Você está na página 1de 164

SEO M

OPES E FERRAMENTAS ESPECIAIS


NDICE

SISTEMA DE CONTROLE DE INCNDIO ANSUL (M02005) .................................................................................... M2-1


AQUECEDOR DO REFRIGERANTE DO MOTOR (M07011) ..................................................................................... M7-1
GRUPO DE FERRAMENTAS ESPECIAIS (M08021) ................................................................................................. M8-1
PERSIANAS DO RADIADOR ................................................................................................................................... M19-1
MEDIDOR DE CARGA TIL III (M20008) ................................................................................................................. M20-1
SISTEMA DE LEO DO MOTOR RESERVA............................................................................................................ M31-1
SISTEMA DA ESCADA RETRTIL ........................................................................................................................... M32-1

M01057

ndice

M1-1

ANOTAES

M1-2

ndice

M01057

SEO M2
SISTEMAS DE CONTROLE DE INCNDIO
NDICE

SISTEMA DE CONTROLE DE INCNDIO (MANUAL) ............................................................................................... M2-3


Operao .............................................................................................................................................................. M2-3
Inspeo e Manuteno ....................................................................................................................................... M2-3
Procedimentos de Recarga .................................................................................................................................. M2-4
SISTEMA DE ATUAO E DETECO ELTRICA CHECKFIRE SRIE 1........................................................... M2-5
Mdulo de controle ............................................................................................................................................... M2-5
Atuador ................................................................................................................................................................. M2-6
Cabo de Deteco Linear ..................................................................................................................................... M2-6
Cabo de energia ................................................................................................................................................... M2-6
Conjunto de testes ................................................................................................................................................ M2-6
Ativador................................................................................................................................................................. M2-6
Prendendo o Cabo de Deteco .......................................................................................................................... M2-7
Teste Preliminar antes da Juno Final ................................................................................................................ M2-7
Procedimento de Instalao para o Ativador ........................................................................................................ M2-9
Colocando a Sistema de Atuao e Deteco Eltrica em Operao.................................................................. M2-9

CRONOGRAMAS DE INSPEO E MANUTENO .............................................................................................. M2-10


Diariamente ........................................................................................................................................................ M2-10
Manuteno normal baseada nas horas reais de operao............................................................................... M2-10
EM CASO DE INCNDIO ..........................................................................................................................................M2-11
DIAGNSTICO DE FALHAS NO SISTEMA DE DETECO ELTRICO................................................................ M2-13

M02005

Sistemas de Controle de Incndio

M2-1

ANOTAES

M2-2

Sistemas de Controle de Incndio

M02005

SISTEMA DE CONTROLE DE INCNDIO (MANUAL)


O sistema de controle de incndio ajuda a proteger a mquina no caso de um incndio. O sistema consiste de:







$WXDGRUHV
$WXDGRU3QHXPiWLFR5HFHSWRUHVGH&DUWXFKRV
9iOYXODGHDOtYLRGHSUHVVmR
9iOYXODVGHUHWHQomR
5HVHUYDWyULRVTXtPLFRVVHFRV
0DQJXHLUDVHELFRV

Quando o atuador for pressionado, um cartucho de nitrogQLRSUHVVXUL]DUiRUHVHUYDWyULRTXtPLFRVHFR'HSRLVTXHR


UHVHUYDWyULRTXtPLFRVHFRIRUSUHVVXUL]DGRDWpXPDSUHVVmR
VXILFLHQWHXPDPHPEUDQDGHUHEHQWDPHQWRQDVDtGDGR
UHVHUYDWyULRURPSHUiSHUPLWLQGRTXHRXLGRTXtPLFRXLGL]DGRXDDWpRVELFRV2VELFRVGLUHFLRQDUmRRDJHQWHSDUD
o fogo e apagaro as chamas.

Operao
Para acionar o sistema de controle de incndio, puxe
o anel de segurana em um dos atuadores e baixe a
alavanca. Um atuador est localizado na cabina prxima ao operador. O outro atuador est na estrutura
do pra-lama prximo ao pra-choque.
OBSERVAO: Acionar qualquer um dos atuadores
ativar o sistema de controle de incndio.

Inspeo e Manuteno
essencial que o sistema de controle de incndio
VHMDLQVSHFLRQDGRQRPtQLPRDFDGDVHLVPHVHV
3DUDDVVHJXUDUTXHHOHIXQFLRQDUiGHPDQHLUDHcaz:
1. Verifique a aparncia geral do sistema, danos
mecnicos e corroso.
2. Inspecione se h danos em toda junta da tampa
GHDEDVWHFLPHQWRGHUHVHUYDWyULRTXtPLFRHWURTXHFDVRVHMDQHFHVViULR9HULTXHVHKiFRUWHV
UHEDUEDVURVFDVHQFDYDODGDVRXVXSHUItFLHV
speras.
 9HULTXHRQtYHOGHTXtPLFRVHFR2QtYHOQmR
deve ser inferior a 3 pol. (76 mm) da base de
DEHUWXUDGHHQFKLPHQWR4XtPLFRVVHFRVGHYHP
XLUOLYUHPHQWHVHPDJOXWLQDo}HV
 &HUWLTXHVHTXHDVYHQWLODo}HVQDVURVFDVGH
DEHUWXUDGHHQFKLPHQWRQmRHVWHMDPREVWUXtGDV
5. Retire o cartucho do extintor e examine a vedao
da membrana. Substitua a vedao se necessrio.
Instale o cartucho e aperte manualmente.

FIGURA 2-1, SISTEMA DE CONTROLE DE INCNDIO


1. Atuador do cabo
2. Atuador remoto
 9iOYXODGHDOtYLRGHVHgurana
4. Vlvulas de reteno
5. Receptor do atuador

M02005

6. Cartucho
7. Juno da membrana
de rebentamento
 5HVHUYDWyULRTXtPLFRVHFR

FIGURA 2-2 TAMPA DO BICO E DESCARGA

Sistemas de Controle de Incndio

M2-3

FIGURA 2-3 TAMPA DOS BICOS E DA DESCARGA


6. Inspecione se h danos mecnicos e cortes nas
OLQKDVFRQH[}HVHQRVELFRV
 9HULTXHDVDEHUWXUDVGRVELFRV$VDEHUWXUDV
devem ser envolvidas com graxa de silicone ou
equipadas com tampas de descarga plsticas, se
forem equipadas com bicos conforme mostrado
na figura 2-2. Os bicos do tipo mostrados na
Figura 2-3 no devem ser engraxados. Apenas
as tampas protetoras mostradas devem ser utilizadas com este tipo de bico.
8. Retire e inspecione o cartucho dosa atuadores
remotos. Substitua se estiverem danificados.
9HULTXHDRSHUDomRGRSLQRGHSHUIXUDomR
 6XEVWLWXDTXDOTXHUYHGDomRGHFDERRXRTXH
esteja faltando, ou que esteja quebrada.

Procedimentos de recarregamento

3. Retire cada extintor de incndio de seu suporte.


4. Desmonte a juno da membrana de rebentamento e
VXEVWLWXDDMXQomRGDQLFDGDcom o lado liso virado
para o extintor.
 (QFKDRUHVHUYDWyULRFRPTXtPLFRVHFRQmRPDLVTXH
trs pol. (76 mm) a partir da base da abertura de enchimento.
6. Inspecione as roscas e juntas da abertura de enchimento. Limpe as roscas se necessrio.
7. Instale a tampa de enchimento e aperte manualmente.
8. Retire a proteo do cartucho do reservatrio de produto
TXtPLFRVHFRHUHWLUHRFDUWXFKR
 &HUWLTXHVHTXHRSLQRGHSHUIXUDomRGRFDUWXFKRHVWHMDWRWDOPHQWHUHWUDtGR
10. Pese o novo cartucho. O peso deve estar dentro de 7,0
gramas do peso marcado no cartucho.
11. Parafuse o novo cartucho no conjunto do atuador, aperte
com a mo.
12. Substitua a proteo do cartucho e instale o reservatrio
GHSURGXWRTXtPLFRVHFRHPVHXVXSRUWH
13. Conecte a linha na juno de rebentamento, e alinhe no
atuador do reservatrio.
14. Retire a proteo do cartucho dos atuadores remotos e
substitua os cartuchos.
 6XEVWLWXDVDVSURWHo}HVGRFDUWXFKRHLQVWDOHSLQRVGH
DQpLVQRVERW}HVGHSUHVVmR
 9HULTXHVHKiGDQRVPHFkQLFRVQDPDQJXHLUDFRQH[}HVHELFRV6XEVWLWXDWRGDPDQJXHLUDTXHWLYHUVLGR
exposta a reas de incndio.
17. Limpe os bicos e passe novamente graxa de silicone ou
instale tampas de descarga. Utilize tampas para os novos bicos projetados mostrados nas Figuras 2-2 e 2-3.

Aps acionar o sistema de controle de incndio, o


sistema deve ser recarregado. Siga o procedimento
DEDL[RSDUDFDGDWDQTXHTXtPLFRVHFRHDWXDGRU
instalado:
1. Libere a presso das linhas, puxando o anel na
YiOYXODGHDOtYLRGHVHJXUDQoD
2. Desconecte a linha do atuador do tanque e retire a
linha da juno da membrana de rebentamento.

M2-4

Sistemas de Controle de Incndio

M02005

SISTEMA DE ATUAO E DETECO ELTRICA CHECKFIRE SRIE 1


26LVWHPDGHDWXDomRHGHWHFomRHOpWULFD&KHFNUH6pULH
1 (Figura 2-5) utiliza cabo de deteco linear. Este um
GXSORFDERWpUPLFRFODVVLFDGRFRQGXWRUGHFDORU4XDQGRR
cabo de deteco submetido a 105C o revestimento isolante do cabo derrete, permitindo que os condutores entrem
em curto juntos, fechando o circuito eltrico at o ativador
que detonado para baixar o pino de perfurao e acionar
o cartucho ejetor.
luz
indicadora
verde

Componentes do sistema de atuao e deteco eltrica


&KHFNUHVmRPRVWUDGRVQD)LJXUD
Mdulo de Controle
(Figura 2-4)
)RUQHFHDVFRQH[}HVHOpWULFDVQHFHVViULDVHQWUHRRGH
HQHUJLDHRFDERGHGHWHFomROLQHDUDWpRRGHHQHUJLDIRUnecendo energia eltrica, atravs do ativador, at o atuador.
7DPEpPIRUQHFHXPDYHULFDomRYLVXDOGDGLVSRQLELOLGDGH
de energia pressionar o boto de presso acender a luz
LQGLFDGRUDYHUGHVHDHQHUJLDHOpWULFDHVWLYHUGLVSRQtYHOQR
sistema.

FIGURA 2-4. MDULO DE CONTROLE

),*85$6,67(0$'('(7(&d2(/e75,&$$78$d2&+(&.),5(
1. Mdulo de controle
 $WXDGRU0DQXDO$XWRPiWLFR

M02005

3. Cabo de Deteco Linear


4. Cabo de energia

Sistemas de Controle de Incndio

5.

Conjunto de Testes (No Mostrado)

M2-5

Atuador
(Figura 2-6)
Fornece meios automticos e manuais de ativao
de sistema de extino de incndio. Ao puxar o pino
anel sob o boto e ento apertar o boto vermelho, o
pino de perfurao romper o diafragma no atuador
e acionar o sistema. Automaticamente, o ativador
p[DGRSDUDURPSHUDPHPEUDQDGHUHEHQWDPHQWR
quando o cabo de deteco linear for exposto a temperaturas superiores suas faixas determinadas.

FIGURA 2-8. CABOS DE ENERGIA

FIGURA 2-9. CONJUNTO DE TESTES


),*85$$78$'250$18$/$87207,&2
Cabo de deteco Linear
(Figura 2-7)
Consiste em um duplo-cabo trmico classificado
condutor de calor. A classificao da temperatura
GRFDERpGH&FRPDXWLOL]DomRGHRSUHWRRX
&FRPDXWLOL]DomRGHRYHUPHOKR4XDQGRR
cabo submetido a temperaturas que excedam essa
FODVVLFDomRRUHYHVWLPHQWRGHLVRODomRGHUUHWHSHUmitindo derrete permitindo que os condutores entrem
em curto juntos, fechando o circuito para acionar o
ativador.

1. Conjunto de luzes indicadoras


2. Conjunto de Jumpers de Cabo de deteco de Fim-DeLinha
Conjunto de Testes
(Figura 2-9)
)RUQHFHDYHULFDomRGHFRQWLQXLGDGHHOpWULFDHFRQVLVWHHP
um conjunto de luzes indicadoras e um conjunto de deteco
GHRVGHGHWHFomROLQHDUGH)LP'H/LQKD

FIGURA 2-7. CABO DE DETECO LINEAR


Cabo de Energia
(Figura 2-8)
Consiste em um conector de bateria e cabos de
chumbo condutores para conectar o sistema de
atuao ao sistema eltrico do caminho (circuito da
EDWHULD 2FRQHFWRUEDWHULDpHTXLSDGRFRPIXVtYHLV
GHDPSpUHVHPOLQKD VXEVWLWXtYHLV 

M2-6

Ativador
(Figura 2-10)

FIGURA 2-10. ATIVADOR

Componente detonado eletricamente que contm uma pequena carga exata de plvora. Quando o circuito de atuao
fechado pelo derretimento do cabo de deteco linear, uma
SRQWHGHDomRLQWHUQDQRDWLYDGRUDTXHFHSURYRFDQGRDGHtonao da plvora, forando o pino de perfurao a romper a
membrana do cartucho para liberar a carga de gs nitrognio.

Sistemas de Controle de Incndio

M02005

Prendendo o Cabo de Deteco


Depois que o cabo de deteco linear tiver sido instalado
solto, prenda-o ao equipamento que est sendo protegido
da seguinte maneira:
1. Comece no mdulo de controle com a primeira seo
GRFDERGHGHWHFomR6HHVWDVHomRIRUVXFLHQWHSDUD
cobrir toda a rea de risco, no sero necessrias exWHQV}HVDGLFLRQDLV6HIRUHPQHFHVViULDVH[WHQV}HV
adicionais, retire o conector vazio da extremidade da
SULPHLUDH[WHQVmRHDGLFLRQHH[WHQV}HVDWpTXHWRGD V 
a(s) rea(s) de risco seja(m) coberta(s).

que o cabo de energia est instalado corretamente no mdulo de controle. Se a luz no


DSDUHFHUYHULTXHWRGDVDVFRQH[}HVSDUD
certificar que estejam conectadas. Teste
novamente soltando o boto. Se a luz no
estiver acesa, consulte Diagnsticos de Falhas Sistema de Deteco Eltrica, nesta
seo.
b. Se a energia da bateria estiver correta, reali]HDYHULFDomRWRWDOGRVLVWHPDGHHQHUJLD

OBSERVAO: Lembre-se de deixar a conexo vaga fechada na ltima extenso do cabo de deteco.
Ao fazer a conexo, empurre o conector no receptculo at
ouvir o som de clique (Figura 2-11). Conectores e receptculos so chavetados para permitir a insero apenas em
uma direo. Depois de observado o clique, d um pequeQRSX[mRSDUDWUiVQRFRQHFWRUSDUDFRQUPDUTXHIRLIHLWD
a conexo.

Lmpada
indicadora

FIGURA 2-12 VERIFICAO DE ENERGIA

FIGURA 2-11. CONECTOR DO CABO DE DETECO


LINEAR.
2. Prenda o cabo a cada 30 45 cm por todas as reas de
risco, utilizando os prendedores de cabo de nylon pretos
fornecidos. Prenda em intervalos menores se desejar,
ou para manter o cabo fora do caminho. Prenda o cabo
QDVVXSHUItFLHVGHPRQWDJHPGHFNVVXSRUWHVPDQgueiras hidrulicas na rea, ou qualquer pea imvel,
segura do equipamento protegido. Lembre-se sempre
GDVGLUHWUL]HVPHQFLRQDGDVDRLQVWDODUDDomR

CUIDADO

No instale o ativador no cabo de chumbo neste


momento. (Figura 2-13)

Testes Preliminares Antes da Juno Final


Toda a deteco linear e instalao de cabos de energia esto completas agora. Antes de armar o atuador com o ativaGRUpQHFHVViULRYHULFDUWRGDVDVFRQH[}HVSDUDDVVHJXUDU
que foram feitas adequadamente.
1. O Cabo de Energia
FIGURA 2-13. NO CONECTE O ATIVADOR
a. Solte o boto no topo do mdulo de controle e observe uma luz indicador verde (Figura 2-12). Com
o boto solto, a luz deve estar acesa. Isso indica

M02005

Sistemas de Controle de Incndio

M2-7


Retire o conector vazio

Instale o jumper apenas


para teste.
Figura 2-14. Instalao do jumper.
2. O Cabo de Deteco Linear

F 5HDOL]HDWpRPD~OWLPDH[WHQVmRGHFDERGHGHteco e retire o conjunto do jumper (Figura 2-15).


Finalmente, coloque o conector vazio original no
cabo de deteco. A luz do mdulo de teste deve
apagar imediatamente. Se ela no apagar, consulte
Diagnstico de falhas.
d. Retire o conjunto de teste do sistema, primeiro desconectando o conector do ativador do mdulo de
teste (Figura 2-17). OBSERVAO: Guarde estes
FRPSRQHQWHVSDUDSRVVtYHOXWLOL]DomRPDLVWDUGH

CUIDADO

Retire o jumper para evitar que o sistema de extino de


incndio seja descarregado quando o ativador for instalado no sistema de atuao e deteco eltrica .

a. Com a utilizao do conjunto fornecido, reDOL]HDWpRPD~OWLPDH[WHQVmRGHFDERGH


deteco. Retire o conector vazio tampado
(Figura 2-14) e instale o conjunto do jumper.
OBSERVAO: Mantenha o conector tampado ao
ser instalado novamente, depois que o teste for completado.
b. Com o jumper em seu lugar, parafuse o
ativador no receptculo no mdulo de teste
(Figura 2-15). A luz do mdulo de teste deve
DFHQGHULPHGLDWDPHQWH(VWHWHVWHFRQUPD
que o cabo est instalado adequadamente
e funcionar conforme projetado. Se a luz
do mdulo de teste no acender, consulte a
seo Diagnstico de Falhas.

Retire o conjunto do jumper


Substitua o conector vazio

FIGURA 2-16. RETIRE O CONJUNTO DO JUMPER

Mdulo de teste

Mdulo de teste

Mdulo de controle
Mdulo de controle
Figura 2-15. Instalao do Conjunto de Mdulo
de Teste

M2-8

FIGURA 2-17. RETIRE O CONJUNTO DE LUZ


INDICADORA

Sistemas de Controle de Incndio

M02005

Procedimento de Instalao para o Ativador


Depois de completos todos os testes e todos os componentes do conjunto de teste tiverem sido removidos, arme
o sistema.
Ativador

Com a utilizao de uma chave, insira o ativador no


furo de entrada direito superior do corpo do atuador,
HDSHUWHUPHPHQWH
Depois de instalar o ativador no corpo do atuador,
solte a tampa protetora do ativador e retire a ponte
(Figura 2-19).

CUIDADO

Sempre instale primeiro o ativador no corpo do


atuador, antes de instalar o conector no corpo
rosqueado do ativador. possvel se ferir se o
ativador for acionado do lado de fora do atuador.
Instale o conector do ativador no prisioneiro rosqueado do ativador (Figura 2-20). Aperte, com a mo, o
PDLVUPHSRVVtYHO

FIGURA 2-18
Ponte
Tampa Protetora

Colocao do Sistema de Atuao & Deteco


Eltrica em operao
Para colocar o Sistema de Atuao e Deteco Eltrica em operao, proceda da maneira a seguir:
 9HULTXHVHWRGRVRV[DGRUHVHVWmREHPDSHUWDGRV&HUWLTXHVHTXHDFRQWUDSRUFDQRFRUSR
do atuador esteja bem apertada.
2. Antes de instalar o cartucho do atuador, empurre
a alavanca manual do perfurador vrias vezes
para assegurar uma operao suave.
3. Insira o pino do anel no furo e prensa a vedao
do cabo de chumbo (Veja a Figura 2-21).

FIGURA 2-19

FIGURA 2-20

FIGURA 2-21. INSTALAO DO CARTUCHO DO


ATUADOR
1. Insira o cartucho LT-5-R (PB0674) no corpo do
DWXDGRULQIHULRUHDSHUWHUPHPHQWHFRPDPmR
2. Registre a data que o sistema foi colocado em
operao.

M02005

Sistemas de Controle de Incndio

M2-9

CRONOGRAMAS DE INSPEO E MANUTENO

CUIDADO

Procedimentos adequados de inspeo e manuteno devem ser executados em intervalos espeFtFRVSDUDFHUWLFDUTXHRVLVWHPDGHDWXDomRH


deteco eltrica funcionar como determinado.

4. Pese o cartucho de atuao no sistema de atuao e deteco eltrica. Substitua o cartucho se o peso for 7 graPDVDPHQRVTXHRGHWHUPLQDGRQRFDUWXFKR9HULTXH
nas roscas do cartucho se h entalhes, rebarbas, encavalamento de roscas e aspereza nas bordas aplainadas.
Examine a elasticidade da gaxeta na base do sistema
de atuao e deteco eltrica. Se a temperatura estiver
abaixo de congelante, aquea a gaxeta com o calor do
corpo para assegurar uma boa vedao. Limpe e passe
uma camada leve de graxa de silicone resistente a calor.

Diariamente
O operador da mquina deve testar manualmente
a energia do sistema empurrando o boto e obserYDQGRDOX]LQGLFDGRUD,VWRFRQUPDVHDHQHUJLDGD
EDWHULDHVWiGLVSRQtYHO6HDOX]QmRHVWLYHUDFHVD
consulte Diagnstico de Falhas nesta seo.

Conector do ativador

Manuteno normal baseada nas horas reais de


operao
2VLVWHPDFRPSOHWRGHYHVHUYHULFDGRPHQVDOPHQWHRXDQWHVGHSHQGHQGRGDVFRQGLo}HVGHWUDEDOKR
ou da manuteno do caminho para executar uma
YHULFDomRFRPSOHWDGRVLVWHPD
OBSERVAO: O ativador deve ser substitudo
depois de cinco anos de operao. O descarte adequado do ativador antigo deve ser feito atuando o
ativador dentro do corpo do atuador. Para isto, retire
o cartucho LT-5-R do atuador do corpo. Instale o conjunto de jumper de teste na extremidade do conjunto
de cabo de deteco linear. Este jumper funcionar
FRPRXPFXUWRQDDomRHSURYRFDUiDGHVFDUJDGR
ativador.
Retire o jumper, limpe o atuador, instale o novo ativador e reinstale o cartucho.
O sistema agora est de volta operao.
Registre a data da instalao do novo ativador.
 9HULTXHRDSHUWRGHWRGRVRVSDUDIXVRVGHPRQtagem.
 9HULTXHRDSHUWRGHWRGRVRVFRQHFWRUHVGHDomRHSRVVtYHLVHYLGrQFLDVGHFRUURVmR
 ,QVSHFLRQHRRGHHQHUJLDHGHWHFomRGDPDneira a seguir:
a. Verifique se existe desgaste em razo de
DEUDVmR SHQHWUDo}HVGDODWHUDLVDRUHGRU
de cantos, etc.).

E 9HULTXHVHKiGDQRVFDXVDGRVSRULPSDFWR
direto ou outro mau uso.
c. Verifique os apertos dos locais de montagem.

G &HUWLTXHVHTXHDHVWUXWXUDGHPRQWDJHP
no se soltou ou quebrou, qualquer um dos
dois pode provocar afundamento.

M2-10

FIGURA 2-22. RETIRE O CARTUCHO E DESCONECTE O


ATIVADOR.

CUIDADO

No reinstale o cartucho neste momento.


5. Teste a energia do sistema soltando o boto no mdulo
de controle. Observe a luz quando o boto estiver solto.
6. Solte o conector do ativador antes de continuar com a
srie de testes a seguir (Figura 2-22).
7. Com a utilizao do conjunto de testes fornecido, realize
DWpRPD~OWLPDH[WHQVmRGHFDERGHGHWHFomR5HWLUH
o conector vazio tampado e instale o conjunto do jumper
(guarde o conector vazio tampado para ser reinstalado
aps o trmino do teste).
8. Com o jumper no lugar, parafuse o conector do ativador
no receptculo do mdulo de teste. A luz do mdulo de
WHVWHGHYHDFHQGHULPHGLDWDPHQWH(VWHWHVWHFRQUPD
que o cabo de deteco est adequadamente instalado
e funcionar corretamente.

Sistemas de Controle de Incndio

M02005

10. Retire o conjunto de teste do sistema desconectando o conector do ativador do mdulo de teste
(Figura 2-24).

Mdulo de teste

CUIDADO

Falha na remoo do conjunto do jumper provocar descarga do sistema quando o ativador for
instalado no sistema de atuao e deteco eltrica.

Mdulo de Controle
FIGURA 2-23. PRENDA O CONJUNTO DA LUZ INDICADOR (Mdulo de Teste)
Se o mdulo de teste no acender, consulte Diagnstico de
Falhas do Sistema de Deteco Eltrica, nesta seo.
 5HDOL]HDWpRPD~OWLPDH[WHQVmRGHFDERGHGHWHFomR
e retire o conjunto do jumper. Coloque o conector vazio
tampado original no cabo de deteco. A luz do mdulo
de teste deve apagar imediatamente. Se no apagar,
consulte Diagnstico de Falhas do Sistema de Deteco
Eltrica, nesta seo.

Mdulo de teste

 5HWLUHRDWLYDGRUGRFRUSRGRDWXDGRUHYHULTXH
se no foi aceso. Reinstale o ativador e aperte
UPHPHQWHFRPXPDFKDYH
12. Reinstale o conector do ativador ao ativador e
DSHUWHUPHPHQWHFRPDPmR
13. Puxe o pino do anel no atuador do sistema de
atuao e deteco eltrica e empurre o pino vrias vezes para assegurar um movimento suave.
Reinstale o pino do anel e prenda a vedao do
cabo de chumbo.
14. Instale o cartucho de atuao de volta no corpo
GRDWXDGRULQIHULRUHDSHUWHUPHPHQWHFRPDPmR
EM CASO DE INCNDIO
Proceda da seguinte maneira durante e aps um
incndio. No caso de um incndio, devem ser realizados os passos a seguir:
1. Desligue a mquina.
2. Acione o sistema de extino de incndio manualmente.
3. Afaste-se da mquina levando um extintor de
incndio manual porttil, se puder.
4. Permanea em alerta com um extintor de incnGLRSRUWiWLOSDUDDSDJDUTXDOTXHUSRVVtYHOUHLQtFLR
de incndio aps o sistema de extino ter se
esgotado.
Explicao dos passos acima
1. Se voc deixar a mquina em funcionamento, ela
SRGHDGLFLRQDUFRPEXVWtYHODRIRJRRXUHLQLFLi
ORFRPIDtVFDV
2. Pode ajudar a apagar o fogo mais rapidamente.
 6DtGDLPHGLDWDGDiUHDGHIRJROKHSURWHJHGH
FKDPDVVRSUDGDVSHORYHQWRH[SORV}HVRXRXtros perigos criados pelo fogo.
4. aconselhvel ter um extintor manual porttil
porque calor remanescente pode provocar o
UHLQtFLRGHLQFrQGLRGHSRLVTXHRVLVWHPDGH
extino do sistema estiver descarregado. Dependendo do calor que restar, isto poder ocorrer
GLYHUVDVYH]HVSRUWDQWRTXHDWHQWRDWpTXHR
equipamento esfrie e voc esteja certo de que
QmRDFRQWHFHUiXPUHLQtFLRGRLQFrQGLR

Mdulo de controle

FIGURA 2-24. RETIRE O MDULO DE TESTE

M02005

Sistemas de Controle de Incndio

M2-11

O que esperar
Quando um sistema de extino de incndio descarregado, h algum barulho, acompanhado por
QXYHQVGHSURGXWRTXtPLFRVHFR5HVSLUDUSDUWtFXODV
estranhas no agradvel, mas o agente no txico.

Parte superior do
corpo

O que fazer depois que o fogo for apagado


O equipamento no deve ser ligado novamente at
TXHWHQKDVLGRUHYLVDGRHOLPSR MDWRVERUULIRVGH
gua ou vapor podem ser utilizados para remover
RSyTXtPLFR 6HRVLVWHPDGHDWXDomRHGHWHFomR
eltrica no puder ser recarregado imediatamente, ao
menos recarregue o restante do sistema de extino
de incndio para que a proteo acionada manualPHQWHTXHGLVSRQtYHO

Base da haste
/XEULTXHRDQHO2FRP
graxa de silicone
Pino de perfurao

Recarga do Sistema de Atuao e Deteco Eltrica


Mola

A recarga do sistema de atuao e deteco eltrica


similar ao procedimento original de instalao e
colocao do sistema de deteco automtica em
operao. Siga esses procedimentos como descrito
anteriormente neste manual, omitindo a seo que
trata da montagem do suporte e do cabo de energia.
Substitua toda a extenso de cabo de deteco envolvida na rea de incndio.
Antes de colocar o sistema em operao novamente,
importante que a cmara interna do atuador seja
totalmente limpa. Uma falha de limpeza pode provocar excesso de carbono agregado ao anel O interno e
FkPDUDGRSLVWmR(VWHDF~PXORWDPEpPLQWHUURPSHUiR
retorno do pino de perfurao sua posio mais alta.
Para limpar o atuador (Veja a Figura 2-25):
1. Retire o ativador
2. Retire o atuador do suporte e solte a parte superior do corpo.
3. Aplique presso base do pino de perfurao.
Isto forar o pino de perfurao e a mola para fora.
4. Limpe completamente os depsitos de carbono
da base da haste, pino de perfurao , mola e superItFLHLQWHUQDGRFRUSR
5. Depois que todos os componentes estiverem
OLPSRVHVHFRVOXEULTXHRVDQpLV2FRPJUD[DGH
silicone, generosamente.
6. Monte novamente o atuador e pressione o boto
manualmente vrias vezes, para assegurar um movimento livre o pino de perfurao.

Corpo do atuador

Aproximadamente
1,6 mm
PP

FIGURA 2-25. MONTAGEM DO ATUADOR

OBSERVAO: Quando o pino de perfurao estiver


de volta posio inicial, o ponto de corte do pino
ser aproximadamente 1,6 mm abaixo da rosca no
corpo do atuador inferior (Figura 2-25).

M2-12

Sistemas de Controle de Incndio

M02005

DIAGNSTICO DE FALAHAS DO SISTEMA DE DETECO ELTRICA


PROBLEMA: A luz indicadora verde no mdulo de controle no acende quando o boto solto.
CAUSAS POSSVEIS
AO CORRETIVA SUGERIDA
)XVtYHOTXHLPDGRQRFRQMXQWRGRFRQHFWRUGDEDWHULD
Conexo da bateria solta
&RQHFWRUHQWUHDDomRGHHQHUJLDVROWRRXRTXHEUDGR
Bateria descarregada.
Lmpada queimada

PROBLEMA: Luz do mdulo de teste no acende


CAUSAS POSSVEIS
Conjunto do jumper no est no lugar na extremidade da
DomRGD]RQDGHGHWHFomR
&RQHFWRUGDDomRGHHQHUJLDRXGD]RQDGHGHWHFomRVROto.
Lmpada queimada.
)XVtYHOTXHLPDGRQRPyGXORGRFRQHFWRUGDEDWHULD
Fio quebrado.
Bateria descarregada.
Conexo da bateria solta.

3URFXUHSRVVtYHOFXUWRFLUFXLWRQDDomRGHHQHUJLD
H[WHUQDHWURTXHRIXVtYHO
Limpe a aperte.
5HFRQHFWHLQVWDOHXPDQRYDH[WHQVmR
Carregue a bateria, ou instale uma nova.
Solte as lentes verdes, instale uma lmpada nova.

AO CORRETIVA SUGERIDA
Instale o conjunto de jumper.
Reconecte.
Solte as lentes verdes, instale uma nova lmpada.
3URFXUHSRVVtYHOFXUWRFLUFXLWRQDDomRGHHQHUJLD
H[WHUQDHWURTXHRIXVtYHO
Instale uma nova extenso.
Carregue a bateria ou instale uma nova.
Limpe e aperte.

PROBLEMA: Luz do mdulo de teste no apaga


CAUSAS POSSVEIS
Conjunto do jumper deixado na extremidade do cabo de
deteco.
6HomRGRFDERGHGHWHFomRGDQLFDGD

PROBLEMA: Ativador detonado


CAUSAS POSSVEIS
9HULTXHDFRQGLomRGHLQFrQGLRDQWHULRU
Cabo de deteco muito perto de fonte de calor
Conjunto do jumper de teste deixado no lugar aps o teste

M02005

AO CORRETIVA SUGERIDA
Retire o jumper. Reinstale o conector vazio tampado.
6XEVWLWXDDVH[WHQV}HVGDQLFDGDVGRFDERGHGHteco.

AO CORRETIVA SUGERIDA
6XEVWLWXDDVH[WHQV}HVGRFDERGD]RQDGHGHWHFo. Substitua o ativador e recarregue.
Verifique se h pontos quebrados de segurana,
afaste de fonte de calor, e recarregue.
Retire o jumper, reinstale a extremidade tampada do
conector e recarregue.

Sistemas de Controle de Incndio

M2-13

ANOTAES

M2-14

Sistemas de Controle de Incndio

M02005

SEO M7
AQUECEDOR DO REFRIGERANTE DO MOTOR
NDICE

AQUECEDORES DE LEO DO MOTOR ................................................................................................................... M7-3


INFORMAES GERAIS .................................................................................................................................... M7-3
DIAGNSTICO DE FALHAS ................................................................................................................................ M7-3
ELEMENTO DO AQUECEDOR............................................................................................................................ M7-3
Remoo........................................................................................................................................................ M7-3
Instalao....................................................................................................................................................... M7-4
AQUECEDOR DO LQUIDO DE ARREFECIMENTO DO MOTOR ............................................................................ M7-5
TERMOS GERAIS ................................................................................................................................................ M7-5
Manuteno ................................................................................................................................................... M7-5
ELEMENTO DE AQUECIMENTO ........................................................................................................................ M7-5
Remoo........................................................................................................................................................ M7-5
Instalao....................................................................................................................................................... M7-6
TERMOSTATO ..................................................................................................................................................... M7-6
Remoo........................................................................................................................................................ M7-6
Instalao....................................................................................................................................................... M7-6
AQUECEDORES DE LEO HIDRULICO ................................................................................................................ M7-7
INFORMAES GERAIS .................................................................................................................................... M7-7
DIAGNSTICO DE FALHAS ................................................................................................................................ M7-7
ELEMENTO DO AQUECEDOR............................................................................................................................ M7-7
Remoo........................................................................................................................................................ M7-7
Instalao....................................................................................................................................................... M7-8

M07010 7/09

Aquecedor do Refrigerante do Motor

M7-1

ANOTAES

M7-2

Aquecedor de Refrigerante de Motor

7/09 M07010

AQUECEDORES DE LEO DO MOTOR


INFORMAES GERAIS
A operao dos aquecedores de leo opcionais controlada
pelos termostatos do aquecedor do sistema do lquido de
arrefecimento. Os motores Cummins utilizam dois aquecedores de 240 Volts e 500 watts no crter de leo. Nem todos
os caminhes so equipados com esses equipamentos
opcionais.

DIAGNSTICO DE FALHAS
A operao de um aquecedor de leo pode ser testada por
meio de toque no ressalto de montagem (3, Figura 7-1),
localizado no crter de leo. Aps permitir que o aquecedor
execute sua funo durante um tempo, o ressalto estar
aquecido ao toque.
1. Se o aquecedor de leo no estiver quente ao toque,
YHULTXHVHKiWHQVmRGHD9IRUQHFLGDSHOR
cabo de fora.
2. Se o aquecedor de leo no estiver quente pelo contato
GRVGHGRVYHULTXHRFLUFXLWRGRWHUPRVWDWRQRVDTXHcedores do lquido de arrefecimento do motor. Inspecione tambm os circuitos entre o aquecedor e a fonte de
alimentao externa.
3. Se o aquecedor de leo no estiver quente ao toque e
a tenso estiver correta, deve-se ento substituir o elemento do aquecedor.

FIGURA 7-2. CONJUNTO DO AQUECEDOR


1. Cabo de fora
2. Tampo
3. Arruela
4. Bucha de borracha
5. Alojamento

6. Tampa do elemento
7. Tampa do alojamento
8. Fios eltricos
&RQHFWRUHVGDDomR

ELEMENTO DO AQUECEDOR
Remoo
1. Desconecte a fonte de alimentao externa.
NOTA: A substituio do elemento do aquecedor
pode ser feita sem que seja necessrio drenar o leo
do crter. Desmonte todas as peas, a comear pela
tampa do elemento.
$VJXUDVHPRVWUDPRFRQMXQWRFRPSOHWRGR
aquecedor de leo removido do crter.

FIGURA 7-1. AQUEDOR DE LEO DO MOTOR


1. Aquecedor de leo
2. Cabo de fora

M07010 7/09

3. Ressalto de monta
gem do crter de leo

2. Remova a tampa do alojamento (7, Figura 7-2).


 5HPRYDRVFRQHFWRUHVGHDomR  HGHV
conecte os cabos eltricos (8).
4. Se necessrio, retire o tampo (2) e remova
o cabo de fora do alojamento (5).
5. Remova os alojamentos da tampa do ele
mento (6).

Aquecedor do Refrigerante do Motor

M7-3

6. Solte o parafuso de ajuste (3, Figura 7-3) e remova o elemento do aquecedor (2) da tampa do
elemento (1).

FIGURA 7-3. REMOO DO ELEMENTO DO AQUECEDOR


1. Tampa do elemento
2. Elemento do aquecedor

3. Parafuso de ajuste
de reteno do elemento

Instalao
1. Instale o novo elemento do aquecedor (2) e
prenda-o na posio com o parafuso de ajuste (3,
Figura 7-3).
2. Aplique um composto anti-engripamento nas
roscas da tampa do elemento (6, Figura 7-2) e
instale o alojamento (5, Figura 7-2).
3. Caso tenham sido removidos, insira o cabo de
fora (1), bucha de borracha (4), arruela (3) e a
tampa (2) no alojamento.
4. Enrole os fios e coloque conectores de fiao
SDUDIXVDGRV  HPFDGDSDUGHRV
5. Ajuste o cabo de fora e aperte o tampo do
cabo.
6. Substitua o alojamento (5).
7. Se o leo do motor tiver sido drenado, reabasteoDRFiUWHUFRPyOHROLPSRHOWUDGR

M7-4

Aquecedor de Refrigerante de Motor

7/09 M07010

Aquecedor do Refrigerante do Motor


ELEMENTO DE AQUECIMENTO

GERAL
Para ajudar partidas em condies de clima frio, o
caminho pode estar equipado com aquecedores de
sistema de resfriamento. Duas unidades de aquecimento de refrigerantes de alta capacidade so
montadas sob o motor, na subestrutura do mdulo de
energia. O sistema inclui:




$TXHFHGRUHV
7HUPRVWDWRV
9iOYXODHPDQJXHLUDVGHGHVOLJDPHQWRGHUHIULgerante
 5HFHSWiFXORGHYROWV
 &DERVGHHQHUJLDDomRGRWHUPRVWDWRHFDL[D
de derivao.
A operao do aquecedor controlada por um termostato montado na extremidade de entrada das unidades de aquecimento. O termostato LIGA o aquecedor a 48C e DESLIGA a 60C. As vlvulas de gaveta
permitem a substituio do elemento aquecedor ou sensor
do termostato sem perda de refrigerante do motor.

Retirada
1. Desconecte a fonte de energia externa no receptculo de encaixe.
2. Feche as vlvulas de gaveta localizadas nas portas de entrada e sada.
3. Retire o elemento de aquecimento.
a. Retire os dois parafusos Phillips da tampa na
entrada do cabo de energia. Retire a tampa.

E 'HVFRQHFWHRVGRLVRVHOpWULFRVHUHWLUHR
elemento de aquecimento do cartucho.

CUIDADO

No opere o motor enquanto o aquecedor do


sistema de resfriamento do motor estiver ligado.
$YiOYXODGHUHWHQomRGHX[RHOLPLQDRX[RGH
refrigerante pelo aquecedor enquanto o motor
est em operao. Isto provocar uma falta de circulao no aquecedor e queimar os elementos
de aquecimento.
Manuteno
3DUDYHULFDUDVXQLGDGHVGHDTXHFLPHQWRGDRSHrao, as mangueiras de gua de sada devem ser
mornas ao toque.
 9HULTXHWRGDVDVFRQH[}HVHOpWULFDVSDUDDVVHgurar que sejam feitas conexes adequadas.
2. Verifique se existe elemento de aquecimento
queimado. (No retire a unidade de aquecimento
do caminho.)
a. Retire os dois parafusos Phillips e retire a
tampa deslizante.
b. Conecte um voltmetro nos dois terminais
HOpWULFRVHYHULTXHDWHQVmRGHRSHUDomR
(220 a 230 volts) enquanto a temperatura
do refrigerante estiver abaixo de 48 C. Se a
tenso atual estiver correta, o elemento de aquecimento est com defeito e deve ser substitudo.
3. Se no for lida a tenso correta (medida acima)
nos terminais do elemento de aquecimento, o termostato est com defeito e deve ser substitudo.

M07010 7/09

FIGURA 7-4. AQUECEDOR DE REFRIGERANTE


1. Termostato
2. Conjunto do aquecedor
3. Porta de sada de
gua

Aquecedor do Refrigerante do Motor

4. Elemento de aquecimento
5. Tampa
6. Terminais

M7-5

Instalao
1. Instale o novo elemento de aquecimento.
a. Cubra as roscas do novo elemento de aquecimento com um componente antiemperramento de rosca.
b. Parafuse o elemento de aquecimento no
FDUWXFKRHDSHUWHUPHSDUDJDUDQWLUTXHQmR
ocorram vazamentos.
 &RQHFWHRVRVHOpWULFRV
3. Coloque a tampa deslizante do elemento na posio e prenda com parafusos.
4. Abra as vlvulas de gaveta.
5. Ligue a fonte de energia externa. Depois de permitir que o elemento aquea por algum tempo, as
mangueiras de sada devem estar mornas ao toque.
 9HULTXHVHKiYD]DPHQWRVHVHRQtYHOGRUHIULgerante est adequado.

TERMOSTATO
Retirada
1. Desconecte a fonte de energia externa no tam
po do receptculo.
OBSERVAO: No necessrio retirar o conjunto
do termostato do aquecedor.
2. Retire os dois parafusos e tire a tampa.
 'HVFRQHFWHRVGRLVRVHOpWULFRV
4. Solte os dois parafusos de regulagem e retire a
unidade sensora de temperatura.

FIGURA 7-2. CONJUNTO DO TERMOSTATO.


1. Tampa
2. Unidade sensora de
temperatura

3. Carcaa
4. Parafusos de regulagem

Instalao
1. Instale uma nova unidade sensora e prenda no
lugar com dois parafusos de regulagem.
 &RQHFWHRVRVHOpWULFRV
3. Coloque a tampa na posio e prenda com os
parafusos.
4. Encaixe na fonte de energia externa.
Depois de permitir que o elemento aquea por algum
tempo, as mangueiras de sada devem estar mornas
ao toque.

M7-6

Aquecedor de Refrigerante de Motor

7/09 M07010

FERRAMENTAS ESPECIAIS
VLVULA DE CARGA DE NITROGNIO
Nmero da pea
EB1759

1.
2.
3.
4.
5.
6.
7.
8.

Descrio
Conjunto de carga
de nitrognio

Uso
Carga de nitrognio
da suspenso e do
acumulador

Vlvula ala T
Adaptador da vlvula de carga
Vlvulas de sada do coletor (do calibrador)
Vlvula de entrada (do regulador)
Vlvula Reguladora (Presso de nitrognio)
Coletor
Calibrador de presso de carga (Suspenses)
Gs nitrognio seco

OBSERVAO: a disposio das peas pode ser diferente


da ilustrao, dependendo do conjunto de Carga P / N.

CONJUNTO DE ROLAGEM PERIFRICA


Nmero da pea
EJ2627

Descrio
Conjunto de roletes

Uso
Remoo e instalao do mdulo de
energia

OLHAL
Nmero da pea

Descrio

TG1106

Olhal, 0,75-10 UNC

WA4826

Olhal, 1,25-7 UNC

M08021 5/10

Uso
Solicitaes de levantamento diversas

Ferramentas Especiais

M8-1

CHAVE NO LINEAR (EXCNTRICA)


Nmero da pea
TZ3535

Descrio
Chave de extremidade 1,5 pol de caixa
de ajuste

Uso
Montagens de cabo
e diversas

ADAPTADOR DE TORQUE
Nmero da pea
TZ2734

Descrio
Adaptador de torque
de pol.

Uso
Diversos

CABO
Nmero da pea

Descrio

TZ2733

Cabo tubular

Uso
Utilizao com
PB8326 e TZ2734

INSTALADOR DA VEDAO
Nmero da pea
TY2150

M8-2

Ferramentas Especiais

Descrio
Ferramenta de instalao da vedao

Uso
Instalao das vedaes da face do
rolamento da roda
dianteira

5/10 M08021

FERRAMENTAS DE ALINHAMENTO DA LUVA


Nmero da pea
TZ0992

Descrio

Uso

Ferramenta de
alinhamento de

Suspenso traseira e
barra antioscilao

luva

TY4576

Ferramenta de

Conjunto de ligao
da barra de direo
e tirante, Consulte a
Seo G

alinhamento de
luva

ACOPLAMENTO DE DESCONEXO RPIDA


Nmero da pea

Descrio

PB6039

Uso

Acoplamento hidrulico

Diversos

CHICOTE
Nmero da pea
PC 2525

Descrio
Chicote

Uso
Descarregamento do
medidor de carga til.
Consulte a seo M

TUBO
Nmero da pea
PC2710

Descrio
Ferramenta

Utilizao
Auxiliar na montagem dos cilindros
de elevao

VISTA A-A

M08021 5/10

Ferramentas Especiais

M8-3

TESTE DE TENSO DA CORREIA


Nmero da
pea

PC2061

Descrio

Uso

Teste da ten- 9HULFDomRGDWHQso da correia so da correia do


ar condicionado

FERRAMENTA DE ALINHAMENTO DA CORREIA


Nmero da
pea

EL8868

Descrio

Uso

Ferramenta de Alinhamento da
alinhamento da c o r r e i a d o a r
correia V
condicionado

SOQUETES E ADAPTADORES
Nmero da pea

Descrio

Uso

TZ2726

Soquete 1-1/8

TZ2729

Soquete 1-1/4

Diversos

TV7567

Soquete 1-5/16

Diversos

PB6825

Soquete de impacto Diversos


1-5/8

TZ2100

Soquete 1-7/8

Diversos

TZ2727

Soquete 2-1/4

Diversos

TZ2728

Soquete 2-3/4

Diversos

TR0532

Extenso de 8 de boca Diversos


quadrada

TR0533

Extenso de 17 de Diversos
boca quadrada

TV1186

Extenses 3-1/2

Diversos

TR0546

Ala T deslizante

Diversos

TZ2730

Adaptador 1 x 1-1/2

Diversos

TZ2731

Adaptador x 1

Diversos

EF6721

Cruzeta de 7/8

Diversos

SG5488

Parafuso de fenda 1 Diversos


1/8 7NC x 5

VN9787

Arruela plana 1 1/8

M8-4

Diversos

Ferramentas Especiais

5/10 M08021

FERRAMENTAS UTILIZADAS NA LAVAGEM DO SISTEMA HIDRULICO


Nmero da
pea

Descrio

Utilizao

XB5776

Mangueira

Lavagem do circuito da
direo

PC3074

Bloco de lavagem
(Cilindros bypass
de elevao)

Lavagem do circuito do
sistema de elevao

GERENCIADOR DE DADOS DO MEDIDOR DE CARGA


TIL
Nmero da
pea

Descrio

Utilizao

AK4720

Software

Anlise dos dados do


medidor de carga til

BOMBA VCUO DO SISTEMA HIDRULICO


Nmero da
pea

Descrio

Utilizao

XB0887

Bomba vcuo

Reter o leo durante a


abertura do sistema

M08021 5/10

Ferramentas Especiais

M8-5

FERRAMENTAS DE SERVIOS DIVERSAS

As ferramentas na tabela a seguir podem ser solicitadas Kent-Moore:

A tabela a seguir lista mais ferramentas especiais que sero


necessrias para vrios procedimentos de servio:
Nmero da
pea

Descrio

Nmero
da pea

Uso

Descrio

Uso

EJ2847

Ferramentas de remoo
do pino

Remoo do pino da
suspenso traseira

J-24092

Pernas sacadoras

Manuteno do
ar condicionado

EJ2848

Cilindro

Remoo do pino da
suspenso traseira

J-25030

Ferramenta de bloqueio do
cubo da embreagem

Manuteno do
ar condicionado

EJ2849

Bomba manual

Remoo do pino da
suspenso traseira

J-33884-4

Teste do interruptor indicador

Manuteno do
ar condicionado

EJ2850

Adaptador

Remoo do pino da
suspenso traseira

J-8092

Ala universal

Manuteno do
ar condicionado

VN2707

Parafuso de fenda 0,625


11NC x 2,75

Remoo do pino da
suspenso traseira

J-8433

Sacador de polia

Manuteno do
ar condicionado

SS1143

Ferramenta de instalao do
eixo vazado do cilindro de
elevao

Instalao do eixo
vazado do cilindro
de elevao

J-9395

Piv do sacador

Manuteno do
ar condicionado

J-9399

6RTXHWHGHSDUHGHQD

SS1158

Ferramenta do tampo do
eixo vazado do cilindro de
elevao

Instalao e remoo do tampo


do eixo vazado do
cilindro de elevao

Manuteno do
ar condicionado

J-9401

Ferramenta de remoo do
conjunto do prato e cubo da
embreagem

Manuteno do
ar condicionado

VJ6567

Ferramenta de instalao do
tubo do radiador

Instalao do tubo
do radiador

J-9403

Chave inglesa

Manuteno do
ar condicionado

XA2307

Ferramenta do rompedor

Remoo do tubo do
radiador

J-9480-01

Instalador da placa de
acionamento

Manuteno do
ar condicionado

BF4810

Ferramenta do rolamento

Alternador de 24 V

J-9480-02

Espaador

BF4818

Ferramenta de remoo do
rolamento dianteiro

Alternador de 24 V

Manuteno do
ar condicionado

J-9481

BF4820

Ferramenta de remoo da
bobina

Alternador de 24 V

Instalador do Sacador e
rolamento

Manuteno do
ar condicionado

Bf4821

Ferramenta de insero do
rolamento

Alternador de 24 V

BF4822

Ferramenta de servio do
estator

Alternador de 24 V

M8-6

Ferramentas Especiais

5/10 M08021

FERRAMENTA PARA O PISTO DOS FREIOS


Nmero da
pea

XB3579

Descrio

Utilizao

Chave inglesa Remoo/instalao


especial
da tampa do pisto do
freio de estacionamento
traseiro

0,257
0,4375 largura x 0,650 profundidade
8 orifcios igualmente espaados sobre placa de 3.800 de dimetro

ITEM QTDE. PEA DESCRIO


* 4,60 dim. x 0,75 AISI 4110
PADRO *

0,437 x 1.000 pino guia

PADRO 1-1/2 x 3/4 chave de impacto de 6 pt

116,8

45 tip.

