que instantaneamente. Dessa maneira, amplificaes so completadas em menos de 10 minutos, em vez dos 120
minutos tpicos. As amplificaes podem ser
acompanhadas em tempo real, como descrito. Os
termocicladores disponveis so levados ao campo
para confirmar o diagnstico de doenas infecciosas in loco.
A segunda est mais distante, mas j experimental e se refere PCR realizada em chips
miniaturizados com volumes de reao menor
que 5ml. Tanto a amplificao quanto a deteco dos produtos resultantes podem ser feitas
nesses dispositivos.
SEQENCIAMENTO DE DNA NA MEDICINA
MOLECULAR
At recentemente, seqenciamento era considerado oneroso e difcil demais para ser realizado rotineiramente na medicina molecular.
Todavia, com a disponibilidade de seqenciadores automticos mais baratos, de kits que permitem seqenciar DNA preparado de vrias
fontes com alta reprodutibilidade e confiabilidade sem o uso de radioistopos e sem a obrigatoriedade de clonar o DNA a ser seqenciado,
e de programas que facilitam a fcil manipulao das seqncias geradas, esta tcnica tornou-se indispensvel nesta rea. Alm disso, o
seqenciamento considerado o mtodo mais
confivel de deteco de mutaes, esperadas
e inesperadas, no DNA-alvo. Qualquer variante encontrada usando os mtodos de varredura
j descritos aqui, ter de ser seqenciada para
identificar a origem da variao.
Normalmente na medicina molecular o
DNA-alvo de interesse especificamente amplificado por PCR e seqenciado diretamente, obviando a necessidade de clonar o alvo. Isso quase
elimina dois problemas vistos no passo da clonagem, erros de seqncia causados pela Taq
polimerase e aquele da heterozigose, alm da
dificuldade relativa de praticar a clonagem. A Taq

polimerase incorpora bases erroneamente com


a freqncia mdia de uma em cada 2.000 (outras DNA-polimerases termoestveis, por exemplo, Pfu polimerase, so mais fiis ao realizar as
cpias). Se um produto da amplificao que
contiver um desses erros for clonado, todos os
plasmdeos provenientes dessa molcula tero
esse erro e, ao serem seqenciados, levaro
concluso de que h uma mutao ou polimorfismo. Quando o produto de PCR seqenciado diretamente, esse tipo de erro artificial
minoritrio escondido pela maioria das molculas-cpia normais, como se fossem uma nica molcula.
Se o DNA genmico for amplificado, e, no
caso de DNA humano, existem duas cpias do
alvo, se faz necessrio que o seqenciamento
detecte variaes (por exemplo, mutaes pontuais) presentes em heterozigose. Nos pontos de
heterozigose, o sinal de cada base no seqenciamento cai pela metade e sobreposto pelo sinal
dado pela base da outra fita, como demonstrado
na Fig. 13.17.
At h pouco tempo, seqenciamentos de
alta qualidade e difceis de se realizar eram necessrios para garantir a deteco destes heterozigotos, mas atualmente isso se tornou mais
simples e reprodutvel. Porm, quando os produtos so clonados antes de serem seqenciados, possvel que somente um dos alelos seja
seqenciado, pelas mesmas razes discutidas
acima. Por esse motivo, nessas situaes necessrio seqenciar no mnimo seis clones independentes para minimizar a chance de no
observao de heterozigotos.
Embora o seqenciamento direto de produtos de PCR tenha se tornado quase que rotineiro na medicina molecular, h algumas situaes
que se faz necessrio a obrigatoriedade do seqenciamento de produtos clonados para detectar
variantes. Essas so aquelas em que a seqncia
variante sabidamente existir em minoria comparada com a seqncia normal, por exemplo
em um tumor pequeno, ou quando clulas tumorais esto sendo procuradas em urina ou fezes. A purificao e o seqenciamento do DNA
total nesses casos no revelaro mutaes, que
estaro sub-representadas e escondidas na seqncia normal. Na PCR os dois alelos sero
amplificados com igual eficincia correspondente
razo das clulas normais para aquelas cance-

181

Cap.

13

Captulo

13

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Aps anlise do
blastmero,
implantar o embrio

Cap.

13

Aps anlise do
blastmero, no
implantar o embrio

No-afetado

Afetado

Fig. 13.16 Diagnstico gentico pr-implantao. Anlise de blastmero mostrada no painel superior no caso de
uma doena hereditria recessiva. As quatro possveis fertilizaes entre espermatozides e ocitos so consideradas, em
que N e M significam os alelos normais e mutantes, respectivamente. Na etapa de oito clulas, uma bipsia do embrio
feita para remover um ou dois dos blastmeros; isto no afeta o futuro desenvolvimento do embrio. O DNA do blastmero
submetido PCR para determinar a presena ou no dos dois alelos; a ausncia do alelo normal implica que o blastmero homozigoto para o alelo mutante e que o embrio no deveria ser implantado para evitar o desenvolvimento de um
indivduo afetado. O painel inferior considera a anlise (por PCR) dos glbulos polares, que so formados durante a
meiose do ocito, em que a mulher heterozigoto para a doena. MI e MII so a primeira e a segunda diviso meitica,
respectivamente do ocito. Neste caso existem trs possibilidades em relao ao primeiro glbulo polar: se recombinao
no ocorrer, ele ser homozigoto normal ou homozigoto afetado. Se recombinao ocorrer, o primeiro glbulo polar ser
heterozigoto. Se o primeiro glbulo polar for homozigoto para o alelo normal, o ocito possui duas cpias do alelo mutante
e o futuro embrio certamente ter este alelo se fertilizao acontecer. No caso inverso, o resultado oposto ser obtido. No
caso de recombinao, o segundo glbulo polar ter de ser analisado para predizer qual alelo materno estar presente no
ocito maduro. As vantagens da anlise dos glbulos polares sobre a dos blastmeros incluem o fato que somente material
extra-embrinico manipulado e que problemas de mosaicismo em embries so evitados. Por outro lado, esta abordagem
no aplicvel nas doenas autossmicas dominantes em que o pai afetado, e na identificao de sexo, em que a
contribuio paterna tem que ser conhecida.

182

BIOLOGIA MOLECULAR COMO INSTRUMENTAL MDICO

rosas; quando a amostra tiver <30% clulas tumorais, a deteco da mutao no ser possvel. Se no utilizar um mtodo de seletivamente
enriquecer as seqncias mutantes (veja item
Confirmao da presena/ausncia do produto
da PCR), ou de seletivamente isolar o tecido tumoral no incio (por cuidadosa microdisseco),
os produtos de PCR tero de ser clonados e seqenciados para aumentar a chance de achar a
seqncia mutante.
Utilizando sistemas fluorescentes, h dois
mtodos para a realizao de seqenciamentos:
em um deles, denominado dye-primer, o primer
de seqenciamento marcado no seu extremo
5 com o fluorforo e quatro reaes distintas
so realizadas com os respectivos terminadores
(ddNTPs) para cada DNA a ser seqenciado.
No segundo, chamado de dye-terminator, o
primer de seqenciamento no marcado, e
os quatro terminadores so acoplados ao(s)
fluorforo(s). At recentemente, o mtodo dyeprimer era considerado necessrio para deteco de heterozigotos com confiana, e os picos
vistos no eletroferograma eram mais homogneos; porm, com a introduo de polimerases
de DNA modificadas (por tcnicas de DNA recombinante) e de fluorforos mais eficientes, o
mtodo dye-terminator passou a ser mais utilizado atualmente: a qualidade do seqenciamento
gerado boa, os primers usados para fazer a PCR
podem ser usados como primers de seqenciamento em vez de sintetizar primers fluorescentes para cada DNA-alvo a ser seqenciado e, se
quatro fluorforos diferentes para cada um
dos quatro ddNTPs forem usados, a reao
de seqenciamento pode ser realizada em um
nico tubo. Presentemente, polimerases de DNA
termoestveis e modificadas so empregadas para
fazer seqenciamento cclico (vrios seqenciamentos alternados em um termociclador) usando o mtodo dye-terminator que requer pouco
DNA-alvo e que, portanto, ideal para produtos de PCR no laboratrio clnico.

OUTRAS

TECNOLOGIAS PARA AMPLIFICAR

CIDOS NUCLICOS

Embora a PCR continue sendo a ferramenta mais empregada para amplificar especificamente e analisar pequenas quantidades de cidos
nuclicos, outras metodologias eficazes tm sido

Cap.

13

Fig. 13.17 Seqenciamento de heterozigotos. Os eletroferogramas mostram parte do seqenciamento do xon


11 do gene BRCA2 obtido com a metodologia dye-terminator e seqenciamento cclico. O trao superior representa a seqncia normal enquanto o inferior representa um
indivduo heterozigoto na posio 6382 do gene onde, em
uma das cpias do gene, houve uma substituio C T.
Essa variante denominada C6382T. Embora essa metodologia no produza picos de tamanho uniforme, ela suficientemente confivel para revelar heterozigotos. A
existncia desta variante foi confirmada pelo seqenciamento da fita complementar posteriormente.
Captulo

desenvolvidas como alternativas. Uma das razes devido patente, que restringe o uso da
PCR para fins comerciais; esta patente deve terminar em torno do ano 2006.
As outras metodologias podem ser categorizadas em trs grupos: amplificao do alvo,
amplificao da sonda e amplificao do sinal.
As tcnicas que amplificam o alvo, as quais incluem PCR, NASBA (nucleic acid sequence-based amplification), SDA (strand displacement
assay), TMA (transcription mediated amplification) e RCA (rolling circle amplification), oferecem uma maior sensibilidade de deteco
permitindo que uma molcula do alvo possa ser
detectada. Os mtodos de amplificao da sonda incluem LCR (descrito aqui), Qb-replicase e
cycling probe reaction, tambm permitindo que
algumas molculas da seqncia alvo possam ser
detectadas. Amplificao do sinal feita usando
bDNA (branched DNA). Algumas dessas tcnicas sero discutidas a seguir, e o restante delas
est em fase de introduo no mercado.

183

13

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

NASBA

Cap.

13

O alvo inicial DNA ou RNA, o que j limita sua aplicabilidade. A esse, anelado um primer hbrido (primer 1), contendo um promotor
de RNA polimerase no seu trmino 5, e ento
um cDNA gerado usando transcriptase reversa (RT). A enzima RNase H usada para
digerir a fita de RNA nessa fita dplex de
RNADNA, liberando uma fita simples de DNA.
Essa fita simples copiada por RT atravs de
um segundo primer (primer 2) que tambm
contm um promotor de RNA polimerase no
seu trmino 5, gerando uma fita dupla de
DNADNA. Esses passos representam a fase
inicial no-cclica, como mostra a Fig. 13.18.
A segunda fase cclica durante a qual a amplificao ocorre: cada fita do dplex DNADNA
serve como molde para T7 RNA polimerase (a
terceira enzima usada nessa metodologia), que
gera transcritos mltiplos de RNA. Cada um desses, por sua vez, so transcritos pela RT a partir
do primer 2, gerando mais cpias de DNA na forma de fitas dplex de RNADNA. Aps a ao
de RNase H, a RT atua novamente, a partir do
primer 1, encerrando o ciclo. Todos os passos so
efetuados a uma temperatura constante. Diferente
da PCR, cada ciclo de amplificao por transcrio produz 40-100 cpias de RNA: uma amplificao maior que um milho de vezes do produto
de RNA atingida dentro de uma hora. Esse produto detectado aps hibridizao com duas sondas (oligonucleotdeos) especficas que atuam
simultaneamente: uma sonda contm biotina para
captar o produto, enquanto a outra marcada
com um composto que inicia uma reao eletroquimoluminescente, atravs da qual medido o
grau da reao. Essa tecnologia tem sido aplicada quantificao de RNA de HIV1 em pacientes infectados.
TMA
semelhante a NASBA, mas difere na medida que a RT especial por possuir atividade
de RNase H inerente. O mtodo de deteco dos
amplicons de RNA tambm diferente. Essa
metodologia usada para detectar Mycobacterium tuberculose.
BDNA
Somente o sinal amplificado nessa metodologia, o que significa que resultados falso-po-

184

sitivos por contaminao local so mais raros.


Sondas especficas que possuem estruturas parecidas com pentes (fornecidos pelo manufaturador) ligam-se no cido nuclico-alvo. Cada
pente fornece stios para a hibridizao de at
3.000 sondas acopladas a uma enzima, como
fosfatase alcalina. O consumo de um substrato
quimoluminescente pela enzima gera um sinal
proporcional ao nmero de molculas-alvo presentes, como diagramado na Fig. 13.19. Esse
sistema usado na quantificao de DNA de
HBV e RNA de HCV e HIV.

HIBRIDIZAO
A maioria dos mtodos descritos aqui, usados na rea clnica para caracterizar variantes
moleculares em cido nuclico, refere-se a pequenas mudanas, sejam mutaes pontuais ou pequenas inseres, delees ou rearranjos.
importante lembrar que defeitos no DNA incluem
leses drsticas, exemplificadas pela perda ou ganho de um cromossomo inteiro. Essas aberraes
cromossmicas ocorrem em 0,6% dos nascimentos vivos humanos e em at 5% dos natimortos. A
mutao mais comum em humanos a nodisjuno em meiose do cromossomo 21 que leva
sndrome de Down.
Aberraes cromossmicas so tradicionalmente visualizadas realizando bandeamento dos
cromossomos e caritipo. Leses mais sutis podem ser vistas com o uso de FISH (fluorescent in
situ hybridization) onde uma sonda de DNA (clonado em plasmdeo, bacterifago ou cosmdeo)
marcado (com biotina ou digoxigenina) hibridizado com os cromossomos comumente em metfase. A sonda observada posteriormente por
fluorescncia. O limite de resoluo em torno
de 1Mb nesses casos, mas quando cromossomos
em interfase so o alvo, duas sondas coradas em
cores diferentes, e separadas por somente 50kb
podem ser distinguidas. Leses menores devem
ser detectadas pelo uso de Southern blotting e hibridizao, que separam fragmentos de DNA de
500bp a 20kb em tamanho. Assim sendo, essa
metodologia continua sendo usada para detectar,
por exemplo, os rearranjos que ocorrem na leucemia mielide crnica (t[9:22]), cromossomo
Philadelphia) e no linfoma folicular (t[14:18]),
bem como as expanses de trincas observadas na
sndrome de X-frgil (vide supra). Se a possibilidade desse tipo de leso maior no for levada em

BIOLOGIA MOLECULAR COMO INSTRUMENTAL MDICO

DNA-DNA

DNA (+)

RT
Desnaturar

Primer 1
RNA (+)

RNA-DNA

RT

DNA ()

RNase H

RT
DNA-DNA

Primer 2

FASE NO-CCLICA
T7 RNA polimerase
n

RNA ()

Primer 2

T7 RNA polimerase

FASE CCLICA

RT
RNA-DNA

Cap.

13

RT

RNase H
DNA (+)

Primer 1

Fig. 13.18 NASBA. Essa metodologia possui duas fases: a no-cclica e a cclica, e utiliza dois primers hbridos, 1 e 2,
cada um contendo um promotor de RNA polimerase no seu segmento 5. A fase no-cclica usa RNA ou DNA como alvo e
tem como objetivo a produo de vrias cpias de DNA dupla fita, onde cada fita contm o promotor de RNA polimerase.
Esta fase depende das enzimas transcriptase reversa (RT), e RNase H que remove a fita de RNA de uma molcula hbrida
RNADNA. Amplificao por transcrio ocorre durante a fase cclica quando um nmero grande de fitas de RNA gerado
pela ao das enzimas T7 RNA polimerase, RT e RNase H, e o consumo dos primers 1 e 2. As cpias de RNA so quantificadas por uma reao eletroquimoluminescente.
Captulo

considerao, um diagnstico atravs de PCR e


da anlise do produto resultante ser incorreto.
Por exemplo, estimado que 35% das mutaes
no gene BRCA1 so devidos a delees grandes
(510bp a 14kb): porm essas no sero reconhecidas ao realizar PCR e seqenciamento do produto gerado.

CHIPS

E SEQENCIAMENTO POR

HIBRIDIZAO

Com a tecnologia importada do uso de fotolitografia em chips de silcio na fabricao de semicondutores, possvel sintetizar oligonucleotdeos,
por exemplo, de 8-mer, numa superfcie que normalmente de vidro. As bases so acrescentadas
seqencial e controladamente, e a posio de cada
oligonucleotdeo, na pequena placa de vidro, com
sua seqncia, conhecida. Trinta e dois ciclos de
adies especficas (ou seja, oito adies de cada
um dos quatro nucleotdeos) permitem a produo de todos os 65.536 possveis oligonucleot-

deos de 8-mer. O conceito original dessa tecnologia (25 anos atrs) baseia-se no blot de Southern,
e molculas de cido nuclico marcadas poderiam
ser usadas para interrogar molculas de cido nuclico fixadas em um suporte slido, inicialmente
membranas de nitrocelulose. O uso de um suporte
como vidro, que impermevel e rgido, faz com
que as sondas encontrem e hibridizem com seus
alvos mais rapidamente, sem entrar em poros de
membranas. As lavagens so mais rpidas pelos
mesmos motivos. Alm disso, a planura, transparncia e rigidez do vidro permitem uma melhor
aquisio e processamento de imagens, e as posies dos oligonucleotdeos ficam mais bem definidas do que numa superfcie flexvel. Portanto,
atualmente so produzidos agrupamentos contendo 400.000 oligonucleotdeos diferentes, cada um
no seu espao de 20 m2.
Um produto de PCR, comumente marcado
com um fluorforo, hibridizado com esse chip,
que lavado posteriormente para remover o
produto no-anelado. Aps estmulo com laser, as posies de fluorescncia so lidas e in-

185

13

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Hibridizar sondas ao
cido nuclico-alvo
e fase slida

Hibridizar bDNA
(multmero de
amplificao)

Sonda de
extenso

Sonda de
captura

cido nuclico
desnaturado

Cap.

Hibridizar sondas
marcadas com
enzima ao bDNA

13

Acrescentar substrato e
medir quimoluminescncia

Fig. 13.19 bDNA. O cido-nuclico-alvo capturado numa fase slida usando sondas. Outras sondas de extenso
tambm so hibridizadas ao alvo que, por sua vez, hibridizam ao bDNA. O bDNA possui formato de pente e o multmero
de amplificao; esta molcula fornecida pr-construda pelo fabricante. No prximo passo, outras sondas marcadas
com uma enzima (comumente fosfatase alcalina) so hibridizadas ao bDNA. A enzima atua sobre um substrato (por
exemplo, dioxetano), produzindo quimoluminescncia que quantificada.

terpretadas por computador, a partir da qual a


seqncia no produto de PCR inferida. Produtos contendo variaes na seqncia anelaro em
posies sutilmente diferentes, e produtos obtidos de heterozigotos hibridizam em no mnimo duas posies simultaneamente. Essa
tecnologia est avanando rapidamente, tanto
pelo aumento na densidade de oligonucleotdeos colocados numa dada rea do chip, quanto na habilidade de ler os sinais de fluorescncia
mais compactados. Os problemas encontrados,
como o auto-anelamento do produto nas condies de hibridizao usadas, esto sendo solucionados.
Se os oligonucleotdeos que forem fixados
no chip possuem seqncias de cDNAs, esses
chips podem ser usados para acompanhar a ex-

186

presso de genes atravs do mRNA obtido, por


exemplo, de um tecido em estudo. A expresso
de genes de interesse em dois tecidos diferentes,
ou em duas amostras de um tecido, uma sendo
neoplstica, pode ser comparada. O tempo dir
se essa tecnologia ser adotada nos laboratrios
de medicina molecular.

BIBLIOGRAFIA
1. Arnheim N, Erlich H. Polymerase chain reaction strategy.
Annu Rev Biochem, 61:131-156, 1992.
2. Belgrader P et al. PCR detection of bacteria in seven
minutes. Science, 284:449-450, 1999.
3. Cotton RGH. Mutation detection. Oxford University
Press, 1997.
4. Kostrikis LG et al. Spectral genotyping of human alleles.
Science, 279:1228-1229, 1998.

BIOLOGIA MOLECULAR COMO INSTRUMENTAL MDICO

5. Nollau P, Wagener C. Methods for detection of point


mutations: performance and quality assessment. Clin
Chem, 43:1114-1128, 1997.
6. Tang YW, Procop GW, Persing DH. Molecular
diagnostics of infectious diseases. Clin Chem,
43:2021-2038, 1997.
7. The chipping forecast. Suplemento a Nat.Genetics 21,
janeiro 1999.

8. Williams C et al. Assessment of sequence-based p53


gene analysis in human breast cancer: mRNA in
comparison with genomic DNA targets. Clin Chem,
44:455-462, 1998.
9. Winn-Deen ES. Automation of molecular genetic methods
Part 2: DNA amplification techniques. J Clin Ligand
Assay, 19:21-32, 1996.

Cap.

13

Captulo

13

187

A ANLISE DE CARACTERES DETERMINADOS GENETICAMENTE

A Anlise de Caracteres
Determinados Geneticamente
Marlia de Arruda Cardoso Smith
Spencer Luiz Marques Payo

INTRODUO

A metodologia clssica de anlise dos caracteres genticos envolve o estudo de genealogias


ou de heredogramas e a adequao da segregao destes caracteres aos pressupostos bsicos
das Leis de Mendel.
Como se sabe, genes alelos so aqueles que
contm o mesmo tipo de informao gentica
(por exemplo, informao para cor de olhos) e
que se situam em um mesmo loco em cromossomos homlogos. Cromossomos homlogos
so aqueles que contm o mesmo tipo de informao gentica, sendo um de origem materna e
o outro de origem paterna.
O comportamento destes genes pode ser observado durante o processo de diviso celular das
clulas germinativas, a meiose, que ir originar
os gametas. A Fig. 14.1 mostra um esquema simplificado da meiose, em que podemos verificar
que os genes alelos A e a se segregam durante a
primeira e a segunda diviso da meiose e que os
genes no-alelos A e D, ou a e d, recombinam-se
ao acaso, ou seja, segregam-se independentemente durante a formao das quatro clulas-filhas
haplides. Os genes ligados, ou seja, que se encontram prximos em um mesmo cromossomo,
como A e B ou a e b na Fig. 14.1, por outro lado,
dependendo da distncia entre eles e de sua freqncia de permuta, podem ser herdados con-

juntamente, como assinalado na Fig. 14.1. A freqncia de recombinao entre estes genes possibilita a construo de um mapa gentico com
distncias entre os genes em centimorgans. O
contedo total de informao gentica por gameta ou por clula haplide (n) denominado
genoma.
A diviso celular mitose ocorre nas clulas
somticas e leva formao de duas clulas geneticamente idnticas clula parental.
O conceito gene-partcula foi proposto por
Mendel, que estabeleceu a relao de dominncia e recessividade entre genes alelos. Gene dominante aquele que expressa seu efeito em dose
simples e o gene recessivo aquele que necessita da presena dos dois alelos para expressar o
seu carter.
Na espcie humana, as clulas somticas,
diplides (2n), mostram 46 cromossomos, os
quais ocorrem aos pares. Existem 22 pares de
cromossomos autossomos e dois cromossomos
sexuais, nas mulheres XX e nos homens XY.

COMO SE ESTUDA A HEREDITARIEDADE?


A anlise da distribuio de um carter nas
famlias revela o modo de participao da hereditariedade.

191

Cap.

14

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

c) filhos de afetados tm 50% de risco de herdar o carter;

O estudo das genealogias e de sua representao grfica os heredogramas permitiu estabelecer basicamente quatro tipos de herana
monognica ou mendeliana: herana autossmica dominante, herana autossmica recessiva, herana ligada ao X dominante e herana
ligada ao X recessiva, exemplificadas na Fig. 14.2.

Cap.

14

d) o fentipo ocorre igualmente em homens e


mulheres.

Herana Autossmica Recessiva

As doenas genticas so, em geral, de incidncia baixa na populao. Assim, os gentipos


mais freqentemente observados em indivduos
afetados por doenas decorrentes de genes autossmicos so: o heterozigoto dominante Aa,
quando se trata de doena de herana dominante e o homozigoto recessivo aa, quando se trata
de doena de herana recessiva. Os critrios para
a sua identificao de cada padro de herana,
os tipos de casamentos mais freqentes e os gentipos mais provveis encontram-se a seguir.

(Casamento mais freqente: Aa: normal e Aa:


normal)
a) afetados em geral so filhos de pais normais
heterozigotos;
b) filhos de pais normais heterozigotos tm 1/4
de risco de serem afetados:
c) a consanginidade favorece o aparecimento
do fentipo;
d) o carter ocorre igualmente em homens e
mulheres.

Herana Autossmica Dominante

Herana Ligada ao X Recessiva

(Casamento mais freqente: Aa:afetado e aa:


normal):

(Casamento mais freqente XA Xa :heterozigota


normal e XAY: hemizigoto normal)

a) o fentipo aparece em todas as geraes;

a) ausncia de transmisso do carter de homem para homem;

b) afetados em geral so filhos de afetados;

B
d

Metfase I

b
Interfase

a
b

A
B

a
b

A
B

Profase

Sendo n= 2, h possibilidade de
disposio dos cromossomos na
placa metafsica

a
b
d

Metfase II

A
B

A
B
D

A
B

a
b

A
B

Gametas
a
b

a
b d

A
B

Fig. 14.1 Esquema simplificado da Meiose.

192

B D

a
D

B d

A ANLISE DE CARACTERES DETERMINADOS GENETICAMENTE

Cap.

Fig. 14.2 Padres de herana.

b) o carter mais freqente em homens;


c) o carter , em geral, transmitido por mulheres heterozigotas normais para metade de seus
filhos do sexo masculino.

Herana Ligada ao X Dominante


(Casamentos mais freqentes: XAXa: heterozigota
afetada e Xa Y: hemizigoto normal ou XaXa-: homozigota normal e XAY hemizigoto afetado)
a) ausncia de transmisso do carter de homem para homem;

RELATO DE CASO DE HERANA


AUTOSSMICA DOMINANTE
Qual o risco de recorrncia da disostose
mandbulo facial (sndrome de Treacher-Collins)
na prole dos indivduos II.1 e II.3 do heredograma que se encontra na Fig. 14.3.
O importante catlogo de Victor McKusick,
contendo todas as doenas genticas de herana monognica mendeliana j identificadas, pode
atualmente ser acessado pela Internet, no endereo: http//www.ncbi.nlm.nih.gov/omim.

d) o carter est presente em todas as geraes.

A partir de informaes da literatura, sabese que a disostose mandibulofacial ou sndrome


de Treacher-Collins comporta-se de acordo com
herana autossmica dominante. Assim, na prole
de afetado, no caso do indivduo I.1, o risco terico de recorrncia da anormalidade de 50%.

Estes conhecimentos permitem que possamos inferir o risco de recorrncia de um carter em uma determinada famlia e estabelecer,
portanto, prognsticos para a famlia.

Com relao ao indivduo II.3, observa-se que


normal, embora seja filho de afetado e progenitor de outro indivduo afetado. Este indivduo, portanto, possui o gene da afeco, o qual, porm,

b) o carter mais freqente em mulheres;


c) homens ou mulheres afetados apresentam 50%
de risco de terem filhas afetadas;

193

14

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

hlice por Watson & Crick em 1953, mostrou que


as propriedades do DNA eram coincidentes com
as propriedades da hereditariedade, como conservao e variao, codificao, mutao e recombinao, fato que permitiu um fantstico
desenvolvimento da Gentica na segunda metade do sculo XX.

Fig. 14.3 Heredograma de famlia com sndrome de


Treacher-Collins.

Cap.

14

no se manifestou fenotipicamente. Nesta situao, diz-se que o gene dominante com penetrncia reduzida ou que neste indivduo o gene no
est penetrante.
No caso da disostose mandbulo facial, a
penetrncia do gene, extrada de informaes da
literatura, de 80%, ou seja, em 80 de 100 indivduos portadores obrigatrios do gene, este s
se manifesta fenotipicamente em 80% deles.
A falta de penetrncia do gene altera a expectativa terica inicial de 50% de indivduo afetado na prole de um afetado. Assim, em prole de
afetado, considerando-se a penetrncia de 80%
do gene, haver 0,50 x 0,80 = 0,40, ou seja,
40% dos indivduos com expresso fenotpica do
gene ou penetrncia do gene desta afeco.
Outro fenmeno associado herana autossmica dominante a variabilidade de expresso do gene entre indivduos de uma mesma
irmandade, que abrange desde casos mais leves
at os casos mais graves. No caso da disostose
mandibulofacial, a expresso da alterao malar
e mandibular varia significativamente entre os
indivduos de uma mesma irmandade.

QUAL A NATUREZA DO MATERIAL


HEREDITRIO?
A unidade da hereditariedade o gene, o qual
se localiza nos cromossomos dos ncleos das clulas. A cromatina constituda pelo DNA e por
protenas bsicas e cidas associadas em nveis
progressivos de compactao da cromatina, formando os cromossomos. A descoberta do DNA
como o material gentico responsvel pela hereditariedade e a elucidao da estrutura da dupla

194

O DNA constitudo por nucleotdeos formados por um acar, a desoxirribose, uma base
nitrogenada e um grupo fosfato (Fig.14.4). As
bases podem ser pricas, como adenina (A) e
guanina (G) ou pirimdicas, como citosina (C)
e timina (T), como pode ser observado na Fig. 14.4.
A observao de que uma seqncia de bases do DNA poderia conter uma mensagem gentica ou uma informao gentica com
significado fisiolgico para a clula, permitiu que
se compreendesse melhor a funo do gene na
clula.

QUAL O CONCEITO ATUAL DO GENE?


O conceito de gene, desde a sua formulao
inicial, como gene-partcula, vem progressivamente se transformando at o conceito atual de
seqncias complexas de DNA, compostas por
subunidades codificadoras e no-codificadoras.
Um gene ainda pode ser definido como uma
seqncia de DNA de um cromossomo responsvel por um produto funcional na clula, que
pode ser um polipeptdeo ou uma molcula de
RNA.
Nos ltimos anos, vrias descobertas modificaram a relao biunvoca, segundo a qual uma
determinada seqncia de DNA era responsvel
por uma nica seqncia de RNA e um nico
polipeptdeo. Admite-se atualmente que um gene
possa ser responsvel por vrios RNA mensageiros e diferentes polipeptdeos.
A Fig. 14.5 mostra um esquema de um gene
humano tpico.
Pode-se assim observar que um gene composto por diferentes subunidades. As subunidades codificadoras so denominadas xons e as
no-codificadoras de ntrons, cujo significado
pouco compreendido. Os ntrons encontram-se
intercalados entre os xons. Prximas extremidade 5' e flanqueando estas subunidades, encontram-se as regies promotoras, que so
seqncias responsveis pelo incio da transcri-

A ANLISE DE CARACTERES DETERMINADOS GENETICAMENTE

Cap.

Fig. 14.4 Esquema da molcula do DNA.

Incio da
transcrio

xons
(seqncias codificadoras)

DNA
5

Cdon finalizador

Promotor
Cdon iniciador
Regio 5 no
traduzida

ntrons
(seqncias intercalares)

Sinal de
poliadenilao
Regio 3 no
traduzida

Sentido da transcrio

Fig. 14.5 Esquema de um gene humano tpico.

o, ou seja, da sntese de RNA mensageiro a


partir do molde de DNA.
Basicamente, a seqncia de DNA considerada como gene, com seus xons, ntrons e regio promotora, serve de molde para a produo
de um RNA mensageiro (RNAm), em razo da
complementaridade entre as bases A-T e G-C.
A seqncia de trs bases adjacentes constitui um cdon e cada cdon corresponde a um
aminocido especfico.
A expresso de um gene ou a manifestao
de sua funo trata-se da transformao da

mensagem codificada no DNA para um RNA


mensageiro (RNAm). A molcula de RNAm a
seguir, processada (emenda ou splicing), levando exciso de ntrons. A sntese de RNAm
chama-se transcrio. A informao codificada
na molcula de RNAm , subseqentemente
transformada em seqncia de aminocidos, que
daro origem a polipeptdeos no citoplasma da
clula. Este processo de sntese de protenas denomina-se traduo da mensagem gentica.
A Fig. 14.6 mostra o esquema do fluxo de
informaes do DNA para o RNA mensageiro e
para a sntese de protenas.

195

14

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

TIPOS DE DNA NO GENOMA HUMANO


A organizao do DNA no genoma humano
bastante complexa. Basicamente o DNA composto por trs classes: DNA de cpia nica, que
a seqncia mais freqentemente observada
(60%) e da qual uma pequena frao inclui os
genes que codificam protenas; o DNA de seqncias repetitivas (30%) , disperso por todo o
genoma, de funo ainda pouco conhecida e o
DNA altamente repetitivo (10%), encontrado em
regies de maior condensao cromossmica
durante a interfase do ciclo celular, com funo
tambm pouco conhecida.
Cap.

14

MUTAES GENTICAS
Normalmente o processo de replicao ocorre de forma precisa, resultando em cpias idnticas de DNA. Algumas vezes, contudo, pode
haver erros, produzindo mutaes, que so modificaes permanentes no material gentico. As
mutaes podem ocorrer de novo, isto , quando aparecem pela primeira vez em determinado

Filamento no transcrito
DNA
Filamento transcrito
RNAm

xon ntron xon


1
1
2

5
3
5

indivduo ou podem ser herdadas dos progenitores. Estima-se que a freqncia de mutaes
novas seja da ordem de 10-6 por loco por gerao. Fundamentalmente, as diferentes mutaes
podem ser agrupadas em duas categorias: mutaes de ponto e mutaes de comprimento.
As mutaes de ponto so aquelas em que
h alterao de uma nica base de DNA, resultando na alterao de um cdon, podendo alterar a funo e a produo do polipeptdeo. As
mutaes de comprimento so aquelas que envolvem inseres ou delees no DNA, acarretando aumento ou diminuio de segmentos com
as seqncias de bases do DNA.
Tanto as mutaes de ponto como as mutaes de comprimento podem ter conseqncias crticas no produto do gene. Podem acarretar
alteraes em qualquer passo da biossntese de
protenas, afetar a regio promotora do gene e
alterar a sua transcrio, modificar o processamento do RNAm (splicing), ocasionar formas
alternativas de processamento do RNAm e portanto, diferentes polipeptdeos, alterar a produ-

xon
3

ntron
2

RNA

Transcrio

Retirada
dos ntrons

5 CAP
Processamento
do RNAm
5

3
5

Acrscimo de poli (A)

A A A A 3
Retirada
dos ntrons
A A A A 3

Cadeia polipeptdica
em crescimento
Traduo
do RNAm

A A A A 3

Ribossomos
Polipetdeo completo

Fig. 14.6 Sntese de protenas a partir de molcula do DNA.

196

Ncleo
Citoplasma

A ANLISE DE CARACTERES DETERMINADOS GENETICAMENTE

o do RNAm maduro, interferir na traduo


do RNAm em protenas e mesmo influenciar o
processamento posterior das protenas.
importante salientar que nem sempre uma
doena determinada pelo mesmo tipo de mutao. Inmeras doenas, como, por exemplo, a
hemofilia A, a talassemia beta, a distrofia muscular de Duchenne e a deficincia de 21-hidroxilases, apresentam grande heterogeneidade
gentica allica, podendo ser causadas por diferentes mutaes dentro de um mesmo gene.

misso destas seqncias pode haver reduo ou


expanso desta regio, por eventos de recombinao entre as seqncias homlogas. Estas mutaes so conhecidas como mutaes dinmicas.
A magnitude da expanso est relacionada extenso da repetio parental e muitas vezes ao
sexo do progenitor afetado. Estas expanses podem levar a padres no-mendelianos de herana e explicar o fenmeno da falta de penetrncia
e expressividade varivel de um gene.

O GENOMA DINMICO
MECANISMOS EPIGENTICOS DE
DA EXPRESSO GNICA

CONTROLE

Existem ainda mecanismos epigenticos, ou


seja, mecanismos hereditrios de controle da
expresso gnica que no podem ser explicados
por alteraes na seqncia do DNA. Muitos
mecanismos epigenticos conhecidos referemse ao estado fisiolgico do gene que est evidentemente associado ao estado da cromatina do
cromossomo. A cromatina pode apresentar-se
ativa ou inativa. No estado ativo, a cromatina
encontra-se descondensada, com fraca ligao
com as histonas H1, a citosina (C) do DNA no
est, em geral, metilada, as histonas esto acetiladas e a cromatina est mais sensvel ao da
DNA nuclease, entre outros fenmenos. No estado de cromatina inativa, esta se encontra condensada e apresenta forte ligao com a histona
H1. O chamado efeito de posio de um gene,
extensamente estudado em drosfilas, refere-se
a genes em domnios de cromatina inativa e,
portanto, tambm inativos. Alm disso, fenmenos que interferem na expresso dos genes e que
no se referem a alteraes na seqncia do
DNA, como mutaes em regies promotoras
de genes ribossmicos, podem tambm interferir na expresso gnica.
Estes fascinantes mecanismos epigenticos
de controle da expresso dos genes merecem ainda muita investigao e no iremos nos aprofundar nestes aspectos.

O GENOMA HUMANO ESTVEL?


O genoma humano contm uma elevada proporo de seqncias repetitivas de DNA. Nestas
regies o DNA no estvel e durante a trans-

O DNA dinmico em sua transmisso e


este conceito moderno recuperou trabalhos antigos da dcada de 1940 de Brbara McClintock
que observou a existncia de elementos genticos transponveis em milho. Estes conceitos foram tardiamente agregados ao corpo terico da
Gentica, aps a descoberta de doenas decorrentes de expanso de trinucleotdeos, como diversas doenas neurodegenerativas e como a
sndrome do cromossomo X frgil.
Estas mutaes dinmicas, como as expanses de trinucleotdeos de comportamento patognico, so encontradas, por exemplo, na
doena de Huntington, na ataxia espinocerebelar, na doena de Machado-Joseph, na distrofia
miotnica, entre outras. Nestas doenas, o tipo
de expanso de trinucleotdeos envolve a seqncia de bases (CAG)n e (CTG)n.
No caso da doena de Huntington, de
herana autossmica dominante, a transmisso
da mutao pela via paterna leva expanso da
seqncia de trinucleotdeos no filho afetado, o
qual apresenta um quadro clnico mais grave e
de acometimento mais precoce. Este fenmeno
denomina-se antecipao gentica. Indivduos
afetados com a doena de Huntington apresentam de 36 a 121 repeties da seqncia de CAG
enquanto que indivduos normais apresentam de
10 a 35 repeties. A deteo de uma pr-mutao, ou seja, de um nmero de expanses entre
os limites normal e patolgico, presente em indivduos fenotipicamente normais, uma condio de risco para nascimento de novo afetado
na famlia e deve ser analisada cuidadosamente
no nvel do DNA, para diagnstico, prognstico
e, especialmente, para o Aconselhamento Gentico das famlias, como pode ser verificado no
Captulo 3.

197

Cap.

14

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

A conseqncia das expanses CAG parece


estar no nvel da protena, provavelmente conferindo ganho de funo ou funo alterada. O
resduo de poliglutamina codificado pela repetio CAG foi sugerido como substrato para a
transglutaminase, como agente de ligao cruzada com protenas e como causa maior das
doenas neurodegenerativas genticas, por meio
de sua genotoxicidade.

Cap.

14

Outros tipos de mutaes dinmicas, que levam a expanses de trinucleotdeos (CGG)n e


(CCG)n so os chamados stios frgeis cromossmicos. A sndrome de cromossomo X frgil
a forma mais freqente de deficincia mental no
sexo masculino. Os indivduos afetados pela sndrome apresentam em geral de 230 a 1.000 repeties dos trinucleotdeos e os indivduos
normais, de 6 a 52 repeties. Podem existir indivduos normais com pr-mutaes, ou seja,
com nmero de repeties entre os dois limites
mencionados e, portanto, com risco de ter um
filho afetado por esta sndrome. No Captulo 2
encontram-se informaes especficas sobre a
sndrome do X frgil.
As seqncias de DNA repetitivo disperso
podem ainda comportar-se como elementos
transponveis. Em algumas doenas humanas,
foi observada a insero de um elemento transponvel no gene do fator de coagulao 8, que
ocasionou a hemofilia A. Na neurofibromatose
foi tambm observada a insero de um elemento transponvel.

HERANA POLIGNICA OU MULTIFATORIAL


(HERANA COMPLEXA)
Existem caracteres determinados por ao
cumulativa de genes que podem ainda interagir com fatores do meio ambiente. Exemplos clssicos desta forma de herana so a
estatura, a inteligncia, bem como a anencefalia e o lbio leporino. Nestas condies, os
riscos de recorrncia do carter no podem
ser calculados por mecanismos biolgicos
conhecidos e, em geral, utilizam-se os chamados riscos empricos, que so estimativas
observadas em famlias de afetados da populao. Assim, por exemplo, o risco emprico
de recorrncia de anencefalia na irmandade
de um afetado de 5,6%.