* Indica as dimenses em polegadas


Os orifcios 1, 3, 5 e 7 so utilizados
Os orifcios 2, 4, 6 e 8 so alternados

Orifcio C: 60,32 x 12,7 profundidade


para soquetes
8,9 ref.

M08021 5/10

Ferramentas Especiais

Seo A A

M8-7

Nmero da pea

Descrio

Faa localmente utilizando dimenses mostradas


abaixo
Ferramenta extratora
KC7095

3DUDIXVRVGH[DomRGRHPSXUUDGRU
1,25 x 8 pol.

WA0366

Arruelas planas temperadas, 1,25 pol.

Uso
Para separar o fuso da roda dianteira do
pisto da suspenso
Use no 830E-AC

Consulte a Seo G, Eixo de Acionamento, Fusos e Rodas, para informaes sobre o uso da ferramenta de fuso, para
remover de maneira adequada os fusos da mquina.

19 furos, (espaados de maneira igual) em um crculo de


parafusos de modelo de 20
furos

Furos marcados com X so recomendados como nmero mnimo a ser


utilizado.

Material = Ao T1 ou equivalente

M8-8

Ferramentas Especiais

5/10 M08021

SEO M19
PERSIANAS DO RADIADOR
NDICE
PERSIANAS DO RADIADOR 3
PERSIANAS DO RADIADOR.................................................................................................................................... M19-3
OPERAO .............................................................................................................................................................. M19-3
Circuito hidrulico ............................................................................................................................................... M19-3
Circuito eltrico ................................................................................................................................................... M19-4
MANUTENO E REPAROS ................................................................................................................................... M19-4
DIAGNSTICO DE FALHAS..................................................................................................................................... M19-5
Diagnstico de falhas hidrulicas ....................................................................................................................... M19-8
Diagnstico de falhas eltricas ......................................................................................................................... M19-10

M19003

Persianas do Radiador

M19-1

ANOTAES

M19-2

Persianas do Radiador

M19003

PERSIANAS DO RADIADOR
As persianas do radiador opcionais ajudam a manuteno
da temperatura adequada do refrigerante do motor, primariamente em operaes sob condies de clima frio.

OPERAO

O sistema da persiana contm os seguintes componentes:



 &RQMXQWRGDSHUVLDQDFRPFLOLQGURDWXDGRUKLGUiXOLFR

 9iOYXODVGHUHGXomRGHSUHVVmRGHIRUQHFLPHQWRGH
leo hidrulico e solenide de controle do cilindro

 5HOrVGHFRQWUROHGRVROHQyLGH

 ,QWHUUXSWRUKDELOLWDGHVDELOLWDDSHUVLDQD

A presso de leo hidrulico para operar o cilindro


atuador do conjunto da persiana fornecido do circuito de direo do caminho. Uma mangueira (2,
Figura 19-1) presa porta da conexo T na bomba
do sistema de lubrificao automtico direciona o
yOHRSDUDDYiOYXODGHUHGXomRGHSUHVVmR  (VWD
YiOYXODUHGX]DSUHVVmRGRFLUFXLWRGHGLUHomR
kPa (3500 psi) at 10342 kPa (1500 psi). A presso
pPDLVWDUGHUHGX]LGDDN3D SVL SHODYiOYXOD
UHGXWRUDGHSUHVVmR  TXHIRUQHFHDYiOYXODVROHQyLGHGDSHUVLDQD  SDUDSUHVVXUL]DUDH[WUHPLGDGH
do cabeote do cilindro atuador da persiana (11), fechando as persianas durante o aquecimento do moWRU4XDQGRDVSHUVLDQDVVmRVLQDOL]DGDVSDUDDEULU
DYiOYXODVROHQyLGHVHUiGHVHQHUJL]DGDHRFDUUHWHO
mudar para direcionar o leo para a extremidade da
YDUHWDGRFLOLQGURGRDWXDGRU2yOHRUHWRUQDDRUHVHUYDWyULRDWUDYpVGDPDQJXHLUD  GLUHFLRQDGDSDUDR
tanque hidrulico.

1.
2.



6.



Suporte do radiador
Fornecimento de leo
9iOYXODGHUHGXomRGHSUHVVmR
9iOYXODGHUHGXomRGHSUHVVmR
9iOYXODVROHQyLGHGDSHUVLDQD
At a extremidade do cabeote do cilindro
$WpDH[WUHPLGDGHGDYDUHWDGRFLOLQGUR
&KLFRWHHOpWULFR $WpDFDL[DGHGHULYDomRGDHVWUXWXUD
do lado direito)
9. At a caixa do interruptor de desabilitao da persiana
 5HWRUQRGHyOHRSDUDDPDQJXHLUDGRUHVHUYDWyULR
11. Cilindro atuador da persiana

Circuito hidrulico

),*85$9/98/$6'()251(&,0(172'(/(2'2&,/,1'52$78$'25'$3(56,$1$

M19003

Persianas do Radiador

M19-3

Circuito Eltrico
8PLQWHUUXSWRUHVWiORFDOL]DGRHPXPDFDL[D 
Figura 19-2) presa estrutura superior direita ao lado
GRUHVHUYDWyULRGHJUD[DGRVLVWHPDGHOXEULFDomR
DXWRPiWLFD  TXHSRGHVHUXWLOL]DGRSDUDGHVDELOLWDU
as persianas durante condies de clima quente.
As persianas normalmente so acionadas pelo motor
ECM. O controlador do motor monitora a temperatura
do refrigerante e fornece um sinal para fechar as perVLDQDVTXDQGRDWHPSHUDWXUDHVWLYHUPXLWREDL[D
2PRWRU(&0IRUQHFHUiXPVLQDOGH9&& FLUFXLWR
6 SDUDHQHUJL]DURUHOr.ORFDOL]DGRQRTXDGURGH
UHOr&RQVXOWHDWDEHODSDUDWHPSHUDWXUDVHVSHFtFDVHPTXHR(&0HQYLDUiXPVLQDOSDUDIHFKDUDV
SHUVLDQDV,VWRIHFKDUiRVFRQWDWRVGRUHOr12DOLPHQWDGRVSHORUHOr.TXHIRUQHFH9&&TXDQGR
RLQWHUUXSWRUHVWLYHUOLJDGR 21 $FRUUHQWHSHOR.p
alimentada pelo interruptor que desabilita a persiana
IHFKDGRSDUDRSHUDomRGDSHUVLDQD HHQHUJL]DUiD
YiOYXODVROHQyLGHGDSHUVLDQDSDUDGLUHFLRQDURyOHR
para a extremidade do cabeote do cilindro atuador
da persiana para fechar as persianas.
6HRDUFRQGLFLRQDGRGDFDELQDHVWLYHUOLJDGRRUHOr
.HQHUJL]DUiDEULQGRRFLUFXLWR9&& 67 
alimentando o solenide de controle da persiana,
HYLWDQGRTXHDVSHUVLDQDVVHIHFKHP
Consulte o esquema eltrico na parte de trs do
PDQXDOGHRFLQDSDUDLQIRUPDo}HVDGLFLRQDLVVREUH
DomR

FIGURA 19-2. CAIXA DE INTERRUPTOR DE HABILITAO


DA PERSIANA
1. Estrutura superior direita
 5HVHUYDWyULRGHJUD[D
2. Caixa de interruptores
GHOXEULFDomRDXWRPitica (auto-lube)
3. Fio do chicote para a
YiOYXOD VROHQyLGH GD
persiana

MANUTENO E REPARO
$YiOYXODVROHQyLGH )LJXUD HYiOYXODVGHUHGXomR
de presso (3 & 4) no circuito hidrulico so ajustadas em
IiEULFDHQmRVmRDMXVWiYHLV6HXPDYiOYXODHVWLYHULQRSHUDQWHUHWLUHHVXEVWLWXDWRGDDYiOYXODFRPSOHWDHRFRQMXQWR
do corpo.
2VUHOrV.H.VmRGLVSRVLWLYRVHQFDL[DGRVTXHSRGHP
VHUVXEVWLWXtGRVIDFLOPHQWHVHHVWLYHUHPFRPGHIHLWR2V
UHOrVHVWmRORFDOL]DGRVQRTXDGURORFDOL]DGRQRJDELQHWH
HOpWULFR6XDORFDOL]DomRSRGHYDULDUHPUD]mRGDGDWDGH
fabricao do caminho.
2FRQMXQWRGDSHUVLDQDGHYHVHULQVSHFLRQDGRFRPUHODomRD
danos fsicos e com relao sua abertura e fechamento total, sem enroscar. Se necessrio, ajuste a articulao do cilindro do atuador para assegurar uma operao adequada.

M19-4

Persianas do Radiador

M19003

DIAGNSTICO DE FALHAS
7RGRWHVWHKLGUiXOLFRGHYHVHUUHDOL]DGRFRPyOHRKLGUiXOLFR
em temperatura de operao normal, e motor em marcha
lenta.
Consulte a Figura 19-3 para pontos de teste de diagnstico
de falhas mostrados com setas.
&RQVXOWHD7DEHODSDUDHVSHFLFDo}HVGHDEHUWXUDHIHFKDPHQWRGHSHUVLDQDSDUD0RWRUHV.RPDWVX

1. Sada de presso reduzida


2. Entrada
3. Reservatrio

PERIGO

&HUWLTXHVHTXHRPRWRUHDFKDYHJHUDOIRUDP
'(6/,*$'26 SRU SHOR PHQRV  VHJXQGRV
SDUDSHUPLWLUTXHDSUHVVmRGRDFXPXODGRUVHMD
DOLYLDGD
$OLYLHDSUHVVmRDQWHVGHGHVFRQHFWDUDVOLQKDV
KLGUiXOLFDV$SHUWHILUPHPHQWHWRGDVDVFRQH
[}HVDQWHVGHDSOLFDUSUHVVmR
2HVFDSHGHXLGRKLGUiXOLFRVRESUHVVmRSRGH
WHUIRUoDVXFLHQWHSDUDSHQHWUDUQRFRUSRGHXPD
SHVVRDSHQHWUDQGRQDSHOHHSURYRFDQGRJUDYHV
IHULPHQWRVHSRVVLYHOPHQWHPRUWHVHQmRIRUUH
FHELGRWUDWDPHQWRPpGLFRDGHTXDGRLPHGLDWR

Alimentao

Retorno

),*85$',$*167,&2'()$/+$6+,'58/,&$6
1.




Fornecimento de leo
9iOYXODGHUHGXomRGHSUHVVmR
9iOYXODGHUHGXomRGHSUHVVmR
9iOYXODVROHQyLGH

 &KLFRWHGHDomR
6. Conexo T
7. Calibrador de presso

8. Para a extremidade do cabeote


do cilindro
 3DUDDH[WUHPLGDGHGDYDUHWDGR
cilindro

TABELA I. MOTORES KOMATSU SSDA16V160


Temperatura do Refrigerante

Temperatura do Coletor de Entrada

Temperatura do Combustvel

Aberto 88 C (190 F)
Fechado 85 C (185 F)

Aberto 60 C (140 F)
Fechado 54 C (130 F)

Aberto 68 C (155 F)
Fechado 66 C (150 F)

M19003

Persianas do Radiador

M19-5

Tabela II. Diagnstico de Falhas

1. Operao de teste das persianas

Com o motor em marcha lenta, conecte uma


IRQWHGH9&&jYiOYXODVROHQyLGH 
Figura 19-1)

As persianas fecham V PARA PASSO 11


As persianas permanecem abertas V
PARA PASSO 2

2. 9HULFDomRGDSUHVVmRKLGUiXOLca at a extremidade da vareta


do cilindro

Instale as conexes T (6, Figura 19-3) nas


linhas (8 & 9). Conecte os calibradores de
presso com uma faixa de 0 3500 kPa
(0-500 psi) nas conexes T. desconecte o
FKLFRWHGHDomR  GDYiOYXODVROHQyLGH
'HYHKDYHUSUHVVmRN3D SVL QD
mangueira (9), e NENHUMA presso na
mangueira (8).

1DVHVSHFLFDo}HVV PARA PASSO 3


)RUDGDVHVSHFLFDo}HVV PARA PASSO 4

3. 9HULFDomRGDSUHVVmRKLGUiXlica at a extremidade do cabeote do cilindro

&RQHFWHIRQWH9&&jYiOYXODVROHQyLGH
'HYHKDYHUSUHVVmRN3D SVL QD
mangueira (8) e NENHUMA presso na
mangueira (9)

'HQWURGDVHVSHFLFDo}HVV PARA PASSO 11


)RUDGDVHVSHFLFDo}HVV PARA PASSO 4
Se nada mudou ao comparar com o Passo
93$5$3$662

4. 9HULFDomRGDSUHVVmRKLGUiXlica entre a vlvula de reduo


de presso (3) e a vlvula solenide (4).

Instale a mangueira com a conexo T entre 'HQWURGDVHVSHFLFDo}HVV PARA O


DYiOYXODGHUHGXomRGHSUHVVmR  HD
PASSO 7
YiOYXOD  &RQHFWHRFDOLEUDGRUGHSUHVVmR )RUDGDVHVSHFLFDo}HVV PARA O PASSO 5
com uma faixa de presso de 0 3500 kPa
SVL QDFRQH[mR7$SUHVVmRGHYH
ser de 517 kPa (75 psi).

5. 9HULFDomRGDSUHVVmRKLGUiXlica entre a vlvula de reduo


(2) e a vlvula de reduo de
presso (3)

Instale a mangueira com a conexo T entre


DYiOYXODGHUHGXomRGHSUHVVmR  HD
YiOYXODGHUHGXomRGHSUHVVmR  &RQHFWH
o calibrador de presso com uma faixa de
presso de 0 35000 kPa (0 5000 psi) na
FRQH[mR7$SUHVVmRGHYHVHUGH
kPa (1.500 psi).

6. A vlvula de reduo de pres- SXEVWLWXDDYiOYXODGHUHGXomRGHSUHVVmR  


so (3) est com defeito

'HQWURGDVHVSHFLFDo}HVV PARA O
PASSO 6
)RUDGDVHVSHFLFDo}HVV PARA O PASSO 8

V PARA O PASSO 5

7. A vlvula solenide (4) est com 6XEVWLWXDDYiOYXODVROHQyLGH  


defeito
8. 9HULTXHDSUHVVmRGHDOLPHQtao para a vlvula de reduo
de presso (2)

Instale a conexo T entre a mangueira


GHIRUQHFLPHQWRGHyOHR  HDYiOYXODGH
reduo de presso (2). Conecte o calibrador de presso com faixa de presso de
0 35000 kPa (0-5000 psi) at a conexo
7$SUHVVmRGHYHVHUGH
kPa (3000 3500 psi) a mesma presso de
espera do sistema de direo.

9. A vlvula de reduo de pres- 6XEVWLWXDDYiOYXODGHUHGXomRGHSUHVVmR  


so (2) est com defeito

'HQWURGDVHVSHFLFDo}HVV PARA O
PASSO 9
)RUDGDVHVSHFLFDo}HVV PARA O PASSO 10

V PARA A ETAPA 8.

10. A alimentao hidrulica para Execute os procedimentos de diagnstico de V PARA A ETAPA 8.


IDOKDVQRPDQXDOGHRFLQDDGHTXDGRSDUD
as persianas est incorreta.
corrigir o sistema hidrulico do sistema.

M19-6

Persianas do Radiador

M19003

Tabela II. Diagnstico de Falhas

11. 9HULTXHVHKiWHQVmRDGHTXDGD
no Quadro do rel 8

&RPDFKDYHJHUDOOLJDGD 21 XWLOL]HXP
920SDUDYHULFDUVHKi9&&QRFLUFXLWR5QRUHOr.

12. 7HQVmRLQDGHTXDGDQR4XDGUR 12. execute os procedimentos de diagnstiFRVGHIDOKDVQRPDQXDOGHRFLQDDGHTXDdo rel 8

'HQWURGDVHVSHFLFDo}HV V PARA
PASSO 13
)RUDGDVHVSHFLFDo}HV V PARA PASSO 12
Depois do reparo, V PARA O PASSO 11

do para obter a tenso adequada no circuito


5FRPDFKDYHJHUDOOLJDGD 21 

15. 9HULTXHVHKiWHQVmRDGHTXDda no rel K5.

)DoDXPMXPSHUGH9&&DWpRFLUFXLWR 'HQWURGDVHVSHFLFDo}HVV PARA


6'HSRLVYHULTXHVHKi9&&QR
PASSO 17
FLUFXLWR7QRTXDGURGRUHOr
)RUDGDVHVSHFLFDo}HV V PARA PASSO 16

16. Rel K5 est com defeito

6XEVWLWXDRUHOr.

V PARA O PASSO 15

17. 9HULTXHRLQWHUUXSWRUHGHVDbilitao da persiana

9HULTXHVHKi9&&QRFLUFXLWR7
dentro da caixa do interruptor de desabilitao da persiana.

'HQWURGDVHVSHFLFDo}HVV PARA
PASSO 19
)RUDGDVHVSHFLFDo}HVV PARA PASSO 18

18 9HULTXHVHKiFLUFXLWRDEHUWR
no circuito 65T1

/RFDOL]HHFRQVHUWHDFRQH[mRDEHUWDQR
circuito 65T1.

V PARA O PASSO 17

'HQWURGDVHVSHFLFDo}HV V PARA19. 9HULTXHRLQWHUUXSWRUGHGHVD- 9HULTXHVHKi9&&QRFLUFXLWR7


Se no for detectada tenso, ligue o interruptor PASSO 21
bilitao da persiana
de desabilitao da persiana.

Fora das especificaes V PARA


PASSO 20

20. Interruptor de desabilitao da


persiana com defeito

20. Substitua o interruptor de desabilitao


da persiana.

V PARA O PASSO 19

21. 9HULTXHVHKi9&&QDYiOvula solenide (4, Figura 19-4)

9HULTXHVHKi9&&QDYiOYXODVROHnide, no circuito 65T2.

'HQWURGDVHVSHFLFDo}HV V PARA
PASSO 23
Fora das especificaes V PARA
PASSO 22

22. 9HULTXHVHKiFLUFXLWRDEHUWR
no circuito 65T2

ORFDOL]HHFRQVHUWHFRQH[mRDEHUWDQR
circuito 65T2

V PARA O PASSO 21

23. 9HULTXHRDWHUUDPHQWRGD
vlvula solenide

9HULTXHVHKiDWHUUDPHQWRQRWHUPLQDO
GDYiOYXODVROHQyLGH&RQVHUWHFRQIRUPH
necessrio.

M19003

Persianas do Radiador

M19-7

Diagnstico de Falhas Hidrulicas

SIM

Causa

Soluo

11 Problema
eltrico

9iSDUDGLDJnstico de falhas eltricas

11 Problema
eltrico

9iSDUDGLDJnstico de falhas eltricas

SIM
Com o motor em
marcha lenta,
conecte uma
fonte de energia
GH 9 && QD
YiOYXODVROHQyLde (5, Figura
19-1). As perV L D Q D V  G H Y H P
fechar.

NO

SIM

NO 2. Instale as conexes T (6, Figura


19-4) nas linhas (8 &
9). Conecte os calibradores de presso
com faixa de 0
3500 kPa (0-500 psi)
nas conexes T.
Desconecte o chiFRWHGHDomR  GD
YiOYXOD VROHQyLGH
'HYHKDYHUSUHVVmR
de 517 kPa (75 psi)
na mangueira (9), e
NENHUMA presso
na mangueira (8).

SIM-3 Conecte
fonte de energia de
9&&QDYiOYXOD
V R O H Q y L G H   ' H Y H
KDYHU SUHVVmR GH
517 kPa (75 psi)
na mangueira (8), e
NENHUMA presso
na mangueira (9).

NENHUMA MUDANA DO PASSO


ANTERIOR
9iOYXOD VROHnide (4) est
com defeito

Substitua a
YiOYXODVROHnide (4)

9iOYXODVROHnide (4) est


com defeito

Substitua a
YiOYXODVROHQyLde (4)

9iOYXODGHUHduo de presso (3) est


com defeito

Substitua a
Y i O Y X O D  G H
reduo de
presso

NO

NO

NO-4 Instale a
mangueira com
conexo T entre a
YiOYXODGHUHGXomR
  H  Y i O Y X O D   
Conecte o calibrador
de presso com
faixa de presso de
0 3500 kPa (0
500 psi) na conexo
7$SUHVVmRGHYH
estar entre 517 kPa
(75 psi).

SIM

NO

SIM
NO-5 Instale a mangueira com a conexo
7 HQWUH D YiOYXOD GH
reduo de presso (2)
HDYiOYXODGHUHGXomR
de presso (3). Conecte
o calibrador de presso com uma faixa de
presso de 0 35000
kPa (0 5000 psi) na
conexo T. A presso
GHYHVHUGHN3D
(1.500 psi).

NO

Continua na
prxima pgina

M19-8

Persianas do Radiador

M19003

Diagnstico de Falhas Hidrulicas (continuao)

Causa
9 i O Y X O D  G H
reduo de
presso est
com defeito

SIM

Soluo
Substitua a
Y i O Y X O D  G H
reduo de
presso (2)

Instale as conexes T entre


a mangueira de alimentao
GHyOHR  HDYiOYXODGHUHduo de presso (2). Conecte
o calibrador de presso na
conexo T com uma faixa
de presso de 0 35.000 kPa
SVL $SUHVVmRGHYH
ser de 20.684 24.131 kPa
(3.000 3.500 psi), a mesma
presso de espera do sistema
de direo.

Alimentao
hidrulica
das persianas est
incorreta

NO

M19003

Persianas do Radiador

Execute os
procedimentos de diagnstico de
falhas no maQXDOGHRFLna adequado
para corrigir
o sistema
hidrulico.

M19-9

Diagnstico de falha eltrica





&RQHFWHXPDIRQWHGH9&&DRWHUPLQDO6QR4XDGURGR5HOrUHOr ,VWRID]DVSHUVLDQDVIHFKDUHPGHVYLDQdo do sinal ECM do motor.)


&HUWLTXHVHTXHRVLVWHPDGRDUFRQGLFLRQDGRHVWHMDGHVOLJDGRRXGHVFRQHFWHRR7QRUHOr 6HKRXYHU
9&&QRWHUPLQDO7DVSHUVLDQDVQmRIHFKDUmR 

Causa

SIM

P r o b l e m a h i - Conserte
o sistema
drulico
hidrulico

8 W L O L ] H  X P
9 2  0   S D U D
Y H U L I L F D U    9
CC no circuito
7QDYiOYXOD
solenide da
persiana.

 /LJXHDFKDYH
geral.
 /LJXH R LQWHUruptor de desabilitao

SIM

NO

Soluo

9 H U L I L T X H  V H
K i    9  & &  Q R
circuito 65T1 no
UHOr

SIM

NO

9HULILTXH VH Ki


9 && QR FLUcuito 712ST no
UHOr

SIM

Circuito aberto
entre 65T1 &
65T2

Conserte o circuito aberto

5 H O r    F R P
defeito

Substitua o
UHOr

5 H O r    F R P
defeito

Substitua
RUHOr

Circuito aberto
no circuito 712R
GDFKDYHJHUDO

Conserte o
circuito 712R

9 H U L I L T X H  V H
K i    9  & &  Q R
NO circuito 712R no
UHOr

NO

M19-10

Persianas do Radiador

M19003

SEO M20
MEDIDOR DE CARGA TIL III

NDICE
SEO OPERAO................................................................................................................................................. M20-5
Introduo ........................................................................................................................................................... M20-5
Resumo dos dados ...................................................................................................................................... M20-5
Coleta de dados ........................................................................................................................................... M20-5
DESCRIO DOS COMPONENTES ................................................................................................................ M20-6
Diagrama do sistema ................................................................................................................................... M20-6
Sensor de presso da suspenso ............................................................................................................... M20-6
Inclinmetro ................................................................................................................................................. M20-6
Mostrador do operador ................................................................................................................................ M20-6
Interruptor do operador ................................................................................................................................ M20-7
Entrada da velocidade ................................................................................................................................. M20-7
Interruptor do corpo da caamba levantada ................................................................................................ M20-7
Interruptor de trava dos freios ...................................................................................................................... M20-7
Medidor de carga til .................................................................................................................................. M20-7
Prticos de comunicao ............................................................................................................................. M20-7
Entrada da chave de partida ........................................................................................................................ M20-8
Alimentao eltrica do medidor de carga til ............................................................................................. M20-8
Luzes indicadoras de carga ......................................................................................................................... M20-8
Fiao eltrica e terminais ........................................................................................................................... M20-9
Sadas TCI ................................................................................................................................................... M20-9
MOSTRADOR E INTERRUPTOR DO OPERADOR ........................................................................................ M20-10
Leitura do velocmetro ............................................................................................................................... M20-10
Leitura da carga exibida pelo mostrador.................................................................................................... M20-10


8VDQGRRQ~PHURGHLGHQWLFDomRGR2SHUDGRU ....................................................................................... M20-10


Usando o contador de carga e de toneladas ............................................................................................. M20-10
Contador do total de toneladas .................................................................................................................. M20-10
Contador de carga total ..............................................................................................................................M20-11
Zerando os contadores ...............................................................................................................................M20-11
Visualizando os dados dos sensores ao vivo .............................................................................................M20-11
Outras mensagens do mostrador ...............................................................................................................M20-11
FUNCIONAMENTO DO MEDIDOR DE CARGA TIL E CLCULO DA CARGA TIL ............................. M20-12
Descrio dos estados do ciclo de transporte da carga ............................................................................ M20-12

M20008 02/10

Medidor de carga til III

M20-1

Descrio do ciclo de transporte da carga ....................................................................................................... M20-12


Clculo da carga ............................................................................................................................................... M20-13
Carga devolvida ................................................................................................................................................ M20-13
Preciso das medies..................................................................................................................................... M20-13
Fontes de Erro no Clculo da Carga til ................................................................................................................. M20-13
Erro no clculo da carga til ............................................................................................................................. M20-13
Condies de carregamento............................................................................................................................. M20-14
Sensores de presso ........................................................................................................................................ M20-14
Flutuaes de carga ......................................................................................................................................... M20-14
Velocidade e distncia ...................................................................................................................................... M20-14
DADOS DO CICLO DE TRANSPORTE DA CARGA .............................................................................................. M20-14
Dados do ciclo de transporte da carga ............................................................................................................. M20-14
Marcas de alerta de ciclo de transporte de carga............................................................................................. M20-16
Dados de torque do chassi ............................................................................................................................... M20-17
Dados de peso suportado pelas suspenses do caminho ............................................................................. M20-17
Dados de velocidade mxima........................................................................................................................... M20-17
Registros de alarme.......................................................................................................................................... M20-17
Dados dos cdigos de falha ............................................................................................................................. M20-18
NOES SOBRE O SOFTWARE PARA PC .......................................................................................................... M20-19
Software para PC ............................................................................................................................................. M20-19


&RQJXUDomRGRVLVWHPD .................................................................................................................................. M20-19


Instalao do software do Medidor de Carga til III ......................................................................................... M20-19

DOWNLOAD DE DADOS........................................................................................................................................ M20-20


CONFIGURAO DO SISTEMA PLM III ................................................................................................................ M20-21
Iniciando as comunicaes............................................................................................................................... M20-21
Unidades de carga til exibidas no mostrador.................................................................................................. M20-21
Unidades de tempo........................................................................................................................................... M20-21
Menu de conexes ........................................................................................................................................... M20-21
Fazendo a conexo com o Medidor de carga til ............................................................................................. M20-22


&RQJXUDomRGRPHGLGRUGHFDUJD~WLO ............................................................................................................. M20-22


Programao das informaes de data e hora................................................................................................. M20-22
Programao do tipo do caminho fora-de-estrada ......................................................................................... M20-23
Programao das unidades de medida exibidas no mostrador........................................................................ M20-23
Programao do nmero de srie do chassi .................................................................................................... M20-23
Programao do nmero do caminho ............................................................................................................ M20-23
Programao do Distribuidor Komatsu ............................................................................................................. M20-23

M20-2

Medidor de carga til III

M20008 02/10

Programao do cliente Komatsu..................................................................................................................... M20-23


Tara do caminho limpo.................................................................................................................................... M20-24
Calibrao do inclinmetro ............................................................................................................................... M20-24
Anlise dos Dados ............................................................................................................................................ M20-25
Criando uma pesquisa ............................................................................................................................... M20-25


&ODVVLFDomRSHORQ~PHURGDXQLGDGHGRFDPLQKmR ................................................................................ M20-25

&ODVVLFDomRSHORWLSRGHFDPLQKmR.......................................................................................................... M20-25

&ODVVLFDomRSRUJDPDGHGDWDV ............................................................................................................... M20-26

&ODVVLFDomRSRUJDPDGHKRUiULRV........................................................................................................... M20-26
Tela de visualizao de detalhes de carga til........................................................................................... M20-27
Gerao de relatrios ................................................................................................................................ M20-27
Resumo - relatrio de uma pgina............................................................................................................. M20-28
Informativo detalhado - relatrio com mltiplas pginas............................................................................ M20-28

*HUDomRGHJUiFRV................................................................................................................................... M20-29
Exportao de dados ................................................................................................................................. M20-29
Exportao do CSV ................................................................................................................................... M20-29
Compactao ............................................................................................................................................. M20-30
Importao de dados ................................................................................................................................. M20-31
Deletando registros de ciclos de transporte de carga................................................................................ M20-31
Visualizao de alarmes ............................................................................................................................ M20-32
Deletando registros de alarme ................................................................................................................... M20-32
SEO DIAGNSTICO DE FALHAS ....................................................................................................... M20-33

DIAGNSTICO DE FALHAS................................................................................................................................... M20-33


Visualizao dos alarmes ativos....................................................................................................................... M20-33
Exibio dos dados em tempo real ............................................................................................................ M20-33
Teste das luzes indicadoras de carga til .................................................................................................. M20-33
Criao de arquivos de registro das entradas ........................................................................................... M20-34
Inspees dirias ....................................................................................................................................... M20-34
Manuteno peridica................................................................................................................................ M20-34
Exibies anormais na partida ................................................................................................................... M20-35
No h exibio da carga til quando a chave de partida ligada ........................................................... M20-36
No h informaes no velocmetro .......................................................................................................... M20-37
No h informaes no mostrador do operador ........................................................................................ M20-37
No h comunicao com o computador (PC) .......................................................................................... M20-38
As luzes indicadoras de carga no se acendem durante o carregamento ................................................ M20-39
As luzes indicadoras de carga se mantm acesas .................................................................................... M20-40
As luzes indicadoras de carga se mantm acesas durante as operaes de despejo ............................. M20-40
O mostrador no limpo aps a carga ser despejada .............................................................................. M20-40
M20008 02/10

Medidor de carga til III

M20-3

Problemas de calibrao ........................................................................................................................... M20-41


Alarme 1 Alta presso dianteira esquerda .............................................................................................. M20-42
Alarme 2 - Baixa presso dianteira esquerda ............................................................................................ M20-42


'LDJQyVWLFRGHIDOKDVGDDomRGDVXVSHQVmRGLDQWHLUDHVTXHUGD .......................................................... M20-42


Alarme 3 - Alta presso dianteira direita .................................................................................................... M20-43
Alarme 4 - Baixa presso dianteira direita ................................................................................................. M20-43

'LDJQyVWLFRGHIDOKDVGDDomRGDVXVSHQVmRGLDQWHLUDGLUHLWD ................................................................ M20-43


Alarme 5 - Alta presso traseira esquerda................................................................................................. M20-44
Alarme 6 - Baixa presso traseira esquerda.............................................................................................. M20-44

'LDJQyVWLFRGHIDOKDVGDDomRGDVXVSHQVmRGLDQWHLUDHVTXHUGD ........................................................... M20-44


Alarme 7 - Alta presso traseira direita ...................................................................................................... M20-45
Alarme 8 - Baixa presso traseira direita ................................................................................................... M20-45

'LDJQyVWLFRGHIDOKDVGDDomRGDVXVSHQVmRWUDVHLUDGLUHLWD .................................................................. M20-45


Alarme 9 Alto nvel do inclinmetro......................................................................................................... M20-46
Alarme 10 Baixo nvel do inclinmetro.................................................................................................... M20-46

'LDJQyVWLFRGHIDOKDVGDDomRGRLQFOLQ{PHWUR........................................................................................ M20-46
Alarme 13 Falha de entrada do corpo da caamba levantada ............................................................... M20-47
Alarme 16 Falha de gravao na memria ............................................................................................. M20-48
Alarme 17 Falha de leitura da memria .................................................................................................. M20-48
Alarme 18................................................................................................................................................... M20-49
Alarme 19................................................................................................................................................... M20-49
Alarme 22................................................................................................................................................... M20-49
O interruptor do operador no funciona ..................................................................................................... M20-50
Alarme 26 Falha no interruptor do usurio funo SELECIONAR ...................................................... M20-50
Alarme 27 Falha no interruptor do usurio funo AJUSTAR.............................................................. M20-50
Mapa dos conectores................................................................................................................................. M20-51
Conectores................................................................................................................................................. M20-52

PROCEDIMENTOS DE VERIFICAO DO MEDIDOR PLMIII.............................................................................. M20-53


Descrio geral .......................................................................................................................................... M20-53
Ferramentas necessrias .......................................................................................................................... M20-53


3URFHGLPHQWRVGHYHULFDomR .................................................................................................................... M20-53

CONFIRMAO DOS PROCEDIMENTOS DE VERIFICAO DO MEDIDOR PLMIII .................................. M20-57


Programao do aplicativo Flashburn ....................................................................................................... M20-57


M20-4

/LVWDGHFRQUPDo}HV ................................................................................................................................ M20-59

Medidor de carga til III

M20008 02/10

SEO OPERAO
INTRODUO

Coleta de Dados

O medidor de Carga til III (PLMIII) mede, exibe e registra na


memria o peso do material que est sendo carregado por
um caminho fora-de-estrada. O sistema consiste geralmente em um medidor da carga til, um indicador, luzes instaladas na plataforma e sensores. Os sensores primrios so
quatro sensores de presso da suspenso e um inclinmetro. Outras entradas incluem um sinal de corpo da caamba
levantado, um sinal de trava dos freios e velocidade.
Resumo dos Dados
A memria permite o armazenamento de 5208 ciclos de
transporte de cargas. Para cada um desses ciclos so armazenadas na memria as seguintes informaes:
 &DUJD~WLO
 1~PHURGHLGHQWLFDomRGRRSHUDGRU 
 'LVWkQFLDTXHRFDPLQKmRSHUFRUUHFRPDFDoDPEDFDUregada e vazia
 7HPSRHPTXHDFDoDPEDSHUPDQHFHYD]LDHVWDQGR
ou no o motor em funcionamento, de carregamento,
carregada estando ou no o motor em funcionamento, e
QDOPHQWHRWHPSRGHVSHQGLGRQRGHVFDUUHJDPHQWRGD
caamba.
 9HORFLGDGHPi[LPDFRPDFDoDPEDFDUUHJDGDHYD]LD
acompanhada do horrio do dia.
 9HORFLGDGHPpGLDFRPDFDoDPEDFDUUHJDGDHYD]LD
 &DUJDTXHVREUDQDFDoDPEDTXDQGRDFDUJDWUDQVSRUtada descarregada.
 +RUiULRGRGLDHPTXHVHLQLFLRXRFLFORGHWUDQVSRUWHGD
carga, o carregamento da caamba e o descarregamento da mesma.
 3LFRGHWRUTXHSRVLWLYRHSLFRGHWRUTXHQHJDWLYRDFRPpanhados da hora do dia.
 3LFRGHFDUJDOLEHUDGDDFRPSDQKDGRGDKRUDGRGLD
 5HODomRHQWUHWRQHODGDVHPSKSDUDFDGDXPGRVSQHXV
dianteiros e mdia para cada um dos pneus traseiros.

O sistema utiliza-se do ambiente operacional Windows 95/98NT para o download, armazenamento na


memria e visualizao das informaes relativas a
cargas teis e falhas. O software desenvolvido para
uso em PC capaz de fazer o download de toda uma
frota de caminhes em um arquivo de banco de dados Paradox. Os usurios podem pesquisar o banco
de dados por data, dia e horrio, tipo do caminho e
nmero do caminho para a gerao de relatrios,
grficos e exportao de dados. O software pode
exportar os dados no formato .CSV, extenso facilmente importvel para a maioria dos aplicativos
de planilha. O ambiente operacional Windows no
compatvel com o Sistema Medidor de Carga til 2.
de suma importncia que cada um dos sistemas
GHPHGLomRGHFDUJD~WLOVHMDFRQJXUDGRSDUDFDGD
caminho que utilize software compatvel com PC.
As informaes do nmero de srie do chassi e do
nmero do caminho fora-de-estrada so usadas
pelo programa que gera e gerencia o banco de dados
para a organizao dos dados referentes carga til.
O Sistema do medidor de carga til deve ainda ser
FRQJXUDGRSDUDDUHDOL]DomRGHFiOFXORVSDUDRPRGHORGHFDPLQKmRHVSHFtFR(UURVGHFRQJXUDomR
podem levar perda de dados e acarretar clculos
imprecisos da carga til.

O medidor de carga til armazena em sua memria dados


que no podem ser apagados, acompanhando o veculo ao
longo de toda sua vida til. Esses dados incluem:
 $VFDUJDV~WHLVPi[LPDVUHJLVWUDGDVDFRPSDQKDGDV
do registro das datas e horrios em que ocorreram.
 2VWRUTXHVSRVLWLYRVHQHJDWLYRVPi[LPRVUHJLVWUDGRV
acompanhados das datas e horrios em que ocorreram.
 $VYHORFLGDGHVPi[LPDVUHJLVWUDGDVDFRPSDQKDGDV
das datas e horrios em que ocorreram.

M20008 02/10

Medidor de carga til III

M20-5

Descrio dos Componentes


Diagrama do Sistema

Luzes de
carga
Vermelha

Interruptor do
Usurio momentaneamente desligado
para cima=
SELECIONA
para baixo=
PROGRAMA

Mostrador do
velocmetro/
carga

Prtico de Dados-Cabina
Download de dados
Configurao doSistema
Medidor de Carga til
Diagnstico de Falhas

Prtico de dados ao nvel


do cho(opcional)
Download de dados
&RQJXUDomRGR6LVWHPD
Medidor de Carga til
Diagnstico de Falhas

Laptop PC
Download de dados
Configurao doSistema Medidor de Carga til Diagnstico de
Falhas

Medidop de carga 3

CAN Prtico
CAN Prtico

Verde
24V c.c

TCI- 70%
TCI- carregado
TCI-hipercarregado

mbar

Placa de scores
Placa de scores e sistema
de despacho opcionais

Inclinmetro de
passo
2,6 V c.c = 0
-103 mV/

Sensor de presso
de suspenso
400lb/poF
40-20ma

Sensor de corpo da
caamba levantado
24 Vc.c= para baixo
circuito aberto= para
cima

Trava dos freios


Velocidade GE
terra =aplicada
entrada de
circuitoaberto=
frequncia do
desaplicada
velocmetro

Alimentao eltrica
Alimentao por bateria
Sensor da chave da
partida

Sensor da presso da suspenso

Mostrador do operador

O Sistema Medidor de Carga til III utiliza um sensor


GHSUHVVmRELODUFRPSUHVVmRQRPLQDODWpOE
pol2 (281 kg/cm2) e presso limite (sobrecarga) de
10000 lb/pol2 (700 kg/cm2 8PGRVRVTXHFKHJDDR
sensor o de tenso de alimentao, enquanto o outro o sinal. A gama de presses compreendida entre
0 e 4000 lb/pol2 convertida em uma corrente eltrica
entre 4 e 20 ma. A tenso nominal do sensor de +
18 V c.c. Cada um dos sensores de presso possui
cabo com 3000 mm de comprimento. Os cabos possuem blindagem e reforo especiais para conferi-los
de resistncia mecnica e isolamento contra interferncias na recepo sob a forma de rudos.

O mostrador do velocmetro e da carga til usado para


se saber a velocidade do caminho e a carga til que est
transportando no momento da consulta ao mostrador. O
mostrador do alto usado para exibir a velocidade, tanto em
unidade do Sistema Mtrico Internacional (km/h), como na
do Sistema Britnico (milhas por hora). O terminal do terra
n 4 localizado atrs do velocmetro, quando conectado,
permite ao velocmetro fornecer a velocidade em unidade
do Sistema Mtrico Internacional, e, desconectado, exibir a
velocidade em unidade do Sistema Britnico. Para ajustar
o velocmetro, utiliza-se um potencimetro calibrador atrs
do mesmo, tal como ocorre com os velocmetros convencionais.

Inclinmetro

O medidor da carga til usa o mostrador de baixo para a


OHLWXUDGHHGRWRWDOGHWRQHODGDVRXRQ~PHURGHLGHQWLcao do operador. Utilizando-se o interruptor do operador
localizado no painel de instrumentos, voc pode ler no mostrador as presses da suspenso e a inclinao no instante
da consulta. A programao das unidades de medida nas
quais voc deseja que o mostrador exiba os dados feita
no software compatvel com PC. As cargas teis podem ser
expressas em toneladas americanas, toneladas inglesas ou
toneladas mtricas.

O inclinmetro usado para aumentar a preciso dos


clculos da carga em uma inclinao. Ele utiliza trs
RV3DUDRVHQVRURRYHUPHOKRpRGDYROWDJHP
3DUD R VHQVRU R R YHUPHOKR p R GD YROWDJHP
de alimentao de + 18 V c.c., o preto o terra, ao
passo que o branco o sinal. O sinal de inclinao
uma voltagem entre 1 e 4 V. Zero graus de inclinao
representado, na linha do sinal, por uma voltagem
de 2,6 V c.c. A cada grau da inclinao subido pela
dianteira do caminho, a voltagem do sinal diminuir
0,103 V c.c.

M20-6

Medidor de carga til III

M20008 02/10

Interruptor do Operador

Medidor de carga til

O interruptor do operador para carga til usado para programar, visualizar e apagar o contador de carga total e o
contador de total de toneladas, tambm sendo empregado
para entrar com o nmero de identificao do operador
(0-9999). Este interruptor tambm pode ser utilizado para a
visualizao das presses da suspenso e do inclinmetro.
O interruptor do operador para o medidor da carga til localiza-se no painel de instrumentos, possuindo duas posies
QmR[DV$SRVLomRGRDOWRpDGH6(/(d2HPSUHJDGD
para passar de uma informao a outra dentre as exibidas
no mostrador, ao passo que a de baixo a de PROGRAMAd2XWLOL]DGDSDUDSURJUDPDURQ~PHURGHLGHQWLFDomRGR
operador ou zerar os contadores da carga e do total de toneladas. Normalmente, as entradas do interruptor para o medidor
da carga til se do em circuito aberto. O interruptor conecta
provisoriamente o circuito ao terra.

O medidor de carga til localiza-se no interior de uma


carcaa de alumnio. Existe uma pequena janela na
face da unidade, que permite visualizar o funcionamento do conjunto, assim como os cdigos dos
alarmes ativos. Em circunstncias normais de operaomRXP]HURQRYLVRUGHGRLVGtJLWRVFDSLVFDQGRH
apagando. Os cdigos de falhas ativas so exibidos
durante dois segundos. Tipicamente, esses cdigos
so visualizados usando-se
o laptop conectado ao prtico de comunicao serial.

Entrada de velocidade
O Sistema Medidor de Carga til III utiliza um sinal de velocidade para calcular a velocidade, a distncia, bem como
outros dados atrelados ao desempenho da mquina.
Esta entrada essencial para o bom funcionamento do sistema. O Sistema Medidor de Carga til III recebe este sinal do
mostrador do velocmetro/operador localizado no painel de
instrumentos. O mesmo sinal exibido ao operador usado
pelo sistema. Em caminhes fora-de-estrada dotados desse
sistema, os clculos de distncia baseiam-se no raio de rolagem dos pneus.
Interruptor do corpo da caamba levantado
O sinal de entrada do corpo da caamba levantado recebido de um interruptor magntico localizado na parte interna
do chassi do caminho fora-de-estrada, mais precisamente
frente do pino pivotado do corpo do veculo. Este interruptor o mesmo tipicamente usado para a entrada para o sistema
de transmisso. Quando o corpo da caamba encontra-se baixado, o interruptor fecha e completa o circuito para a alimentao de controle 71. Um sinal de 24 V c.c. indica que o corpo da
caamba est baixado, ao passo que o circuito aberto sinaliza
que o corpo da caamba encontra-se levantado.
Interruptor de trava dos freios
O interruptor de trava dos freios usado para travar os
freios das rodas traseiras do caminho fora-de-estrada. Seu
HPSUHJRVHID]QHFHVViULRSDUDRFiOFXORGDVXWXDo}HVGH
FDUJDYHULFDGDVGXUDQWHRSURFHVVRGHFDUUHJDPHQWRGD
caamba. Sem o interruptor de trava dos freios aplicado, o
medidor de carga til interpretar que o caminho foi carregado usando-se um carregador contnuo e, assim, produzir
um vis no registro do ciclo de transporte da carga. Independentemente da utilizao do recurso de trava dos freios,
todas as demais funes permanecero normais. A entrada
da trava dos freios vem do interruptor localizado no painel
de instrumentos. O interruptor de trava dos freios conecta o
circuito ao terra. O circuito em aberto sinaliza que os freios
esto destravados, enquanto o terra indica que a trava dos
freios encontra-se aplicada.
M20008 02/10

H no medidor de carga til um conector de 40 pinos.


Um macaco de rosca usado para manter as carcaas do medidor de carga til e do conector do chicote
GDDomRHOpWULFDXQLGDVHQWUHVL2SDUDIXVRGHVVH
macaco de rosca requer uma chave sextavada de
4 mm ou 5/32. O torque de aperto correto para esse
parafuso de 25 lb.pol. Quatro parafusos promovem
D[DomRGDFDUFDoDGRPHGLGRUGHFDUJD~WLODRVHX
suporte de sustentao na cabina.
A placa de circuito impresso existente no interior da
carcaa do medidor de carga til composta por
componentes eletrnicos multilamelares, de dupla
facialidade e fixados na superfcie da placa. No
existem componentes que requeiram manuteno no
campo no interior dessa placa de circuito impresso.
Os componentes eletrnicos foram projetados para
resistir s condies ambientais severas de um campo de minerao. Lembre-se - se voc abrir a carcaa
do medidor de carga til, perder a garantia.
Prticos de comunicao
O medidor de carga til possui dois prticos de comunicao serial RS232 e dois prticos CAN. No interior
da caixa de juno do medidor de carga til voc encontra conexes para os dois prticos seriais. Os dois
prticos CAN foram disponibilizados para futuros sistemas eletrnicos. O prtico serial # 1 usado para a
comunicao com o visor do painel de instrumentos,
sendo tambm empregado para a conexo do laptop.
Quando o PC estiver usando o prtico serial, o mostrador permanecer em branco. Este prtico opera
inicialmente com programaes seriais a 9800.8 N, 1.
Estas programaes
variam automaticamente aumentando a taxa de comunicao com o PC utilizando o prtico. Este prtico
VHULDOHPSUHJDXPDFRQH[mRGHKDUGZDUHWULODU
O prtico serial # 2 usado para a comunicao com
outros componentes eletrnicos de placas, como o
sistema Modular Minings Dispatch ou a placa de
scores da Komatsu. Este prtico utiliza uma conexo
GHKDUGZDUHWULODU$VFRQH[}HVDHVWHSyUWLFRVHULDO
exigem a aprovao da Komatsu. H vrias opes
de protocolo disponveis, estando informaes tcnicas detalhadas igualmente disponveis mediante
licenciamento.

Medidor de carga til III

M20-7

Entrada da chave de partida

Luzes indicadoras de carga

O Medidor de Carga til III monitora a situao em


que se encontra a chave de partida. Um sinal de 24
V c.c. indica que a chave de partida est aberta, e o
circuito em aberto que ela est desligada. O medidor
de carga til no recebe sua alimentao eltrica do
circuito da chave de partida. Aps a remoo da chave de partida, o medidor de carga til permanece ligado por vrios segundos. Quando a chave de partida
desenergizada, o medidor de carga til realiza uma
srie de operaes internas em sua memria antes
de desligar por si prprio. Para que essas operaes
aconteam, deve ser respeitado um intervalo mnimo
de 15 segundos entre a ltima vez em que a chave
de partida foi desligada e seu prximo religamento. O
medidor de carga til resetar automaticamente por
si mesmo sem erro se no for respeitado o tempo
VXFLHQWHSDUDRSURFHVVDPHQWRGDVRSHUDo}HVFLWDdas. O visor poder piscar rapidamente.

O Medidor de Carga til III utiliza luzes de carga para sinalizar ao operador da p carregadeira de rodas o peso aproximado do material transportado no caminho fora-deestrada. As luzes de carga somente acendem quando a
trava dos freios est aplicada. As luzes so controladas pelo
medidor de carga til atravs de uma srie de rels existentes na caixa de juno. O medidor de carga til controla os
rels por meio de sadas de 24 V c.c. Um sinal de 24 V c.c.
proveniente do medidor de carga til alimenta a bobina dos
rels e conecta a alimentao eltrica das baterias s luzes
de carga. Quando o rel no se encontra alimentado pelo
medidor de carga til, um resistor de preaquecimento conecta a luz de carga a uma voltagem reduzida. Este circuito
UHDOL]DRSUpDTXHFLPHQWRGRVODPHQWRVGDOX]GHFDUJDH
reduz a alimentao de corrente quando a luz se encontra
totalmente iluminada. Este sistema prolonga a vida til das
luzes de carga.

Alimentao eltrica do medidor de carga til

As luzes de carga progressivamente indicam ao operador da


p carregadeira de rodas o peso aproximado do material que
o caminho est transportando.

A alimentao eltrica do medidor de carga til provm do circuito das baterias existente no caminho
fora-de-estrada. Para interromper a alimentao
eltrica das
baterias para o medidor de carga til, primeiro voc
dever remover a chave de partida e esperar 15
segundos, do contrrio, os dados referentes ao ciclo
de transporte de cargas podero ser perdidos. O
medidor de carga til desliga por si prprio aproximadamente 15 segundos aps a remoo da chave de
partida. O sistema do medidor de carga til opera a
uma voltagem nominal de 24 V c.c., com 1 a 2 amps,
dependendo dos opcionais instalados. O medidor de
carga til foi projetado para desligar automaticamente
se a voltagem da alimentao eltrica exceder 36 V
c.c. Alm disso, o sistema protegido por um disjuntor de 5 amp localizado na caixa de juno.
A alimentao eltrica das luzes de carga provm
do mesmo circuito da bateria. As luzes de carga so
alimentadas por um rel, que controlado pela chave
de partida. As luzes de carga so ainda protegidas
por um disjuntor de 15 A localizado na caixa de juno.

M20-8

8PDOX]YHUGHSLVFDQWHLQGLFDTXHDSUy[LPDXWXDomRGH
carga far com que a carga medida supere mais de 50% da
carga nominal. Uma luz verde esttica indica que a carga no
momento supera mais de 50% da capacidade nominal.
8PDOX]kPEDUSLVFDQWHVLQDOL]DTXHDSUy[LPDXWXDomRGH
carga far a carga medida superar mais de 90% da carga
nominal. Uma luz mbar esttica sinaliza que a carga no
momento supera 90% da capacidade nominal.
8PDOX]YHUPHOKDSLVFDQWHLQGLFDTXHDSUy[LPDXWXDomR
de carga far a carga medida superar 105% da carga nominal, enquanto uma luz vermelha esttica sinaliza que a carga
no momento excede 105% da capacidade nominal.
O ideal, para o carregamento, que a luz verde e a luz mbar estejam estticas e que a luz vermelha esteja piscando,
o que significa que a carga transportada pelo caminho
encontra-se entre 90% e 105% da carga nominal para o
FDPLQKmRHTXHDSUy[LPDXWXDomRGHFDUJDIDUiDFDUJD
medida superar 105% da carga nominal.

Medidor de carga til III

M20008 02/10

Fiao eltrica e terminaes


A maioria das conexes do Medidor de Carga til III de seu
caminho fora-de-estrada utilizam um cabo de servio pesaGR(VWHFDERPXOWLFRQGXWRUDPDUHORXVDXPRQDPHQWH
tranado de 16 awg projetado para operaes que envolvem
movimento contnuo. Os condutores so protegidos por uma
blindagem laminada e tranada que tem por funo isol-los
de interferncia na recepo por rudo eletrnico e torn-lo
VLFDPHQWHPDLVUHVLVWHQWH$WHUPLQDomRWtSLFDGHVVHR
um terminal anelar # 10. A grande maioria das conexes
para o Medidor de Carga til III so feitas na caixa de juno
do mesmo.
Sadas TCI
O sistema de transmisso GE empregado nos caminhes
fora-de-estrada 830E solicita ao medidor de carga til informaes relativas carga transportada pelo caminho.
Existem trs sadas do medidor de carga til para o GE para
a indicao da carga relativa no caminho. Um sinal de 24 V
c.c. no circuito 73MSL sinaliza que a carga equivale a 70%
da carga nominal. Um sinal de 24 V c.c no circuito 73FSL
sinaliza que o caminho encontra-se 100% carregado. O
circuito 730SL no est sendo usado atualmente.

M20008 02/10

Medidor de carga til III

M20-9

MOSTRADOR E INTERRUPTOR
DO OPERADOR
Leitura do velocmetro
A janela do alto do mostrador do velocmetro/carga
corresponde seo do velocmetro. O mostrador
exibe a velocidade indicada pela freqncia recebida.
O indicador de velocidade pode ser ajustado usandose o potencimetro localizado atrs do indicador.
possvel alterar tambm as unidades de medida
exibidas no mostrador. O terminal n 4 controla as
unidades de medida exibidas no mostrador. Ligandose o terminal n 4 ao terra, o mostrador exibir a
velocidade na unidade de medida do Sistema Mtrico
Internacional, ao passo que deixando em aberto, o
mostrador exibir a velocidade na unidade de medida
do Sistema Britnico.
Leitura da carga exibida pelo mostrador
A parte inferior do mostrador do velocmetro/carga
usada para informar a carga til. A posio SELECT
(SELECIONAR) do interruptor do operador permite
que o usurio acesse no mostrador algumas informaes de grande utilidade, cuja seqncia apresentada abaixo:


&DUJD~WLO
&DUJD ~WLO

1~PHURGHLGHQWLFDomRGRRSHUDGRU
1~PHUR GH LGHQWLFDomR GR RSHUDGRU

7RWDOGHWRQHODGDVQRWXUQR
7RWDO GH WRQHODGDV QR WXUQR

&RQWDGRU GD FDUJD QR WXUQR


 &RQWDGRUGDFDUJDQRWXUQR

3UHVVmRGDVXVSHQVmRGLDQWHLUDHVTXHUGD
3UHVVmR GD VXVSHQVmR GLDQWHLUD HVTXHUGD

3UHVVmRGDVXVSHQVmRGLDQWHLUDGLUHLWD
3UHVVmR GD VXVSHQVmR GLDQWHLUD GLUHLWD

3UHVVmR GD VXVSHQVmR WUDVHLUD HVTXHUGD


3UHVVmRGDVXVSHQVmRWUDVHLUDHVTXHUGD




3UHVVmR GD VXVSHQVmR WUDVHLUD GLUHLWD


3UHVVmRGDVXVSHQVmRWUDVHLUDGLUHLWD


,QFOLQ{PHWUR
,QFOLQ{PHWUR

O mostrador retm a informao exibida at o interruptor SELECT voltar a ser pressionado. As presses
das suspenses, o inclinmetro e as cargas teis exibidas no mostrador so baseadas nas entradas dos
sensores de corrente.
As comunicaes com o mostrador utilizam o mesmo
link serial visto na conexo de download. Sempre que
um outro computador seja conectado ao prtico serial
SDUDRGRZQORDGRXFRQJXUDomRGRVLVWHPDR
mostrador de baixo apaga. Esta no a mesma conexo utilizada por sistemas de despacho de minas.

8VDQGRRQ~PHURGHLGHQWLFDomRGRRSHUDGRU
2Q~PHURGHLGHQWLFDomRGRRSHUDGRUDWXDOpUHJLVWUDGR
na memria para cada ciclo em que a mquina transporta a
carga, podendo ser selecionado dentro do intervalo compreendido entre 0 e 9999.
5RWHLURSDUDSURJUDPDURQ~PHURGHLGHQWLFDomRGRRSHrador:
1. Pressione o interruptor SELECT at QUE Id= aparea no mostrador.
2. Mantenha o boto SET pressionado at 0000 aparecer no mostrador. O primeiro dgito dever estar piscando.
3. Volte a pressionar o boto SET para mudar de dgito.
4. Pressione o boto SELECT uma vez para ajustar o
segundo dgito.
5. Utilize novamente o boto SET para mudar de dgito.
6. Pressione o boto SELECT uma vez para ajustar o
terceiro dgito.
7. Use o boto SET novamente para mudar de dgito.
8. Pressione o boto SELECT uma vez para ajustar o
quarto dgito.
9. Use outra vez o boto SET para mudar de dgito.
10. Pressione o boto SELECT uma vez mais para entrar
FRPRQ~PHURGHLGHQWLFDomRGRRSHUDGRU
Caso nenhum boto seja pressionado por 30 segundos,
o mostrador retornar operao normal. O nmero que
HVWDYDHQWUDGRVHUiSHUGLGRHRQ~PHURGHLGHQWLFDomR
retornar ao anterior.
Usando o contador de carga e de toneladas
O Medidor de Carga til III permite ao operador do caminho
fora-de-estrada monitorar e rastrear o total de toneladas
transportadas pelo caminho, bem como o nmero de ciclos
de transporte de carga realizados pelo caminho durante o
turno de trabalho. Estas informaes podem ser apagadas
GRPRVWUDGRUQRLQtFLRGHFDGDWXUQRGHWUDEDOKRDPGH
que o operador consiga registrar na memria quantas cargas
e toneladas foram transportadas pelo caminho durante o
turno de trabalho.
Contador de total de toneladas
O contador de total de toneladas registra o nmero de toneladas transportadas pelo caminho desde a ltima vez em
que foi zerado. Para se chegar ao valor exato do total de
toneladas transportadas pelo caminho, necessrio multiplicar o valor exibido no mostrador por 100. Por exemplo,
se o mostrador estiver exibindo
, o total de toneladas
43.200. Este mostrador pode ser zerado no incio de cada
turno de trabalho para que o operador possa registrar na memria quantas toneladas foram transportadas pela mquina
GXUDQWHXPWXUQRGHWUDEDOKRHVSHFtFR$VXQLGDGHVVmR
selecionadas utilizando-se o software compatvel com PC.
 3DUDYLVXDOL]DURFRQWDGRUGRWRWDOGHWRQHODGDVSUHVsione e solte o interruptor SELECT at que
=
aparea no mostrador.

M20-10

Medidor de carga til III

M20008 02/10

Contador de carga total


O contador de carga total registra o nmero de cargas transportadas pelo caminho fora-de-estrada desde a ltima vez
em que foi zerado. Este mostrador pode ser zerado no incio
de cada turno para que o operador possa registrar quantas
cargas foram transportadas pelo caminho durante seu turno de trabalho.


O inclinmetro mostra graus inteiros de inclinao,


sendo que uma inclinao positiva se d com a dianteira do caminho embicada para cima. O mostrador
exibir rapidamente o tipo de informao mostrada
a cada 10 segundos. Por exemplo, se a presso na
dianteira esquerda estiver sendo exibida, piscar no
mostrador de um em um minuto. Quando mostrada
a carga til, esta informao no exibida.

3DUDYLVXDOL]DURFRQWDGRUGHFDUJDWRWDOSUHVVLRQHH
solte o interruptor SELECT at
= aparecer no
mostrador.

Zerando os contadores
Se voc zerar o contador do total de toneladas ou o contador
de carga total, ambos os contadores sero zerados.

Para zerar o contador do total de toneladas e o contador de


carga total, siga o roteiro abaixo:
1. Pressione o interruptor SELECT at o mostrador
exibir
= ou
=.
2. Mantenha o boto SET pressionado at zerar o mostrador.
Visualizando os dados dos sensores em tempo real
O mostrador pode ser usado ainda para uma rpida visualizao das leituras do momento dos quatro sensores da
presso das suspenses e do inclinmetro. Este recurso
pode ser usado durante perodos de manuteno programada para checar o estado das suspenses. Esses valores so
exibidos em tempo real e sero atualizados medida que
IRUHPPRGLFDGRV
As exibies em tempo real no podem ser apagadas, o que
WRUQDRERWmR6(7VHPHIHLWRQHVWHFDVRHVSHFtFR
As unidades exibidas no mostrador so controladas pela
FRQJXUDomRGRPHGLGRUGHFDUJD~WLO3URJUDPDQGRVHR
medidor de carga til para exibir em seu mostrador unidades
do Sistema Mtrico Internacional, as presses passam a ser
informadas em dcimos de kg/cm2. Por exemplo, se o mostrador mostrar
, o valor efetivo ser de 20,2 kg/cm2.
Se programado para exibir toneladas americanas, o medidor
de carga til fornecer as presses em lb/pol2. Para converter uma presso em kg/cm2 para lb/pol2, multiplique por 14,2
(1 kg/cm2 = 14,2 lb/pol2). Somente o software desenvolvido
para PC capaz de detectar qual sistema de unidades de
medida foi programado para exibio no mostrador.

M20008 02/10

3UHVVmRGLDQWHLUDHVTXHUGD3DUDH[LELUDSUHVso na suspenso dianteira esquerda, pressione


e solte o interruptor SELECT at
= aparecer no mostrador.
3UHVVmRGLDQWHLUDGLUHLWD3DUDH[LELUDSUHVVmR
na suspenso dianteira direita, pressione e solte
o interruptor SELECT at
= aparecer no
mostrador.
3UHVVmRWUDVHLUDHVTXHUGD3DUDH[LELUDSUHVso na suspenso traseira esquerda, pressione e
solte o interruptor SELECT at
= aparecer
no mostrador.
3UHVVmRWUDVHLUDGLUHLWD3DUDH[LELUDSUHVVmR
na suspenso traseira direita, pressione e solte
o interruptor SELECT at
= aparecer no
mostrador.
,QFOLQ{PHWUR3DUDH[LELUDLQFOLQDomRGHVHX
caminho fora-de-estrada, pressione e solte o
interruptor SELECT at
= aparecer no mostrador.

Outras mensagens do mostrador


Quando o sistema do medidor de carga til iniciado,
o mostrador informa o modelo de caminho fora-deestrada para o qual o Medidor de Carga til III est
FRQJXUDGR
No caso, por exemplo, de um caminho fora-deestrada 930E, o mostrador exibir
.
Se o Medidor de Carga til III encontrar problemas de memria, o mostrador exibir o cdigo
_________TXDQGRRHUURHVSHFtFRGHPHPyULDIRUR
88. Em circunstncias como essa, diga-se de passagem muito raras, o sistema dever ser desligado durante 30 segundos, e, aps esse perodo, reiniciado.

Medidor de carga til III

M20-11

FUNCIONAMENTO DO MEDIDOR DE CARGA TIL E


CLCULO DA CARGA TIL
Descrio dos estados do ciclo de transporte da carga
O ciclo de transporte da carga tpico pode ser desmembrado em oito estgios ou estados distintos.
Cada um desses estados obriga o medidor de carga
til a realizar clculos diferenciados e armazenar diferentes dados na memria.
Estados ou estgios de um ciclo de transporte de carga tpico:
1. Zona em tara
2. Caamba vazia
3. Carregamento da caamba
4. Manobra
 =RQDQDO
6. Transporte da carga
7. Descarregamento da caamba
8. Seqncia ps-descarregamento
Descrio do ciclo de transporte da carga
Um novo ciclo de transporte de carga iniciado assim que a carga transportada no ciclo de transporte
de carga anterior descarregada da caamba do
caminho. O medidor de carga til permanecer no
estado da seqncia ps-carregamento durante 10
VHJXQGRVSDUDFRQUPDUTXHDFDUJDIRLHIHWLYDPHQte descarregada da caamba. Se a carga til em
dado momento no chegar a 20% da carga nominal,
o medidor de carga til passar
para a zona de tara e iniciar o clculo de uma nova
tara com a caamba do caminho vazia. Se, aps a
carga ser descarregada da caamba, a carga til no
tiver cado para menos de 20% da carga nominal, o
medidor retornar ao estados de manobra ou transporte
da carga. Nesse caso, ser registrado no ciclo de transporte de carga uma falsa caamba levantada.
Quando voc encontrar-se na zona em tara e deslocar-se a uma velocidade superior a 5 km/h, o medidor
de carga til calcula o peso da carga remanescente
na caamba do caminho. Este valor de tara ser
subtrado do peso da carga remanescente da caamEDFDUUHJDGDDPGHVHGHWHUPLQDUDFDUJD~WLOQDO
O medidor de carga til passar da zona em tara ou
caamba vazia para o estado carregamento se forem
GHWHFWDGDVXWXDo}HVQDFDUJD(OHYDQGRVHRFRUSR
da caamba no estado de caamba vazia, o medidor
de carga til pode ser reprogramado manualmente no
estado zona em tara para que calcule uma nova tara.
Do estado de caamba vazia, o medidor de carga til
passar ao estado de carregamento atravs de um
ou outro meio que explicaremos agora. Se a trava
dos freios estiver aplicada, o medidor de carga til
HVWDUiDQDOLVDQGRDVSUHVV}HVGDVVXVSHQV}HVDP
GHGHWHFWDUXPDSRVVtYHOXWXDomRGHFDUJDTXHVH
FRQUPDGDIDUiFRPTXHRPHGLGRUSDVVHDRHVWDGR
de carregamento. A magnitude mnima da carga para
DGHWHFomRGHXPDXWXDomRGHFDUJDFRUUHVSRQGHD
GDFDUJDQRPLQDO8PDXWXDomRGHFDUJDQRUmalmente leva 4 a 6 segundos para ser detectada. O
segundo mtodo para passar de caamba vazia para
carregamento da caamba atravs do carregamen-

M20-12

to contnuo da caamba. Isto pode acontecer se a trava dos


freios no for utilizada durante o carregamento da caamba.
Se a carga passar de 50% da carga nominal durante 10 segundos sem a trava dos freios aplicada, o medidor passar
para carregamento da caamba e ir registrar a marca de
carregamento contnuo no ciclo de transporteda carga.
O medidor de carga til passa de carregamento da caamba
para manobra assim que o caminho fora-de-estrada comea a se mover. A zona de manobra de 160 m, tendo sido
assim concebida para permitir ao operador reposicionar o
caminho sob a p carregadeira de rodas. Mais carga til
pode ser acrescida a qualquer momento dentro da zona
de manobra. Assim que o caminho percorre os 160 m, o
PHGLGRUGHFDUJD~WLOSDVVDSDUDD]RQDQDOHFRPHoDD
calcular a carga til. Levantando-se o corpo da caamba
com o medidor de carga til no estado de manobra, a marca
GHDXVrQFLDGHFDUJDQDOpUHJLVWUDGDQRUHJLVWURGRFLFORGH
transporte da carga, no calculada a carga til e ol medidor
passa para o estado de carregamento da caamba.
Se voc imprimir ao caminho uma velocidade superior a
5 km/h na zona final, o medidor de carga til calcular o
peso da carga carregada remanescente na caamba do
caminho. O mesmo algoritmo avanado usado para
calcular o peso da carga da carga carregada remanescente
na caamba do caminho, inclusive quando deveria estar
vazia. Recebendo o sinal de corpo da caamba levantado,
RPHGLGRUGHFDUJD~WLOSDVVDUiGD]RQDQDODRHVWDGRGH
carregamento da caamba. Se o caminho tiver sido movido
SRUPHQRVGHPLQXWRQD]RQDQDORPHGLGRUGHFDUJD~WLO
FDOFXODUiDFDUJD~WLOQDOXWLOL]DQGRXPDWpFQLFDGHSRQGHrao que poder levar a uma mdia menos precisa. Se isto
acontecer, a marca de carga mdia ser registrada no ciclo
de transporte da carga.
O medidor de carga til alterado para o estado de despejo
quando o corpo da caamba levantado. O medidor de
carga til ser alterado do estado de despejo para ps-carregamento quando o corpo da caamba comear a descer
sua posio de repouso.
Da posio ps-carregamento, o medidor de carga til poder assumir um destes trs estgios:
1. Se a mdia da carga til for correspondente a
GDFDUJDQRPLQDOHQHQKXPDFDUJD~WLOQDO
tiver sido calculada, o medidor de carga til retornar
para o estado de manobrabilidade. Aps o caminho
percorrer 160 m, o medidor passar para oestado de
]RQDQDOHWHQWDUiUHFDOFXODUDFDUJD~WLO$LQGLFDomR
corpo da caamba falsamente levantado ser registrada
no registro do ciclo de transporte.
2. Se a mdia de carga til for superior a 20% da carga noPLQDOHDFDUJD~WLOQDOWLYHUVLGRFDOFXODGDRPHGLGRU
de carga til retornar para o estado de transporte. A
indicao corpo da caamba falsamente levantado ser
registrada no registro do ciclo de transporte.
3. Se a mdia de carga til for inferior a 20% da carga nominal, o medidor de carga til passar para o estado de
zona de tara e comear a calcular uma nova tara vazia

Medidor de carga til III

M20008 02/10

Clculo da carga
2FiOFXORGDFDUJDQDOGLIHUHGR~OWLPRFiOFXORFRPDVXWXDo}HVGDFDUJD$SUHFLVmRGRFiOFXORGDVXWXDo}HVGD
carga depende das condies em que a caamba foi carregada e da posio do caminho durante o carregamento
GDFDoDPED2~OWLPRFiOFXORFRPDVXWXDo}HVGDFDUJD
QmRpRYDORUUHJLVWUDGRQDPHPyULDFRPRDFDUJDQDO$
FDUJDQDOpGHWHUPLQDGDSRUXPDVpULHGHFiOFXORVUHDOLzados enquanto o caminho fora-de-estrada se encaminha
ao local em que a carga que transporta na caamba ser
descarregada.
Carga devolvida
A carga devolvida calculada em termos da diferena entre
a tara atual do caminho fora-de-estrada e a tara do caminho fora-de-estrada com a caamba totalmente sem carga.
A tara do caminho com a caamba totalmente sem carga
calculada usando-se o software desenvolvido para PC.
Quando as suspenses passam por manuteno ou so
promovidas alteraes que possam afetar o peso da carga
remanescente na caamba do caminho fora-deestrada,
necessrio recalcular a tara do caminho com a caamba
totalmente sem carga.
Preciso das medies
As medies de carga til normalmente se repetem dentro
de um desvio de 1%. A preciso para um teste em escala
SDUWLFXODUGHSHQGHGHFRPELQDo}HVHVSHFtFDVGHVHQVRUHV
de presso e medidores de carga til, bem como as variveis
HVSHFtFDVGHFDGDWHVWHHPHVFDOD&RPSDUDo}HVHQWUHGLferentes testes de escala freqentemente so feitas sem ser
levadas em conta as diferenas introduzidas por instalaes
HVSHFtFDVHDRSHUDomRGDVHVFDODVSDUDFDGDWHVWH$OpP
disso, cada um dos sensores de presso e medidores de
carga til introduzem sua prpria no-linearidade.
Cada caminho fora-de-estrada se torna uma combinao
individual de sensores e medidor de carga til. Erros dessas
fontes podem introduzir um desvio de at 7% nos clculos
GRPHGLGRUGHFDUJD~WLOSDUDXPWHVWHHPHVFDODHVSHFtFR
isso para um nico caminho fora-de-estrada.
Uma vez que o Medidor de Carga til III calcula uma nova
tara com a caamba do caminho totalmente vazia para
cada carga til, um teste em escala detalhado deve pesar o
caminho com a caamba vazia e carregada para cada ciclo
de transporte da carga. Utilizando-se uma mdia aritmtica
simples de 2 ou 3 pesagens do caminho com sua caamba
totalmente vazia como uma tara com a caamba totalmente
vazia para todo o teste em escala, voc introduzir um erro
VLJQLFDWLYRVHFRPSDUDGRVRVSHVRVREWLGRVFRPDHVFDOD
com os pesos calculados pelo Medidor de Carga til III.

M20008 02/10

FONTES DE ERRO NO CLCULO


DA CARGA TIL
Erro no clculo da carga til
A fonte nmero um de erro no clculo da carga til
surge quando as suspenses no recebem a devida
manuteno. O medidor de carga til calcula a carga
til medindo diferenas no peso suportado pelas
suspenses do caminho com sua caamba vazia
e carregada. O nico mtodo para a determinao
do peso suportado pelas suspenses do caminho
consiste em medir a presso do gs nitrognio nas
suspenses. Se as suspenses no estiverem com
a manuteno em dia, o medidor de carga til ser
incapaz de estabelecer um valor preciso para a carga
til. Os dois fatores crticos so a altura adequada do
leo e uma carga igualmente apropriada de nitrognio.
Se as suspenses apresentarem uma sobrecarga,
o medidor de carga til no conseguir determinar o
peso suportado pelas suspenses do caminho com
a caamba vazia O cilindro da suspenso dever
movimentar-se normalmente dentro de seus cursos
ascendente e descendente medida que o caminho
desloca-se com a caamba vazia. A presso em uma
suspenso sobrecarregada dever empurrar a haste
da suspenso at o limite de seu curso. Neste caso,
a presso no interior do cilindro no representa com
preciso a fora necessria para suportar aquela
parte do caminho.
Se as suspenses estiverem recebendo carga insuFLHQWHRPHGLGRUGHFDUJD~WLOQmRVHUiFDSD]GH
determinar o peso da carga aplicada ao caminho. O
cilindro da suspenso deve ser capaz de se deslocar
para cima e para baixo medida que o caminho
carregado se desloca.
Se a presso aplicada a uma suspenso pouco
FDUUHJDGDQmRIRUVXFLHQWHSDUDVXSRUWDUDFDUJD
a suspenso poder entrar em colapso e produzir
contato entre as partes metlicas. Nesse caso, a
presso interna do cilindro no representar com preciso a fora necessria para suportar aquela parte
do caminho.
A pouca altura do leo tambm pode gerar erros por
no suportar corretamente um caminho carregado.
Este o motivo pelo qual a altura do leo e a carga
de nitrognio so os fatores mais crticos com relao
medio da carga til. Se as suspenses no puderem ser mantidas adequadamente, no ser possvel
fazer uma medio precisa da carga til. Alm disso,
a manuteno da suspenso tambm um fator muito importante para a vida til do caminho.

Medidor de carga til III

M20-13

Condies de carregamento
2FiOFXORGDFDUJDQDOSURFHVVDGRSHORVLVWHPDGR
Medidor de Carga til III no sensvel s condies
GHFDUUHJDPHQWR$FDUJDQDOpFDOFXODGDjPHGLGD
que o caminho fora-de-estrada se afasta da p carregadeira de rodas. Variaes nas condies e na
inclinao da via de trfego utilizada pelo caminho
so compensadas pela sistemtica complexa dos
clculos realizados pelo medidor de carga til.
Sensores de presso
Pequenas variaes nos sensores tambm podem
contribuir para erros no clculo da carga til. Cada
um dos sensores de presso apresenta particularidades que os fazem ligeiramente distintos entre si.
As diferenas de preciso de cada sensor em si na
escala que vai de 0 a 4000 lb/pol2 podem acrescer
ou subtrair em relao s medies de carga til. Isto
tambm se aplica aos circuitos de entrada de cada
sensor empregado nos vrios medidores de carga
til. Estas diferenas, em casos extremos, podem
representar at 7% . Esses erros sero sistemtiFRVHUHFRUUHQWHVSDUDFRPELQDo}HVHVSHFtFDVGH
medidores de carga til e sensores utilizados em um
determinado caminho fora-de-estrada.
Flutuaes de carga
2VFiOFXORVGDVXWXDo}HVGHFDUJDSRGHPVHUDIHWDdos pelas condies no ponto em que a caamba do
caminho carregada. Estacionar o caminho contra
uma mureta de acostamento ou contra obstculos
grandes pode levar o medidor de carga til a uma
impreciso no clculo de determinadas flutuaes
de carga. Embora o sistema do Medidor de Carga
til III utilize uma avanada linguagem algortmica de
FiOFXORSDUDDGHWHUPLQDomRGHXWXDo}HVGHFDUJD
as condies no local em que a carga carregada na
caamba podem afetar a preciso.

DADOS DO CICLO DE TRANSPORTE


DA CARGA
O Medidor de Carga til III registra e armazena dados na
memria instantnea instalada na placa de circuito impresso. Esta memria no requer uma bateria separada. Os dados so disponibilizados atravs do software de download.
O Medidor de Carga til III armazena na memria 5208 reJLVWURVGHFDUJD~WLO4XDQGRDPHPyULDFDRFXSDGD
o medidor de carga til apaga os 745 registros de carga til
mais antigos e continua a lanar novos registros na memria.
O Medidor de Carga til III capaz de armazenar na memULDUHJLVWURVGHDODUPH4XDQGRDPHPyULDFDUHSOHWD
de registros, o medidor de carga til apaga os 312 registros
de alarme mais antigos e continua a lanar novos registros
na memria.
Todos os dados so calculados e armazenados na memria
existente no interior do medidor de carga til em unidades
mtricas. Em seguida, feito o download dos dados, que
so armazenados em unidades mtricas dentro do banco de
dados Paradox do PC. O programa de anlise converte as
XQLGDGHVQRIRUPDWRGHWHODVJUiFRVHUHODWyULRV
As unidades lanadas na Tabela 1 representam as unidades
efetivamente armazenadas no banco de dados. O valor
para o tempo de incio do ciclo de transporte de carga o
nmero de segundos de 01/01/1970 ao incio do ciclo de
transporte da carga. Os tempos de todos os demais eventos
so expressos em termos do nmero de segundos desde o
tempo de incio do ciclo de transporte da carga. O programa
de download e anlise desenvolvido para PC converte esses
Q~PHURVHPGDWDVHKRUiULRVSDUDQVGHJHUDomRGHJUicos e relatrios.

Velocidade e distncia
O medidor de carga til recebe o mesmo sinal de velocidade do velocmetro. Este sinal uma freqncia
que representa a velocidade do caminho fora-deestrada. O medidor de carga til utiliza essa freqncia para calcular velocidades e distncias. O medidor
adota um nico valor para o raio de rolagem do pneu.
O raio de rolagem poder variar as velocidades para
cima, j que aumenta quanto maior for a velocidade. O raio
de rolagem efetivo do pneu tambm variar em funo da
caamba do caminho estar carregada ou vazia. O medidor de carga til no compensa essas variaes.
OBS.: Os modelos 730E e 830E anteriores esto
sujeitos a incorreo de dados relativos velocidade
em razo de interferncia eltrica. As velocidades
incorretas so geradas enquanto o caminho est parado. Os novos modelos passaram a ser equipados com
um atenuador para a preveno desse erro. Foi lanado
um kit para dotar os Sistemas de Medidor de Carga til III
do acumulador. Voc poder obter mais detalhes junto ao
representante de servios de sua regio.
M20-14

Medidor de carga til III

M20008 02/10

Dados de Ciclos de Transporte de Carga


As informaes fornecidas a seguir so registradas em cada ciclo de transporte de carga
Tabela 1 : DADOS DE CICLOS DE TRANSPORTE DE CARGA
Dados

Unidade

Observaes

Nmero do caminho

alfanumrico

$WpFDUDFWHUHVSRGHPVHUDUPD]HQDGRVQHVWHFDPSRSDUDDLGHQWLFDomRGRFDPLQKmR1RUPDOPHQWHODQoDVHQHVWH
campo somente o nmero do caminho.

Data/hora de incio do ciclo de


transporte da carga

segundos

Nmero de segundos de 01/01/1970 at o incio do ciclo de transporte da carga. O ciclo de transporte da carga
tem incio quando o medidor transita do estado de descarregamento da caamba para caamba vazia aps o
ciclo de transporte de carga anterior. O programa de download converte os segundos em data e horrio para
exibio na tela do mostrador.

Carga til

toneladas

Armazenada na memria como toneladas mtricas. O programa de download permite a converso para toneladas americanas ou toneladas inglesas

1~PHURGHXWXDo}HVGHFDUJD

nmero

1~PHURGHXWXDo}HVGHFDUJDGHWHFWDGDVSHORPHGLGRUGHFDUJD~WLO

1~PHURGHLGHQWLFDomRGR
operador

nmero

Este um nmero de 4 dgitos que pode ser lanado pelo operador no incio de seu turno de trabalho

Marcas de alerta

alfa

&DGDOHWUDUHSUHVHQWDXPDPHQVDJHPGHDOHUWDHVSHFtFDVREUHRFLFORGHWUDQVSRUWHGHFDUJD3DUDPDLRUHV
detalhes, consulte a pgina 19.

Carga devolvida (retroalimentada)

toneladas

Diferena entre a ltima tara com a caamba vazia e a tara com o caminho limpo

Tempo de transporte com a


caamba vazia

segundos

Nmero de segundos nos estados de zona de tara e caamba vazia com o caminho em movimento

Tempo de parada com a


caamba vazia

segundos

Nmero de segundos nos estados de zona de tara e caamba vazia com o caminho parado

Tempo de carregamento

segundos

Nmero de segundos no estado de carregamento da caamba

Tempo de transporte de carga


com a caamba carregada

segundos

1~PHURGHVHJXQGRVQRVHVWDGRVGHPDQREUD]RQDQDOHFDoDPEDFDUUHJDGDFRPRFDPLQKmRHPPRYLPHQWR

Tempo de parada com a


caamba carregada

segundos

1~PHURGHVHJXQGRVQRVHVWDGRVGHPDQREUD]RQDQDOHFDoDPEDFDUUHJDGDFRPRFDPLQKmRSDUDGR

Tempo de despejo

segundos

Nmero de segundos no estado de descarregamento da caamba

Tempo de incio do carregamento da caamba

segundos

Nmero de segundos do incio do ciclo de transporte de carga a quando o medidor transita do estado de caamba vazia a carregamento da caamba

Tempo de incio do descarregamento da caamba

segundos

Nmero de segundos do incio do ciclo de transporte de carga ao momento em que o medidor passa do estado
de caamba carregada para carregamento da caamba

Distncia de transporte de carga


com a caamba carregada

Distncia percorrida pelo caminho com sua caamba carregada

Distncia de transporte de
carga com a caamba vazia

Distncia percorrida pelo caminho com sua caamba vazia

Velocidade mx. do caminho


com sua caamba carregada

km/h

Velocidade mxima registrada com o caminho com a sua caamba carregada

Tempo da veloc. mx. do


caminho com sua caamba
carregada

segundos

Nmero de segundos do incio do ciclo de transporte de carga ao momento em que a velocidade mxima efetivamente ocorreu

Velocidade mxima com a


caamba vazia

km/h

Velocidade mxima registrada com o caminho com a caamba vazia

Tempo de velocidade mxima


com a caamba vazia

segundos

Nmero de segundos do incio do ciclo de transporte de carga ao momento em que a velocidade mxima efetivamente ocorreu

Pico de torque positivo do chassi

toneladas.
metros

O torque positivo do chassi medido quando o chassi tende a virar no sentido horrio (visto do assento do operador)

Tempo de pico de torque do


chassi

segundos

Nmero de segundos do incio do ciclo de transporte de carga ao pico de torque. O programa de download
converte isso em segundos para exibio na tela do mostrador

Pico de torque negativo do chassi

toneladas.
metros

O torque negativo do chassi medido quando o chassi tende a virar no sentido anti-horrio (visto do assento do
operador)

Tempo do pico de torque do


chassi

segundos

Nmero de segundos do incio do ciclo de transporte de carga ao pico de torque. O programa de download
converte isso em segundos para exibio na tela do mostrador

Pico da carga suportada pelas


suspenses

toneladas

Clculo do pico de carga dinmica

Tempo de pico da carga suportada pelas suspenses

segundos

Nmero de segundos do incio do ciclo de transporte de carga ao clculo do pico instantneo da carga

Relao entre toneladas e km/h


do pneu dianteiro esquerdo

t-km/h

Relao t-km/h do pneu para o ciclo de transporte de carga

Relao entre toneladas e


km/h do pneu dianteiro direito

t-km/h

Relao t-km/h do pneu para o ciclo de transporte de carga

Relao mdia entre toneladas


e km/h dos pneus traseiros

t-km/h

Relao t-km/h dos pneus para o ciclo de transporte de carga

Nmero de srie do chassi

alfa

1~PHURGHVpULHGRFKDVVLGRFDPLQKmRORFDOL]DGRQDSODFDGHLGHQWLFDomRH[LVWHQWHQRFKDVVL

Reservados 1-10

nmero

Estes valores so clculos internos usados no contnuo aprimoramento do sistema do Medidor de Carga til III,
devendo, portanto, ser ignorados

M20008 02/10

Medidor de carga til III

M20-15

Marcas de alerta de ciclo de transporte de carga


O medidor de carga til espera que os ciclos de
transporte de carga progridam de uma determinada
forma. Quando algo imprevisvel acontece, o sistema
registra uma marca de alerta. Diversos eventos compreendidos no ciclo de transporte de carga podem
levar gerao de uma marca de alerta. Cada uma
delas indica uma ocorrncia anormal durante o ciclo
de transporte de carga, no sinalizando necessariamente um problema com o medidor de carga til ou
com o clculo da carga til.
A: Carregamento contnuo
Esta mensagem gerada quando o caminho est
com pelo menos 50% de sua carga mxima sem o
PHGLGRUGHFDUJD~WLOGHWHFWDUXWXDo}HVGHFDUJD
Isto indica que foi usada uma operao de carregamento contnuo para carregar o caminho, podendo
tambm sinalizar que o medidor de carga til no
recebeu a entrada da trava dos freios enquanto o
caminho estava sendo carregado. Pode estar haYHQGRXPSUREOHPDFRPDDomRHOpWULFDRXDWUDYD
dos freios simplesmente no foi usada. O medidor de
FDUJD~WLOQmRPHGLUiXWXDo}HVGHFDUJDDQmRVHU
que a trava dos freios seja usada durante o processo
de carregamento.
B: Transio de carregamento para descarregamento da caamba
Esta mensagem gerada quando o medidor de carga
til detecta uma entrada de corpo da caamba levantado durante o processo de carregamento da caamba. Esta mensagem normalmente acompanhada de
XPDPDUFDGHDXVrQFLDGHFDUJDQDO
&$XVrQFLDGHFDUJDQDO
Esta mensagem gerada quando o medidor de carga
~WLOQmRpFDSD]GHGHWHUPLQDUDFDUJD~WLOQDOQRFDPLQKmR1RUPDOPHQWHLVWRVLJQLFDTXHRPHGLGRUGH
carga til passou do estado de caamba carregada
para o estado de descarregamento da caamba antes que a carga pudesse ser medida com preciso.
D: Transio de manobra para descarregamento
da caamba

carga final. Normalmente, este registro feito quando o


carregamento da caamba tem incio, antes, portanto, de se
calcular com preciso a tara, ou ento a carga descarregada da caamba antes que se possa fazer o clculo preciso
da carga.
)7UDQVLomRGH]RQDQDOSDUDGHVFDUUHJDPHQWRGDFDamba
Esta mensagem gerada quando o medidor de carga til detecta corpo da caamba levantado enquanto est calculando
DFDUJD~WLOQDOVLQDOL]DQGRTXHRRSHUDGRUGHVFDUUHJRX
a carga da caamba. Ela tambm pode ser gerada se o sinal
de corpo da caamba levantado no estiver chegando da
forma esperada ao medidor de carga til e o peso no caminho cai drasticamente enquanto o sistema est calculando
DFDUJD~WLOQDO
H: Falso corpo da caamba levantado
Esta mensagem indica que o corpo da caamba foi levantado durante o ciclo de transporte da carga sem que a carga
tenha sido descarregada da caamba. O sinal de corpo da
caamba levantado sinalizou que o caminho estava descarregando a caamba, mas o peso do caminho no caiu
abaixo de 20% da carga nominal.
I: Interrupo ou ausncia do sinal de corpo da caamba
levantado
Esta mensagem indica que a carga foi descarregada da
caamba sem que o medidor de carga til recebesse o sinal
de corpo da caamba levantado. O peso do caminho caiu
abaixo de 20%, mas o medidor de carga til no recebeu o
sinal de corpo da caamba levantado do sensor.
J: Falha no sensor de velocidade
Esta mensagem indica que o medidor de carga til detectou
o carregamento e o descarregamento da caamba sem ter
recebido um sinal de velocidade.
K: Nova tara no calculada
O medidor de carga til no conseguiu calcular com preciso
um novo peso suportado pelas suspenses do caminho
com a caamba vazia para utilizar como valor de tara para o
ciclo de transporte da carga. O valor da tara do ltimo ciclo
de transporte de carga foi usado para calcular a carga til.
L: Ciclo de transporte da carga incompleto

Esta mensagem gerada quando o medidor de


carga til detecta uma entrada de corpo da caamba
levantado durante o processo de manobra ou reposicionamento, sinalizando que o operador descarregou
a carga transportada na caamba. Ela pode tambm
ser gerada se o sinal de corpo da caamba levantado
no estiver chegando como deveria ao medidor de
carga til e o peso no caminho cai drasticamente
enquanto o caminho encontra-se em processo de
manobra ou reposicionamento.
E: Carga ou tara mdia utilizada
Esta mensagem indica que a carga til registrada
pode no ser to precisa quanto um clculo tpico de
M20-16

O medidor de carga til no possua dados apropriados para


iniciar o ciclo de transporte da carga aps ser ligado. Quando
o Medidor de Carga til III desligado, registra os dados
do ciclo de transporte de carga em andamento na memria.
Esta marca sinaliza que estes dados no foram registrados
na ltima vez em que o medidor de carga til foi desligado.
Isto pode acontecer quando se desconecta a bateria para
parar o caminho, ao invs de fazer isso desligando-se a
chave de partida. Um ciclo de transporte de carga com esta
marca de alerta no pode ser considerado preciso. Ciclos de
transporte de carga com esta marca de alerta so exibidos
em vermelho na janela de resumo de carga til, no fazendo
parte das estatsticas globais para efeito de gerao de relatrios ou visualizao em tela.

Medidor de carga til III

M20008 02/10

M: Ciclo de transporte de carga excessivamente longo


A marca ciclo de transporte de carga excessivamente longo
indica que o ciclo de transporte de carga gastou mais de
KRUDVSDUDVHUQDOL]DGR2VWHPSRVDUPD]HQDGRVQD
memria para dados eventos podem no ser precisos. Isto
no afeta, contudo, o clculo da carga til.
N: Erro de entrada do sensor
Um alarme foi programado para uma das entradas dos 5
sensores fundamentais durante o ciclo de transporte de
carga.
Os cinco sensores fundamentais so os quatro sensores de
presso e o inclinmetro. Sem essas entradas, o medidor
de carga til no pode calcular a carga til. Um ciclo de
transporte de carga com essa marca de alerta no pode ser
considerado preciso. Os ciclos de transporte de carga com
esta marca de alerta so exibidos em vermelho na janela
de resumo de carga til, no sendo levados em conta para
efeito das estatsticas globais para a gerao de relatrios
ou visualizao de dados na tela.
Dados de torque do chassi
O medidor de carga til registra os 5 valores de pico de
torque do chassi positivos e negativos e o momento em que
ocorrem. O torque do chassi uma medio do movimento
torsional ao longo da linha de centro longitudinal do caminho. A medio do torque positivo do chassi feita quando
as foras da suspenso dianteira do caminho atuam para
movimentar torsionalmente o chassi em sentido horrio,
conforme posicionado no assento do operador. A medio
do torque negativo feita quando as foras da suspenso
atuam no sentido oposto.
Por exemplo, quando as presses dianteira esquerda e traseira direita se elevam enquanto as presses dianteira direita e traseira esquerda so reduzidas, o chassi do caminho
experimenta um movimento torsional ao longo da sua linha
de centro longitudinal. Neste caso, o medidor de carga til ir
registrar um torque de chassi positivo.

Dados de peso suportado pelas suspenses do


caminho
O medidor de carga til realiza constantemente a
monitorao ao vivo do clculo da carga til. Este
valor naturalmente sobe e desce em se tratando de
um caminho carregado em funo das condies
da via utilizada para o transporte da carga e do modo
como o caminho dirigido. O medidor de carga til
registra os 5 clculos mais altos da carga til e o
horrio em que eles ocorreram. Esta informao armazenada em uma memria permanente localizada
no interior do medidor.
Dados de velocidade mxima
O medidor de carga til registra as 5 velocidades
mais altas e o horrio em que elas ocorreram. Esta
informao armazenada em uma memria permanente localizada no interior do medidor.
Registros de alarme
O medidor de carga til armazena na memria registros de alarme para que o pessoal da manuteno
tenha um histrico do sistema. Todos os cdigos so
visualizados usando-se o PC conectado ao medidor
de carga til. Os cdigos ativos tambm so exibidos
no mostrador de dois dgitos do prprio medidor.
&DGDFyGLJRWHPXPDFDXGDHVSHFtFDHGHYHOHYDU
a uma investigao com o objetivo de se estabelecer
uma forma de corrigir o problema. Algumas falhas
podem ser solucionadas pelo medidor de carga til.
Os dados do ciclo de transporte de carga apontaro
se uma condio de alarme estava presente durante
o ciclo. Falhas relacionadas com os sensores das
suspenses ou do inclinmetro no podem ser solucionadas pelo medidor de carga til.

Os 5 valores mais altos nos sentidos positivo e negativo so


armazenados permanentemente na memria interna do medidor de carga til.

M20008 02/10

Medidor de carga til III

M20-17

Tabela 2 Tabela 2
Cdigo de falha

M20-18

Nome

Descrio

Presso alta do pneu dianteiro esquerdo

Corrente de entrada > 22 ma

Presso baixa do pneu dianteiro esquerdo

Corrente de entrada < 2 ma

Presso alta do pneu dianteiro direito

Corrente de entrada > 22 ma

Presso baixa do pneu dianteiro direito

Corrente de entrada < 2 ma

Presso baixa dos pneus traseiros


esquerdos

Corrente de entrada > 22 ma

Presso baixa dos pneus traseiros


esquerdos

Corrente de entrada < 2 ma

Presso alta dos pneus traseiros


direitos

Corrente de entrada > 22 ma

Presso baixa dos pneus traseiros


direitos

Corrente de entrada < 2 ma

Inclinmetro alto

Corrente de entrada < 0,565 V c.c.

10

Inclinmetro baixo

Corrente de entrada > 5,08 V c.c.


No usado

11

Falha de entrada da velocidade

12

Falha de entrada da trava do freio

No usado

13

Falha na entrada de corpo da caamba levantado

O medidor de carga til detectou atividade de descarregamento da caamba sem ter recebido um sinal de corpo da caamba levantado

16

Falha de linguagem da memria

Indica um possvel problema na memria quando o medidor ligado.


/LJXHRQRYDPHQWHHYROWHDYHULFDUVHRSUREOHPDSHUVLVWH

17

Falha de leitura da memria

Indica um possvel problema na memria quando o medidor ligado.


/LJXHRQRYDPHQWHHYROWHDYHULFDUVHRSUREOHPDSHUVLVWH

18

Suspenso traseira direita plana

O medidor de carga til detectou a suspenso traseira direita descarregada

19

Suspenso traseira esquerda plana

O medidor de carga til detectou a suspenso traseira esquerda descarregada

20

Alterao de tempo

O tempo do medidor de carga foi alterado em mais de 10 minutos. O tempo


de programao do alarme indica o
tempo original, enquanto apagar o alarme indica o novo tempo

21

Resetamento do valor da tara

Usurio forou manualmente o medidor de carga a retesar o peso do


transporte com a caamba vazia (tara). Isto,
levou o medidor zona de tara e perda de todos os dados referentes
ao ciclo de transporte anterior.