198

HERDABILIDADE DE UM CARTER

A herdabilidade de um carter uma medida do grau de participao do patrimnio gentico, em relao aos fatores ambientes, na gnese
de um carter. uma medida bastante til na
anlise de caracteres multifatoriais.
Para a anlise da herdabilidade so investigados pares de gmeos monozigticos e dizigticos quanto concordncia ou discordncia de
um fentipo ou carter. Em virtude de os gmeos monozigticos apresentarem o mesmo material gentico enquanto os gmeos dizigticos
possuem 50%, e ambos os tipos de gmeos compartilharem o mesmo meio ambiente pr-natal e
ps-natal, uma concordncia elevada entre os
gmeos monozigticos mostra uma participao
significativa do patrimnio gentico em determinado fentipo.
A herdabilidade, ou seja, a proporo de varincia fenotpica atribuda varincia genotpica pode ser expressa em porcentagem. Assim,
por exemplo, a herdabilidade do carter inteligncia de 55%, indicando que o componente
gentico responsvel por 55% deste fentipo
enquanto os fatores ambientes so responsveis
por 45% do mesmo fentipo.
Os estudos de adoo, por outro lado, destacam a participao do componente gentico
por meio de estudos de filhos de mesmos pais
biolgicos criados separadamente em ambientes diversos e tm sido tambm bastante utilizados em pesquisas de caracteres multifatoriais.

MTODOS

DE

ANLISE

DE

MUTAES

Diversas so as tcnicas que permitem analisar as mutaes patolgicas e seus efeitos. As tcnicas podem envolver a anlise do DNA (Captulo
3), a anlise do produto gnico (Captulo 4), alm
da investigao do fentipo fisiolgico ou clnico
(Captulo 1).
Nos ltimos anos, o desenvolvimento das
tcnicas de DNA recombinante e anlise direta
do DNA tiveram grande impacto para o conhecimento da estrutura e da funo dos genes humanos. Tem sido, assim, possvel uma melhor
compreenso da base molecular das mutaes e
dos mecanismos bioqumicos e fisiolgicos responsveis por vrias doenas genticas. Estes

A ANLISE DE CARACTERES DETERMINADOS GENETICAMENTE

avanos possibilitaram um grande progresso nos


mtodos diagnsticos pr e ps-natais e no
Aconselhamento Gentico de vrias enfermidades.
A tcnica de hibridao do DNA com diferentes sondas, por meio de Southern blotting
(Captulo 3), pode envolver:
a) sondas gene-especficas, derivadas do DNA
genmico;
b) sondas de DNA complementar (cDNA) do
gene, obtidas a partir de RNAm por meio
da transcriptase reversa;
c) sondas de oligonucleotdeos sintticos, obtidas a partir de uma seqncia de 20 nucleotdeos conhecidos de um gene especfico,
podendo ser complementares a um trecho
de gene normal ou do mutante.
Estas sondas so preparadas por tcnicas de
DNA recombinante, realizando-se a clonagem,
ou seja, a amplificao do fragmento de DNA
humano em plasmdeos.
A tcnica da PCR (polymerase chain reaction) descrita no Captulo 3 veio permitir a amplificao exponencial de segmentos especficos
do DNA, para a obteno de oligonucleotdeos
sintticos.
Quando a mutao no puder ser detectada
diretamente, utilizam-se os chamados estudos
de ligao do gene da doena com marcadores
genticos polimrficos do DNA, chamados polimorfismos de comprimento de fragmentos de
restrio (restriction fragment lengh polimorphims (RFPL), que se encontram caracterizados
no Captulo 3. Estes marcadores comportam-se
mendelianamente e de forma co-dominante,
como um gene ligado ao gene da doena.
Como vimos no tpico introdutrio deste captulo, genes quando fortemente ligados, so
transmitidos conjuntamente ( ver genes A e B,
na Fig. 14.1 de Meiose). Quanto mais prximo
o gene da doena for do marcador polimrfico
de DNA, mais provvel que sejam herdados conjuntamente, menor ser a taxa de recombinao
gentica ou permuta entre eles e mais precisa
ser a predio do gentipo a partir do marcador gentico. Para esta anlise empregam-se diversos marcadores polimrficos, em geral de
microssatlites, de diferentes cromossomos e o
marcador que apresentar maior ligao com o
gene da doena poder ser utilizado para seu

diagnstico. A estimativa da probabilidade mxima da ligao em relao probabilidade de


no-ligao expressa como lod score (logarithm of the odds). Por conveno, valores maiores que trs de lod scores significam forte ligao
e o polimorfismo de DNA , portanto, um timo
marcador do gene da doena.
A introduo recente de mtodos de anlise
do DNA com microchips (Captulo 3) e de uso
ainda no difundido em todos os laboratrios do
mundo, veio permitir a anlise de todos os genes
humanos conhecidos e de possveis genes ainda
no identificados, por meio de sondas de oligonucleotdeos sintticos miniaturizadas.
Cap.

PADRES NO-CLSSICOS DE HERANA:


HERANA MITOCONDRIAL E IMPRESSO
(IMPRINTING) GENMICO
Fenmenos que no podem ser explicados
exclusivamente pela gentica clssica mendeliana no so incomuns. As mutaes dinmicas,
descritas anteriormente, podem levar transmisso no-mendeliana dos caracteres.
Existem ainda outras situaes que no podem ser explicadas pelo mendelismo, como a
herana mitocondrial e o fenmeno de imprinting (impresso).
Herana Mitocondrial
Na herana mitocondrial, a peculiaridade
reside no fato de todos os indivduos serem aparentados pela linhagem materna, sendo, portanto, uma condio de herana materna.
O cromossomo mitocondrial um cromossomo circular, localizado no citoplasma da clula
e que no se encontra associado a protenas cidas ou bsicas, como o DNA dos cromossomos
nucleares. O DNA mitocondrial replica-se dentro
das mitocndrias, as quais distribuem-se aleatoriamente s clulas-filhas. Na transmisso pelas
geraes, so os ocitos que carregam significativamente as mitocndrias em seu citoplasma, enquanto os espermatcitos quase no apresentam
estas organelas. O DNA mitocondrial est praticamente todo identificado. Ele contm genes de
RNA ribossmico, de RNA transportador, de polipeptdeos que so subunidades de enzimas de
fosforilao oxidativa e genes responsveis por

199

14

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

diversas neuropatias, como a neuropatia ptica


de Leber, alm de possveis genes da doena de
Alzheimer e de Parkinson.
Impresso Genmica (imprinting)
O fenmeno de impresso (IMPRINTING)
pode ser definido como uma condio em que a
expresso diferencial dos genes depende da origem materna ou paterna destes genes.

Cap.

14

A doena de Huntington, mencionada anteriormente, uma condio que modificada por


impresso genmica sexo-especfica. Cerca de
90% dos casos originam-se de famlias com o
pai o genitor de sexo masculino afetado. Alm
disso, 10% dos casos tm acometimento mais
precoce e mais grave, caracterizando-se a situao de antecipao gentica. Os mecanismos
responsveis por este comportamento diferencial dos genes maternos e paternos no esto
bem esclarecidos e podem ser diversos, como a
metilao epigentica do DNA e a ao de genes modificadores e controladores do fenmeno
de imprinting
As sndromes de Prader-Willi e Angelman
ilustram outra condio de imprinting genmico. Estas sndromes apresentam delees na
mesma regio cromossmica do cromossomo
15q11q13. O fentipo diverso de cada uma,
porm, depende da origem do cromossomo presente no indivduo afetado. Esta situao incomum pode ser mais bem compreendida no
Captulo 2.
PROJETO GENOMA HUMANO
O Projeto Genoma Humano (PGH) um
programa internacional de investigao, que teve
incio em 1990, designado para construir mapas gentico e fsico detalhados do genoma humano, para determinar a seqncia completa de
nucleotdeos do DNA humano, visando localizar de 50.000 a 100.000 genes atravs do seqenciamento de aproximadamente trs bilhes
de pares de bases dentro do genoma humano e
permitir a anlise comparativa com os genomas
de vrios outros organismos usados amplamente em laboratrio de pesquisas como sistemas
modelos.
Os produtos cientficos do PGH compreenderam recursos de informaes detalhadas sobre

200

a estrutura, organizao e funo do DNA humano, informaes estas que constituem uma
srie bsica de caractersticas hereditrias para
o desenvolvimento e funcionamento do organismo humano. O sucesso na execuo dessas metas ambiciosas demandou o desenvolvimento de
uma variedade de novas tecnologias. Significativo avano tem sido tambm necessrio na utilizao de informaes amplamente disponveis
para cientistas, e de resultados que devero ser
rapidamente difundidos na rea da sade pblica. Deste modo, a melhoria da tecnologia da investigao biomdica um outro importante
produto do PGH. Desde o seu incio, foi claramente reconhecido que a obteno e o uso de
tais conhecimentos genticos teriam importantes implicaes para indivduos e sociedade.
Anlises das implicaes tica, legal e social do
conhecimento gentico so os principais componentes de um esforo em funo do PGH.
Nos Estados Unidos, o National Institute
of Health (NIH) e o Departament of Energy
(DOE) so responsveis pelo seqenciamento
de 60% a 70% do genoma humano; o resto do
genoma humano ser seqenciado pelo Sanger Center na Inglaterra e por outros centros
de seqenciamento no mundo.
O projeto genoma tem mostrado um considervel progresso por meio de um longo alcance da fronteira tecnolgica. Entre os mais
notveis aspectos deste projeto podemos citar:
a) novos tipos de marcadores genticos, tais
como microssatlites, que podem ser utilizados
pela reao em cadeia da polimerase (Polymerase Chain Reaction PCR); b) sistemas de vetores aperfeioados para clonagem de longos
fragmentos de DNA e melhoria nas estratgias
experimentais e mtodos de computao para a
reunio destes clones em conjunto, os quais permitem a elaborao de mapas fsicos; c) a identificao de stios de seqncias-alvo como uma
unidade comum do mapeamento fsico do genoma e, finalmente, e) melhoria na tecnologia e
automatizao do seqenciamento do DNA.
O projeto genoma humano tem ainda mostrado um profundo impacto nas pesquisas na
rea mdica, como evidenciado pelo isolamento
de um nmero expressivo de genes associados a
importantes doenas, tais como doena de Huntington, esclerose amiotrfica lateral, neurofibromatoses tipos 1 e 2, distrofia miotnica e stio

A ANLISE DE CARACTERES DETERMINADOS GENETICAMENTE

frgil do cromosomo X. Genes que conferem


uma predisposio a doenas comuns, tais como
cncer de mama, cncer de clon, hipertenso,
diabetes e doena de Alzheimer, tm tambm sido
localizados em regies especficas dos cromossomos. Todas estas descobertas se beneficiaram
das informaes, investigaes e tecnologias
desenvolvidas pelas pesquisas do PGH. Descobertas muito mais excitantes so esperadas, incluindo tecnologia para o estudo de efeitos de
agentes ambientais na sade de um indivduo, a
capacidade de decifrar os genomas de muitos
outros organismos, incluindo inmeros microrganismos importantes para a agricultura e o meio
ambiente, alm da identificao de um grande
nmero de genes envolvidos em diversas doenas. Sendo assim, a tecnologia e os dados produzidos pelo PGH resultaro num forte estmulo
para as principais reas de pesquisa biolgica e
de biotecnologia.
Desde o incio do PGH em 1990, o aumento
dos conhecimentos em tecnologia e automatizao do seqenciamento do DNA permitiram o
trmino do projeto com quatro anos de antecedncia e a previso inicial de 50.000 a 100.000
genes caiu para aproximadamente 30.000 genes.
Para tanto, o rascunho do genoma humano foi
produzido por dois grupos rivais, o Projeto Genoma Humano (consrcio pblico internacional
dos EUA e Gr-Bretanha) liderado por Francis
Collins (Nature, 409: 813-960, 2001) e a empresa americana Celera do geneticista Craig Venter (Science, 291: 1304-1351, 2001.
RESUMO DO CAPTULO
Os seguintes aspectos da anlise de caracteres genticos foram abordados neste captulo:

a metodologia clssica de anlise gentica e


a caracterizao dos tipos de herana monognica mendeliana;
a natureza do material gentico, o conceito
atual de gene, os tipos de mutaes;
o genoma dinmico e as expanses de trinucleotdeos;
os mecanismos epigenticos de controle da
expresso gnica;
a herana polignica ou multifatorial;
mtodos de anlise das mutaes;
os padres no-clssicos da herana, como
herana mitocondrial, impresso (imprinting) genmica;
o Projeto Genoma Humano: estado atual.

BIBLIOGRAFIA
1. Griffiths AJF, Miller JH, Suzuki DT, Lewontin RC,
Gelbart WM. Introduo Gentica. Traduo. Ed.
Guanabara Koogan, Rio de Janeiro, 1998.
2. Kuehl PM, Weisemann JM, Touchman JW, Green ED,
Boguski MS. An Effective Approach for Analyzing
Prefinished Genomic Sequence Data. Genome
Res. 9:189-194, 1999.
3. Paulson HL. Protein fate in neurodegenerative
proteinopathies: polyglutamine disease join the
(mis)fold. Am. J. Hum. Gen. 64(2): 339-345, 1999.
4. Sinden R. Human Genetics 99: Trinucleotide repeats.
Biological implications of the DNA structures
associated with disease-causing tiplet repeats. Am.
J. Hum. Gen. 64(2): 346-353, 1999.
5. Smith MAC, Melaragno MI, Brunoni D. Princpios de
Gentica Mdica . Ed. Lima GR e Baracat E.
Ginecologia Endcrina. Atheneu, S.Paulo, 1995.
6. Stracham T, Read AP. Human Molecular Genetics. Bios
Scientific Publishers, Wiley-Liss, Oxford, 1996.
7. Payo SLM, Smith MAC, Floeter-Winter LM, Bertolucci
PHF. Ribosomal RNA in Alzheimers disease and
ageing. Mech. Ageing Dev. 105: 265-272, 1998.
8. The Human Genome. Nature, 409: 813-960, 2001.
9. The Human Genome. Science, 291: 1304-1351, 2001.

201

Cap.

14

OS CROMOSSOMOS HUMANOS

Os Cromossomos Humanos
Maria Isabel Melaragno
Bianca Borsatto

A informao gentica contida no ncleo das


clulas constituda pelo DNA o qual, na espcie humana, encontra-se distribudo em 46 cromossomos. Esse DNA est associado a protenas
em diferentes graus de compactao conforme
a fase do ciclo celular em que a clula se encontra de forma que os cromossomos se apresentaro com diferentes morfologias. Durante a
interfase, fase do ciclo celular entre duas divises mitticas, os cromossomos se encontram
desespiralizados formando uma massa homognea denominada cromatina no sendo possvel,
portanto, distingui-los como estruturas individualizadas.
Antes de a clula iniciar o processo de diviso, ocorre a duplicao do DNA cromossmico resultando em duas duplas hlices de DNA
idnticas. medida que a clula comea a se
dividir, ocorre uma gradual condensao dos
cromossomos sendo que estes se tornam mais
visveis como estruturas distintas durante a metfase da mitose. Nessa fase, os cromossomos
esto duplicados e so visualizados sendo compostos, cada um, por duas cromtides idnticas
ligadas pelo centrmero (Fig. 15.1).
Apesar de os cromossomos terem sido descritos e assim denominados no final do sculo
XIX j tendo sido relacionados hereditariedade, foi somente em 1956 que se determinou
como sendo 46 o nmero de cromossomos na

espcie humana. Isso s foi possvel graas introduo de tcnicas de cultura de clulas e de
preparao cromossmica as quais so basicamente as mesmas ainda hoje utilizadas.

ESTUDO

DOS

CROMOSSOMOS

O estudo dos cromossomos pode ser realizado a partir de qualquer tecido com clulas
nucleadas com capacidade de diviso, tais como
os linfcitos do sangue perifrico, fibroblastos
da pele, clulas da medula ssea, das vilosidades
corinicas, do lquido amnitico ou ainda de tecidos slidos como as gnadas e tumores. A cultura de linfcitos do sangue perifrico a tcnica
mais utilizada para o estudo cromossmico devido facilidade de obteno e de cultivo do
material (Fig. 15.2).
Para a realizao do caritipo, linfcitos retirados do sangue perifrico so colocados em
meio de cultura enriquecido com soros adequados e fito-hemaglutinina a qual estimula a diviso dos linfcitos T. As clulas so cultivadas em
condies estreis a 37oC por cerca de 72 horas.
Na ltima hora de cultura adicionada colchicina, substncia que impede a formao das fibras do fuso mittico bloqueando as clulas em
metfase, fase de maior condensao cromossmica e, portanto de mais fcil visualizao. O
preparo dos cromossomos efetuado com a adi-

203
3a. prova - Schor - Paginador: Fernando

Cap.

15

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

INTERFASE
Cromossomos
descondensados
(cromatina)

METFASE

Cromossomos
como nica
cromtide
(no visualizvel)

ANFASE e TELFASE

Cromossomos
com duas
cromtides

Separao das
cromtides irms

2 clulas filhas
resultantes
da mitose

INTERFASE

Fig. 15.1 Esquema do ciclo mittico mostrando a morfologia dos cromossomos.

Cap.

15

5ml de sangue venoso

CARITIPO

Fotografia

Sangue
meio de cultura
soro fetal bovino
fito-hemaglutinina

Anlise

Incubao
72 horas a 37oC
Colorao
das lminas
Colchicina
1 hora a 37oC

Separao
dos linfcitos
por centrifugao

Tratamento
hipotnico

Fixao
das clulas

Clulas
gotejadas
em lminas

Fig. 15.2 Esquema das etapas para a realizao de uma cultura de linfcitos do sangue perifrico para obteno do
caritipo.

o de uma soluo salina hipotnica, para haver um melhor espalhamento dos cromossomos,
seguido da adio de uma soluo fixadora. O
material gotejado em lminas de microscpio.
As lminas so ento coradas e as clulas em

204

metfase, analisadas em microscpio ptico.


Existem diferentes mtodos de colorao cromossmica para a anlise dos cromossomos, sendo a colorao slida e o bandamento G os mais
utilizados na rotina de citogentica. A colorao

OS CROMOSSOMOS HUMANOS

slida, obtida atravs do uso do corante Giemsa


resulta na colorao homognea dos cromossomos permitindo a anlise de seu nmero e morfologia. A tcnica de colorao de bandamento
G resulta em faixas transversais, denominadas
bandas, caractersticas para cada cromossomo,
permitindo a identificao e classificao de cada
um dos 23 pares cromossmicos.
Na metfase, os cromossomos so constitudos por duas cromtides unidas pelo centrmero, o qual delimita longitudinalmente dois braos
cromossmicos: o menor referido como brao
curto (representado pela letra p, de petit) e o maior
como brao longo (representado pela letra q). De
acordo com a posio do centrmero, os cromossomos humanos podem ser classificados em metacntricos (braos de tamanhos semelhantes),
submetacntricos (brao curto menor do que o
longo) e acrocntricos (brao curto muito menor
do que o longo). Segundo normas internacionais
de padronizao de nomenclatura cromossmica
(ISCN, 1995), as bandas cromossmicas delimitam diferentes regies de seus braos. Dentro de
cada regio, as bandas (bandas claras e escuras)
so numeradas a partir do centrmero (Fig. 15.3).

Os cromossomos, aps anlise em microscpio ptico, so fotografados e organizados de


acordo com o tamanho, posio do centrmero e
padro de bandamento. A essa classificao e organizao dos cromossomos dado o nome de
caritipo (Fig. 15.4).
Verifica-se na espcie humana, 23 pares de
cromossomos sendo 22 pares de autossomos
(pares encontrados igualmente em ambos os
sexos) e um par de cromossomos sexuais (XX
na mulher e XY no homem). Os caritipos normais masculinos e femininos so designados
46,XY e 46,XX, respectivamente.
O estudo dos cromossomos e da diviso celular referido como citogentica. Atualmente
existem analisadores de imagem computadorizados os quais so utilizados em citogentica
para fazer a classificao dos cromossomos e a
realizao da cariotipagem automaticamente.

CITOGENTICA-MOLECULAR
A limitao da citogentica clssica decorrente da necessidade de clulas em diviso

Regio banda
6
5
3

Regio banda

3
2

1
2

2
1

Regio banda

4
3

3
2
1
1

2
1
1

3
2
1

1
2

1
2
3
4
5

1
2
3
4
5
6

2
21

1
2
3
4
1

Fig. 15.3 Padro de bandamento G de um cromossomo metacntrico (1), um submetacntrico (X) e um acrocntrico
(21). O centrmero delimita o brao curto (p) e o brao longo (q) onde so evidenciadas as diferentes regies e bandas
desses cromossomos.

205
3a. prova - Schor - Paginador: Fernando

Cap.

15

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

15

Fig. 15.4 Caritipo de um homem normal (46,XY) com bandamento G. (a) Cromossomos metafsicos como so
visualizados ao microscpio (b) Cromossomos aps terem sido fotografados, cortados e organizados aos pares.

para a obteno de cromossomos metafsicos e


tambm pelo nvel limitado de resoluo quanto
visualizao de possveis alteraes cromossmicas.
Uma banda cromossmica nas melhores
condies de bandamento contm 3.106 pares
de bases (pb), de forma que somente podero
ser detectadas, pelo exame do caritipo, delees ou alteraes cromossmicas maiores do
que as de cerca de 100 genes. Outra dificuldade
da citogentica clssica a necessidade de cromossomos metafsicos de boa qualidade, o que
muitas vezes no possvel, como por exemplo,
em alguns tipos de tumores slidos.
Em clulas interfsicas, a informao gentica que nos era dada anteriormente pelo estudo
dos cromossomos era restrita cromatina X, ou
corpsculo de Barr, descrito em 1949 em clulas femininas. Essa cromatina X representa um
dos cromossomos X da mulher que permanece
condensado e inativado durante a interfase. Em
casos de aneuploidias, qualquer nmero de cromossomos X a mais do que um, resulta em cromatina X positiva. Atualmente, com as tcnicas
de citogentica-molecular, todos os cromossomos j podem ser estudados, mesmo durante a
interfase.
Com a introduo de tcnicas moleculares,
houve nos ltimos anos um avano da citogentica. A chamada citogentica-molecular baseada na capacidade de as fitas da dupla hlice

206

de DNA se separarem (pelo rompimento das


pontes de hidrognio que unem os nucleotdeos
das duas fitas) atravs de diferentes processos
de desnaturao, e de se renaturarem. Desta
forma, possvel obter molculas hbridas atravs do emparelhamento de molculas complementares do DNA alvo com uma determinada
sonda de DNA.
Existem diferentes tipos de sonda as quais so
utilizadas de acordo com o interesse da investigao: sondas complementares s regies centromricas de todos os cromossomos, sondas de
seqncias nicas (incluindo as gnicas) e sondas de um cromossomo inteiro as quais representam um conjunto de sondas que se hibridam
com vrias regies de um cromossomo resultando em uma pintura cromossmica (Fig. 15.5).
A tcnica mais utilizada a tcnica de hibridao in situ por fluorescncia (FISH). Para a
realizao da FISH, as lminas so preparadas
a partir de clulas crescidas em suspenso, de
preparao direta ou a partir de tecidos slidos,
sendo o material fixado em lminas de microscpio. As sondas utilizadas so marcadas de forma que podero ser detectadas por fluorocromos
com microscpio de fluorescncia.
Entre as vantagens da tcnica de FISH, destacam-se a possibilidade de anlise de clulas em
interfase, eliminando a necessidade de culturas
celulares e o estudo de metfases de preparaes cromossmicas pobres ou com anormali-

OS CROMOSSOMOS HUMANOS

Fig. 15.5 Hibridao in situ por fluorescncia em: (a) uma clula interfsica hibridada com sonda centromrica do
cromossomo 18, revelando trissomia desse cromossomo; (b) cromossomos metafsicos hibridados com sonda de pintura
cromossmica do cromossomo X de uma mulher normal; (c) cromossomos metafsicos de um indivduo normal hibridados com a sonda controle RARA em 17q21 e com a sonda da regio 17p13.3, regio cuja deleo acarreta a sndrome
de Miller-Dieker (cortesia Dr. Marcial Francis Galera).

dades cromossmicas muito complexas ou pequenas, que no seriam detectadas atravs de


tcnicas clssicas de bandamento.

ALTERAES CROMOSSMICAS
A primeira doena reconhecida como tendo
etiologia cromossmica foi a sndrome de Down,
quando Lejeune e col., em 1959, relataram a
presena de um cromossomo extra em indivduos com a sndrome. Em seguida, outras sndromes decorrentes de alteraes cromossmicas
numricas foram descritas e tambm, alteraes
cromossmicas estruturais.
A Tabela 15.1 apresenta as alteraes cromossmicas mais freqentes na espcie humana.
Durante a diviso celular, os cromossomos so
distribudos eqitativamente s clulas-filhas. Uma
distribuio anormal dos cromossomos pode resultar em alteraes cromossmicas numricas. Por
outro lado, quebras durante a diviso celular podem resultar em alteraes cromossmicas estruturais.
Na maioria das vezes, o erro ocorre durante
a meiose, resultando em gametas e, portanto,
em zigotos, com desequilbrio cromossmico
acarretando anormalidades em todas as clulas,
ou seja, uma anormalidade constitucional. Em
alguns casos, o erro pode ocorrer aps a formao do zigoto, em divises mitticas, podendo
ocasionar mosaicismo, isto , a presena num

indivduo ou tecido de duas ou mais linhagens


celulares geneticamente distintas, porm, originadas de um mesmo zigoto. O mosaicismo
mais freqentemente observado em alteraes
envolvendo os cromossomos sexuais. Nestes
casos, o fentipo tende a ser mais leve dependendo do grau de mosaico.
Alteraes cromossmicas dos autossomos
ou dos cromossomos sexuais (tanto numricas como estruturais) podem ser verificadas
em sndromes malformativas, retardo mental,
hipogonadismo e em erros da determinao
sexual. Na gentica da reproduo, o estudo
citogentico est recomendado para casos inexplicados de infertilidade, abortamentos espontneos, em casos de diagnstico pr-natal e,
atualmente, em diagnstico pr-implantacional.
Alteraes cromossmicas tambm tm sido relacionadas a clulas tumorais e a sndromes de
instabilidade cromossmica.
A maioria das alteraes cromossmicas
no vivel sendo responsveis por mais de 50%
dos abortos espontneos. Estima-se que a incidncia de alteraes cromossmicas em recmnascidos seja em torno de 0,7%.
Para se descrever caritipos alterados, indica-se nmero total de cromossomos, seguido pelos cromossomos sexuais e pela anormalidade, seja
ela um cromossomo adicional ou em falta, ou um
cromossomo estruturalmente alterado. Como
exemplos de caritipos alterados temos os cari-

207
3a. prova - Schor - Paginador: Fernando

Cap.

15

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Tabela 15.1
Alteraes Cromossmicas Freqentes nos Seres Humanos

Cap.

15

Distrbio

Anormalidade
Cromossmica

Caritipos Mais Freqentes

Incidncia

Sndrome de Down

Trissomia 21

47,XX(ou XY),+21
47,XX,+21/46,XX
6,XX,der(21;14)(q10;q10),+21

1:600

Sndrome de Edwards

Trissomia 18

47,XX(ou XY),+18

1:8.000

Sndrome de Patau

Trissomia 13

47,XX(ou XY),+13

1:25.000

Sndrome de Turner

Monossomia X

45,X
45,X/46,XX
46,X,i(Xq)
45,X/46,Xi(Xq)
46,X,del(Xp)

1:5.000

Sndrome de Klinefelter

Cromossomos
sexuais XXY

47,XXY

1:800

Sndrome do triplo X

Trissomia X

47,XXX

1:700

Sndrome do duplo Y

Cromossomos
sexuais XYY

47,XYY

1:2.000

Triploidia

3n

69,XXX

raro

Tetraploidia

4n

92,XXXX

raro

Rearranjos no
equilibrados

delees,
duplicaes etc.

ex:
46,XX,del(5p)
46,XY,der(2)t(2;5)(q21;q31)

1:17.000

Rearranjos equilibrados

translocaes
robertsonianas

ex:
45,XX,der(14;21)(q10;q10)

1:1.000

translocaes
recprocas

ex:
46,XY,t(2;5)(q21;q31)

1:11.000

tipos 47,XY,+21 (trissomia do cromossomo 21),


45,X (monossomia X), 45,X/46,XX (monossomia X em mosaico), 46,XX,del(5)(p)(15) (deleo do brao curto do cromossomo 5 com ponto
de quebra na banda p15), 46,XX,t(2;7)(q13;q22)
(translocao recproca equilibrada entre os
braos longos dos cromossomos 2 e 7), 46,XY,
inv(1)(p21q31) (inverso pericntrica do cromossomo 1) e 46,Xi(Xq) (isocromossomo de brao
longo do X).

Alteraes Cromossmicas Numricas


As alteraes cromossmicas numricas podem ser classificadas em aneuploidias e poli-

208

ploidias, dependendo da quantidade de cromossomos envolvidos no desequilbrio.

Aneuploidia
A aneuploidia o tipo mais comum de distrbio cromossmico, ocorrendo em aproximadamente 4% das gestaes.
As aneuploidias constituem um tipo de alterao numrica na qual as clulas no contm
um mltiplo de 23 cromossomos, apresentando
cromossomos a mais ou a menos. Podem
ocorrer monossomias (presena de apenas um
representante de um dado cromossomo), tris-

OS CROMOSSOMOS HUMANOS

somias (presena de trs cromossomos em vez


do par normal) e, mais raramente, tetrassomias
e pentassomias.
Aneuploidias so letais para a maioria dos
cromossomos. A monossomia est praticamente restrita monossomia do cromossomo X, a
qual resulta na sndrome de Turner. As monossomias autossmicas so, em geral, incompatveis com a sobrevivncia a termo, enquanto que
trissomias de alguns cromossomos so vistas com
certa freqncia entre nativivos.
As trissomias completas de autossomos mais
freqentes so as dos cromossomos 21, 13 e 18
as quais resultam nas sndromes de Down (Fig.
15.6), Patau e Edwards, respectivamente. As trissomias envolvendo os cromossomos sexuais podem resultar nos caritipos 47,XXY, 47,XXX,
47,XYY e nas sndromes de Klinefelter, triplo X
e duplo Y, respectivamente. Os raros casos de
tetrassomia e pentassomia esto restritos aos cromossomos sexuais.
As aneuploidias envolvendo os cromossomos
sexuais, em geral, resultam em alteraes fenotpicas mais brandas do que aquelas envolvendo
os autossomos, em virtude da inativao de um
dos cromossomos X que excederem a um, no
incio da vida embrionria e da pouca quantidade de genes presentes no cromossomo Y.

Poliploidia
Qualquer clula que contenha um mltiplo
exato de 23 cromossomos designada euplide. Assim, clulas normais como os gametas
haplides (n=23) e as clulas somticas diplides (2n= 46) so euplides. Acima do nvel diplide, a euploidia denominada poliploidia.
Nos seres humanos, a poliploidia pouco freqente tendo sido relatadas triploidia (3n) e
tetraploidia (4n) em abortos e em nativivos com
sobrevida curta, estes em geral apresentando mosaicismo.
Uma das possveis causas da triploidia a
dispermia, i.e., a fertilizao de um ovcito por
dois espermatozides. A tetraploidia, menos freqente que a triploidia, pode se originar pela
fuso de dois zigotos diplides, ou pela falha
mittica no incio do desenvolvimento embrionrio, com a migrao dos cromossomos duplicados para uma nica das duas clulas-filhas.

Fig. 15.6 Caritipo 47,XX,+21 (trissomia do cromossomo 21) de um paciente com a sndrome de Down.

Alteraes Cromossmicas Estruturais


As alteraes cromossmicas estruturais so
menos freqentes do que as alteraes cromossmicas numricas, podendo envolver um ou mais
autossomos, cromossomos sexuais ou ambos.
Essas alteraes resultam de quebras nos
cromossomos e subseqente reunio das extremidades quebradas em uma configurao anormal (Fig. 15.7). As quebras cromossmicas
podem ser espontneas ou causadas por agentes clastognicos, como a radiao ionizante e
algumas substncias qumicas.
Os rearranjos cromossmicos resultantes
podem ser equilibrados ou no-equilibrados
com relao quantidade de material gentico
por clula.
Nos rearranjos equilibrados, no h perda
nem ganho de material gentico. Desta forma,
as alteraes equilibradas no acarretam, como
regra geral, efeitos no fentipo do indivduo,
apesar destes estarem sujeitos a riscos elevados
de produzir prole com desequilbrios cromossmicos. No grupo de rearranjos equilibrados, esto includas as translocaes equilibradas e as
inverses.
Os rearranjos cromossmicos no-equilibrados so aqueles que resultam em material cromossmico em falta (deleo) ou em excesso
(duplicao), resultando em monossomias ou
trissomias parciais, respectivamente. Em contras-

209
3a. prova - Schor - Paginador: Fernando

Cap.

15

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Deleo

q13

Translocao recproca equilibrada

del(X) (q12q28)
q28
Fragmento
sem
centrmero

q21
der(10)

Isocromossomo

10

q34

10
4

Xp

10

Xq
Translocao
(4;10)(q34;q21)

Xq

Xq

Cap.

15

der(4)

i (Xq)

Inverso

Translocao Robertsoniana
equilibrada

p22

180o
q25

14

14

21

21

14

t(14;21)

21

inv(1)(p22q25)

Fig. 15.7 Esquema de exemplos de alteraes cromossmicas estruturais: (a) deleo no brao curto do cromossomo
X; (b) isocromossomo do brao longo do cromossomo X; (c) inverso pericntrica do cromossomo 1; (d) translocao
recproca entre os braos longos dos cromossomos 4 e 10 e (e) translocao robertsoniana entre os cromossomos 14 e 21.

te com as alteraes numricas, cujas aneuploidias esto restritas a poucos autossomos, a variedade de alteraes estruturais enorme, pois,
as quebras cromossmicas podem ocorrer em
diferentes pontos e envolver diferentes cromossomos ou combinaes cromossmicas.

Deleo (representada pela


abreviatura del)
As delees se referem perda de parte do
cromossomo resultando em monossomia parcial
do segmento perdido. Em geral, as delees so
menos viveis do que as duplicaes correspondentes, sendo letais quando resultam em perda
de mais de 2% do genoma total haplide. Entre
as delees, mais freqentes encontram-se a deleo do brao curto do cromossomo 5 (com
diferentes pontos de quebra em 5p) resultando
na monossomia parcial 5p, originariamente de-

210

nominada sndrome, e as delees dos braos


curtos dos cromossomos 4, 11 e 18.
As delees podem ocorrer de novo, i.e., originando-se casualmente na meiose de um dos
pais ou, ser o resultado da segregao de um
rearranjo equilibrado presente em um dos pais
(e.g. translocao equilibrada). Pode ocorrer
deleo das extremidades de um cromossomo
com a posterior unio dos braos curtos e longos
havendo a formao de um cromossomo em anel
(r, de ring). Algumas delees podem ser muito
pequenas de forma que so difceis ou impossveis de serem reveladas no estudo do caritipo.
Essas delees submicroscpicas, ditas microdelees, podem ser ento mais facilmente
identificadas atravs da tcnica de FISH, como
exemplificado na Fig. 15.5. As microdelees
podem envolver genes contguos e resultar em
fentipo com caractersticas de vrias doenas
monognicas.

OS CROMOSSOMOS HUMANOS

Dentre alguns exemplos de sndromes de microdelees, podemos ressaltar as sndromes de


Prader-Willi e de Angelman, responsveis por
alteraes fenotpicas distintas. Cerca de 70%
dos casos de ambas afeces so decorrentes de
uma deleo em 15q11-q13, entretanto, dependendo da origem parental da deleo, ou seja,
se esta ocorreu no cromossomo 15 paterno ou
materno, os fentipos apresentados sero caractersticos das sndromes de Prader-Willi e de
Angelman, respectivamente.

Duplicao (dup)
As duplicaes se referem ao ganho de um
segmento cromossmico que poder resultar em
trissomias parciais. Essas podem surgir por crossing over desigual durante a meiose ou a partir
de um gameta com desequilbrio cromossmico
herdado de um progenitor com uma alterao
equilibrada.

Isocromossomo (i)
Os isocromossomos so cromossomos nos
quais um dos braos est ausente e o outro duplicado. Um indivduo com um isocromossomo
apresenta monossomia de um brao cromossmico e trissomia do outro.
Os possveis mecanismos para se formar um
isocromossomo so a diviso errnea do centrmero e quebras em Xp prximas ao centrmero com a reunio das extremidades quebradas.
Entre os isocromossomos observados em nativivos est o do brao longo do cromossomo X,
sendo que o caritipo pode ser representado
como 46,X,i(Xq).

Inverso (inv)
As inverses ocorrem quando um nico cromossomo sofre duas quebras e o segmento entre
essas reconstitudo de forma invertida. Um portador dessa alterao cromossmica equilibrada
poder produzir gametas anormais, acarretando
um maior risco de abortamento e prole com trissomias e/ou monossomias parciais. As inverses
podem ocorrer envolvendo o centrmero (inverses pericntricas) ou, apenas um dos braos
cromossmicos (inverses paracntricas).

Translocao (t)
As translocaes se referem troca de segmentos entre cromossomos no-homlogos. As
translocaes recprocas resultam da quebra
de cromossomos, com a troca recproca dos
segmentos quebrados. Em geral, apenas dois
cromossomos esto envolvidos e o nmero
total de cromossomos inalterado, sendo a
alterao cromossomicamente equilibrada. Na
maioria das vezes, as translocaes recprocas
no acarretam alteraes fenotpicas, estando
associadas a um alto risco de formao de gametas no equilibrados resultando em abortamento e/ou prognie anormal. As translocaes
robertsonianas, por outro lado, ocorrem pela
fuso dos braos longos de dois cromossomos
acrocntricos prxima regio centromrica,
com a perda dos braos curtos. O caritipo resultante, com apenas 45 cromossomos, incluindo o cromossomo com a translocao,
considerado equilibrado, uma vez que a perda dos
braos curtos de acrocntricos, os quais so constitudos por rDNA, no tem implicaes fenotpicas. Um portador de translocao robertsoniana
apresenta, no entanto, risco elevado para a prole
com desequilbrio cromossmico. Um exemplo de
translocao robertsoniana freqente a dos braos longos dos cromossomos 21 e 14 (Fig. 15.8).
Assim, uma mulher portadora do cromossomo derivado dessa translocao apresenta caritipo
45,XX,der(14;21)(q10;q10) e poder dar origem a indivduos com a sndrome de Down e
trissomia 21 por translocao com o caritipo
46,XY,der(14;21)(q10;q10),+21.
Quanto s caractersticas clnicas das sndromes, as trissomias dos autossomos afetam
mais o fentipo do que as trissomias dos cromossomos sexuais. Nas alteraes dos cromossomos autossomos, observam-se, em geral,
retardo de crescimento intra-uterino e ps-natal, comprometimento do desenvolvimento mental, padro de sinais dismrficos e malformaes.
Por outro lado, malformaes maiores e retardo
mental no so comuns nas aneuploidias dos cromossomos sexuais, sendo a caracterstica mais
marcante, o comprometimento da fertilidade.
A determinao do sexo masculino dada
pela presena do gene SRY (Sex determining region Y chromosome), presente no brao curto
do cromossomo Y, gene esse responsvel pela
formao do testculo a partir da gnada indife-

211
3a. prova - Schor - Paginador: Fernando

Cap.

15

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

cromtides, sendo essa regio susceptvel a quebras. O cromossomo X frgil observado em


culturas de linfcitos utilizando condies de
cultura com depleo de cido flico ou de timidina, sendo detectado em at 50% das metfases de homens portadores da sndrome e, menos
freqentemente, em mulheres heterozigotas para
o gene. A mutao do frgil X apresenta um comportamento instvel, podendo haver um aumento
do nmero de repeties do trinucleotdeo CGG
na regio 5 no traduzida do gene, aumento esse
verificado quando o gene transmitido pela
mulher, constituindo uma doena com padro
de herana pouco usual.

Cap.

15

Fig. 15.8 Caritipo 46,XX,der(14;21)(q10;q10),+21 de


uma paciente com sndrome de Down e trissomia 21 por
translocao.

renciada. Subseqentemente, a diferenciao


sexual masculina dos ductos genitais internos e
da genitlia externa determinada pelos hormnios produzidos pelos testculos. Desta forma,
os caritipos que apresentam o cromossomo Y
(mais especificamente, o brao curto onde se
localiza o gene SRY), resultam em indivduos
com fentipo masculino.

Sndromes de Instabilidade Cromossmica


Existem sndromes que apresentam instabilidade cromossmica, as quais demonstram uma
freqncia mais elevada de quebras e rearranjos
cromossmicos variados. Defeito nos mecanismos de reparo de DNA resultam nessa predisposio a quebras e hipersensibilidade a agentes
mutagnicos. As sndromes clssicas de instabilidade cromossmica so a anemia de Fanconi,
ataxia-telangiectasia e sndrome de Bloom as
quais apresentam herana mendeliana autossmica recessiva.

Stio Frgil do X
A sndrome do stio frgil do X recebeu esse
nome devido presena de um cromossomo X
que demonstra uma regio com uma falha no
corada prxima poro distal do brao longo
em Xq27.3, em geral envolvendo ambas as

212

Dissomia Uniparental
A dissomia uniparental, conceito relativamente novo em humanos, observada quando
um genitor contribui com duas cpias de um
cromossomo e o outro com nenhuma. Como
mencionado anteriormente, as sndromes de Prader-Willi e de Angelman, em 70% dos casos, so
causadas por microdelees do cromossomo 15,
em 15q11-q13. Os 30% restantes so decorrentes de dissomia uniparental do cromossomo 15.
Esse fenmeno pode surgir de diferentes maneiras, dentre elas, da formao de um zigoto
trissmico com perda subseqente de um dos
cromossomos 15, restando os dois de mesma
origem parental. A dissomia uniparental resulta
em efeito fenotpico por haver imprinting genmico, ou seja, a expresso diferencial dos alelos
de origem materna e paterna. Algumas partes
de alguns cromossomos (entre essas, a regio
q11-13 do cromossomo 15) esto sujeitas a esse
fenmeno do imprinting genmico sendo que a
maioria do genoma autossmico parece ser funcionalmente dissmica.

RESUMO
Os cromossomos humanos podem ser estudados atravs do caritipo, obtido a partir do
estudo de clulas metafsicas, ou atravs de tcnicas de citogentica-molecular, com o uso de
sondas de DNA especficas para certos cromossomos ou regies cromossmicas. Atravs dessas metodologias, alteraes cromossmicas
numricas e estruturais podem ser identificadas.

OS CROMOSSOMOS HUMANOS

Essas anormalidades so verificadas em maior


freqncia em casais com infertilidade (muitas
vezes devido a uma alterao estrutural equilibrada), em abortos, em sndromes malformativas, em casos de retardo mental, hipogonadismo,
entre outros.

BIBLIOGRAFIA
1. Jorde LB, Carey JC, Bamshad MJ, White RL. Gentica
Mdica. Guanabara Koogan, Rio de Janeiro, 1999.
2. Gersen SL, Keagle MB. The Principles of Clinical
Cytogenetics. Humana Press, Totowa, 1999.
3. Miller OJ, Therman E. Human Chromosomes. SpringerVerlag New York, Inc., New York, 2001.

Cap.

213
3a. prova - Schor - Paginador: Fernando

15

TERAPIA GNICA

Terapia Gnica
Sang Won Han

As idias primordiais de tratar-se uma doena hereditria por meio de interveno gnica,
provavelmente, surgiram na dcada de 1960,
quando a estrutura de DNA e o cdigo gentico
foram determinados. A correo imaginria de
genes defeituosos em uma clula como seguir
um procedimento cirrgico, onde os defeituosos so removidos precisamente e os sadios
transplantados no mesmo local. Entretanto, ao
lembrarmos que cerca de oitenta mil genes que
compem o nosso DNA cromossmico esto distribudos aleatoriamente em 5% do total de trs
bilhes de nucleotdeos, a terapia molecular imaginria torna-se difcil na prtica.
Alm disso, algumas outras questes fundamentais tiveram que ser respondidas antes de
dar-se o primeiro passo experimental de interveno gnica em um organismo ntegro, tais
como: a) Como introduzir um gene ou um pedao de DNA em uma clula sem afetar a fisiologia celular? E se afetar, quanto isso prejudicial
clula? b) A disfuno de um gene um fato
que ocorre em todas as clulas de um paciente,
e conseqentemente, devemos corrigi-lo em todas as clulas?
Enquanto a maioria dos pesquisadores dedicava-se busca de conhecimentos necessrios
para experimentao humana no futuro, alguns
j se aventuravam sem ter tido conhecimentos e
experincias suficientes, como o dr. Nirenberg
o responsvel pela decifrao do cdigo gentico temia e previa no seu artigo publicado
na revista Science em 1967.

...The genetic language now is known, and


it seems clear that most, if not all, forms of life
on this planet use the same language, with minor
variations....My guess is that cells will be programmed with synthetic messages within 25
years....The point which deserves special emphasis is that man may be able to program his own
cells with synthetic information long before he
will be able to assess adequately the long-term
consequences of such alterations, long before he
will be able to formulate goals, and long before
he can resolve the ethical and moral problems
which will be raised. When man becomes capable of instructing his own cells, he must refrain
from doing so until he has sufficient wisdom
to use this knowledge for the benefit of mankind....
Decisions concerning the application of this knowledge must ultimately be made by society, and
only an informed society can make such decisions wisely.... (Transcrio parcial do texto publicado em Science 157: 633, 1967).
No ano 1989, o primeiro protocolo clnico
de transferncia de um gene bacteriano para estudo de cncer foi realizado nos EUA, e no ano
seguinte vrios experimentos de terapia gnica
humana. Estes acontecimentos se devem aos
enormes progressos cientficos e tecnolgicos,
principalmente na rea de biologia molecular e
celular entre outras, que satisfizeram as comunidades cientficas e ticas.
Hoje, aps uma dcada, mais de 500 protocolos clnicos de terapia gnica envolvendo
mais de 3.000 pacientes esto em fase de anda-

231

Cap.

18

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

mento, de preparo e alguns j concludos no


mundo todo. O fato curioso ao analisar os protocolos clnicos que mais de 60% deles esto
dirigidos ao estudo de cncer e s doenas genticas menos de 15% (Fig. 18.1). Embora a
origem do cncer tenha ntima relao com a
gentica, devido manifestao de vrios genes
e entre os quais muitos desconhecidos, seu tratamento atravs de tecnologias de transferncia
gnica no era factvel. Tanto isso verdade, que
as doenas genticas especuladas por terapia
gnica so de origem de defeitos monognicos.
Afinal, quais foram as novas descobertas
cientficas e desenvolvimentos tecnolgicos que
permitiram experimentao humana em terapia
gnica? No somente de defeitos monognicos,

Cap.

18

rgos (Fig. 18.2). Os laboratrios de biologia


molecular, que no dispem de bisturi atmico
e nem microscpio capaz de visualizar tomos,
conseguem substituir um pedao de DNA genmico pelo outro exatamente no mesmo lugar.
Na verdade, a prpria clula, principalmente as
dos organismos inferiores, realiza esta tarefa de
troca por um mecanismo conhecido por recombinao homloga. Entretanto, o evento
de recombinao homloga raro mesmo em
condies timas (Fig. 18.3), e conseqentemente, esta estratgia ainda est distante de ser usada para terapia gnica.
Na prtica, o gene defeituoso no substitudo por um normal, e sim, um gene teraputico adicionado clula para suprir a deficincia

Cncer
Marcao gnica

Doenas infecciosas

Doenas monognicas
Outras
Fig. 18.1 Doenas estudadas e candidatas terapia gnica (Reproduzido com a permisso da Wiley Gene Medicine
Web Site: http://www.wiley.co.uk/genmed).

mas tambm doenas malignas de origens de


diversos genes desconhecidos como o cncer?
Os cromossomos de uma clula humana so
compostos por 3 x 109 nucleotdeos carregando
informaes necessrias para expressar cerca de
35.000 genes (o nmero de genes foi estimado
aps trmino do projeto de genoma humano). As
mutaes gnicas, que resultam em doenas genticas e inclusive os cnceres levam alterao de
qualidade e/ou quantidade de protenas das clulas e dependendo do grau de modificao, os indivduos sofrem em nveis diferentes.
Se um cirurgio tivesse uma ultraviso com
um bisturi capaz de localizar e cortar molculas
especficas, certamente pensaria em remover um
gene defeituoso e transplantar um gene normal,
como acontece numa cirurgia de transplante de

232

DNA
mutante

Fig. 18.2 Transplante de gene por um cirurgio?

TERAPIA GNICA

Gene normal

Vetor
Adio

Substituio

Gene mutante

DNA cromossomal

Eliminado

Fig. 18.3 Mecanismo de substituio e adio de um gene.

de uma funo celular causada pela falha de um


ou mais genes. Este tipo de prtica se torna possvel, uma vez que apenas uma pequena porcentagem do nosso DNA cromossomial tem funes
estabelecidas, e conseqentemente, a introduo de um novo pedao de DNA teria pouca
probabilidade de provocar alguma alterao danificadora. Para elevar mais o nvel de seguran-

a, a transferncia de genes ex vivo as clulas


obtidas do paciente por bipsia so modificadas
geneticamente no laboratrio e depois retornadas ao paciente mais usada e recomendada
pela comunidade cientfica (Fig. 18.4). Hoje, a
transferncia gnica in vivo tambm possvel
com alta eficincia e alta segurana, graas ao
desenvolvimento de novos vetores (Tabela 18.1).

Tabela 18.1
Mtodos Utilizados para Transferncia de Genes nas Clulas de Mamferos
e Provveis Aplicaes em Terapia Gnica
Mtodo

Aplicao em Terapia Gnica


Ex vivo

In vivo

Expresso Transiente(T),
ou Estvel (E)

Viral
Retrovrus
Adenovrus
Adenoassociado vrus (AAV)

+/-

T
E

Herpes vrus

+/-

Vaccinia vrus

+/-

Poliovrus

+/-

No-viral
Conjugados de DNA-ligante

Conjugados de DNA-ligante-Adenovrus

+/-

+/-

Via lipossomo
Injeo direta de DNA
Precipitao comCaPO4

(+), Principal aplicao ; (+/-), Algumas aplicaes; (-), Poucas aplicaes.

233

Cap.

18

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Por exemplo, os vetores engenheirados com o


genoma do adenovrus so capazes de infectar a
maioria das clulas humanas sem serem integrados ao DNA genmico, i.e., os DNAs recombinantes adenovirais permanecem no ncleo
celular como um plasmdeo bacteriano (os vetores e suas propriedades sero discutidos mais
tarde).

Cap.

18

A definio de terapia gnica, baseando-se


nas novas estratgias de transferncia gnica, ficou mais ampla, onde o(s) gene(s) ou
segmento(s) de cidos nuclicos (DNA ou RNA)
so introduzidos nas clulas do paciente no somente para suprir a disfuno gnica, mas tambm para atribuir uma nova funo. Baseada
neste novo conceito, a terapia gnica tornou-se
mais poderosa, porque, em princpio, a maioria
das doenas genticas e no-genticas podem ser tratadas por esta tecnologia. Desta forma, o fator determinante para direcionamento
de pesquisas em terapia gnica tornou-se o in-

teresse socioeconmico, e o cncer devido a sua


alta incidncia, tornou-se um alvo preferido compreendendo mais de 50% de toda pesquisa clnica de terapia gnica.
A evoluo biotecnolgica, principalmente a
engenharia gentica, foi o elemento fundamental na realizao prtica de terapia gnica no incio. Ainda hoje, o investimento cientfico e
tecnolgico continua para engenheirar os vetores virais e no-virais cada vez mais seguros, de
fcil produo em grande escala e eficientes na
transfeco/transduo1 , seja in vivo ou ex vivo
(Tabela 18.1).
O vetor um veculo que carrega genes exgenos e tem capacidade de automultiplicar-se.
Para diferenciar uma clula modificada geneticamente por um vetor de uma outra no modificada, os genes marcadores como ampR (gene que
confere resistncia ao antibitico ampicilina),
neoR (gene que confere resistncia ao antibiti-

In vivo

Ex vivo
Bipsia
Implante
Vetor de
retrovrus
Clulas modificadas
geneticamente

Cultura de clulas

Fig. 18.4 Transferncia gnica in vivo e ex vivo.

234

TERAPIA GNICA

Os genes para serem expressos nas clulas


humanas precisam estar acompanhados de outros componentes e estar ordenados na seguinte forma na planta do vetor: Promotor Gene
teraputico Poli-A.

Alm disso, como a manipulao gnica e o


cultivo dos microorganismos so mais fceis e
baratos, partes de informaes genticas contidas nos seus DNAs so aproveitadas nas construes de vetores dirigidos para clulas de
mamferos. Por exemplo, o DNA circular bacteriano o plasmdeo que tem capacidade de
auto-replicar toda sua seqncia de DNA e as
funes de cada segmento foram bem determinadas. Para engenharia da maioria dos vetores
de expresso de genes humanos, duas regies
de DNA bacteriano so utilizadas (aproximadamente 2 kpb), ori (origem de replicao bacteriana) e o gene que leva resistncia de antibiticos
como ampR, formando um vetor hbrido, que
pode funcionar tanto na bactria como no ser
humano (Fig. 18.5).

Onde a regio promotora reconhecida pela


RNA polimerase II promovendo a transcrio e
a regio Poli-A entendida como um sinal de
trmino de transcrio. Os vetores modernos
podem ter outros pedaos de DNAs, como seqncias de ntrons para dar maior estabilidade
de mRNA e, conseqentemente, ele permanece
ativo por mais tempo nas clulas produzindo
mais protenas recombinantes.

T7

Apa I*

Sp6

BGH pA

Ndel
Nrul

BstX I
Not I
Xho I
Xba I*

T7

A montagem de um protocolo clnico de terapia gnica requer definio de gene(s) vetor clula alvo, baseada em estudos prvios e
suficientes nos animais de experimentao com
a aprovao de todos protocolos pela comisso
tica e cientfica local. Para entender melhor,
alguns estudos clnicos j realizados por terapia
gnica sero descritos e discutidos.

BamH I
Bstx I
EcoR I
EcoR V

Hind III
Kpn I

co geneticina) e lacZ (gene codificadora da enzima beta-galactosidase, que na presena do


substrato sinttico conhecido por X-gal as clulas ficam azuladas) so introduzidos na construo de vetores.

f1 o
ri

V
CM

BgIII

40
SV
Neo
myc
in

5.4 kb

Ttth111I

SV

illin
Ampic

Pvul

pcDNA3

Smal

40

Cole 1
Bsml
Fig. 18.5 Estrutura de um vetor de expresso eucaritica. (Reproduzido com a permisso do Invitrogen Corp); P CMV:
promotor do citomegalovrus; BGH pA: sinal de poliadenilao do gene do hormnio de crescimento bovino; SV40: promotor ou sinal de poliadenilao do vrus simiano 40; Neomycin: gene de resistncia ao antibitico neomicina; Ampicillin:
gene de resistncia ao antibitico ampicilina; ColE1: origem de replicao bacteriana.

235

Cap.

18

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

IMUNODEFICINCIA SEVERA COMBINADA


(IDSC)
A enzima adenosina deaminase (ADA) uma
das envolvidas no metabolismo de purina e na
sua ausncia ocorre acmulo de vrios substratos e entre eles, a deoxiadenosina, que txica
principalmente para os linfcitos T, e menos severamente para os B (Fig. 18.6).
Como conseqncia de mau funcionamento da ADA, os indivduos adquirem a sndrome
de Imunodeficincia Severa Combinada, que em
geral, fatal nos primeiros dois anos de idade.
As crianas sofrem de infeces severas e freqentes, que so causas principais de morte nestes pacientes. Uma minoria de pacientes sofre
uma forma menos severa desta doena, resultando em ataques tardios de doenas relacionadas imunodeficincia.
Cap.

18

ga a atingir quase 100 % ultimamente. No caso


de doador no HLA-compatvel, o sucesso do
transplante fica em torno de 50%.
Como alternativa de tratamento, a injeo semanal da enzima ADA bovina misturada com o
PEG (polietileno glicol) foi utilizada por muitos
pacientes. Houve recuperao do sistema imune
em pelo menos 35 crianas durante seis anos de
tratamento.
Desde que o gene ADA foi clonado e caracterizado, a IDSC-ADA foi indicada para ser testada por terapia gnica por vrias razes:
O tamanho de cDNA do gene ADA aproximadamente 1,1 Kb que ideal para vetor
retroviral.
A doena IDSC-ADA causada pelo defeito
de um nico gene, ADA, que facilita na avaliao ps-transferncia gnica.

Dentre vrias formas de tratamento da


IDSC, o transplante de medula ssea alognica
a melhor opo, onde o ndice de sucesso do
transplante com doador de HLA compatvel che-

cidos nuclicos
Energia celular
cAMP

IDSC-ADA uma doena fatal, e embora o


transplante de medula ssea alognica possa curar a doena, isto s aplicvel em 2530 % dos pacientes. Os pacientes sem doador

ATP

ADP

AMP

Purina via
de salvao

NH2

OH

ADA

Neurotransmisso

IMP
PNP

HPRT
Hipoxantina

N
HOCH2
O

NH3

N
HOCH2
O

Xantina

Xantina
Oxidase

cido rico
OH OH
(H)
(deoxi) adenosina

OH OH
(H)
(deoxi) inosina

Fig. 18.6 Via metablica de (deoxi) adenosina. ADA: adenosina deaminase.

236

Urina

TERAPIA GNICA

CORREO DA IDSC-ADA TRANSFERINDO O


GENE ADA NOS LINFCITOS T DEFICIENTES

de HLA idntico esto sujeitos alta taxa de


mortalidade e morbidade.
Baseando-se nos resultados de transplante
de medula ssea alognica, de se esperar
que as clulas corrigidas geneticamente e infundidas nos pacientes tero uma vantagem
no crescimento seletivo sobre s doentes no
modificadas.

Para obter aprovao na realizao de ensaio clnico de terapia gnica para IDSC-ADA,
foi necessria demonstrao experimental in vitro e com animais de experimentao: i) A expresso do gene ADA humano nas clulas T
humanas imortalizadas foi alta e segura com os
vetores retrovirais de nova gerao. ii) Steven
Rosenberg e colaboradores observaram que os linfcitos TIL marcados com o gene bacteriano neoR
infundidos nos pacientes com tumores slidos infiltraram nos tumores e expressaram neoR estavelmente sem efeitos colaterais.

A expresso do gene ADA no requer uma


regulao precisa.
Como a doena IDSC-ADA causada pela
disfuno dos linfcitos T, que so derivados de
clulas primordiais hematopoticas, as estratgias de terapia gnica para deficincia de ADA
foram elaboradas para introduzir o gene ADA
nos linfcitos T ou s clulas primordiais hematopoticas.

Em setembro de 1990, duas crianas que


sofriam de SCID-ADA, previamente tratadas
com PEG-ADA sem sucesso, foram escolhidas
Cap.

Clula
empacotadora
Sntese de
protenas
virais
gag pol env

NEO
RNA transcrito

DNA

LTR

Genmico

SV 40
hADA
NEO
psi +

SV 40
hADA
NEO
psi + pLASN

LTR

RNA transcrito

LTR
gag pol env
psi

LTR

Transfeco
CaPO4

NEO
Transcrio
reversa

Clula-alvo

Retrovrus
empacotados

Infeco
3

NEO
Provrus
integrado

Fig. 18.7 Esquema de produo do vetor retroviral. O plasmdeo pLASN carregando o gene hADA transfectado na
clula empacotadora de vrus (passo 1). O retrovrus recombinante gerado (passo 2) utilizado para infectar clulas-alvo
(passo 3), as quais so implantadas no homem posteriormente.

237

18

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

para ensaio de terapia gnica. Inicialmente, sangue dos pacientes foi coletado e os linfcitos isolados para serem alterados geneticamente.
Paralelamente, os retrovrus recombinantes, expressando o gene ADA humano foram gerados,
e posteriormente, foram adicionados cultura
dos linfcitos para infeco (Fig. 18.7). Os linfcitos alterados com o gene ADA foram introduzidos nas crianas por infuso (Fig. 18.8), e
demais clulas foram estocadas no nitrognio
lquido para conservao longa e infuses posteriores. Mesmo aps a terapia gnica, ambas
as crianas continuaram a receber o PEG-ADA.

Cap.

18

Foi reportado atravs de jornais cientficos e


de imprensas que as duas crianas conseguiram
recuperar sistema imune totalmente deficitrio
para um nvel aceitvel com condies boas de
sade clinicamente. Os genes introduzidos puderam ser detectados dos linfcitos circulantes
de ambos pacientes mesmo aps vrios anos de
tratamento.

CORREO DA IDSC-ADA TRANSFERINDO O


GENE ADA NAS CLULA PRIMORDIAIS
HEMATOPOTICAS
Alterao gentica dos linfcitos T com ADA
para correo de IDSC ainda no uma solu-

o definitiva. A durao dos linfcitos T no organismo do homem relativamente curta em


relao s clulas primordiais, e as clulas modificadas introduzidas no paciente no vo substituir os linfcitos circulantes e nem completar
todo seu repertrio. Portanto, a busca por uma
terapia gnica definitiva, ou pelo menos de maior
durao de soluo, foi necessria.
As clulas hematopoticas so as que correspondem s necessidades para uma terapia de
longa durao, alm de sua obteno e purificao os estudos biolgicos esto suficientemente
avanados para seu uso em terapia gnica e celular. Embora os vetores retrovirais (aqueles derivados de oncovrus) infectam as clulas
somente na fase de diviso, os fatores de crescimento hematopoticos so usualmente utilizados para auxiliarem na infeco das clula
primordiais in vitro. Em meados da dcada de
1980, vrios grupos de pesquisadores conseguiram transferir genes exgenos para clulas primordiais hematopoticas, entretanto, a sua
expresso in vivo no foi persistente. Uma das
modificaes importantes posteriores para melhorar expresso de genes exgenos foi a reengenharia de vetores retrovirais para carregar
somente um nico gene e no incluir nem genes
de marcador gentico. Dessa forma, o gene ADA
humano pode ser expresso por longo prazo nas

Leucoferese
PEG-ADA

OKT3 + IL 2
Vetor retroviral
LASN

Infuso

Fig. 18.8 Esquema geral de ensaio clnico de terapia gnica para IDSC-ADA.

238

TERAPIA GNICA

No foi detectado vrus de replicao-competente.

clula primordiais hematopoticas dos camundongos, gerando linfcitos T expressadores de


ADA.
Os genes exgenos podem ser introduzidos
nas clulas primordiais eficientemente com a
exposio mltipla de vrus ou fazendo um cocultivo com as clulas produtoras de vrus irradiadas letalmente. Em ambos os casos, o nvel
de transduo viral pode chegar a 40%.
Vrios centros de pesquisa em terapia gnica realizaram transferncia do gene ADA ex vivo
para clula primordiais envolvendo mais de 10
crianas no mundo todo. Os resultados so bastante satisfatrios conforme os descritos a seguir:
No foram observados efeitos colaterais devido ao processo de transferncia gnica.

Todos os protocolos de terapia gnica foram acompanhados de tratamento com


PEG-ADA.
Todas as crianas tratadas esto em boas
condies de sade.
Segundo Caludio Bordignon da Itlia, aps
dois anos duas crianas submetidas ao tratamento de terapia gnica em seu laboratrio
apresentaram normalizao do repertrio do
sistema imune com imunidades humoral e celular restauradas. Mesmo aps a descontinuao do tratamento, os linfcitos T circulantes
foram substitudos progressivamente pelos vindos das clulas primordiais modificadas geneticamente.

Cap.

cAMP

PKA

(1)
ATP
TM

NBF 1

Extracelular
Membrana
Intracelular
NBF 2

ADP

FOSFATASE
(2)

NBF 1

NBF 2

P
PP P

(6)
2 ATP
(3)
(5)

2 ADP
Cl

(4)

+ Pi
(5)

P
P PP

P
PP P

Fig. 18.9 Hiptese de controle duplo da CFTR pelo PKA e ATP. O cAMP estimula PKA (protena quinase A) a fosforilar
resduos serina do domnio R (passo 1). O canal CFTR liga-se ao ATP (passo 3) e hidrolisado, induzindo mudana
conformacional (passo 5) que permite a abertura do canal.

239

18

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

FIBROSE CSTICA
A fibrose cstica a doena mais investigada
atravs de terapia gnica na categoria de doenas
hereditrias monognicas. Esta a doena recessiva autossmica mais comum e potencialmente
letal. Sua incidncia alta entre os caucasianos,
ocorrendo um caso entre 2.500 recm-nascidos
no norte da Europa, o que leva a uma deduo de
ocorrncia de heterozigotos de 1 em cada 25 indivduos. Os europeus meridionais, judeus Ashkenazi e negros americanos tambm so afetados
em um nmero significativo.

Cap.

18

Uma descrio compreensiva da fibrose cstica foi introduzida no comeo deste sculo e o
nome da doena foi dado baseando-se na destruio de funo excrina pancretica como
uma conseqncia da doena. Entre outros rgos, o trato respiratrio o principal local afetado, ocorrendo obstruo devido aos mucos
denso e pegajoso com infeco subseqente, especialmente por pseudomonas. A maioria dos
pacientes de fibrose cstica tambm afetada no
trato gastrointestinal, onde cerca de 85% tem
insuficincia pancretica como uma conseqncia de obstruo do ducto pancretico e prejuzo da funo excrina. Para homens adultos
afetados pela fibrose cstica, a infertilidade
universal que tambm bastante comum entre
as mulheres.
O gene responsvel pela fibrose cstica foi
clonado no ano 1989 por uma tcnica chamada
clonagem posicional, depois de uma longa batalha cientfica. Inicialmente, o gene de fibrose cstica foi rastreado e mapeado entre os indivduos
afetados pela anlise de ligao. Refinando-se a
regio do DNA cromossmico que contm o
gene da fibrose cstica pelas anlises genticas,
o gene CFTR (cystic fibrosis transmembrane
conductance regulator) foi isolado e caracterizado. O gene composto de 250 kpb e o transcrito tem cerca de 6,5 kpb codificando uma
protena de 1480 aminocidos. Esta protena
expressa nas superfcies da membrana apical de
clulas epiteliais de pncreas, intestino, glndula salivar, glndula sudorpara e trato reprodutivo. No pulmo humano, o CFTR expresso no
epitlio respiratrio em nvel baixo e consideravelmente alto nas glndulas submucosas. Atravs de um consrcio mundial de anlise gentica
de fibrose cstica, mais de 170 diferentes mutaes foram identificadas at o momento, sendo

240

que a mutao DF508 est presente em mais de


70% dos pacientes.
A protena CFTR possui dois domnios
transmembranares, dois stios que ligam ao nucleotdeo e um domnio regulatrio com vrios
aminocidos carregados com carga positiva.
responsvel pelo transporte do on cloreto e o
processo ativado pela protena quinase A
(PKA) dependente de cAMP (AMP cclico)
(Fig. 18.9).
O tratamento clnico pode variar desde um procedimento simples como tapagem no peito at o
complexo transplante de pulmo. Em conseqncia disso, o tempo de vida dos pacientes tem aumentado significativamente.
Terapia gnica para fibrose cstica surgiu
como uma terapia alternativa visando alcanar
um tratamento de longa durao ou definitivo.
Como mais de 95 % de mortalidade e morbidade da fibrose cstica ocorre devido s complicaes pulmonares, o alvo principal de clulas para
transferncia do gene CFTR para correo o
epitlio pulmonar.
Hoje existem cerca de 14 laboratrios envolvidos no ensaio clnico de terapia gnica para
fibrose cstica no mundo todo. Os procedimentos so fundamentados na construo de um
vetor capaz de transferir o gene CFTR in vivo e
administrar diretamente no epitlio respiratrio
sob forma de spray (Fig. 18.10). A transferncia
gnica ex vivo no uma boa opo para prote-

DNA

spray
de vetores
Pulmo

Ad

AAV

Vetor
Fig. 18.10 Transferncia do gene CFTR para o epitlio
pulmonar para correo de fibrose cstica. Os vetores de
adenovrus, vrus adenoassociado e lipossomo carregando
o sistema de expresso do gene CFTR so introduzidos sob
forma de aerossol via trato respiratrio.

TERAPIA GNICA

O genoma do adenovrus formado pela fita


dupla de DNA com o tamanho aproximado de
36kpb. Funcionalmente, o genoma viral dividido em duas partes: genes expressos nas fases
precoce e tardia da infeco. H 6 distintas regies na fase precoce de infeco, a maioria com
seus prprios promotores: E1A, E1B, E2A, E2B,
E3 e E4. A regio tardia consiste em 5 unidades
codificantes (L1-L5), mas apenas um nico promotor controla suas expresses: MLP (major late
promotor). Apesar de existirem mais de 50 diferentes sorotipos de adenovrus, os sorotipos 5 e
2 (Ad5 e Ad2) so mais usados para construo
de vetores para terapia gnica.

nas membranares, principalmente de difcil acesso para transplante de clulas alteradas geneticamente. Alm disso, a maior parte das clulas
epiteliais no replicante in vivo no permitindo
infeco pelo retrovrus. Desta forma, os vetores derivados de adenovrus (Fig. 18.11), vrus
adenoassociado (Fig. 18.12) e lipossomos (Fig.
18.13) so mais indicados e usados nos ensaios
clnicos no momento.
At o final do ano 1999, as concluses dos
estudos de fibrose cstica por terapia gnica envolvendo dezenas de pacientes do mundo todo
so as seguintes:
Est evidente que com a tecnologia de hoje
no se consegue uma expresso sustentvel
do gene CFTR por um tempo suficiente para
tratamento de fibrose cstica.

Uma das principais vantagens do uso de vetor adenoviral a facilidade de produo viral
em grande quantidade no laboratrio e a alta
capacidade de infeco in vivo. Entretanto, os
vetores adenovirais utilizados para terapia gnica de fibrose cstica geram resposta imunolgica
do hospedeiro devido expresso de alguns genes virais. Uma vez que a maior parte dos vetores adenovirais no so integrados ao genoma
da clula hospedeira e so mantidos na forma
extracromossmica, h necessidade de novas
aplicaes de vetores adenovirais. As aplicaes
subseqentes de adenovrus recombinantes no

Os primeiros passos importantes de terapia


gnica para a doena foram estabelecidos,
onde os mtodos so factveis com segurana e dosagens conhecidas.
Ensaios clnicos da fase I alcanaram seus
objetivos, e para o prximo passo, os estudos esto sendo direcionados para aprimorar o tempo de expresso do CFTR e eficcia
fisiolgica.

Regio precoce

E 1B
E 1A

E3

E 2B

E 2A

E4

Genoma do adenovrus

L1,

L2,

L3,

L4,

L5

Regio tardia
prom

CFTR pA

Vetor de
expresso
de hADA

Co-transfeco
com CaPO4
Clula
A293

Adenovrus
recombinante
infeccioso
usado para
terapia gnica
Fig. 18.11 Produo de vetor adenoviral. A clula A293 que j expressa o gene E1A co-transfectada com o vetor de
expresso do gene CFTR e o genoma de adenovrus sem o oncogene E1A. Por mecanismo de recombinao homloga, os
adenovrus recombinantes so gerados na clula A293 e podem ser purificados para serem utilizados em terapia gnica.

241

Cap.

18

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Ad

cap

rep

pAAV/Ad
helper
Plasmdeo
Co-transfeco

Gene
teraputico

Lise celular aps 48-72 horas por


congelamento/descongelamento

prAAV
Plasmdeo
Ad
rAAV

Cap.

18

Ad
rAAV

Transduo aps a
dilise

In vivo ou ex vivo
Ultracentrifugao
gradiente de CsCl

Fig. 18.12 Produo de vetor adenoassociado (AAV) para terapia gnica. Para gerar vrus adenoassociado necessrio co-transfeco de um vetor de expresso de um gene teraputico (ex. CFTR), um vetor de expresso de genes do AAV e
adenovrus. Por mecanismo de recombinao homloga e complementao do adenovrus, os AAV recombinantes so
obtidos, purificados por ultracentrifugao e dialisados para serem aplicados nos homens.

Lipossomo catinico

Lipossomo aninico

Fig. 18.13 Preparao de lipossomos para terapia gnica. Os lipossomos so facilmente obtidos dissolvendo-se os
fosfolipdeos desejados num solvente orgnico (ex. clorofrmio). Os solventes so removidos e os lipossomos so misturados com o DNA num tampo, e pode ser utilizado para transfeco in vitro ou in vivo. A forma de associao do DNA ao
lipossomo pode variar de acordo com a carga do fosfolipdeo utilizado.

242

TERAPIA GNICA

trazem mais efeito teraputico, porque o sistema imune do paciente j criou seus anticorpos
contra protenas virais. As pesquisas esto sendo direcionadas para melhorar a engenharia de
vetores adenovirais visando obter vetores que no
estimulam resposta imune.
O vrus adenoassociado bastante simples
estruturalmente. O genoma constitudo de fita
simples de DNA com a extenso de 5kb e existem apenas duas regies codificantes: rep e cap.
A regio rep codifica polipeptdeos que participam na replicao e a cap protenas capsdicas.
O AAV apresenta uma caracterstica no comum
entre outros vrus que introduzir seu contedo
genmico no brao curto do cromossomo humano 19 entre q13.3 e qter em algumas condies especficas. Alm disso, a necessidade de
outros vrus helper para sua propagao (ex.:
adenovrus) faz com que os vetores AAV sejam
bastante seguros para sua aplicao em terapia
gnica. Uma das desvantagens de seu uso na prtica a dificuldade de produo de AAV recombinante em grande escala e sua capacidade
limitada em abrigar genes grandes.
Os lipossomos consistem de uma suspenso aquosa de fosfolipdeos que podem ter cargas positivas ou negativas conforme a carga do
fosfolipdeo utilizado. Para estudos de fibrose
cstica, os lipossomos catinicos que ligam no
DNA e na superfcie celular tm sido preferidos
(Fig. 18.13). Devido facilidade de produo
em grande escala e em grande variedade de
lipossomos, a sua utilizao na terapia ou simples transferncia gnica tem aumentado recentemente. Embora a eficincia de transfeco in
vivo seja baixa, devido ao baixo nvel de toxicidade e efeito colateral, os lipossomos podem ser
aplicados repetidamente, e seu uso nos ensaios
clnicos est aumentando rapidamente.
Os lipossomos podem entrar na clula por fuso ou endocitose, a maior parte sendo degrado
pelas enzimas lisossomais e o restante chega at o
ncleo onde expresso. Em geral, as clulas transformadas pelo lipossomo no so permanentes e
necessitam de uma presso seletiva para manter o
nvel de expresso de genes exgenos in vitro.
A via de administrao pode ser intravenosa, aerosol ou diretamente no rgo ou tecido.
Para fibrose cstica, transfeco de clulas epiteliais pulmonares na forma de aerosol tem sido
a principal via de administrao.

PERSPECTIVAS
Transferncia de um gene para um paciente
com objetivo teraputico iniciou-se com uma viso restrita s doenas genticas. Entretanto, ao
enxergar e provar que o gene usado para terapia
pode ser qualquer um, inclusive de outros microorganismos ou de um simples pedao de material gentico sintetizado no laboratrio, o
espectro de doenas-alvo tratveis por terapia gnica ficou infinito. O fator determinante na escolha de uma(s) doena(s) para ser
pesquisada(s) atravs de terapia gnica depende muito mais da influncia socioeconmica do
que cientfica. Sendo assim, as doenas genticas, onde a maioria tem incidncias raras, deixaram de ser prioridades e as doenas mais
comuns como cnceres, AIDS e de cardiovasculares se tornaram maior foco de estudo para
terapia gnica.
Durante os ltimos dez anos, milhares de
pacientes foram submetidos aos ensaios clnicos
de terapia ou simples transferncia gnica. Informaes cientficas e tecnolgicas obtidas so
indiscutivelmente valiosas para a prxima fase
de pesquisas em terapia gnica, apesar de pouco sucesso na cura dos pacientes.
Entre outros fatores que podem influenciar
no sucesso de terapia gnica, uma boa engenharia de vetores um passo essencial para tal objetivo. Ainda no existe um vetor que pode infectar/
transfectar a maioria das clulas in vivo e in vitro
para adaptar os protocolos de terapia gnica
conforme as manifestaes de doenas. A especificidade do vetor e a clula-alvo para entrega
de material gentico e a facilidade de produo
em grande quantidade so outros requisitos a
serem cumpridos.
Alm destes fatores importantes na construo de um vetor ideal, a formulao de um sistema de expresso gnica regulvel pelo prprio
vetor um acontecimento imprescindvel para tratar doenas que requerem controle fino na administrao de produtos gnicos. Instalao de um
mecanismo no vetor para sua remoo do organismo quando no for mais preciso, tambm est
nos planos de estudos atravs da engenharia gentica. Acredita-se que os avanos cientficos e
tecnolgicos satisfaro estas exigncias e necessidades num futuro prximo.

243

Cap.

18

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

RESUMO
A terapia gnica que foi criada com o objetivo de corrigir as doenas genticas, hoje, devido sua versatilidade tecnolgica, a maioria
das doenas adquiridas e genticas se tornaram alvos potenciais de estudo. O princpio baseia-se em transferir gene(s) ou segmento(s)
de cidos nuclicos (DNA ou RNA) nas clulas dos pacientes atravs de vetores, in vivo ou
ex vivo, para suprir uma disfuno gnica ou
atribuir uma nova funo.
Desde 1989, quando foi realizado o primeiro experimento humano de terapia gnica, quase 400 ensaios clnicos envolvendo mais de 3.000
pacientes foram experimentados at hoje. O cncer a principal doena estudada, e casos de
AIDS e doenas vasculares esto aumentando.

Cap.

18

Um dos fatores mais determinantes para


sucesso de terapia gnica, ainda a construo de um bom vetor, ou seja, aquele capaz de
carregar tamanhos variveis de genes, transfectando quaisquer clulas com especificidade
controlvel, seja in vivo ou in vitro. Alm disso,
necessrio que o vetor possua um mecanismo
de regulao de expresso do gene teraputico

244

para que a quantidade do produto gnico e o


tempo de expresso sejam modulados. Acredita-se que melhorias concretas estejam por vir em
futuro prximo.

BIBLIOGRAFIA
1. Anderson WF. Human gene therapy. Nature 392(6679
Suppl):25-30, 1998.
2. Blaese RM, Culver KW, Miller AD, Carter CS, Fleisher
T, Clerici M, Shearer G, 3. Chang L, Chiang Y,
Tolstoshev P et al. T lymphocyte-directed gene
therapy for ADA- SCID: initial trial results after 4
years. Science 270(5235):475-80, 1995.
4. Bordignon C, Notarangelo LD, Nobili N, Ferrari G,
Casorati G, Panina P, Mazzolari E,Maggioni D, Rossi
C, Servida P et al. Gene therapy in peripheral blood
lymphocytes and bone marrow for ADAimmunodeficient patients. Science 270(5235):4705, 1995.
5. Collins FS. Cystic fibrosis: molecular biology and
therapeutic implications. Science 256:774-9, 1992.
6. Friedmann T, Felgner PL, Blaese RM, Ho DY, Sapolsky
RM, Mirsky S, Rennie J. Making gene therapy work.
Sci Am Jun: 96-123, 1997.
7. Miller AD. Human gene therapy comes of age. Nature
357:455-460, 1992.
8. Morgan RA, Anderson WF. Human gene therapy. Annu
Rev Biochem 62:191-217, 1993.
9. Nirenberg MW. Will society be prepared? Science
157:633, 1967.

GENTICA DO CNCER

Gentica do Cncer
Slvia Regina Caminada de Toledo

INTRODUO
O cncer no representa uma doena nica,
mas um grupo heterogneo de doenas que tem
na sua origem o mesmo processo desordenado
de diviso celular. H vinte anos atrs era impossvel imaginar como tipos to diferentes de
cncer poderiam apresentar mecanismos patognicos comuns.
Foram os avanos alcanados na pesquisa
do cncer nos ltimos anos que provaram que,
alm do comportamento biolgico, todos os tumores tm em sua origem alteraes do DNA.
Dessa forma, a revoluo na pesquisa do cncer
pode ser resumida na constatao de que o cncer fundamentalmente gentico.
As clulas de um organismo saudvel vivem
em um complexo, interdependente e regulado
processo proliferativo, tanto que cada tecido
mantm tamanho e arquitetura apropriados s
necessidades do organismo. As clulas cancerosas violam esse esquema, fugindo dos controles
proliferativos e criando seus prprios controles.
Todo esse mecanismo complexo coordenado
por genes. Portanto, o mecanismo de tumorignese resultado de uma srie de alteraes dos
genes que atuam direta ou indiretamente no controle do ciclo celular.
Uma pequena parte dessas mutaes herdada atravs da linhagem germinativa, estando,
portanto, presente em todas as clulas do indivduo e, assim, predispondo ao aparecimento do
cncer. A grande maioria das mutaes que con-

tribui para o desenvolvimento do cncer, no entanto, acontece em clulas somticas estando presente somente nas clulas neoplsicas do paciente.
Existem duas classes de genes que atuam na
patognese do cncer. A primeira inclui os genes que controlam diretamente a proliferao
celular, so eles os oncogenes e os genes supressores de tumor. A segunda classe formada por
genes que no controlam diretamente o ciclo celular, mas controlam as taxas de mutaes, os
genes de reparo do DNA.

GENES

DO

CNCER

Oncogenes
Os oncogenes so formas modificadas de
genes celulares normais denominados protooncogenes. Os proto-oncogenes tm papel essencial no controle positivo da proliferao e
diferenciao celular. As protenas codificadas
por esses genes exercem sua funo em diversos
processos intracelulares, atuando como protena quinases, fatores de crescimento, receptores
de fatores de crescimento ou transdutores de sinal, estando seus produtos distribudos em todos os compartimentos subcelulares. Qualquer
alterao na estrutura ou na expresso desses
genes altera sua funo normal, exercendo assim importante papel no complexo processo de
oncognese.
Os proto-oncogenes tm atuao dominante ao nvel celular. Portanto, a alterao de um

245

Cap.

19

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

nico alelo j suficiente para que esse gene seja


considerado ativado em oncogene e contribua
para o fentipo maligno. Existem diversos mecanismos de ativao dos proto-oncogenes e a
palavra ativao aqui, deve ser interpretada como
a alterao de funo desses genes favorecendo
ou levando ao desenvolvimento do cncer.

estrutura desses cromossomos a formao de


um gene quimrico e por conseqncia de uma
protena de fuso. Os genes envolvidos nesse
rearranjo so o proto-oncogene ABL, localizado em 9q34 e o gene BCR localizado em 22q11.
A protena quimrica tem uma atividade cataltica aumentada quando comparada atividade
da protena normal (Fig. 19.1).