22

Retrocarga excessiva

2PHGLGRUGHFDUJD~WLOGHWHFWRXUHWURFDUJDH[FHVVLYDGHQLGDSHOR
usurio em dois ciclos consecutivos de transporte de carga

26

Falha no uso do interruptor pelo usu- Interruptor seletor ligado por mais de 2 minutos (pode indicar curtorio - SELECT
circuito com o terra)

27

Falha no uso do interruptor pelo usu- Interruptor de programao ligado por mais de 2 minutos (pode indicar curtorio - SET
circuito com o terra)

Medidor de carga til III

M20008 02/10

NOES SOBRE O SOFTWARE PARA PC


Noes sobre o software para PC
O software para PC possui as seguintes funes bsicas:
 &RQJXUDomRGRVLVWHPDGR0HGLGRUGH&DUJDWLO,,,QR
caminho fora-de-estrada.
 'LDJQyVWLFRGHIDOKDVHFKHFDJHPGRVLVWHPDGR0HGLdor de Carga til III
 'RZQORDGGHGDGRVGRVLVWHPDGR0HGLGRUGH&DUJDWLO,,,
 $QiOLVHGRVGDGRVGRVVLVWHPDVGHPHGLomRGDFDUJD~WLO
$FRQJXUDomRRGLDJQyVWLFRGHIDOKDVHRGRZQORDGUHquerem uma conexo serial para o medidor de carga til no
caminho fora-de-estrada. A anlise pode ser feita a qualquer tempo sem que seja necessria uma conexo para o
medidor de carga til.
Os dados da carga til so transferidos por download de
diversos caminhes para um banco de dados no PC.
O banco de dados pode ser acessado para pesquisar toda
a frota, um caminho fora-de-estrada, ou um modelo desse
veculo. Os dados podem ser gerados sob a forma de grFRVRXUHODWyULRVHDLQGDLPSRUWDGRVRXH[SRUWDGRV2
aplicativo de exportao capaz de capturar os dados de
carga til e salv-los em um formato facilmente importvel
por programas processadores de planilha, como o Excel, ou
de texto, como o Word.

Instalao do software do Medidor de Carga til III


O CD ROM contendo o Software de Gerenciamento
dos Dados da Carga til (PDM) comear automaticamente a ser instalado no momento em que for
introduzido no drive do PC. Caso isso no acontea,
o software pode ser instalado rodando-se o programa
Setup.exe existente no CD ROM.
Para rodar o software, o PC dever atender s seJXLQWHVHVSHFLFDo}HVPtQLPDVVHUXP3HQWLXPGH
133 Mhz com memria ram de 64 MB e no mnimo
300 MB de espao livre em seu hard drive. Voc conseguir uma performance melhor se utilizar no PC um
processador Celeron, AMD K6-2 ou superior e memria ram de 128 MB com freqncia de processamento
de 400 Mhz. O Software PDM utiliza um potente
banco de dados para manipular a grande quantidade
de dados colhidos do sistema do Medidor de Carga
til III. O uso de um computador mais potente e com
maior memria para rodar o software poder resultar
HPXPDPHOKRUDVLJQLFDWLYDGDSHUIRUPDQFH2VRItware pode ser melhor visualizado em uma tela com
resoluo mnima de 800 x 600.

&RQJXUDomRGRVLVWHPD
Quando instalado pela primeira vez no caminho fora-deestrada, o Medidor de Carga til III precisa, para que opere,
VHUFRQJXUDGR(VWHSURFHVVRGHPDQGDYiULDVHWDSDVH
utiliza o computador laptop para a realizao das programaes necessrias. O procedimento de setup pode ser
desmembrado nas seguintes etapas:







&RQH[mRGRODSWRSDRVLVWHPDGR0HGLGRUGH&DUJDWLO,,,
$WLYDomRGDUHGHGHFRPXQLFDo}HV
3URJUDPDomRGRKRUiULRHGDGDWD
3URJUDPDomRGRWLSRGHFDPLQKmRIRUDGHHVWUDGD
3URJUDPDomRGRQ~PHURGHLGHQWLFDomRGRFDPLQKmR
fora-de-estrada
3URJUDPDomRGDVXQLGDGHVGHPHGLGDGRYHORFtPHWURH
do mostrador da carga til.

M20008 02/10

Medidor de carga til III

M20-19

DOWNLOAD DE DADOS
O Medidor de Carga til III registra muitos tipos de
dados. O software para PC do Medidor de Carga til
III foi projetado para realizar o download dos dados
de uma frota inteira de caminhes. Ao invs de criar
um arquivo de dados para cada caminho, este software para PC combina todos os dados de muitos
caminhes em um banco de dados no hard drive
do computador. O software possibilita, ento, aos
usurios pesquisar o banco de dados para a gerao
GHUHODWyULRVHJUiFRV2VGDGRVSDUDFDPLQK}HV
especficos ou grupos de caminhes podem ser
facilmente analisados. Estes mesmos dados podem
ser exportados para uso em outros aplicativos do
software, como processadores de texto e aplicativos
de gerao de planilhas.

Roteiro para o download do medidor de carga til:


1. Conecte o medidor de carga til e inicie o software do
PC.
2. Selecione no menu principal a opo de menu Connect
to Payload Meter (conexo ao medidor de carga til). O
PC pedir a informao mais atualizada sobre o estado
do medidor de carga til. O mostrador exibir, ento, o
nmero de ciclcos de transporte de carga e os alarmes.
3. Selecione o boto Begin Download (iniciar o
download).O PC pedir os dados de carga til e alarme
do medidor de carga til, e ir salv-los no banco de
dados. Isto poder levar alguns minutos. Uma barra progressiva na parte inferior mostrar o tempo aproximado
que resta.

medida que o banco de dados cresce, a perforPDQFHGRVRIWZDUHSDUD3&SDUDQVGHDQiOLVHYDL


caindo. Uma dica que pode ser til exportar periodicamente dados. Por exemplo, pesquise o banco de
dados para saber a quinzena, ms ou semestre mais
antigo e imprima um relatrio resumido. Ento, exporte os dados para um formato compactado e salve
o arquivo em um local seguro. Uma vez exportados
os dados, delete todos os resultados da pesquisa do
banco de dados. Se necessrio, voc poder reimportar facilmente os dados no banco de dados principal
SDUDQVGHDQiOLVHHPXPDRFDVLmRIXWXUD$UHPRomR
desses dados mais antigos aumentar a performance.

O software para PC faz o download dos dados do


medidor de carga til para um nico banco de dados Paradox. Os dados de todos os caminhes so
acrescidos ao mesmo banco de dados. O download
do medidor de carga til pode levar alguns minutos.
Os dados so acrescidos ao banco de dados do laptop utilizado para o download.
Para transferir os dados para um outro computador,
necessrio fazer uma pesquisa para isolar os dados que sero efetivamente exportados. Enquanto
estiver sendo realizado um download, no pressione
o interruptor do operador localizado no painel de
instrumentos.

M20-20

Medidor de carga til III

M20008 02/10

CONFIGURAO DO SISTEMA DO MEDIDOR DE CARGA TIL III

Toneladas Americanas: A carga til exibida em


toneladas americanas, ao passo que as distncias e
velocidades em milhas.

Iniciando as comunicaes
O software PDM permite aos usurios fazer download e conJXUDomRGRVLVWHPD

Toneladas Mtricas: A carga til exibida em toneladas mtricas, ao passo que as distncias e velocidades em quilmetros.
Toneladas Inglesas: A carga til exibida em toneladas inglesas, ao passo que as distncias e velocidades em milhas.
Unidades de tempo
Exemplo em minutos e segundos:
Cinco minutos e trinta e dois segundos = 5:32
Exemplo em dcimos de minuto:
Cinco minutos e trinta e dois segundos = 5.53
Menu de conexes

Antes de conectar ao medidor de carga til, selecione Change Program Options (mudar as opes do programa), e
FRQUPHVHRSURJUDPDVHOHFLRQRXRSyUWLFRVHULDOFRUUHWR
de laptop. A maior parte dos laptops utiliza a porta Comm 1
para comunicaes seriais. As unidades exibidas no mostraGRUSDUDJHUDomRGHUHODWyULRVHJUiFRVSHORVRIWZDUHSDUD
PC podem ser programadas neste formato. Para retornar ao
menu principal, clique em Done (concludo).

A partir do menu principal, clique no boto Connect to Payload Meter (conecte ao medidor de carga til). O PC tentar
a conexo ao medidor de carga til e pedir as informaes
bsicas do sistema.Caso haja problema na interface de comunicao, o PC tentar estabelecer por 3 vezes a conexo
DQWHVGHFHVVDUGHQLWLYDPHQWHDVWHQWDWLYDV,VWRSRGHUi
levar alguns segundos.
Unidades de carga til exibidas no mostrador
H 3 opes disponveis para a exibio de unidades no sofWZDUHGR3&DVVLPFRPRHPUHODWyULRVHJUiFRV

M20008 02/10

A tela de conexes exibe ao usurio as informaes


bsicas do sistema.
 2Q~PHURGHVpULHGRFKDVVLGHYHEDWHUFRPR
nmero de srie do caminho fora-de-estrada
estampado na placa do nmero de srie localizada no chassi do caminho.
 2Q~PHURGRFDPLQKmRIRUDGHHVWUDGDpXP
Q~PHURGHLGHQWLFDomRDWULEXtGRDRFDPLQKmR
fora-de-estrada pela mineradora. Os dados de
data e horrio do medidor de carga til provm
do medidor de carga til no instante da conexo.
 2Q~PHURGHUHJLVWURVGHFLFORVGHWUDQVSRUWH
de carga o nmero de registros de ciclos de
transporte de carga armazenados na memria e
disponveis para download.
 2 Q~PHUR GH DODUPHV DWLYRV LQGLFD TXDQWRV
alarmes encontram-se ativos no sistema quando
a conexo estabelecida. Caso haja alarmes
ativos, possvel acessar o boto Display Active
Alarms (mostrar os alarmes ativos).
 2Q~PHURGHDODUPHVLQDWLYRVUHYHODTXDQWRV
alarmes foram armazenados na memria e esto
disponveis para download.
 $YHUVmRGRVRIWZDUH3&0PRVWUDDYHUVmRDWXDO
do software empregado no medidor da carga til.
As informaes a respeito do menu de conexes adYrPGDFRQJXUDomRGRVLVWHPDGRPHGLGRUGHFDUJD
til existente em seu caminho fora-de-estrada.

Medidor de carga til III

M20-21

+iDLQGDPXLWDVRSo}HVGHFRQJXUDomRHGRZQORDG
disponveis nessa tela. O menu de conexes atualizado apenas quando a conexo estabelecida pela
SULPHLUDYH]3DUDYLVXDOL]DUDVPRGLFDo}HVIHLWDV
com a conexo estabelecida, o usurio deve fechar a
janela e reconectar ao medidor de carga til.
O menu de conexes exibido aps uma conexo
serial ter sido estabelecida e o software para PC ter
sido conectado ao medidor de carga til.

Programao da data e da hora

A hora que aparece acima aquela transmitida do medidor


de carga til quando a conexo foi estabelecida pela primeira vez.

Conexo com o medidor de carga til


A rede de comunicaes com o Medidor de Carga til
III requer um computador laptop que rode o software
PDM. A conexo do software com o medidor de carga til feita atravs do prtico serial do medidor n
1. Este o mesmo prtico utilizado pelo mostrador
da velocidade e da carga til. Quando o laptop est
usando o prtico serial, a tela de baixo do visor do
operador localizado no painel monitor apagar. Isto
no afeta o desempenho do velocmetro.


&RQHFWHRODSWRSDRVLVWHPDXVDQGRRFKLFRWHGH
comunicao EF9160. O conector para download
tipicamente est localizado na carcaa instalada
na parede traseira da cabina. O sistema do Medidor de Carga til III utiliza a mesma conexo que
o sistema
do Medidor de Carga til 2.

&RQJXUDomRGRPHGLGRUGHFDUJD~WLO
$FRQJXUDomRGRPHGLGRUGHFDUJD~WLOUHTXHUXPD
conexo serial com o sistema do Medidor de Carga
WLO,,,&OLFDQGRQRERWmR&RQJXUH3D\ORDG0HWHU
FRQJXUDomRGRPHGLGRUGHFDUJD~WLO YRFrDFHVVD
DWHODHRPHQXGDFRQJXUDomRGHVHXFDPLQKmR
fora-de-estrada. Esta tela exibe as configuraes
mais atualizadas armazenadas na memria do medidor de carga til.
4XDQGRDVFRQJXUDo}HVIRUHPDOWHUDGDVRERWmR
Save Changes (salvar alteraes) dever ser pressionado para salvar as alteraes no medidor de
FDUJD~WLO3DUDFRQUPDUDVDOWHUDo}HVVDLDSDUDR
menu principal e faa uma nova conexo com o medidor da carga til.

A data e a hora so mantidas por um chip especial existente


na placa de circuito impresso do Medidor de Carga til III. A
memria para esse chip mantida por um capacitor muito
grande quando cessa a alimentao eltrica do medidor
de carga til. Esses componentes conseguem manter as
programaes de data e hora por aproximadamente 30
dias. Decorrido esse tempo, o medidor de carga til poder
perder a data e a hora programadas. recomendvel que o
VLVWHPDUHFHEDDOLPHQWDomRHOpWULFDDFDGDGLDVDPGH
que a data e a hora sejam mantidas. Se voc perder a data
e a hora, simplesmente resete as informaes usando este
procedimento. A rercarga do capacitor consome aproximadamente 90 minutos.
A mudana da data e da hora ir afetar o ciclo de transporte
de carga em andamento, e poder levar a resultados imprevistos em relao s informaes estatsticas para um
determinado ciclo de transporte de carga.
Roteiro para mudar a hora:
1. Clique sobre o dgito que precisa ser alterado.
2. Use as setas para cima/para baixo para alterar ou digitar
o valor correto.
3. Pressione o boto Save Changes (salvar alteraes)
para salvar a nova hora no medidor de carga til.
Roteiro para mudar a data:
1. Clique sobre o dgito que precisa ser alterado.
2. Digite o valor correto ou use o calendrio para selecionar uma data.
3. Pressione o boto Save Changes (salvar alteraes)
para salvar a nova hora no medidor de carga til.

M20-22

Medidor de carga til III

M20008 02/10

Programao do tipo do caminho fora-de-estrada

 $SDUWLUGDWHODGHFRQJXUDo}HVGRFDPLQKmRXVHD
barra de rolagem do menu para selecionar o tipo de caminho fora-de-estrada no qual o medidor de carga til
est instalado.
2. Pressione o boto Save Changes (salvar alteraes)
para programar a alterao no medidor.
Programao das unidades de medida exibidas no mostrador
O mostrador da velocidade e da carga til do medidor de
carga til exibe, na tela do alto, a velocidade. As unidades
de medida em que a velocidade ser exibida na tela do
mostrador so selecionadas utilizando-se uma ligao direta
localizada atrs da carcaa.
possvel passar as unidades de medida de carga til exibidas na tela de baixo do mostrador de toneladas mtricas
para toneladas americanas ou toneladas inglesas usando a
WHODGHFRQJXUDo}HVGRFDPLQKmRIRUDGHHVWUDGD$H[Lbio em tempo real das informaes da presso tambm
pode ser programada tanto em unidade do Sistema Mtrico
Internacional (kg/cm2), como em unidade do Sistema Britnico (lb/pol2).
1. partir da tela de configuraes do caminho fora-deestrada, selecione as unidades de medida de carga
til a serem usadas no visor de baixo do mostrador de
velocidade e carga til.
2. Pressione o boto Save Changes (salvar alteraes)
para programar essa alterao no medidor de carga til.
Programao do nmero de srie do chassi

Programao do nmero do caminho


A maior parte das operaes de minerao atribui um
Q~PHURDFDGDXPDGDVSDUWHVGRHTXLSDPHQWRDP
GHSRVVLELOLWDUXPDUiSLGDLGHQWLFDomR(VWHQ~PHUR
ou nome pode ser lanado no campo do nmero do
caminho. muito importante lanar um nmero de
caminho exclusivo para cada caminho que utilize
o sistema de Medidor de Carga til III. Este nmero
uma das informaes chaves usadas no banco de
dados do ciclo de transporte de carga. O campo comporta 20 caracteres alfanumricos.
 1DWHODGHFRQJXUDo}HVGRFDPLQKmRHQWUHFRP
o nmero do caminho no campo apropriado.
2. Pressione o boto Save Changes (salvar alteraes)
para programar a alterao no medidor de carga til.
Programao do Distribuidor Komatsu
Este campo no registro de ciclos de transporte de carga pode comportar o nome do Distribuidor Komatsu
que auxiliou na implantao do sistema. A Komatsu
tambm atribui um nmero de distribuidor a cada um
de seus distribuidores. Este nmero de seu Distribuidor Komatsu tambm pode ser lanado nesse campo. O campo comporta 20 caracteres alfanumricos.
 1DWHODGHFRQJXUDo}HVGRFDPLQKmRLQIRUPH
no campo apropriado, o nome ou o nmero de
seu distribuidor.
2. Pressione o boto Save Changes (salvar alteraes)
para programar a alterao no medidor de carga til.
Programao do cliente Komatsu
Este campo no registro de ciclo de transporte de
carga pode comportar o nome da mineradora ou
operao onde o caminho fora-de-estrada esteja
trabalhando. A Komatsu atribui um nmero de cliente
para cada cliente Komatsu. Este nmero usado ainda em todas as reclamaes de garantia. O nmero
do cliente Komatsu tambm pode ser lanado nesse
campo, que comporta 20 caracteres alfanumricos.
1.

2Q~PHURGHVpULHGRFKDVVLHVWiORFDOL]DGRQDSODFD[DGD
QRFKDVVLGHVHXFDPLQKmRIRUDGHHVWUDGDTXHFDYROWDGD
de frente para o pneu dianteiro direito. muito importante
entrar com o nmero de srie correto do chassi. Este nmero
uma das informaes chaves utilizada dentro do banco de
dados do ciclo de transporte de carga. O campo comporta 20
caracteres alfanumricos.

Na tela de configuraes do caminho, informe o


nome ou o nmero do cliente no campo apropriado.
2. Pressione o boto Save Changes (salvar alteraes)
para programar a alterao no medidor de carga til.

1. Na tela de configuraes do caminho, informe, no


campo apropriado, o nmero de srie do chassi de seu
caminho fora-de-estrada.
2. Pressione o boto Save Changes (salvar alteraes)
para programar a alterao no medidor de carga til.
M20008 02/10

Medidor de carga til III

M20-23

Tara do caminho limpo

Calibrao do inclinmetro

O medidor de carga til utiliza o valor da tara do


caminho limpo para calcular a carga devolvida
caamba do caminho para cada ciclo de transporte
de carga. A carga devolvida caamba do caminho
armazenada no registro de ciclo de transporte de carga a nova tara com a caamba vazia menos a tara
do caminho limpo.
Este procedimento deve ser executado sempre que
as suspenses passarem por manuteno ou quando
IRUHPSURPRYLGDVDOWHUDo}HVVLJQLFDWLYDVQRSHVR
suportado pelas suspenses do caminho. Antes de
SDVVDUDHVWHSURFHGLPHQWRFHUWLTXHVHGHTXHDV
suspenses encontram-se devidamente abastecidas
de leo e carregadas. Para a medio da carga til,
essencial que o leo esteja na altura correta, e que a
SUHVVmRGRJiVHVWHMDGHQWURGRYDORUHVSHFLFDGR
Uma vez iniciado o processo de determinao da tara
do caminho limpo, o medidor da carga til passar
a calcular o peso suportado pelas suspenses do
caminho com a caamba do mesmo vazia. Este
clculo prossegue enquanto o caminho segue para
o prximo ponto de carregamento de sua caamba.
Comeado o processo, no h sentido em prosseguir
a monitorao do processo com o PC. O caminho
no precisa estar em movimento para iniciar este
procedimento.
1. Aps limpar a sujeira e os detritos do caminho e
FRQUPDU
VH D PDQXWHQomR GDV VXVSHQV}HV HVWi
FRQUPDUVHDPDQXWHQomRGDVVXVSHQV}HVHVWi
em dia, use o software do Medidor de Carga til
III para a conexo com o medidor de carga til.
 3DUWLQGR
GD WHOD GH FRQJXUDo}HV GR FDPLQKmR VHOH3DUWLQGRGDWHODGHFRQJXUDo}HVGRFDPLQKmRVHOHcione Clean Truck Tare (tara do caminho limpo).
3. Siga risca as instrues fornecidas na tela.

M20-24

O procedimento de calibrao do inclinmetro tem por objetivo compensar variaes na altura de montagem do inclinmetro. A entrada do inclinmetro essencial para o clculo
da carga til.
Este procedimento deve ser realizado em um terreno relativamente plano. Freqentemente, a rea onde realizada a
manuteno um local ideal para a execuo deste procedimento.
1. Aps limpar a sujeira e os detritos do caminho e certiFDUVH GH TXH D PDQXWHQomR GDV VXVSHQV}HV HVWi HP
FDUVHGHTXHDPDQXWHQomRGDVVXVSHQV}HVHVWiHP
dia, use o software do Medidor de Carga til III para a
conexo com o medidor de carga til.
3DUWLQGRGDWHODGHFRQJXUDo}HVGRFDPLQKmRVHOHFLR 3DUWLQGR
GD WHOD GH FRQJXUDo}HV GR FDPLQKmR VHOHFLRne a opo Inclinometer (inclinmetro).
3. Com o caminho parado e a trava dos freios aplicada,
pressione o boto de partida. Esse comando envia ao
medidor de carga til uma instruo para varrer uma vez
o inclinmetro.
4. D uma andada com o caminho, estacionando-o na
mesma posio em que se encontrava, s que, desta
vez, voltado para a direo oposta.
5. Com o caminho parado e a trava dos freios aplicada,
pressione o boto de partida. Esse comando envia ao
medidor de carga til uma nova instruo para voltar
a varrer o inclinmetro. O medidor de carga til far a
mdia dos dois valores amostrativos para determinar o
deslocamento mdio.
6. Siga risca as instrues fornecidas na tela.

Medidor de carga til III

M20008 02/10

Anlise dos Dados

Formulrio de resumo dos dados de carga til


Hora:
&ODVVLFDRVGDGRV
dentro de uma hora do dia
compreendida dentro da
gama de horrios que vai
das 8:00 hs s 17:00hs

Data :
&ODVVLFDRVGDGRV
dentro de uma gama de
datas(ex.: 01/12/2000 a
31/12/2000)

Tipo do Camnho:
&ODVVLFDRVGGRVSHOR7LSR
do Caminho(ex.:930E
ou830E)

Nmero doCaminho:
&ODVVLFDRVGDGRVSHORQ~mero unitrio do Caminho
(ex.:347)
Resumo dos dados de
carga til: Resumo das
anlises estatsticas das
cargas teis pesquisadas

Pesquisa no banco de
dados e exibio na tela
do mostrador:
&ODVVLFDRVGDGRVSHODVRSes de pesquisa selcionads
( unidade,tipo, data, hora) e
exibe os resultados na tela
do mostrador

Opes de Sada
Usado para gerar relatrios,
JUiFRVHGDGRVHVSHFFRVD
partir da pesquisa solicitada

Resumo dos tempos de


ciclos:
Resumo dos tempos de
ciclos levantados na pequisa
selecionada

Registros dos ciclos de transporte de carga:


Visualizao resumida dos registros de ciclos de transportes de carga levantados na pesquisa selecionada. Clique duas vezes para visualizar os detalhes de cada registro de ciclo de transporte de carga. Os
ciclos de transportes de carga dentro da rea vermelha no esto includos nas estatsticas do resumo.

As ferramentas de anlise de dados permitem que o usurio monitore a performance dos sistemas de medidores de
carga til utilizados ao longo de toda a frota. A anlise tem
incio quando o boto View Payload Data (visualizao dos
dados de carga til) pressionado, o que inicia uma pesquisa no banco de dados de todos os caminhes, em todas as
datas e horas, sendo os resultados exibidos no formulrio
resumido de cargas teis.
O usurio pode mudar o objeto da pesquisa mudando as
datas, horas ou caminhes que sero includos na pesquisa
que deseja visualizar no mostrador.
Os ciclos de transporte de carga na caixa de dados da parte
inferior podem ser clicados duas vezes para que o mostrador
exiba os resultados detalhados daquele ciclo de transporte
GHFDUJDHVSHFtFR
Criando uma pesquisa
O programa deixa de exibir todos os caminhes, tipos, datas
e horas para a pesquisa inicial. O contedo exibido na tela
pode ser sintetizado selecionando-se que caminhes ou tipos voc deseja visualizar na tela, ou, tambm, restringindoVHRXQLYHUVRGHSHVTXLVDDGDWDVHKRUiULRVHVSHFtFRV

&ODVVLFDomRSHORQ~PHURXQLWiULRGRFDPLQKmR
O nmero unitrio do caminho o nmero unitrio
do caminho lanado no medidor de carga til no moPHQWRGHVXDFRQJXUDomRQDLQVWDODomR$SHVTXLVD
pode ser programada para buscar todos os camiQK}HVRXXPQ~PHURGHFDPLQKmRHVSHFtFR4XDQdo o programa comea a rodar, procura no banco de
dados todos os nmeros exclusivos de caminhes e
gera uma lista para seleo.
$HVFROKDGHXPQ~PHURGHFDPLQKmRHVSHFtFROLPLtar os dados nos mostradores, resumos e relatrios
a um caminho selecionado. Para gerar relatrios
para o caminho nmero 374, selecione 374 na barra
de rolagem do menu e clique no boto Query Database and Display (pesquisar no banco de dados e
mostrar na tela).
&ODVVLFDomRSHORWLSRGHFDPLQKmR
O tipo de caminho corresponde ao seu porte dentro
da famlia de caminhes Komatsu. Isto permite ao
usurio uma rpida visualizao dos resultados de
diferentes tipos de caminhes de sua propriedade.
Por exemplo, possvel gerar um relatrio separado
para caminhes fora-de-estrada 830E e 930E.

Os itens da pesquisa so adicionados na condio AND


(E). Se o usurio selecionar um nmero de caminho e
XPDJDPDGHGDWDVDSHVTXLVDFODVVLFDUiRVGDGRVSDUD
aquele nmero de caminho e gama de datas.

M20008 02/10

Medidor de carga til III

M20-25

&ODVVLFDomRSRUJDPDGHGDWDV

2. Mude a data From para 05/01/2000.

A pesquisa inicia-se em 1995 e segue at a data atual


QR3&3DUDUHVWULQJLUDJDPDDXPDGDWDHVSHFtFD
mude as datas From (de) e To (a). Por exemplo,
para visualizar os relatrios de ciclos de transporte
de carga do caminho 374 para o ms de julho de
2000:
1. Selecione 374 na barra de rolagem do menu de
caminhes.
3. Mude a data To para 08/01/2000.
4. Mude a hora From para 06:00 h.
5. Mude a hora To para 18:00 h.

6.

Pressione Query Database and Display (pesquisar o banco de dados e exibir na tela) para visualizar os resultados

Esta pesquisa mostrar os ciclos de transporte de carga de


05/01 a 08/01, no horrio compreendido entre 6:00 h e 18:00 h.

2. Mude a data From para 01/07/2000.

Date
Time

JJan 5, 2000

Jan 6, 2000

Jan 7, 2000

an 8, 2000

Jan 9, 2000

0:00

6:00

3. Mude a data To para 31/07/2000.


4. Pressione Query Database and Display (pesquisa no banco de dados e visualizao) para
visualizar os resultados.
&ODVVLFDomRSRUJDPDGHKRUiULRV
A gama de horrios seleciona os horrios do dia
dentro de datas vlidas. Programando-se a gama de
horrios entre 6:00 h e 18:00 h, voc restringir as
FDUJDV~WHLVH[LELGDVQRPRVWUDGRUjVFDUJDVYHULFDdas dentro desse intervalo para cada dia da gama de
datas abrangidas. As horas so lanadas no formato
24:00 h. Para visualizar os relatrios dos ciclos de
transporte de carga desde o primeiro turno de trabalho do caminho 374 entre 05/01/2000 e 08/01/2000,
proceda da seguinte maneira:
1. Selecione o caminho 374 na barra de rolagem
do menu de caminhes.

M20-26

12:00

18:00

24:00
Query : Date: 1/5/00 to 1/8/00
Daily Shift Time: 6:00 to 18:00

Haul Cycles Included in the Query

Os tempos de turno selecionados podem estender a pesquisa retroativa data original. Se voc programou a pesquisa
para varrer as datas de 05/01 a 08/01 e a pesquisa de horrios foi reprogramada para abranger os turnos do perodo
das 18:00 h s 06:00 h, os resultados se estenderiam
manh do dia 09. Isto poder ser observado no exemplo
fornecido a seguir:

Medidor de carga til III

M20008 02/10

Gerao de relatrios

Date
Time

JJan 5, 2000

Jan 6, 2000

Jan 7, 2000

an 8, 2000

Jan 9, 2000

0:00

possvel gerar relatrios e visualiz-los na tela ou


imprimi-los. Estes relatrios so gerados no boto de
pesquisa da tela de resumo de carga til. Por exemSORQDFODVVLFDomRSRUKRUiULRRUHODWyULRLPSUHVVR
iria conter dados do caminho 374 durante o ms de
julho de 2000, no horrio compreendido entre 08:00
h e 17:00 h.

6:00

12:00

Antes de imprimir um relatrio, importante selecionar criteriosamente os dados que faro parte do
universo de pesquisa e pressionar o boto Query
Database & Display (pesquisar o banco de dados e
mostrar na tela).

18:00

24:00
Query :D ate: 1/5/00 to 1/8/00
Daily Shift Time: 18:00 to 6:00

Haul Cycles Included in the Query

Tela de visualizao de detalhes de carga til


A tela de visualizao de detalhes de carga til fornece os
detalhes a respeito de cada um dos ciclos de transporte de
carga. Na tela Payload Summary (resumo de carga til),
clique duas vezes em qualquer ciclo de transporte de carga
para visualizar os detalhes sobre o mesmo.

M20008 02/10

Medidor de carga til III

M20-27

OBS.: Alguns ciclos de transporte de carga podero


conter a marca de alerta de entrada de sensor. Isto
indica que um dos quatro sensores de presso do
inclinmetro no estava funcionando corretamente
durante o ciclo de transporte de carga em questo.
Os ciclos de transporte de carga com esta marca de
alerta so exibidos em vermelho na janela de resumo
de carga til, no estando includos nas estatsticas
globais para efeito de gerao de relatrios ou visualizao na tela.

Payload Summary Report


Report Date: April 11, 2001
Query used for summary:
Truck Number: ALL
Truck Type: ALL

Dates: 2/10/00 to 2/19/01


Daily Shift Time: 00:00 to 24:00

Resumo - relatrio de uma pgina


Um resumo dos dados pesquisados pode ser impresso em uma nica pgina. Os dados de ciclos so
apresentados resumidamente nessa mesma pgina.
Na tela aparecero as velocidades, os tempos de
ciclo, as estatsticas de cargas, alm de dados sobre
o chassi e os pneus.
Informativo detalhado - relatrio com mltiplas
pginas
O relatrio detalhado comea pelo relatrio resumido
e prossegue com vrias pginas contendo dados referentes a cada um dos ciclos de transporte de carga.
No relatrio detalhado vm impressos a data, a hora,
a carga til, os tempos de ciclo, as distncias de ciclo,
DVYHORFLGDGHVHRQ~PHURGHXWXDo}HVGHFDUJD

Payload Detail Report


Report Date: October 17, 2000
Query used for summary:
Truck Number: ALL
Truck Type: ALL
Dates: 8/28/00 to 10/3/00
Daily Shift Time: 00:00 to 24:00

M20-28

Medidor de carga til III

Page 1

M20008 02/10

*HUDomRGHJUiFRV

Exportao de dados

O VRIWZDUHGR0HGLGRUGH&DUJDWLO,,,SRGHJHUDUJUiFRV

que trazem um rpido resumo dos dados de carga til. Estes


JUiFRVSRGHPVHUSHUVRQDOL]DGRVSDUDLPSUHVVmR$VVLP
FRPRRVUHODWyULRVRVJUiFRVVmRJHUDGRVDSDUWLUGDSHVquisa exibida na tela de resumo de carga til. Analisando-se
RH[HPSORGDGRGHFODVVLFDomRSRUJDPDGHKRUiULRRJUiFRLPSUHVVRFRQWHULDXQLFDPHQWHGDGRVGRFDPLQKmR
durante o ms de julho de 2000, no horrio compreendido
entre 08:00 h e 17:00 h.
$QWHVGHJHUDUXPJUiFRYRFrGHYHVHOHFLRQDUFULWHULRVDmente os dados levantados pela pesquisa e pressionar o
boto Query Database & Display (pesquisar o banco de
dados e exibir na tela).
1. A partir da tela de resumo de carga til, selecioQHRERWmR*UDSK JUiFR HPVXDSDUWHLQIHULRU
Aparecer a tela de setup do histograma.

Os dados do banco de dados podem ser exportados


para uso com outros aplicativos de software. Os dados so selecionados da pesquisa que aparece no
momento na tela. Os dados exportados podem ser
armazenados em um arquivo com extenso .CSV
ou um arquivo compactado com extenso .zip.



2IRUPDWR&69SHUPLWHDIiFLOLPSRUWDomRGHGDGRV
para aplicativos de planilhas e editores de texto.
2IRUPDWR=LSSHUPLWHDWUDQVIHUrQFLDGHGDGRV
de um computador para o banco de dados do
software PDM de outro computador. Este recurso
oferece uma forma compactada de transferncia
de dados de um computador para outro.

Exportao do CSV

2. Informe o Lowest Value (valor mais baixo), ou seja a


PHQRUFDUJD~WLOQRJUiFR4XDOTXHUFDUJD~WLOLQIHULRUD
esse valor ser somada na primeira barra.
3. Informe o Highest Value (valor mais alto), isto o maior
YDORUQRJUiFR&DUJDV~WHLVDFLPDGHVVHYDORUVHUmR
somadas na ltima barra.
4. Entre com a Incremental Change (alterao incremental), que determinar o nmero de barras e a distncia
entre elas. O programa limita o nmero de barras a 20.
,VWRSHUPLWHTXHRVJUiFRVVHMDPHQTXDGUDGRVQDWHOD
e caibam em uma pgina de impresso.
 3UHVVLRQHRERWmR&UHDWH*UDSK JHUDUJUiFR 

A sigla CSV significa Valor Separado Por Vrgula.


Este um formato de arquivo de texto ASCII que
permite a arquivos de gerao de planilhas, como o
Excel e o Lotus 123, importar facilmente dados.Para
exportar os dados para um arquivo com extenso
.csv, pressione o boto Export (exportar) na parte
de baixo da tela de resumo de carga til e selecione
To CSV (para o CSV). O programa pedir um nome
de arquivo e a localizao desse arquivo.

$SDUHFHUiQDWHODXPJUiFREDVHDGRQDSHVTXLVDSURJUDPDGDQDWHODGHUHVXPRGHFDUJD~WLO2JUiFRSRGH
ento, ser personalizado e impresso.

M20008 02/10

Medidor de carga til III

M20-29




5HVervados 1-5, 7-10:. Esses valores so clculos internos usados no contnuo aprimoramento do Medidor de
Carga til III, devendo, portanto, ser ignorados
5HVHUYDGR(VVHYDORUUHSUHVHQWDDFDUJD~WLOHVWLPDGD
no ponto em que est a p carregadeira de rodas imediatamente antes do caminho comear a se mover.

Dois grupos de dados so exportados. No alto da


WHODFDPRVGDGRVGHFLFORGHWUDQVSRUWHGHFDUJD
ao passo que nas colunas esto, da esquerda para
direita, os seguintes dados:


































1~PHURGRFDPLQKmR
'DWDGHLQtFLRGRFLFORGHWUDQVSRUWHGHFDUJD
+RUDGHLQtFLRGRFLFORGHWUDQVSRUWHGHFDUJD
&DUJD~WLO
)OXWXDo}HVGHFDUJD
1~PHURGHLGHQWLFDomRGRRSHUDGRU
0DUFDVGHDOHUWD
&DUJDUHWURDOLPHQWDGD GHYROYLGD
7HPSRWRWDOGRFLFORGHWUDQVSRUWHGHFDUJD
7HPSRGHIXQFLRQDPHQWRGRFDPLQKmRFRPVXD
caamba vazia
7HPSRGHSDUDGDFRPDFDoDPEDYD]LD
7HPSRGHFDUUHJDPHQWR
7HPSRGHIXQFLRQDPHQWRGRFDPLQKmRFRPVXD
caamba carregada
7HPSRGHSDUDGDFRPDFDoDPEDFDUUHJDGD
7HPSRGHGHVFDUUHJDPHQWRGDFDoDPED
7HPSRGHLQtFLRGRFDUUHJDPHQWR
7HPSRGHLQtFLRGRGHVFDUUHJDPHQWRGDFDoDPED
'LVWkQFLDSHUFRUULGDQRWUDQVSRUWHGHFDUJDFRP
a caamba carregada
'LVWkQFLDSHUFRUULGDQRWUDQVSRUWHGHFDUJDFRP
a caamba vazia
9HORFLGDGHPi[LPDGRFDPLQKmRFRPVXDFDamba carregada
0RPHQWRHPTXHDYHORFLGDGHPi[LPDGRFDPLnho com sua caamba carregada ocorreu
9HORFLGDGHPi[LPDGRFDPLQKmRFRPVXDFDamba vazia
0RPHQWRHPTXHDYHORFLGDGHPi[LPDGRFDPLnho com sua caamba carregada ocorreu
7RUTXHPi[LPRWRUTXHGRFKDVVL
0RPHQWRHPTXHRWRUTXHPi[LPRRWRUTXHGR
chassi ocorreu
7RUTXHPi[LPRWRUTXHGRFKDVVL
0RPHQWRHPTXHRWRUTXHPi[LPRWRUTXHGR
chassi ocorreu
&iOFXORGRSHVRPi[LPRVXSRUWDGRSHODVVXVpenses do caminho
0RPHQWRHPTXHRFiOFXORGRSHVRPi[LPRVXportado pelas suspenses do caminho ocorreu
NPKGRSQHXGLDQWHLURHVTXHUGR
NPKGRSQHXGLDQWHLURGLUHLWR
NPKPpGLRGRVSQHXVWUDVHLURV
1~PHURGHVpULHGRFKDVVL

M20-30

A segunda srie de dados abaixo dos dados referentes a


ciclo de transporte de carga so os alarmes. As colunas de
alarmes, da esquerda para a direita, so:







2WLSRGRDODUPH
$GDWDHPTXHRDODUPHIRLSURJUDPDGR
$KRUDHPTXHRDODUPHIRLSURJUDPDGR
'HVFULomRGRDODUPH
$KRUDHPTXHRDODUPHIRLDSDJDGRGDPHPyULD
$GDWDHPTXHRDODUPHIRLDSDJDGRQDPHPyULD

Compactao

Esta funo de exportao permite a transferncia de dados


de um laptop para outro computador. Este recurso pode ser
particularmente til quando um laptop em servio estiver
sendo usado para o download de diversas mquinas e transIHUrQFLDGRVGDGRVSDUDXPFRPSXWDGRUFHQWUDODPGHTXH
sejam submetidos a uma anlise. Pode ser usado ainda para
copiar dados de transporte de carga de um determinado caminho em um disquete para anlise.
O formato do arquivo uma verso binria compactada da pesquisa que aparece na tela. A importao do arquivo por outro
computador somente possvel rodando-se o software PDM.

Medidor de carga til III

M20008 02/10

Procedimento para exportao de dados no formato ZIP:

Deletando registros de ciclos de transporte de carga

 &RQUPHVHRVGDGRVH[LELGRVQDWHODFRUUHVSRQGHP
aos dados levantados na pesquisa que precisam efetivamente ser exportados.
2. A partir da tela de resumo de carga til, pressione o boto
EXPORT (exportao) e selecione To ZIP (para ZIP)
3 O programa pedir um nome e localizao de arquivo.

Para deletar registros de ciclos de transporte de


carga do banco de dados principal, pressione o boto Delete localizado na parte inferior da tela de
resumo de carga til. O programa exibir um resumo
dos registros da pesquisa solicitada.Para deletar um
registro, selecione um por vez e pressione o boto
Delete. Recomendamos que os registros sejam
exportados para um arquivo em zip para que seja
criado um backup antes do deletamento propriamente dito. Pressionando o curso, voc pode selecionar
mltiplos registros. Pressionando o boto Delete All
(deletar tudo), voc selecionar todos os registros da
pesquisa em questo e ir delet-los.

Importao de dados
Esta funo de importao permite a transferncia de dados
de um laptop para outro computador. Este recurso pode ser
de grande utilidade quando um laptop em servio usado
para fazer o download de diversas mquinas e realizar a
transferncia de dados para um computador central com o
objetivo de que esses dados sejam analisados. Pode ser
usada ainda para copiar dados de um determinado camiQKmRGHXPGLVTXHWHSDUDXPEDQFRGHGDGRVSDUDQVGH
anlise.
Para importar dados, pressione o boto IMPORT (importar)
localizado na parte inferior da tela de resumo de carga til.
O programa pedir um arquivo com extenso .zip para
importar. Localize o arquivo e pressione Open (abrir). O
programa s importar arquivos em zip criados por outro
computador rodando o software PDM.

M20008 02/10

NOTA: Uma vez deletados do banco de dados principal, os registros no mais podem ser recuperados,
portanto, altamente recomendvel que todos os
registros sejam exportados e arquivados em arquivos
compactados antes de sua excluso propriamente
GLWDDPGHTXHIXWXUDPHnte, possam ser consultados.

Medidor de carga til III

M20-31

Visualizao de alarmes

Deletando registros de alarme

A partir da tela de resumo de carga til, clique o boto


Alarms (alarmes) para visualizar a tela do alarme.
2VDODUPHVVmRFODVVLFDGRVVHJXQGRDVSHVTXLVDV
programadas na tela de resumo de carga til. Os alarmes podem ser exibidos como ativos ou inativos.

Para deletar registros de alarme do banco de dados principal, pressione o boto Delete na parte inferior da tela
de visualizao dos alarmes. O programa exibir na tela
um resumo dos alarmes encontrados na pesquisa. Para
deletar um alarme, selecione um por vez e pressione o
boto Delete. Recomendamos que voc exporte os dados
SHVTXLVDGRVSDUDXPDUTXLYRFRPH[WHQVmR]LSSDUDQV
de backup antes da excluso propriamente dito. Mantendose o cursor pressionado, voc poder selecionar mltiplos
registros. Pressionando o boto Delete All (deletar tudo),
voc selecionar todos os alarmes da pesquisa em questo
e excluir todos eles.
OBS.: Uma vez deletado do banco de dados principal, um
alarme no poder ser recuperado. Assim sendo, altamente recomendvel que, antes de serem deletados, todos os
registros sejam exportados e arquivados em um formato de
DUTXLYRFRPSDFWDGRDPGHTXHSRVVDPVHUFRQVXOWDGRV
posteriormente

M20-32

Medidor de carga til III

M20008 02/10

SEO DE DIAGNSTICO DE FALHAS


Exibio dos dados em tempo real

DIAGNSTICO DE FALHAS
O diagnstico de falhas do sistema PLMIII feito por meio
do programa do compitador (PC), onde possvel:






9LVXDOL]DURVDODUPHVDWLYRV
9LVXDOL]DUDVHQWUDGDVGRVHQVRUXWLOL]DQGRR9LVRUGH
Dados em Tempo Real.
7HVWDUDVOX]HVLQGLFDGRUDVGHFDUJD~WLO
&ULDUDUTXLYRVGHUHJLVWURGDVHQWUDGDVGRVHQVRUSDUD
anlise posterior.
(VVDVDWLYLGDGHVH[LJHPXPDFRQH[mRFRPRVLVWHPD3/MIII.

Visualizao dos alarmes ativos


Alarmes ativos so os alarmes que foram programados, mas
ainda no foram limpos. Cada alarme programado quando
as condies de ativao so mantidas por 5 segundos.
Cada alarme limpo quando a condio retornada para a
faixa normal por 5 segundos. Por exemplo, 5 segundos aps
o sensor de presso traseira-esquerda ter sido desconectado, O alarme de baixa presso da traseira esquerda ser
ativado. possvel visualizar essa situao por meio da tela
Conexo ao Medidor de Carga til. Aps 5 segundos do
sensor de presso ter sido reconectado, o alarme ser limpo
e registrado na memria.
Os alarmes ativos so registrados na memria como cleared (limpos) quando a chave de partida desligada.
Quando a alimentao de energia restaurada ao medidor
de carga til, os alarmes sero reativados se as condies
permanecerem por 5 segundos.
Para visualizar os alarmes ativos:
1

Conecte-se ao medidor de carga til e execute o


programa do PC.
2. No menu principal, selecione Connect to Payload
Meter (Conectar ao Medidor de carga til). O PC ir
solicitar a ltima informao de status do medidor
de carga til.
3. Se houver alarmes ativos, o boto Display Active
Alarms (Exibir alarmes ativos), existente no canto
inferior esquerdo da tela, estar disponvel. Se o
ERWmRQmRHVWLYHUGLVSRQtYHOVLJQLFDTXHQmRKi
alarmes ativos no momento da conexo. A tela no
ser limpa automaticamente. Se uma condio
IRUPRGLFDGDSDUDFDXVDUXPDODUPHRXVXiULR
dever sair do programa e abrir novamente a tela
Connect to Payload Meter (Conectar ao medidor
de carga til).

O programa do PC pode ser utilizado para visualizar


as leituras de entrada ao vivo do medidor de carga
til. Os nmeros so exibidos em intervalos mdios
de 1 segundo.
1. Conecte o medidor de carga til e execute o
programa do PC.
2. No menu principal, selecione Connect to
Payload Meter (Conexo com o Medidor de
carga til). O computador ir solicitar a ltima
informao de status do medidor de carga til.
3. Selecione o boto Real Time Data (Dados
em tempo real). A tela de dados ser aberta.
O computador solicitar ao medidor de carga
til que inicie a transmisso dos dados.
4. Para sair, pressione o boto Close (fechar).
As unidades utilizadas em cada medida so determiQDGDVSHODFRQJXUDomRQDV2So}HVGR3URJUDPD
do software do computador. As quatro presses da
suspenso e do inclinmetro so mostradas. O status
das entradas do Corpo da caamba levantado e o
Travamento dos freios tambm so mostrados. O
estado do ciclo de transporte da carga e a velocidade
so exibidos, bem como o peso atual suportado pela
suspenso, que difere da carga til simplesmente. O
peso suportado pela suspenso a medio do peso
do caminho acima da suspenso. Ela no inclui
os pneus, fusos, motores das rodas, carcaas de
comandos, ou qualquer outro item que se encontre
abaixo da suspenso.
Testando as luzes indicadoras de carga til
A exibio dos dados em tempo real tambm permite
ao usurio ativas individualmente as luzes indicadoras da carga til. Isto pode ser particularmente til
para testar as luzes. Para acionar uma luz de carga
til de uma cor em particular:
1. Clique na caixa de seleo ao lado da luz
colorida para ativ-la.
2. Pressione o boto Set Lights (ajustar luzes)
para acend-la.
3. Desmarque a caixa e pressione Set Lights
(ajustar luzes) para desligar a luz.
As luzes retornaro ao seu estado normal quando o
visor de dados em tempo real for fechado.

M20008 02/10

Medidor de carga til III

M20-33

arquivo, a gravao ir sobrescrever o arquivo anterior, apagando os dados anteriores. Para colher
mais dados, feche a janela de dados em tempo real,
abra-a novamente em seguida e crie um novo arquivo de registro.

Criando arquivos de registro de entradas


O programa do computador (PC) capaz de criar
um arquivo de texto do fluxo de dados em tempo
real a partir do medidor de carga til. Isto pode ser
H[WUHPDPHQWH~WLOSDUDQVGHGLDJQyVWLFR2VGDGRV
so gravados como um arquivo de dados de texto no
formato de valores separados por vrgula (.csv). Os
dados so registrados como unidades mtricas em
uma proporo de 50 amostras por segundo. O arquivo de dados pode crescer muito de maneira rpida.
Cada amostra registra uma linha no arquivo ASCII no
formato .csv.
A ordem de cada linha de dados a seguinte:
 'DWD
 +RUiULR
 3HVRVXSRUWDGRSHODVXVSHQVmR
 3UHVVmRGLDQWHLUDHVTXHUGD
 3UHVVmRGLDQWHLUDGLUHLWD
 3UHVVmRWUDVHLUDHVTXHUGD
 3UHVVmRWUDVHLUDGLUHLWD
 ,QFOLQDomR
 9HORFLGDGH
 (VWDGRGRFRUSRGDFDoDPEDOHYDQWDGR  SDUDFLPD
 (VWDGRGHWUDYDPHQWRGRVIUHLRV  DWLYDGR
 (VWDGRGHFDUJD~WLO
 0DUFDVGHDOHUWDGHVWDWXV
 6REUHVVDOHQWH
Para criar um arquivo de registro:
1. Conecte o medidor de carga til e execute o
programa do computador (PC).
2. No menu principal, selecione Connect to
Payload Meter (Conectar ao medidor de
carga til). O computador ir solicitar a ltima
informao de status do medidor de carga til.
3. Selecione o boto Real Time Data (Dados
em tempo real). A tela de exibio de dados
em tempo real abrir. Em seguida o computador ir solicitar ao medidor de carga til
que comece a transferncia dos dados.
4. Clique no boto Set File Name (Nomear
arquivo) e digite um nome e informe o local
onde ser armazenado o arquivo de texto. A
extenso padro .txt. Este dado pode ser
facilmente importado para as planilhas no formato de valores separados por vrgula (.CSV).
5. Uma vez nomeado o arquivo, os botes Start
Log (Iniciar registro) e Stop Log (Interromper
registro) estaro ativos.
6. Pressione o boto Start Log (Iniciar registro)
para comear a colher os dados e grav-los
no arquivo. Uma vez iniciado o processo, ele
no poder ser interrompido e reiniciado.
7. Pressione o boto Stop Log (Interromper
registro) para interromper a gravao dos
dados. Caso se tente reiniciar o registro do

M20-34

Inspees dirias
Uma parte importante da manuteno do sistema do Medidor
de carga til III (PLMIII) diz respeito ao monitoramento das
entradas bsicas do sistema. Recomenda-se que o operador
do caminho caminhe ao redor do caminho e inspecione
visualmente os seguintes itens:



&RQGLo}HVGHFDUUHJDPHQWRGDVVXVSHQV}HVQmRHVtando planas nem sobrecarregadas.


1tYHOGHSUHVVmRQDVVXVSHQV}HVYHULTXHDVVXVSHQses usando o indicador do operador e o interruptor do
operador.

Manuteno peridica
5HFRPHQGDPRVTXHRVVHJXLQWHVLWHQVVHMDPYHULFDGRVD
cada 500 horas de operao:
 &RQUPHDVSUHVV}HVGDVXVSHQVmRXVDQGRLQGLFDGRres externos.
 &RQUPHVHDDOWXUDGDVXVSHQVmRHVWiDSURSULDGD
 &RQUPHVHDVVXVSHQV}HVVXSRUWDPEHPDFDUJDHVH
no h contato de metal com metal quando o caminho
carregado.
 &RQUPHVHRLQFOLQ{PHWURLQGLFDYDORUHVSRVLWLYRV  
quando o caminho est embicado para cima e negativos (-) quando est embicado para baixo.
$OpPGLVVRSRGHUiVHU~WLOFRQUPDUDRSHUDomRDSURSULDGD
das suspenses, dirigindo o caminho durante um ciclo
completo de transporte de carga. Registre as presses da
suspenso usando a ferramenta de arquivo de registro em
CSV no aplicativo Payload Data Manager (Gerenciador de
dados de carga til). As presses da suspenso neste arTXLYRGHUHJLVWURSRGHUmRVHUUHYHUWLGDVHPXPJUiFRSDUD
IDFLOLWDUDLGHQWLFDomRGHVXVSHQV}HVVREUHFDUUHJDGDVRX
em posio plana.

Medidor de carga til III

M20008 02/10

Exibies anormais com a caamba levantada


2PHGLGRUGHFDUJD~WLOH[HFXWDGLYHUVDVYHULFDo}HVQRVLVWHPDLQWHUQRGDPHPyULDVHPSUHTXHRFRUSRGDFDoDPED
levantado. EM caso de falha, o indicador do operador poder exibir um cdigo de falha quando a fora for aplicada ao
sistema PLMIII.
Er:01 $IDOKDGHPiFRQJXUDomRGRFDPLQKmRLQGLFDTXHRPHGLGRUHQFRQWURXXPHUURDROHURUHJLVWURDWXDOGHFRQJXUDo}HVGRFDPLQKmRQDPHPyULD
Er:02 A falha de registro de calibrao imprpria indica que o medidor encontrou uma falha durante a transmisso de
mensagens entre os microprocessadores na placa do circuito.
Er:03 A falha de comunicaes entre processadores indica que o medidor encontrou uma falha durante a transmisso
de mensagens entre os microprocessadores na placa do circuito.
Para solucionar essas falhas:

Causa
SIM

SIM

NO

NO

O cdigo Er03 ainda


exibido no indicador com a caamba
levantada?

SIM

Medidor de carga
til OK
Perda de memria
do programa

 'HVOLJXHDFKDYHGH
partida
 5HPRYDDIRUoDGD
bateria desconectada
 $JXDUGHPLQXWR
 5HVWDXUHDIRUoD
 /LJXH D FKDYH GH
partida

- Reprograme
o processador
secundrio. Entre
em contato com
o distribuidor para
obter a verso
mais recente do
programa.

Medidor de carga til OK

NO

Substitua as
peas

Os cdigos Er01
e Er02 ainda so
exibidos no indicador com a caamba
levantada?

 5HSURJUDPH R
processador primrio. Entre em
contato com o
distribuidor para
obter a verso
mais recente do
programa

Os cdigos Er01,
Er02 ou Er03 so
exibidos no indicador
quando a caamba
levantada?

Defeito no medidor de
carga til

Soluo

6HHVWHVHUURVSHUVLVWLUHPDSyVDUHSURJUDPDomRRVSURFHVVDGRUHVSULPiULRHVHFXQGiULRGRPHGLGRUGHFDUJD~WLO
devero ser substitudos.

M20008 02/10

Medidor de carga til III

M20-35

Nenhuma informao de carga til exibida quando a chave de partida ligada







&RQUPHDWHQVmRGDEDWHULDQDFDL[DGHMXQomRGR3/0,,,HQWUH7%$ SRVLWLYR H7%; WHUUD 


9HULTXHDFRQGLomRGRGLVMXQWRUGHFLUFXLWR$ &%$ QDFDL[DGHMXQomRGR3/0,,,
9HULTXHWRGRVRVFRQHFWRUHVHWHUPLQDLVQRVFLUFXLWRVGHIRUoDGRPHGLGRUGHFDUJD~WLO
6HRYLVRUGHGRLVGtJLWRVQRPHGLGRUGHFDUJD~WLOH[LELUVHJXLGRGHQRPRPHQWRGHHOHYDomRGDFDoDPEDFRQtinue no processo Nenhuma informao exibida no mostrador do operador. Este visor de dois dgitos normalmente
alterna o valor 0 a cada exibio. No caso dos alarmes ativos, esta exibio mostrar os cdigos de cada alarme
ativo. Os cdigos de alarme encontram-se na seo relacionada operao do caminho fora-de-estrada.

Causa

SIM
SIM

H tenso de
20-30V entre o
pino 1 e o pino
3 no conector
R264 do medidor de carga
til?

 'HVFRQHFWH
o conector
R264 do
medidor de
carga til.
 / L J X H  D
chave de
partida.

NO

H tenso de
20-30V entre
o pino 17 e o
pino 3 do conector R264?

H tenso de
20-30V entre
o pino 1 e o
NO bloco do terra
GB12 na cabina?

H tenso de
20-30V entre
o pino 17 e o
bloco do terra
GB12 na cabina?

NO

SIM
A resistncia
SIM e n t r e o p i n o
3 do conector
R264 e GB12
SIM de 1 ohm ou
mais?
NO

NO

M20-36

Medidor de carga til III

Soluo

Defeito no
medidor de
carga til

Substitua as
peas

Defeito no contato
ou desconexo
na fiao do circuito da chave de
partida

Ve r i f i q u e e
substitua as
reas de contato do terminal
do conector

D e s c o n e x o n o Repare ou subssinal do terra entre titua o chicote de


GB12 e R264
DomR

Contato defeituoso 9HULTXHHVXEVdo circuito da fonte titua as reas de


de alimentao
contato do terminal do conector

Desconexo no
sinal de fora de
TB45-B para o
medidor

Repare ou
substitua o chiFRWHGHDomR

M20008 02/10

No h informaes no velocmetro
No h informaes sendo exibidas no mostrador do operador


6HRYHORFtPHWURHVWLYHUIXQFLRQDQGRPDVRPRVWUDGRUGRRSHUDGRUSHUPDQHFHUHPEUDQFRFRQUPHDVFRQH[}HV
com o medidor de carga til na seo No h exibio da carga til quando a chave de partida ligada.
Causa
SIM

NO

H uma tenso
de 20-30V
NO e n t r e o p i n o
1 de D28 na
caixa de juno
de carga til e
TB45-X?

H uma tenso de 2030V entre o


terminal 1 e
GB12, o bloco
do terra no
caminho?

Falha no diodo D28

SIM
H u m a te nso de 20-30V
entre TB32-N
NO e o chassi?

NO

H uma tenso
de 20-30V entre o terminal 1
e o terminal 9
no indicador?

 /LJXHDFKDve de partida

SIM

Substitua a pea

Desconexo na
fiao entre a caixa
auxiliar e a caixa de Repare ou substijuno de carga til
WXDDDomR

Falha na fiao do
sinal da chave de
partida e a caixa
auxiliar

Repare ou
substitua a
DomR

9HULTXHUHSDUH
Defeito no contato da a rea de contafonte de alimentao to do terminal do
conector

NO
A resistncia
superior a
1 ohm entre
o terminal 9
e o bloco do
terra GB12 na
cabina?

Soluo

alha na fiao R e p a r e o u
NO F
entre o indicador e
a caixa de juno de
carga til

A resistncia superior a 1 ohm entre


TB45-V na caixa de
juno de carga til o
SIM bloco do terra GB12
na cabina?

Falha na fiao
entre a caixa de
juno e o bloco
SIM do terra

Falha na fiao de
comunicaes entre
R264 para o pino 23
do medidor de carga
til para TB45-S e o
pino 33 para TB45-V

SIM

substitua a
DomR

Repare ou
substitua a
DomR

Repare ou
substitua a
DomR

O medidor de carga

SIM til se comunica com o

laptop por meio de cabo


conector na cabina?
Falha na fiao de

 &RQHFWHRODSWRS
ao medidor de carga til e monitore
os sensores de
presso

SIM

NO comunicaes entre

O visor de 2 dgitos no medidor


de carga til
funciona corretamente quando a
chave de partida
ligada?

SIM

Defeito no indicador

Problema na alimentao do medidor de


carga til

NO

M20008 02/10

o terminal 2 para
TB45-Se o terminal 9
para TB45-V

H continuidade na fiao
entre o terminal 2 para
NO T B 4 5 - S e o
terminal 9 para
TB45-V?

Medidor de carga til III

Repare ou
substitua a
DomR

Substitua a
pea
Confirme a
condio de
alimentao
para o medidor de carga
til

M20-37

No h comunicao com o computador (PC)


No caso do laptop (PC) no se conectar apropriadamente ao sistema PLMIII:
 &RQUPHVHKiDOLPHQWDomRSDUDRPHGLGRUGHFDUJD~WLO
 &RQUPHDVFRQJXUDo}HVGDSRUWDVHULDOGRODSWRSXVDQGRRSURJUDPDGHFRPSXWDGRU3DUDWDQWRDSDUWLUGRPHQX
SULQFLSDOVHOHFLRQH&KDQJH3URJUDP2SWLRQV $OWHUDURSo}HVGRSURJUDPD &RQUPHVHDSRUWDVHULDOVHOHFLRQDGD
est correta e encontra-se disponvel.
 &RQUPHVHXPSURJUDPDGHVLQFURQL]DomRWLSR3HUVRQDO'LJLWDO$VVLVWDQWV 3'$ QmRHVWiXVDQGRDSRUWDVHULDO
Com freqncia, um programa PDA como o HotSync da Palm Pilot assumir o controle da porta serial e no permitir
que outros aplicativos utilizem a conexo serial. Feche o programa de sincronizao e faa uma nova tentativa de
executar o Payload Data Manager (Gerenciador de dados de carga til).
 &RQUPHRXVRGR,QWHUUXSWRUGR2SHUDGRU6HHVWHLQWHUUXSWRUHVWLYHUIXQFLRQDQGRFRUUHWDPHQWHHOHFRQUPDUiD
funcionalidade das comunicaes entre o medidor de carga til e a caixa de juno.
 $QWHVGHGDULQtFLRDRGLDJQyVWLFRGHIDOKDVGHVOLJXHDFKDYHGHSDUWLGD$JXDUGHPLQXWRHYROWHDOLJDUDFKDYHGHSDUWLGD

Causa
Possvel problema
na fiao que
promove as comunicaes entre o
medidor de carga
til e a caixa de
juno/indicador

NO

O interruptor
do operador
funciona corretamente?

 R  O D S W R S  Q m R
est conectado
ao medidor de
carga til

Falha na fiao
entre a caixa
de juno e o
conector de download P252

SIM

SIM

A resistncia
superior a 1
ohm do pino
D do conector P252 a
TB45-S?

Falha na fiao
entre a caixa
de juno e o
conector de download P252

SIM

NO

A resistncia
superior a 1 ohm
do pino D do
conector P252 a
TB45-V?

SIM
A resistncia
superior a 1
ohm do pino
D do conecNO t o r P 2 5 2 a
TB45-T?

NO

M20-38

Medidor de carga til III

Falha na fiao
entre a caixa
de juno e o
conector de download P252

Falha na fiao
no chicote de
download entre
o computador
e o conector de
download

Soluo
V para a
seo O in terruptor do
operador no
funciona

Repare ou substiWXDDDomR

Repare ou subsWLWXDDDomR

Repare ou substiWXDDDomR

Repare ou subsWLWXDDDomR

M20008 02/10

As luzes indicadoras de carga no se acendem durante o carregamento







&RQUPHVHRRSHUDGRUGRFDPLQKmRXVDRLQWHUUXSWRUGHWUDYDPHQWRGRVIUHLRV 1(8752 GXUDQWHRFDUUHJDPHQWR


6HPHVWDHQWUDGDRPHGLGRUGHFDUJDQmRUHFRQKHFHUiSURSULDPHQWHDVXWXDo}HVGHFDUJD
,QVSHFLRQHRVEXOERVGDVOX]HVLQGLFDGRUDVGHFDUJDXWLOL]DQGRRPRGRGHYHULFDomRGDVOkPSDGDV
9HULTXHRIXQFLRQDPHQWRGRGLVMXQWRU$&%%QDFDL[DGHMXQomRGRPHGLGRUGHFDUJD~WLO
3DUDFRQWLQXDUFRPRGLDJQyVWLFRGHIDOKDVDFLRQHWRGDVDVOX]HVLQGLFDGRUDVGHFDUJD~WLOXWLOL]DQGRRPRGRGH
YHULFDomRGDVOkPSDGDVGRSURJUDPD3D\ORDG'DWD0DQDJHU *HUHQFLDGRUGHGDGRVGHFDUJD~WLO 

M20008 02/10

Medidor de carga til III

M20-39

As luzes indicadoras de carga permanecem acesas


As luzes indicadoras de carga permanecem acesas durante o despejo
O mostrador no limpo quando a carga despejada



9HULTXHRVLQDOGRLQWHUUXSWRUGRFRUSRGDFDoDPEDOHYDQWDGD4XDQGRRVLQDOLQGLFDGRUGHFDoDPEDOHYDQWDGDQmRpUHFHELGR
adequadamente durante o despejo, o medidor de carga til poder manter as luzes acesas aps o corpo ser baixado.
9HULTXHDDomRGDVOX]HVLQGLFDGRUDVGHFDUJD~WLOXWLOL]DQGRRVSURFHGLPHQWRVGHVFULWRVQDVHomR$VOX]HVLQGLcadoras de carga no se acendem durante o carregamento.
Causa
NO

H tenso de
20-30 V entre
TB45-P e
TB45-X?

 & R Q H F W H  R
SIM
laptop
 8WLOL]DQGR
o programa
Gerenciador
de dados de
carga til,
acenda todas as luzes
de carga til

H tenso de
20-30 V entre
TB45-A e
TB45-X?

NO
Com todas as
luzes acesas,
h tenso de
20-30 V entre
TB45-P e
TB45-X?

SIM

A resistncia
maior que
1 ohm de
TB45-D para
TB45-E?

SIM

NO

Realize o diagnstico
de falhas do sinal da
chave de partida para
a caixa de juno

)DOKDQDDomR
ou no disjuntor
do circuito
entre TB45-A e
TB45-D.

Repare ou substitua
DDomRRXRGLVMXQtor do circuito

Falha na fiao
para TB45-A

Repare ou subsWLWXDDDomR

Falha na fiao ou
no rel 4

Repare ou substitua
DDomRRXRUHOp

SIM

NO

Com todas as
luzes acesas,
h tenso de
20-30 V entre
TB45-H para
TB45 -X, de
TB-J para
TB45-X e
TB45-K para
TB45-X?

NO
SIM
Foi estabelecida
uma comunicao
apropriada entre o
laptop e o medidor
de carga til?

Falha na fiao
entre TB45-H e o
pino 7, ou TB45-J
e o pino 6, ou
TB45-L e o pino 5
no conector R264
no medidor de
carga til

Uso imprprio do
programa para
NO o PC

NO

SIM

SIM

M20-40

)DOKDQDDomR
ou no rel 3

NO

Com todas
as luzes
acesas, h
tenso de
20-30 V entre TB45-N e
TB45-X?

Com todas
as luzes
acesas, h
tenso de
20-30 V entre TB45-N
e TB45-X?

NO

Com todas as
luzes acesas,
h tenso de
SIM 20-30 V entre
TB45-M e
TB45-X?

Soluo

Possvel problema
de fiao entre o
sinal da chave de
partida e a caixa
de juno

Repare ou subsWLWXDDDomR

Ve r i f i q u e s e o
laptop est sendo
usado corretamente
9HULTXHDDomR
e substitua o rel

)DOKDQDDomR
ou no rel 2

9HULTXHDDomR
e substitua o rel

)DOKDQDDomRRX
no rel 1

Verifique a fiao
e substitua o rel

NO )DOKDQDDomRSDUD Repare ou substitua

SIM

Com todas as
luzes acesas,
h tenso de
20-30 V em
cada uma das
lmpadas?

Medidor de carga til III

a luz individual ou
problema no terra da
lmpada

Uso imprprio do
programa para
SIM o PC

DDomR

Verifique se o programa do laptop


est sendo usado
corretamente e tente mais uma vez

M20008 02/10

Problemas de calibrao



9HULTXHVHRFDPLQKmRHVWiYD]LRHOLPSR
&RQUPHVHRPHGLGRUGHFDUJD~WLOHQFRQWUDVHHPVHXHVWDGRGHWUDQVSRUWHGHFDUJDDGHTXDGR2PHGLGRUGH
FDUJDGHYHUiHVWDUYD]LRRXQRVHVWDGRVGH]RQDGDWDUDSDUDTXHDFDOLEUDomRVHMDLQLFLDGD,VWRSRGHVHUYHULFDGR
utilizando-se o modo de monitoramento em tempo real do programa Payload Data Manager (Gerenciador de dados
de carga til).
2PHGLGRUGHFDUJD~WLOSRGHVHUUHVHWDGRSDUDPDUFDURLQtFLRGHXPQRYRFLFORGHWUDQVSRUWHHOHYDQGRVHDFDoDPED
quando o caminho estiver vazio. Este procedimento poder ser necessrio aps fazer a manuteno das suspenses.

M20008 02/10

Medidor de carga til III

M20-41

Alarme 1 Alta presso dianteira esquerda


Alarme 2 - Baixa presso dianteira esquerda
'LDJQyVWLFRGHIDOKDVGDDomRSDUDDVXVSHQVmRGLDQWHLUDHVTXHUGD
Estes alarmes indicam que a corrente lida pelo medidor de carga til maior que 22ma ou menor que 2ma.
O sensor de presso projetado para emitir 4-20ma sobre uma faixa de presso de 4000 psi.
 9HULTXHVHKiDOLPHQWDomRGHYDRVHQVRUHP7%/QDFDL[DGHMXQomRGHFDUJD~WLO
 9HULTXHVHDVFRQH[}HVGRVLQDOGRFLUFXLWR)'GDFDL[DGHFRQH[mRGDVXVSHQVmRHVTXHUGDHGH7%%SDUD
a caixa de juno de carga til TB46-F para o pino 39 do conector R264 do medidor de carga til esto corretas.

Causa

NO

NO

H tenso de
18 v entre 39F
do medidor
de carga til e
TB45-X?

A resistncia entre o pino


36 de R264 no medidor de
carga til e 39F na caixa
de juno maior que
1 ohm?

NO

Falha no medidor
de carga til
Falha na fiao
entre o pino 36 do
conector R264 do
medidor de carga
til e TB46-L

SIM

 / L J X H  D
chave de
partida
SIM

18 V entre
NO
 'HVFRQHFte o circui- SIM T B 4 6 - L e
TB45-X?
to 39F do
medidor
H tenso de
NO
18 V entre
de carH tenso de
TB46-L e
ga til de
1
8
V
e
n
t
r
e
SIM
 5HFRQHFWH
TB45-X?
TB46-L
SIM T B 4 6 - L e
o circuito
TB45-X?
 / L J X H  D
39F caixa
chave de
de conexo
partida
SIM
 5HFRQHFWH
dianteira di 5HFRQHFWH
o circuito
reita (TB41)
o circuito
39F caixa
 /LJXHDFKD39F caixa
de conexo
ve de partida
de conexo
dianteira
traseira
esquerda
(TB61)
(TB42)
 / L J X H  D
 /LJXHDFKDchave de
ve de partida
partida
SIM

Reparar ou substiWXLUDDomR

)DOKDQDDomRSDUD Reparar ou substia caixa de conexo WXLUDDomR


dianteira esquerda
)DOKDQDDomRSDUD Reparar ou substia caixa de conexo WXLUDDomR
traseira
)DOKDQDDomRSDUD Reparar ou substiWXLUDDomR
o inclinmetro

Falha no medidor de
carga til

A corrente no
circuito 39FD
superior a 2mA
e inferior a 22
mA?
SIM

 , Q V W D O H  R
medidor de
corrente no
circuito 39FC
 /LJXHDFKDve de partida

Substituir unidade

)DOKDQDDomRSDUD Reparar ou substia caixa de conexo WXLUDDomR


dianteira direita

NO
H tenso de

H tenso
de 18 v entre
TB46-L e
TB45-X?

Soluo

A resistncia maior que 1


ohm de TB42A para TB46-L ou
NO TB42-B a TB46-F?

Substituir o medidor/
substituir o sensor

Falha no chicote

Reparar ou substiWXLUDDomR

Falha no chicote

Reparar ou substiWXLUDDomR

NO
SIM

A resistncia maior que 1 ohm


de R264-36 para TB46-L ou
R264-39 a TB46-F?
Falha no sensor ou ligao
incorreta da
fiao na caiNO xa de conexo

M20-42

Medidor de carga til III

Substituir o sensor
ou reparar as conexes

M20008 02/10

Alarme 3 Alta presso dianteira direita


Alarme 4 - Baixa presso dianteira direita
'LDJQyVWLFRGHIDOKDVGDDomRSDUDDVXVSHQVmRGLDQWHLUDGLUHLWD
Estes alarmes indicam que a corrente lida pelo medidor de carga til maior que 22ma ou menor que 2ma.
O sensor de presso projetado para emitir 4-20ma sobre uma faixa de presso de 4000 psi.
 9HULTXHVHKiDOLPHQWDomRGHYQRVHQVRUHP7%/QDFDL[DGHMXQomRGHFDUJD~WLO
 9HULTXHVHDVFRQH[}HVGRVLQDOGRFLUFXLWR)&GDFDL[DGHFRQH[mRGDVXVSHQVmRGLUHLWDHGH7%%SDUDD
caixa de juno de carga til TB46-G para o pino 20 do conector R264 do medidor de carga til esto corretas.

NO
H tenso de
18 v entre 39F
NO d o m e d i d o r
de carga til e
TB45-X?

A resistncia entre o pino


36 de R264 no medidor
de carga til e 39F na
caixa de juno maior
que 1 ohm?

SIM
NO

H tenso
de 18 V en 'HVFRQHFWH
o circuito 39F SIM tre TB46-L e
TB45-X?
do medidor de
carga til de
TB46-L
 /LJXHDFKDYH
 5HFRQHFWH SIM
de partida
o circuito
39F caixa
de conexo
dianteira direita (TB41)
 /LJXHDFKDve de partida

H tenso
de 18 v entre TB46-L e
TB45-X?

 /LJXHDFKDYH
de partida

NO

Soluo

Falha no medidor de
carga til

Substituir unidade

Falha na fiao
entre o pino 36 do
conector R264 do
medidor de carga
til e TB46-L

Reparar ou substiWXLUDDomR

)DOKDQDDomRSDUD Reparar ou substia caixa de conexo WXLUDDomR


dianteira direita
)DOKDQDDomRSDUD Reparar ou substia caixa de conexo WXLUDDomR
dianteira esquerda

NO
H tenso
de 18 V entr e TB 4 6 - L e
TB45-X?

NO
H tenso
de 18 V enSIM tr e TB 4 6 - L e
TB45-X?
 5 H F R Q H F W H  R
circuito 39F
 5HFRQHFWHR SIM
caixa de
circuito 39F
conexo dian caixa de
teira esquerda
conexo tra(TB42)
seira (TB61)
 /LJXHDFKDYH
 /LJXHDFKDde partida
ve de partida

SIM

SIM

Causa

Falha na fiao
para a caixa de
conexo traseira

)DOKDQDDomRSDUD Reparar ou substiWXLUDDomR


o inclinmetro

Falha no medidor de carga til

A corrente no
circuito 39FD
superior a
2mA e inferior
a 22 mA?
SIM

 ,QVWDOHRPHGLGRU
de corrente no NO
circuito 39FC
 /LJXHDFKDYHGH
partida

Falha no chicote

A resistncia maior que 1


ohm de TB41A para TB46-L ou
TB41-B a TB46-G?

Reparar ou substiWXLUDDomR

Substituir o medidor/substituir o
sensor

Reparar ou subsWLWXLUDDomR

NO
SIM

Falha no chicote

Reparar ou substiWXLUDDomR

A resistncia maior que 1 ohm


de R264-36 para TB46-L ou
R264-20 a TB46-G?

NO

M20008 02/10

Medidor de carga til III

Falha no sensor
ou ligao incorUHWDGDDomRQD
caixa de conexo

Substituir o sensor
ou reparar as conexes

M20-43

Alarme 5 Alta presso traseira esquerda


Alarme 6 - Baixa presso traseira esquerda
'LDJQyVWLFRGHIDOKDVGDDomRSDUDDVXVSHQVmRWUDVHLUDHVTXHUGD
Estes alarmes indicam que a corrente lida pelo medidor de carga til maior que 22ma ou menor que 2ma.
O sensor de presso projetado para emitir 4-20ma sobre uma faixa de presso de 4000 psi.
 9HULTXHVHKiDOLPHQWDomRGHYQRVHQVRUHP7%/QDFDL[DGHMXQomRGHFDUJD~WLO
 9HULTXHVHDVFRQH[}HVGRVLQDOGRFLUFXLWR)&GDFDL[DGHFRQH[mRGDVXVSHQVmRGLUHLWDHGH7%%SDUDD
caixa de juno de carga til TB46-G para o pino 20 do conector R264 do medidor de carga til esto corretas.

Causa

NO

NO

H tenso de
18 v entre 39F
do medidor
de carga til e
TB45-X?

 'HVFRQHFWH
o circuito 39F
do medidor
de carga til
de TB46-L
 /LJXHDFKDve de partida

H tenso
de 18 v entre TB46-L e
TB45-X?

 /LJXHD
chave de
partida

NO

A resistncia entre o pino


36 de R264 no medidor de
carga til e 39F na caixa
de juno maior que
1 ohm?

Falha no medidor de carga


til
Falha na fiao
entre o pino 36 do
conector R264 do
medidor de carga
til e TB46-L

SIM

Substituir unidade

Reparar ou substiWXLUDDomR

)DOKDQDDomRSDUD Reparar ou substituir


a caixa de conexo DDomR
dianteira direita

NO
H tenso
de 18 V enSIM tre TB46-L e
TB45-X?

 5HFRQHFWH
o circuito
39F caixa
de conexo
dianteira direita (TB41)
 / L J X H  D
chave de
partida

Soluo

Falha na fiao
para a caixa de
conexo dianteira
esquerda

NO
H tenso de
18 V entre
TB46-L e
SIM TB45-X?

H t e n s o NO
Falha na fiao
de 18 V enpara a caixa de
tre TB46-L e
conexo traseira
SIM TB45-X?

 5HFRQHFWH
o circuito
39F caixa
de conexo
dianteira
esquerda
(TB42)
 /LJXHDFKDve de partida

 5HFRQHFWH R
circuito 39F
caixa de conexo traseira
(TB61)
 /LJXHDFKDYH
de partida

Reparar ou substituir
DDomR

Reparar ou substi)DOKDQDDomRSDUD
WXLUDDomR
SIM o inclinmetro

SIM

Falha no medidor
de carga til

A corrente no
circuito 39FB
superior a 2mA
SIM e inferior a 22
mA?
SIM
A resistncia maior que 1
ohm de TB61-A para TB46-L ou
 , Q V W D O H  R NO TB61-C a TB46-J?
medidor de
corrente no
circuito 39FB
 /LJXHDFKDYH
de partida

Reparar ou substituir
DDomR

Substituir o medidor/
substituir o sensor

Falha no chicote

Reparar ou substiWXLUDDomR

Falha no chicote

Reparar ou substituir
DDomR

Falha no sensor
ou ligao incorreta da fiao na
caixa de conexo

Substituir o sensor
ou reparar as conexes

NO
SIM

A resistncia maior que 1 ohm


de R264-36 para TB46-L ou
R264-30 a TB46-K?

NO

M20-44

Medidor de carga til III

M20008 02/10

Alarme 7 Alta presso traseira direita


Alarme 8 - Baixa presso traseira direita
'LDJQyVWLFRGHIDOKDVGDDomRSDUDDVXVSHQVmRWUDVHLUDGLUHLWD
Estes alarmes indicam que a corrente lida pelo medidor de carga til maior que 22ma ou menor que 2ma.
O sensor de presso projetado para emitir 4-20ma sobre uma faixa de presso de 4000 psi.
 9HULTXHVHKiDOLPHQWDomRGHYQRVHQVRUHP7%/QDFDL[DGHMXQomRGHFDUJD~WLO
 9HULTXHVHDVFRQH[}HVGRVLQDOGRFLUFXLWR)&GDFDL[DGHFRQH[mRGDVXVSHQVmRGLUHLWDHGH7%%SDUDD
caixa de juno de carga til TB46-G para o pino 20 do conector R264 do medidor de carga til esto corretas.

NO

H tenso de
NO 18 v entre 39F
do medidor
de carga til e
TB45-X?
 'HVFRQHFte o circuito 39F do
medidor de
carga til
de TB46-L
 / L J X H  D
chave de
partida

H tenso
de 18 v entre TB46-L e
TB45-X?

 / L J X H  D
chave de
partida

NO

Substituir unidade

)DOKDQDDomRSDUD Reparar ou substia caixa de conexo WXLUDDomR


dianteira direita

H tenso
de 18 V enSIM t r e T B 4 6 - L e
TB45-X?

)DOKDQDDomRSDUD Reparar ou substia caixa de conexo WXLUDDomR


dianteira esquerda

NO
H tenso
de 18 V entre TB46-L e
TB45-X?

 5HFRQHFWH
o circuito
39F caixa
de conexo
dianteira
esquerda
(TB42)
 /LJXHDFKDve de partida

NO Falha na fiao
para a caixa de
conexo traseira

H tenso de
18 V entre
TB46-L e
SIM
TB45-X?

Falha na fiao
para o inclinSIM metro

Reparar ou substiWXLUDDomR

Reparar ou substiWXLUDDomR

 5HFRQHFWHR
circuito 39F
caixa de
conexo traseira (TB61)
 /LJXHDFKDve de partida

SIM

SIM

Falha no medidor de
carga til

)DOKDQDDomRHQWUH
o pino 36 do conector Reparar ou substituir
R264 do medidor de DDomR
carga til e TB46-L

SIM

SIM

Soluo

NO

A resistncia entre o pino


36 de R264 no medidor
de carga til e 39F na
caixa de juno maior
que 1 ohm?

 5HFRQHFte o circuito 39F


caixa de
conexo
dianteira direita
(TB41)
 / L J X H  D
chave de
partida

Causa

A corrente no
circuito 39FA
superior a 2mA
e inferior a 22
mA?

Falha no medidor
de carga til

Substituir o medidor/substituir o
sensor

Falha no chicote

Reparar ou substiWXLUDDomR

Falha no chicote

Reparar ou substiWXLUDDomR

Falha no sensor
ou ligao incorreta da fiao na
caixa de conexo

Substituir o sensor
ou reparar as conexes

SIM

A resistncia maior que 1


ohm de TB61-A para TB46-L ou
 , Q V W D O H  R NO TB61-B a TB46-K?
medidor de
corrente no
circuito 39FB
 /LJXHDFKDve de partida

NO
SIM

A resistncia maior que 1 ohm


de R264-36 para TB46-L ou
R264-40 a TB46-K?

NO

M20008 02/10

Medidor de carga til III

M20-45

Alarme 9 Alta tenso do inclinmetro


Alarme 10 - Baixa tenso do inclinmetro
'LDJQyVWLFRGHIDOKDVGDDomRGRLQFOLQ{PHWUR
Estes alarmes indicam que a tenso para o medidor de carga til encontra-se fora da faixa de trabalho. A tenso no sinal
39FE deve ser maior que 0,5 V e menor que 5,0 V conforme medio feita na caixa de juno entre TB46-P e TB46-N.

Causa
NO

NO
H tenso de
NO 18 v entre 39F
do medidor
de carga til e
TB45-X?

A resistncia entre o pino


36 de R264 no medidor de
carga til e 39F na caixa
de juno maior que
1 ohm?

Falha no medidor de
carga til

Soluo
Substituir unidade

Falha na fiao entre


o pino 36 do conector Reparar ou substituir
R264 do medidor de DDomR
carga til e TB46-L

SIM

NO

H tenso
de 18 V en 'HVFRQHFWH
NO
o c i r c u i - SIM tre TB46-L e
TB45-X?
to 39F do
H tenso de
medidor de
18 V entre
carga til de
H tenso de NO
TB46-L e
TB46-L
 5HFRQHFWH
18 V entre
SIM TB45-X?
 / L J X H  D
o circuito
TB46-L e
chave de
39F caixa
SIM TB45-X?
partida
de conexo
 5HFRQHFWH R
dianteira diSIM
circuito 39F
reita (TB41)
caixa de
 5HFRQHFWHR
 / L J X H  D
H tenso
conexo diancircuito 39F
chave de
de 18 v enteira esquerda
caixa de
partida
tre TB46-L e
(TB42)
conexo traTB45-X?
/LJXHDFKDYH
seira (TB61)
de partida
 / L J X H  D
chave de
 /LJXHDFKDYH
A tenso
partida
SIM
de partida
entre os pinos TB46-P
SIM e T B 4 6 - N
superior a 5,0
SIM
V e inferior a
H tenso
0,5 V?
de 18 V nos
pinos de 3 a
NO 2 do conector
 / L J X H  D
R246?
chave de
A resistncia maior que 1
partida
ohm de R264-3 para TB46-L
NO o u R 2 6 4 - 2 a T B 4 6 - N , o u
R264-1 a TB46-P?

SIM

Falha na fiao para a Reparar ou substicaixa de conexo dian- WXLUDDomR


teira direita
Falha na fiao para a Reparar ou substicaixa de conexo dian- WXLUDDomR
teira esquerda
Falha na fiao para Reparar ou subsa c a i x a d e c o n e x o WLWXLUDDomR
traseira
)DOKDQDDomRSDUDR Reparar ou substiWXLUDDomR
inclinmetro

Falha no medidor de
carga til

Substituir o medidor

Erro de conexo na
fiao ou defeito no Substituir o sensor
inclinmetro

Falha no chicote

Reparar ou substituir
DDomR

Falha no chicote

Reparar ou substiWXLUDDomR

SIM

A resistncia maior que 1


ohm de R264-3 para TB46-L ou
R264-2 a TB46-N, ou R264-1
a TB46-P?

NO

M20-46

Medidor de carga til III

Falha no sensor ou ligaomRLQFRUUHWDGDDomR


na caixa de conexo

Reparar as conexes

M20008 02/10

Alarme 13 Falha de entrada do corpo da caamba levantado


O medidor de carga til detecta quando a carga despejada sem que seja necessrio receber um sinal de levantamento
do corpo da caamba. Quando o volume de carga rapidamente reduzido para menos de 50% de seu volume total sem
que o sinal de caamba levantada tenha sido recebido, o Alarme 13 programado. O alarme ser cancelado assim que
for detectado um ciclo de despejo normal. O ciclo de despejo normal, por sua vez, ser detectado quando for recebido um
sinal de elevao do corpo da caamba, a carga sendo despejada rapidamente e o sinal de descida do corpo da caamba
sendo recebido subseqentemente.

Causa

NO
H tenso de 20 30 V no
circuito 71 para o interruptor
de elevao da caamba
localizado no chassi do
caminho?

NO
O painel de
instrumentos do
caminho indica
corretamente
a condio
de corpo da
caamba levantada?

Falha no interruptor

Repare ou subsWLWXDDDomR

Substitua o interruptor

SIM

SIM

NO

SIM

H tenso de 20
30 V entre TB46-D
e TB46-X quando
o corpo baixado
e 0 V quando o
corpo da caamba
levantado?

A resistncia
maior que
1 ohm entre
TB46-D e
TB27-H?

NO

NO

SIM

Falha na fiao da
caixa de juno de
carga til para a
caixa auxiliar

Repare ou substiWXDDDomR

Conexo incorUHWDGDDomRQD
placa do terminal

Substitua a
conexo

Falha no medidor

Substitua o
medidor

Falha na fiao da
caixa de juno para
o conector R264 do
medidor de carga til

Repare ou subsWLWXDDDomR

A resistncia
maior que
1 ohm entre TB46-D e
R264-18?

SIM

M20008 02/10

)DOKDQDDomR
do interruptor

Soluo

Medidor de carga til III

M20-47

Alarme 16 Falha na gravao da memria


Alarme 17 Falha na leitura da memria
Estes alarmes indicam que o medidor de carga til encontrou um problema interno na sua memria. Recomenda-se que
a alimentao do medidor de carga til seja removida por 1 minuto. Inicialmente, desligue a chave de partida e aguarde
por 30 segundos para, ento, desconectar a bateria. Aguarde mais um minuto antes de restabelecer a fora.
Nos casos em que o restabelecimento da fora para o medidor de carga til no faz com que ele volte ao seu funcionamento normal, talvez seja necessrio reprogramar o medidor de carga til. Todos os dados atuais na memria sero
SHUGLGRV,VWRLUiUHLQLFLDURPHGLGRUGHFDUJD~WLOGHPDQHLUDHFLHQWH
 &RQVXOWHR'LDJQyVWLFRGHIDOKDVGDVH[LELo}HVDQRUPDLVFRPRFRUSRGDFDoDPEDOHYDQWDGRSDUDREWHUPDLVLQIRUPDo}HV

M20-48

Medidor de carga til III

M20008 02/10

Alarme 18
2PHGLGRUGHFDUJD~WLOGHWHFWRXXPDFRQGLomRGHFDUJDLQVXFLHQWHQDVXVSHQVmRWUDVHLUDGLUHLWD
7DOYH]VHMDQHFHVViULRHIHWXDUDPDQXWHQomRGDVXVSHQVmR&RQVXOWHD6HomR+QHVWHPDQXDOGHRFLQDSDUDREWHU
informaes sobre a aplicao de carga nas suspenses.
Alarme 19
2PHGLGRUGHFDUJD~WLOGHWHFWRXXPDFRQGLomRGHFDUJDLQVXFLHQWHQDVXVSHQVmRWUDVHLUDHVTXHUGD
7DOYH]VHMDQHFHVViULRHIHWXDUDPDQXWHQomRGDVXVSHQVmR&RQVXOWHD6HomR+QHVWHPDQXDOGHRFLQDSDUDREWHU
informaes sobre a aplicao de carga nas suspenses.
Alarme 22
O medidor de carga til detectou uma condio de carga devolvida vazia que extrapola o patamar de carga devolvida
GHQLGRSHORXVXiULRHPGRLVFLFORVFRQVHFXWLYRVGHWUDQVSRUWHGHFDUJD
Pare o caminho e limpe qualquer material preso no corpo da caamba do caminho.

M20008 02/10

Medidor de carga til III

M20-49

O interruptor do operador no funciona


Alarme 26 Falha no interruptor do usurio - SELECT
Alarme 27 - Falha no interruptor do usurio - SET




9HULTXHDDOLPHQWDomRGRLQGLFDGRUGRPRVWUDGRUHGRYHORFtPHWURGRPHGLGUGHFDUJD~WLO
9HULTXHVHQmRKiXPODSWRSFRQHFWDGRDRVLVWHPD3/0,,,
'HVOLJXHDFKDYHGHSDUWLGDHDJXDUGHPLQXWRDQWHVGHYROWDUDOLJDUDFKDYH9HULTXHVHRSUREOHPDSHUVLVWH

Causa
SIM
H comunicao na
fiao entre o medidor de carga til e o
indicador? Consulte
o tpico No h
exibio do indicador
para obter maiores
informaes.

NO

A resistncia
superior a 1
ohm entre o
pino 27 do conector do medidor de carga
til e o bloco
do terra GB12
na cabina?

A resistncia
superior a
1 ohm entre
o pino 38 do
NO c o n e c t o r d o
medidor de carga til e o bloco
do terra GB12
na cabina?

 'HVFRQHFWH
R264 do medidor de carga til
 'HVOLJXHRLQWHUruptor SELECT

SIM
 'HVFRQHFWH5
do medidor de
carga til
 'HVOLJXH R LQWHUruptor SELECT

SIM

NO

SIM

Falha na fiao de
comunicaes entre
o medidor de carga
til e o indicador

)DOKDQDDomRHQWUH
o pino 38 de R264 e
o terminal 3 do interruptor do operador

NO

SIM
 'HVFRQHFWH
R264 do
medidor de
carga til
 ' H V O L J X H  R
interruptor
SELECT

Defeito no contato do 9HULTXHHUHSDUH


a rea de contato
conector
do conector

A resistncia
superior a
1 ohm entre
o terminal 5
do interruptor
do operador
e o bloco do
terra GB12 na
cabina?

SIM

Repare ou substiWXDDDomR

Repare ou subsWLWXDDDomR

Falha no interruptor
do operador

Substitua a
pea

Falha na fiao
entre o terminal 5
do interruptor do
operador e GB12

Repare ou substiWXDDDomR

A resistncia
superior a 1
ohm entre o
terminal 4 do
interruptor do
operador e o
bloco do terra
GB12 na cabina?

 'HVFRQHFWH5
do medidor de
carga til
 'HVOLJXH R LQWHUruptor SELECT

M20-50

A resistncia
superior a
1 ohm entre
o terminal 3
do interruptor
do operador
e o bloco do
terra GB12 na
cabina?

NO

Soluo

NO

Medidor de carga til III

)DOKDQDDomRHQWUH
o pino 27 de R264 e
o terminal 4 do interruptor do operador

Repare ou substiWXDDDomR

M20008 02/10

Mapa dos conectores


Este diagrama mostra a disposio geral dos conectores, placas de terminais e conexes diversas.

CONEXES POR CABOS

CAIXA DE JUNO
DE CARGA TIL

CAIXA AUXILIAR

Indicador
Medidor de carga til

Interruptor do
operador

REL
DIODO

Inclinmetro

Interruptor de
travamento dos
freios
CONECTOR DIAG/DOWNLOAD

CAIXA DE CONEXO
DA SUSPENSO
DIREITA

CAIXA DE CONEXO DA
SUSPENSO ESQUERDA

SUSPENSO DIANTEIRA
ESQUERDA

M20008 02/10

SUSPENSO
TRASEIRA
ESQUERDA

CAIXA DE CONEXO DA
SUSPENSO TRASEIRA

Medidor de carga til III

SUSPENSO
TRASEIRA
DIREITA

SUSPENSO
DIANTEIRA
DIREITA

M20-51

Conectores
Face de contato do lado do chicote

Face de contato do medidor


de carga til

Face de contato do
conector de diagnsticos

Lado do chicote
P246

Faces de contato

Lado do inclinmetro

Lado do chicote do conector


do interruptor dos freios

M20-52

Medidor de carga til III

M20008 02/10

PROCEDIMENTO DE VERIFICAO DO MEDIDOR DE CARGA TIL PLMIII


Descrio geral
2SURFHVVRGHYHULFDomRFRQVLVWHHPSUHQGHUFDUJDVGH
teste no local dos sensores de presso da suspenso e
YHULFDUDSUHVVmRLQGLFDGDSHORPHGLGRUGHFDUJD~WLO$OpP
disso, conecte um laptop (PC) ao medidor de carga til para
YHULFDUVHDYHUVmRGRSURJUDPDHVWiDWXDOL]DGDEHPFRPR
o resto das entradas e sadas do sistema.
Ferramentas necessrias
 3URJUDPD3D\ORDG'DWD0DQDJHU *HUHQFLDGRUGH
dados de carga til)
 ()&KLFRWHGH'RZQORDG
 (-&KLFRWHVWHVWHGR3/0,,, VmRQHFHVViULRV 
3URFHGLPHQWRGHYHULFDomR
1. Acople um chicote EJ3057 caixa de conexo da suspenso dianteira esquerda. O grampo vermelho de jacar dever ser preso ao circuito 39F do conector TB42-A.
O grampo branco de jacar dever ser preso ao circuito
39FD em TB42-B. O chicote EJ3057 atuar como uma
carga de teste para simular uma presso de suspenso
sobre o sensor do sistema do medidor de carga til.
2. Prenda um chicote EJ3057 caixa de conexo da suspenso dianteira direita. O grampo vermelho de jacar
dever ser preso ao circuito 39F em TB41-A. O grampo
branco de jacar dever ser preso ao circuito 39FC em
TB41-B.
3. Prenda um chicote EJ3057 conexo da suspenso
traseira esquerda na caixa de conexo da suspenso
traseira. O grampo vermelho de jacar dever ser preso
ao circuito 39F em TB61-A. O grampo branco de jacar
dever ser preso ao circuito 39FB em TB61-C.
4. Prenda um chicote EJ3057 conexo da suspenso
traseira direita, na caixa de conexo da suspenso traseira. O grampo vermelho de jacar dever ser preso
ao circuito 39F em TB61-A. O grampo branco de jacar
dever ser preso ao circuito 39FA em TB61-B.
 1DFDL[DGHMXQomRGR3/0,,,YHULTXHDWHQVmRGHHQtrada no circuito 39G entre TB45-B e TB45- X. Esta tenso dever ser de 24 VC c.c. proveniente das baterias.
6. Ligue a chave de partida. O velocmetro/indicador do
mostrador no painel de instrumentos dever exibir os
tipos de caminho pelo viso inferior. O modelo padro
do medidor de carga til o 930E.
 1DFDL[DGHMXQomRGR3/0,,,YHULTXHDWHQVmRGH
alimentao do sensor no circuito 39F entre TB46-L e
TB45-X. esta tenso dever ser de 18 V c.c. 1V c.c.

M20008 02/10

8. Volte para a cabina e verifique o velocmetro/


indicador do mostrador. O indicador mostrar a
carga til atual. Com o chicote EJ3057 acoplado
ao sensor, a carga til apontada dever ser de 0.
OBS: O mostrador pode ser utilizado para exibir rapidamente as leituras atuais dos quatro sensores de presso da suspenso e do inclinmetro. Este procedimento
pode ser utilizado durante os perodos de manuteno
SURJUDPDGRVUHJXODUPHQWHSDUDVHYHULFDURHVWDGR
da suspenso. Estas exibies ocorrem em tempo real
e so atualizadas conforme h mudanas de valores. O
mostrador pode ter sua exibio alterada pressionandose o boto SELECT no painel de instrumentos. A seqncia de exibio :
PL= Carga til
Id 1~PHURGHLGHQWLFDomRGRRSHUDGRU
tL= Total de toneladas no turno
LC= Contador de carga do turno
LF= Presso da suspenso dianteira esquerda
UF= Presso da suspenso dianteira direita
Lr= Presso da suspenso traseira esquerda
rr= Presso da suspenso traseira direita
In= Inclinmetro
OBS: As exibies em tempo real no podem ser eliminadas, sobre as quais o boto SET no ter efeito algum.
OBS: As unidades empregadas pelo mostrador so
FRQWURODGDVSHODVFRQJXUDo}HVGRPHGLGRUGHFDUJD
til. Por padro, o medidor exibe as medidas no sistema mtrico, onde as presses sero exibidas em
intervalos de kg/cm2. Por exemplo, se o mostrador
exibir 202, o valor real ser de 20,2 kg/cm2. Se o
medidor de carga til estiver ajustado para exibio
em toneladas, as presses sero exibidas em psi
(lbs/pol2). Para fazer a converso de kg/cm2 para psi,
multiplique por 14,2233 psi (lbs/pol2) = 1 kg/cm .
OBS: O inclinmetro exibe graus inteiros de inclinao. Uma inclinao positiva ocorre quando o caminho est apontando para cima.

Medidor de carga til III

M20-53

OBS: O indicador ir mostrar rapidamente o tipo de


informao exibida a cada 1 minuto. Por exemplo, se
a presso dianteira esquerda estiver sendo exibida,
Lf (presso dianteira esquerda) = ser mostrada a
cada minuto. Apenas no mostrador do medidor de
carga til, PL= no exibe essa informao.
9. Pressione e mantenha o boto SELECT pressionado no painel de instrumentos. Ser exibido
Id 6ROWHRERWmRHR1~PHURGHLGHQWLFDomR
do operador ser exibido. Este valor dever ser 0.
10. Pressione e mantenha o boto SELECT pressionado no painel de instrumentos. Ser exibido
tL=. Solte o boto e o valor total de toneladas
ser exibido. Este valor dever ser 0.
11. Pressione e mantenha o boto SELECT pressionado no painel de instrumentos. Ser exibido
LC=. Solte o boto e o nmero de carga passar a ser exibido. Este valor dever ser 0.
12. Pressione e mantenha o boto SELECT pressionado no painel de instrumentos. Ser exibido LF=. Solte o boto e a presso dianteira
esquerda ser exibida. Este valor dever ser
fornecido em unidades mtricas. O valor nominal
dever ser de 23,4 kg/cm2 (332psi). Valores entre
17,6 e 29,2 kg/ cm2 (250 psi e 416 psi) so aceitveis.
13. Pressione e mantenha o boto SELECT pressionado no painel de instrumentos. Ser exibido
rf=. Solte o boto e a presso dianteira direita
passar a ser exibida. Este valor dever ser fornecido em unidades mtricas. O valor nominal
dever ser de 23,4 kg/cm2 (332psi). Valores entre
17,6 e 29,2 kg/cm2 (250 psi e 416 psi) tambm
sero aceitveis.
14. Pressione e mantenha o boto SELECT pressionado no painel de instrumentos. Ser exibido
Lr=. Solte o boto e a presso traseira esquerda ser exibida. Este valor dever ser fornecido
em unidades mtricas. O valor nominal dever
ser de 23,4 kg/cm2 (332psi), embora valores entre 17,6 e 29,2 kg/cm2 (250 psi e 416 psi) tambm
sero aceitos.