Mecanismos de Ativao
de Proto-oncogenes

No linfoma de Burkitt, tambm uma translocao cromossmica a responsvel pela ativao do proto-oncogene MYC. No entanto, nesse
caso no ocorre uma fuso gnica, mas sim a
expresso contnua desse gene nas clulas onde
a translocao est presente, resultado da justaposio do proto-oncogene MYC com o loco do
gene da cadeia pesada das imunoglobulinas (IG).
O gene MYC se localiza originalmente em 8q24;
quando ocorre o rearranjo esse gene translocado para 14q32 onde se localiza o gene da cadeia pesada das imunoglobulinas (Fig. 19.2) . A
oncoprotena MYC transforma os linfcitos B,
pois o aumento de sua expresso altera o papel
de fator de transcrio exercido por essa protena quando forma heterodmeros com outras
protenas, aumentando assim a transcrio dos
genes por eles controlados.

O entendimento dos diversos mecanismos


de ativao requer a caracterizao e o reconhecimento da funo dos proto-oncogenes, permitindo, assim, uma comparao entre sua
funo normal e as alteraes que influenciam o
potencial de transformao.

Cap.

19

Alteraes cromossmicas so uma forma


importante de ativao de proto-oncogenes. A
investigao das regies dos pontos de quebra
nos rearranjos cromossmicos no-randmicos
presentes nos tumores humanos tem permitido
isolar e mapear diversos oncogenes.
A primeira alterao citogentica diretamente
relacionada a um tipo especfico de neoplasia,
foi a deteco de um pequeno cromossomo
denominado Philadelphia (Ph1), presente em
clulas de pacientes portadores de leucemia
mielide crnica (LMC). O cromossomo Ph
resultado de uma translocao envolvendo os
braos longos dos cromossomos 9 e 22 ,
t(9;22)(q34;q11). O resultado da alterao na

Um outro proto-oncogene ativado por translocao cromossmica o gene BCL2. Em linfoma folicular de clulas B esse gene tem sua
expresso aumentada, assim como o gene MYC,
resultado da justaposio com a cadeia pesada
da imunoglobulina [t(14;18)(q32;q21)]. Um as-

5
A)

Ph1

BCR
B)

ABL
9
der (9)

5
BCR
mRNA

BCR
22 der (22)

Protena

ABL

ABL
8.5kb
210kDa

3
Fig. 19.1 a) Esquema da t(9;22)(q34;q21) presente em leucemia mielide crnica (LMC), indicando a localizao dos
genes envolvidos no rearranjo; b) Esquema do rearranjo gnico, do RNA e da protena hbrida (Foto gentilmente cedida
por Cristiane A. Dalla Torre, Disciplina de Gentica, Departamento de Morfologia, Unifesp-EPM).

246

GENTICA DO CNCER

pecto interessante a ressaltar que a expresso


aumentada do gene BCL2 no funciona como
estimulador da proliferao celular, mas sim prolonga a sobrevivncia das clulas progenitoras,
inibindo a apoptose (morte celular programada) imortalizando, assim, as clulas alteradas.

MYCN e MYCL), famlia RAS (HRAS, KRAS e


NRAS), receptores de fatores de crescimento
(ERBB1 e 2, FGFR1 e 2) e outros genes como
(CCND1, MDM2, CDK4, CCNE, AKT2 e MYB).
Em tumores onde a amplificao gnica foi
detectada tem sido observada uma forte associao com estgios avanados da doena e um
pior prognstico. Um dos modelos de estudo
da amplificao gnica tem sido o neuroblastoma, onde a amplificao de MYCN associada
rpida progresso da doena, independente
da idade do paciente ou da classificao anatomopatolgica e clnica do tumor.

A mutao gnica tambm um mecanismo de ativao de proto-oncogenes. Um dos


clssicos exemplos a ativao dos genes da
famlia RAS. Esses genes so ativados por mutaes de ponto, alterao de uma nica base
na seqncia de DNA do gene, que alteram o
produto final e sua funo, agora diretamente
relacionada transformao da clula onde esse
evento ocorre.

A amplificao dos genes ERBB2 e MYC


ocorre em aproximadamente 15% a 30% dos
tumores de ovrio sendo relacionada com estgios avanados da doena. Essa observao fortalece a proposta de que a amplificao gnica
um evento mais tardio, nos mltiplos passos que
envolvem a patognese do cncer.

Um mecanismo muito particular de ativao


de proto-oncogene ainda no totalmente conhecido, a amplificao gnica. Aqui os genes no
tem sua estrutura alterada, mas sim o seu nmero de cpias por genoma. A amplificao gnica
visvel citologicamente, podendo ocorrer na forma extracromossmica, como pequenos marcadores sem centrmero, denominados minsculos
duplos (DMINs) ou, integrados a um cromossomo como regies homogeneamente coradas
(HSRs) (Fig. 19.3). A amplificao gnica um
evento restrito s clulas do cncer e confere uma
vantagem de crescimento para as clulas onde
ocorre. Genes que aparecem freqentemente amplificados em determinados tipos de cncer incluem proto-oncogenes da famlia MYC (MYC,

A)
p

3
2
1

Cap.

GENES SUPRESSORES

DE

TUMOR

So genes que nas clulas normais codificam


protenas cuja funo a regulao negativa do
crescimento ou do processo de diferenciao
celular. Quando esses genes perdem sua funo, passam a contribuir diretamente no fentipo alterado das clulas malignas. Apesar de esses
genes serem chamados de supressores de tumor,

3
2
1
3
2
1

2
1
1
2
3
1

2
3

MYC

2
2
1
21
22

3
2
1
1
2
3

IGH

1
2
3
1
2
3

1
2
3

3
8

2
1
1

1
2
3

der(14)

1
4 2
3
1 1
2 2
3

B)
3 MYC

5
1

3
3 IGH

5
14
2 3
MYC

IGH

der (8)
Fig. 19.2 A) Esquema da t(8;14)(q24;q11) presente em linfoma de Burkitt, indicando a localizao dos genes envolvidos no rearranjo; B) Esquema do rearranjo gnico e do RNA hbrido.

247

19

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

19

essa no a forma mais precisa para descrever


suas funes, no entanto a nomenclatura dos
genes envolvidos no cncer se baseia mais nas
alteraes patognicas do que em sua funo
normal. Ao contrrio dos oncogenes, a identificao dos genes supressores de tumor no feita atravs de estudos de modelos experimentais
de carcinognese viral e qumica, mas sim, atravs de anlise de tipos especficos de tumores
humanos. Entre as abordagens de xito na localizao cromossmica de genes supressores de
tumor est a investigao citogentica de linfcitos de sangue perifrico de pacientes com cncer. Esse tipo de estudo tem por objetivo
identificar alteraes cromossmicas como delees e translocaes que levariam inativao
de um ou dos dois alelos de um gene supressor
de tumor. Foram esses estudos que orientaram
a identificao de alguns genes supressores de
tumor como o gene RB1 (13q14) em retinoblastoma, WT1 (11p13) em tumor de Wilms, gene
APC (5q21) em polipose adenomatosa familial
e NF1 (17q11.2) em neurofibromatose tipo 1.
Os genes supressores de tumor tm comportamento recessivo ao nvel celular, portanto necessrio que os dois alelos estejam alterados para
que esse gene perca sua funo.
Famlias que apresentam predisposio a
certos tipos de cncer, muitas vezes so compostas por indivduos portadores de alteraes
em um dos alelos de um gene supressor de tumor especfico. Essa alterao acontece na linhagem germinativa, podendo ser transmitida
para as geraes subseqentes. Como esses genes tm comportamento recessivo, a ausncia
de uma cpia (heterozigose) silenciosa e o processo de tumorignese s vai se estabelecer quando ocorrer alterao do outro alelo (homozigose
ou perda da heterozigose). Uma vez que a probabilidade de alterao de um nico alelo consideravelmente maior do que a alterao de dois
alelos de um gene, a chance de um indivduo,
portador desse tipo de predisposio desenvolver um tumor maior do que a chance de um
indivduo da populao geral. No entanto, somente 10% dos cnceres apresentam um padro
familial e desses, poucos apresentam um comportamento mendeliano.
Em 1971, Ohno props um modelo geral
para a gnese do cncer tendo como base os

248

Fig. 19.3 Amplificao gnica a.localizao do gene


normal, b. elementos extracromossmicos, c. minsculos
duplos, d. integrao linear dos minsculos duplos formando uma regio homogeneamente corada. Clulas de neuroblastoma apresentando amplificao de MYCN
demonstrada por FISH c.Ncleo interfsico com mais de 50
cpias do gene MYCN na forma de minsculos duplos; d.
Ncleo metafsico apresentando as duas formas de amplificao, minsculos duplos (DMs) e regio homogeneamente
corada (HSR) (Fotografias gentilmente cedidas por Maisa
Yoshimoto, Disc. de Gentica/Departamento de Morfologia, Unifesp/EPM).

GENTICA DO CNCER

aspectos recessivos da gentica e, no mesmo ano,


Knudson props um modelo embasado na anlise de dados epidemiolgicos das formas familiais e espordicas de retinoblastoma, um tumor
ocular maligno e raro da infncia. Esse tumor
ocorre tanto na forma espordica quanto familial onde a predisposio para desenvolver o tumor herdada de forma mendeliana com padro
de herana autossmico dominante com alto
grau de penetrncia. Knudson props que nos
casos com componente hereditrio, a predisposio para desenvolver o tumor deveria ter sido
herdada como uma mutao recessiva na linhagem germinativa, mas o sinal para desenvolvimento do tumor s seria dado a partir de uma
segunda mutao que deveria ocorrer em uma
clula somtica. Assim a clula onde o segundo
evento aconteceu ficaria em homozigose para a
mutao. Nos casos espordicos, no entanto, o
passo inicial para o desenvolvimento do tumor
dependeria da ocorrncia de duas mutaes somticas consecutivas, inativando os dois alelos
de um determinado gene. O modelo proposto
por Knudson para o retinoblastoma conhecido como hiptese de dois eventos e esse o
mecanismo aceito para perda de funo dos genes de supresso tumoral. O gene RB1 foi o primeiro gene desse grupo a ser completamente
caracterizado e reconhecido como sendo o gene
cuja perda de funo tem relao direta com a
gnese do retinoblastoma (Fig. 19.4).
A natureza recessiva dos genes supressores
de tumor incontestvel, no entanto, existem excees importantes. Quando um gene supressor
de tumor, em heterozigose, est comprovadamente envolvido em um processo de carcinognese,
a mutao denominada dominante negativa.
Um dos mecanismos para explicar esse evento
poderia ser a capacidade de inativao do produto normal pelo produto do alelo alterado. A
protena normal poderia estar sendo produzida
em nveis muito inferiores aos necessrios para
exercer uma regulao negativa ou ento o produto mutante adquire propriedades oncognicas, atuando como oncogene.
Um dos genes mais freqentemente alterados em cnceres humanos o gene TP53, e
acredita-se que esse gene est alterado em aproximadamente 70% de todos os cnceres. Em
1990, Malkin et al. e Srivastava et al. demonstraram que indivduos portadores de sndrome
de Li-Fraumeni carregavam uma mutao do

gene TP53 na linhagem germinativa. A sndrome de Li-Fraumeni uma forma rara de predisposio ao cncer onde os indivduos so
afetados por formas variadas de tumores que s
se manifestam quando a mutao no gene TP53
reduzida a homozigose.
Atualmente o gene TP53 reconhecido como
o gene que governa a transio de G1 para S do
ciclo celular. Sempre que danos do DNA forem
detectados, o gene TP53 tem o papel de suprimir a progresso do ciclo celular e a replicao
do DNA. Dessa forma, monitora o acmulo de
danos do DNA, estendendo o perodo de transio para permitir que o dano seja reparado
antes de sua fixao no genoma durante a replicao, ou elegendo a clula para uma morte celular programada (apoptose) se o dano for
irreparvel. Assim, esse gene no previne a ocorrncia de um tipo de tumor em particular, como
no caso de outros supressores de tumor, mas
sim atua como supressor da tumorignese.

GENES DE REPARO DO DNA


MUTATOR GENES
Em 1980, Loeb props que somente um fentipo hipermutvel poderia justificar o nmero
de mutaes observadas no cncer e, naquele
momento no existia nenhum mecanismo conhecido que pudesse ser o responsvel pelo fentipo hipermutvel.
A instabilidade cromossmica presente nas
clulas tumorais se traduz pela presena de caritipos complexos, com perda, ganho e rearranjos cromossmicos e somente alguns destes
podem ser relacionados gnese cncer. Os genes relacionados instabilidade genmica so
ainda pouco conhecidos, no entanto algumas
doenas tm fornecido informaes importantes sobre os genes responsveis pela instabilidade do DNA.
A ataxia-telangectasia uma doena recessiva caracterizada por ataxia cerebelar progressiva, dilatao das veias da conjuntiva e
globo ocular, imunodeficincia, atraso de desenvolvimento e predisposio consideravelmente aumentada para o cncer. Os indivduos
homozigotos para a doena, freqentemente
morrem de cncer antes dos 25 anos e os heterozigotos tm risco aumentado de desenvolver

249

Cap.

19

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

19
Fig. 19.4 Mecanismos possveis de perda de heterozigose em retinoblastomas.

cncer quando comparado com a populao geral. O gene ATM, que se localiza em 11q22-23,
o gene mutado nesses indivduos. O fentipo
dos indivduos com ataxia telangectasia sugerem
o envolvimento desse gene em processos fundamentais do controle da integridade gentica.
No cncer de clon hereditrio sem plipos, a doena herdada de forma autossmica dominante com alto grau de penetrncia.
Os genes que ocasionam predisposio a essa
condio foram mapeados em 2p15-p16
(MSH2), 3p21.3 (MLH1), 7p22 (PMS2) e
2q31 (PMS1). Mutaes desses genes, que
codificam protenas que mantm um sistema
de correo de erros, levam a um aumento
geral da taxa de mutaes. Os indivduos com
cncer de clon sem plipos so constitucionalmente heterozigotos para qualquer desses
genes e a perda de heterozigose ocorre nas
clulas tumorais.
Os genes tm sido denominados Mutator genes com base na sua contribuio patognica quando mutado. Sua funo nas

250

clulas normais garantir a integridade da informao gentica mantendo a eficincia da


replicao e reparo do DNA. Esses genes tm
um comportamento recessivo na clula, como
os genes supressores de tumor, requerendo
assim duas alteraes, em ambos os alelos para
que o gene perca sua funo.

IMPRINTING GENMICO E CNCER


O imprintig genmico uma modificao
epigentica de um alelo parental especfico de
um gene ou do cromossomo onde esse gene se
localiza, no envolvendo no entanto alteraes
na seqncia de DNA . Evidncias recentes tm
indicado que o imprintig genmico uma forma
epigentica de regulao gnica, que resulta em
expresso gnica uniparental, podendo funcionar como fator de predisposio ao cncer. Esse
imprinting diferencial ocorre no gameta ou no
zigoto resultando em uma expresso diferencial
dos dois alelos de um gene nas clulas somticas do recm-nascido.

GENTICA DO CNCER

Alteraes do imprintig genmico foram


identificadas em certos tipos de cncer, podendo ocorrer tanto em cnceres de adulto
quanto de crianas. Essas alteraes levam a
uma expresso inadequada dos genes que regulam a diviso celular, representando, no
entanto, alteraes potencialmente reversveis.
Um dos aspectos mais interessantes do imprinting genmico que ele atua sobre diferentes
processos celulares, incluindo sinalizao intercelular, processamento do RNA e controle do
ciclo celular.
Uma das primeiras sugestes sobre a importncia do imprinting genmico em cncer foi a
mola hidatiforme. A mola hidatiforme um tumor maligno do tecido extra-embrionrio, resultado de um embrio formado por dois
conjuntos haplides paternos sem material genmico materno. Pode ser o resultado de dispermia e perda do complemento materno ou de
duplicao do genoma paterno e perda do equivalente materno.
O gene MYC foi a primeira demonstrao
de um gene especfico com imprinting genmico em cncer. Os pesquisadores observaram que
o gene MYC (8q24) quando translocado para o
locus da cadeia pesada da imunoglobulina em
14q32, era expresso em alguns tecidos somente

quando a alterao tivesse acontecido na linhagem germinativa paterna, quando herdado por
via materna o gene no transcrevia.

TELMEROS, TELOMERASE E CNCER


A enzima telomerase uma ribonucleoprotena que adiciona repeties TTAGGG garantindo a manuteno de uma estrutura localizada
na extremidade dos cromossomos, denominada
telmero. Os telmeros tm papel fundamental
no controle do nmero de divises que uma clula deve ter at sua morte.
Em 1972, Watson demonstrou que as DNA
polimerases no podiam copiar linearmente todo
o cromossomo de uma extremidade a outra. Desse
modo, o processo de replicao deixa de copiar
uma pequena regio na extremidade 3dos cromossomos e assim, essas extremidades diminuem
progressivamente a cada ciclo de duplicao. Na
linhagem germinativa a enzima tem sua atividade
garantida pela necessidade de manuteno do tamanho dos telmeros na formao dos gametas.
Nas clulas somticas normais os telmeros sofrem encurtamento a cada diviso celular, ocorrendo, no entanto, atividade residual da enzima
em alguns tipos celulares. O telmero pode ser
chamado de relgio molecular, pois determina

TAMANHO

Tamanho do
telmero

Reduo progressiva do
tamanho do telmero
Retomada da atividade
da telomerase

Estabilizao do
tamanho do telmero
IMORTALIZAO
DIVISES CELULARES
Fig. 19.5 Relao entre tamanho do telmero, atividade da telomerase e imortalidade celular.

251

Cap.

19

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

o nmero de vezes que uma clula pode se dividir


e quando a senescncia celular deve acontecer.
Nas clulas cancerosas a taxa de proliferao celular aumentada e, portanto os telmeros tendem a sofrer encurtamento. Para garantir
a proliferao celular contnua, essas clulas reativam a atividade da telomerase, equilibrando o
tamanho do telmero (Fig. 19.5). Independente
das distintas etiologias dos diversos tipos de cncer, achados recentes evidenciaram o importante papel da ativao da enzima telomerase em
clulas tumorais malignas.

Cap.

19

O gene TP53 e o gene RB1 so molculas


chaves na induo da senescncia celular. Alteraes nesses genes devem ser suficientes para
aumentar o tempo de vida das clulas favorecendo o desenvolvimento de tumores mortais.
Entretanto, a retomada da expresso da telomerase, fato que ocorre na maioria dos tumores,
provavelmente o evento crtico para a sustentao do crescimento da maioria dos tumores
independente da presena de mutao no gene
TP53.

At o momento no se sabe o motivo pelo


qual ocorre a retomada da atividade da telomerase nos tumores. A chave de todas as questes
relacionadas telomerase reside na determinao dos tipos de tumores onde ocorre uma correlao clnica direta entre a atividade da
telomerase, o diagnstico e prognstico tumoral, permitindo assim que sejam utilizadas terapias inibidoras da telomerase como mais um
recurso no combate ao cncer.

CONCLUSES
As clulas precisam acumular de quatro a
sete mutaes para se tornarem tumorignicas e
cada mutao necessita da expanso do clone
mutante por pelo menos um milho de clulas
antes que ocorra a prxima mutao. Algumas
dessas mutaes so recessivas e nesse caso precisam de duas expanses clonais para que o gene
tenha sua funo eliminada. Isso provavelmente
requer de 80 a 200 duplicaes de uma clula
normal para gerar um tumor maligno.

Fig. 19.6 Mltiplos passos na fomao de um tumor malgno M=mutao em genes supressores de tumor ou protooncogenes. Clulas normais; Clulas com uma mutao; Clulas com duas mutaes; Clulas com trs mutaes; Clulas com quatro mutaes; Clulas com cinco mutaes; Clulas com cinco mutaes e reativao da telomerase.

252

GENTICA DO CNCER

A retomada da expresso da telomerase, que


ocorre na maioria dos tumores, provavelmente
um evento crtico na manuteno do crescimento de muitos cnceres. Alm disso, o cncer pode
no somente ser resultado de somatria de mutaes, gnicas ou cromossmicas, mas tambm
resultar de alteraes epigenticas que tm por
produto a expresso inapropriada de genes que
atuam no processo de patognese.
A concluso a que podemos chegar que a
formao de um tumor um processo de mltiplas etapas que podem ser evidenciadas pelas
alteraes genticas presentes nas clulas neoplsicas (Fig. 19.6).

NESSE CAPTULO ABORDAMOS:


quais as classes de genes que atuam na patognese do cncer e quais os mecanismos
que alteram esses genes
como esses genes alterados em sua estrutura e/ou funo atuam no processo de tumorignese

como uma modificao epigentica como o


imprinting genmico pode atuar no cncer
o papel da enzima telomerase e dos telmeros em clulas tumorais malignas
como todos os eventos que acontecem nas
clulas tumorais se combinam na patognese do cncer

BIBLIOGRAFIA
1. Heim S, Mitelman F. Cancer Cytogenetics, Chromosomal and Molecular Genetics Aberration of Tumor
Cells.Wiley-Liss.1995
2. Rooney DE, Czepulkowski. Human Cytogenetics A
practical approach, Ed. IRL Press at Oxford
University Press, New York,1992
3. Strachan T, Read AP. Human Molecular Genetics,
Editors: Strachan, T. & Read, A.P., Ed. Bios
Scientific Publishers and Wiley-Liss. 1996.
4. Vogelstein B, Kinzler KW (ed).The Genetic Basis of
Human Cancer. Ed. McGraw-Hill, New York, 1998.

253

Cap.

19

SIMPATOMIMTICOS E SIMPATOLTICOS

Simpatomimticos
e Simpatolticos
Maria Christina Werneck de Avellar

FISIOFARMACOLOGIA
SIMPTICO

DO

SISTEMA NERVOSO

O sistema nervoso simptico importante


na regulao de rgos tais como corao e vasos sangneos perifricos. O neurotransmissor
liberado dos terminais nervosos simpticos a
noradrenalina, mas em resposta a algumas formas de estresse, a adrenalina tambm liberada
da medula da glndula adrenal. Estas catecolaminas so inativadas principalmente pelo processo de captao neuronal, uma protena
transportadora de alta afinidade pelo neurotransmissor simptico que transporta a noradrenalina da fenda sinptica para o interior do neurnio.
Um transporte similar, a captao extraneuronal, tambm ocorre no tecido extraneuronal, mas
um sistema menos seletivo e menos saturvel.
As enzimas monoaminoxidase (MAO) e catecolO-metiltransferase (COMT) esto amplamente
distribudas nos tecidos e metabolizam as catecolaminas. A inibio da MAO (ex. tranilcipronina) e da COMT (ex.-estradiol) tem pouco
efeito potenciador nas respostas estimulao
nervosa simptica, uma vez que estas so principalmente inativadas pelo sistema de captao.
Pelo fato de as funes mediadas ou modificadas pelo sistema nervoso simptico serem
diversas, as drogas que mimetizam, alteram ou

antagonizam sua atividade so teis no tratamento de vrias desordens clnicas, incluindo a


hipertenso arterial, choque cardiovascular, arritmias cardacas, asma e reaes anafilticas,
entre outras. Muitas das aes das catecolaminas e dos agentes simpatomimticos podem ser
classificadas em sete tipos gerais: 1) aes excitatrias perifricas em certos tipos de msculo liso, como vasos sangneos suprindo a
pele, rins e membrana mucosa e em clulas
glandulares, tais como a glndula salivar e a sudorpara; 2) aes inibitrias perifricas em
outras musculaturas lisas, tais como a parede
da glote, rvore brnquica e vasos sangneos
que suprem a musculatura esqueltica; 3) aes
excitatrias cardacas, responsveis pelo aumento na freqncia e fora de contrao cardaca;
4) aes metablicas, gerando aumento da glicogenlise no fgado e msculos e liberao de
cidos graxos livres do tecido adiposo; 5) aes
endcrinas, tais como modulao da secreo
de insulina, renina e hormnios hipofisrios; 6)
aes no sistema nervoso central, como estimulao respiratria e, com algumas drogas,
aumento no estado de alerta e atividade psicomotora concomitante com reduo no apetite;
7) aes pr-sinpticas, que resultam tanto na
inibio como facilitao da liberao de neurotransmissores tais como noradrenalina ou
acetilcolina.

273

Cap.

21

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

BASES MOLECULARES DA FUNO


RECEPTORES ADRENRGICOS

DOS

Os receptores adrenrgicos esto presentes


em quase todos os tecidos perifricos e em muitas populaes neuronais do sistema nervoso central. Alguns neurnios apresentam receptores
pr-juncionais (ou pr-sinpticos) que servem
como auto ou heterorreceptores para inibir a liberao nervosa de uma variedade de neuro-

Cap.

transmissores. Pela comparao da potncia de


agonistas e antagonistas, os receptores adrenrgicos foram classificados em adrenoceptores (1 e
2) e adrenoceptores (1, 2, 3, 4). Os adrenoceptores , por sua vez, so ainda subdivididos em
subtipos: adrenoceptores 1 (1a, 1b e 1d), que
esto normalmente presentes em clulas ps-sinpticas, e adrenoceptores 2 (2a, 2b e 2c), expressos tanto pr- quanto ps-sinapticamente.

21

Fig. 21.1 Representao dos eventos que ocorrem em um terminal nervoso simptico. A tirosina transportada
ativamente para o axoplasma e convertida a DOPA e dopamina (DA) por enzimas citoplasmticas. DA transportada para
dentro de vesculas da varicosidade, onde ocorre a sntese e estocagem de noradrenalina (NA). A chegada de um potencial
de ao causa um influxo de Ca++ para dentro do terminal nervoso (no mostrado), induzindo fuso da vescula com a
membrana plasmtica e o processo de exocitose da NA. A NA liberada, ento, ativa adrenoceptores e na membrana
ps-sinptica. A NA, que transportada para o interior destas clulas (captao 2), provavelmente rapidamente inativada pela enzima catecol-O-metiltransferase (COMT) a metanefrina (NMN). O mecanismo mais importante para trmino da
ao da NA no espao juncional a captao neuronal ativa (captao 1) e posterior estocagem em vesculas de armazenamento. O aumento de NA no terminal nervoso pode tambm acarretar a inativao deste neurotransmissor pela enzima
monoaminoxidase (MAO), gerando metablitos deaminados que so liberados do terminal nervoso. A NA, presente na
fenda sinptica, pode tambm ativar receptores a2 pr-sinpticos, inibindo a liberao exocittica de NA. Outros neurotransmissores (ex. ATP e peptdeos) podem ser estocados juntamente com NA nas mesmas ou em populaes diferentes
de vesculas.

274

SIMPATOMIMTICOS E SIMPATOLTICOS

Todos os adrenoceptores e so receptores acoplados a protena G e que diferem na forma como transmitem o sinal atravs da
membrana. Os adrenoceptores , de modo geral,
estimulam a enzima adenilil ciclase, via protena
Gs, aumentando os nveis de formao de AMP
cclico intracelular. Os adrenoceptores 2, por
outro lado, inibem esta enzima via protena Gi,
gerando diminuio dos nveis de AMP cclico. A
ativao dos adrenoceptores 1, acoplados principalmente protena Gq, produz ativao da hidrlise de fosfoinositdeos de membrana catalizada
pela enzima fosfolipase C gerando a formao de
dois sinalizadores intracelulares principais: o inositdeo trifosfato (IP3), que aumenta as concentraes de Ca++ intracelular, e o diacilglicerol
(DAG), que atua ativando a protena quinase C
(PKC).

DROGAS SIMPATOMIMTICAS E SEUS EFEITOS


FISIOFARMACOLGICOS
Os simpatomimticos so drogas que mimetizam parcial ou completamente as aes da noradrenalina e adrenalina. Estas drogas podem ser
divididas em simpatomimticos de ao direta, que
atuam diretamente nos adrenoceptores (subtipos
e/ou ) ou simpatomimticos de ao indireta, que atuam indiretamente no terminal nervoso
pr-sinptico, geralmente causando a liberao
do neurotransmissor noradrenalina.
Um fator importante na resposta de qualquer
clula ou rgo s aminas simpatomimticas a
densidade e a proporo de adrenoceptores e
apresentados pelo tecido. Por exemplo, a noradrenalina possui pouca capacidade em aumentar o fluxo areo bronquiolar, uma vez que
os adrenoceptores presentes na musculatura lisa
bronquiolar so predominantemente do subtipo
2. Ao contrrio, o isoproterenol e a adrenalina,
agonistas 2 no seletivos, so potentes broncodilatadores. Os vasos sangneos cutneos expressam quase que exclusivamente receptores ;
desta forma, a noradrenalina e a adrenalina causam vasoconstrio de tais vasos, enquanto o isoproterenol tem pouco efeito. A musculatura dos
vasos sangneos, que suprem a musculatura esqueltica, possui adrenoceptores e 2; a ativao dos receptores 2 causa vasodilatao,
enquanto a estimulao dos adrenoceptores
gera vasoconstrio. Em tais vasos, a concentrao limiar de adrenalina para ativao dos receptores 2 mais baixa do que para os receptores

. Quando ambos os receptores so ativados em


concentraes mais altas de adrenalina, a resposta adrenrgica predomina. Concentraes
fisiolgicas de adrenalina causam principalmente
vasodilatao.
A resposta final de um rgo-alvo a aminas
simpatomimticas ditada no s pelos efeitos
diretos dos agentes nos receptores adrenrgicos,
como tambm pelos efeitos homeostticos reflexos do organismo. O efeito mais importante
de muitas aminas simpatomimticas o aumento da presso sangnea causado pela estimulao dos receptores , presentes na musculatura
lisa vascular. Esta estimulao gera reflexos compensatrios, mediados pelo sistema barorreceptor da aorta e da cartida. Como resultado, o
tnus simptico diminudo e o tnus vagal aumentado; cada uma destas respostas leva a uma
diminuio da freqncia cardaca. Este reflexo
importante para drogas que tm pouca capacidade de ativar receptores diretamente.

Simpatomimticos de Ao Direta
As aes das aminas simpatomimticas de
ao direta esto intimamente relacionadas com
a especificidade do receptor ( ou ) e efeitos
compensatrios que provocam. As drogas que
ativam seletivamente receptores (1 e 2) (ex.
isoproterenol) aumentam a fora e a freqncia cardaca e causam vasodilatao, resultando em uma queda da presso diastlica e da
presso arterial mdia, com poucas alteraes
da presso arterial sistlica. As drogas que ativam seletivamente adrenoceptores 2 (ex. salbutamol) so utilizadas na produo de
broncodilatao em doses que causam efeitos
mnimos no corao. So drogas resistentes a
MAO e no captadas pelo sistema de captao
neuronal e de escolha no tratamento da asma.
Apesar de por muito tempo, dobutamina ser
considerada um exemplo de agonista seletivo de
adrenoceptores 1, seu mecanismo de ao
complexo e dependente das duas formas enantiomricas presentes na mistura racmica usada
clinicamente. O ismero dobutamina (-) um
agonista 1 potente, enquanto o ismero (+)
um antagonista 1 potente, que bloqueia os efeitos do ismero (-). Os efeitos destes dois ismeros, no entanto, so mediados por
adrenoceptores . Clinicamente, os efeitos cardiovasculares da dobutamina racmica so de-

275

Cap.

21

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

correntes das diferentes propriedades farmacolgicas dos esteroismeros (_) e (+). A dobutamina tem efeitos de inotropismo e cronotropismo
positivo no corao, sem alterao da resistncia perifrica, sendo indicada em casos de controle emergencial de descompensao cardaca.
As drogas que ativam seletivamente adrenoceptores 1 (fenilefrina, metoxamina) possuem
importncia clnica pelos efeitos contrteis induzidos na musculatura lisa vascular, gerando
aumento da resistncia vascular perifrica, sendo a presso sangnea mantida ou elevada. So,
por estas aes, importantes para tratamento de
hipotenso ou choque. A fenilefrina tambm
normalmente usada como agente descongestionante nasal e midritico em vrias preparaes
nasais e oftlmicas.

Cap.

21

As drogas de ao seletiva em adrenoceptores 2 (ex. clonidina) so usadas em conjunto


com diurticos principalmente para tratamento
da hipertenso sistmica, apesar de serem efetivos quando administrados isoladamente. Aps
administrao intravenosa, so potentes vasoconstritores por ativarem adrenoceptores 2 pssinpticos presentes na musculatura lisa vascular
perifrica. No entanto, aps administrao oral,
possuem efeitos em adrenoceptores 2 presentes nos centros de controle cardiovascular no
sistema nervoso central, suprimindo o fluxo de
atividade do sistema nervoso simptico do crebro, resultando assim em abaixamento da presso arterial.
As implicaes clnicas e farmacolgicas dos
adrenoceptores 3 e 4 esto ainda sob investigao. Recentemente, a associao entre variantes genticas do gene do adrenoceptor 3
humano e casos de diabetes tipo II e obesidade
tem gerado a procura por agonistas mais seletivos deste subtipo de adrenoceptor, que poder
significar futuramente um avano no tratamento farmacolgico para tais condies clnicas.

Simpatomimticos de Ao Indireta
Os simpatomimticos de ao indireta possuem a estrutura da noradrenalina e por isso so
transportados, pelo carreador da captao 1, para
dentro do terminal nervoso onde ento deslocam a noradrenalina vesicular para o citoplasma. Uma parte da noradrenalina metabolizada

276

pela enzima MAO, sendo o restante liberado por


exocitose para ativar os adrenoceptores ps-sinpticos. As aminas simpatomimticas de ao
indireta que agem liberando noradrenalina do
terminal nervoso (ex. anfetamina) induzem efeitos que so gerados, pela ao da noradrenalina
liberada, em adrenoceptores e dos tecidosalvo. A efedrina, alm de causar liberao de noradrenalina, tambm estimula diretamente
adrenoceptores e . Seus efeitos so similares
aos da adrenalina, porm muito mais prolongados. A efedrina tem um efeito central leve, mas a
anfetamina, que penetra no crebro mais facilmente, tem maior efeito estimulante no humor e
alerta alm de um efeito depressor no apetite. A
anfetamina e drogas similares possuem alto potencial de droga de abuso e so mais raramente
usadas clinicamente atualmente.
A cocana, alm de ser um anestsico local,
um simpatomimtico de ao indireta, inibindo o
processo de captao neuronal 1 de noradrenalina pelo terminal nervoso. Possui um efeito estimulante central intenso, por isso sendo uma droga
de abuso.

DROGAS BLOQUEADORAS
SIMPTICO

DO

NEURNIO

As drogas bloqueadoras do neurnio simptico so drogas simpatolticas que atingem o


terminal nervoso simptico e, tanto depletam
os terminais nervosos de noradrenalina, como
previnem sua liberao, gerando um efeito antihipertensivo com a administrao prolongada.
So inicialmente captadas pelo sistema de captao neuronal 1 de noradrenalina e, uma vez
dentro do terminal nervoso, concentram-se nas
vesculas neurossecretrias, tomando o lugar da
noradrenalina estocada, que passa a ser liberada lentamente para o citoplasma onde metabolizada pela enzima MAO intraneuronal.
Durante a administrao prolongada do terminal nervoso, estas drogas passam a ser liberadas como agente inativo por estmulos que
normalmente liberam noradrenalina do terminal nervoso, gerando assim o efeito simpatoltico. A reserpina liga-se a vesculas de estocagem
de neurnios adrenrgicos centrais e perifricos, enquanto a guanetidina possui ao nos
neurnios perifricos.

SIMPATOMIMTICOS E SIMPATOLTICOS

ANTAGONISTAS DE RECEPTORES
ADRENRGICOS
Os antagonistas de receptores adrenrgicos so
simpatolticos de ao direta que bloqueiam diretamente os adrenoceptores (subtipos e/ou ).
Os antagonistas -adrenrgicos (-bloqueadores) so importantes no tratamento da hipertenso, angina, arritmias cardacas e glaucoma.
So drogas com grau variado de solubilidade e
cardiosseletividade, cujo mecanismo de ao
deve-se ao bloqueio competitivo dos adrenoceptores . O propranolol considerado um antagonista no-seletivo, pelo fato de apresentar
afinidade igual para adrenoceptores 1 e 2. O
metoprolol e atenolol possuem maior afinidade
pelos adrenoceptores 1, sendo exemplos de antagonistas 1 seletivos. Propranolol um antagonista puro, sem atividade intrnseca em
receptores . Vrios bloqueadores (ex. pindolol), no entanto, ativam parcialmente os adrenoceptores na ausncia de catecolaminas, com
atividade intrnseca bem menor que a de um
agonista total como o isoproterenol. Embora as
vantagens clnicas de tais drogas com atividade
simpatomimtica intrnseca no tenham sido esclarecidas, podem ser preferencialmente usadas
em pacientes com bradicardia.
Em indivduos normais, os antagonistas adrenrgicos no causam efeitos visveis. Os efeitos mais importantes so vistos na atividade
cardiovascular de pacientes com doenas cardiovasculares tais como hipertenso ou isquemia
miocrdica. Os antagonistas diminuem a freqncia cardaca e a contratilidade miocrdica por
bloquearem especificamente receptores 1 presentes em nvel cardaco. Quando antagonistas no
seletivos so usados, a resistncia perifrica tende a aumentar, pelo bloqueio de adrenoceptores
2 vasculares e reflexos simpticos compensatrios que ativam adrenoceptores vasculares.
Contudo, com a administrao em longo prazo
dos antagonistas , estes efeitos na resistncia
perifrica tendem a diminuir. Os antagonistas
no causam reduo da presso sangnea em
pacientes normotensos, mas causam reduo da
presso de pacientes com hipertenso. Apesar de
amplamente usados com tais fins, os mecanismos
que geram tais regulaes so complexos. O efeito colateral mais importante dos antagonistas

causado pelo bloqueio dos receptores 2 na musculatura lisa bronquiolar. Em pacientes com doena broncoespasmtica, portanto, bloqueadores
com maior seletividade 2 devem ser preferencialmente usados para diminuir as chances de quadros de broncoespasmos. Contudo, pelo fato de
a seletividade dos bloqueadores 1 atualmente disponveis no ser absoluta, o uso destas drogas em
pacientes asmticos deve ser evitado sempre que
possvel.
Os antagonistas -adrenrgicos (-bloqueadores) possuem aplicaes clnicas mais limitadas. O prazosin, um antagonista 1 seletivo,
usado no tratamento da hipertenso. A fenoxibenzamida, um antagonista irreversvel, usado
para bloquear os efeitos gerados pelas grandes
quantidades de catecolaminas liberadas de tumores da medula da adrenal (feocromocitoma).
Muitos bloqueadores tm sido usados no tratamento perifrico da doena vascular oclusiva,
geralmente com pouco sucesso.
Os antagonistas -inespecficos, como fentolamina, so antagonistas competitivos que reduzem o tnus arteriolar e venoso, causando
queda na resistncia perifrica e hipotenso. So
drogas que revertem os efeitos pressores da
adrenalina uma vez que os efeitos vasodilatadores, mediados pelos adrenoceptores 2, no
so compensados por vasoconstrio mediada
por adrenoceptor e a presso arterial cai (efeito reverso da adrenalina). Antagonistas causam taquicardia reflexa, que mais acentuada
com drogas no seletivas que bloqueiam adrenoceptores 2 pr-sinpticos no corao. Neste caso, o bloqueio dos auto-receptores 2
aumenta os nveis de noradrenalina liberada,
causando conseqentemente estimulao de
adrenoceptores 1 cardacos.

BIBLIOGRAFIA
1. Goldstein DS. Catecholamine receptors and signal
transduction. Overview. Advances in Pharmacology
(New York). 42:379-90, 1998.
2. Goodman and Gilmans The Pharmacological Basis of
Therapeutics, 9 th ed./Joel G. Hardman, Alfred
Goodman Gilman, Lee E. Limbird, The McGrawHill Companies, 1996.
3. Lomasney JW, Allen LF, Lefkowitz RJ. Cloning and
regulation of catecholamine receptor genes. In:
Molecular endocrinology, basic concepts and clinical
correlations, Weintraub BD (ed.), Raven Press, New
York, 1997.

277

Cap.

21

COLINOMIMTICOS E COLINOLTICOS

Colinomimticos
e Colinolticos
Caden Souccar

Nas terminaes nervosas colinrgicas, a


transmisso sinptica pode ser alterada por drogas que exercem aes:
Pr-sinpticas, interferindo com a sntese,
o armazenamento e a liberao de acetilcolina (ACh), ou
Ps-sinpticas, mimetizando ou bloqueando
as aes muscarnicas e nicotnicas da ACh
nos receptores colinoceptivos.
As drogas que atuam pr-sinapticamente
(Fig. 22.1) podem:
Facilitar a liberao de ACh induzida por estimulao nervosa como a 4-aminopiridina que
bloqueia os canais de potssio ativados por
clcio (KCa), prolongando a despolarizao
da membrana do terminal nervoso.
Reduzir a liberao de ACh por inibio de
sua sntese. O hemicolnio bloqueia o transporte da colina do meio extracelular para a
terminao nervosa por um transportador
de membrana dependente de sdio, inibindo a sntese de ACh.
Inibir a liberao de ACh das terminaes
nervosas por inibio do transporte do neurotransmissor sintetizado no citoplasma para
as vesculas sinpticas pelo vesamicol. O
Mg2+ , Co2+, Mn2+ e os antibiticos ami-

noglicosdeos (estreptomicina, gentamicina


e neomicina) inibem a liberao estimulada
de ACh por alteraes do influxo de Ca2+
para o terminal nervoso. A interao da toxina botulnica com uma das protenas envolvidas na fuso das membranas da vescula
sinptica e do terminal nervoso, a sinaptobrevina, tambm inibe a liberao da ACh. A
toxina botulnica do tipo A usada no tratamento de certas distonias como no caso de
blefaroespasmo e no estrabismo.
As aes ps-sinpticas da ACh decorrem
da interao do agonista com receptores colinoceptivos muscarnicos e nicotnicos, mimetizando os efeitos produzidos pelos alcalides
naturais muscarina e nicotina, respectivamente.
Os receptores muscarnicos pertencem famlia
dos receptores acoplados s protenas ligadoras
do nucleotdeo de guanina (protenas G). So
encontrados nas membranas ps-sinpticas de
clulas de rgos inervados por fibras parassimpticas e em algumas estruturas no-inervadas
por fibras colinrgicas, como o endotlio, e em
outras inervadas por fibras ps-ganglionares simpticas colinrgicas, como os vasos da musculatura esqueltica e as glndulas sudorparas.
Os receptores muscarnicos apresentam estrutura comum formada por sete domnios

279

Cap.

22

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Cap.

22

Fig. 22.1 Esquema geral de uma sinapse colinrgica. A acetilcolina (ACh) sintetizada no citoplasma das terminaes
nervosas por acetilao da colina extracelular, em reao catalizada pela enzima colinacetiltransferase. As setas com
linhas interrompidas indicam os stios de ao das drogas relacionadas (em itlico).

transmembranares interligados por alas hidroflicas, trs extracelulares e trs intracelulares,


com um domnio N-terminal extracelular e um
domnio C-terminal intracelular. Os domnios
3, 6 e 7 esto envolvidos na interao do receptor com o agonista, enquanto a terceira ala
intracelular e o domnio C-terminal esto envolvidos na interao com a subunidade da
protena G. Esses receptores regulam, em geral,
a produo de segundos-mensageiros intracelulares enquanto a seletividade do agonista
determinada pelos subtipos de receptores muscarnicos e protenas G presentes nas clulas (ver
Introduo).
Estudos moleculares revelaram a existncia
de cinco subtipos de receptores muscarnicos,
codificados por genes diferentes e que correspondem aos receptores caracterizados farmacologicamente como M1 a M5 (Tabela 22.1). Os
subtipos M1, M4 e M5 so expressos principalmente no sistema nervoso, o subtipo M2 em
msculo cardaco e o subtipo M3 em glndulas
excrinas e no sistema nervoso. Os cinco subti-

280

pos de receptores so classificados de acordo com


a via de sinalizao intracelular por eles mediadas, em duas categorias funcionais (Tabela 22.1).
Os receptores M1, M3 e M5 so acoplados fosfolipase C associada membrana atravs das
protenas G da famlia Gq/11, insensveis toxina pertussis, induzindo a hidrlise do bifosfato de fosfatidilinositol (PIP2). A degradao do
PIP2 origina os segundos-mensageiros 1,4,5-trifosfato de inositol e diacilglicerol que, por sua vez,
mobilizam Ca2+ dos stios armazenadores intracelulares e ativam as protenas quinases C,
respectivamente. Os receptores M1, M3 e M5
podem acoplar-se tambm ativao das fosfolipases A2, C e D, tirosina quinase e ao influxo de
Ca2+. Os receptores do subtipo M2 e M4 so acoplados s protenas Gi/Go sensveis toxina-pertussis inibindo o acmulo de AMP cclico e
produzem aumento do influxo de K+ , inibio
dos canais de Ca2+ neuronais e aumento da fosfolipase A2.
Os receptores colinoceptivos nicotnicos, perifricos e centrais, pertencem classe dos re-

COLINOMIMTICOS E COLINOLTICOS

Tabela 22.1
Subtipos e Caractersticas dos Receptores Colinoceptivos Muscarnicos
Tipo de
Receptor

Outras Denominaes

Localizao

Sinalizao Intracelular

M1

M1a

Nervos

IP3, DAG

M2

M2a, M2 cardaco

Corao, nervos, msculo liso

Inibio do AMPcclico
Ativao de canais de K+

M3

M2b M2 glandular

glndulas, musc. liso endotlio

IP3, DAG

M4

SNC

Inibio da produo
de AMPcclico

M5

SNC

IP3, DAG

ceptores associados a canal inico e ativados por


neurotransmissores. Localizam-se na membrana plasmtica das fibras ps-ganglionares autonmicas parassimpticas e simpticas, na medula
da supra-renal e na membrana ps-juncional das
sinapses motoras perifricas. O receptor nicotnico encontrado na juno neuromuscular esqueltica (muscular) uma glicoprotena
transmembranar formada por quatro subunidades diferentes com uma estrutura quaternria 2
formando um poro central e com um stio
ligante de ACh em cada subunidade .
O receptor nicotnico localizado nas sinapses
ganglionares autonmicas e centrais (neuronal)
um pentmero formado por duas subunidades
transmembranares diferentes, e , e que delimitam um canal inico seletivo para ctions. As
subunidades , mas no as , so homlogas
subunidade do receptor nicotnico muscular.
Os genes do receptor nicotnico neuronal codificam pelo menos nove subtipos de receptores formados pelas subunidades (2 a 9) e trs
subtipos com as subunidades (2 a 4). As diferentes combinaes dessas subunidades originam
diversos subtipos de receptores caracterizados por
sua alta permeabilidade ao Ca2+.
As drogas colinomimticas podem exercer suas aes diretamente, por interao com
os receptores muscarnicos ou nicotnicos, ou
indiretamente, atravs da inibio da enzima
responsvel pela hidrlise da ACh, a acetilcolinesterase (AChE). Neste ltimo caso, a
permanncia da ACh liberada na fenda sinptica prolongada com conseqente aumento
da durao do efeito.

COLINOMIMTICOS

DE

AO DIRETA

Os colinomimticos de ao direta constituem os steres de colina, acetilcolina, metacolina, betanecol e carbacol, e os alcalides de origem
natural, muscarina, pilocarpina, nicotina e lobelina. Os steres de colina so compostos de
estrutura quaternria incapazes de atravessar a
barreira hematoenceflica sendo, portanto, desprovidos de ao no sistema nervoso central. A
acetilcolina exerce atividade tima nos receptores muscarnicos e nicotnicos, mas rapidamente hidrolisada pela AChE quando administrada
por via endovenosa. A metacolina e o betanecol
tm ao seletiva em receptores muscarnicos; a
metacolina, porm, rapidamente hidrolisada
pela AChE, enquanto que o betanecol menos
sensvel hidrlise enzimtica. O carbacol apresenta atividade semelhante nos receptores muscarnicos e nicotnicos e pouco sensvel
degradao pela AChE.
A muscarina uma amina quaternria pouco
absorvida no trato gastrointestinal, mas txica
quando ingerida. Os alcalides pilocarpina, nicotina e lobelina tm estrutura terciria e so prontamente absorvidos. A oxotremorina um
agonista muscarnico sinttico, com estrutura
terciria e potente ao no sistema nervoso central, utilizado como instrumento farmacolgico.
A dimetilfenilpiperazina (DMPP) um potente
estimulante dos receptores nicotnicos ganglionares de origem sinttica e estrutura quaternria.
Mecanismo de Ao
A ACh liberada das terminaes nervosas
parassimpticas pode interagir com receptores

281

Cap.

22

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

muscarnicos ps-juncionais produzindo seus


efeitos nos rgos efetores, ou interagir com receptores colinoceptivos muscarnicos ou nicotnicos pr-sinpticos (auto-receptores),
modulando sua prpria liberao.
Todos os receptores muscarnicos so acoplados protena G e a ativao desses receptores pelos agonistas pode produzir liberao de IP3
e DAG, os quais induzem liberao de Ca2+ do
retculo endoplasmtico ou sarcoplasmtico e
abertura dos canais de clcio em msculo liso,
respectivamente. Outros mecanismos intracelulares desencadeados por ativao dos receptores muscarnicos incluem aumento das
concentraes de GMPc, aumento do fluxo de
potssio e diminuio da atividade da adenilil ciclase (Tabela 22.1).
Efeitos Farmacolgicos
Os efeitos farmacolgicos dos colinomimticos muscarnicos so os mesmos decorrentes da ativao dos receptores muscarnicos.
Cap.

22

Os colinomimticos muscarnicos produzem,


no olho, contrao dos msculos esfintrico da
ris (miose) e ciliar, permitindo a acomodao
visual para distncias curtas. Esses efeitos favorecem o efluxo do humor aquoso pelo canal de
Schlemm e a drenagem da cmara anterior.
No sistema cardiovascular a ACh e anlogos reduzem a resistncia vascular perifrica e a
freqncia dos batimentos cardacos. A injeo
endovenosa de ACh produz vasodilatao e conseqente hipotenso acompanhada por taquicardia reflexa. O efeito vasodilatador da ACh
relacionado liberao de xido ntrico (NO)
das clulas vasculares endoteliais, produzindo relaxamento da musculatura lisa vascular. Este efeito mediado por ativao da guanilil ciclase e
aumento do GMP cclico. A maioria dos vasos
sangneos, no entanto, no tem inervao parassimptica de forma que a funo dos receptores muscarnicos nos vasos desconhecida.
No msculo cardaco, a ativao dos receptores M2 reduz a freqncia e a fora de
contrao. Esta ao mediada pela protena
Gi produzindo inibio da adenilil ciclase e efeito inotrpico negativo. As subunidades ( ) da
Gi aumentam a condutncia das fibras cardacas ao potssio produzindo bradicardia e hiperpolarizao.

282

A ACh estimula as secrees glandulares


produzindo contrao da musculatura lisa por
ativao dos receptores M3 acoplados formao de IP3 e DAG. O IP3 aumenta a concentrao de Ca 2+ citoslico, desencadeando a
contrao muscular ou secreo glandular. A
injeo endovenosa de ACh produz vasodilatao indiretamente por liberao de NO das clulas endoteliais vasculares.
Outros efeitos dos colinomimticos muscarnicos incluem broncoconstrio e aumento das
secrees em geral (salivar, lacrimal, sudorpara, traqueobrnquica e gstrica), aumento da
motilidade gastrointestinal, contrao do msculo detrusor da bexiga urinria e relaxamento
dos msculos do trgono e esfinctrico.
No sistema nervoso central as vias colinrgicas esto relacionadas aos processos cognitivos, de memria e aprendizagem e seu
comprometimento associado a doenas degenerativas e demncia senil. Os mecanismos de
sinalizao intracelular mediados pelos receptores M1 e M3 regulam as protenas precursoras
de amilide, principal constituinte das placas que
se depositam nos vasos cerebrais dos portadores do mal de Alzheimer. Embora o efeito estimulante central da nicotina inalada no tabaco
seja conhecido, a funo real dos receptores nicotnicos no sistema nervoso central no est
bem estabelecida ainda.
Os colinomimticos muscarnicos so utilizados por instilao local para o tratamento do
glaucoma. A pilocarpina a droga de escolha devido sua estrutura terciria o que facilita sua
absoro. O carbacol e o betanecol so indicados
para estimular o esvaziamento da bexiga urinria
em certos quadros neurolgicos ou aps cirurgias que comprometem o esvaziamento vesical.
COLINOMIMTICOS DE AO INDIRETA
A ACh liberada das terminaes nervosas
colinrgicas degradada pela AChE, uma protena de 320 kDa associada membrana basal
da fenda sinptica. A butirilcolinesterase (BuChE) outra colinesterase encontrada no plasma, no fgado, na pele, no crebro e na
musculatura lisa intestinal e que tem como substrato especfico a butirilcolina.
Os colinomimticos de ao indireta produzem seus efeitos farmacolgicos inibindo a

COLINOMIMTICOS E COLINOLTICOS

AChE, prolongando a meia vida e as aes da


ACh nas sinapses colinrgicas. O centro ativo
da AChE apresenta um stio aninico contendo um resduo de glutamato e um stio estersico com um anel imidazlico de histidina e
uma serina hidroxilada. A hidrlise enzimtica
ocorre aps a ligao da ACh com o stio ativo
da enzima com conseqente liberao da colina, permanecendo a enzima acetilada. Na etapa
seguinte ocorre hidrlise espontnea do grupamento serina-acetila. A velocidade de hidrlise
da ACh rpida e maior que 10.000 molculas/
segundo em um nico stio ativo.

O uso dos inibidores da colinesterase indicado principalmente para o tratamento do glaucoma e da miastenia gravis.

Os inibidores da colinesterase so divididos


em trs grupos principais: 1) Compostos contendo um grupamento amnio quaternrio
(edrofnio) que se ligam reversivelmente ao stio aninico e com curta durao de ao (2 -10
min). 2) steres do cido carbmico contendo
grupamentos de amnio tercirio (fisostigmina)
ou quaternrio (neostigmina, piridostigmina).
So substratos da enzima e so hidrolizados de
forma anloga a ACh, mas mais lentamente (0,56 h). Os carbamatos apresentam tambm atividade agonista, desensibilizante e bloqueadora do
receptor nicotnico/canal inico. 3) Compostos
organofosforados (ecotiofato, isofluorato) que
interagem com o stio ativo da enzima atravs
de ligao covalente, estvel, sofrendo hidrlise
extremamente lenta. Por esta razo so considerados inibidores irreversveis. So compostos lipossolveis e extremamente txicos, usados
como inseticidas (paration, malation), ou como
gases de nervo (sarin, tabun) em armas qumicas. A exposio crnica a certos organofosforados produz neuropatia associada
desmielinizao de axnios. A pralidoxima
um composto reativador da colinesterase que
apresenta um nitrognio quaternrio capaz de
se ligar ao stio aninico da enzima e restaurar sua atividade cataltica. indicado nos casos de envenenamento por organofosforados,
preferencialmente antes do processo de envelhecimento da enzima, quando ela ainda suscetvel reativao.

So exemplos de drogas parassimpatolticas


a atropina (hiosciamina) e a escopolamina (hioscina) que so alcalides de estrutura terciria,
extrados da Atropa belladona e do hyoscyamus
niger, respectivamente. Esses compostos interagem competitivamente com os receptores muscarnicos centrais e perifricos, bloqueando as
aes muscarnicas. A atropina no discrimina
os subtipos de receptores M1, M2 e M3, enquanto que o anlogo sinttico, pirenzepina seletivo
para os receptores M1.

Os efeitos farmacolgicos produzidos pelos


inibidores de colinesterase so semelhantes aos
produzidos pelos colinomimticos de ao direta, principalmente aqueles relacionados s aes
nos sistema cardiovascular e gastrointestinal, no
olho e na juno neuromuscular esqueltica.

DROGAS COLINOLTICAS
As drogas colinolticas atuam antagonizando as aes da ACh e anlogos nos receptores muscarnicos (parassimpatolticos) e
nos receptores nicotnicos dos gnglios autonmicos simpticos e parassimpticos (ganglioplgicos), ou da juno neuromuscular
esqueltica (curares).

Esses compostos atravessam a barreira hematoenceflica e produzem efeitos centrais como


pequena sedao (atropina) ou estimulao
quando em altas doses (escopolamina).
Perifericamente, a atropina e anlogos bloqueiam os efeitos produzidos por estimulao
das fibras parassimpticas na musculatura lisa,
no msculo cardaco e nas glndulas. Esses efeitos consistem de aumento da freqncia dos
batimentos cardacos no ndulo sinoatrial, sem
alterao do tnus vascular, uma vez que os vasos so desprovidos de inervao parassimptica. A atropina e anlogos, no entanto, bloqueiam
os efeitos muscarnicos da ACh administrada
endovenosamente. Alm disso, produzem midrase, cicloplegia e diminuio da secreo lacrimal; broncodilatao e diminuio das secrees
traqueobrnquicas, diminuio da motilidade
intestinal, das secrees salivares e gastrointestinais; reduo da sudorese; relaxamento da
musculatura lisa dos ureteres e da bexiga urinria reduzindo o esvaziamento vesical.
As drogas parassimpatolticas tm seu uso
indicado para o tratamento da cinetose, nos exames clnicos oftalmolgicos e na pr-anestesia
para reduzir as secrees traqueobrnquicas esti-

283

Cap.

22

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

muladas por anestsicos irritantes, como o ter.


Para reduo das descargas vagais que acompanham as dores associadas ao infarto do miocrdio; no controle da hipermotilidade intestinal,
do espasmo vesical e da incontinncia urinria;
no envenenamento por inseticidas fosforados. O
ipratropium, anlogo sinttico de estrutura quaternria, usado na asma, por via inalatria, para
produzir broncodilatao com menores efeitos
parassimpatolticos generalizados.
Os principais efeitos indesejados de doses
teraputicas da atropina e anlogos so: reteno urinria, secura da boca, cicloplegia, midrase, anidrose e taquicardia.

Cap.

22

284

BIBLIOGRAFIA
1. Eglen RM, Reddy H, Watson N, Challiss RAJ. Muscarinic
acetylcholine receptor subtypes in smooth muschle.
Trends. Pharm. Sci, 15:114-119, 1994.
2. Galzi J-L, Revah F, Bessis A, Changeux J-P. Functional
architecture of the nicotinic acetylcholine receptor:
from electric organ to brain. Annu. Rev. Pharmacol,
31:37-72, 1991.
3. McGehee DS, Role LWP. Physiological diversity of
nicotinic acetylcholine receptors expressed by
vertebrate neurons. Annu. Rev. Physiol. 57:521-546,
1995.
4. Taylor P. Agents acting at the neuromuscular junction
and autonomic ganglia. In: Goodman & Gilmans
The Pharmacological Basis of Therapeutics. 9th Ed.
McGraw-Hill, New York, ed. JG Hardman, LE
Limbird, PB Molinoff, RW Ruddon, AG Gilman. pp.
899-936, 1995.

ANESTSICOS LOCAIS

Anestsicos Locais
Caden Souccar

Os anestsicos locais so drogas que inibem


as sensaes de dor por inibirem a propagao
do potencial de ao no local de sua aplicao.
Nas membranas das clulas nervosas e musculares, a propagao do potencial de ao est
relacionada presena de canais de Na+ e K+
dependentes de voltagem. Esses canais so protenas de membrana com estrutura semelhante,
mas com seletividade inica diferente. A despolarizao da membrana nervosa (-60mV a 40mV) ativa os canais de Na+ dependentes de
voltagem, levando sua abertura e ao influxo do
Na+ aumentando sua condutncia por 1-2ms.
Ao atingir o potencial de equilbrio do on
(+40mV), os canais de Na+ inativam lentamente enquanto os canais de K+ dependentes de voltagem so ativados, permitindo o efluxo de K+.
Esses ltimos so inativados aps 5-10ms produzindo uma hiperpolarizao rpida. O potencial de repouso da membrana finalmente
restaurado pela ao da ATPase dependente de
Na+ e K+ (Na+,K+-ATPase).
O canal de Na+ purificado do crebro humano um complexo protico heterotrimrico
formado por trs subunidades: (260kDa),
1(36kDa) e 2 (33kDa). As trs subunidades
expostas superfcie externa apresentam intensa glicosilao. O canal de Na+ do msculo esqueltico no apresenta a subunidade 2,
enquanto o da placa do peixe eltrico formado
apenas pela subunidade . A subunidade con-

tm domnios homlogos (I a IV) cuja disposio na membrana delimita o poro do canal de


Na+. Cada domnio formado por seis segmentos transmembranares (S1-S6). A abertura do
canal dependente de voltagem atribuda a alteraes conformacionais resultantes dos movimentos dos sensores de voltagem produzidos pelas
alteraes do potencial transmembrana. O sensor de voltagem localiza-se na regio S4, que
hidrofbica e contm resduos com carga positiva (Fig. 24.1).
A densidade e a distribuio dos canais de
Na+ na membrana diferem entre os axnios mielinizados e no-mielinizados. Nos axnios nomielinizados, os canais de Na+ so distribudos
uniformemente (20 canais/m2), enquanto nos
axnios mielinizados esses canais esto agrupados (104 canais/m2) nos ndulos de Ranvier .
Os canais de K+ dependentes de voltagem
so formados por quatro subunidades , contendo cada uma seis segmentos transmembranares (S1-S6) com grupamentos N-terminal e
C-terminal intracelulares (Fig. 24.1). Uma regio especializada entre S5 e S6 forma a parte
essencial do poro do canal de K+. O segmento
S4 parte importante do sensor de voltagem
semelhana do observado nos canais de Na+ e
de Ca2+.
Os anestsicos locais so bases fracas com
pKa entre 8 e 9, que se dissociam em pH fisio-

289

Cap.

24

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

lgico. A estrutura qumica bsica do grupo consiste de um grupamento aromtico, lipoflico e


uma amina secundria ou terciria, hidroflica,
interligados por uma cadeia intermediria formada por um grupamento ster ou amida. Com
base na presena de um desses ltimos grupamentos, os anestsicos locais so classificados
em derivados steres ou amidas.
Os compostos steres (procana, cocana, tetracana) so rapidamente hidrolisados pela colinesterase plasmtica, apresentando a maioria
durao de ao curta. Os derivados amida (lidocana, prilocana e bupivacana) so mais estveis e com maior meia-vida plasmtica.

MECANISMO

DE

AO

Um primeiro mecanismo de ao proposto


atribui o bloqueio dos canais de sdio natureza lipoflica dos anestsicos locais, permitindo sua incorporao na membrana da clula
nervosa, ou presso exercida por essas drogas na membrana, reduzindo o poro do canal e
alterando o fluxo inico (teoria da expanso da
membrana).
Cap.

A segunda hiptese assume a presena de


receptor para o anestsico local no canal de sdio, acessvel pela face interna da membrana. A
interao com esse stio ocorreria com a forma
protonada da molcula liberada aps penetrao
axonal dos anestsicos locais na forma de base
livre lipossolvel e sua posterior dissociao. A
forma protonada interage com um receptor no
canal de sdio acessvel pela face interna da membrana, bloqueando a condutncia e o potencial
de ao. O efeito proporcional concentrao
da droga e ao nmero de canais de Na+ bloqueados, observando-se inicialmente aumento do limiar de excitabilidade, diminuio da velocidade
de conduo, diminuio da amplitude do potencial de ao e, finalmente, bloqueio do potencial
de ao. O bloqueio dependente de voltagem e
do tempo de exposio droga, observando-se
bloqueio mais rpido com altas freqncias de
disparo do potencial de ao.
Alm de reduzir a condutncia ao Na+, os
anestsicos locais podem tambm reduzir o aumento da condutncia ao K+, prolongando a fase
de repolarizao da membrana. Este efeito, no
entanto, no est relacionado inibio do potencial de ao propagado.

24
A

Canal de sdio dependente de voltagem

Canal de potssio dependente


de voltagem
Fig. 24.1 Estruturas propostas dos canais de sdio (A) e de potssio dependentes de voltagem (B). Em detalhe, os
quatro domnios transmembranares da subunidade do canal de sdio.

290

ANESTSICOS LOCAIS

Tabela 24.1
Sensibilidade das Fibras Nervosas aos Anestsicos Locais
Dimetro (m)

Velocidade de
Conduo (m/s)

Sensibilidade
ao Bloqueio

12-20
5-12
3-6
2-5

70-120
30-70
15-30
12-30

+
++
++
+++

<3

3-15

++++

Dor, temperatura, tato

0,4-1,2

0,5-2,3

++++

Ps-ganglionares

0,3-1,3

0,7-2,3

++++

Fibras Nervosas

Funo

Tipo A
(mielinizada)
(mielinizada)
(mielinizada)
(mielinizada)

Propriocepo, motora
Tato, presso
Fuso muscular
Dor, temperatura, tato

Tipo B
(ligeira mielin.)
Tipo C
Raiz dorsal
(no-mielin.)
Simpticas
(no-mielin.)

Autonmica
pr-ganglionar

EFEITOS NAS FIBRAS NERVOSAS


O bloqueio da conduo nervosa pelos anestsicos locais est relacionado ao dimetro do
nervo e ao seu grau de mielinizao. Em geral,
essas drogas bloqueiam a conduo nervosa de
fibras de menor dimetro mais rapidamente que
as de maior dimetro, mas as fibras mielinizadas so mais sensveis que as no-mielinizadas
de igual dimetro (Tabela 24.1).
Os anestsicos locais so utilizados por:
Aplicao tpica em membranas de mucosas nasal, oral, na rvore traqueobrnquica
e uretral. Neste caso so associados a vasoconstritores (adrenalina principalmente)
para reduzir o sangramento e induzir retrao tissular.
Aplicao por infiltrao que consiste na injeo dos anestsicos locais sob a pele.
Para produzir bloqueio regional na anestesia espinhal (bloqueio subaracnide) e epidural. A anestesia espinhal consiste na
produo de bloqueio regional por aplicao do anestsico local diretamente no lquido espinhal.
Anestesia lombar epidural consiste no
bloqueio da conduo nervosa na mesma
regio atingida pela anestesia espinhal, mas
a droga administrada fora da dura mter.

Anestesia caudal extradural, consiste na


aplicao do anestsico na regio da cauda
equina.
Bloqueio endovenoso de extremidade consiste na injeo endovenosa do anestsico
local para produzir anestesia de um membro aps aplicao de um torniquete para
evitar o retorno venoso.
Bloqueio simptico para produzir bloqueio
de inervao simptica mediante a aplicao em gnglios simpticos (ggl. estrelado,
T1) para reduzir espasmos vasculares de
extremidades.
Controle de arritmia cardaca. A procainamida e a lidocana so as principais drogas
utilizadas no tratamento das arritmias cardacas. Anlogos dos anestsicos locais ativos por via oral (ex. mexiletina) so usados
tambm como antiarrtmicos. So mais efetivos no tratamento das arritmias ventriculares do que das de origem atrial.

EFEITOS INDESEJADOS
Os principais efeitos indesejados dos anestsicos locais so relacionados s suas aes
centrais e cardiovasculares. Os principais efeitos centrais consistem de estimulao, confuso mental, irritao e tremores, podendo
evoluir a convulso e depresso dos centros

291

Cap.

24

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

medulares como ocorre com a procana. O


nico anestsico local com ao diferente a
cocana que produz euforia, provavelmente relacionada sua ao inibidora da recaptao
de catecolaminas.
A lidocana e prilocana tm menos efeitos
centrais.
Os efeitos cardiovasculares consistem de depresso do miocrdio, vasodilatao e reduo
da contratilidade do miocrdio, indiretamente
por inibio da corrente de Na+. O influxo de
Na+ reduzido levando a uma diminuio da
concentrao de sdio intracelular que por sua
vez reduz o Ca2+.

Cap.

24

292

Produzem vasodilatao por ao direta


muscular e por inibio do sistema nervoso simptico, o que contribui para a reduo da presso arterial.
Reaes de hipersensibilidade ocorrem com
maior freqncia com os derivados steres.

BIBLIOGRAFIA
1. Catterall W, Mackie K. Local anesthetics. In: Goodman
& Gilmans. The Pharmacological Basis of
Therapeutics. 9th Ed. McGraw-Hill, New York, ed.
J. G. Hardman, L. E. Limbird, P. B. Molinoff, R. W.
Ruddon and A G. Gilman. P. 331- 347, 1995.
2. Robertson B. The real life of voltage-gated K+ channels:
more than model behaviour. Trends Pharmacol Sci.
18:474-483, 1997.

ANTI-HIPERTENSIVOS

Anti-hipertensivos
Maria Teresa R. Lima-Landman

A correlao internacionalmente descrita


entre nveis pressricos e incidncia de patologias de alta morbidade e mortalidade como acidentes vasculares cerebrais, infarto, insuficincia
cardaca ou renal, indica a necessidade de controle agressivo da hipertenso em homens e
mulheres. A hipertenso leve sem comprometimento de rgos vitais pode se beneficiar da simples mudana dos hbitos de vida, mas a
hipertenso moderada e a grave necessitam de
tratamento medicamentoso.
No entanto, como na maioria dos pacientes a hipertenso assintomtica, a aderncia
ao tratamento farmacolgico prolongado, s vezes caro e com eventuais efeitos colaterais , em
geral, pequena.
Todos os medicamentos anti-hipertensivos apresentam efeitos colaterais em maior
ou menor nmero. A escolha de uma droga
especfica deve ser feita, portanto, segundo
critrios indicados pelo quadro clnico.
No sendo a situao urgente como, por
exemplo, na hipertenso maligna acompanhada
por leso de rgo, o esquema de tratamento
farmacolgico usualmente adotado o proposto em 1980 pela JNCHBP (Joint National Commission on High Blood Pressure) e adotado no
VI Report of the Joint National Committee on
prevation, detection, evaluation, and treatment
of high blood pressure (1997). Neste esquema,

tambm conhecido como Terapia em Etapas, o


tratamento iniciado com uma nica droga, na
maioria das vezes um diurtico. Dependendo da
resposta do paciente, uma segunda droga de
mecanismo de ao diferente associada. Se ainda assim no ocorrer o efeito teraputico esperado, uma terceira droga pode ser associada ao
tratamento.
Diversas classes de drogas anti-hipertensivas esto disponveis no mercado, cada uma com
um mecanismo de ao especfico (Fig. 25.1).
Os diurticos so teis pois aumentam a excreo de solutos e de lquido. Vrios bloqueadores
ou inibidores do sistema nervoso simptico so
utilizados. Os vasodilatadores diretos so empregados como anti-hipertensivos, pela diminuio da resistncia perifrica que produzem.
Recentemente foram introduzidos na terapia
anti-hipertensiva os bloqueadores da enzima conversora de angiotensina (ECA) e os bloqueadores dos receptores de angiotensina do tipo AT1.

DIURTICOS
Os diurticos foram durante dcadas as
principais drogas utilizadas no tratamento antihipertensivo. A incidncia de acidentes vasculares cerebrais (40%) e a de patologias cardacas
relacionadas hipertenso (16%) foi reduzida
dramaticamente com o uso dos diurticos.

293

Cap.

25

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Bloqueadores -Adrenrgicos
1/ 2 - Propranolol
1 seletivo - Atenolol

Simpatolticos de Ao Central
Clonidina
Metildopa
Reserpina

Diurticos
Tiazidas
Furosemide
Poupadores de K+

PA = DC RP

Angiotensinognio
renina
Angiotensina I

Bloqueadores do Receptor AT1

ECA
ACh

Losartan

Endotlio

5- HT

ACh
ACh

S1

COX

ADP

NOS

BK

Angiotensina II

L-arg

Inibidores da ECA
Captopril
Enalapril

NO

Msculo Liso

Na+

Ca2+ AT II

ET 1
ET A
ET
ETB

K+

Ca2+

Contrao

GMPc

AMPc

Relaxamento

Fig. 25.1 Locais e mecanismos de ao das principais classes de drogas anti-hipertensivas.

Cap.

25

O mecanismo pelo qual os diurticos reduzem a presso arterial no est totalmente elucidado. A queda inicial da presso arterial
atribuda a uma diminuio do volume sangneo, do retorno venoso e, conseqentemente, do
trabalho cardaco. Gradativamente, o trabalho
cardaco retorna ao normal, mas a resistncia
perifrica diminuda mantm o efeito hipotensor. A associao entre o baixo custo e a facilidade de administrao faz com que os diurticos
sejam amplamente utilizados sozinhos ou em associao com outras drogas nos hipertensos leves e moderados.
Trs classes de diurticos so usadas preferencialmente na hipertenso: 1) tiazidas, 2)
diurticos de ala e 3) poupadores de potssio,
cujos mecanismos de ao foram descritos detalhadamente no Captulo 26.
Fadiga, depresso, irritabilidade, incontinncia urinria, impotncia, perda da libido e reaes alrgicas constituem os efeitos colaterais
principais dos diurticos. Os diurticos podem
precipitar crises de gota, diabetes melito e aumentar os nveis plasmticos de colesterol.

294

SIMPATOLTICOS
Os medicamentos pertencentes a essa classe
de hipotensores anti-hipertensivos agem por bloquear a transmisso simptica eferente tanto central como perifrica. Os efeitos colaterais que
muitas vezes incapacitam o paciente para a vida
cotidiana restringem o uso de simpatolticos de
ao central.
A -metildopa uma pr-droga que nos terminais nervosos adrenrgicos transformada em
-metilnoradrenalina com alta afinidade pelos
receptores adrenrgicos do tipo 2, moduladores inibitrios das eferncias simpticas. A clonidina agonista adrenrgico 2>1 e tem o
mesmo mecanismo de ao da -metildopa. A
ao da reserpina bem menos seletiva. Depletando os terminais simpticos, serotoninrgicos
e dopaminrgicos centrais e perifricos, a reserpina produz aes mltiplas que reduzem o seu
uso aos pacientes refratrios aos outros agentes
anti-hipertensivos.
Os bloqueadores -adrenrgicos so os simpatolticos mais utilizados no controle da presso
arterial. Inicialmente a presso arterial reduzida

ANTI-HIPERTENSIVOS

por bloqueio dos receptores -adrenrgicos e por


diminuio do dbito cardaco. Com a continuidade do tratamento, o dbito cardaco volta ao
normal, porm o efeito anti-hipertensivo persiste
porque permanecem bloqueados os receptores adrenrgicos envolvidos na liberao de renina pelas clulas justaglomerulares. Com a diminuio
da concentrao de angiotensina II circulante, o
tnus vascular e a resistncia perifrica so reduzidos. No caso do propranolol (bloqueador 1/
2, no seletivo, lipossolvel), soma-se a estas
aes um provvel efeito ansioltico.
Os bloqueadores 1/2 no seletivos apresentam como desvantagem a induo de crises
asmticas por bloqueio dos receptores 2 pulmonares. Este efeito colateral menor com os
bloqueadores seletivos 1 (atenolol, metoprolol)
que atuam predominantemente nos receptores
1 cardacos.
Os efeitos colaterais tambm so vrios: os
bloqueadores -adrenrgicos tendem a diminuir
a concentrao plasmtica de HDL-colesterol,
efeito mais marcante em fumantes. Fadiga e letargia so os efeitos centrais mais comuns dos
bloqueadores . Alguns indivduos relatam sonhos e pesadelos, depresso e perda de memria. A capacidade de exerccio pode ser reduzida.
Extremidades frias, diminuio da funo cardaca, problemas gastrointestinais e impotncia
so tambm descritos com o uso de bloqueadores .

VASODILATADORES
Inibidores da Enzima Conversora de
Angiotensina I (ECA) Captopril e
Similares
A inibio da ECA, enzima envolvida na sntese de angiotensina II, peptdeo com potente
ao vasoconstritora, diminui a resistncia perifrica e, conseqentemente, a presso arterial.
Os inibidores da ECA, como o captopril,
mostraram-se efetivos em aumentar a expectativa de vida dos pacientes com insuficincia
cardaca, no tratamento de ataques cardacos
e no retardamento da progresso da insuficincia renal nos pacientes com leso renal. Estudos demonstraram que os inibidores da ECA
revertem a hipertrofia ventricular esquerda de
forma melhor do que os bloqueadores ,

diurticos e, possivelmente, que os bloqueadores de canal de clcio.


Tosse, queda excessiva da presso arterial
e reaes alrgicas foram descritas em pacientes recebendo inibidores da ECA. Apesar
de os inibidores de ECA protegerem contra doenas renais, eles podem causar reteno de
potssio, o que pode levar parada cardaca
especialmente em pacientes recebendo diurticos poupadores de potssio ou suplementao de potssio. Hipoglicemia pode ser
tambm observada, devendo-se tomar cuidado quando da sua utilizao em pacientes diabticos. Granulocitopenia, efeito colateral raro
e severo, foi observada, sendo minimizada com
a reduo da dose.

Bloqueadores do Receptor de
Angiotensina II (AT1) Losartan e Similares
As primeiras drogas bloqueadoras do receptor de angiotensina, por serem peptdicas,
tinham seu uso restrito ao ambiente hospitalar. O descobrimento de novas substncias de
origem no peptdica com esta atividade, como
o losartan por exemplo, aumentou o uso ambulatorial desta classe de drogas. Os inibidores do receptor AT1 diminuem a presso arterial
por competirem com a angiotensina II pelo seu
receptor. A tosse induzida pelos inibidores da
ECA no observada com esta classe de drogas talvez por no afetarem a degradao de
bradicinina.

ANTAGONISTAS
SIMILARES

DE

CLCIO NIFEDIPINA

O clcio o mediador final na contrao da


clula muscular lisa. Sem aumento da concentrao citoslica de clcio no h contrao
muscular, seja ela decorrente de ativao de receptores -adrenrgicos via IP3, ou por despolarizao da membrana celular e abertura de canais
de clcio voltagem-dependentes do tipo L.
Os bloqueadores dos canais de clcio (nifedipina e similares), tambm conhecidos como
antagonistas de clcio, ligam-se aos canais de
clcio do tipo L impedindo a entrada de clcio
na clula o que leva ao relaxamento da musculatura lisa vascular, reduo da resistncia vascular perifrica e diminuio da presso arterial.

295

Cap.

25

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Apesar do custo mais elevado, a eficcia


dos bloqueadores de clcio similar dos bloqueadores -adrenrgicos e das tiazidas.
Os seus efeitos colaterais mais comuns so tonturas, hipotenso, vermelhido e edema de tornozelo. Fadiga, impotncia e constipao tambm
foram observadas em pacientes sob medicao com
antagonistas de clcio.

ANTAGONISTAS -ADRENRGICOS
PRAZOSIN E DOXAZOSIN
Os antagonistas -adrenrgicos (prazosin e
doxazosin) promovem vasodilatao por bloqueio
seletivo dos receptores 1. Por sua ao seletiva,
estes compostos no causam taquicardia, mas
podem causar hipotenso postural que pode ser
severa aps a primeira dose do medicamento.

ATIVADORES DO CANAL DE POTSSIO


MINOXIDIL

Cap.

25

O minoxidil abre canais de potssio sensveis ao ATP. A sada de potssio por estes canais
leva hiperpolarizao da clula e, em conseqncia, ao relaxamento vascular, diminuindo a
presso arterial. A ocorrncia de hipertricose
contra-indica o seu uso em mulheres.

296

LIBERADORES DE XIDO NTRICO (NO)


NITROPRUSSIATO DE SDIO
Crises hipertensivas agudas so tratadas geralmente com a administrao endovenosa de
substncias vasodilatadoras potentes. O nitroprussiato de sdio se decompe no sangue liberando
xido ntrico (NO), um composto altamente instvel e que, uma vez dentro da clula muscular
lisa, estimula a enzima guanilato ciclase, aumentando a concentrao intracelular de GMPc que
leva ao relaxamento da clula.

BIBLIOGRAFIA
1. Hypertension control. Report of WHO expert committee.
WHO Technical Repor Series, 862, 1996.
2. Oates JA. Antihypertensive agents and drug therapy of
hypertension. In: Goodman & Gilmans. The
Pharmacological Basis of Therapeutics, 9 th ed.
McGraw-Hill, pp 780-808, 1996.
3. The sixth report of the Joint National Committee on
prevation, detection, evaluation, and treatment of
high blood pressure. Arch. Intern. Med. 157:24132446, 1997.
4. Recomendations updated for hypertension. Harvard
Health Letter 23(3):6-7, 1998.
5. Ribeiro AB. Tratamento Clnico da Hipertenso Arterial.
In Atualizao Teraputica Manual prtico de
diagnstico e tratamento. 2nd.ed. eletrnica, CISEPM, 1998.
6. Fuchs FD. Frmacos anti-hipertensivos. In: Farmacologia
Clnica. Fundamentos da Teraputica Racional. 2nd
ed. Editora Guanabara/Kogan, pp. 431-443, 1998.

DIURTICOS

Diurticos
Maria Teresa R. Lima-Landman

Os diurticos constituem um dos grupos de


drogas mais prescritos na prtica mdica. So
empregados em diversas situaes clnicas, algumas de alta prevalncia como a hipertenso
arterial, a insuficincia cardaca, a insuficincia
renal, a sndrome nefrtica e a cirrose heptica.

porte Na+- Cl-). Este ltimo critrio ser o adotado neste captulo (Fig. 26.1).

Os diurticos agem nos rins aumentando o


volume urinrio. Entretanto, para sua ao teraputica, devem aumentar tambm a concentrao de solutos eliminados, principalmente de
NaCl (natriurticos). Como ao colateral, os
diurticos modificam, em maior ou menor grau,
a reabsoro/excreo de ctions (K+, H+, Ca++
e Mg++), de nions (Cl-, HCO3- e HPO4-) e de
cido rico.

A acetazolamida age no tbulo contorcido


proximal, inibindo tanto a enzima anidrase carbnica ligada s membranas luminal e basolateral (anidrase carbnica tipo IV) como a
citoplasmtica (anidrase carbnica tipo II), levando a um bloqueio da reabsoro de NaHCO3.
Produzem um aumento rpido na excreo de
HCO3-, inibio da acidez titulvel e da secreo de amnia no ducto coletor, com conseqente aumento do pH urinrio e acidose metablica.
A atividade diurtica dos inibidores da anidrase
carbnica autolimitada porque a excreo de
HCO3- gera acidose metablica fazendo com que
a quantidade de HCO3- filtrado seja tambm reabsorvida, cessando o efeito diurtico.