M20-54

15. Pressione e mantenha o boto SELECT pressionado


no painel de instrumentos. Ser exibido rr=. Solte o
boto e a presso traseira direita ser exibida. Este valor
dever ser fornecido em unidades mtricas. O valor nominal dever ser de 23,4 kg/cm2 (332psi). Valores entre 17,6
e 29,2 kg/cm2 (250 psi e 416 psi) tambm sero aceitos.
16. Pressione e mantenha o boto SELECT pressionado
no painel de instrumentos. Ser exibido In=. Solte o
boto e o valor do inclinmetro ser exibido. Este valor
ser fornecido em graus. O grau de inclinao ir depender do modo como o caminho foi regulado durante
a sua montagem. Valores at 3 sero aceitveis. No
necessrio zerar esta leitura ajustando-se a atitude do
inclinmetro no assento do operador.
17. Pressione e mantenha o boto SELECT pressionado
no painel de instrumentos. Ser exibido PL=. Solte o
boto e a carga til atual ser exibida.
18. Conecte um laptop ao laptop ao sistema PLMIII. Normalmente utiliza-se um cabo EF9160 para download.
O conector do medidor de carga til encontra-se atrs
do assento do operador, na parede de trs da cabina,
DRODGRGRVXSRUWHGH[DomRGR0HGLGRUGHFDUJD~WLO
PLMIII. O laptop dever estar com o Payload Data Manager (Gerenciador de dados de carga til) instalado.
19. Execute o programa.
20. No menu principal, selecione Connect to Payload Meter (Conectar ao medidor de carga til).

Medidor de carga til III

M20008 02/10

 2PHQXGHFRQH[}HVVHUiH[LELGR6HOHFLRQH&RQJXUH
3D\ORDG0HWHU &RQJXUDUPHGLGRUGHFDUJD 

 &RQUPHVHDYHUVmRGRSURJUDPDGRVLVWHPD3/0,,,
corresponde verso mais recente disponvel. Assim
como a verso de 09 de maio do programa EJ0575-1
ser exibido 01/28/01A. A ltima verso poder ser
encontrada em http://www.kms-peoria.com/payload. Se
a verso no corresponder ltima verso indicada na
internet, faa o download da verso mais recente e atualize o programa PLMIII utilizando o aplicativo Flashburn.
Consulte o tpico Confirmao do procedimento de
YHULFDomRSDUDREWHUPDLRUHVLQIRUPDo}HV
 8VDQGRRPHQX&RQJXUDo}HVGR&DPLQKmRIDoDRV
seguintes ajustes:








$MXVWHRKRUiULR
$MXVWHDGDWDSDUDDGDWDGHKRMH
$MXVWHDVXQLGDGHVGRPRVWUDGRUGRLQGLFDGRUSDUDR
sistema mtrico, toneladas curtas ou toneladas longas,
GHDFRUGRFRPRGHVWLQRQDOGRYHtFXOR6HQmRKRXYHU
QHQKXPDHVSHFLFDomRRDMXVWHVHUiIHLWRHP7RQHODdas mtricas.
$MXVWHRWLSRGHFDPLQKmRVHJXQGRRPRGHORDSURSULDGR
do caminho.
3UHVVLRQHRERWmR6DYH&KDQJHV VDOYDUDOWHUDo}HV 
para programar as alteraes no medidor de carga til.

24. Ajuste do nmero de srie do chassi.

M20008 02/10

OBS: O nmero de srie do chassi est localizado


HPXPDSODFD[DGDQRFKDVVLGRFDPLQKmR$SODFD
encontra-se na parte externa, na raia direita inferior,
voltada para o pneu dianteiro direito. muito importante
informar o nmero de srie correto do chassi. Este nmero um dos campos principais utilizados dentro do
banco de dados do ciclo de transporte de carga. O campo capaz de receber 20 caracteres alfanumricos.
 1DWHOD7UXFN&RQJXUDWLRQ &RQJXUDo}HVGR
caminho), digite o nmero de srie do chassi no
campo apropriado.
 3UHVVLRQHRERWmR6DYH&KDQJHV 6DOYDUDOWHraes) para programar as alteraes no medidor de carga til.
25. Ajuste do Nmero da Unidade do Cliente.
OBS: A maioria das operaes em minas atribui um
Q~PHURSDUDGDSHoDGHHTXLSDPHQWRDPGHDJLOL]DUDVXDLGHQWLFDomR(VWHQ~PHURRXQRPHSRGH
ser inserido no campo Customer Unit Number (Nmero da Unidade do Cliente). de extrema importncia que o nmero da unidade do cliente seja informado. Este nmero um dos campos principais dentro
do banco de dados do ciclo de transporte de cargas.
O campo suporta 20 caracteres alfanumricos. Se
QHQKXPQ~PHURGRFDPLQKmRWLYHUVLGRHVSHFLFDGR
informe o nmero de srie do chassi.
 1DWHOD7UXFN&RQJXUDWLRQ &RQJXUDo}HVGR
caminho), digite o nmero do caminho no campo apropriado.
 3UHVVLRQHRERWmR6DYH&KDQJHV 6DOYDUDOWHraes) para programar as alteraes no medidor de carga til.
26. Ajuste do Distribuidor Komatsu.
OBS: Este campo no ciclo do transporte de carga pode
receber o nome do distribuidor Komatsu que ajudou
a instalar o sistema. A Komatsu tambm atribui um
nmero de distribuidor para distribuidor. Este nmero
utilizado em todos os contratos de garantia. Este
nmero do distribuidor Komatsu tambm pode ser introduzido neste campo. Este nmero um dos campos
principais utilizados dentro do banco de dados do ciclo
de transporte de cargas. O campo capaz de receber
20 caracteres alfanumricos. Se o distribuidor no for
conhecido, digite DESCONHECIDO.
 1DWHOD7UXFN&RQJXUDWLRQ &RQJXUDo}HVGR
caminho), digite o nome do distribuidor no campo apropriado.
 3UHVVLRQHRERWmR6DYH&KDQJHV 6DOYDUDOWHraes) para programar as alteraes no medidor de carga til.

Medidor de carga til III

M20-55

27. Ajuste do cliente Komatsu.


OBS: Este campo no registro do ciclo do transporte
de cargas pode receber o nome da mina ou da operao onde o caminho estiver em servio. A Komatsu
tambm atribui um nmero de cliente para cada cliente. Este nmero utilizado em todos os contratos de
garantia. Este nmero de cliente Komatsu tambm
pode ser colocado neste campo. Este nmero um
dos campos principais utilizados dentro do banco de
dados do ciclo de transporte de cargas. O campo
suporta 20 caracteres alfanumricos. Se o cliente no
for conhecido, digite DESCONHECIDO.
1DWHOD7UXFN&RQILJXUDWLRQ &RQILJXUDo}HVGR
caminho), digite o nmero ou o nome do cliente no
campo apropriado.
3UHVVLRQHRERWmR6DYH&KDQJHV 6DOYDUDOWHUDes) para programar as alteraes feitas no medidor
de carga til.
28. Pressione Save Changes (Salvar alteraes) e
IHFKHDWHODGH&RQJXUDo}HVGRFDPLQKmRHR
menu de conexes.
29. No menu principal, selecione a opo Connect to
Payload Meter (Conectar ao medidor de carga til).
30. No menu de conexo, selecione Configure
Payload Meter (Configurar medidor de carga
~WLO &RQUPHVHWRGDVDVDOWHUDo}HVDQWHULRUHV
IRUDPVDOYDVHIHFKHRIRUPXOiULRGH&RQJXUDes do caminho.
31. No meu de Conexo, selecione Real Time Data
(Dados em tempo real).

OBS: O peso exibido na tela de dados em tempo real


o peso suportado pela suspenso e inclui o peso do
caminho. Aplicadas as cargas de teste de presso
suspenso, o valor nominal dever se de 112 toneladas curtas (101 toneladas mtricas).

M20-56

 &RQUPHVHDVSUHVV}HVGDVXVSHQVmRHQFRQWUDPVH
na faixa de trabalho. O valor nominal dever ser de 23,4
kg/cm2 (332 psi). Os valores entre 17,6 e 29,2 kg/cm2
(250 psi e 416 psi) so aceitveis. Registre os valores
exibidos.
 &RQUPHVHRLQFOLQ{PHWURHQFRQWUDVHGHQWURGDIDL[D
de trabalho e registro o valor.
&RQUPHVHDHQWUDGDGRFRUSRGDFDoDPEDOHYDQWDGD
funciona corretamente. Coloque uma arruela de ao no
interruptor de elevao da caamba. A tela de dados em
tempo real dever indicar No (No). Remova a arruela
e a tela passar a indicar Yes (Sim). O estado do ciclo
do transporte de carga ser alterado para Dumping
(Despejando).
 &RQUPHVHDHQWUDGDGHWUDYDPHQWRGRVIUHLRVHVWi
funcionando corretamente. Acione o travamento dos
freios utilizando o interruptor existente no painel de instrumentos. A tela de dados em tempo real dever indicar
a condio ON (Ligado). Desligue o travamento dos freios.
A tela passar a indicar a condio OFF (Desligado).
36. Acendas as luzes verdes indicadoras de carga assinalando a opo Green Light (luz verde) e pressionando
o boto Set Lights (programar luzes). Verifique se
apenas as luzes indicadoras de carga na cor verde
encontram-se iluminadas.
37. Desabilite as luzes verdes e acenda as luzes indicadoras
de carga na cor mbar, assinalando a opo Amber Light
(luz mbar) e pressionando o boto Set Lights (programa
OX]HV 9HULTXHVHDSHQDVDVOX]HVkPEDUVHDFHQGHP
38. Desabilite as luzes mbar e acione as luzes indicadoras
de carga na cor vermelha, assinalando a opo Red
Light (luz vermelha) e pressionando o boto Set Lights
SURJUDPDUOX]HV 9HULTXHVHDSHQDVDVOX]HVYHUPHlhas se acenderam.
39. Desabilite todas as luzes indicadoras de carga til e
SUHVVLRQHRERWmR6HW/LJKWV SURJUDPDUOX]HV &RQUme se todas as luzes se apagaram.
40. Use o procedimento de calibrao do velocmetro para
RWLSRSDUWLFXODUGRFDPLQKmRDPGHVLPXODUXPVLQDO
GHYHORFLGDGHGH03+ .PK &RQUPHVHHVWH
valor exibido pelo velocmetro no painel de instrumentos e pela tela de dados em tempo real. O valor pode
ser de 1 MPH (2 km/h). O travamento dos freios deve
estar desativado para que o PLMIII reconhea a entrada
de velocidade.
41. No computador (PC), feche a tela de dados em tempo
real e o menu de conexes e retorne ao menu principal.

Medidor de carga til III

M20008 02/10

42. Remova o chicote EJ3057 da caixa de juno da suspenso


dianteira esquerda, e os conectores TB42-A e TB42-B.
43. Aguarde pelo menos 1 minuto e remova o chicote
EJ3057 das conexes existentes no lado traseiro esquerdo, na caixa de juno traseira, e os conectores
TB61-B e TB61-C.
44. Aguarde por pelo menos mais 1 minuto e remova o chicote EJ3057 das conexes existentes no lado traseiro
direito, na caixa de juno traseira, e os conectores
TB61-A e TB61-C.
45. Aguarde por mais 1 minuto e remova o chicote EJ3057
das conexes existentes no lado dianteiro direito, na caixa de juno dianteira-direita, e os conectores TB61-B
e TB61-C.
46. Aguarde por mais 1 minuto.
47. No menu principal do programa, pressione o boto Connect
to Payload Meter (Conectar ao medidor de carga til).
48. No menu de conexo, selecione a opo Display Active
$ODUPV ([LELUDODUPHVDWLYRV &RQUPHVHRVTXDWUR
alarmes so exibidos na seqncia correta;
Baixa presso na suspenso dianteira esquerda
Baixa presso na suspenso traseira esquerda
Baixa presso na suspenso traseira direita
Baixa presso na suspenso dianteira direita
49. Feche todas as janelas e desconecte o laptop do siste
ma PLMIII.

CONFIRMAO DO PROCEDIMENTO DE VERIFICAO DO


MEDIDOR DE CARGA TIL PLMIII
Programao do aplicativo Flashburn
Instrues gerais:
Antes de iniciar, verifique a existncia do arquivo
com a extenso .kms, necessrio para programar
o produto e se voc saber onde encontr-lo no seu
computador.
A programao ir cancelar todas as informaes
UHODFLRQDGDVjFRQJXUDomRGRFDPLQKmR
OBS: Antes de iniciar este procedimento, registre as
LQIRUPDo}HVGHFRQJXUDomRGR0HGLGRUGHFDUJD~WLO
possvel localizar essas informaes por meio do
programa de gerenciamento Payload Data Manager.
Aps a programao, ser necessrio restaurar esVDVLQIRUPDo}HVQDSDUWHGHFRQJXUDomRGRPHGLGRU
de carga til.
1.
2.

Desligue a fonte de alimentao do medidor de carga


til desligando a chave de partida.
Execute o aplicativo Flashburn instalado no laptop.

 9HULTXHVHRPHGLGRUGHFDUJD~WLOHVWiGHVOLJDdo e pressione NEXT (prximo).

M20008 02/10

Medidor de carga til III

M20-57

 &RQUPHVHDVFRPXQLFDo}HVHVWmRDGHTXDGDV
antes de programar com o laptop. Geralmente a porta
utilizada a COM 1. Pressione NEXT (prximo).

5.

Pressione BROWSE (pesquisar) e selecione o


arquivo .kms que auxiliar na programao do medidor de carga til. Pressione NEXT (prximo).

7. Aps uma programao bem sucedida, desligue a chave de partida.


8. Aguarde por 20 segundos e volte a ligar a chave.
 6HUiQHFHVViULRFRQJXUDURPHGLGRUGHFDUJD~WLOFRQforme as instrues fornecidas no manual, utilizando o
programa Payload Data Manager instalado no laptop

6. Quando solicitado, ligue a chave de partida para


ativar o medidor de carga til. O computador dar
incio programao do medidor de carga til.
Este processo leva aproximadamente 5 minutos.

M20-58

Medidor de carga til III

M20008 02/10

/LVWDGHYHULFDomRFRQUPDomR
Use a tela de Exibio de Dados em Tempo Real para checar os
LWHQVGDOLVWDGHYHULFDomRIRUQHFLGDQDWDEHODDEDL[R

,WHPDVHUYHULFDGR

Valor

Iniciais

Verso do programa PLMIII


Funcionamento adequado do mostrador e do interruptor do usurio
Presso dianteira esquerda
Presso dianteira direita
Presso traseira esquerda
Presso traseira direita
Inclinmetro
Funcionamento adequado das luzes verdes
Funcionamento adequado das luzes mbar
Funcionamento adequado das luzes vermelhas
Funcionamento adequado da entrada de travamento dos freios
Funcionamento adequado da entrada de elevao do corpo da
caamba
Funcionamento adequado da entrada de velocidade
Data
Caminho
Assinatura

M20008 02/10

Medidor de carga til III

M20-59

ANOTAES

AS PARTES DESTE PRODUTO RELACIONADAS AOS SISTEMAS DE MEDIO DE


CARGA TIL SO FABRICADAS SOB LICENA DE
L.G. HAGENBUCH, detentor das patentes norte-americanas nmeros 4.831.539 e
4.839.835.

M20-60

Medidor de carga til III

M20008 02/10

SEO M31
SISTEMA DE LEO DO MOTOR RESERVA
NDICE
SISTEMA DE LEO DO MOTOR RESERVA........................................................................................................... M31-3
Operao ..................................................................................................................................................... M31-4
Luzes de LED de monitoramento ................................................................................................................ M31-4
Controle de abastecimento do reservatrio (Item opcional) ........................................................................ M31-5
Procedimento de abastecimento (recurso de abastecimento remoto) ........................................................ M31-5
SERVIOS DE MANUTENO ............................................................................................................................... M31-6
A cada 10 horas de operao, ou uma vez em cada turno: ........................................................................ M31-6
A cada 500 horas de operao: ................................................................................................................... M31-6
Troca de leo ............................................................................................................................................... M31-6
DIAGNSTICO DE FALHAS .............................................................................................................................. M31-7
Disjuntor do circuito ou fusvel ..................................................................................................................... M31-7
DIAGRAMAS DO SISTEMA ELTRICO ............................................................................................................ M31-8

M31004 10/07

Sistema de leo do Motor Reserva

M31-1

ANOTAES

M31-2

Sistema de leo do Motor Reserva

10/07 M31004

SISTEMA DE LEO DO MOTOR RESERVA


O sistema de leo do motor reserva projetado para acrescentar maior capacidade de leo para o crter do motor e
reduzir a freqncia de manuteno do leo do motor. A
circulao constante de leo entre o crter do motor e o
tanque reserva (9, Figura 31-1) aumenta o volume total de
leo em operao. Isto auxilia na diluio dos efeitos de
contaminao e perda de aditivos, mantendo a qualidade do
leo por perodos maiores. O sistema adiciona ou remove
RyOHRGRPRWRUFRQIRUPHQHFHVViULRDPGHPDQWHUXP
nvel constante, prevenindo ocorrncias de excesso ou falta
de leo no circuito.
2OWUR  H[LVWHQWHQRFLUFXLWRGHDOLPHQWDomRSURWHJHD
unidade de bombeamento (11) e impede a transferncia
de elementos contaminantes para o crter do motor, que
poderiam chegar ao tanque durante as operaes de manuteno. Alm disso, proporciona um nvel adicional de leo
limpo.
A capacidade do sistema de alimentao normal do leo conduzido para o tanque reserva , a grosso modo, equivalente
ao volume de leo em circulao no motor. No processo de
ajuste contnuo do nvel de leo do motor, h uma circulao
constante de leo entre o motor e o tanque reserva. O volume de leo no tanque se torna parte do leo em operao no
motor. Os intervalos de troca de leo podero normalmente
ser estendidos proporcionalmente ao aumento no volume
de leo de servio. A extenso do intervalo alm de um
aumento proporcional , na maioria das vezes, possvel,
mas dever ser aplicado apenas segundo as determinaes
baseadas na coleta de amostras e anlise do leo. As condies locais, como aplicaes do motor, clima, e qualidade
do combustvel devero ser levadas em considerao antes
de se determinar a vida til permissvel do leo.

M31004 10/07

FIGURA 31-1. TANQUE DE RESERVA DE LEO


1. Tubo de suco
2. Tubo de abastecimento remoto
3. Vlvula de abastecimento
4. Tubo de adio do
motor
5. Interruptor de abastecimento
6. Vlvula de alvio do ar
7. Tubo de abastecimento do reservatrio

Sistema de leo do Motor Reserva

8. Tampa do bocal de
abastecimento do
reservatrio
9. Tanque de reserva
10. Tubo de adio do
motor
11. Unidade de bombeamento
12. Visor de nvel
13. Tubo de adio do
reservatrio

M31-3

Operao

Luz de LED de monitoramento

O leo do motor circula entre o crter de leo do motor (1, Figura 31-2) e o tanque reserva (2) pela ao
de duas bombas de acionamento eltrico (bomba 1 e
bomba 2) dentro de uma nica unidade de bombeaPHQWR  $XQLGDGHGHERPEHDPHQWRp[DGDQDODWHUDO
do tanque reserva. A unidade da bomba equipada com
uma luz de LED de monitoramento em um dos lados.





&RQVWDQWH$ERPEDHVWiVXJDQGRRyOHRGRFiUWHUGR
motor e baixando o nvel do leo.
3XOVDomRUHJXODU$ERPEDHVWiUHWRUQDQGRRyOHR
para o crter do motor e elevando o nvel do leo.
3XOVDomRLUUHJXODU2yOHRHQFRQWUDVHQRQtYHOFRUUHWR
de funcionamento.

A bomba 1 suga o leo do crter (1) em um ponto


de controle predeterminado pela altura do tubo de
suco (3). O leo presente acima deste ponto
coletado e transferido para o tanque reserva. Isto faz
com que o nvel de leo no crter do motor baixe at
que o ar seja removido.
O ar que chega unidade de bombeamento ativa a
bomba 2, que retorna o leo do tanque reserva (2) e
eleva o nvel de leo do motor at que o ar deixe de ser
sugado pela bomba 1. Com isso, a bomba 2 desligada. O nvel de funcionamento ajustado continuamente
no ponto de controle pela alternncia entre a retirada e o
retorno de leo no crter de leo do motor. O leo retornando para o crter estar abaixo do nvel operacional
normal para evitar a aerao do leo.

FIGURA 31-2. DIAGRAMA DO SISTEMA DE RESERVA


1. Crter de leo do motor
2. Tanque de leo
3. Tubo de suco

M31-4

4. Unidade de bombeamento (1 e 2)
5. Vlvula de alvio de ar

Sistema de leo do Motor Reserva

A. Tubo de suco de leo


B. Tubo de retorno do leo
C. Nvel de leo do motor

10/07 M31004

Controle de abastecimento do tanque (opcional)


Com o sistema de leo reserva, o nvel de leo do motor se
mantm constante, onde apenas o tanque reserva necessita
de abastecimento de rotina. O sistema de abastecimento
controla automaticamente o abastecimento do tanque remoto a partir de uma posio conveniente em relao ao
nvel do solo. O abastecimento do tanque at o nvel cheio
apropriado rpido e preciso, levando um intervalo de 2 a 3
minutos para ser concludo.
O tanque de leo reserva do motor projetado para agregar
maior capacidade de leo ao motor e reduzir a freqncia
de manuteno do leo do motor. Ainda assim, o nvel de
yOHRGRPRWRUGHYHUiVHUYHULFDGRDFDGDWURFDGHWXUQRSRU
meio da vareta de medio do nvel de leo.
Se o leo do motor tiver sido drenado do crter de leo do
motor, ser preciso adicionar leo novo atravs do tubo de
abastecimento do motor. Aps uma troca de leo, tanto o
motor como o tanque reserva devero ser completados com
leo antes que seja dada partida.
OBS: NO use o leo do tanque reserva para abastecer o
crter de leo do motor.
O interruptor do sistema (2, Figura 31-3) um interruptor de
acionamento do tipo dinammetro que alimenta o sistema de
abastecimento. O interruptor de partida (3) um interruptor
de boto pressionvel que promove a abertura da vlvula
GHDEDVWHFLPHQWR[DGDQRWDQTXHUHVHUYDSDUDGDULQtFLR
ao abastecimento automtico do tanque reserva. O leo
IRUQHFLGRVRESUHVVmRXLSHODYiOYXODGHDEDVWHFLPHQWRDWp
chegar ao tanque.

FIGURA 31-3. ABASTECIMENTO REMOTO DO


TANQUE DE LEO RESERVA

1.
2.
3.

Caixa de controle
remota
Interruptor do sistema
Interruptor de partida

4.
5.

Luz indicadora de tanque CHEIO


Luz indicadora de ABERTURA DA VLVULA

Procedimento de abastecimento (recurso de abastecimento remoto)


OBS: Este procedimento adiciona leo ao tanque reserva.
1. Conecte a mangueira de suprimento de presso do novo
leo ao acoplador rpido no caminho. Abra a vlvula na
mangueira de suprimento para aplicar presso.
2. Puxe o interruptor do sistema (2, Figura 31-3) para ativar
o sistema de abastecimento.
3. Pressione o interruptor de partida (3). A luz indicadora de
$%(5785$'$9/98/$  GHYHUiVHDFHQGHUFRQUPDQdo o incio do processo de abastecimento.
4. Quando o tanque estiver cheio, a luz indicadora de ABERTURA DA VLVULA apagar e a luz indicadora de tanque
CHEIO (4) se acender.
5. Feche a vlvula de suprimento de leo acoplada mangueira de abastecimento.
6. Pressione e mantenha pressionado o interruptor de partida (3) por alguns segundos para aliviar a presso do leo
no tubo.
7. Desconecte a mangueira de suprimento de leo novo.
8. Pressione o interruptor (2) para desligar a alimentao do
sistema de abastecimento.
M31004 10/07

Sistema de leo do Motor Reserva

M31-5

SERVIOS DE MANUTENO

A cada 500 horas de operao:

Entre as drenagens de leo, a nica manuteno


normal necessria consiste em completar rotineiramente o leo no tanque de suprimento reserva. A
manuteno dos nveis de funcionamento deve ser
YHULFDGDSHULRGLFDPHQWHWDQWRPDQXDOPHQWHDQWHV
de dar a partida, como por meio das luzes do sistema
de monitoramento na unidade de bombeamento do
tanque reserva (11, Figura 31-1) enquanto o motor
estiver em funcionamento.

 7URTXHWRGRVRVOWURVGRVLVWHPDHGRPRWRUVHDSOLFiYHO
2. As falhas no sistema costumam ser causadas muito
mais por conexes eltricas inadequadas do que todas
DVRXWUDVFDXVDVFRPELQDGDV9HULTXHVHDVFRQH[}HV
eltricas esto bem apertadas e livres de sinais de corURVmRRXGDQRVItVLFRV9HULTXHDEDWHULDRDOWHUQDGRU
o interruptor de presso de leo, as caixas de juno, a
caixa de abastecimento de controle remoto os disjuntores de circuito.
3. Examine os cabos eltricos em toda a sua extenso
SDUDVHFHUWLFDUTXHQmRKiGDQRV
4. Pequenos vazamentos na mangueira podem causar
mau funcionamento do sistema. Examine todas as mangueiras, incluindo aquelas no tanque reserva e as que
OLJDPRWDQTXHDRPRWRUYHULFDQGRVHQmRKiYD]DPHQWRVUDFKDGXUDVRXDYDULDV9HULTXHWRGDVDVJXDUnies quanto ao seu grau de aperto, examinando tambm
se causam vazamento ou se apresentam avarias.

+iDLQGDXPOWURHPOLQKD GHWHOD LQVWDODGRQDHQtrada da vlvula de abastecimento (3, Figura 31-1).


(VWHOWURQmRH[LJHPDQXWHQomRSHULyGLFDPDVSRder ser limpo removendo-o do sistema e lavando-o
SRUDSOLFDomRGHiJXDDWUDYpVGROWUR

CUIDADO

&8,'$'29HULTXHVHPSUHRQtYHOGHyOHRDQWHV
GHGDUDSDUWLGD8VHDYDUHWDGHPHGLomRGRQtYHO
GHyOHRGRPRWRU
A cada 10 horas de operao, ou uma vez em cada
de turno:
 QWHVGHGDUDSDUWLGDYHULTXHRQtYHOGHyOHR
usando a vareta de medio do nvel de leo
do motor. O nvel de leo dever estar na faixa
GHRSHUDomRQRUPDO'RFRQWUiULRYHULTXHVHR
sistema reserva est funcionando normalmente.
2. A qualidade do leo do motor ser melhor se o
tanque reserva for mantido praticamente cheio.
Verifique o nvel de leo no tanque reserva.
Como uma orientao bsica, se o leo estiver
abaixo do nvel entre a metade do tanque e o
tanque cheio, abastea o tanque manualmente
DWpTXHRyOHRTXHYLVtYHOQROLPLWHVXSHULRUGR
visor de nvel, ou use o mtodo de controle de
abastecimento automtico.
 $SyVGDUDSDUWLGDHDTXHFHURPRWRUYHULTXHR
VLQDO /(' GRQtYHOGHyOHRGRPRWRUSDUDYHULFDU
se o motor est sendo mantido no nvel predeterminado de leo em funcionamento. O sinal dever
alternar entre perodos de linearidade e piscante.

Troca de leo
1. Drene tanto o crter como o tanque reserva. Em seguida
reabastea-os com leo novo at atingir os nveis espeFLFDGRV
 7URTXHRVOWURVGRWDQTXHUHVHUYDHGRPRWRUFRQIRUPH
houver necessidade.
 'rDSDUWLGDHYHULTXHVHRIXQFLRQDPHQWRHVWiQRUPDO
OBS.: No use o leo do tanque reserva para completar o
crter do motor. Ambos devero estar em seus nveis adequados antes da partida do motor.
2QtYHOGHyOHRGRPRWRUGHYHUiVHUYHULFDGRFRPDYDUHWD
de medio do nvel de leo a cada troca de turno. O nvel de
yOHRQRWDQTXHUHVHUYDWDPEpPGHYHUiVHUYHULFDGRDFDGD
troca de turno. O leo dever estar visvel no meio do visor
indicador. Do contrrio, adicione leo no tanque reserva at
TXHTXHYLVtYHOQRDOWRGRYLVRUGHQtYHO

NOTA: O leo deve estar sempre visvel no visor de


nvel inferior. Se o reservatrio for equipado com trs
visores de nvel, o leo deve estar sempre visvel no
visor de nvel intermedirio.

M31-6

Sistema de leo do Motor Reserva

10/07 M31004

DIAGNSTICO DE FALHAS
eLPSRUWDQWHTXHVHFRPSUHHQGDRVLJQLFDGRGRVVLQDLV
das luzes de LED da unidade de bombeamento. Elas so
utilizadas basicamente para verificar se o sistema est
mantendo o nvel de leo na altura da extremidade aberta
do tubo de suco, no crter de leo do motor. Alm disso,
o sinal tambm serve como uma ferramenta importante na
deteco das falhas do sistema.
4XDQGRRVLQDOHVWi&2167$17( VHPSLVFDU VLJQLFD
que a bomba 1 est funcionando e o leo est sendo sugado
do motor e transferido para o tanque reserva.
Quando o sinal est PISCANDO, a bomba est sugando ar
pelo tubo de suco, que dispara a operao da bomba 2
para operar e transferir o leo de volta para o motor do tanque (a condio piscante na verdade os pulsos da bomba
2). Quando o leo encontra-se no nvel correto, no motor, o
ar e o leo entram alternadamente no tubo de suco, com
a bomba 1 comandando a operao da bomba 2 com cada
parte de ar que passa pelo tubo.
Este um teste completo para verificar o funcionamento
apropriado da unidade de bombeamento. possvel realizar
essa operao sem que seja preciso ligar o motor, conectando
apenas o interruptor de presso do leo, que ativa o sistema.
6HRVLQDOOXPLQRVRHVWLYHU&2167$17(VLJQLFDTXH
a bomba 1 est bombeando leo. Faa a verificao
soltando a mangueira na sada da bomba 1 para checar
VHQmRKiX[RGHyOHR DERPEDpPDUFDGDSRUXPD
ranhura na sua rea de sada).
2. Solte a mangueira na entrada da bomba 1 para coletar
o ar. A bomba 2 passar, assim, a operar e o sinal coPHoDUiDSLVFDU9HULTXHRFRUUHWRERPEHDPHQWRGD
bomba 2 soltando a mangueira na sua parte de sada e
YHULFDQGRVHQmRKiX[RGHyOHR
3. Reinstale a mangueira de entrada na bomba 1. A bomba
dever, mais uma vez, receber leo e a condio piscante dever parar.

M31004 10/07

OBS: H uma outra condio capaz de indicar um


nvel mais alto de leo do que o ponto controlado.
Em uma situao onde tanto o motor como o tanque
reserva sejam abastecidos em excesso, no haver
ambiente no tanque para remover o leo e baixar o
nvel no motor. Nesse caso, o sinal de LED no pra
nunca de PISCAR porque a bomba 1 jamais recebe
ar. Ela prosseguir bombeando ar do motor para o
tanque, mas em funo do tanque estar cheio, o leo
retornar para o motor por meio da vlvula de alvio
de ar, localizada na parte superior do tanque.
H duas explicaes possveis para um abastecimento excessivo do tanque e do motor:



4XDQGR R WDQTXH p DEDVWHFLGR DWp R QtYHO


CHEIO e o motor recebe leo em excesso.
4XDQGRRyOHRpDGLFLRQDGRGLUHWDPHQWHSDUDR
motor entre as trocas de leo. O sistema transfere o leo para o tanque reserva at que este no
possa mais receber leo, enquanto o motor permanece superabastecido. Por isso importante
que o leo seja adicionado apenas ao tanque
UHVHUYDHQWUHDVWURFDVGHyOHRH[FHWRFODURVHR
nvel de leo no motor estiver extremamente baixo.

Fusvel do circuito
O Sistema Reserva protegido por um fusvel de 15
(Bloco de fusveis 2, posio 10), localizado no gabinete de controle auxiliar.
A unidade da bomba protegida por um fusvel de 15
ampres (Bloco de fusveis 2, posio 9), localizado
no gabinete de controle auxiliar
Para obter informaes relacionadas ao circuito, consulte
RGLDJUDPDGRVLVWHPDQRQDOGRPDQXDOGHRFLQD

Sistema de leo do Motor Reserva

M31-7

DIAGRAMA DO SISTEMA ELTRICO

FIGURA 31-4. DIAGRAMA DO SISTEMA DE ABASTECIMENTO


1. Vlvula de abastecimento
2. Sensor do nvel de leo (alto do tanque reserva de leo)
3. Disjuntor do circuito de 15 Amp

M31-8

4. Caixa de desconexo da bateria


5. Fio terra
6. Caixa de controle de abastecimento remoto

Sistema de leo do Motor Reserva

10/07 M31004

SEO M32
SISTEMA DE ESCADA RETRTIL
NDICE
SISTEMA DE ESCADA RETRTIL ..............................................................................................................................M32-6
REGRAS GERAIS DE SEGURANA ................................................................................................................M32-6
DESCRIO DO SISTEMA DA ESCADA DE ACESSO ....................................................................................M32-6
OPERAO DO SISTEMA DA ESCADA DE ACESSO .....................................................................................M32-6
Operao normal .........................................................................................................................................M32-6
Operao de emergncia ............................................................................................................................M32-8
Operao do interruptor de limitao ..........................................................................................................M32-8
PAINEL DE CONTROLE INTERNO DA CABINA...............................................................................................M32-8
CARACTERSTICAS DO PAINEL DE CONTROLE INTERNO DA CABINA....................................................M32-10
Tela de exibio digital ..............................................................................................................................M32-10
Botes de comando...................................................................................................................................M32-10
FUNES DO PAINEL DE CONTROLE INTERNO DA CABINA....................................................................M32-12
Controle de temporizao .........................................................................................................................M32-12
Condio do sistema da escada de acesso ..............................................................................................M32-12


,GHQWLFDomRGRVFyGLJRVGHIDOKD ............................................................................................................M32-12

&RQJXUDomRGRVLVWHPDGDHVFDGDGHDFHVVR ........................................................................................M32-13
Bloqueio do painel de controle interno da cabina......................................................................................M32-13
Elevao automtica .................................................................................................................................M32-13

'LDJQyVWLFRV .....................................................................................................................................................M32-13
Manuteno ...............................................................................................................................................M32-13
USO DO PAINEL DE CONTROLE INTERNO DA CABINA..............................................................................M32-14
Elevando a escada de acesso...................................................................................................................M32-14
Baixando a escada de acesso...................................................................................................................M32-15
USO DA CAIXA DE CONTROLE AO NVEL DO SOLO ..................................................................................M32-16
Elevando a escada de acesso...................................................................................................................M32-16
Baixando a escada de acesso...................................................................................................................M32-16

M32002

Sistema de escada retrtil

M32-1

OPERAO DO PACOTE HIDRULICO ........................................................................................................M32-17


MANUTENO ................................................................................................................................................M32-21
Noes de segurana aplicadas manuteno........................................................................................M32-21
Movimentos inesperados da escada de acesso........................................................................................M32-21
Elevao automtica da escada ...............................................................................................................M32-21
Recarga automtica do acumulador (escada na posio ELEVADA) .......................................................M32-22
PROCEDIMENTOS DE MANUTENO PREVENTIVA..................................................................................M32-23
Inspees dirias.......................................................................................................................................M32-23


,QVSHo}HVDFDGDKRUDVGHRSHUDomR ................................................................................................M32-23

,QVSHo}HVDFDGDKRUDVGHRSHUDomR ................................................................................................M32-23

EXECUAO DOS SERVIOS DE MANUTENO ........................................................................................M32-24




9HULFDomRGRQtYHOGHyOHRGRUHVHUYDWyULR..............................................................................................M32-24

7URFDGRXLGR5/6 ...................................................................................................................................M32-24
Limpeza do RLS ........................................................................................................................................M32-25

DIAGNSTICO DO RLS ..................................................................................................................................M32-25




'HVFULomRGRVUHFXUVRVGHGLDJQyVWLFR .....................................................................................................M32-25
Monitoramento continuo do sistema..........................................................................................................M32-26

5HYLVmRGRVGDGRVGRKLVWyULFRGRVLVWHPD ..............................................................................................M32-27
Monitoramento da integridade nas comunicaes ....................................................................................M32-27

,QIRUPDo}HVVREUHVHUYLoRVHUHJLVWURV .....................................................................................................M32-27
Registros de eventos do sistema ..............................................................................................................M32-28

NVEIS DE ACESSO DE SEGURANA ..........................................................................................................M32-29




1tYHOGHDFHVVR1(1+80 ..................................................................................................................M32-29

1tYHOGHDFHVVR5(675,72 ................................................................................................................M32-29

1tYHOGHDFHVVR&203/(72 ..............................................................................................................M32-29
Privilgios de acesso do usurio ...............................................................................................................M32-30

,''28685,26(1+$..............................................................................................................................M32-31
Opes de seleo de valores de campo seqenciais .............................................................................M32-31

,''28685,2&21),*85$d2'(12928685,2..........................................................................M32-32

M32-2

7DEHODGHFDUDFWHUHVQDFRPSRVLomRGDVVHQKDV.....................................................................................M32-31

Sistema de escada retrtil

M32002

FALHAS DO SISTEMA.................................................................................................................................... M32-32




7LSRGHIDOKD(UURGHFRPXQLFDomR ...................................................................................................... M32-33

7LSRGHIDOKDIXVtYHOGH$$TXHLPDGR ......................................................................................... M32-33

7LSRVGHIDOKD%RELQDGDERPED6XELU'HVFHU$EULU)HFKDU HPFXUWRRXGHVFRQHFWDGD

$EULU)HFKDUUHOHYDQWHVRPHQWHSDUDHVFDGDJLUDWyULD .......................................................................... M32-34

7LSRGHIDOKD5HFDUJDGRSDFRWHKLGUiXOLFRH[FHVVLYDPHQWHORQJD .................................................... M32-34

7LSRGHIDOKD)DOKDQRUHOpLQLELGRU ...................................................................................................... M32-35

7LSRVGHIDOKD)DOKDQRUHOpGDOX]VLUHQH .................................................................................... M32-35

7LSRGHIDOKD$HVFDGDXOWUDSDVVDROLPLWHVXSHULRU ........................................................................... M32-36

7LSRGHIDOKD$HVFDGDQmRDOFDQoDRVHXOLPLWH ................................................................................ M32-36

7LSRGHIDOKD$HVFDGDSHUPDQHFHVREUHRVHXOLPLWH ....................................................................... M32-37

7LSRGHIDOKD%DL[RQtYHOGRyOHR ....................................................................................................... M32-37

7LSRGHIDOKD7HQVmRGRVLVWHPDDFLPDGH9GXUDQWHRPRYLPHQWR .............................................. M32-38

7LSRGHIDOKD7HQVmRGRVLVWHPDDEDL[RGH9 ................................................................................ M32-38

7LSRGHIDOKD7HQVmRGRVLVWHPDDFLPDGH9 ................................................................................. M32-39

7LSRVGHIDOKD,QWHUUXSWRUFRPXWDGRUUHPRWRGH(/(9$d2HRX'(6&,'$
retido por muito tempo (quando equipado) .............................................................................................. M32-39

7LSRGHIDOKD7HPSRGHUHFDUJDGRDFXPXODGRUVXSHULRUDXPDKRUD ............................................... M32-40

7LSRGHIDOKD(OHYDomRGRVLVWHPDSHORIUHLRGHHVWDFLRQDPHQWR ..................................................... M32-40

7LSRVGHIDOKD1tYHLVGHVHUYLoRHYHQFLGRV .......................................................................... M32-41

7LSRGHIDOKD1tYHLVGHVHUYLoRHFRPSOHWRV ................................................................................ M32-41

GERENCIAMENTO DE DADOS ..................................................................................................................... M32-42


Arquivos de registro.................................................................................................................................. M32-42


*HUDomRGHUHODWyULRV ............................................................................................................................... M32-43

DIAGRAMAS DO MENU ................................................................................................................................. M32-49




&RQJXUDomRGDFRQWURODGRUD .................................................................................................................. M32-49

,QIRUPDo}HVGHFRQWDWR ............................................................................................................................ M32-49


Exibir registros recentes ........................................................................................................................... M32-49

&RQJXUDomRGRVLVWHPD .......................................................................................................................... M32-49


Carregar registros USB ......................................................................................................................... M32-49

M32002

'LDJQyVWLFRV ............................................................................................................................................. M32-49

Sistema de escada retrtil

M32-3

ANOTAES

M32-4

Sistema de escada retrtil

M32002

FIGURA 32-1. SISTEMA DE ESCADA RETRTIL (BAIXADA)


(INSTALAO DO MODELO 830E-1AC)

M32002

Sistema de escada retrtil

M32-5

SISTEMA DE ESCADA RETRTIL


(Item opcional)
REGRAS GERAIS DE SEGURANA
Os procedimentos de segurana apresentados
DVHJXLUGHYHPVHUVHJXLGRVSDUDJDUDQWLUQtYHLV
seguros de operao e utilizao do Sistema de
Escada Retrtil (RLS).






1. NO pule ou corra pelas escadas.


2. NO sobrecarregue a escada. Uma pessoa
por vez deve usar a escada.
3. S e g u r e o s c o r r i m e s q u a n d o e s t i v e r
utilizando a escada.
 6HPSUHSRVLFLRQHVHXFRUSRGHIUHQWHSDUDD
escada ao subir ou descer por ela.
5. NO permanea na escada quando o
VLVWHPDHVWLYHUHOHYDQGRDRXEDL[DQGRDRX
TXDQGRRFDPLQKmRHVWLYHUHPPRYLPHQWR
 6HPSUHIDoDXPDLQVSHomRYLVXDOQDHVFDGD
para garantir que a unidade no est
GDQLFDGD
 &RQILUPH VH D HVFDGD HVWi WRWDOPHQWH
baixada em
sua posio antes de
subir a bordo por ela.
 0DQWHQKD VXDV PmRV H GHGRV GLVWDQWHV
dos pontos de presso enquanto a escada
estiver em movimento.
 9HULILTXH VHPSUH SDUD JDUDQWLU TXH QmR
K i  S H V V R D V  Q D  H V F D G D  R X  Q D V  V X D V
proximidades enquanto esta se movimenta.
10. A escada deve ser mantida limpa e livre de
XPLGDGHJUD[DHyOHR
 4XDQGR HVWLYHU QD FDELQD GR FDPLQKmR
utilize sempre o painel de controle interno da
cabina para elevar a escada.
12. Relate imediatamente para o pessoal
encarregado da manuteno quaisquer
GHIHLWRVTXHIRUHPREVHUYDGRV

DESCRIO DO SISTEMA DE ESCADA DE


ACESSO
256/ 6LVWHPDGH(VFDGD5HWUiWLOQDVLJODHPLQJOrV 
FRQVLVWHGHXPDHVFDGDGHDFHVVRFRPDFLRQDPHQWRHOHWUR
KLGUiXOLFRDOLPHQWDGDSHORVLVWHPDHOpWULFRGH9FFGR
FDPLQKmR25/6SURSRUFLRQDPHLRVVHJXURVSDUDVXELURX
GHVFHUGRFDPLQKmRVREFRQGLo}HVQRUPDLVRXLVLWXDo}HV
de emergncia. O RLS composto de dois componentes de
FRQWUROHSULQFLSDLVRSDLQHOGHFRQWUROHORFDOL]DGRQDFDELQD
HRSDFRWHGHDFLRQDPHQWRTXHRSHUDDHVFDGD FRQVXOWHD
JXUD 
1. O p a i n e l d e c o n t r o l e d a c a b i n a u m
PLFURSURFHVVDGRUTXHFRQWURODPRQLWRUDDUPD]HQD
e transmite os dados operacionais do sistema da
escada retrtil.

 2 SDFRWH GH DFLRQDPHQWR HOHWURKLGUiXOLFR p
IRUQHFLGRHPXPJDELQHWHGHDoRLQR[LGiYHODR
QtYHOGRVROR1HOHHVWmRDUPD]HQDGRVRVSULQFLSDLV
FRPSRQHQWHVGHFRQWUROHHOpWULFRVHKLGUiXOLFRV
utilizados para suspender ou baixar a escada.

2 5/6 WDPEpP p FRPSRVWR GH FKLFRWH GH ILDomR


FRQHFWRUHVHVWLORDOHPmRPDQJXHLUDVKLGUiXOLFDVHXPD
vlvula redutora de emergncia.

OPERAO DO SISTEMA DA ESCADA DE


ACESSO
Operao normal
'XUDQWHDRSHUDomRQRUPDOXPDSHVVRDSRGHEDL[DURX
elevar o sistema de escada retrtil (RLS) utilizando os
VHJXLQWHVHTXLSDPHQWRV


3DLQHOGHFRQWUROHLQWHUQRGDFDELQD

&DL[D GH FRQWUROH DR QtYHO GR VROR ORFDOL]DGD


SUy[LPRjFDL[DGHLVRODPHQWRGDEDWHULD

,QWHUUXSWRUHVGHFRQWUROHQRSDFRWHGHDFLRQDPHQWR

OBS.: Tanto o interruptor de desconexo mestre, localizado


na caixa de isolamento, como
o interruptor de isolamento, no pacote de acionamento,
devem estar ligados (posio ON) para que o sistema RLS
funcione.
&RPRXPDPHGLGDGHVHJXUDQoDDX[LOLDURVLVWHPD5/6
XWLOL]DXPLQWHUEORTXHDPHQWRSRUIUHLRGHHVWDFLRQDPHQWR
&RPLVVRRIUHLRGHHVWDFLRQDPHQWRGRYHtFXORGHYHHVWDU
aplicado para que a escada possa ser operada sob condies
normais. O sistema RLS ir elevar a escada automaticamente
VHRRSHUDGRUOLEHUDURIUHLRGHHVWDFLRQDPHQWRHSUHVVLRQDU
inadvertidamente o boto UP (Elevar) no painel de controle
LQWHUQRGDFDELQDDQWHVGHDFLRQDURFDPLQKmR

M32-6

Sistema de escada retrtil

M32002

FIGURA 32-2. PACOTE DE ACIONAMENTO HIDRULICO E PAINEL DE CONTROLE INTERNO DA CABINA

M32002

Sistema de escada retrtil

M32-7

Operao de emergncia
(P XPD VLWXDomR GH HPHUJrQFLD R VLVWHPD GH
escada retrtil (RLS) pode ser baixado utilizando
DYiOYXODUHGXWRUDGHHPHUJrQFLD )LJXUD 
LQVWDODGDQRFKDVVLDFLPDGRFRQMXQWRGHIDUyLVGR
lado esquerdo. A vlvula redutora de emergncia
DOLYLDDSUHVVmRKLGUiXOLFDGRVLVWHPDGDHVFDGDH
pemite que a escada desa suavemente ao solo.

Operao do interruptor de limitao


O sistema RLS utilize um interruptor de limitao superior
para monitorar a posio da escada e garantir que a mesma
VHMDPDQWLGDQDSRVLomRHOHYDGD 83 HQTXDQWRRFDPLQKmR
HVWLYHUVHGHVORFDQGR&RPRFDPLQKmRHPPRYLPHQWRD
tela do painel de controle interno da cabina indica a posio
H[DWDGDHVFDGDSRUPHLRGDH[LELomRGHWH[WRVHJUiFRV
para o operador.
Se a escada perder contato do interruptor de limitao
SRU PDLV GH WUrV VHJXQGRV R SDFRWH GH DFLRQDPHQWR
KLGUiXOLFRIDUiXPDWHQWDWLYDSDUDUHSRVLFLRQDUDHVFDGD
Esta ao poder ocorrer no mximo por trs vezes a cada
KRUDDLQWHUYDORVVXSHULRUHVDRLWRPLQXWRV(VVHVOLPLWHV
HVWDEHOHFLGRVSURWHJHPRSDFRWHKLGUiXOLFRGHRSHUDo}HV
desnecessrias e combustes inevitveis do motor eltrico
de 24 V.
2DODUPHLQGLFDGRUGHIDOKDVHUiDWLYDGRHDPHQVDJHP
ESCADA desconectada do interruptor de limitao ser
exibida no painel de controle interno da cabina. Deve-se dar
FRQKHFLPHQWRGRDODUPHSUHVVLRQDQGRVHRVERW}HV>(;,7@
(SAIR) ou [ENTER] no painel de controle interno da cabina.
Se a escada no retomar o contato com o interruptor de
limitao dentro de um intervalo de tempo predeterminado
GHWUrVVHJXQGRVRDODUPHVHUiUHDWLYDGR

),*85$9/98/$5('8725$'((0(5*1&,$
1. Vlvula redutora de emergncia
2. Grade
3DUDEDL[DUDHVFDGDJLUHDDOoDGDYiOYXODUHGXWRUD
GHHPHUJrQFLDQRVHQWLGRKRUiULR$HVFDGDGHVFHUi
lentamente at atingir o solo.
3DUDUHWRUQDUDHVFDGDjVXDSRVLomRRULJLQDOJLUH
DDOoDHPVHQWLGRDQWLKRUiULR HFRPDHQHUJLD
UHVWDXUDGDQRSDFRWHGHDFLRQDPHQWRSUHVVLRQHR
boto [UP] (ELEVAR) para suspender a escada.