Os mecanismos de ao dos diurticos so


muito estudados, a ponto de alguns stios de interao de drogas no nfron j terem sido identificados e clonados.
Os diurticos podem ser classificados de
acordo com diversos critrios como: local de
ao (por exemplo: diurticos de ala), eficcia (por exemplo: diurticos de alto teto), estrutura qumica (por exemplo: diurticos
tiazdicos), semelhana de ao (por exemplo:
diurticos tiazdicos-smile), efeito na excreo
de potssio (por exemplo: diurticos poupadores de potssio), tipo de diurese produzida (por
exemplo: diurticos osmticos) ou mecanismo
de ao (por exemplo: inibidores do co-trans-

INIBIDORES DA ANIDRASE CARBNICA


(ACETAZOLAMIDA)

Com o advento de compostos mais ativos e


especficos, os inibidores da anidrase carbnica,
cujo prottipo a acetazolamida, passaram a ter
emprego limitado como diurtico. No entanto,
como esta enzima est presente em vrios stios
como: olhos, SNC, pncreas, mucosa gstrica e
eritrcitos, os efeitos extra-renais da acetazolamida continuaram a ter importncia teraputica, como, por exemplo, na reduo da presso

297

Cap.

26

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Lumem

K+

Na+

K+

Na+

H+

Na+
K+

Inibidores do Co-transporte

Na +-

Clula Tubular

H+

ac

Na +

Diurticos Tiazdicos

Inibidores do Canal de Na +
Amiloride
Triantereno

Cl Cl -

Aldosterona
+

Na

Antagonistas da aldosterona
Espironolactona

Inibidores da Anidrase Carbnica


Aceta zolamida

K+ Na+Na+ HCO32 Cl -

HCO3H + H2CO3
Na+

Clula Tubular

CO2

ac
Na+

Lumem

H+ + H2CO 3
HCO3-

K+

H2O

ac
CO2
+

H2O

Na+ , K+

Na+

Inibidores do Co-transporte Na +-K+ -2 Cl Furosemide

Fig. 26.1 Locais e mecanismos de ao dos diurticos.

Cap.

26

intra-ocular no glaucoma, na reduo da produo de liquor e na epilepsia.

deve ser sempre considerada j que potencialmente grave em indivduos com insuficincia
cardaca medicados com digitlicos.

INIBIDORES DO CO-TRANSPORTE
NA+- CL- (CLOROTIAZIDA E SIMILARES)

Diversos diurticos tiazdicos como a clorotiazida e a hidroclorotiazida so encontrados no


mercado. Como apresentam o mesmo mecanismo de ao diurtica, a diurese mxima produzida pelos diurticos tiazdicos a mesma,
diferindo apenas quanto potncia e farmacocintica.

Os diurticos pertencentes a esta classe, apesar de no serem os mais potentes, so os de


primeira escolha no tratamento da hipertenso
arterial, tanto como monoterapia como em associao com outras drogas anti-hipertensivas.
As tiazidas produzem diurese por inibirem
o co-transporte Na+-Cl- na membrana basal do
tbulo contorcido distal, provavelmente no stio de ligao de Cl-. Este co-transportador
constitudo por 1.023 aminocidos, possui 12 domnios transmembrana provveis e longos domnios no-hidrofbicos NH2- e COOH-terminais.
A inibio do co-transportador de Na+-Claumenta a excreo destes dois ons levando a
uma maior apresentao de sdio nos stios distais de troca por K+ e H+, o que pode levar
hipopotassemia e alcalose metablica. A diminuio da concentrao de potssio plasmtico

298

Sedao, impotncia e rashes cutneos podem ser observados em pacientes sob medicao tiazdica. Entretanto, os principais efeitos
adversos so metablicos, isto , hipopotassemia, hiperuricemia, hiperglicemia e hipercolesterolemia.

INIBIDORES DO CO-TRANSPORTE
NA+- K+- 2 CL- (FUROSEMIDA)
Pertencem a esta classe os diurticos mais
potentes disponveis atualmente: furosemida,
cido etacrnico e bumetanida. Estas drogas so
utilizadas principalmente para reduzir o edema

DIURTICOS

perifrico e pulmonar na insuficincia cardaca


moderada ou grave. Ao contrrio dos diurticos
tiazdicos, so eficazes em pacientes hipertensos com comprometimento renal.
A ao diurtica da furosemida decorrente
da inibio do co-transporte Na+- K+- 2 Cl- na
membrana luminal do segmento espesso da ala
de Henle, diminuindo a reabsoro de Na+ e,
conseqentemente, de Cl- e de gua. Como o segmento espesso da ala de Henle tem alta capacidade de reabsoro de Na+, drogas que atuam
neste local possuem alta potncia diurtica. O cotransportador Na+- K+- 2 Cl- constitudo por
1.099 aminocidos, tem 12 hlices transmembrana e pores amino- e carboxiterminais intracelulares. Existem evidncias de que o mecanismo
molecular desta inibio ocorre por interao da
furosemida com o stio de ligao do cloreto. Em
decorrncia da inibio do co-transportador, mais
sdio apresentado aos stios distais de secreo
de K+ e, conseqentemente, a perda de K+ maior do que a observada com outros diurticos. A
reabsoro de ons Ca++ e Mg++ tambm inibida pelos diurticos de ala em decorrncia da abolio do gradiente transepitelial responsvel pela
reabsoro destes ctions.
A perda de potssio importante e deve ser
lembrada principalmente em pacientes que esto
sob medicao digitlica, pois pode facilitar o
aparecimento de arritmias fatais. O restabelecimento dos nveis sricos de potssio deve ser garantido pela ingesta de alimentos ricos neste on
ou pela suplementao com sais de potssio.
Os diurticos de ala apresentam efeitos
adversos semelhantes aos das tiazidas: hiperglicemia, hiperuricemia, hipotenso e hipopotassemia. Surdez, que pode ser irreversvel, foi
descrita aps o uso de altas doses de furosemida
por administrao endovenosa.

BLOQUEADORES DO CANAL DE NA+


DO EPITLIO RENAL (POUPADORES DE K+AMILORIDE, TRIANTERENO)
Tanto a amilorida como o triantereno causam um pequeno aumento na excreo de NaCl
sendo utilizados principalmente em associao
com diurticos espoliadores de K+ para diminuir a excreo deste on.
As clulas principais da poro terminal do
tbulo distal e do ducto coletor apresentam ca-

nais de sdio na membrana luminal, responsveis pela reabsoro deste on a favor do seu gradiente eletroqumico. O influxo de sdio
despolariza a membrana luminal sem afetar a
permeabilidade da membrana basolateral, criando uma diferena de potencial transepitelial negativa responsvel pela secreo luminal de K+
via canais voltagem dependentes. O bloqueio dos
canais de sdio causa, portanto, uma diminuio indireta da secreo de potssio.
O stio preciso de ao dos bloqueadores de
canal de sdio no conhecido. Sabe-se que este
canal de sdio presente na clula epitelial renal
diferente daqueles dependentes de voltagem presentes em outras clulas (neurnios e micitos).
O efeito adverso mais importante dos bloqueadores de canal de sdio a hiperpotassemia que pode ser fatal em pacientes com
insuficincia renal. Entre os efeitos colaterais
mais comuns temos: nusea, vmito, diarria,
dor de cabea, cimbras e tontura.

ANTAGONISTAS DA ALDOSTERONA
(ESPIRONOLACTONA)
O uso teraputico dos antagonistas da aldosterona tambm est relacionado propriedade poupadora de potssio e no potncia
diurtica.
A aldosterona, interagindo com receptores
especficos situados no citoplasma das clulas
epiteliais da poro terminal do tbulo contorcido distal e do ducto coletor, estimula a sntese
de protenas especficas responsveis, entre outras, pelo aumento na expresso de canais de
sdio, da Na+ -K+ ATPase, mudanas na permeabilidade das tight junctions e aumento da
atividade de enzimas mitocondriais envolvidas
na produo de ATP. Em conseqncia, a condutncia ao sdio na membrana luminal e a atividade da bomba de sdio na membrana
basolateral so estimuladas aumentando o transporte transepitelilal de NaCl e a diferena de
potencial transepitelial negativa, tambm provocando a secreo luminal de K+ e H+.
A espironolactona inibe competitivamente a
ligao da aldosterona ao receptor de mineralocorticide citoplasmtico das clulas tubulares
inibindo sua ao natriurtica.
A eficcia clnica da espironolactona depende, portanto, dos nveis endgenos de aldoste-

299

Cap.

26

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

rona, o que no ocorre com os inibidores dos


canais de Na+ mencionados anteriormente.
O principal efeito colateral da espironolactona a hiperpotassemia. Alm disso, devido
sua estrutura qumica esteroidal, a espironolactona pode causar impotncia, ginecomastia, diminuio da libido, hirsutismo, alteraes na voz
e no ciclo menstrual. Pode produzir ainda efeitos colaterais gastrointestinais (diarria, gastrite, lcera pptica, hemorragia gstrica), centrais
(tontura, letargia, ataxia, confuso e dor de ca-

Cap.

26

300

bea), dermatolgicos (rashes cutneos) e, mais


raramente, discrasias sangneas.

BIBLIOGRAFIA
1. Fuchs FD. Frmacos anti-hipertensivos. In Farmacologia
Clnica. Fundamentos da Teraputica Racional. 2nd
ed. Editora Guanabara/Kogan, pp. 431-443, 1998.
2. Jackson EK. Diuretics. In. Goodman & Gilmans. The
Pharmacological Basis Of Therapeutics. 9th ed.
McGraw-Hill, pp 685-713, 1996.
3. Orita Y, Nakahama H. Diuretic therapy. Intern. Med.
37(2):219-221, 1998.

ANTIARRTMICOS

Antiarrtmicos
Antonio Jos Lapa

Distrbios da origem, ou da conduo dos


potenciais de ao cardacos, so freqentes e
devidos a causas variadas. As arritmias causadas por estes distrbios podem ser sintomticas
ou no. Nos dois casos h a possibilidade preocupante dos batimentos irregulares virem a desenvolver uma insuficincia cardaca, ou de haver
uma progresso para arritmias mais srias, com
morte sbita. A cardioverso produzida com choques eltricos DC aplicados no precrdio e a ablao de focos ectpicos por radiofreqncia
aplicada durante cateterismo cardaco so os
mtodos fsicos utilizados no tratamento de arritmias, sempre que necessrio, no primeiro caso,
ou quando possvel, no segundo. O tratamento
farmacolgico das disritmias cardacas recorrentes usa medicamentos de vrias classes teraputicas: bloqueadores de canais de sdio,
bloqueadores de receptores 1-adrenrgicos, bloqueadores de canais de potssio e bloqueadores
de canais de clcio, alm de estimulantes vagais,
como a digoxina, e ativadores de canais de potssio sensveis acetilcolina, como a adenosina. intuitivo depreender que drogas capazes
de interferir com a origem e a propagao do
estmulo eltrico cardaco so tambm potencialmente txicas. De fato, a experincia teraputica mostrou que todas as drogas utilizadas para
corrigir anomalias do impulso cardaco tm efi-

ccia limitada e so arritmognicas, isto , interferem diretamente com a excitabilidade cardaca, podendo originar arritmias to
preocupantes quanto aquelas a serem tratadas.
Apesar do mecanismo de ao da maioria dos
antiarrtmicos ter slida explicao experimental, o mais das vezes, frente variao dos quadros clnicos humanos, a terapia antiarrtmica
emprica. Por outro lado, evidncias obtidas de
testes clnicos especficos mostraram que o tratamento com antiarrtmicos aumenta a letalidade em pacientes assintomticos com arritmia
ps-infarte. Por esta razo, o uso de uma droga
antiarrtmica deve ser bem documentado e limitado s taquiarritmias supraventriculares sintomticas e s arritmias ventriculares com risco
de vida.
De acordo com o mecanismo de ao molecular, as drogas antiarrtmicas so divididas nas
quatro classes teraputicas j mencionadas:
Classe I compostos com a caracterstica
farmacolgica comum de bloquear canais de
sdio (anestsicos locais) e inibir a excitabilidade cardaca. Estes medicamentos so subdivididos em trs subgrupos com efeitos diferentes no
potencial de ao das fibras de Purkinje: as drogas da subclasse IA, representadas pela quinidina, procainamida e diisopiramida, diminuem a

301

Cap.

27

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

velocidade de propagao e tambm aumentam


o perodo refratrio efetivo da fibra cardaca. Os
compostos da Subclasse IB, representados pela
lidocana e fenitona, reduzem a excitabilidade cardaca, mas diminuem o perodo refratrio do potencial de ao. Os da Subclasse IC representados
pela flecainida e encainida so compostos semelhantes, porm mais potentes, que inibem a excitabilidade e prolongam o perodo refratrio.
Classe II Agentes -bloqueadores como
o propranolol, metoprolol, atenolol, sotalol e outros, que, inibindo as influncias da estimulao
simptica, diminuem o automatismo e a velocidade de propagao atrioventricular.
Classe III Drogas que bloqueiam os canais de potssio ativados durante a repolarizao do potencial de ao, como a amiodarona e
o sotalol, que prolongam o perodo refratrio e
diminuem o automatismo da fibra cardaca.
Classe IV Bloqueadores de canais de clcio, como o verapamil, o diltiazen e outros, que
diminuem o automatismo e a conduo atrioventricular.

Cap.

27

Os compostos das classes I, III e IV bloqueiam diretamente os canais inicos de sdio, potssio e clcio, inibindo a excitabilidade,
aumentando o perodo refratrio e reduzindo o
automatismo do miocrdio, respectivamente. Os
compostos da classe II (bloqueadores ) foram
apresentados no captulo correspondente. A ao
desses medicamentos explicada por bloqueio
dos receptores 1-adrenrgicos acoplados, via
protena Gs, produo de AMPc. Os medicamentos antiarrtmicos das classes II e V tambm
tm o mecanismo de ao molecular explicado
experimentalmente. Os alvos da interao desses antiarrtmicos so os canais inicos, protenas integrais da membrana celular com vrios
domnios transmembranas ligados atravs de
cadeias de aminocidos extra e intracelulares. Na
sua distribuio alostrica, as cadeias proticas
do canal delimitam um poro cuja abertura controlada pela disposio das protenas transmembrana. Como estas so molculas carregadas
eletricamente, os canais inicos adquirem conformao diferente conforme o campo eltrico
que se estabelece dos dois lados da membrana.
Na clula em repouso, com potencial de membrana ao redor daquele estabelecido pelo equilbrio eletroqumico do potssio, a disposio das
protenas tal que a maioria dos poros est fe-

302

chada. Os canais de sdio e os canais de clcio


tipo L tm a caracterstica comum de serem ativados e inativados por voltagem, isto , uma vez
despolarizada a membrana celular a valores limiares ou de ativao, as protenas que constituem os canais sofrem uma mudana na sua
conformao alostrica, abrindo-se passagem
dos ons a favor do gradiente de concentrao e
do gradiente eltrico, isto , para o interior da
clula (canais ativados ou abertos). Com a despolarizao superposta na clula pelo influxo dessas cargas positivas, os canais sofrem nova
disposio espacial, fechando a passagem dos
ons apesar da membrana continuar despolarizada (canais inativados). Algumas diferenas
entre os canais de sdio e clcio tipo L merecem
ateno: 1) Os potenciais de ativao dos canais
so diferentes. Os canais de sdio so ativados
em potenciais de repouso (-85 a -95 mV) e inativados em sua quase totalidade de 75 a -55
mV. Os canais de clcio do tipo L so ativados
em potenciais de membrana mais despolarizados, de -60 mV a -50 mV, sendo inativados em
potenciais positivos, isto , j durante o plat do
potencial de ao. 2) Como o gradiente de sdio transmembrana (~135 mM) bem maior que
o de clcio (~5 mM), a velocidade de influxo de
ons sdio, uma vez abertos os canais, muito
maior que a do clcio. As correntes que se instalam so, portanto, rpidas para o sdio e lentas
para o clcio. 3) A reorganizao dos canais de
sdio de volta sua conformao de repouso
dependente do tempo para restabelecimento do
potencial de membrana, enquanto os canais de
clcio so mais influenciados pelo tempo uma
vez que se abrem em potenciais de membrana
despolarizados. Assim, clulas com maior freqncia de potenciais de ao, ou clulas que
sofreram um processo de anxia e despolarizaram, apresentam maior nmero de canais de
sdio abertos ou inativados. A utilidade teraputica das drogas antiarrtmicas est baseada na
elevada afinidade que apresentam para canais ativados ou inativados e relativamente pequena afinidade para canais em repouso. Assim, a
automaticidade de focos ectpicos suprimida
mais do que a ritmicidade dos marca-passos, e a
excitabilidade e a velocidade de conduo nas
clulas despolarizadas so mais inibidas que nas
clulas normais. Este efeito, conhecido como
bloqueio dependente do uso, ou da ativao, ou
do estado de transio do canal, no o mesmo

ANTIARRTMICOS

para todos os agentes conhecidos. A lidocana,


por exemplo, tem alta afinidade para canais ativos e inativados; a amiodarona tem alta afinidade para canais inativados e a quinidina afinidade
por canais ativados. Alm disso, importante
considerar no mecanismo de ao molecular
destes compostos, a velocidade de dissociao
da droga do seu stio de interao no canal. De
modo geral, porque a velocidade de recuperao inversa ao grau de despolarizao da clula, a reverso do bloqueio do canal muito rpida
(0,1 a 0,4s) com os compostos do grupo IB,
intermediria (1,8 a 3s) com os compostos do
grupo IA e III, mas muito prolongada (>10s)
para as drogas do grupo IC. Finalmente, a considerar na seleo de um antiarrtmico, so as
interaes com outros canais, com receptores
autonmicos ou enzimas. O aumento do perodo refratrio produzido pelos compostos do grupo IA explicado por bloqueio simultneo dos
canais de potssio e prolongamento do tempo
de repolarizao celular, efeito este talvez mais
importante que a inibio dos canais de sdio
na preveno dos ritmos de reentrada. Atividade
inversa teriam os compostos do grupo III, prioritariamente bloqueadores de canais de potssio
com ao tambm em canais de sdio. A considerar nos efeitos colaterais seriam os efeitos produzidos por bloqueio de receptores muscarnicos
(quinidina), receptores adrenrgicos (quinidina
e amiodarona) e efeitos indesejveis no relaci-

onados diretamente aos efeitos cardacos, como


a hipersensibilidade induzida pela quinidina, o
quadro de lpus induzido pela procainamida, as
aes no SNC produzidas pela lidocana, a toxicidade pulmonar e mltiplos outros efeitos produzidos pela amiodarona. Conclui-se dessas
consideraes que o fato de drogas de um mesmo grupo de antiarrtmicos terem mecanismos
moleculares e efeitos eletrofisiolgicos semelhantes, no garantia da mesma ao clnica
e indicao teraputica. A seleo dever sempre ser indicada pelo quadro clnico e pelo
comprometimento cardaco, considerando-se
as caractersticas farmacocinticas da droga e a
possibilidade de interao com outros medicamentos, inclusive outros antiarrtmicos, que precipitem uma arritmia fatal.

BIBLIOGRAFIA
1. DiFrancesco D. Pacemaker mechanism in cardiac tissue.
Annu. Rev. Physiol. 55: 455-472, 1993.
2. Roden DM. Risks and benefits of antiarrhythmic therapy.
N. Engl. J. Med. 331: 785: 791, 1994.
3. Roden DM. Antiarrhythmic drugs. In: Hardman JG,
Molinoff PB, Ruddon RW, Limbird LE, Goodman
Gilman A. Goodman and Gilmans The
Pharmacological Basis of Therapeutics, 9 th Ed.
McGraw-Hill Co. Inc., International Edition, 1996,
pp. 839-874.
4. Vaughan Williams EM. Classifying antiarrhythmic
actions: by facts or speculation. J. Clin. Pharmacol.
32:964-977, 1992.
Cap.

303

27

ANDRGENOS E ANTIANDRGENOS

Andrgenos
e Antiandrgenos
Maria Christina Werneck de Avellar

SNTESE, ARMAZENAMENTO E
DOS ANDRGENOS

REGULAO

No homem, a testosterona o principal andrgeno plasmtico, sendo sintetizada e secretada principalmente pelas clulas testiculares
intersticiais (clulas de Leydig) e em concentraes baixas pela crtex da glndula adrenal. Na
mulher, a testosterona sintetizada em pequenas quantidades tanto pelos ovrios quanto pela
glndula adrenal.
Nos testculos, os espermatozides so
produzidos nos tbulos seminferos por um
processo que requer a ao do hormnio foliculoestimulante (FSH) em clulas de Sertoli e
a ao da testosterona, sintetizado pelas clulas de Leydig em resposta ao hormnio luteinizante (LH). Tanto LH quanto FSH so
hormnios gonadotrficos liberados pela hipfise anterior, com aes mediadas, pelo
menos em parte, pelo aumento intracelular de
AMP cclico. A liberao de FSH e LH , por
sua vez, controlada pelo hipotlamo, que libera pulsos de hormnio liberador de gonadotrofinas (GnRH).
A testosterona o andrgeno mais importante nos humanos. Anteriormente puberdade, as concentraes de testosterona no plasma
so baixas (menos do que 20ng/dl), embora os
testculos pr-pberes sejam capazes de sinteti-

zar andrgenos se estimulados com gonadotrofinas. No homem adulto, as concentraes plasmticas esto ao redor de 300-1000 ng/dl.
Cerca de 2% da concentrao plasmtica
de testosterona est na forma livre. Quando
deixa a circulao, a testosterona difunde-se pela
membrana celular e, em muitos tecidos-alvo,
reduzida dihidrotestosterona, pela ao da enzima 5-redutase. A dihidrotestosterona um
andrgeno mais potente que a prpria testosterona e atua como mediador intracelular de muitas aes do hormnio.
Duas isoformas da 5-redutase so conhecidas: a 5-redutase 1, localizada principalmente
em tecidos no genitais, como pele e fgado e a
5-redutase 2, presente em rgos do trato urogenital masculino e na pele genital de ambos de
homens e mulheres. Alguns casos de pseudo-hermafroditismo apresentam deficincia da enzima
5-redutase 2 em tecidos-alvo. Nestes pacientes, o gentipo masculino secreta quantidades
normais de testosterona pelos testculos, mas o
hormnio no convertido dihidrotestosterona. Neste caso, a genitlia externa no se desenvolve, mas a virilizao dos ductos wollfinianos
durante a embriognese normal.
A testosterona parece ser o principal mediador da regulao da produo de LH pelo sistema hipotlamo-hipfise e da espermatognese.

319

Cap.

31

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Fig. 31.1 Representao dos eventos que ocorrem durante a sntese da testosterona, seu metabolismo e mecanismo de
ao. As principais drogas andrognicas e antiandrognicas esto tambm indicadas.

Cap.

31

A inibio da secreo de FSH por hormnios


testiculares envolve tanto as aes de hormnios peptdicos (ex.: inibina) como as aes de
hormnios esteroidais (ex.: a prpria testosterona e o estradiol). A inibina um hormnio
peptdico, sintetizado pelas clulas de Sertoli e
por clulas ovarianas que na hipfise diminui a
expresso do hormnio gonadotrfico FSH.
Nos testculos e em uma variedade de tecidos extraglandulares, a testosterona, mas no a
dihidrotestosterona, tambm pode ser aromatizada a estradiol, sendo esta a via que gera a sntese de estrgenos em homens e em mulheres
ps-menopausadas. Aproximadamente 50g de
estradiol so sintetizados diariamente em homens
normais. Embora possua papel importante no
fechamento de epfises, o excesso relativo de estrgenos causa feminizao em homens.

320

MECANISMO

DE

AO

DOS

ANDRGENOS

Tanto a testosterona quanto a dihidrotestosterona ligam-se a receptor intracelular, o receptor de andrgeno, membro da superfamlia de
receptores esteroidais nucleares. A ligao da
dihidrotestosterona ao receptor de andrgeno
forma um complexo hormnio-receptor mais
estvel que a ligao da testosterona, explicando-se assim a maior potncia da dihidrotestosterona em relao testosterona.
Aps a ligao do hormnio, o complexo
hormnio-receptor de andrgeno sofre uma alterao conformacional e transloca-se para o
ncleo celular. No ncleo, este complexo ligase a seqncias do DNA (elementos de resposta
ao hormnio) como homodmeros e, ao interagir diretamente com a maquinria de transcri-

ANDRGENOS E ANTIANDRGENOS

o basal e/ou por interagir com vrias protenas co-ativadoras, aumenta a transcrio do
gene-alvo a ser regulado. Isto resulta na sntese
de RNA mensageiro, que transportado para o
citoplasma, onde dirige a sntese proteica e outras mudanas celulares que juntas constituem
a ao andrognica. O complexo hormnio-receptor de andrgeno tambm pode modular negativamente a expresso do gene-alvo. Isto pode
ocorrer pela ligao competitiva a stios ocupados por outros fatores de transcrio ou pela
interao do receptor de andrgeno com fatores
de transcrio j ligados a seqncias do DNA.
At o momento, h ainda dvidas se a dimerizao do receptor necessria para este tipo de
interao protena-protena.
O receptor de andrgeno codificado por
um gene presente no cromossomo X. Mutaes que afetam a atividade da 5-redutase ou
do receptor de andrgeno impedem a virilizao do embrio e resultam em quadros de
pseudo-hermafroditismo masculino.

AES FISIOFARMACOLGICAS E UTILIZAO


TERAPUTICA DOS ANDRGENOS
Os andrgenos possuem diferentes funes
nos vrios estgios da vida. Na fase embrionria, os andrgenos virilizam o trato urogenital
do embrio masculino. Na puberdade, os andrgenos tm papel importante na espermatognese, na regulao da liberao das gonadotrofinas,
no desenvolvimento dos caracteres sexuais masculinos secundrios, na maturao do comportamento sexual e agressivo masculino e nos
efeitos das alteraes no balano positivo de nitrognio e desenvolvimento muscular. No homem adulto, as doses altas de testosterona
suprimem a liberao de gonadotrofinas e causam atrofia dos rgos sexuais acessrios masculinos. Na mulher, andrgenos causam
mudanas, muitas das quais similares s observadas no homem pr-pbere.
A administrao parenteral de andrgenos
(testosterona e steres de testosterona, ex.: propionato de testosterona) usada na deficincia andrognica causada por castrao e no tratamento
de crianas com puberdade retardada ou de homens portadores de hipogonadotrofismo por doena testicular ou hipofisria. A testosterona
rapidamente inativada pelo fgado aps adminis-

trao oral, mas os andrgenos sintticos (ex. mesterolona) mantm-se ativos quando administrados oralmente. O uso destes andrgenos orais,
no entanto, tem sido associado com um aumento
no risco de desordens hepticas, principalmente
jaundice* e tumores.
Derivados da testosterona, ativos por via
sublingual (ex.: ciclodextrin-testosterona), so
rapidamente absorvidos e excretados, o que tem
permitido seu emprego no tratamento de hipogonadismo, meninos pr-pberes ou, mais recentemente, na reposio dos baixos nveis de
testosterona plasmtica de homens idosos.
Os andrgenos promovem crescimento
muscular em meninos e em mulheres de todas
as idades, efeitos mediados pela sua interao
com receptor de andrgeno. Em homens com
hipogonadismo ou castrados, os andrgenos
reduzem a excreo urinria de nitrognio, Na+,
K+ e Cl- e aumentam a massa muscular e o peso
corpreo. Contudo, no sabido se os andrgenos tm qualquer efeito benfico no desenvolvimento muscular e atltico, bem como no
balano de N+ de homens sexualmente maduros. Apesar disso, so ainda usados e abusados
por atletas, treinadores e esportistas para melhora da capacidade atltica. Os efeitos anablicos dos andrgenos devem-se suas aes em
receptores de andrgenos presentes em tecidos,
como a musculatura esqueltica.
Todos os hormnios esteroidais anablicos
(ex.: nandrolone) disponveis at o momento so
tambm andrognicos e podem ser usados clinicamente para aumentar a sntese protica aps
as cirurgias de grande porte ou em pacientes
portadores de doenas debilitantes crnicas (ex.:
sndrome de imunodeficincia adquirida, infeces crnicas). Vale salientar, no entanto,
que os efeitos destes esterides na fora e
massa muscular de levantadores de peso amadores so nfimos, quando comparados com
os obtidos em homens em programa de treinamento intenso. Contudo, ganhos significantes na
massa e na fora muscular concomitante com a
perda de gordura corporal podem ser obtidos se
estes esterides forem administrados a levantadores de peso que j atingiram uma estabiliza*Jaundice: estase e acmulo de bile nos capilares biliares da
poro central dos lbulos hepticos, sem obstruo dos
ductos.

321

Cap.

31

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

o do tamanho e da fora muscular. Ganhos


ainda maiores podem ocorrer com programas
mais intensos de treinamento e com o uso de
doses altas de esterides.
Alm de aumentarem a massa e a fora muscular, os esterides anablicos tambm possuem efeitos anticatablicos, que parecem ser o
fator mais importante para o aumento da massa
muscular. Estes efeitos provavelmente ocorrem
pelo bloqueio dos efeitos catablicos induzidos
por glicocorticides que so secretados em resposta ao estresse ou como resultado da melhora
na ingesto de protenas e ao conseqente aumento da reteno de N+.
Os esterides anablicos so tambm capazes de estimular a eritropoiese, uma vez que a
testosterona estimula a formao de eritropoitina. Estes efeitos podem explicar o aumento na
capacidade aerbica que ocorre com o uso de
anablicos.
Na mulher e criana pr-pbere, o efeito
colateral principal dos andrgenos e, at certo
ponto dos esterides anablicos, a masculinizao. O efeito colateral de suprimir a liberao
de gonadotrofinas, por ao de retroalimentao negativa por andrgenos no eixo hipotlamo-hipfise, ocorre tanto em homens quanto
mulheres. Pelo fato de a testosterona ser convertida a estradiol nos testculos e tecidos extraglandulares do homem, pela ao de aromatases,
a sndrome de feminizao (ex. ginecomastia)
passvel de ocorrer com homens que usam este
hormnio para obteno de efeitos anablicos.
Cap.

31 MECANISMO DE AO DE DROGAS
ANTIANDROGNICAS

Compostos que bloqueiam a sntese ou a ao


dos andrgenos so teis no tratamento da hiperplasia e carcinoma prosttico, acne, calvcie
masculina, sndromes virilizantes da mulher e
puberdade precoce de meninos. H trs classes
diferentes de drogas com ao antiandrognica.

Inibidores de Sntese de Andrgenos


Os inibidores da sntese de andrgeno mais
efetivos so o prprio hormnio liberador de gonadotrofinas (GnRH) ou os agonistas sntticos
de receptor de GnRH (ex. leuprolide ou gonado-

322

relina). Com a administrao contnua destas drogas, as concentraes plasmticas do LH e da testosterona diminuem por efeito de retroalimentao
negativa a nvel hipofisrio, induzindo um quadro de castrao farmacolgica, mas reversvel.
Tal terapia uma alternativa mdica castrao
cirrgica para diminuir a produo de testosterona em homens com cncer de prstata.

-redutase
Inibidores da Enzima 5
Como a converso de testosterona para dihidrotestosterona essencial para alguma aes
andrognicas, os inibidores da enzima 5-redutase bloqueiam seletivamente a ao dos andrgenos em tecidos onde a produo contnua de
dihidrotetosterona essencial (prstata e folculos capilares, principalmente). O finasteride
um inibidor competitivo que bloqueia preferencialmente a atividade da enzima 5-redutase 2,
mas tambm inibe a 5-redutase 1. Com este
bloqueio, h uma diminuio na concentrao
de dihidrotestosterona no plasma e prstata, sem
alterao dos nveis plasmticos de testosterona
e LH. Na hiperplasia prosttica, o finasteride
causa uma diminuio do tamanho prosttico.
Um tero dos homens tratados com esta droga
apresenta melhora do fluxo urinrio e da sintomatologia associada, evitando a cirurgia de homens que apresentam manifestaes moderadas
da doena. O uso de finasteride est tambm
em estudo para o tratamento da calvcie masculina. Outros inibidores da enzima 5-redutase,
incluindo agentes especficos para 5-redutase
1, esto sob investigao.

Antagonistas de Receptores de
Andrgenos
A progesterona um antiandrgeno fraco e,
na procura por progestgenos ativos por via oral,
descobriu-se que o acetato de ciproterona atuava como um antagonista de receptor de andrgeno potente. Esta droga compete com a
testosterona e a dihidrotestosterona pela ligao
com o receptor de andrgeno; quando administrado a ratas prenhas, o acetato de ciproterona
bloqueia as aes dos andrgenos no feto masculino, induzindo uma forma de pseudo-hermafroditismo masculino. O acetato de
ciproterona tambm possui atividade progesta-

ANDRGENOS E ANTIANDRGENOS

cional, o que suprime a secreo de gonadotrofinas na hipfise pela ativao de receptores de


progesterona. Portanto, os efeitos da droga resultam em inibio da sntese de testosterona e
bloqueio direto do receptor de andrgeno.
A flutamida e bicalutamida (casodex) so
antiandrgenos no esteroidais puros, no apresentando atividades hormonais. O mecanismo
de ao da flutamida envolve, provavelmente,
uma converso in vivo 2-hidroxiflutamida
que, assim como bicalutamida, um antagonista potente de receptores de andrgenos. Em
animais adultos, estas drogas causam involuo
de tecidos-alvo de andrgeno tais como prstata e vescula seminal e, por bloquearem a retroalimentao inibitria da testosterona na
produo de LH, induzem aumento plasmtico
de LH e testosterona. Desta forma, apesar da
potncia antiandrognica in vitro, o aumento da
concentrao plasmtica limita seus efeitos antiandrognicos. Como conseqncia, estes antiandrgenos so utilizados em conjunto com

GnRH ou anlogos do GnRH (ex. leuprolide),


para inibio da liberao de gonadotrofinas e
da sntese de testosterona. O principal uso clnico da flutamida e da biculatamida o tratamento do cncer prosttico, geralmente em
associao com GNRH ou seus anlogos sintticos ou ainda estrgenos, para bloqueio da sntese de andrgenos. Flutamida tem sido tambm
usada experimentalmente no tratamento do hirsutismo na mulher.

BIBLIOGRAFIA
1. Goodman and Gilmans. The Pharmacological Basis of
Therapeutics, 9 th ed./Joel G. Hardman, Alfred
Goodman Gilman, Lee E. Limbird, The McGrawHill Companies, 1996.
2. Greenspan FS, Strewler G.J., Basic and Clinical
Endocrinology, 5th ed., Appelton and Lange, 1997.
3. Brinkmann AO, Blok LJ, de Ruiter PE. Doesburg P.
Steketee K. Berrevoets CA. Trapman J. Mechanisms
of androgen receptor activation and function.
Journal of Steroid Biochemistry & Molecular
Biology. 69(1-6):307-13, 1999.

Cap.

323

31

ANALGSICOS OPIIDES

Analgsicos Opiides
Maria Salete de Abreu Castro

A principal utilidade clnica dos opiides o


controle da dor. Agonistas opiides, como a
morfina, induzem profunda analgesia sem alterar as outras modalidades sensoriais como o tato
ou a percepo trmica, por exemplo. Estas drogas so particularmente teis no tratamento de
dores viscerais difusas, dores associadas ao cncer e na analgesia pr e ps-cirrgica. Dores neuropticas, entretanto, costumam ser resistentes
aos opiides, ao passo que dores inflamatrias
ou dores somticas de localizao bem definida
so mais adequadamente tratadas com analgsicos no-esteroidais ou com uma associao de
um analgsico no esteroidal e um opiide (paracetamol e dextropropoxifeno, por exemplo).
A atividade de um agonista opiide est fortemente vinculada a requisitos estruturais e estereoqumicos da sua molcula, comprovando
sua atuao atravs de receptores farmacolgicos. Existem trs tipos bem definidos de receptores opiides: (mu), (delta) e (kapa). A
ativao destes receptores desencadeia uma cascata de eventos que resultam em diversos efeitos
biolgicos tais como: analgesia, bradicardia, depresso de reflexos flexores, depresso respiratria, diurese, euforia ou disforia, hipotermia,
miose, modulao de processos endcrinos e do
sistema imune, reduo do peristaltismo intestinal e sedao.
As drogas opiides podem ser classificadas
como agonistas opides (morfina), antagonis-

tas (naloxona) e drogas de funo mista (nalorfina, pentazocina) que podem ser agonistas em
um dado tipo de receptor e antagonista ou agonista parcial em outro receptor (Tabela 34.1).
Podemos generalizar que a ativao do receptor causa analgesia espinal e supra-espinal, depresso respiratria, miose, reduo do
trnsito gastrointestinal e euforia. A ativao de
receptores , por sua vez, causa analgesia predominantemente espinal que acompanhada de
disforia, ao invs de euforia; este receptor est
associado tambm analgesia opiide perifrica. Os agonistas causam pouca depresso respiratria e miose, quando comparados aos
agonistas . O desenvolvimento de agonistas
seletivos relativamente recente, de forma que
as conseqncias clnicas de sua ativao ainda
no esto claras. Em animais, o receptor est
associado analgesia espinal (Tabela 34.2).
Todos os receptores opides pertencem superfamlia de receptores com sete domnios
transmembrana acoplados a uma protena G
heterotrimrica, que pode ser Gi, G0 ou Gq, conforme o tipo e a localizao do receptor envolvido. Na realidade, as diferenas entre as respostas
evocadas nos vrios tecidos ou por receptores
diversos de um mesmo tecido refletem, na maioria dos casos, variaes da expresso da protena G ou de seus efetores, muito mais do que
diferenas inerentes s propriedades dos receptores envolvidos.

343

Cap.

34

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Tabela 34.1
Principais Efeitos Farmacolgicos Induzidos
pela Ativao dos Diferentes Tipos e Subtipos
de Receptores Opiides
Efeito Farmacolgico

Receptor

Analgesia espinal

Analgesia supraespinal

1, 2

Aumento da secreo
Hormnio do Crescimento
Prolactina

Depresso respiratria

Diurese

Euforia

Inibio da liberao
Acetilcolina
Dopamina

1
2

Miose

Psicotomimesis
Reduo peristaltismo GI

Sedao

A ativao de receptores opiides , e


em diferentes tipos celulares est associada primariamente a trs eventos bsicos: reduo dos
nveis de AMPc, aumento da corrente retificadora de K+ e supresso de correntes de Ca2+
voltagem-dependentes.

Cap.

34

REDUO DOS NVEIS DE AMPc


Agonistas opiides reduzem os nveis de
AMPc atravs da inibio da adenilil ciclase
(AC). Como este processo depende de Na+ e
GTP e sensvel toxina pertussis, deve decorrer da ativao da subunidade da protena
Gi. Em algumas regies do SNC, como no hipocampo, o receptor opiide do tipo 1 est
acoplado protena G0. Nesta circunstncia, as
subunidades parecem ser as responsveis pela
inibio da AC. Como conseqncia da reduo dos nveis de AMPc, a PKA no ser ativada, reduzindo a fosforilao de vrias protenas.
A liberao de neurotransmissores e a ativao

344

Tabela 34.2
Efeito e seletividade de drogas opiides
Tipo de Receptor

Droga

Morfina

+++

Metadona

+++

Etorfina

+++

Levorfanol

+++

Fentanil

+++

+++

+++
+++

Butorfanol

AP

+++

Buprenorfina

AP

Nalbufina

Naloxona

Naltrexona

Nalorfina

+++

Pentazocina

AP

++

Sufentanil

+++

++

(+) agonista; (-) antagonista; (AP) agonista parcial; (?)


dados no disponveis

de canais de ctions ativados por hiperpolarizao so exemplos de processos que estaro


comprometidos pela reduo da fosforilao
protica.
A verificao de que agonistas opiides promovem uma atividade GTPsica foi associada
inicialmente ao processo de inibio da adenilil
ciclase via estimulao da protena Gi. Todavia, verificou-se que a atividade GTPsica era
pronunciada tambm no estriatum, onde no
so detectadas alteraes nos nveis de AMPc.
Esta dissociao forneceu uma primeira evidncia de que os receptores opiides podem estar
acoplados a mltiplos sistemas efetores.

REGULAO

DE

CANAIS INICOS

A ativao de receptores opiides acoplados


protena Gi leva abertura de canais de K+,
estimulando uma corrente retificadora de K+
para dentro da clula e aumentando a concen-

ANALGSICOS OPIIDES

trao intracelular deste on. O receptor est


associado tambm ativao direta da corrente
IKACh, atravs das subunidades da protena Gi.
O estmulo da protena G por agonistas opiides leva diretamente inibio de canais de
Ca2+ voltagem-dependentes (tipos N, P e Q),
tanto em neurnios do ncleo do trato solitrio
(NTS) quanto em neurnios da raiz dorsal da
medula, com conseqente reduo do Ca2+ intracelular. A reduo do Ca2+ intracelular est
relacionada tambm aos efeitos observados aps
a interao de agonistas com receptores opiides perifricos (do trato gastrointestinal). Alm
disto, receptores e inibem o canal de Ca2+
sensvel a dihidropiridina.
Embora a maioria dos efeitos dos opiides esteja associada a uma reduo do Ca2+ intracelular, a subunidades das protenas Gi/
G0 podem ativar diretamente a PLC, gerando
trifosfato de inositol (IP3) a partir do fosfatidilinositol. O IP3 promove a liberao de Ca2+ do
retculo endoplasmtico, causando um aumento
localizado e transitrio do Ca2+ citoslico.

MECANISMOS ENVOLVIDOS
OPIIDE

NA

ANALGESIA

A ativao de um receptor opiide causa


analgesia atravs de dois mecanismos bsicos:
reduo da liberao de neurotransmissores e
reduo da excitabilidade neuronal (Fig. 34.1).
A ativao direta de correntes de K+ e o bloqueio de canais de Ca2+ operados por voltagem
(tipos N, P, Q e R) hiperpolarizam a clula, contribuindo para a reduo da excitabilidade neuronal
em tratos como o espinotalmico e em neurnios
da raiz dorsal da medula, responsveis pela aferncia dos impulsos nociceptivos at o SNC.
A queda na liberao de neurotransmissores
deriva da diminuio dos nveis de AMPc e do
Ca2+ intracelular, podendo levar tanto a uma reduo da descarga do neurnio ps-sinptico,
quando o neurotransmissor envolvido for excitatrio (taquicinina A, substncia P etc.), quanto a
uma exacerbao da freqncia de descarga neuronal, se ocorrer em locais onde o trato neuronal
estiver sujeito modulao por interneurnios
inibitrios (GABArgicos, glutamatrgicos).
Este ltimo mecanismo especialmente importante nos neurnios localizados na substncia
cinzenta periaquedutal (SCPA). Neste local, a ati-

ATIVAO DO
RECEP TOR OPIIDE

G0
Gi/
ADENILIL
CICLASE

AMPc

K+
Ca2+

K+
Ca2+
EXCITABILIDADE
NEURONAL

LIBERA O DE
NEUROTRANSMISSORES

Fig. 34.1 Mecanismos envolvidos na analgesia opiide. 1) O estmulo da protena G acoplada ao receptor opiide pode levar ativao direta de correntes de K+ e ao
bloqueio de canais de Ca2+ operados por voltagem (tipos N,
P, Q e R). Estes eventos hiperpolarizam a clula, contribuindo
para a reduo da excitabilidade neuronal em locais como o
trato espinotalmico e em neurnios da raiz dorsal da medula, responsveis pela aferncia dos impulsos nociceptivos at
o SNC. 2) A queda na liberao de neurotransmissores deriva da diminuio dos nveis de AMPc e do Ca2+ intracelular,
podendo levar tanto a uma reduo da descarga do neurnio ps-sinptico que conduz o estmulo nociceptivo quanto
a uma exacerbao da freqncia de descarga de neurnios modulatrios controlados tonicamente por interneurnios
inibitrios.

vao de receptores opiides acoplados a uma


protena Gi correlaciona-se com a ativao da
PLA2. O cido araquidnico assim produzido
metabolizado pela via da 12'-lipoxigenase para um
intermedirio ainda no estabelecido, capaz de
ativar canais de K+ sensveis voltagem (tipo sensvel a dendrotoxina). Como os neurnios descendentes da SCPA so tonicamente inibidos por
interneurnios GABArgicos e o aumento do K+
intracelular reduz a liberao espontnea de
GABA, ocorre a retirada da inibio GABArgica, levando ativao de vias descendentes inibitrias que modulam o processo de percepo
dolorosa.
Este mecanismo explica tambm o sinergismo que existe entre os analgsicos opiides e os
analgsicos antiinflamatrios no-esteroidais: ao
inibirem a ciclooxigenase, estas drogas aumentariam a oferta de substrato para a via da 12lipoxigenase (Fig. 34.2).

345

Cap.

34

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

A interferncia com a liberao de GABA


parece estar envolvida na manifestao da sndrome de abstinncia: a retirada abrupta de
medicamentos opiides causa um aumento rebote na atividade da adenililciclase, com conseqente elevao dos nveis de AMPc que, via
estmulo da PKA, aumenta a liberao de GABA
no ncleo accumbens. A exacerbao dos efeitos GABArgicos seria um dos mecanismos responsveis pelo aparecimento de alguns dos
sinais e sintomas da sndrome de abstinncia
(clicas abdominais, vmito, ansiedade e disforia, sedao, aumento da temperatura corporal etc.).
Os opiides ligam-se a receptores situados
em vrios ncleos e tratos do sistema nervoso central e tambm, perifericamente, a receptores situados nas fibras sensoriais e
nociceptores perifricos. Estes receptores opiides perifricos so dotados de caractersticas
similares s de seus congneres do SNC, sendo responsveis pelos efeitos antinociceptivos
perifricos de anlogos metilados de opiides
(que no cruzam a barreira hematoenceflica).
Nesta circunstncia, o efeito analgsico se faz
atravs da atenuao da excitabilidade do nociceptor perifrico e do neurnio aferente primrio que, alm de ter menor velocidade de
descarga, passa a liberar menor quantidade de
neurotransmissores excitatrios (e.g., Substncia P) no corno dorsal da medula. Tambm aqui
os opiides agem atravs do aumento das correntes de K+, reduo das correntes de Ca2+ e
da inibio da AC, via protena G.

Cap.

34

ATENUAO DA RESPOSTA A
AGONISTAS OPIIDES
A atenuao dos sinais gerados pela ativao de um receptor opiide freqentemente
observada aps a administrao de doses repetidas de agonistas ou e, em grau muito menor, de agonistas . Este fenmeno est
majoritariamente associado a uma dessensibilizao tanto da clula como um todo quanto dos
receptores envolvidos. Alm da dessensibilizao, ocorre tambm uma alterao do nmero
de receptores da superfcie celular, atravs da
internalizao, da reduo de sua sntese e/ou
aumento de sua degradao (down regulation dos
receptores opiides).

346

Observaes in vitro demonstraram que


quando se adiciona morfina a uma cultura de
neurnios, ocorre uma queda inicial dos nveis
de AMPc pelo bloqueio da AC. Se as clulas permanecem expostas morfina, os nveis de AMPc
aumentam paralelamente dessensibilizao dos
receptores. Destes experimentos deriva a proposio de que o tratamento prolongado com
agonistas opiides reduz a afinidade dos ligantes
por seus receptores especficos e provoca o desacoplamento entre o receptor e a protena G. Se
os neurnios so expostos cronicamente a agonistas ou observa-se uma reduo gradativa da capacidade destes agonistas ativarem a
corrente retificadora de K+. Nesta circunstncia, a ativao da corrente de K+ por drogas noopiides (como a somatostatina) tambm est
prejudicada, indicando que ocorre uma dessensibilizao da clula como um todo, aliada dessensibilizao especfica do receptor opiide.
Agonistas de alta afinidade (etorfina)
causam uma rpida internalizao de receptores in vitro e in vivo. Este processo de internali-

Tabela 34.3
Local e Vias Envolvidas na Analgesia
Induzida pela Morfina e Similares
Locais da Ao Analgsica de Drogas Opiides
PAG (Subs. Cinzenta Periaquedutal)
NMR (Ncleo Magno da Rafe)
Substncia Gelatinosa do Corno Dorsal
da Medula
Nociceptores Perifricos
Neurnio Aferente Primrio
Vias Ascendentes da Dor Bloqueadas Pelos
Opiides
Trato Espinotalmica
Trato Espinorreticular
Algumas fibras do Funculo Dorsolateral
Vias Descendentes Inibitria Desbloqueadas/
Ativadas Pelos Opiides
Trato Espinocortical
Trato Rafe-Espinal
Analgesia Opiide Perifrica
1) Reduo da Excitabilidade
Neurnio aferente primrio
Nociceptor
2) Reduo da Liberao de
Neurotransmissores
Sinpse do neurnio primrio no corno
dorsal da medula

ANALGSICOS OPIIDES

zao homlogo. Em outras palavras, receptores so internalizados em resposta a ligantes


e no a ligantes ou e vice-versa. A fosforilao de resduos de aminocidos do domnio
citoplasmtico C-terminal importante para a
internalizao dos receptores opiides, uma vez
que o processo impedido tanto por inibidores
especficos da serina/treonina quinase quanto
pela deleo ou troca de resduos de serina ou
de treonina desta regio.
A exposio prolongada a agonistas opiides
leva a uma perda de receptores da superfcie celular que no pode ser completamente explicada

pela simples internalizao dos mesmos. O mecanismo mais provvel desta down regulation
uma reduo da sntese de receptores. Coerentemente, a morfina causa reduo do mRNA para
o receptor no hipotlamo, sem afetar os nveis
mRNA que codificam receptores no opiides.
Tambm aqui est envolvida a fosforilao protica, uma vez que inibidores das quinases de receptores acoplados protena G (GRKs) ou a
mutao da treonina 353 da regio C-terminal
impedem a down regulation de receptores . Alm
disto, existem evidncias de que os receptores
opiides acoplados protena Gi so mais sens-

Cap.

Fig. 34.2 Na ausncia de ligantes opiides, os neurnios descendentes do Ncleo Magno da Rafe (NMR) esto tonicamente inibidos por interneurnios GABArgicos, impedindo a ativao de vias descendentes inibitrias (A). A ativao do
receptor opiide tem como conseqncia a reduo da liberao espontnea de GABA, levando ativao de vias descendentes inibitrias e modulando o processo de percepo dolorosa (B). No terminal pr-sinptico do interneurnio GABArgico, a ativao de receptores opiides acoplados a uma protena Gi correlaciona-se com a ativao da PLA2. O cido
araquidnico assim produzido metabolizado pela via da 12'-lipoxigenase para um intermedirio ainda no estabelecido,
capaz de ativar canais de K+ sensveis voltagem (tipo sensvel a dendrotoxina). O aumento do K+ intracelular reduz a
liberao espontnea de GABA (C). Este mecanismo explica tambm o sinergismo que existe entre os analgsicos opiides
e os analgsicos antiinflamatrios no-esteroidais: ao inibirem a ciclooxigenase, estas drogas aumentariam a oferta de
substrato para a via da 12-lipoxigenase (D).

347

34

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

veis down regulation, uma vez que a toxina


pertussis limita a magnitude do processo.
Os agonistas produzem muito pouca dessensibilizao, no tendo sido demonstrado o processo de internalizao rpida para estes
receptores. A down regulation deste tipo de receptor tardia e discreta. Estas constataes podem estar relacionadas com a menor tolerncia e
menor potencial de abuso observado com este tipo
de opiide.
A dessensibilizao, a internalizao e a down
regulation de receptores opiides so essenciais
para a adaptao celular e formam as bases dos
fenmenos de tolerncia e dependncia.
Uma das principais limitaes ao uso de analgsicos opiides est relacionada tolerncia diferenciada aos vrios efeitos dos opiides. A miose
e a constipao intestinal so exemplo de efeitos
que quase no sofrem reduo com o uso crnico. Por outro lado, a magnitude do efeito analgsico dos opiides bastante influenciada pelo
desenvolvimento da tolerncia. Precaues devem
ser tomadas para que o incremento da dose, visando manuteno do nvel da analgesia, no
produza depresso respiratria, uma vez que a
tolerncia a esta ltima desenvolve-se mais lentamente.

Cap.

34

Deve ser salientado, entretanto, que a tolerncia e a dependncia fisiolgica so eventos incomuns durante um tratamento de curto prazo
(analgesia ps-operatria, por exemplo) em pacientes que no tenham histria anterior de abuso
de drogas. Alm disto, em pacientes com dor crnica severa (como pacientes terminais de cncer,
por exemplo) o aumento da dose de morfina raramente acontece de maneira voluntria, estando
muito mais associada ao aumento progressivo da
intensidade da dor que ao desenvolvimento de tolerncia ou ao abuso da droga.

348

Os opiides, com atividade agonista parcial


em receptores (buprenorfina ou butorfanol, por
exemplo), possuem efeito analgsico mximo inferior ao de um agonista total (morfina ou metadona, por exemplo). Isto significa que o aumento
escalonado da dose no causar necessariamente
aumentos adicionais da analgesia e da depresso respiratria. Alm disto, os agonistas parciais podem desencadear os sinais e sintomas da
crise de abstinncia, se administrados a um paciente em uso crnico de morfina (ou de outro
agonista total).
O conhecimento inadequado ou incompleto
da farmacologia dos opiides resulta, freqentemente, em precaues exageradas e restries na
dosagem destas drogas, infligindo ao paciente um
controle inefetivo da dor.
Os progressos recentes no campo da biologia molecular vm contribuindo para uma melhor compreenso destes fenmenos. O avano
neste campo deve levar compreenso dos mecanismos subjacentes, especificidade da ao
opiide e ao desenvolvimento da tolerncia e dependncia, propiciando o desenvolvimento de
drogas opiides onde o efeito teraputico possa
ser dissociado de efeitos colaterais e que possuam menor potencial de tolerncia, abuso e/ou
dependncia.
BIBLIOGRAFIA
1. Clapham DE, Neer EJ. Ann. Rev Pharmacol. Toxicol.
37:167-203, 1997.
2. Goodman and Gilmans. The Pharmacologycal Basis of
Therapeutics, 9a ed. Chap. 23, p. 521-556.
3. Harrison C, Smart D, Lambert DG. Br. J. Anaesth.
81:20-28, 1998.
4. Jordan B, Devi LA. Br. J. Anaesth, 81:12-19, 1998.
5. Kieffer BL. TiPS Jan 99, 20:19-26, 1999.
6. Stein C. New Eng. J. Med. 332:1685-1690, 1995.
7. Vaughan CW, Ingram SL, Connor MA, Christie MJ.
Nature Dec 11; 390:611-614, 1997.

ANSIOLTICOS

Ansiolticos
Thereza Christina Monteiro de Lima

Em pessoas saudveis a resposta de estresse


provocada por uma ameaa ou um desafio real,
sendo usada, atravs de uma ao apropriada,
na soluo da situao enfrentada. A ansiedade,
no entanto, uma reao de alerta excessivo,
desproporcional situao enfrentada, ou na
ausncia de um estmulo detectvel, sendo caracterizada por sentimentos de apreenso, incerteza e medo, geralmente acompanhados de
sintomas fsicos. Fisicamente, a ansiedade expressa por respostas fisiolgicas que incluem hipertenso arterial, taquicardia, taquipnia e
aumento na tenso muscular, alm de reduo
no fluxo sangneo intestinal que pode resultar
em nuseas ou diarria.
Os distrbios de ansiedade so a condio
psiquitrica mais comum no mundo ocidental,
afetando milhes de pessoas, sendo que apenas
um quarto dos indivduos busca ajuda mdica.
Algumas vezes esses distrbios so severos e incapacitantes, mas podem ser efetivamente tratados com terapia e medicao adequada. A
ansiedade pode existir como um distrbio primrio ou estar associada a outros problemas mdicos e/ou psiquitricos, tais como depresso,
psicose, abuso de drogas ou hipertiroidismo. A
ansiedade patolgica uma condio que varia
na sua apresentao, incluindo fobias, ataques
de pnico, distrbio de ansiedade generalizado,
transtorno obsessivo compulsivo e distrbio de
estresse ps-traumtico.
Os distrbios de ansiedade so geralmente
produzidos por uma combinao de condies

psicolgicas, fsicas e genticas. Um dos fatores


causais parece ser um desbalano nos neurotransmissores do sistema lmbico e outras estruturas a ele relacionadas, no qual a terapia
medicamentosa est baseada. Vrios estudos tm
mostrado uma hiperatividade noradrenrgica no
loco cerleo (ncleo do sistema nervoso central
SNC que constitui um sistema primitivo
de alerta do organismo, preparando-o para a resposta ao perigo luta ou fuga). Observa-se
tambm uma reduo na atividade GABArgica
e um aumento na atividade serotonrgica na regio septo-hipocampal (reas do sistema lmbico que reconhecem o perigo especfico,
envolvendo processos de aprendizagem e memria). Na verdade, atualmente algumas reas
do crebro esto sendo associadas a distrbios
de ansiedade especficos, como no caso do corpo estriado e o transtorno obsessivo-compulsivo
(TOC), a amgdala e o distrbio de ansiedade
generalizado (generalized anxiety disorder, GAD)
e ataques de pnico.
O uso de medicamentos para o tratamento
da ansiedade to antigo quanto a histria da
Medicina, mas foi o advento dos benzodiazepnicos (1959) e sua eficcia em tratar a ansiedade que levou a um melhor entendimento dessa
psicopatologia, implicando definitivamente o
cido gama-aminobutrico (GABA) na sua patofisiologia. Algumas drogas que afetam a noradrenalina e a serotonina, como os antidepressivos,
so tambm eficazes em tratar vrios distrbios
de ansiedade, fortalecendo a hiptese do envol-

349

Cap.

35

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

BZDs

ClEFEITOS

Cl-

Ansioltico

Lorazepam
Clonazepam

Hipno-- sedativo
Hipno

Clordiazepxido

Alprazolam

Relaxante muscular
Anticonvul sivante

Clonazepam

GABA

Diazepam

BZDs

Flurazepam

Barbitricos

Etanol
Picrotoxina
Neuroesterides

Fig. 35.1 Representao esquemtica do receptor GABArgico do tipo GABAA e local de ao dos ansiolticos benzodiazepnicos (BZDs).

vimento desses neurotransmissores nessa psicopatologia. Atualmente a abordagem teraputica


mais efetiva para a maioria dos distrbios de ansiedade consiste numa combinao de terapia
cognitiva-comportamental e medicao.

BENZODIAZEPNICOS

Cap.

35

Os benzodiazepnicos (BZDs) tm sido, nos


ltimos 40 anos, o tratamento padro dos distrbios de ansiedade. Seu mecanismo de ao
a facilitao da transmisso inibitria GABArgica. Os receptores GABAA so estruturas heteropentamricas associadas a um canal inico
(Cl-) e constituem o sistema inibitrio predominante no SNC de mamferos. Suas subunidades
(6), (4), (4), (1) e (2), combinadas
entre si, compem as vrias isoformas do receptor GABAA. H evidncias de que os receptores
GABAA contendo a subunidade 2 medeiam o
efeito ansioltico, enquanto os que possuem subunidades diferentes medeiam outras aes dos
BZDs (p.e., 1 efeito sedativo). Quando o
GABA interage com esses receptores, o canal inico aberto e o influxo de Cl- aumenta, resul-

350

tando na hiperpolarizao da clula e na reduo da excitabilidade. Alm do stio de interao


com o GABA, no receptor GABAA h, pelo menos, cinco outros stios de ligao: um para BZDs
(R-BZD), um para barbitricos, e outros para o
etanol, os neuroesterides e a picrotoxina. A interao dos BZDs com seus receptores modula
alostericamente o stio receptor de GABA, modificando sua conformao estrutural, aumentando sua afinidade e resultando num aumento
da freqncia de abertura dos canais de Cl-. Conseqentemente, h uma facilitao da inibio
mediada pelo GABA, por hiperpolarizao da
membrana pr e/ou ps-sinptica e uma reduo do disparo neuronal.
O diazepam (Valium), o lorazepam (Lorax), o midazolam (Dormonid) e o clordiazepxido (Tensil) so usados no tratamento da
GAD. O alprazolam (Frontal) e o clonazepam
(Rivotril) so efetivos no ataque de pnico, agorafobia e GAD. Os efeitos colaterais mais comuns dos BZDs so a sonolncia residual, alm
da potenciao do efeito depressor de outras drogas como a cimetidina (Tagamet), alguns antihistamnicos e o etanol, sendo que pacientes
idosos so mais susceptveis. O principal pro-

ANSIOLTICOS

blema com o uso dos BZDs o desenvolvimento de tolerncia e dependncia.


Os BZDs, atuando nos R-BZD (BZ1 e BZ2),
tambm produzem outros efeitos teraputicos,
tais como relaxante muscular, anticonvulsivante
e hipno-sedativo. Como as diferenas entre os
BZDs de ordem farmacocintica e no farmacodinmica, geralmente os compostos de meiavida longa so usados como ansiolticos e os de
meia-vida curta como hipno-sedativos. Os principais hipno-sedativos usados na atualidade so
benzodiazepnicos, como o flurazepam (Dalmane). Alm dos BZDs, os anti-histamnicos (difenidramina Benadryl ) e os agonistas
especficos de receptores BZ1 no-benzodiazepnicos (zolpidem Ambien) so utilizados na
clnica mdica como hipno-sedativos atualmente. Os barbitricos, drogas muito usadas at a
dcada de 1960, atuam interagindo em stio receptor prprio localizado no canal de Cl- do receptor GABAA, aumentando a durao de abertura
desses canais, em doses teraputicas, ou como
GABAmimticos em doses altas. Esses compostos foram gradualmente substitudos pelos BZDs
que so mais seletivos, mais seguros e possuem
menor risco de gerar dependncia.

rem em minutos ou horas. Essa demora atribuda a uma adaptao celular ao nvel dos receptores como uma reduo dos adrenoceptores ,
alm de um aumento na transmisso 5-HT e
uma reduo na afinidade do stio receptor de
glicina no receptor NMDA.

AZAPIRONAS
A buspirona (Buspar), assim como outras
azapironas (gepirona, ipsapirona), apresenta
um efeito teoricamente ansio-seletivo, atuando como agonista parcial de receptores serotonrgicos 5-HT 1A somatodendrticos, o que
levaria, por retroalimentao negativa, a uma reduo nos nveis de 5-HT na fenda sinptica.
No entanto, seus efeitos teraputicos tambm demoram alguns dias/semanas para aparecerem,
o que faz com que a aderncia ao tratamento
seja pequena. Sua vantagem a de no promover dependncia, sedao e potenciao dos efeitos de outros depressores centrais. Seus efeitos
colaterais resumem-se a tonturas e nuseas, mas
no devem ser prescritos com drogas inibidoras
da MAO.

ANTIDEPRESSIVOS

OUTRAS DROGAS

Mais recentemente diversos antidepressivos foram introduzidos com sucesso na teraputica de vrios tipos de ansiedade. Entre eles temos
os antidepressivos tricclicos (ATCs), como a
imipramina (Tofranil) e a clomipramina (Anafranil), que inibem a recaptao de noradrenalina (NA) e serotonina (5-HT), sendo
estruturalmente similares aos antagonistas dos
transportadores de NA e 5-HT. Inibidores seletivos de recaptao de 5-HT (ISRSs), como
a fluoxetina (Prozac), sertralina (Zoloft), paroxetina (Aropax), e fluvoxamina (Luvox),
entre outros, so tambm usados na clnica,
assim como alguns inibidores da enzima monoamino-oxidase (IMAOs), como a tranilcipromina (Parnate). Seus efeitos colaterais vo
desde boca seca, hipotenso postural, constipao, viso borrada, insnia, ganho de peso,
tontura, crises hipertensivas (IMAOs) disfuno sexual. O maior problema com o uso
dos antidepressivos a demora para o aparecimento dos seus efeitos clnicos (2-8 semanas),
apesar dos seus efeitos bioqumicos aparece-

Os bloqueadores dos adrenoceptores ,


como o propanolol (Inderal) e o atenolol (Atenol), reduzem os componentes autonmicos

Tabela 35.1
Drogas de Escolha no Tratamento dos
Distrbios de Ansiedade
Distrbio
de Ansiedade

Tratamento com Drogas

GAD

BZDs, buspirona, ATCs

Ataques de
pnico

ISRSs, BZDs, ATCs, IMAOs

Fobias

BZDs, -bloqueadores, ISRSs

TOC

ISRSs, exceto quando


h tiques (neurolpticos),
clomipramina, IMAOs
(no responsivos)

Estresse
ps-traumtico

ISRSs e outros antidepressivos,


clonidina

351

Cap.

35

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

da ansiedade, como taquicardia e diaforese.


So teis em algumas fobias (ansiedade de performance) e em patologias cardacas, endcrinas e outras condies mdicas associadas
ao estresse e ansiedade. A clonidina (Atensina), agonista 2-adrenrgico, tem sido usada no tratamento do distrbio de estresse
ps-traumtico, mas apresenta efeitos colaterais importantes.

PERSPECTIVAS TERAPUTICAS
Outras drogas antagonistas de receptores serotonrgicos do tipo 5-HT2 (ritanserina) e 5-HT3
(ondansetron) vm sendo usadas na teraputica
das ansiedades. Outros moduladores do receptor GABA, como o paglocone, vm sendo testados na tentativa se obter uma maior seletividade
de ao e menos efeitos colaterais. Drogas seletivas que atuam em receptores de aminocidos
excitatrios como o glutamato e nos receptores
de neuropeptdeos (colecistocinina, substncia P,

Cap.

35

352

neuropeptdeo Y, CRH, opiides...) alm da pregabalina (derivado do anticonvulsivante gabapentina) so tambm possibilidades futuras na
abordagem teraputica dos distrbios de ansiedade.

BIBLIOGRAFIA
1. Brawman-Mintzer O, Lydiard RB. Biological basis of
generalized anxiety disorder, J. Clin. Psych, 51: 1625, 1997.
2. Jordan AD, Kordik CP, Reitz AB, Sanfillipo PJ. Novel
anxiolytics agents 1994 to present, Exp. Opin.
Ther. Patents, 6 (10): 1047-1060, 1996.
3. Kilts CD. Recent pharmacologic advances in
antidepressant therapy, AJM, 97 (suppl. 6A): 3S12S, 1994.
4. Rickels K, Schweizer E. The clinical presentation of
generalized anxiety in primary-care settings:
practical concepts of classification and management,
J. Clin. Psych., 58: 4-9, 1997.
5. Rubolph U. Identification of molecular substrate for the
attenuation of anxiety: a step toward the development
of better anti-anxiety dugs, The Scientific World,
1:192-193, 2001.
6. Fredman S, Korn M. Anxiety disorders and related
conditions, http://psychiatry.medscape.com, 2003.

ANTIPSICTICOS

Antipsicticos
Thereza Christina Monteiro de Lima

O termo esquizofrenia foi inicialmente usado para categorizar pacientes cujos processos e
respostas emocionais pareciam desconexos. O
termo significa literalmente mente dividida. A
esquizofrenia , dentre as psicopatologias, a mais
grave, afetando 1% da populao mundial. A
esquizofrenia um distrbio psictico crnico
caracterizado pela presena dos seguintes sintomas, que variam em nmero e intensidade:
Alucinaes auditivas
Delrios e distrbios do pensamento (conhecidos como sintomas positivos)
Indiferena afetiva, falta de motivao e interao social diminuda (conhecidos como
sintomas negativos)
Os tratamentos da esquizofrenia so sintomticos e no curativos, mas se feitos precocemente podem alcanar 80-85% de remisso. No
entanto, 30-40% dos pacientes esquizofrnicos
apresentam uma resposta inadequada aos tratamentos com drogas neurolpticas antipsicticas
tradicionais, o que leva a reinternaes repetidas e a um alto custo social, ocupacional e econmico. Neste aspecto, a introduo dos
antipsicticos atpicos trouxe um certo alento ao
quadro vigente at ento.
Quanto etiologia da esquizofrenia, podese afirmar que no h uma causa nica para todos os casos. So crescentes as evidncias de
que as anormalidades que ocorrem no desenvolvimento cerebral fetal so muito mais im-

portantes que os fatores causais genticos ou ambientais. Estudos recentes mostram que vrios
pacientes esquizofrnicos apresentam anormalidades no tamanho de certas reas cerebrais e
na sua atividade. H uma hipoatividade do crtex pr-frontal (aonde se processam parte da
memria, da razo, a agresso e a fala), que pode
ser responsvel pelos sintomas negativos, e uma
perda tecidual, principalmente no hipocampoamgdala (envolvidos no controle emocional) do
lado esquerdo do crebro, a qual atribuda a
sintomatologia positiva dessa patologia. Outras
anormalidades na circuitaria cerebral tambm
podem ser responsveis pelos sintomas, pois h
erros de percepo, concluses incorretas e
comportamentos estranhos como resposta s
informaes recebidas. Os fatores genticos e
neurolgicos tambm parecem importantes no
desenvolvimento da esquizofrenia, pois podem
ativar ou exacerbar seus sintomas. H tambm
um desbalano de neurotransmissores cerebrais,
especialmente do neurotransmissor dopamina
(DA), ocorrendo uma hiperatividade dopaminrgica em algumas regies do sistema nervoso central (SNC). Na verdade, o melhor suporte para
o envolvimento do sistema DA na esquizofrenia
veio do fato de que todas as drogas antipsicticas so antagonistas nos receptores dopaminrgicos do tipo D 2. No entanto, esse efeito
bloqueador dos receptores aparece em horas e
no se correlaciona temporalmente com os efeitos clnicos que se instalam semanas aps o
uso contnuo dos antipsicticos. O efeito tera-

353

Cap.

36

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Fig. 36.1 Representao esquemtica dos terminais dopaminrgicos (DA) e serotonrgicos (5-HT) e local de ao
das drogas antipsicticas tpicas (neurolpticos ) e atpicas.

putico das drogas antipsicticas parece estar


mais bem correlacionado com a diminuio da
circulao do principal metablito de DA, o cido homovanlico (HVA), que s ocorre aps algumas semanas de tratamento. Outra possvel
explicao para essa demora um aumento no
nmero de receptores dopaminrgicos D2, com
conseqente reduo nos receptores D1 (subtipos D1 e D5), no crtex cerebral.

DROGAS ANTIPSICTICAS TPICAS

Cap.

36

A abordagem teraputica primria da esquizofrenia feita com drogas antipsicticas


tpicas (neurolpticos), como a clorpromazina
(Amplictil), o haloperidol (Haldol), a tioridazina (Melleril) e a trifluoroperazina (Stelazine), embora atualmente haja uma tendncia
a tratar inicialmente os pacientes com drogas
atpicas. O mecanismo de ao das drogas tpicas , principalmente, o bloqueio de receptores
dopaminrgicos do tipo D2 na via mesolmbica.
No h grandes diferenas entre as drogas citadas, sendo que todas so eficazes em controlar os sintomas positivos da doena, mas no
os negativos. Seus efeitos colaterais so vrios
e muitos esto relacionados sua ao bloquea-

354

dora de receptores dopaminrgicos em outras


vias, como a nigroestriatal. A ao nessa via leva
aos principais efeitos colaterais que so os extrapiramidais e que vo de uma distonia aguda
discinesia tardia em mdio prazo, de maior
ou menor intensidade, sendo que alguns desses efeitos mimetizam a sintomatologia da doena de Parkinson. O tratamento dos efeitos
colaterais extrapiramidais se faz por reduo da
dose do medicamento ou pela sua troca por uma
droga atpica. s vezes so prescritas drogas
antiparkinsonianas, como o anticolinrgico
trihexifenidil (Artane), que aumenta os nveis
de dopamina e ajuda a reestabelecer o balano
neuroqumico. Essas drogas tambm so teis
na melhora dos sintomas negativos da esquizofrenia, mas possuem efeitos colaterais que
no podem ser desprezados, alm de aumentarem os custos do tratamento.

DROGAS ANTIPSICTICAS ATPICAS


Esse grupo de drogas tambm bloqueia os
receptores dopaminrgicos D2, especialmente os
D4, porm parece faz-lo em outras reas cerebrais, diferentes daquelas de atuao dos neuro-

ANTIPSICTICOS

lpticos tpicos, alm de serem antagonistas de


receptores de outros neurotransmissores, como
o serotoninrgico 5-HT2. Entre elas temos a clozapina (Leponex) e a risperidona (Risperdal).
Essas drogas parecem ter efeitos benficos sobre
os sintomas positivos e negativos da esquizofrenia e apresentam menos efeitos colaterais, no
produzindo efeitos extrapiramidais, o que as distingue das drogas tpicas.

OUTRAS DROGAS
Os antidepressivos podem ser usados junto
com os antipsicticos para aliviar a depresso,
comorbidade comum em pacientes esquizofrnicos. Os ansiolticos benzodiazepnicos tambm
podem ser usados em algumas situaes clnicas, embora seu uso prolongado no seja recomendado. O ltio parece til em melhorar alguns
sintomas negativos em indivduos sem histria
familiar de esquizofrenia. As drogas antiepilpticas como a carbamazepina (Tegretol) e o valproato de sdio (Depakene), so razoavelmente
benficas em casos no responsivos e indivduos
violentos.

OUTRAS TERAPIAS
Um quinto a um tero dos pacientes esquizofrnicos no responde adequadamente terapia medicamentosa. Outras terapias, como a
psicoterapia, a terapia psicossocial e o eletrochoque convulsivo, so usadas, alm de ser fundamental um suporte psicolgico famlia. Um
outro tratamento alternativo que tem sido tentado a glicina, um aminocido, mas at o momento os resultados so pouco consistentes. A

busca de um antagonista seletivo de receptores


dopaminrgicos D4 tambm uma das possibilidades para se encontrar drogas mais especficas para essa psicopatologia.

PERSPECTIVAS TERAPUTICAS
Existem algumas tentativas do uso de antagonistas dos receptores sigma e neurocinrgico
NK1, agonistas NMDA, anlogos de glutamato e,
especialmente, agonistas nicotnicos seletivos. Um
outro achado recente diz respeito natureza da
interao das drogas antipsicticas conhecidas e
usadas clinicamente ao nvel dos receptores D2,
aonde esses antagonistas parecem ser de fato agonistas inversos desse receptor.

BIBLIOGRAFIA
1. Andreasen NC. Schizophrenia: the fundamental
questions, Brain Res. Rev., 31:106-112, 2000.
2. Fleischhacker WW, Hummer M. Drug treatment of
schizophrenia in the 1990s. Achievements and future
possibilities in optmising outcomes, Drugs, 53 (6):
915-929, 1997.
3. Hall DA, Strange PG. Evidence that antipsychotic drugs are
inverse agonists at 2-dopamine receptors, Brit. J.
Pharmacol., 121:731-736, 1997.
4. Howard HR. Antipsychotic drugs: recent developments
and novel agents, Exp. Opin. Ther. Patents,
7(4):353-369, 1997.
5. Lidow MS, Willians GV, Goldman-Rakic P. The cerebral
cortex: a case for common site of action of
antipsychotics, TiPS, 19:136-140, 1998.
6. Mardes Sr, Essock SM, Miller AL, Buchanan RW, Davis
JM, Kane JM, Lieberman J, Schooler NR. The
Mount Sinai conference on the pharmacotherapy of
schizophrenia. Schizopr. Bull, 28(1):5-16, 2002.
7. Pickar D. Prospects for pharmacotherapy of
schizophrenia, Lancet, 345:557-561, 1995.
8. Terenius L. Schizophrenia: pathophysiological
mechanisms a synthesis, Brain Res. Bull, 31:401404, 2000.

Cap.

355

36

ANTIEPILPTICOS

Antiepilpticos
Thereza Christina Monteiro de Lima

A epilepsia tem atrado todas as culturas atravs da histria da humanidade, sendo que sua
natureza violenta e, at certo ponto, misteriosa,
levou sua denominao que, em grego, significa possudo por algo acima (epi = acima +
lamvano = receber) ou por um poder divino,
o que fazia com que os seus portadores fossem
considerados desde sacerdotes a bruxos ou possudos pelo mal, em diferentes pocas e culturas. A epilepsia um termo genrico que designa
seletivamente um grupo de distrbios crnicos
do sistema nervoso central (SNC), caracterizados por crises epilpticas recorrentes de curta
durao na ausncia de fatores precipitadores.
As crises epilpticas so manifestaes de distrbios da atividade eltrica cerebral, conseqentes a descargas neuronais anormais e excessivas.
As manifestaes clnicas das crises variam de
breves lapsos de reatividade sem perda de conscincia (crises de ausncia) a convulses com
perda de conscincia (crises tnico-clnicas generalizadas). As descargas eltricas anormais
podem ou no ser acompanhadas de manifestaes clnicas, na dependncia do local e do nmero de neurnios envolvidos. A descarga
anormal pode ser limitada a um foco (crise parcial) ou se espalhar por vrias regies (crise generalizada). A classificao adequada das crises
fundamental para a escolha da terapia adequada
e especfica.
A epilepsia o distrbio neurolgico mais
comum do mundo ocidental. Sua incidncia
de 0,5-1% na populao. As crises recorrentes,
se freqentes, interferem com a capacidade do

paciente em manter suas atividades dirias e a


terapia medicamentosa eficiente em controlar
as crises em 70-80 % dos pacientes. A epilepsia
est entre os primeiros distrbios do SNC tratados efetivamente com drogas, as quais so usadas na profilaxia das crises.
A etiologia da epilepsia parcialmente conhecida. Entre as inmeras causas da epilepsia temos alteraes inicas e eletrolticas, distrbios
do metabolismo de carboidratos, aminocidos e
lipdeos, infeces do SNC, tumores cerebrais,
traumatismos cranianos; ingesto de drogas e
hipertermia. Os mecanismos bsicos da epilepsia so diversos e procurar uma nica causa ,
no mnimo, subestimar o problema. No entanto, h basicamente duas hipteses para explicar
as crises parciais e as convulses generalizadas:
uma hipoatividade GABArgica (principal sistema neurotransmissor inibitrio, mediado pelo
GABA, cido -aminobutrico) e uma hiperatividade dos sistemas de neurotransmissores aminoacidrgicos (AAEs), excitatrio, mediados
principalmente pelo glutamato e aspartato, no
SNC. Por outro lado, o GABA, agindo em receptores GABAA e GABAB do tlamo, ativa correntes de Ca2+ de baixo limiar, resultando em
oscilaes talmicas, traduzidas comportamentalmente como crises de ausncia tpicas. Na verdade, podemos dizer que quatro mecanismos
esto envolvidos na gnese e espalhamento das
descargas epilpticas:
1) Alterao de funo na membrana neuronal,
como mudanas nos canais inicos regula-

357

Cap.

37

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

D iazepam
Lorazepam
Lorazepam
C lonazepam
lonazepam
C
Fenobarbital
Fenobarbital
Vigabatrina

Etanol

Gabapentina
Progabida
Tiagabina

GAB A-T

C lG AB A

GABA
GABA

B ZD
B ZD

G A BA B

C arbamazepina

N a+

G LU

Fenitona
Valproato

N a+
C a 2+

GABA
BZD

K+
Z n 2+ / M g 2+

NM D A
G licina
Poliam inas

Lamotrigina
Gabapentina?
Felb am ato?

Fig. 37.1 Representao esquemtica das transmisses inibitria (cido g-aminobutrico, GABA) e excitatria (glutamato, GLU), envolvendo receptores GABAA e NMDA (N-metil-d-aspartato), respectivamente, e local de ao das drogas
antiepilpticas.

dos por voltagem, que podem levar despolarizao excessiva (desvio despolarizante
paroxstico) ou excesso de potencial de ao
(perda da inativao).
Terapia medicamentosa: A fenitona (Dilantin), a fosfenitona (Cerebyx), a carbamazepina (Tegretol) e sua pr-droga oxcarbazepina
(Trileptal) reduzem o disparo repetitivo por bloqueio do canal de Na+ dependente de voltagem.
Essa ao compartilhada pelo felbamato, que
parece tambm ampliar as respostas mediadas
pelo receptor GABAA e modular a funo do receptor de AAEs do tipo NMDA (N-metil-D-aspartato). O valproato de sdio (Depakene), a
etossuximida e a zonisamida parecem agir bloqueando canais inicos (Na+, K+ e Ca2+) e o
disparo neuronal, reduzindo a atividade da ATPase Na+-K+ dependente.
Cap.

37

2) Reduo da inibio, o que permite o disparo neuronal excessivo.