OBS.: Dependendo da razo pela qual a escada perde o


contato com o interruptor de limitao superior (defeito no
interruptor, dano fsico causado escada, etc.), mesmo
com um alarme de falha, possvel suspender a escada
GHPDQHLUDVXFLHQWHSDUDTXHRYHtFXORVHGHVORTXHVHP
ULVFRGHGDQLFDURVLVWHPD5/6(VWDSRVVLELOLGDGHSHUPLWH
a execuo de reparos e servios de manuteno de modo
mais conveniente.
&RQWXGRpGDLQWHLUDUHVSRQVDELOLGDGHGRRSHUDGRULQYHVWLJDU
as condies da escada antes de continuar a operar o
caminho. O alarme de falha do sistema RLS serve como
XPOHPEUHWHSDUDRRSHUDGRUQRWLFDQGRRGDH[LVWrQFLDGH
XPSUREOHPDTXHH[LJHVXDDWHQomR

PAINEL DE CONTROLE INTERNO DA CABINA


2SDLQHOGHFRQWUROHLQWHUQRGDFDELQD )LJXUD HVWi
localizado no lado esquerdo do painel de instrumentos e
FRQWpPXPPLFURSURFHVVDGRUTXHFRQWURODH[LEHPRQLWRUD
armazena e transmite todos os dados relacionados
operao do sistema da escada de acesso. O painel de
FRQWUROHLQWHUQRGDFDELQDIRUQHFHLQIRUPDo}HVHPWHPSR
real ao operador sobre a posio da escada de acesso.

OBS.: A ala da vlvula redutora de emergncia


deve ser colocada em sua posio original antes de
reativar a escada.

M32-8

Sistema de escada retrtil

M32002

FIGURA 32-4. CONTROLES DA CABINA (VISTA DO OPERADOR)


1. Painel de controle interno da cabina

M32002

Sistema de escada retrtil

M32-9

P R O P R I E D A D E S D O PA I N E L D E
CONTROLE INTERNO DA CABINA
O painel de controle interno da cabina composto de
XPDWHODGLJLWDOGHH[LELomRERW}HVGHFRPDQGR >83@
(/(9$5 >'2:1@ %$,;$5 >(17(5@ $&(,7$5 
>(;,7@ 6$,5  >/()7@ (648(5'$  >5,*+7@
(DIREITA)) para operar a escada atravs dos vrias
WHODVGHH[LELomRGRPHQXXPDSRUWD86%HXPD
porta RS232 para transmitir os dados operacionais
do sistema da escada retrtil para um laptop na
H[HFXomRGRGLDJQyVWLFRGHIDOKDV2SDLQHOGH
FRQWUROHHVWiFRQHFWDGRDXPFKLFRWHHOpWULFRFRPXP
plugue de 15 pinos. Observe a Figura 32-5.

Tela do visor digital


$WHODGRSDLQHOGHFRQWUROHLQWHUQRGDFDELQD )LJXUD
 LQIRUPDDRXVXiULRDFRQGLomRGRVLVWHPD
mensagens de erro e um indicador visual da posio
GDHVFDGD EDL[DGDHOHYDGDHPPRYLPHQWR 

Botes de comando
2ERWmR>83@ (/(9$5  )LJXUD H[HFXWD
XPFRQWUROHGHGXSODIXQomRXWLOL]DGRSDUDHOHYDU
a escada durante as operaes normais e tambm
para acessar as opes do menu. Pressione este
boto e segure-o brevemente para elevar a escada.
$RSUHVVLRQDUHHPVHJXLGDVROWDUHVWHERWmRFDGD
OLQKDGRPHQXVHUiVHOHFLRQDGDHPDQWrORDSHUWDGR
IDUi FRP TXH RV LWHQV GD OLVWD GR PHQX VHMDP
selecionados continuamente.

M32-10

2ERWmR>'2:1@ %$,;$5  )LJXUD WDPEpPH[HFXWD


XPFRQWUROHGHGXSODIXQomRXWLOL]DGRSDUDEDL[DUDHVFDGD
durante operaes normais e acessar as opes do menu.
Pressione este boto e segure-o brevemente para baixar
DHVFDGD$RSUHVVLRQDUHHPVHJXLGDVROWDUHVWHERWmR
FDGDOLQKDGRPHQXVHUiVHOHFLRQDGDHPDQWrORDSHUWDGR
IDUiFRPTXHRVLWHQVGDOLVWDGRPHQXVHMDPVHOHFLRQDGRV
continuamente.

2ERWmR>(17(5@ $&(,7$5  )LJXUD pXPERWmR


GHP~OWLSODVIXQo}HVXWLOL]DGRSDUDDFLRQDURDODUPHGH
IXQFLRQDPHQWRGRVLVWHPDGDHVFDGDHDFHVVDURPHQX
quando o painel se encontra no Modo de Exibio. Este
ERWmRWDPEpPpXWLOL]DGRSDUDFRQILUPDURXDFHLWDUDV
alteraes mostradas na tela do visor. Pressione este boto
SDUDFRQUPDURXDFHLWDUDVDOWHUDo}HV
relacionadas na tela.

2ERWmR>(;,7@ 6$,5  )LJXUD pXPERWmRGHP~OWLSODV


IXQo}HVXWLOL]DGRSDUDDFLRQDURDODUPHGHIXQFLRQDPHQWR
do sistema da escada e acessar o menu quando o painel
se encontra no Modo de Exibio. Este boto tambm
utilizado para sair das telas do menu. Pressione este boto
para sair completamente das telas do menu.

Sistema de escada retrtil

M32002

CONTROLE DO SISTEMA
DE ACESSO

FIGURA 32-5. PAINEL DE CONTROLE INTERNO DA CABINA (VISTA FRONTAL)

M32002

1. Tela do visor
2. Boto [UP] (ELEVAR)
%RWmR>'2:1@ %$,;$5 

4. Boto [LEFT] (ESQUERDA)


5. Boto [RIGHT] (DIREITA)
%RWmR>(17(5@ $&(,7$5 

Sistema de escada retrtil

7. Boto [EXIT] (SAIR)


8. Porta USB
3OXJXHGRFKLFRWHGHSLQRV

M32-11

2ERWmR>/()7@ (648(5'2  )LJXUD p


XVDGRSDUDDFHVVDURVLWHQVjHVTXHUGDDSyVD
LQVHUomRGDVHQKD

Status do sistema da escada


2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDLQIRUPDQDWHODD
posio e a condio do sistema da escada de acesso.
(QTXDQWR D HVFDGD VH HQFRQWUD HP PRYLPHQWR XPD
imagem animada da escada indica se a mesma est sendo
elevada ou baixada.

2ERWmR>5,*+7@ ',5(,72  )LJXUD pXVDGR


SDUDDFHVVDURVLWHQVjGLUHLWDDSyVDLQVHUomRGD
VHQKD

$SRUWD86% )LJXUD HVWiORFDOL]DGDQDODWHUDO


do painel de controle e permite ao usurio acessar
e baixar os dados operacionais da escada em um
GLVSRVLWLYR86%RXXPDXQLGDGHDVKSDUDSRVWHULRU
anlise.

O painel de controle est conectado ao sistema


HOpWULFRSRUPHLRGHXPSOXJXHGHSLQRV )LJXUD
32-5).

FUNES DO PAINEL DE CONTROLE


INTERNO DA CABINA
$VIXQo}HVQRUPDLVGRSDLQHOGHFRQWUROHLQWHUQRGD
FDELQDVmRDSUHVHQWDGDVDVHJXLU
Controle de temporizao
O painel de controle interno da cabina controla
automaticamente o tempo das operaes de
elevao e descida da escada.

M32-12

,GHQWLFDomRGRVFyGLJRVGHIDOKDV
O painel de controle interno da cabina exibe mensagens
HFyGLJRVGHIDOKDGRVLVWHPDDOpPGHSURGX]LUXPDOHUWD
VRQRURDXGtYHOTXDQGRXPDIDOKDRXSUREOHPDpGHWHFWDGR
2VLVWHPDpSURJUDPDGRSDUDGLDJQRVWLFDUGLIHUHQWHV
WLSRVGHFyGLJRVGHIDOKDVHPHQVDJHQV$VIDOKDVGR
sistema devem ser corrigidas para garantir uma operao
LQLQWHUUXSWDGDHVFDGD&RQVXOWHDVHomRUHIHUHQWHDRV
'LDJQyVWLFRVPDLVDGLDQWHQHVWHFDStWXORSDUDREWHUPDLV
LQIRUPDo}HV

Sistema de escada retrtil

M32002

&RQJXUDomRGRVLVWHPDGDHVFDGD
O painel de controle interno da cabina permite que somente
pessoas autorizadas alterem o tempo de acionamento
GRVLVWHPDHOHWURKLGUiXOLFRRGHVOLJDPHQWRGDVOX]HVGR
SDLQHOGHVOLJDPHQWRGDWHODGRYLVRUHDVFRQJXUDo}HVGH
DMXVWHGHGLDHKRUD2DFHVVRpSURWHJLGRSRUVHQKDSDUD
HYLWDUDOWHUDo}HVDFLGHQWDLVGRVLVWHPDRXSURYRFDGDVSRU
pessoal no-autorizado.

Elevao automtica
O painel de controle interno da cabina suspende a
escada automaticamente quando o operador libera o
IUHLRGHHVWDFLRQDPHQWRHQmRSUHVVLRQDRERWmR>83@
(Elevar) no painel de controle antes de arrancar com
RFDPLQKmR(VWHpXPUHFXUVRGHVHJXUDQoDSDUD
evitar danos ao sistema de escada retrtil. A elevao
da escada nesta maneira ir gerar uma mensagem de
IDOKDTXHVHUiDUPD]HQDGDQDPHPyULDGRVLVWHPD

'LDJQyVWLFRV
O painel de controle interno da cabina permite a
exibio dos ltimos 50 eventos na tela do visor.
$OpPGLVVRDPHPyULDQmRYROiWLOGRSDLQHOSRVVXL
um banco de registro de dados de 3000 pontos
LQFRUSRUDGR7RGRVRVGLDJQyVWLFRVGRVLVWHPDGD
escada de acesso podem ser recuperados por meio
do download dos registros de dados utilizando-se
XPGLVSRVLWLYR86%HSRVWHULRUDQiOLVHQDIRUPDGH
SODQLOKDVGR0LFURVRIW([FHO

Bloqueio do painel de controle interno da cabina


3DUDFRQWURODUDRSHUDomRGDHVFDGDVRPHQWHQRQtYHO
GRVRORRSDLQHOGHFRQWUROHLQWHUQRGDFDELQDSRGHVHU
EORTXHDGR(VWDDomRpSURWHJLGDSRUVHQKDSDUDHYLWDU
TXHRSDLQHOGHFRQWUROHVHMDPEORTXHDGRSRUSHVVRDOQmR
autorizado.

Manuteno
O painel de controle interno da cabina monitora o
QtYHOGHyOHRGRVLVWHPDGDHVFDGDGHDFHVVRHID]
a contagem do nmero de ciclos de operao do
VLVWHPD4XDQGRpQHFHVViULRID]HUDPDQXWHQomR
XPDODUPHVRQRURDXGtYHOpHPLWLGRSHORSDLQHO
de controle enquanto uma mensagem indicadora
exibida automaticamente no painel de controle.
&RQVXOWHDVHomRUHIHUHQWHDVHUYLoRVPDLVDGLDQWH
QHVWHFDStWXORSDUDREWHULQIRUPDo}HVDGLFLRQDLV

M32002

Sistema de escada retrtil

M32-13

UTILIZAO DO PAINEL DE CONTROLE


INTERNO DA CABINA
(QTXDQWRDHVFDGDHVWiHPPRYLPHQWRpSRVVtYHO
alterar a sua direo (para cima ou para baixo)
pressionando-se o boto de direo oposta ([UP]
(/(9$5  RX >'2:1@ %$,;$5  QR SDLQHO GH
controle.

1RUPDOPHQWHDHVFDGDVHUiPDQWLGDQDSRVLomREDL[DGD
HPXPFDPLQKmRHVWDFLRQiULR2SDLQHOGHFRQWUROHLQWHUQR
GDFDELQDLQGLFDUiTXHRDFHVVRHVWi'2:1 %DL[DGR 
FRQIRUPHPRVWUDDLOXVWUDomR

Se a mensagem IN CAB LOCKOUT (BLOQUEIO


,17(512'$&$%,1$ IRUH[LELGDQDWHODGRSDLQHO
GHFRQWUROHVLJQLFDTXHRVLVWHPDGHHVFDGDUHWUiWLO
VySRGHUiVHURSHUDGRSHODFDL[DGHFRQWUROHDRQtYHO
GRVRORPRQWDGDSUy[LPRjFDL[DGHLVRODPHQWRGD
EDWHULD7RGRVRVRXWURVUHFXUVRVGHIXQFLRQDOLGDGH
GRSDLQHOGHFRQWUROHSHUPDQHFHUmRGLVSRQtYHLV
LQFOXLQGR DV LQGLFDo}HV GH IDOKDV H RV DODUPHV
sonoros.

CUIDADO

Quando estiver na cabina do operador, use


sempre o boto [UP] (Elevar) no painel de
controle para suspender a cadeira, em vez de
simplesmente liberar o freio de estacionamento.
A operao automtica da escada pela liberao
do freio de estacionamento um recurso
exclusivamente emergencial. NO libere o freio
de estacionamento para elevar a escada como
parte de uma operao normal.
Elevao da escada

M32-14

3 D U D  H O H Y D U  D  H V F D G D   S U H V V L R Q H  H  P D Q W H Q K D
(temporariamente) o boto [UP] (Elevar) localizado no
painel de controle interno da cabina. A escada ilustrada
na tela animada e comear a se elevar at a posio
83HQTXDQWRDVHWD83 HOHYDomR  QRERWmRGRSDLQHO
de controle) passar a piscar. Quando a escada estiver
FRPSOHWDPHQWHHOHYDGDRERWmR>83@SHUPDQHFHUiDFHVR
Quando a escada tiver alcanado sua posio de
GHVORFDPHQWRGHHOHYDomRHDWLQJLURLQWHUUXSWRUGHOLPLWDomR
RSDLQHOGHFRQWUROHLUiLQGLFDUTXHRDFHVVRHVWiHOHYDGR
FRQIRUPHPRVWUDGRQHVVDLOXVWUDomR

Sistema de escada retrtil

M32002

O pacote de acionamento do sistema de escada retrtil


(RLS) continuar operando ainda por mais trs segundos
SDUD FDUUHJDU R DFXPXODGRU KLGUiXOLFR 'XUDQWH HVWH
LQWHUYDORDVHWD83VHPDQWHUiSLVFDQGRDWpTXHRFLFOR
VHMDFRPSOHWR
O sistema RLS utiliza um interruptor de limitao para
monitorar a movimentao da escada para a posio de
HOHYDomR6HDHVFDGDIDOKDUDRDOFDQoDURLQWHUUXSWRUGH
OLPLWDomRRXRLQWHUUXSWRUWLYHUSUREOHPDVSDUDGHVOLJDUXP
DODUPHLQGLFDGRUGHIDOKDVHUiGLVSDUDGRDSyVXPEUHYH
intervalo e o painel de controle interno da cabina ir exibir a
PHQVDJHPPRVWUDGDDVHJXLU

Baixando a escada
OBS.: O freio de estacionamento deve ser aplicado
DQWHVGDHVFDGDVHUEDL[DGD
3DUD EDL[DU D HVFDGD SUHVVLRQH H PDQWHQKD
SUHVVLRQDGR WHPSRUDULDPHQWH RERWmR>'2:1@
%$,;$5 ORFDOL]DGRQRSDLQHOGHFRQWUROHLQWHUQR
da cabina. A escada ilustrada na tela assumir
uma animao e passar a se mover para baixo na
SRVLomRGH'(6&,'$HQTXDQWRRERWmR>'2:1@
permanecer piscando.
Quando a escada tiver alcanado sua posio
GHUHWUDomRRSDLQHOGHFRQWUROHLUiLQGLFDUTXHR
DFHVVRHVWiGLVSRQtYHOFRQIRUPHPRVWUDDLOXVWUDomR
DEDL[R

OBS.:
2DODUPHLQGLFDGRUGHIDOKDGHYHVHUDFLRQDGRSUHVVLRQDQGR
VHRVERW}HV>(;,7@RX>(17(5@QRSDLQHOGHFRQWUROH8PD
YH]HPLWLGRRDODUPHDPHQVDJHPGHIDOKDVHUiVXEVWLWXtGD
SHODPHQVDJHP)$8/7,16<67(0 )$/+$126,67(0$ 
8P LQWHUUXSWRU GH OLPLWDomR FRP GHIHLWR LUi LPSHGLU R
funcionamento normal do sistema RLS e por isso deve ser
corrigido imediatamente.

M32002

4XDQGRDHVFDGDHVWLYHUFRPSOHWDPHQWHEDL[DGDR
ERWmR>'2:1@FDUiFRQWLQXDPHQWHLOXPLQDGR

Sistema de escada retrtil

M32-15

USO DA CAIXA DE CONTROLE AO


NVEL DO SOLO
$FDL[DGHFRQWUROHDRQtYHOGRVROR )LJXUD 
HVWiORFDOL]DGDSUy[LPRjFDL[DGHLVRODPHQWRGD
bateria e contm um interruptor de comutao (2) que
promove a elevao e descida da escada.
OBS.: O freio de estacionamento deve ser aplicado
DQWHVGDHVFDGDVHUEDL[DGD6HRLQWHUUXSWRUGH
comutao (2) for mantido em uma das 2 posies
por mais de dez segundos, uma falha ser ativada e
VHUiQHFHVViULRFRQUPiODSUHVVLRQDQGRRVERW}HV
>(;,7@RX>(17(5@ORFDOL]DGRVQRSDLQHOGHFRQWUROH
LQWHUQRGDFDELQD

M32-16

Elevao da escada
3DUDHOHYDUDHVFDGDFRORTXHRLQWHUUXSWRUGHFRPXWDomR 
Figura 32-6) na posio LADDER UP (ELEVAR ESCADA) e
solte. A operao da escada por meio deste interruptor a
mesma utilizada pelo painel de controle interno da cabina.
Qualquer movimento da escada ser mostrado no painel de
controle interno da cabina.
Descida da escada
3DUDEDL[DUDHVFDGDFRORTXHRLQWHUUXSWRUGHFRPXWDomR
)LJXUD QDSRVLomR/$''(5'2:1HVROWH$
operao da escada por meio deste interruptor a mesma
utilizada pelo painel de controle interno da cabina. Qualquer
movimento da escada ser mostrado no painel de controle
interno da cabina.

),*85$&$,;$'(&21752/($219(/'262/2
&DL[DGHFRQWUROHDRQtYHOGRVROR
,QWHUUXSWRUGHFRPXWDomR

Sistema de escada retrtil

M32002

O P E R A O D O PA C O T E D E A C I O N A M E N T O
HIDRULICO
2SDFRWHGHDFLRQDPHQWRKLGUiXOLFRFRQVLVWHHPXPDFDELQH
GHDoRLQR[LGiYHOHPQtYHOGHDWHUUDPHQWRTXHDORMDRV
FRPSRQHQWHVHOpWULFRVHKLGUiXOLFRVGHFRQWUROHSULQFLSDO(OH
XVD9'&GRVLVWHPDHOpWULFRGRFDPLQKmRSDUDDEDL[DUH
levantar a escada. Consulte a Figura 32-8 e a Figura 32-9.
4XDQGRDHVFDGDHVWLYHUOHYDQWDGDPRWRU9'& 
Figura 32-9) opera e a vlvula de controle direcional (5) se
PRYHSDUDDSRVLomR(/(9$5$SUHVVmRKLGUiXOLFD5/6p
FRQWURODGDSRUYiOYXODVGHDOtYLRGHSUHVVmR  $SUHVVmR
de operao mxima do sistema estabelecida em 17000
N3D SVL PDVDSUHVVmRGHWUDEDOKRUHDOGRVLVWHPD
SRGHVHUPDLVEDL[D2XLGRKLGUiXOLFR5/6XLDWUDYpVGD
vlvula de controle direcional (5) e da vlvula de controle
GHIOX[R  >PHGLomRH[WHUQD@SDUDRODGR(/(9$5GR
acionador e alm de um plugue de cavidade. Durante este
WHPSRRXLGRKLGUiXOLFRFDUUHJDUiRDFXPXODGRU  HXP
interruptor de presso enquanto a escada se move para a
posio ELEVAR .

4XDQGRDHVFDGDHVWLYHUDEDL[DGDDYiOYXODGH
FRQWUROHGLUHFLRQDO )LJXUD YDLVHPRGLFDU
para a posio ABAIXO e o motor 24VDC (14)
comea a abaixar a escada.
2SDFRWHGHDFLRQDPHQWRKLGUiXOLFR FRUWDUiHP
uma durao predeterminada e a escada continuar
DEDL[DQGRVREVXDSUySULDPDVVDFRQWURODGDSHOD
YiOYXODGHFRQWUROHGHX[R  >PHGLomRH[WHUQD
Um recurso adicionado do pacote de acionamento
KLGUiXOLFRpRDTXHFHGRUFRQWURODGRWHUPRVWDWLFDPHQWH
LQVWDODGRQRUHVHUYDWyULRGRXLGR  SDUDDTXHFHU
RXLGRGRVLVWHPD5/6QDRSHUDomRHPFOLPDIULR
Consulte a Figura 32-7.

FIGURA 32-7. AQUECEDOR DO LEO

2DFXPXODGRUKLGUiXOLFR )LJXUD PDQWpPDHVFDGD


na posio levantada e automaticamente recarregado
se a presso do acumulador cair abaixo de 4000 kPa (580
SVL 6HDSUHVVmRKLGUiXOLFDQRDFXPXODGRUFDLUDEDL[R
GHN3D SVL XPLQWHUUXSWRUGHSUHVVmRLQLFLDUi
DERPEDKLGUiXOLFDHUHFDUUHJDUiRVLVWHPD,VWRVRPHQWH
GHYHRFRUUHUWUrVYH]HVSRUKRUDHQmRPDLVGRTXHXPDYH]
a cada oito minutos. Se a escada quebrar o contato com o
LQWHUUXSWRUGHOLPLWHXPDODUPHGHIDOKDDWLYDUiHRSDLQHOGH
controle interno da cabina exibir uma mensagem de erro
TXHWHUiTXHVHUUHFRQKHFLGD
2%6(59$d22DODUPHGHIDOKDGHYHVHUUHFRQKHFLGR
SUHVVLRQDQGRRVERW}HV>(;,7@ 6$,5 RX>(17(5@QR
SDLQHOGHFRQWUROH8PDYH]TXHRDODUPHIRLUHFRQKHFLGRD
PHQVDJHPGHIDOKDVHUiVXEVWLWXtGDSRUXPDPHQVDJHPGH
)$/+$126,67(0$

M32002

Sistema de escada retrtil

M32-17

FIGURA 32-8. PACOTE DE ACIONAMENTO HIDRULICO (VISO EXPLODIDA)

M32-18

Sistema de escada retrtil

M32002

FIGURA 32-8. PACOTE DE ACIONAMENTO HIDRULICO (VISO EXPANDIDA)

1. Cobertura
6WDXI
3. Placa de Cobertura Eltrica
4. Arruela Plana
5. Porca
6. Placa de Montagem
7. Unidade de Controle
3DUDIXVRFRP&DEHoD
6XSRUWHVGH%RUUDFKD
6ROHQyLGH
11. Arruela
3DUDIXVR
3DUDIXVR
14. Ala de Suspenso
15. Porca
16. Motor
17. Estrias do Acoplador
18. Montagem do Motor
3DUDIXVR
20. Arruela da Mola
21. Anel O
22. Retentor do eixo
&RQMXQWRGD%RPED

M32002

24. Cobertura de Suco


25. Arruela Plana
26. Arruela da Mola
3DUDIXVRFRP&DEHoD
3DUDIXVRFRP&DEHoD
29. Abraadeira da Mangueira
30. Filtro de Suco
31. Tubo de Suco
32. Respiro
33. Articulado
3DUDIXVR6HP&DEHoD
35. Arruela Plana
36. Abraadeira P
37. Arruela Plana
38. Porca
39. Mangueira de Respiro
40. Articulado
41. Fluxo de Respiro
3DUDIXVR
43. Arruela da Mola
3DUDIXVRFRP&DEHoD
3DUDIXVRFRP&DEHoD
&RQMXQWRGR&ROHWRU

Sistema de escada retrtil

&RQMXQWRGR7XER
48. Tubo de Retorno
49. Anel O
50. Aquecedor do leo
51. Visor
%XMmR
53. Cotovelo
54. Tanque Hidrulico

M32-19

FIGURA 32-9. PACOTE DE ACIONAMENTO HIDRULICO (VISTA MONTADA)


3DFRWHGHDFLRQDPHQWRKLGUiXOLFR
6ROHQyLGH0RWRU9'&
1y+LGUiXOLFRF,QWHUUXSWRUGH
Isolamento
3ODFDGD&REHUWXUDGR&KLFRWH
5. Vlvula de Controle Direcional
$OtYLRGD(WDSDGR3LORWR

M32-20

7. Pontos de Teste
8. Visor
9. Placa de Montagem
10. Aquecedor do leo
5HVHUYDWyULRGROHR
12. Coletor Hidrulico
5HJXODGRUGH)OX[R$MXVWiYHO

Sistema de escada retrtil

14. Motor 24VDC


15. Acumulador Hidrulico
16. Porta da Cabina
17. Respiro do Tanque
18. Vlvula de Sangria do Acumulador

M32002

MANUTENO
Noes de segurana aplicadas manuteno
Antes de tentar reparar ou executar a manuteno no
VLVWHPDGDHVFDGDWRGRRSHVVRDOGHYHHVWDUIDPLOLDUL]DGR
com os riscos e as etapas de precauo exigidos.
Reparos ou manuteno da escada somente devem
VHUH[HFXWDGRVSRUSHVVRDOGHYLGDPHQWHTXDOLILFDGRH
autorizado.

PERIGO

Siga todos os procedimentos de isolamento e bloqueio


do local de trabalho aplicvel antes de tentar reparar ou
executar a manuteno neste equipamento. A falha ao
isolar adequadamente as fontes de energia da escada,
eletricidade e hidrulica pode levar a dano pessoal ou
morte.
1RPtQLPRDVHWDSDVDVHJXLUGHYHPVHUVHJXLGDVHQTXDQWR
UHSDUDRXPDQWpPHVWHHTXLSDPHQWR
1. Sempre isole a energia eltrica do sistema de
HVFDGDDPHQRVTXHVHMDH[LJLGRSDUDWHVWDURX
DMXVWDUREMHWLYRVDQWHVGHWHQWDUTXDOTXHUWUDEDOKR
HOpWULFRRXPHFkQLFRQDHVFDGD$IDOKDDRLVRODU
adequadamente a energia eltrica da escada pode
levar a leses srias.

 12 WHQWH UHSDUDU VROWDU RX DEULU TXDOTXHU
SHoDGRVLVWHPDKLGUiXOLFRDPHQRVTXHWDQWRD
HQHUJLDHOpWULFDFRPRRIRUQHFLPHQWRKLGUiXOLFR
IRUDP LVRODGRV H DV OLQKDV KLGUiXOLFDV IRUDP
GHVSUHVVXUL]DGDV&HUWLTXHVHGHTXHRVLVWHPDp
GHVSUHVVXUL]DGRYHULFDQGRXPDPHGLGDFRQHFWDGD
j OLQKD LPHGLDWD RX HTXLSDPHQWR DEULQGR XPD
YiOYXODGHWHVWHRXREVHUYDQGRTXHXPDOLQKDMi
est desconectada.


12VDQJUHXPDOLQKDSUHVVXUL]DGDVROWDQGRXP
encaixe.

 9HULILTXHRFKLFRWHHOpWULFRGDHVFDGDOLQKDVGH
ILDomRHKLGUiXOLFDVTXDQWRDGDQRRXGHVJDVWH
HPXPDEDVHUHJXODU&HUWLTXHVHTXHDVOLQKDV
KLGUiXOLFDVGHVXEVWLWXLomRVmRGDPHVPDTXDOLGDGH
e comprimento que as originais.

M32002

 ,PSHoDTXHDVXMHLUDRXRVGHWULWRVHQWUHP
no sistema obstruindo ou tampando as
OLQKDVGHVFRQHFWDGDV
 12 XVH R FKLFRWH HOpWULFR RX DV OLQKDV
KLGUiXOLFDVFRPRXPDHWDSD
6. NO ativar o sistema de escada a menos
TXHDYiOYXODGHDOtYLRHVWHMDQROXJDU
 1 2  X V D U  D  V X D  P m R  S D U D  Y H U L I L F D U
YD]DPHQWRVKLGUiXOLFRV,VWRUHVXOWDUiHP
GDQRVVpULRV6HXPGDQRGHLQMHomRGHDOWD
SUHVVmRIRUVXVSHLWREXVFDURWUDWDPHQWR
mdico imediatamente.
 6HPSUHXVHDSURWHomRGHROKRDGHTXDGD
enquanto repara ou executa manuteno
neste equipamento.

Movimentos inesperados da escada de acesso


'XUDQWH D PDQXWHQomR R 5/6 SRGH OHYDQWDU
D X W R P D W L F D P H Q W H  D  H V F D G D  V H  R  I U H L R  G H
HVWDFLRQDPHQWRGRFDPLQKmRIRUOLEHUDGR
Esta a operao normal para o sistema da escada.
&RQWXGRRVPRYLPHQWRVLQHVSHUDGRVGDHVFDGD
pem em risco potencial do dano para o pessoal da
manuteno.
2%6(59$d2 (VVDV FLUFXQVWkQFLDV QmR VH
aplicariam a um RLS com o seu sistema hidrulico
acionado do sistema hidrulico do caminho a menos
que o sistema do caminho seja pressurizado.

Elevao Automtica da Escada


O levantamento inadvertido da escada ocorrer se o
IUHLRGHHVWDFLRQDPHQWRIRUOLEHUDGRH


$ HQHUJLD QmR IRL LVRODGD GR SDFRWH GH


DFLRQDPHQWRKLGUiXOLFRGRVLVWHPD5/6RX

$ HQHUJLD p UHVWDXUDGD DR SDFRWH GH


DFLRQDPHQWR KLGUiXOLFR GR VLVWHPD 5/6
depois de ser isolada anteriormente.

3DUDHYLWDUHVWHPRYLPHQWRLQHVSHUDGRGDHVFDGD
IDoDRVHJXLQWH


,VROHDHQHUJLDHOpWULFDGR5/6DQWHVGH
OLEHUDURIUHLRGHHVWDFLRQDPHQWR

5HDMXVWHRIUHLRGHHVWDFLRQDPHQWRDQWHVGH
restaurar a energia eltrica para o RLS.

Sistema de escada retrtil

M32-21

Recarga automtica do acumulador (escada na


posio ELEVADA)
2DFXPXODGRUKLGUiXOLFR )LJXUD DVVHJXUD
que a escada est mantida na posio totalmente
OHYDQWDGD &RQWXGR D SHUGD GH SUHVVmR SRGH
ocorrer principalmente devido a vazamentos
H[WHUQRVHPOLQKDVHHQFDL[HVKLGUiXOLFRV25/6
ativar automaticamente o pacote de acionamento
KLGUiXOLFRHUHFDUUHJDUiRDFXPXODGRU&RQVXOWHD
Figura 32-10.

(QTXDQWRDSUHVVmRKLGUiXOLFDGRVLVWHPD5/6HVWiEDL[D
a escada pode mover a uma distncia curta do seu limite
superior. O RLS sentir este movimento e reposicionar a
escada enquanto o acumulador est sendo carregado. O
movimento da escada inesperado e vigoroso. A recarga do
DFXPXODGRURFRUUHQRUPDOPHQWHTXDQGRRFDPLQKmRHVWi
VHQGRRSHUDGR4XDQGRRFDPLQKmRHVWiSDUDGRHRIUHLRGH
HVWDFLRQDPHQWRHVWiDSOLFDGRQmRRFRUUHUiUHFDUJD
'XUDQWHDPDQXWHQomRVHDHVFDGDGHYHUHVWDUQDSRVLomR
ELEVADA com energia e a escada se move do seu limite
VXSHULRUR5/6VHQWLUiHVWHPRYLPHQWRHUHSRVLFLRQDUi
D HVFDGD VH R IUHLR GH HVWDFLRQDPHQWR IRU OLEHUDGR
inadvertidamente.
2%6(59$d2(VWHPRYLPHQWRLQHVSHUDGRGDHVFDGD
pode ser eliminado assegurando que a energia foi isolada
do RLS antes de tentar manuteno em outras peas do
caminho.

FIGURA 32-10. ACUMULADOR HIDRULICO


1. Acumulador Hidrulico

M32-22

Sistema de escada retrtil

M32002

P R O C E D I M E N TO S D E M A N U T E N O
PREVENTIVA
Use os procedimentos de manuteno seguintes para
assegurar a operao do sistema de escada Retrtil
adequado.
Inspeo Diria
1. Inspecione visualmente a escada quanto a dano
PHFkQLFR 6H R PRYLPHQWR IRU SUHMXGLFDGR GH
DOJXPPRGRRFRQMXQWRGHYHVHUUHPRYLGRSDUD
reparo.
2. Inspecione visualmente quanto a limpeza. Assegure
TXHDHVFDGDHVWHMDVHFDHVHPJUD[DHyOHR

 &HUWLILTXHVH GH TXH R QtYHO GR yOHR FRUUHWR p
PDQWLGRQRUHVHUYDWyULRDSUR[LPDGDPHQWHRFHQWUR
do visor.

 /HYDQWHHDEDL[HDHVFDGD9HULILTXHDVSHoDV
VROWDVRXTXDOTXHUFRQGLomRGHUXtGRDGYHUVD

 &HUWLILTXHVH GH TXH R DODUPR GH PRYLPHQWR
H RV /('V SDUD FLPD H SDUD EDL[R IXQFLRQDP
adequadamente.

 9HULILFDUTXDOTXHUPRGLILFDomRQDDSDUrQFLDGR
HTXLSDPHQWRHVSHFLDOPHQWHDTXHOHTXHHIHWXDUiD
estabilidade do sistema da escada.
,QVSHomRDFDGDKRUDVGHRSHUDomR

 9HULFDURKDUGZDUHVROWRRXDXVHQWHHVSHFLDOPHQWH
RVTXHSUHQGHPDHVFDGDDRFDPLQKmR
2. Opere a escada pelo seu ciclo completo duas vezes
HYHULTXH


D &RQGLo}HVGHUXtGRVDGYHUVDV


E $LQFOLQDomRRXDVHVWUXWXUDVGHVDOLQKDGDV
FRPRGHJUDXVHODGRVTXHSRGHPUHVWULQJLUR
movimento da escada. Inspecione a operao
da escada em um plano vertical (visto de
IUHQWH $HVFDGDGHYHPRYHUVHGHFLPDSDUD
baixo relativa caixa do atuador.
3. Inspecione a caixa de atuador e a escada quanto
DGHSyVLWRVGHPDWHULDLVHVWUDQKRVFRPRVXMHLUD
ODPDRXGHWULWRVTXHSRGHPDIHWDUDRSHUDomR
adequada da escada.

 9HULILTXHVHDHVFDODGHIXQo}HVGRVLVWHPDGD
HVFDGDLQFOXLQGRLQWHUUXSWRUHVUHPRWRVHIUHLRGH
HVWDFLRQDPHQWRWUDYDP&HUWLTXHVHGHTXHR/('
QRLQWHUUXSWRUUHPRWREHPFRPRRDODUPRVRQRUR
indicam corretamente durante cada ciclo.

 9HULTXHDFRQGLomRGHWRGDDLQVWDODomRHOpWULFDH
FKLFRWHVHOpWULFRVGHQWURHIRUDGDFDL[DGHFRQWUROH
GHDoRLQR[LGiYHOTXDQWRRGDQRItVLFR




 &HUWLTXHVHGHTXHDFDL[DGHFRQWUROHHVWi
selada adequadamente e sem umidade.
 9H U L I L T X H  R  I R U Q H F L P H Q W R  H O p W U L F R  G R
FDPLQKmR&RPRPRWRUOLJDGRDWHQVmRGR
IRUQHFLPHQWRGRDOWHUQDGRUSDUDRVFRQWUROHV
do sistema de escada no deve exceder
30VDC.

&RP R PRWRU GHVOLJDGR D WHQVmR GR
IRUQHFLPHQWRGDEDWHULDQmRGHYHFDLUDEDL[R
de 21VDC.

2%6(59$d26HDWHQVmRGDEDWHULDFDLUDEDL[R
GH9'&RXH[FHGHU9'&SRGHUHVXOWDUHP
dano aos componentes eletrnicos do sistema. 24
D9'&pH[LJLGRSDUDDRSHUDomRGRVLVWHPDGH
escada adequado.


 9HULILFDUWRGDVDVFRQH[}HVHOpWULFDVQR
circuito RLS quanto a segurana.

ATENO

Certifique-se de que a rea esteja livre de


HTXLSDPHQWRHSHVVRDODQWHVGHVWDYHULFDomR


 9HULTXHDIXQomRGRIUHLRGHHVWDFLRQDPHQWR
OLEHUDQGR R IUHLR HVWDFLRQDPHQWR FRP D
escada na posio ABAIXO. A escada deve
levantar.

 ,QVSHFLRQH YLVXDOPHQWH WRGDV DV OLQKDV


KLGUiXOLFDVHHQFDL[HVTXDQWRDYD]DPHQWRV
Repare quaisquer vazamentos.

ATENO

&HUWLTXHVHGHTXHDVFREHUWXUDVVHMDPXVDGDV
quando a manuteno executada no sistema
hidrulico para impedir que a sujeira e os detritos
entrem no sistema.


 &HUWLTXHVHGHTXHRQtYHOGHyOHRFRUUHWRp
PDQWLGRQRUHVHUYDWyULR&RQVXOWHR9HULFDU
R1tYHOGHOHRGR5HVHUYDWyULRSDUDREWHU
PDLVLQIRUPDo}HV

,QVSHomRDFDGDKRUDVGHRSHUDomR
1. Conclua a Inspeo de 250 Horas.

 'UHQHODYHHUHDEDVWHoDRUHVHUYDWyULRGH
yOHRKLGUiXOLFR
Consulte a seo Troca do Fluido do
Sistema RLS.

M32002

Sistema de escada retrtil

M32-23

EXECUAO DOS SERVIOS DE


MANUTENO
9HULTXH21tYHOGHOHRGR5HVHUYDWyULR
&HUWLTXHVHGHTXHWRGDVDVGLUHWUL]HVGHVHJXUDQoD
QHFHVViULDV IRUDP REVHUYDGDV DQWHV GH WHQWDU
YHULFDURQtYHOGRyOHRQRUHVHUYDWyULRGRyOHR 
)LJXUD $OpPGLVVRFHUWLILTXHVHGHTXHD
HVFDGDHVWHMDQDSRVLomRWRWDOPHQWHDEDL[DGD
,QVSHFLRQH YLVXDOPHQWH WRGDV DV OLQKDV GR yOHR
KLGUiXOLFRHHQFDL[HVTXDQWRDYD]DPHQWRV12
FRPSOHWHRUHVHUYDWyULRGHyOHRGDHVFDGDVHIRUHP
encontrados vazamentos. Substitua as peas com
GHIHLWRHUHSDURTXDOTXHUYD]DPHQWRHQFRQWUDGR
'HSRLVTXHWRGRVRVYD]DPHQWRVIRUDPUHSDUDGRV
UHSDUHRQtYHOGRyOHRGRUHVHUYDWyULR
2%6(59$d2eUHFRPHQGDGRTXHTXDOTXHUyOHR
KLGUiXOLFRDVHUXVDGRSDUDDEDVWHFHURXDGLFLRQDU
ao sistema hidrulico deva ser encaminhada por um
GLVSRVLWLYRFRPOWURGHPtFURQHVDQWHVGRXVR

7URFDGRXLGRGRVLVWHPD5/6
2yOHRKLGUiXOLFRFDFRQWDPLQDGRGHQWURGHDOJXPWHPSR
HLVWRSRGHLPSDFWDUDRSHUDomRGRVLVWHPD5/63RULVVR
pUHFRPHQGDGRTXHRyOHRQRVLVWHPDVHMDWURFDGRSHOR
PHQRVXPDYH]SRUDQR'XUDQWHDVXEVWLWXLomRGRyOHRp
UHFRPHQGDGRTXHRUHVHUYDWyULRVHMDODYDGRFRPiJXDSDUD
retirar qualquer detrito que possa ter se acumulado para
HYLWDUFRQWDPLQDURQRYRyOHR
3DUDWURFDURyOHRKLGUiXOLFR5/6

 5HPRYDREXMmRGDSRUWDGHDEDVWHFLPHQWR 
Figura 32-11).

 5HPRYDRDTXHFHGRUGRyOHR  GRUHVHUYDWyULR
 HSHUPLWLUTXHRyOHRGUHQHHPXPFRQWDLQHU
DFHLWiYHO12 GDQLILTXH D H[WUHPLGDGH GR
DTXHFHGRUGRyOHR

 /DYDURLQWHULRUGRUHVHUYDWyULRFRPXPVROYHQWHGH
limpeza e permita que o solvente usado drene em
um container aceitvel.

 5HLQVWDOHRDTXHFHGRUGRyOHR  12DSHUWHHP
excesso.

 $EDVWHoDQRYDPHQWHRUHVHUYDWyULRDWUDYpVGDSRUWD
de abastecimento (2) com a quantidade correta e
WLSRGHyOHRKLGUiXOLFROLPSROWUDGR

 5HLQVWDOHREXMmRQDSRUWDGHDEDVWHFLPHQWR
7. Opere a escada atravs de dois ciclos completo
para cima e para baixo.

 9HULTXHQRYDPHQWHRQtYHOGRyOHRDWUDYpVGRYLVRU
 &RPSOHWHVHQHFHVViULR12HQFKHUGHPDLV
2%6(59$d2'HSRLVGHWURFDURyOHRR5/6GHYHVHU
operado atravs da sua faixa cheia do movimento pelo
PHQRVGXDVYH]HV,VWRGHYHH[SHOLUTXDOTXHUDUTXHSRGH
estar presente, que destruiria de outra maneira as vedaes
no sistema hidrulico.

FIGURA 32-11. RESERVATRIO DO PACOTE DE


ACIONAMENTO HIDRULICO
1. Visor
2. Porta de
Abastecimento

3. Aquecedor do
leo
5HVHUYDWyULR

3DUDUHSDUDURUHVHUYDWyULRGRSDFRWHGHDFLRQDPHQWR
KLGUiXOLFR




1. Remova a tampa da porta de abastecimento


)LJXUD 
2. Use a marca do indicador MX. no visor
SDUD GHWHUPLQDU R QtYHO GR yOHR FRUUHWR
aproximadamente o centro do visor.
 6HQHFHVViULRDGLFLRQHDTXDQWLGDGHFRUUHWD
H R WLSR GH yOHR KLGUiXOLFR 12 HQFKHU
demais.
 5HLQVWDOHREXMmR

M32-24

Sistema de escada retrtil

M32002

Limpeza do sistema RLS


'HSHQGHQGRGRDPELHQWHRSHUDFLRQDOR5/6GHYHVHUOLPSR
IUHTXHQWHPHQWHSDUDHVWHQGHUDYLGD~WLOGRHTXLSDPHQWRH
diminuir o risco do dano pessoal durante o uso.

$VLQIRUPDo}HVGHGLDJQyVWLFRHVWmRDFHVVtYHLVDR
XVXiULRGHTXDWURPRGRV


 0RQLWRUDPHQWR&RQWtQXRGR6LVWHPD
O status do RLS em tempo real est
GLVSRQtYHODWUDYpVGRYLVRUGRSDLQHOGH
controle interno da cabina. A posio
GD HVFDGD DWXDO (/(9$'$ %$,;$'$
68%,1'2RX%$,;$1'2HDVIDOKDVHRX
erros de sistema esto claramente expostas
com indicaes do painel de controle interno
GD FDELQD YLVXDLV H DXGtYHLV 1HQKXPD
VHQKDGH,'GRXVXiULRpH[LJLGDSDUDHVWD
IXQomR

 5HYLVmRGRVGDGRVGRVLVWHPDGRKLVWyULFR
Os ltimos 50 eventos RLS registrados
podem ser visualizados diretamente do visor
do painel de controle interno da cabina.

&DGD HQWUDGD WHP R KRUiULR H D GDWD
HVWDPSDGDSDUDIiFLOLGHQWLFDomR1HQKXPD
VHQKDGH,'GRXVXiULRpH[LJLGDSDUDHVWD
IXQomR

ATENO

NO aponte o equipamento de jateamento de alta presso


para ou prximo ao pacote de acionamento hidrulico
do RLS, caixa do atuador, mancais ou chicotes eltricos.
A umidade inserida nos chicotes eltricos pode resultar
no movimento incontrolado da escada.
3DUDOLPSDUR5/6
1. Use um desengraxante aprovado para remover ou
VROWDURVGHWULWRVQmRGHVHMDGRVGDVVXSHUItFLHVGRV
degraus da escada. Use uma escova de cerda de
nylon para retirar os detritos dos degraus da escada
se necessrio.
2. Use o equipamento de spray de alta presso para
remover a graxa e os detritos. NO aponte o
HTXLSDPHQWRGHVSUD\GHDOWDSUHVVmRSUy[LPRDR
SDFRWHGHDFLRQDPHQWRKLGUiXOLFRGRVLVWHPD5/6
FDL[DGRDWXDGRUPDQFDLVRXFKLFRWHVHOpWULFRV
$XPLGDGHLQVHULGDQRVFKLFRWHVHOpWULFRVSRGH
resultar no movimento incontrolado da escada.

',$*167,&26'26,67(0$5/6
'HVFULomRGRV5HFXUVRVGH'LDJQyVWLFR
&RPRPHQFLRQDGRDQWHVQHVWHFDStWXORRSDLQHOGHFRQWUROH
LQWHUQRGDFDELQDPRQLWRUDDUPD]HQDHUHODWDRVGDGRV
operacionais do sistema RLS. O painel de controle interno da
FDELQDpSURMHWDGRSDUDIRUQHFHUDRXVXiULRGHSODQHMDPHQWR
GHPDQXWHQomRGR5/6LGHQWLFDomRGHIDOKDGRVLVWHPDH
RGHVHQYROYLPHQWRGHXPEDQFRGHGDGRVGHLQIRUPDo}HV
SDUDUHODWyULRV5/6LQGLYLGXDLV

M32002

Sistema de escada retrtil

M32-25

3. M o n i t o r a m e n t o d a i n t e g r i d a d e n a s
comunicaes

$RSomRGHPHQX'LDJQyVWLFRpDFHVVDGD
da rea de Menu do Controlador do Visor
interno da cabina. Uma lista abrangente de
eventos do sistema pode ser visualizada
G L U H W D P H Q W H  Q R  Y L V R U  I R U Q H F H Q G R  D V
FDSDFLGDGHV GH ORFDOL]DomR GH IDOKDV
adicionais. Todos os eventos so listados
FRPRDWLYRRXLQDWLYRSDUDIDFLOLGDGHGD
LGHQWLFDomR(VWDIXQomRWDPEpPPRQLWRUD
a integridade das comunicaes do sistema
entre o Painel de Controle da Cabina e o
&RQVHOKRGR&RQWUROH3ULQFLSDOQRSDFRWHGH
DFLRQDPHQWRKLGUiXOLFR2VUHVXOWDGRVVmR
exibidos como um valor de por cento durante
YiULRVSHUtRGRVGHWHPSRDWpKRUDV3DUD
XPVLVWHPDVDXGiYHODVSRUFHQWDJHQVQmR
GHYHPVHUPDLVEDL[DLVTXH1HQKXPD
VHQKDGH,'GH8VXiULRpH[LJLGD

4. Registros do Evento do Sistema


8PUHJLVWURGHGDGRVFRQWtQXRGHHYHQWRV
GR VLVWHPD p IRUQHFLGR QD PHPyULD QmR
voltil para download para um dispositivo
86%SDUDWUDQVIHUrQFLDSDUDXPFRPSXWDGRU
porttil ou um PC.
O arquivo ento pode ser traduzido em um
DUTXLYRGR0LFURVRIW([FHOXViYHOXVDQGR
DLQWHUIDFHGR0LFURVRIW([FHOIRUQHFLGDQD
FKDYH86%IRUQHFLGDFRPR5/62UHJLVWUR
p FDSD] GH IRUQHFHU DWp  HYHQWRV
HVWDPSDGRVGHGDWDHKRUD&RQILJXUDGR
HPXPIRUPDWRGHUHJLVWURGHURODJHPRV
SULPHLURVGDGRVVmRVXEVWLWXtGRVTXDQGR
RUHJLVWURHVWLYHUFRPSOHWRIRUQHFHQGRXP
EDQFRGHGDGRVFRQWtQXRGLVSRQtYHOSDUD
UHYLVmR D TXDOTXHU PRPHQWR 1HQKXPD
VHQKDGH,'GRXVXiULRpH[LJLGDSDUDHVWD
IXQomR

M32-26

0RQLWRUDPHQWR&RQWtQXRGR6LVWHPD
$LGHQWLFDomRHPWHPSRUHDOGDSRVLomRGHHVFDGDDWXDO
HVWiGLVSRQtYHODWUDYpVGRJUiFRDQLPDGRGDHVFDGDHR
WH[WRGHDFRPSDQKDPHQWRQRYLVRUGRSDLQHOGHFRQWUROH
interno da cabina.
As ilustraes a seguir indicam uma escada em movimento
subindo (levantamento) e descendo (abaixamento).
(QTXDQWRDHVFDGDHVWiHPPRYLPHQWRRERWmRDSOLFiYHO
[ELEVAR] ou [BAIXAR] no painel de controle iluminar.