Terapia medicamentosa: As drogas que aumentam os nveis de GABA reduzem o disparo
neuronal. Os benzodiazepnicos, como o diazepam (Valium), o lorazepam (Lorax) e o clonazepam (Rivotril), entre outros, faciltam a
transmisso GABArgica, por, agindo num stio
alostrico (R-BZD), aumentarem a afinidade do
GABA nos receptores GABAA e, em conseqn-

358

cia, a freqncia de abertura do canal de Cl- associado a esse receptor. Os barbitricos, como o
fenobarbital (Gardenal) e a primidona, atuam
em stios receptores prprios aumentando a durao da abertura dos canais de Cl- no receptor
GABAA e, em altas doses, agem como GABAmimticos. O valproato de sdio inibe a degradao e/ou aumenta a sntese de GABA, enquanto
a vigabatrina (Sabril) um inibidor irreversvel
da enzima de degradao do GABA, a GABA-T
(GABA-transaminase). A gabapentina um anlogo cclico de GABA, que altera a sntese e liberao desse aminocido, mas que tambm limita
os potenciais de ao dependentes de Na+, enquanto a progabida uma pr-droga GABA e a
tiagabina age como inibidor de recaptao de
GABA. H ainda drogas que atuam nos receptores
de adenosina. A ativao desse sistema ativa segundos-mensageiros e reduz a liberao pr-sinptica de neurotransmissores, como fazem a
carbamazepina e a oxcarbazepina (Fig. 37.1).
3) Aumento da excitao, pois o glutamato interage com os receptores do tipo NMDA,
que esto envolvidos nas descargas de alta
freqncia.
Terapia medicamentosa: Os antagonistas do
receptor NMDA, como a dizolzipina, reduzem a
excitao, a epileptognese, a sincronizao e o

ANTIEPILPTICOS

Tabela 37.1
Tratamento Farmacolgico das Epilepsias
Tipo de Crise

Droga de Escolha

Alternativas

Parciais

Carbamazepina
Fenitona

Primidona
Fenobarbital

Ausncia tpica

Etossuximida

Valproato + Etossuximida

Ausncia atpica

Valproato

Clonazepam

Mioclnica

Valproato

Fenobarbital

Espasmos infantis

ACTH

Corticosterides

Valproato

Fenitona

Carbamazepina

Fenobarbital

Generalizadas

Clnica ou tnica
Tonicoclnicas

Fenitona
Atnicas

Valproato

Acinticas

Valproato

Clonazepam

Febril recorrente
Status epilepticus

Fenitona
Fenobarbital
Diazepam

Fenitona

Fenobarbital

espalhamento da descarga eltrica. A lamotrigina


(Lamictal) inibe a liberao de AAEs, especialmente de glutamato, alm de estabilizar as membranas pr-sinpticas neuronais por bloqueio dos
canais de Na+ dependentes de voltagem.
4) Alteraes das concentraes extracelulares de
K+ e Ca2+, pois, durante as convulses, as
concentraes extracelulares de K+ aumentam e as de Ca2+ diminuem, o que aumenta a
excitabilidade de neurnios, fato importante
na gnese e espalhamento das crises.
Terapia medicamentosa: A fenitona e seus
derivados so as drogas mais efetivas em bloquear os potenciais de ao quando o K+ extracelular est elevado. A crise de ausncia
eficazmente prevenida pela etossuximida que reduz as correntes de Ca2+.
Embora as drogas antiepilpticas no tenham
seus mecanismos de ao completamente esclarecidos, patente que elas exercem suas aes de
duas maneiras gerais:
agindo diretamente nos stios de atividade
eltrica anormal (foco), reduzindo ou impedindo a excitabilidade;
atuando nos neurnios no epilpticos adjacentes, limitando seu envolvimento no espalhamento da atividade epilptica, que o

mecanismo geral pelo qual agem a maioria


das drogas disponveis.

PERSPECTIVAS TERAPUTICAS
Algumas drogas vm sendo testadas clinicamente, como a remacemida, o topiramato, o felbamato, a zonisamida e o levetiracetam, entre
outras, e parecem ser mais efetivos ou, pelo menos, efetivos em indivduos refratrios s terapias
disponveis, alm de apresentarem menos efeitos
colaterais, porm seus mecanismos de ao no
esto totalmente esclarecidos.

BIBLIOGRAFIA
1. Benetello P. New antiepileptic drugs, Pharmacol. Res.,
31 (3/4): 155-162, 1995.
2. Bleck TP, Klawans HL. Convulsive disorders:
mechanisms of epilepsy and anticonvulsant action,
Clin. Neuropharmacol, 13(2):121-128, 1993.
3. Cockerell OC, Shorvon SD. Epilepsia conceitos atuais,
Lemos Ed. Graf., So Paulo, 1997.
4. Jones, JM. The falling sickness in literature, South Med
J, 93 (12):1169-1172, 2000.
5. Lackner TE. Strategies for optimizing antiepileptic drug
therapy in elderly people, Pharmaco-therapy, 22
(3):329-364, 2002.
8. Patsalos PN, Duncan JS. New antiepileptic drugs. A
review of their current status and clinical potential,
CNS Drugs, 2(1):40-77, 1994.
7. Upton N. Mechanisms of action of new antiepileptic
drugs: rational design and serendipitous findings,
TiPS, 15: 456-463, 1994.

359

Cap.

37

ANTIDEPRESSIVOS

Antidepressivos
Thereza Christina Monteiro de Lima

O termo depresso aplicado a uma variedade de experincias que vo de uma sensao de


infelicidade transitria, reativa a perdas na vida
do indivduo normal e saudvel, a estados de desesperana patolgica com caractersticas psicticas. Assim, preciso distinguir a depresso,
como uma psicopatologia, das alteraes de humor, que ocorrem como resposta normal a perdas, doenas fsicas ou mudanas nas condies
de vida, pois as alteraes de humor normais so
autolimitadas, embora possam persistir em diferentes graus por semanas ou mesmo meses.
A depresso tem incidncia de 10% na populao com um custo socioeconmico muito elevado, alm das perdas pessoais do paciente e daqueles
que com ele se relacionam no cotidiano.
A depresso como doena afetiva apresenta
subtipos clnicos de intensidade e durao diferentes que incluem a depresso maior, a distimia
(depresso leve e crnica), a depresso atpica e
o distrbio bipolar (ou psicose manaco-depressiva), alm dos distrbios disfrico pr-menstrual e afetivo sazonal.
As tentativas de identificar as causas da depresso levaram aceitao de diversos fatores
predisponentes, como estresse, traumas, relaes
sociais e familiares fracas, uso de certos medicamentos, infeces, alm de fatores biolgicos
individuais. Em relao a esses, h concordncia sobre a existncia de um desbalano neuroqumico no sistema nervoso central. H

evidncias de um dficit funcional de serotonina (5-HT), de catecolaminas como a noradrenalina e a dopamina (NA e DA) e de acetilcolina
(Ach) em estruturas cerebrais, relacionadas com
o controle emocional, especialmente o sistema
lmbico e suas projees. O lobo pr-frontal,
por exemplo, relativamente menor e menos
ativo em pacientes idosos com depresso.
Cerca de 70-90% dos casos de depresso
so efetivamente tratados com medicamentos
especficos, porm s um tero dos indivduos
afetados percebe que est doente e busca tratamento mdico. A combinao de terapia e drogas antidepressivas parece ser mais efetiva que o
uso de apenas uma dessas abordagens teraputicas. Os antidepressivos so usados em todos os
subtipos de distrbios depressivos exceo do
distrbio bipolar, cujo tratamento envolve tambm outras drogas. Nos indivduos no responsivos a esses tratamentos, outras tcnicas podem
ser usadas, como a terapia eletroconvulsiva, que
segura e efetiva em pacientes em risco iminente de suicdio e em idosos. Os casos severos, no
responsivos a quaisquer terapias, podem se beneficiar da neurocirurgia (cingulotomia).

INIBIDORES SELETIVOS
DE RECAPTAO DE 5-HT
Os inibidores seletivos de recaptao de 5-HT
(ISRSs) so atualmente as drogas de primeira

361

Cap.

38

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

ISRSs Fluoxetina
Sertralina
Paroxetina

5-HT 3

Fluvoxamina
ATCs Imipramina
Clomipramina

5-HT
5-HT 1A

IMAOs
Clonidina

M
A 5-HT
O
5-HT

5-HT 2
5-HT 1A

1B/D

IMAOs
Buspirona

Tranilcipromina

Gepirona
Ipsapirona

Clonidina

M
A
O

NA

Fig. 38.1 Representao esquemtica dos terminais serotonrgico (5-HT), noradrenrgico (NA) e local de ao dos
ansiolticos tipo azapironas (pr-sinapse 5-HT) e dos antidepressivos inibidores seletivos de recaptao de 5-HT (ISRSs),
tricclicos (ATCs) e inibidores da monoaminooxidase (IMAOs).

Cap.

38

escolha no tratamento da depresso maior e de


outros tipos de depresso. Entre eles temos a fluoxetina (Prozac), a sertralina (Zoloft), a paroxetina (Aropax) e a fluvoxamina (Luvox). Essas
drogas, ao inibirem os mecanismos especficos de
transporte de 5-HT na membrana pr-sinptica,
bloqueiam o processo de recaptao e produzem
um aumento nos nveis desse neurotransmissor
na fenda sinptica. Os ISRSs so to eficientes
quanto os antidepressivos tricclicos, mas, por agirem mais seletivamente, produzem efeitos colaterais menos graves, como nuseas, disfunes
sexuais e problemas gastrointestinais. Algumas interaes medicamentosas graves ocorrem com outros antidepressivos, anti-histamnicos (astemizol
Hismanal), demerol e algumas drogas de abuso (LSD, cocana, ecstasy).

e a clomipramina (Anafranil ), eram o tratamento-padro das depresses. Esses compostos inibem a recaptao de noradrenalina e
serotonina (5-HT), atuando como moduladores alostricos negativos nos stios de transportadores pr-sinpticos dessas aminas. Alm
disso, bloqueiam receptores adrenrgicos 1
(causando hipotenso ortosttica, tontura),
colinrgicos muscarnicos (produzindo boca
seca, viso turva, reteno urinria e constipao) e histaminrgicos H1 (levando sedao
e ganho de peso), aes estas responsveis por
seus efeitos colaterais. So compostos ainda
teis na clnica, especialmente em pacientes
que no respondem aos ISRSs.

ANTIDEPRESSIVOS TRICCLICOS

INIBIDORES
(MAO)

Antes da introduo dos ISRSs, os antidepressivos tricclicos (ATCs), como a imipramina (Tofranil), a nortriptilina (Pamelor)

Os inibidores irreversveis da enzima MAO


(IMAOs), enzima metabolizadora das aminas
nos terminais sinpticos, como a tranilcipro-

362

DA

MONOAMINOOXIDASE

ANTIDEPRESSIVOS

mina (Parnate ), so geralmente indicados


quando outros antidepressivos mostram-se
ineficazes. Seus efeitos colaterais vo desde
hipotenso postural, tonturas, disfuno sexual e insnia, a crises hipertensivas (reao
do queijo) quando da ingesto de comidas
ricas em tiramina (queijo, vinho tinto, fgado
de galinha...,). Apresentam ainda srias interaes medicamentosas com vrias drogas
(descongestionantes, psicoestimulantes,
ISRSs, ...). Os inibidores seletivos reversveis
da MAOA, como a moclobemida (Aurorix),
so mais seguros para o uso clnico.

OUTRAS DROGAS
Drogas sintetizadas mais recentemente, como
a venlafaxina (Efexor), atuam bloqueando a recaptao de noradrenalina e serotonina ( semelhana dos ATCs), mas produzem menos efeitos
colaterais. O bupropion, per si um inibidor fraco
da recaptao de NA e DA, mas gera um metablito hidroxilado que possui maior eficcia, sendo
usado em pacientes no responsivos aos ISRSs,
tambm porque produz menos disfunes sexuais que estes. Seus efeitos colaterais so a agitao, cefalias, perda de peso e aumento do risco
de crises convulsivas. Outras drogas com mecanismos de ao semelhantes aos ATCs e ISRSs
esto disponveis para uso teraputico, como a
mirtazapina (Remeron) e a maprotilina (Ludiomil), sem que haja grandes diferenas no que
diz respeito sua eficcia como antidepressivo,
mas, em geral, com efeitos colaterais menos graves que os dos ATCs e ISRSs.

EFEITOS BIOQUMICOS X EFEITOS CLNICOS


Embora os efeitos bioqumicos (aumento
nos nveis de aminas cerebrais) dos antidepressivos ocorram em minutos ou horas, seus efeitos clnicos levam, no mnimo, de duas a quatro
semanas para aparecerem. Isto atribudo a
uma alterao no nmero de receptores pr e
ps-sinpticos (1, 2, 5-HT2,...). Recentemente, aventou-se a hiptese de que o mecanismo final comum para os antidepressivos seja
o de que todos, atravs da regulao dos diferentes receptores, aumentariam os nveis endgenos de neurotrofina-3.

LTIO
Na profilaxia da mania (distrbio bipolar)
so usados os sais de ltio (Li). O Li parece
inibir a inositol-monofosfatase, uma enzima
que regula os nveis intracelulares de inositol,
o que levaria sua queda e conseqente reduo na sntese de fosfatidilinositol e dos segundos-mensageiros inositol 1,4,5- trifosfato
e diacilglicerol, produzindo seu efeito teraputico. Os episdios de mania agudos, por sua
vez, so tratados com antipsicticos atpicos
como a clozapina, a olanzapina e a risperidona, pois o Li no possui ao depressora ou
sedativa. O uso de anticonvulsivantes, como o
valproato de sdio, a carbamazepina, a lamotrigina, a gabapentina, o topiramato e a tiagabina, so alternativas no tratamento da mania.

PERSPECTIVAS TERAPUTICAS
Outras terapias como a privao de sono
(que reduz os adrenoceptores ), ou drogas
como o rolipram (que aumenta os nveis de
AMPc por inibio da enzima fosfodiesterase),
assim como a reposio de estrgeno (na depresso associada menopausa ou ps-parto)
e o uso de plantas medicinais (por exemplo, o
uso do Hypericum perforatum erva-de-SoJoo - nas distimias), vm sendo pesquisadas
na tentativa de se obter uma abordagem mais
segura, rpida e eficiente para o tratamento da
depresso.

BIBLIOGRAFIA
1. Altar CA. Neurotrophins and depression, TiPS, 20: 5961, 1999.
2. Atack JR. Inositol monophosphatase inhibitors: a novel
treatment for bipolar disorders?, Biol. Psych., 37;
761-763, 1995.
3. Kilts CD. Recent pharmacologic advances in
antidepressant therapy, Amer. J. Med., 97 (suppl.
6A):3S-12S, 1994 .
4. Mongeau R, Blier P, de Montigny C. The serotonergic
and noradrenergic systems of the hippocampus: their
interactions and the effects of antidepressants
treatments., Brain Res. Rev., 23:145-195, 1997.
5. Richelson E. Pharmacology of antidepressants
characteristics of the ideal drug, Mayo Clin. Proc.,
69:1069-1081, 1994.
6. Rosenbaum JF. Clinical update on the treatment of
depression, http://psychiatry.medscape.com, 2003.
6. Spigset O, Martensson B. Drug treatment of depression,
BMJ, 518: 1188-1191, 1999.
7. Young AH. Treatment strategies in bipolar affective
disorders, http://psychiatry.medscape.com, 2003.

363

Cap.

38

NDICE REMISSIVO

ndice Remissivo

A
Abortamentos espontneos, 207
Acetato de ciproterona, 322
Acetazolamida, 297
Acetilcolina, 280
Acidentes vasculares cerebrais, 293
cido(S)
araquidnico, 337
carboxlico, 18
desoxirribonuclico (v. DNA)
fosfatdico, 24
fosfrico, 24
graxos, 20
lipdios formados a partir de, 21
homovanlico, 354
nuclico, 4, 65
mtodos de anlise do, 158
reao em cadeia da polimerase, 159
tcnica de Northern blot, 159
tcnica de Southern blot, 158
nuclico-alvo, 164
olico, 228
ribonuclico (v. RNA)
silico, 25
Adenilil cilcase, 106, 266
Adenina, 32, 77
Adenocarcinoma, 166
Adenosina, 235
deaminase, 235
via metablica de, 235
Adenovrus, 124
Adrenoleucodistrofia ligada ao X, 228
Agonistas opiides, 346
AIDS, 134

Ala de Henle, 299


Aldolase, 11
Aldoses, 13
Aldosterona, antagonistas da, 299
Alteraes
congnitas na estruturao e montagem das
protenas, 98
cromossmicas, 207-213
aneuploidia, 208
deleo, 210
dissomia uniparental, 212
duplicao, 211
estruturais, 209
inverso, 211
isocromossomo, 211
numricas, 208
poliploidia, 209
sndrome de instabilidade cromossmica, 212
stio frgil do X, 212
translocao, 211
Alzheimer, mal de, 282
Amiloride, 299
Aminas simpatomimticas, 275
Aminocidos, 5
e protenas, 4, 7
conformao, 8
desnaturao de protenas, 11
interao entre protenas, 10
isomeria ptica, 4
ligao peptdica, 5
metionina, 87
traduo do RNAm em uma seqncia de, 90
Aminoglicosdeos, 286
Ampicilina, 149
resistncia a, 235

365

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Amplificao gnica, 248


Amrinona, 306
Analgsicos opiides, 343-348
atenuao da resposta a agonistas opiides, 346
mecanismos envolvidos, 345
reduo dos nveis de AMPc, 344
regulao de canais inicos, 344
Anatomia do gene, 87
Andrgenos, 319
aes fisiofarmacolgicas e utilizao teraputica
dos, 321
antagonistas de receptores de, 322
inibidores de sntese de, 322
mecanismo de ao, 320
sntese, armazenamento e regulao, 319
Anestsicos locais, 289-292
efeitos, 291
indesejados, 291
nas fibras nervosas, 291
mecanismo de ao, 290
Aneuploidia, 208
Angelman, sndrome de, 212
Angiotensina, 295
I, enzima de converso da, 143
II, bloqueadores do receptor de, 295
Anidrase carbnica, inibidores da, 297
Ansiedade, distrbio de, drogas de escolha no
tratamento dos, 351
Ansiolticos, 349-352
antidepressivos, 351
azapironas, 351
benzodiazepnicos, 350
perspectivas teraputicas, 352
tipos de, 351
Antagonistas
-adrenrgicos, 277, 296
da aldosterona, 299
da dopamina, 316
de clcio, 295
de receptores
adrenrgicos, 277
de andrgenos, 322
de serotonina, 316
muscarnicos, 315
Anticidos
no-sistmicos, 313
sistmicos, 313
Antiandrgenos, mecanismos de ao, 322
Antiarrtmicos, 301-303
Antibitico(s)
aminoglicosdeos, 279
resistncia ao, 235
ampicilina, 235
neomicina, 235
Anticolinrgico trihexifenidil, 354
Anticolinestersicos, 286
Antidepressivos, 351, 361

366

inibidores
da monoaminooxidase, 362
seletivos de recaptao de 5-HT, 361
ltio, 363
perspectivas teraputicas, 363
tipos de, 363
tricclicos, 362
Antidiarricos, 317
Antiemticos, 315
Antiepilpticos, 357-359
perspectivas teraputicas, 359
Antiestrgenos, 329
aes farmacolgicas, 330
mecanismos
de ao, 329
de induo de resistncia de tumores mamrios
aos, 331
Antgeno T, 75
Anti-hipertensivos, 293-296
antagonistas
-adrenrgicos, 296
de clcio, 295
ativadores do canal de potssio, 296
diurticos, 293
liberadores de xido ntrico, 296
mecanismos de ao, 294
simpatolticos, 294
vasodilatadores, 295
Antiinflamatrios esteroidais e no-esteroidais, 337
envolvimento dos eicosanides na resposta
inflamatria, 337
tipos de, 338
Antiprogestina, 334
mecanismo de ao, 335
Antipsicticos, 353-355
atpicas, 354
perspectivas teraputicas, 355
tpicos, 354
Aparelho de Golgi, 94
Apomorfina, 316
Apoptose, 133
mecanismos moleculares envolvidos na, 138
caspases, 139
P53, 139
protenas da famlia do Bcl-2, 139
receptores de TNF/CD95, 139
Arritmias, 301
Aspirina, 266
Ataque de pnico, 351
Ataxia espinocerebelar 197
Atividade
enzimtica especfica, medida da, 226
guanilil ciclase, receptores com, 107
tirosina quinase, receptores com, 107
tomos de carbono, 7
Atracrio, 286
Atropina, 311

NDICE REMISSIVO

Axoplasma, 274
Azapironas, 351

B
Bacillus amyloliquefaciens, 216
Bacilo Gram-negativo, 312
Bactria Thermus aquaticus, 221
Bacterifago lambda, 150
Bandamento G, padro de, de um cromossomo
metacntrico, submetacntrico e acrocntrico, 205
Bandas cromossmicas, 205
Barbitricos, 350
Barr, corpsculos de, 206
Barreira hematoenceflica, 346
BDNA, 184
Benzodiazepnicos, 35
Betanecol, 281
Bibliotecas
de DNA complementar, 153
genmicas, 46, 153
Bicarbonato de sdio, 313
Biologia molecular como instrumental mdico, 163-187
anlise de restrio introduzida por primer, 170
anlise do produto da PCR, 168
pelo seu comprimento, 168
por outras metodologias, 169
BDNA, 184
chips e seqenciamento por hibridizao, 185
clivagem
de mismatch por ribonuclease, 176
qumica de mismatch, 176
confirmao da presena/ausncia do produto da
PCR, 165
digesto com enzima de restrio, 170
ensaio de nuclease 5, 172
faris moleculares, 173
hibridizao, 184
com oligonucleotdeos alelo-especficos, 170
mtodos
de varredura, 175
diagnsticos, 170
monitoramento do aparecimento do produto da
PCR em tempo real, 172
NASBA, 184
OLA e LCR, 172
outras tecnologias para amplificar cidos
nuclicos, 183
PCR, 163
no diagnstico gentico pr-implantao de
doenas monognicas, 179
RAPD, 179
seqenciamento
de DNA na medicina molecular, 181
do produto de PCR, 172
teste de protena truncada, 177

TMA, 184
Biologia molecular do gene, 31-51
clonagem gnica atravs de PCR, 50
clonagem gnica: princpios, estratgias e
ferramentas, 39
ferramentas do DNA recombinante: enzimas
modificadoras do DNA, vetores e clulas
hospedeiras, 40
enzimas de restrio, 42
enzimas modificadoras do DNA, 40
vetores e clulas hospedeiras, 43
princpios e estratgias, 39
conceito de gene, 37
construo de bibliotecas ou genotecas, 45
bibliotecas genmicas, 46
construo de bibliotecas de cDNA, 47
isolamento de clones recombinantes em
bibliotecas de cDNA ou genmicas, 48
atravs de PCR, 49
com sondas radioativas atravs de hidridao
de cidos nuclicos, 48
cromossomos, genes e DNA, 31
estrutura do DNA e replicao do DNA, 32
fluxo da informao gentica na clula: cdigo
gentico, RNAs e protenas, 35
Biomolculas, 3-29
aminocidos e protenas, 4
aminocidos, 4
conformao, 8
desnaturao de protenas, 11
interao entre protenas, 10
isomeria ptica dos aminocidos, 4
ligao peptdica, 5
protenas, 7
carboidratos, 12
derivados de monossacardeos, 18
estereoqumica dos, 15
estrutura cclica dos acares, 16
ligao glicosdica, 18
mutarrotao e poder redutor dos acares, 17
lipdios, 20
eicosanides, 25
formados
a partir de cidos graxos, 21
a partir de isoprenides, 26
fosfoacilglicerdios, 23
glicolipdeos, 25
triacilglicerdios, 22
Bloqueadores
-adrenrgicos, 294
competitivos, 286
da transmisso neuromuscular esqueltica, 285-287
do canal de Na+ do epitlio renal, 299
do neurnio simptico, 276
do receptor de angiotensina II, 295
Brometo de etdio, 148
Bromocriptina, 316

367

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Bupivacana, 290
Burkitt, linfoma de, 246
Butirilcolina, 282
Butirilcolinesterase, 282

C
Cadeia de DNA, 221
Clcio
antagonistas de, 295
como segundo mensageiro, 109
cAMP, papel do, na regulao metablica em
diferentes tipos celulares, 107
Canabinides, 316
Canal(is)
de potssio, 290
ativadores do, 296
de sdio, 290
inicos, 105, 257
receptores acoplados a, 258
Cncer
genes do, 245
mecanismo de ativao de proto-oncogenes, 246
oncogenes, 245
mamrio, ao tumoral local em clulas do, 330
Captopril, 266, 295
Caracteres, anlise de, determinados
geneticamente, 191-201
Carboidratos, 4, 12
derivados de monossacardeos, 18
estereoqumica dos, 15
estrutura cclica dos acares, 16
ligao glicosdica, 18
mutarrotao e poder redutor dos acares, 17
Carbonila, 19
Carbono, cidos de, 7
Carboxiterminal, 7
Caritipo
47,XX,+21, 209
de um homem normal com bandamento G, 206
Caspases, 135, 139
Cauda poli-A, 47
cDNA, construo de bibliotecas de, 47
Cefalina, 24
Clula(s)
A293, 241
B, 246
de Leydig, 319
de mamferos, mtodos utilizados para
transferncia de gene nas, e provveis aplicaes
em terapia gnica, 233
de Sertoli, 320
diplides, 31
do cncer mamrio, ao tumoral local em, 330
endcrinas, 309
epitelial, 333

368

renal, 299
eucariticas, 44, 71
granulosa, 326
hospedeira, 39
LLC-PK1, 138
modificadoras geneticamente, 234
parcrina, 311
parietal, 311
ps-sinptica, 105
primordiais hematopoticas, 237
procariticas, 53, 62
T CD4, 134
teca, 326
tumorais, exfoliao de, em urina, 166
Crebro, efeito da progesterona no, 334
Cetona, 13
Cetoses, 13
Chaperones moleculares, 97
Chips e seqenciamento por hibridizao, 185
Ciclinas, 115
oncogenes e genes supressores de tumor, 130
quinases dependentes de, 117
Ciclizina, 315
Ciclo
celular, 113-119
aspectos gerais, 113
ciclinas, 115
controle da proliferao celular, 115
fases do, 114
G0 e G1, 114
S, G2 e M, 114
fatores de crescimento, 115
do inositol, 268
lisognico, 151
menstrual, 328
controle neuroendcrino do, 328
efeitos da progesterona na proliferao e
decidualizao uterina durante o, 333
mittico, mostrando a morfologia dos
cromossomos, 204
Ciclooxigenase, 337
Cinarizina, 315
Cingulotomia, 361
Cininase II, 143
Circulao sangnea, 316
Crculo rolante
e transcrio reversa, 76
mecanismo de, 76
Citocromo c, 9
Citogentica-molecular, 205
Citomegalovrus, 235
Citometria de fluxo, 138
Citosina, 60, 77
Clivagem de mismatch por ribonuclease, 176
Clomifeno, 329
Clonagem
aplicaes da, 160

NDICE REMISSIVO

atravs de PCR, 50
em vetores de expresso, 156
princpios, estratgias e ferramentas, 39
ferramentas do DNA recombinante: enzimas
modificadoras do DNA, vetores e clulas
hospedeiras, 40
enzimas de restrio, 42
enzimas modificadoras do DNA, 40
vetores e clulas hospedeiras, 43
princpios e estratgias, 39
stios de, 43
Clonazepam, 359
Clones recombinantes atravs de PCR, isolamento
de, 49
Clonidina, 276
Cloreto de guanidina, 11
Clorotiazida, 298
Cocana, 276, 290
Cdigo gentico, 35, 36, 86
Coenzima deficiente, 229
Colelitase, drogas utilizadas na, 318
Colinolticos (v. Colinomimticos e colinolticos)
Colinomimticos
e colinolticos, 279-284
de ao direta, 281
efeitos farmacolgicos, 282
mecanismo de ao, 281
de ao indireta, 282
tipos de, 283
muscarnicos 282
Complexo
Caby inativo, 106
ciclina B-cdk, 118
Composto PDGF, 115
Concanavalina A, 9
Concatmeros, 76
Construo de bibliotecas ou genotecas, 45, 153
de cDNA, 47
de DNA complementar, 153
identificao de clones especficos, 155
clonagem em vetores de expresso, 156
sondas de oligonucleotdeos sintticos, 155
isolamento de clones recombinantes, 48
atravs de PCR, 49
com sondas radioativas atravs de hibridao de
cidos nuclicos, 48
Contratilidade miometrial, 333
Controle da proliferao celular, 115
Convulses, 229
Corantes fluorescentes, 138
DAPI, 138
Hoechst 33342, 138
Coria de Huntington, 222
Corpsculos de Barr, 206
Crtex cerebral, 316
Corticides, atividades antiinflamatrias dos, 341
Cosmdeos, 153

Crescimento, fator de, 115, 126


NGF, 115
PDGF, 126
Criptocromos, 111
Crises epilpticas, 357
Cromtide(s)
cromossomos
com duas, 204
como nica, 204
irms, separao das, 204
Cromatina, 63
X, 206
Cromossomo(s), 31
acrocntrico, padro de bandamento G de um, 205
artificiais de leveduras, 153
com duas cromtides, 204
como nica cromtide, 204
descondensados, 204
e cromatina, 63
estrutura do DNA, 64
estudo dos, 203
genes localizam-se nos, 57
humanos, 203
humanos, 203-213
alteraes cromossmicas, 207
aneuploidia, 208
deleo, 209
dissomia uniparental, 212
duplicao, 211
estruturais, 209
inverso, 211
isocromossomo, 211
numricas, 208
poliploidia, 209
sndrome de instabilidade cromossmica, 212
stio frgil do X, 212
translocao, 211
citogentica-molecular, 205
metacntrico, padro de bandamento G de um, 205
metafsicos, 206
submetacntrico, padro de bandamento G de
um, 205
21, trissomia do, 209
Crossing-over, recombinao, 82
Cruzamento mono-hbrido, 56
Cultura de linfcitos do sangue perifrico, etapas para
realizao de uma, para obteno do caritipo, 204

D
Decametnio, 287
Deficincia(s)
da protena C, 100
muscular primria, 305
protica especfica, 226
Degradao sequencial de Edman, 156

369

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

Deleo cromossmica, 250


Depresso, 349, 361
Derivados
de monossacardeos, 18
do glicerol, 22
Desequilbrio cromossmico, 207
Desnaturao de protenas, 11
Desoxinucleotdeos trifosfato, 71
Desoxirribonucleotdeo livre, 74
Desoxirribose, 32
D-glicose, molculas de, 19
Diabetes melito, 219
Diacilglicerol
ativa protena quinase C, 110
formao de, 269
Diagrama de Ramachandran, 7
Diclofenac, 339
Digesto com enzima de restrio, 170
Digitlicos, 306
Digitoxina, 306
Diidroxicetona, 15
Diisopiramida, 301
Dimetilfenilpiperazina, 281
Disostose mandbulo facial, 194
Dissomia uniparental, 212
Distrofia miotnica, 197
Distrbio de ansiedade, 349
drogas de escolha no tratamento dos, 351
Diurticos, 293, 297-300
antagonistas da aldosterona, 299
bloqueadores do canal de Na+ do epitlio renal, 299
inibidores
da anidrase carbnica, 297
do CO-transporte Na+-CL-, 298
do CO-transporte Na+-K+-2CL-, 298
locais e mecanismos de ao dos, 298
DNA, 8, 34
anlise molecular do, para diagnstico e
prognstico de doenas genticas, 215-224
estudos com microchips, 217
aplicao das matrizes de DNA no
diagnstico, 218
na pesquisa dos traos complexos, 219
tipos de matrizes, 217
mtodos baseados na tcnica de PCR, 220
aplicao, 221
caractersticas do, 221
modificaes, 222
principais tcnicas na investigao da variao
gentica ao nvel molecular, 215
enzimas de restrio, 215
restriction fregment length polymorphism
RFLPs, 216
cadeia de, 221
circular bacteriano, 235
estrutura do, 59
dupla hlice, 60

370

metilao do DNA, 62
superenrolamento, 63
fingerprinting de, 144
genes de reparo do, 245, 249
hbridas, fitas duplas de, 175
homodplex, alteraes em, 176
injeo direta de, 233
metilases, 62
mitocondrial, 164, 219
molde, 73
molcula de
esquema da, 195
sntese de protenas a partir de, 196
mutante, 232
parental, 73
polimerase, 47
-primase, 75
replicao do, 114
semiconservativa, 34
seqenciamento de, na medicina molecular, 181
sondas de, 159, 223
tcnicas de identificao de, atravs de microchips
utilizando a sntese direita de sondas no chip, 218
tipos de, no genoma humano, 196
vrus de, 123
DNA genmico, replicao, reparo e rearranjos
do, 69-84
mutaes, 76
modificao tautomrica e pareamentos raros
entre bases, 77
mutaes induzidas
por agentes qumicos, 79
por radiao, 78
tipos de mutaes, 78
recombinao, 82
reparo do DNA, 79
aps a replicao, 82
por exciso, 80
reverso direta da leso ao, 80
replicao do DNA, 69
crculo rolante e transcrio reversa, 76
forquilha de replicao, 71
origem de replicao, 74
replicando as extremidades dos cromossomos:
telmeros e telomerases, 75
transposio, 83
DNA recombinante, 147-160, 229
anlise e seqenciamento do DNA clonado, 156
mtodo
de dideoxi de Sanger, 157
de Maxam-Gilbert, 156
aplicaes da clonagem gnica, 160
bacterifago lambda, 150
ciclo lisognico, 151
via ltica, 151
construo de bibliotecas, 153

NDICE REMISSIVO

bibliotecas
de DNA complementar, 153
genmicas, 153
identificao de clones especficos numa
biblioteca genmica ou de cDNA 155
clonagem em vetores de expresso, 156
sondas de oligonucleotdeos sintticos, 155
cosmdeos, 153
cromossomos artificiais de leveduras, 153
enzimas de restrio, 147
mtodos de anlise do cido nuclico, 158
reao em cadeia da polimerase, 159
tcnica
de Northern blot, 159
de Southern blot, 158
plasmdeos, 149
vetores, 149
DNA-ligante, 233
DNA-ligante-adenovrus, 233
Doena(s)
causadas pela expanso de trincas de bases, 168
de Fabry, 229
de Gaucher tipo 1, 229
de Huntington, 197
de Machado-Joseph, 197
de von Willebrand, 100
de Wilson, 228
estudadas e candidatas a terapia gnica, 232
lisossmicas de depsito, 229
monognicas, 169
policstica do rim, 229
Doenas genticas
anlise bioqumica do produto gnico para o
diagnstico, prognstico e tratamento de, 225-230
anlise molecular do DNA para diagnstico e
prognstico de, 215-224
estudos com microchips, 217
aplicao das matrizes de DNA no
diagnstico, 218
na pesquisa dos traos complexos, 219
tipos de matrizes, 217
mtodos baseados na tcnica de PCR, 220
aplicao, 221
caractersticas do, 221
modificaes, 222
principais tcnicas na investigao da variao
gentica ao nvel molecular, 215
enzimas de restrio, 215
restriction fregment length polymorphism
RFLPs, 216
bases bioqumicas das, 225
diagnstico de, a partir da anlise da protena, 225
tratamento das, 228
Domperidona, 313, 316
Dopamina, antagonistas da, 316
Dores neuropticas, 343

Down, sndrome de, 209, 211


Doxazosin, 296
Drogas
antilceras pptica, inibidores da secreo
cida e, 309-314
citoprotetores da mucosa gstrica, 313
e drogas procinticas, 313
e mecanismos intracelulares, 310
e secreo gstrica, 309, 311
neutralizadores da, 312
regulao da, 309
citotxicas, 316
luxativas, 317
que afetam o espasmo biliar, 318
utilizadas
na colelitase, 318
na insuficincia cardaca, 305-307
digitlicos, 306
diurticos, 305
estimulantes 1-adrenrgicos, 307
inibidores da fosfodiesterase II, 307
inotrpicas positivas, 306
vasodilatadores, 306
nas inflamaes intestinais, 317
Dupla hlice, 60

E
Edman, degradao sequencial de 156
Edrofnio, 286
Efedrina, 276
Eicosanides, 25
Eletroforese
de protenas, 226
em gel, 170
Eletroporao, 44
Emese, fatores envolvidos no controle da, e drogas
antiemticas, 316
Emticos, 315
Emolientes fecais, 317
Endonucleases de restrio, 40, 66
Engenharia gentica, 39
Ensaio(s)
de nuclease 5, 172
enzimticos realizados no laboratrio de erros
inatos do metabolismo do Hospital de Clnicas
de Porto Alegre, 227
Enzima(s), 266
ADA, 235
adenilil ciclase, estrutura da, 266
adenosina deaminase (ADA), 236
5-redutase, inibidores da, 322
catecol-O-metiltransferase, 274
conversora de angiotensina, inibidores da, 295
de converso da angiotensina I, 143
de restrio, 42, 147, 215

371

VOL. 1 BASES MOLECULARES DA BIOLOGIA, DA GENTICA E DA FARMACOLOGIA

digesto com, 170


DNA, 221
EcoRI, 215
endgenas, medicamentos cujos mecanismos de
ao envolvem a inibio de, 266
modificadoras do DNA, 40
uracil N-glicosilase, 166
Epilepsias, tratamento farmacolgico das, 359
Epitlio renal, 299
Erros inatos do metabolismo, ensaios enzimticos
realizados no laboratrio de, do Hospital de
Clnicas de Porto Alegre, 227
Escherichia coli, 216
Escopolamina, 283
Esfingomielina, 24
Espasmo(s)
biliar, drogas que afetam o, 318
infantis, 359
Espironolactona, 299
Esquizofrenia, 219, 353
Estereoqumica dos carboidratos, 15
Estimulantes
1-adrenrgicos, 307
purgativos, 317
Estradiol, 326
Estresse ps-traumtico, 351
Estrofantina, 306
Estrgenos, 326
aes fisiolgicas e farmacolgicas, 328
mecanismo de ao, 327
receptores de, 326
sntese e secreo de, e protesterona, 325
Estrutur
cclica dos acares, 16
do DNA, 59
dupla hlice, 60
e replicao do DNA, 32
metilao do DNA, 62
superenrolamento, 63
Estruturao protica, 95
princpios da estruturao das protenas, 96
protena(s)
e forma, 95
e sua estrutura qumica, 95
sntese protica necessita de Chaperones, 97
Estudo das genealogias e de sua representao
grfica, 192
Etdio, brometo de, 148
Expresso
e traduo da informao gentica, 85-91
anatomia do gene, 87
cdigo gentico, 86
dos genes s protenas, 86
implicaes fisiolgicas e fisiopatolgicas da
expresso gnica, 88
traduo do RNAm em uma seqncia de
aminocidos, 90

372

transcrio de um gene, 89
eucaritica, vetor de, estrutura de um, 235
gnica
mecanismos epigenticos de controle da, 197
regulao da, no tero, ovrio e oviduto pela
progesterona, 332

F
Fabry, doena de, 229
Fago lambda, 150
Famotidina, 311
Farnesol, 29
Faris moleculares, 173
Fator(es)
de competncia PDGF, 115
de crescimento
derivado de plaqueta, 265
epidermal, 265
NGF, 115
PDGF. 126
de transcrio, 128
Fenilefrina, 276
Fenitona, 359
Fenobarbital, 359
Fenmeno antecipao gentica, 197
Fenotiazinas, 316
Fentipo, 56
Ferramentas do DNA recombinante: enzimas
modificadoras do DNA, vetores e clulas
hospedeiras, 40
enzimas
de restrio, 42
modificadoras do DNA, 40
vetores e clulas hospedeiras, 43
Fibras
de Purkinje, 301
nervosas, efeitos dos anestsicos locais nas, 291
Fibrose cstica, 100, 170, 240
Finasteride, 322
Fingerprinting de DNA, 144
Fisostigmina, 286
Fluxo da informao gentica na clula: cdigo
gentico, RNAs e protenas, 35
Fobias, 351
Frmula de projeo de Haworth, 16
Forquilha de replicao, 71
Fosfato, 18
Fosfoacilglicerdios, 23
Fosfodiesterase II, inibidores da, 307
Fosfolipase, 267
A2, 269
C, 267
Fosfotirosina, 265
Fragmentos de Okasaki, 71
Frutose, 16

NDICE REMISSIVO

Funo ovariana, controle hormonal da, 326


Furosemida, 298

G
GABA, 358
Galamina, 286
Gastrina, 310
Gaucher, doena de, tipo 1, 229
Gel
de poliacrilamida, 157
de SDS-poliacrilamida, 178
DGGE, 175
eletroforese em, 170
Gmeos
dizigticos, 198
monozigticos, 198
Gene(s)
ADA, 235
ex vivo, 239
AKT2, 247
anatomia do, 87
APC, 177, 248
ATM, 136, 250
BRCA1, 177, 219
BRCA2, 177
CCND1, 247
CCNE, 247
CDK4, 247
CFTR, 240, 241
conceito atual do, 194
de reparo do DNA, 245, 249
de resistncia ao antibitico
ampicilina, 235
neomicina, 235
defeituoso, 232
DMD, 177
do cncer, 245
mecanismo de ativao de proto-oncogenes, 246
oncogenes, 245
do hormnio de crescimento bovino, sinal de
poliadenilao do, 235
do sistema renina-angiotensina,
polimorfismo dos, 143
E1A, 241
ERBB2, 247
FMR1, 168
humano tpico, esquema de um, 195
lacZ, 235
MDM2, 247
mecanismo de substituio e adio de um, 233
mutante, 233
MutL, 81
MutS, 81
MYC, 246
neo, 234

NF1, 177, 248


normal, 233
p53, 130
2p15-p16, 250
3p21.3, 250
RAS, 247
RB1, 248
SRY, 211
supressores de tumor e oncogenes, 121-131
ciclinas, oncogenes e genes supressores de
tumor, 130
genes supressores de tumor, 128
oncogenes, 124
fatores de transcrio, 128
ligantes, 126
protenas que ligam GTP, 127
protenas quinases, 126
receptores de superfcie celular com atividade
de tirosina quinase, 126
receptores hormonais nucleares, 127
vrus que causam tumor, 121
supressores de tumor, 247
TP53, 249
transcrio de um, 89
transferncia de, mtodos utilizados para, nas
clulas de mamferos e provveis aplicaes em
terapia gnica, 233
transplante de, por um cirurgio, 232
WT1, 248
Gene, biologia molecular do, 31-51
clonagem de um gene atravs de PCR, 50
clonagem gnica: princpios, estratgias e
ferramentas, 39
ferramentas do DNA recombinante: enzimas
modificadoras do DNA, vetores e clulas
hospedeiras, 40
enzimas de restrio, 42
enzimas modificadoras do DNA, 40
vetores e clulas hospedeiras, 43
princpios e estratgias, 39
conceito de gene, 37
construo de bibliotecas ou genotecas, 45