Quando a escada alcanar as posies levantadas ou


DEDL[DGDVRJUiFRDQLPDGRSDUDUiRPRYLPHQWRHRWH[WR
83 (/(9$5 RX'2:1 %$,;$5 DSDUHFHUiQDWHOD
do visor. Uma vez que a escada concluiu o seu ciclo de
PRYLPHQWRHHVWiQDSRVLomR(/(9$'$RXDEDL[RRERWmR
DSOLFiYHO>83@RX>'2:1@QRSDLQHOGHFRQWUROHSHUPDQHFHUi
iluminado continuamente.

Sistema de escada retrtil

M32002

5HYLVmRGRVGDGRVGRVLVWHPDGRKLVWyULFR
3DUDYLVXDOL]DUDWpGRV~OWLPRVHYHQWRVUHJLVWUDGRV
1. Pressione os botes [ENTER] ou [EXIT] no painel
de controle da cabina.

 'DWHOD&21752//(50(18XVHRERWmR>'2:1@
para rolar para Mostrar Registros Recentes e
pressione o boto [ENTER].

 3DUDYLVXDOL]DUFDGDHQWUDGDXVHRERWmR>'2:1@
para rolar.

Monitoramento da Integridade Comms


$ LQWHUIDFH GD ,QWHJULGDGH &RPPV IRUQHFH XPD
YHULILFDomRGHVD~GHVLPSOHVGDVFRPXQLFDo}HV
entre o painel de controle da cabina e o controlador
SULQFLSDOQRSDFRWHGHDFLRQDPHQWRKLGUiXOLFR3DUD
DFHVVDUHVWDWHOD


 'DWHOD&21752//(50(18XVHRERWmR
>'2:1@QRSDLQHOGHFRQWUROHLQWHUQRGD
FDELQD SDUD URODU SDUD 'LDJQyVWLFRV H
pressione o boto [ENTER].
 8VH R ERWmR >'2:1@ SDUD URODU SDUD
DIAGNSTICOS e pressione o boto
[ENTER]. Uma lista abrangente de eventos
GR VLVWHPD p PDUFDGD FRPR DWLYD RX
LQDWLYDSDUDDLGHQWLFDomRUiSLGDGDVIDOKDV
do sistema que esto atualmente ativas e
precisam de ateno imediata. A Integridade
da Comms listada como um valor de por
cento. Esses valores de por cento indicam
a integridade das comunicaes durante os
~OWLPRVVHJXQGRVPLQXWRVKRUDVH
KRUDV

2%6(59$d22VHYHQWRVVmROLVWDGRVGR~OWLPRHYHQWR
HVWDPSDGRFRPGDWDHKRUD  DWUDYpVGRSULPHLUR
QDVpULH  3UHVVLRQDUHPDQWHURERWmR'2:1RX
83GHVFHUiFRQWLQXDPHQWHSHODOLVWDDWpTXHRERWmRVHMD
OLEHUDGR
2%6(59$d221yGR&RQWUROH,QWHUQRGDFDELQDFRQWpP
XPDEDWHULDUHFDUUHJiYHOSDUDPDQWHURUHOyJLR6HDVWHODV
GHGHQLomRGH'DWDH+RUDDSDUHFHUHPQRLQtFLRDEDWHULD
interna precisar de recarga. Os tempos de recarga so os
seguintes:
7HPSRGH5HVHUYD 7RWDOPHQWH&DUUHJDGR 6HPDQDV
7HPSRSDUD&DUUHJDUWRWDOPHQWH+RUDV
7HPSRGH&DUJD0tQLPR+RUDV
2%6(59$d2 (VWD SRVLomR GH EDWHULD Vy DIHWD DV
FRQJXUDo}HVGH'DWDH+RUD(/$12$)(7$1250$/
(6&$'$(6&$'$5,$2823(5$d2'2'(*5$8

6HLQWHUPLWHQWHDRSHUDomRLQVHJXUDGDHVFDGD
escadaria ou sistema de acesso do degrau
H[SHULPHQWDGDXPDYHULILFDomRGDVHQWUDGDVGH
Integridade Comms recomendada.
3DUDXPVLVWHPDVDXGiYHODVSRUFHQWDJHQVQmR
devem ser mais baixais que 80 %.
6H DV SRUFHQWDJHQV FDtUHP DEDL[R GHVWH YDORU
SUHVFULWRRVVLQWRPDVSRVVtYHLVVHUmR

 HUURV GH FRPXQLFDo}HV ,QWHUPLWHQWHV
mostrados no controlador

 RSHUDomRGHHVFDGD,QVHJXUDLPSUHYLVtYHO

 1HQKXPDRSHUDomRGHHVFDGD
$VSRVVtYHLVFDXVDVVmR








LQVWDODomRHOpWULFDSREUHGHJUDGDGD
LQWHUIHUrQFLDHOpWULFDVXEVWDQFLDO
XPD IDOKD LQWHUQD FRP R KDUGZDUH GR
controlador

5HJLVWURH,QIRUPDomRVREUH6HUYLoR
$ WHOD ',$*167,&2 RIHUHFH DV LQIRUPDo}HV
adicionais depois que a Integridade Comms exibir os
valores.
(VWDVOLVWDJHQVVmR

 4XDQGR RV UHJLVWURV IRUDP RV ~OWLPRV
apagados.
M32002

Sistema de escada retrtil

M32-27

$SRUFHQWDJHPGRHVSDoRGHUHJLVWURTXH
usada atualmente. Um total de 3.000
HQWUDGDVGHUHJLVWURHVWiGLVSRQtYHO

$YHUVmRGHFyGLJRGRVRIWZDUHGRVLVWHPD

2Q~PHURGHRSHUDo}HVTXHSHUPDQHFHP
DWpTXHRVHJXLQWHVHUYLoRGRQtYHORX
QtYHOVHMDH[LJLGR

Registros de Evento do Sistema


O recurso de recuperao de dados do painel de
controle interno da cabina permite o download
simples de dados operacionais RLS que pertencem
jRSHUDomRFRWLGLDQDGR5/67RGRVRVHYHQWRV
incluindo levantamento e abaixamento da escada
HLQGLFDo}HVGHIDOKDVmRHVWDPSDGRVFRPGDWDH
KRUDSDUDIRUQHFHUXPUHJLVWURVHTXHQFLDOGHWRGDV
as operaes RLS.
Para acessar os registros de dados da tela do visor
SULQFLSDO
1. Pressione os botes [ENTER] ou [EXIT] no
painel de controle da cabina.

 'DWHOD&21752//(50(18XVHRERWmR
>'2:1@SDUDURODUSDUD$WXDOL]DU5HJLVWURV
para USB e pressione o boto [ENTER].

M32-28

3.

A mensagem Insira um dispositivo USB exibida.

4. Inserir um dispositivo USB no slot direita do painel


de controle interno da cabina.

Sistema de escada retrtil

M32002

5. O s d a d o s r e g i s t r a d o s c o m e a r o a b a i x a r
DXWRPDWLFDPHQWHXPDYH]TXHDFKDYH86%p
inserida. O progresso de download exibido como
um valor de porcentagem incremental.

NVEIS DE ACESSO DE SEGURANA


2SURJUDPDGHVRIWZDUHTXHGLULJHRV1yVGR&RQWUROH
+LGUiXOLFRVH,QWHUQRGDFDELQDpFRQILJXUDGRGH
IiEULFD SDUD D RSHUDomR 5/6 DGHTXDGD 6H IRU
QHFHVViULR DMXVWDU DOJXP SDUkPHWUR GH WHPSR
atravs do painel interno da cabina
O acesso do Painel de controle ser requisitado para
DRSomRGHPHQXGH&RQWUROOHU&RQJ
3DUDHYLWDUDSRVVLELOLGDGHGHPRGLFDo}HVDFLGHQWDLV
RXSUHMXGLFLDLVDRVSDUkPHWURVGRWHPSRRVQtYHLV
FODVVLILFDGRVGRDFHVVRGHVHJXUDQoDSRGHPVHU
LQLFLDGRVSHORXVXiULR+iWUrVQtYHLVGHDFHVVR
GLVSRQtYHO1(1+805(675,72H&203/(722V
WUrVQtYHLVGHDFHVVRHRVVHXVSULYLOpJLRVVmRFRPR
VHJXH

 4XDQGRRGRZQORDGHVWLYHUFRQFOXtGRSUHVVLRQH
RVERW}HV>(17(5@RX>(;,7@SDUDFRQILUPDUD
WUDQVIHUrQFLDGRVGDGRVHUHPRYHUDFKDYH86%
2VGDGRVSRGHPVHUWUDQVIHULGRVDJRUDSDUDXP3&
ou laptop para reviso.

1tYHOGH$FHVVR1(1+80
1HQKXP,'GHXVXiULRpH[LJLGRSDUDHVWHQtYHO
3ULYLOpJLRV


 9LVXDOL]DUHVFDGDVHVFDGDULDRXRUJDQL]DomR
GHGHJUDX &RQJXUDo}HVGR6LVWHPD

7UDQVIHULUUHJLVWUDSDUD86%

9LVXDOL]DUHQWUDGDVGHUHJLVWURVUHFHQWHV

/HU'LDJQyVWLFRV

$SDJDUVROLFLWDomRGHVHUYLoRGR1tYHO

1tYHOGH$FHVVR5(675,72
Um ID de Usurio vlido exigido para acesso.
6HQKDSDGUmR &RQVXOWH3ULYLOpJLRVGH
acesso de ID de Usurio
Tabela para privilgios de acesso.
1tYHOGH$FHVVR&203/(72
Um ID de Usurio Mestre exigido para acesso.
Consulte a Tabela de Privilgios de acesso de ID de
Usurio para acessar privilgios.

M32002

Sistema de escada retrtil

M32-29

Privilgios de Acesso de Usurio


PARMETRO

DESCRIO

,'GR9HtFXOR

,GHQWLFDGRUGHYHtFXORGHFDUDFWHUHV
(VFDGDGHDomR1,&$RXGHDomR'83/$ 'XSOR
VRPHQWH(VFDGD*LUDWyULD 

Tipo de escada
Tempo de movimento
ACIMA para ELEVAO
da escada
Tempo de movimento
de entrada para
ELEVAO da escada
VRPHQWH(VFDGD*LUDWyULD 
Tempo de movimento
de DESCIDA para
ELEVAO da escada
VRPHQWH(VFDGD*LUDWyULD 
Tempo de movimento
ACIMA
para DESCIDA da escada
VRPHQWH(VFDGD*LUDWyULD 
Tempo de movimento
DE SADA
para DESCIDA da escada
VRPHQWH(VFDGD*LUDWyULD 
Tempo de movimento
ABAIXO
para DESCIDA da escada
VRPHQWH(VFDGD*LUDWyULD 
7HPSRGHIXQFLRQDPHQWR
ABAIXO para
DESCIDA da escada
Funcionamento ABAIXO
para DESCIDA da escada
&RQJXUDomRGDDomR
Quadro de Luz
Limite do menu
Limite da tela
Tempo do alarme sonoro

Bloqueio da Cabina
Data e Hora

RESTRITO

Extenso mxima do tempo de movimentao de elevao


da Escada (1-300 segundos) padroVHJXQGRV

RESTRITO

Extenso de tempo de movimento de ENTRADA da escada


(1-300 segundos) padroVHJXQGRV

RESTRITO

Extenso de tempo do movimento de DESCIDA da escada


no receptculo (1-300 segundos) padro VHJXQGRV

RESTRITO

Extenso de tempo de movimento de ELEVAO da escada


SDUDIRUDGRUHFHSWiFXOR VHJXQGRV padro 
segundos

RESTRITO

Extenso de tempo do movimento de SADA da escada


(1-300 segundos) padro VHJXQGRV

RESTRITO

Extenso de tempo de DESCIDA da escada ativado pelo


SDFRWHGHDFLRQDPHQWRKLGUiXOLFR VHJXQGRV padro
VHJXQGRV

RESTRITO

Extenso de tempo do movimento de DESCIDA da escada


DWLYDGRSHORSDFRWHGHDFLRQDPHQWRKLGUiXOLFR 
segundos) padro VHJXQGRV
Extenso de tempo do movimento de DESCIDA da escada
VHPVHUDWLYDGRSHORSDFRWHGHDFLRQDPHQWRKLGUiXOLFR
(1-300 segundos) padro VHJXQGRV
&RQJXUHRVWDWXVGRLQWHUUXSWRUGH
)UHLRGH(VWDFLRQDPHQWR121&
3DUDGD(121&
,QLELomRFRQHFWDGD6LP1mR
Durao de tempo para quadro de luz para acender depois
do movimento iniciado da escada. 3DGUmRVHJXQGRV
2SHUtRGRGHWHPSRVHPLQWHUYHQomRKXPDQDGHSRLVTXHR
visor retorna tela principal. 3DGUmRVHJXQGRV
2SHUtRGRGHWHPSRVHPLQWHUYHQomRKXPDQDGHSRLVTXH
RYLVRUGHVOLJDHDVLQIRUPDo}HVGRXVXiULRVmRDSDJDGDV
3DGUmRVHJXQGRV
$IUHTrQFLDGRDODUPHVRQRURVRDSDUDROHPEUHWHGHIDOKD
3DGUmRVHJXQGRV
6HGHQLGRHP/,*$'2RXVXiULRVySRGHUiLQLFLDUXP
movimento da escada de um painel de instrumento do
FRQWUROHUHPRWR6H'(6/,*$'2RXVXiULRSRGHUiLQLFLDU
um movimento de escada do controlador da cabina.
Usado para sincronizar o registro de dados

Programao de ativao do pacote de acionamento


KLGUiXOLFRSDUDUHFDUJDGRDFXPXODGRU VHJXQGRV 
3DGUmRVHJXQGRV
Programao de ativao do pacote de acionamento
Tempos de acionamento do
KLGUiXOLFRSDUDUHFDUJDGRDFXPXODGRUDSyVOHYDQWDPHQWRGD
SDFRWHKLGUiXOLFR
HVFDGD VHJXQGRV VHJXQGRV

Tempos de acionamento do
SDFRWHGHKLGUiXOLFR

M32-30

NVEL DE ACESSO
RESTRITO

Sistema de escada retrtil

RESTRITO

RESTRITO

RESTRITO

RESTRITO
RESTRITO
RESTRITO
RESTRITO

RESTRITO
RESTRITO
COMPLETO

COMPLETO

M32002

PARMETRO
&RQJXUDomRGR8VXiULR

DESCRIO
Alm do Usurio Mestre incorporado que tem
DFHVVR&203/(72SRGHPVHUFRQJXUDGRVWUrV
usurios adicionais.

NVEL DE ACESSO
COMPLETO

1~PHURGHWHOHIRQH

'HWDOKHVGHFRQWDWRFRPFDUDFWHUHV
Apagar o registro atual dos dados de evento do
sistema
5HLQLFLDOL]DUDFRQJXUDomRGR6LVWHPDDWXDOSDUD
FRQJXUDo}HVSDGUmR

COMPLETO

Apagar Registros
'HQLomRGHSDGU}HV
Intervalo do Servio de
1tYHO
Intervalo do Servio de
1tYHO
Intervalo Vencido

Nmero de operaes do Sistema de Acesso antes da


VROLFLWDomR6HUYLoRGR1tYHO
ser exibida na tela
Nmero de operaes do Sistema de Acesso antes da
VROLFLWDomR6HUYLoRGR1tYHO
ser exibida na tela
Nmero de operaes depois que a solicitao dos
VHUYLoRVGH1tYHOH1tYHO
DSDUHFHUDQWHVTXHXPDIDOKDGHYHQFLPHQWRGH
VHUYLoRVHMDUHJLVWUDGD

,''28685,26(1+$
$SURYLVmRIRLIHLWDDWpSDUDTXDWURFRQWDVGH,'GHXVXiULR
VHSDUDGDVDVHUHPFRQJXUDGDVHJHUHQFLDGDVQR3DLQHOGH
Controle Interno do sistema RLS. Uma ID de Usurio Mestre
pSUpFRQILJXUDGDSDUDSHUPLWLUTXHXPXVXiULRFRQFOXD
R$FHVVRGR1tYHOHXPVHJXQGR8VXiULR 8VXiULR R
$FHVVR5HVWULWRGR1tYHO&RPRFRPWRGRRDFHVVRGH,'
GH8VXiULRXPDVHQKDYiOLGDGHYHVHULQVHULGDDQWHVTXHR
DFHVVRVHMDFRQFHGLGR3DUDDFHVVDUHVWDWHOD
1. A partir do Modo de Exibio do Controle Interno
da cabina pressione os botes [ENTER] ou [SAIR]
para mover para o CONTROLLER MENU como
mostrado abaixo.

COMPLETO
COMPLETO

COMPLETO

COMPLETO
COMPLETO

2. Usar o boto [ABAIXO] para rolar para


CONTROLLER CONFIG e pressione o boto
[ENTER].
Uma ID de Usurio vlida pode ser inserida agora.
Uma ID de Usurio vlida deve consistir de at
 OHWUDV Q~PHURV HRX FDUDFWHUHV GDV RSo}HV
PRVWUDGDVQDWDEHODGH&DUDFWHUHVGH6HQKD8VH
os botes [ACIMA] e [ABAIXO] para rolar pela lista.
Depois de selecionar o valor correto de um campo
GHVHQKDXVHRERWmR>',5(,72@SDUDURODUSDUD
o seguinte campo at completar. Use o boto
[ESQUERDO] para rolar de volta pelos campos.
4XDQGR RV FDPSRV GH VHQKD IRUHP GHILQLGRV
pressione [ENTER] para aceitar.

Opes de Seleo de Valor de Campo Sequenciais

Letras

/HWUDV$OIDEpWLFDVGH$D= 0DL~VFXODV 

Nmeros

Numerais de 0 a 9

Caracteres

 !"#

7DEHODGH&DUDFWHUHVGH6HQKD
'R0DUFDGRUGR&DPSR,QLFLDO!B
Pressione UP

B !"#$%&'()*+,-./0123456789:;<=

Pressione DOWN

B=<;:9876543210/.-,+*)('&%$#"! 

M32002

Sistema de escada retrtil

M32-31

,''(8685,2129$&21),*85$d2
DE USURIO
Uma vez que o acesso s opes CONTROLLER
&21),*HVWmRFRQFOXtGDVXPDVpULHGHRSo}HV
GHPHQXHVWDUiGLVSRQtYHO3DUDYLVXDOL]DUR,'GH
8VXiULRGHILQLGRDWXDOPHQWH LQFOXLQGRR8VXiULR
0HVWUH RXDGLFLRQHXPQRYR,'GH8VXiULR



 8VHRERWmR>'2:1@SDUDURODUSDUD86(5
SET UP e pressione o boto [ENTER]. Para
DGLFLRQDUXPDQRYD,'GH8VXiULRXVH

RERWmR>'2:1@SDUDURODUSDUDDVHJXLQWH
,'GH8VXiULRQmRDWULEXtGD GHQRYRVHUi
8VXiULR   H DWULEXD D VHQKD XVDQGR R
PHVPRPpWRGRTXHXVRXSDUDLQVHULUDVHQKD
SDUDDFHVVDUDLQWHUIDFHGR&21752//(5
CONFIG.
 'HSRLVGHLQVHULUDQRYDVHQKDGD,'GH
Usurio pressione [ENTER].

2XWUD MDQHOD DEULUi FRP XPD VROLFLWDomR SDUD


>6$/9$5@DVPRGLFDo}HVRX>6$,5@VHPVDOYDU
2%6(59$d2$ VHQKD GH 8VXiULR 0HVWUH p
[DGDHQmRSRGHVHUPRGLFDGD3DUDDVHJXUDQoD
DGLFLRQDGDDVHQKDSDGUmRGR8VXiULRGHYHVHU
PRGLFDGDFRPRRSDGUmRpOLVWDGRQHVWHPDQXDO
$VFySLDVGHTXDOTXHUVHQKDDWULEXtGDVGHYHPVHU
armazenadas em um lugar seguro para evitar a perda
como o resultado do pessoal que se move para novas
posies ou locais de mina.

FALHAS DO SISTEMA
O painel de controle interno da cabina programado para
H[LELUUHJLVWUDUIRUQHFHUHGLDJQRVWLFDUWLSRVGLIHUHQWHVGH
IDOKDV$VIDOKDVGHYHPVHUUHFRQKHFLGDVHFRUULJLGDVSDUD
DVVHJXUDUDRSHUDomRGHHVFDGDLQLQWHUUXSWD$OpPGLVVR
cada solicitao de escada normal registrada. Um mximo
GHHQWUDGDVGHUHJLVWURSRGHVHUIRUQHFLGDDQWHVTXH
RVGDGRVVHMDPVXEVWLWXtGRV&DGDWLSRGHIDOKDGHWHFWiYHOp
FODVVLFDGDFRPRSULRULGDGHDOWDRXEDL[D


 8PDIDOKDGHDOWDSULRULGDGHUHVXOWDUiHPXPDODUPH
FRQWtQXRQRSDLQHOGHFRQWUROHLQWHUQRGDFDELQD

8PDIDOKDGHSULRULGDGHEDL[DUHVXOWDUiHPXP
alarme sonoro em intervalos regulares.

7RGDV DV IDOKDV GR VLVWHPD H[FOXLQGR WHQVmR DOWD RX


baixa detectada com a escada em repouso) precisam do
UHFRQKHFLPHQWRGRXVXiULR8PDPHQVDJHPVHUiH[LELGD
QDWHODGRYLVRUGRSDLQHOGHFRQWUROHOLVWDQGRWRGDVDVIDOKDV
em ordem da prioridade. Todas as condies de alarme
GHYHPVHUUHFRQKHFLGDSUHVVLRQDQGRRVERW}HV>6$,5@RX
[ENTER] no painel de controle.
6HXPDFRQGLomRGHIDOKDH[LVWLUGHSRLVGHVHUUHFRQKHFLGD
SRUH[HPSORDERELQDGDERPEDSHUPDQHFHGHVFRQHFWDGD 
uma mensagem de FALHA NO SISTEMA ser exibida ma
tela do visor e o alarme continuar soando.
&RQVXOWHDVSUy[LPDVVpULHVGDVWDEHODVGDVIDOKDVTXH
GHYHPVHUUHFRQKHFLGDVSDUDJDUDQWLUDRSHUDomRGHHVFDGD
ininterrupta.
2%6(59$d2 4XDQGR XP DODUPH LQGLFD TXH H[LVWH
XPDIDOKDHOHpD~QLFDUHVSRQVDELOLGDGHGRRSHUDGRU
para investigar a condio da escada antes de colocar o
caminho em manuteno.

M32-32

Sistema de escada retrtil

M32002

7LSRGH)DOKD(UURQDVFRPXQLFDo}HV
7LSRGH)DOKD

Prioridade

Alta

Descrio

Um erro nas comunicaes ocorre quando a conexo de comunicaes entre o


SDLQHOGHFRQWUROHLQWHUQRGDFDELQDHDIRQWHGHHQHUJLDQmRREWHYHWUDQVPLVV}HV
SRVLWLYDVHPXPSHUtRGRGHGRLVRXPDLVVHJXQGRV

3RVVtYHO HLV &DXVD V

3RGHVHUFDXVDGDSRUDomRGHWHULRUDGDRXLQFRUUHWDJUDQGHTXDQWLGDGHGH
LQWHUIHUrQFLDGHUXtGRHOpWULFRRXXPDIDOKDHOpWULFDQRVLVWHPDGHFRQWUROH

Resposta do Sistema de Alerta 2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi


ao Operador
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDVRDUiXPDODUPHFRQWtQXR
Problema(s) Resultante(s)

$OJXPPRYLPHQWRGDHVFDGDHPFXUVRVHUiFRQFOXtGRPDVQRYRVPRYLPHQWRVQmR
podero ser iniciados.

Solicitada
&RQUPDomR
do Operador?

Sim.

7LSRGH)DOKD)XVtYHOGH$$TXHLPDGR
7LSRGH)DOKD

Prioridade

Alta

Descrio
3RVVtYHO HLV &DXVD V

)LDomRFRPGHIHLWRRXXPDERELQDGDQLFDGDSRGHWDPEpPFDXVDULVWR

Resposta do Sistema
de Alerta ao Operador

2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDVRDUiXPDODUPHFRQWtQXR

Problema(s) Resultante(s)

6HRIXVtYHOGH$TXHLPDUVHDHVFDGDHVFDGDULDRXGHJUDXQmRSRGHUmR
IXQFLRQDU6HRIXVtYHOGH$TXHLPDUVHDOX]VLUHQHQmRIXQFLRQDUmR

Solicitada
&RQUPDomRGR
Operador?

Sim.

M32002

Sistema de escada retrtil

M32-33

7LSRVGH)DOKDH%RELQDGDERPED6XELU'HVFHU$EULU)HFKDUHPFXUWRRXGHVFRQHFWDGD $EULU)HFKDU
UHOHYDQWHVRPHQWHSDUDHVFDGDJLUDWyULD
7LSRGH)DOKD



Prioridade

Alta

Descrio

(VWDIDOKDRFRUUHTXDQGRXPFLUFXLWRDEHUWRRXHPFXUWRIRUGHWHFWDGRQD
UHVSHFWLYDVDtGD

3RVVtYHO HLV &DXVD V

3RGHVHUFDXVDGDSRUXPDIDOKDGRFRQWURODGRUGDERELQDGRVROHQyLGHGH
UHWHQomRRXGDVROHQyLGHGDERPEDRXDomRFRPGHIHLWR

Resposta do Sistema
de Alerta ao Operador

2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDVRDUiXPDODUPHFRQWtQXR

Problema(s) Resultante(s)

$OJXPPRYLPHQWRGDHVFDGDHPFXUVRVHUiFRQFOXtGRPDVQRYRVPRYLPHQWRVQmR
SRGHUmRVHULQLFLDGRV6HRIXVtYHOGH$TXHLPDUVHDOX]VLUHQHQmRIXQFLRQDUi

Solicitada
&RQUPDomR
do Operador?

Sim.

7LSRGH)DOKD5HFDUJDGRSDFRWHKLGUiXOLFRH[FHVVLYDPHQWHORQJD
7LSRGH)DOKD

Prioridade

Alta

Descrio

(VWDIDOKDRFRUUHTXDQGRDERPEDFRQWLQXDDIXQFLRQDUWUrVVHJXQGRVDSyVD
VDtGDGDURGDPRWUL]GDERPEDWHUVLGRGHVDWLYDGD

3RVVtYHO HLV &DXVD V

Pode ser causada por congelamento dos contatos da bobina do controlador da


ERPEDRXDomRFRPGHIHLWR

Resposta do Sistema
de Alerta ao Operador

2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDVRDUiXPDODUPHFRQWtQXR

Problema(s) Resultante(s)

1HQKXP

Solicitada
&RQUPDomR
do Operador?

Sim.

M32-34

Sistema de escada retrtil

M32002

7LSRGH)DOKD)DOKDGRUHOrGHLQLELomR
7LSRGH)DOKD

Prioridade

Alta

Descrio
3RVVtYHO HLV &DXVD V
Resposta do Sistema
de Alerta ao Operador
Problema(s) Resultante(s)
Solicitada
&RQUPDomR
do Operador?

3RGHVHUFDXVDGDSRUERELQDGRUHOrFRPGHIHLWRFRQHFWDGDjVDtGDGHLQLELomRRX
SRUGDQLFDomRLQWHUQDGDFRQWURODGRUD
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDVRDUiXPDODUPHFRQWtQXR
1HQKXP
Sim.

7LSRGH)DOKD)DOKDGRUHOrGDOX]VLUHQH
7LSRGH)DOKD



Prioridade

Alta

Descrio

(VWDIDOKDRFRUUHTXDQGRXPFLUFXLWRDEHUWRRXHPFXUWRIRUGHWHFWDGRQDVDtGDGD
Luz ou da Sirene de Movimentao da Escada.
3RGHVHUFDXVDGDSRUXPDIDOKDGRHTXLSDPHQWRGHOX]PRYLPHQWDomRGD
HVFDGDRXDomRFRPGHIHLWR
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDVRDUiXPDODUPHFRQWtQXR
Luz de Embarque ou Contato de Movimentao da Escada no ser acionado. O
IXVtYHOGH$SRGHTXHLPDUVH
Sim.

3RVVtYHO HLV &DXVD V


Resposta do Sistema
de Alerta ao Operador
Problema(s) Resultante(s)
Solicitada
&RQUPDomR
do Operador?

M32002

Sistema de escada retrtil

M32-35

7LSRGH)DOKD(VFDGDXOWUDSDVVRXROLPLWHVXSHULRU
7LSRGH)DOKD

12

Prioridade

Alta

Descrio

(VWDIDOKDRFRUUHTXDQGRRLQWHUUXSWRUGROLPLWHGH(/(9$d2pDEHUWRHHVFDGD
encontra-se supostamente na posio totalmente erguida.
3RGHVHUFDXVDGDSRUXPDIDOKDPHFkQLFDGRVLVWHPDEDL[DSUHVVmRGHIHLWRQR
LQWHUUXSWRUGROLPLWHRXDomRFRPGHIHLWR
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDVRDUiXPDODUPHFRQWtQXR
$IRQWHGHHQHUJLDWHQWDUiUHSRVLFLRQDUDHVFDGDSDUDDSRVLomRWRWDOPHQWHHUJXLGD
GXUDQWHXPSHUtRGRGHWHPSRGHQLGRSHODSURJUDPDomRGD5HFDUJDGRSDFRWH
KLGUiXOLFR
Sim.

3RVVtYHO HLV &DXVD V


Resposta do Sistema
de Alerta ao Operador
Problema(s) Resultante(s)

Solicitada
&RQUPDomR
do Operador?

7LSRGH)DOKD(VFDGDQmRDOFDQoDRVHXOLPLWH
7LSRGH)DOKD

13

Prioridade

Alta

Descrio

(VWDIDOKDRFRUUHTXDQGRRPRYLPHQWRGH(/(9$d2GR6LVWHPDGH(VFDGD
Retrtil completado devido a um intervalo de tempo em vez da deteco pelo
VLVWHPDGHXPIHFKDPHQWRGRLQWHUUXSWRUGROLPLWHGH(/(9$d2
Pode ser causada por uma obstruo mecnica da escada que a impede de
IHFKDUGHQWURGRWHPSRDGPLVVtYHOXPDIDOKDQRLQWHUUXSWRUGROLPLWHRXDomR
FRPGHIHLWR
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDVRDUiXPDODUPHFRQWtQXR
1HQKXP

3RVVtYHO HLV &DXVD V

Resposta do Sistema
de Alerta ao Operador
Problema(s) Resultante(s)
Solicitada
&RQUPDomR
do Operador?

M32-36

Sim.

Sistema de escada retrtil

M32002

7LSRGH)DOKD(VFDGDSHUPDQHFHVREUHROLPLWH
7LSRGH)DOKD

14

Prioridade

Alta

Descrio

6HIRUGHWHFWDGRTXHRLQWHUUXSWRUGROLPLWHGH(/(9$d2WHQKDSHUPDQHFLGR
IHFKDGRDRWpUPLQRGD'(6&,'$GDHVFDGDHVFDGDULDRXGHJUDXDRSHUDomR
continuar e ser controlada atravs de parmetros de tempo predeterminados.
8PDIDOKDQRLQWHUUXSWRUGROLPLWHRXHPVXDDomR

3RVVtYHO HLV &DXVD V


Resposta do Sistema
de Alerta ao Operador
Problema(s) Resultante(s)

Solicitada
&RQUPDomR
do Operador?

2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDVRDUiXPDODUPHFRQWtQXR
$RSHUDomRGDHVFDGDHVFDGDULDRXGHJUDXFRQWLQXDPDVRLQWHUUXSWRUGROLPLWH
GH68%,'$pGHVFRQVLGHUDGRWRGRRPRYLPHQWRGDHVFDGDpFRQWURODGRDWUDYpV
de temporizadores.
Sim.

7LSRGH)DOKD%DL[RQtYHOGHyOHR
7LSRGH)DOKD

15

Prioridade

Alta

Descrio

6HDHQWUDGDGRQtYHOGHyOHRGHWHUPLQDUTXHRQtYHOGRyOHRHVWHMDPXLWREDL[R
HVWHHUURVHUiVLQDOL]DGR2)UHLRGH(VWDFLRQDPHQWRGHYHVHUDMXVWDGRSDUD
DVVHJXUDUXPDOHLWXUDSUHFLVD4XDQGRRIUHLRGHHVWDFLRQDPHQWRpOLEHUDGRR
VLVWHPDGHVFRQVLGHUDDHQWUDGDGRQtYHOGHyOHR
1tYHOGRUHVHUYDWyULRGHyOHRQmRPDQWLGRRXXPYD]DPHQWRGHyOHRQRVLVWHPD
KLGUiXOLFR
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDVRDUiXPDODUPHFRQWtQXR
1HQKXP DWpTXHRQtYHOGHyOHRHVWHMDPXLWREDL[RSDUDRSHUDomR 

3RVVtYHO HLV &DXVD V


Resposta do Sistema
de Alerta ao Operador
Problema(s) Resultante(s)
Solicitada
&RQUPDomR
do Operador?

M32002

Sim.

Sistema de escada retrtil

M32-37

7LSRGH)DOKD7HQVmRGRVLVWHPDDFLPDGH9GXUDQWHRPRYLPHQWR
7LSRGH)DOKD

16

Prioridade

Baixa

Descrio

(VWDIDOKDRFRUUHTXDQGRDPHGLomRGDYROWDJHPGR6LVWHPDGH(VFDGD5HWUiWLO
estiver acima de 18 VCC durante o movimento da escada.
)UHTXHQWHPHQWHFDXVDGDTXDQGRRFDPLQKmRHVWiVREXPDFDUJDHOpWULFD SRU
H[HPSORSDUWLGDHPLJQLomR HQTXDQWRDHVFDGDHVWLYHUHPPRYLPHQWR
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
O painel de controle interno da cabina soar um alarme em intervalos regulares.
&RPRXPDIDOKDFRQWtQXDSRGHUiUHGX]LUDYLGDRSHUDFLRQDOGDERPEDKLGUiXOLFD
GR6LVWHPDGH(VFDGD5HWUiWLORXGDQLFiOD
Sim.

3RVVtYHO HLV &DXVD V


Resposta do Sistema
de Alerta ao Operador
Problema(s) Resultante(s)
Solicitada
&RQUPDomR
do Operador?

7LSRGH)DOKD7HQVmRGRVLVWHPDDEDL[RGH9
7LSRGH)DOKD
Prioridade
Descrio

3RVVtYHO HLV &DXVD V


Resposta do Sistema
de Alerta ao Operador
Problema(s) Resultante(s)
Solicitada
&RQUPDomR
do Operador?

M32-38

17
Baixa
(VWDIDOKDRFRUUHTXDQGRDPHGLomRGDYROWDJHPGR6LVWHPDGH(VFDGD5HWUiWLO
estiver abaixo de 18 VCC durante o movimento da escada. O Sistema de Escada
5HWUiWLOQmRGHYHVHURSHUDGRVREWDLVFRQGLo}HVPDVDHVFDGDQmRpEORTXHDGD
para impedir a utilizao.
)UHTXHQWHPHQWHFDXVDGDTXDQGRRFDPLQKmRHVWiVREXPDFDUJDHOpWULFD SRU
H[HPSORSDUWLGDHPLJQLomR 
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
O painel de controle interno da cabina soar um alarme em intervalos regulares.
1HQKXP
No.

Sistema de escada retrtil

M32002

7LSRGH)DOKD7HQVmRGRVLVWHPDDFLPDGH9
7LSRGH)DOKD

18

Prioridade

Baixa

Descrio

(VWDIDOKDRFRUUHTXDQGRDPHGLomRGDYROWDJHPGR6LVWHPDGH(VFDGD5HWUiWLO
estiver acima de 31 VCC durante o movimento da escada. O Sistema de Escada
5HWUiWLOQmRGHYHVHURSHUDGRVREWDLVFRQGLo}HVPDVDHVFDGDQmRpEORTXHDGD
para impedir a utilizao.
3RGHLQGLFDUTXHRDOWHUQDGRUGRFDPLQKmRQmRHVWiIXQFLRQDQGRFRUUHWDPHQWH

3RVVtYHO HLV &DXVD V


Resposta do Sistema
de Alerta ao Operador
Problema(s) Resultante(s)
Solicitada
&RQUPDomR
do Operador?

2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
O painel de controle interno da cabina soar um alarme em intervalos regulares.
1HQKXP
No.

7LSRGH)DOKD,QWHUUXSWRUFRPXWDGRUUHPRWRGH(/(9$d2HRX'(6&,'$UHWLGRSRUPXLWRWHPSR TXDQGR
equipado)
7LSRGH)DOKD



Prioridade

Baixa

Descrio

(VWDIDOKDRFRUUHTXDQGRRLQWHUUXSWRUFRPXWDGRUGRWHUPLQDOGHDFHVVRUHPRWR
mantido na posio CIMA ou BAIXO por mais do que 10 segundos. O evento
UHJLVWUDGRHDPHQVDJHPGHHUURH[LELGDGLVWLQJXLUmRDSRVLomRHIHWLYDGDIDOKD
3RGHVHUFDXVDGDSRUXPXVXiULRTXHPDQWHQKDRLQWHUUXSWRUFRPXWDGRU
SUHVVLRQDGRSRUPXLWRWHPSRXPDF~PXORGHSyODPDQRFRQWDWRRXXPD
GDQLFDomRPHFkQLFDQDXQLGDGH
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
O painel de controle interno da cabina soar um alarme em intervalos regulares.
O movimento da escada em curso ser completado normalmente. O interruptor
FRPXWDGRUSRGHSHUPDQHFHULQXWLOL]iYHODWpTXHDIDOKDVHMDVROXFLRQDGD
Sim.

3RVVtYHO HLV &DXVD V

Resposta do Sistema
de Alerta ao Operador
Problema(s) Resultante(s)
Solicitada
&RQUPDomR
do Operador?

M32002

Sistema de escada retrtil

M32-39

7LSRGH)DOKD7HPSRGHUHFDUJDGRDFXPXODGRUVXSHULRUDXPDKRUD
7LSRGH)DOKD

21

Prioridade

Baixa

Descrio

(VWDIDOKDRFRUUHTXDQGRRDFXPXODGRUQHFHVVLWDUGHUHFDUJDPDLVGRTXHXPD
YH]SRUKRUDGHYLGRjEDL[DSUHVVmR
)UHTXHQWHPHQWHFDXVDGDSRUXPDIDOKDQRVFRPSRQHQWHVGR6LVWHPDGH(VFDGD
Retrtil.
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
O painel de controle interno da cabina soar um alarme em intervalos regulares.
1HQKXP

3RVVtYHO HLV &DXVD V


Resposta do Sistema
de Alerta ao Operador
Problema(s) Resultante(s)
Solicitada
&RQUPDomR
do Operador?

Sim.

7LSRGH)DOKD(OHYDomRGRVLVWHPDSHORIUHLRGHHVWDFLRQDPHQWR
7LSRGH)DOKD

22

Prioridade

Baixa

Descrio

4XDQGRRVLVWHPDHVWLYHUQDSRVLomRGH'(6&,'$HRIUHLRGHHVWDFLRQDPHQWRIRU
OLEHUDGRDHVFDGDHVFDGDULDRXGHJUDXVHUiDXWRPDWLFDPHQWHHUJXLGR(VWDQmRp
DRSHUDomRFRUUHWDGRVLVWHPDHSRUWDQWRpORJDGDFRPRXPDIDOKD
8WLOL]DomRGRIUHLRGHHVWDFLRQDPHQWRHPYH]GRSDLQHOGHFRQWUROHLQWHUQRGD
FDELQDSDUDHUJXHUDHVFDGDHVFDGDULDRXGHJUDX
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
O painel de controle interno da cabina soar um alarme em intervalos regulares.
1HQKXP

3RVVtYHO HLV &DXVD V


Resposta do Sistema
de Alerta ao Operador
Problema(s) Resultante(s)
Solicitada
&RQUPDomR
do Operador?

M32-40

Sim.

Sistema de escada retrtil

M32002

7LSRGH)DOKD1tYHLVHGHVHUYLoRYHQFLGRV
7LSRGH)DOKD
Prioridade
Descrio
3RVVtYHO HLV &DXVD V

Resposta do Sistema
de Alerta ao Operador
Problema(s) Resultante(s)
Solicitada
&RQUPDomR
do Operador?


Baixa
Quando o primeiro e segundo intervalos de servio vencidos tiverem sido
H[FHGLGRVSHODFRQWDJHPGHRSHUDo}HVXPHUURpUHJLVWUDGRHpVROLFLWDGDXPD
QRWLFDomRDRXVXiULR
$HVFDGDDHVFDGDULDRXRGHJUDXQmRIRLVXEPHWLGRDRVHUYLoRGHQWURGHXP
Q~PHURDFHLWiYHOGHRSHUDo}HV6HRVHUYLoRWLYHUVLGRFRPSOHWDGRDVROLFLWDomR
GHVHUYLoRQmRIRLHOLPLQDGDGRVLVWHPD
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
O painel de controle interno da cabina soar um alarme em intervalos regulares.
1HQKXP
Sim.

7LSRGH)DOKD1tYHLVGHVHUYLoRHFRPSOHWRV
7LSRGH)DOKD
Prioridade
Descrio

3RVVtYHO HLV &DXVD V


Resposta do Sistema
de Alerta ao Operador
Problema(s) Resultante(s)
Solicitada
&RQUPDomR
do Operador?

M32002

25
Baixa
$SyVDHVFDGDDHVFDGDULDRXRGHJUDXWLYHUVLGRVXEPHWLGRDRVHUYLoRXP
usurio com ID Usurio-Mestre deve limpar a solicitao de servio. Quando a
VROLFLWDomRGHVHUYLoRpHOLPLQDGDVHUiUHJLVWUDGDXPDHQWUDGD 1tYHOGH6HUYLoR
HRX&RQFOXtGR
2SDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LELUiXPDPHQVDJHPGHIDOKDHOLVWDUi
WRGDVDVIDOKDVHPRUGHPGHSULRULGDGH
O painel de controle interno da cabina soar um alarme em intervalos regulares.
1HQKXP
Sim.

Sistema de escada retrtil

M32-41

GERENCIAMENTO DE DADOS
Para rever os dados de registros baixados a partir
GRSDLQHOGHFRQWUROHLQWHUQRGDFDELQDH[LVWHXPD
LQWHUIDFHFRPR0LFURVRIW([FHOFDUUHJDGDQXPD
PHPyULD86%IRUQHFLGDFRPDXQLGDGHGR6LVWHPD
de Escada Retrtil.
Os dados so apresentados de modo resumido
H FRPR UHJLVWUR FRPSOHWR$ LQWHUIDFH SHUPLWH
FODVVLFDomRDGLFLRQDOGRUHJLVWURFRPSOHWRSDUDR
GHVHQYROYLPHQWRGHUHODWyULRVFXVWRPL]DGRV

Arquivos de registros
Embora os arquivos de registro possam ser
DUPD]HQDGRV QD PHPyULD 86% IRUQHFLGD FRP
D XQLGDGH GR 6LVWHPD GH (VFDGD 5HWUiWLO p
UHFRPHQGiYHOTXHRVDUTXLYRVGHUHJLVWURVHMDP
WUDQVIHULGRVSDUDXPODSWRSRX3&SDUDJHUHQFLDPHQWR
do arquivo a longo prazo. O arquivo padro criado na
PHPyULD86%GXUDQWHRGRZQORDGGRVGDGRVSRVVXL
RVVHJXLQWHVQRPHHIRUPDWR

3RU H[HPSOR XP WtSLFR QRPH GH DUTXLYR SRGHULD VHU


5/6TXHVLJQLFDVHJXQGRDUTXLYR5/6FULDGR
HPGHMXOKRGH
e LPSRUWDQWH TXH D GDWD H R KRUiULR FRUUHWRV VHMDP
programados no painel de controle interno da cabina pelos
VHJXLQWHVPRWLYRV


$VLQIRUPDo}HVGHDQRPrVHGLDXWLOL]DGDVQR
QRPHGRDUTXLYRVmRWRPDGDVGRUHOyJLRDERUGR
2VUHJLVWURVVmRRKRUiULRHDGDWDHVWDPSDGRV
SDUDIRUQHFHUXPKRUiULRSUHFLVRHUHDOGHHYHQWRV
do sistema da escada. Para terem validade
QR GLDJQyVWLFR GH IDOKDV RV UHJLVWUR GHYHP
FRUUHODFLRQDUVHDRVHYHQWRVHIHWLYRV

$$00'',15/6RQGH





 AA VmR RV GRLV ~OWLPRV GtJLWRV GR DQR


corrente
 MM o ms corrente
 DD o dia corrente
 IN p R tQGLFH GR DUTXLYR 6H P~OWLSORV
DUTXLYRVIRUHPFULDGRVQDPHVPDPHPyULD
86% FDGD DUTXLYR VXEVHTXHQWH VHUi
incrementalmente indexado. Se o registro
IRUHOLPLQDGRYLDSDLQHOGHFRQWUROHLQWHUQR
GD FDELQD R tQGLFH GR DUTXLYR LQLFLDUi
QRYDPHQWHGHSDUDRSUy[LPRGRZQORDG
 .RLSpRIRUPDWRGHDUTXLYRGHFRQJXUDomR
original do Sistema de Escada Retrtil a
SDUWLU GRV GDGRV EUXWRV FRGLILFDGRV HP
EDVH KH[DGHFLPDO XWLOL]DGRVQR VLVWHPD
operacional do Sistema de Escada Retrtil.

M32-42

Sistema de escada retrtil

M32002

*HUDomRGH5HODWyULRV
$SyVRVDUTXLYRV5/6WHUHPVLGRUHFXSHUDGRVSUHFLVDP
VHUWUDGX]LGRVSDUDXPIRUPDWRXWLOL]iYHO
2 DUTXLYR 0LFURVRIW ([FHO .RPDWVXB5/6B9[OV p
FDUUHJDGRQDPHPyULD86%IRUQHFLGDFRPDXQLGDGHGR
Sistema de Escada Retrtil.
(VWDLQWHUIDFHJHUDUiUHODWyULRVGRVDUTXLYRV5/6
$VHJXLQWHVHTXrQFLDGHVFUHYHDJHUDomRGHXPUHODWyULRD
SDUWLUGHXPDUTXLYREUXWRSDUDXPDSODQLOKD([FHO

M32002

 $EUDRDUTXLYR0LFURVRIW([FHO.RPDWVXB
5/6B9[OVGLUHWDPHQWHGDPHPyULD86%
ou de uma posio armazenada em um
laptop ou PC.

127$ 2 DUTXLYR 0LFURVRIW ([FHO .RPDWVXB


5/6B9[OVFRQWpPXPDPDFURTXHJHUDUiXPD
$GYHUWrQFLDGH6HJXUDQoD:LQGRZVTXDQGRDEHUWR
$RSomR+DELOLWDU0DFURV 2IFH RXDRSomR
+DELOLWDUHVWHFRQWH~GR 2IILFH WHUiTXHVHU
VHOHFLRQDGDDPGHGDUFRQWLQXLGDGH

Sistema de escada retrtil

M32-43

 $LQWHUIDFH0LFURVRIW([FHO+RPH3DJH 2IFH


 VHUiHQWmRH[LELGDFRQIRUPHPRVWUDGR
abaixo.

 3DUDFDUUHJDUXPDUTXLYRDPGHYLVXDOL]DURV
GDGRVUHJLVWUDGRVFOLTXHQRERWmR>&DUUHJDU
$UTXLYR@ QD FDL[D$omR FRQIRUPH PRVWUDGR
abaixo.

M32-44

Sistema de escada retrtil

M32002

 $SyVFOLFDUQRERWmR>&DUUHJDU$UTXLYR@DSDUHFHUiD
PHQVDJHP/LPSDU3ULPHLURRV'DGRV"&OLTXHHP
[Sim] para limpar os dados previamente carregados a
SDUWLUGDSODQLOKD

 $SDUWLUGDMDQHOD$EULU$UTXLYRSHVTXLVHDSRVLomRGR
DUTXLYR5/6VHOHFLRQHRDUTXLYRQHFHVViULRHFOLTXH
duas vezes ou clique no boto [Abrir] para abrir o
DUTXLYRQDLQWHUIDFH.RPDWVXB5/6B9[OV

M32002

Sistema de escada retrtil

M32-45

6. O arquivo deve abrir na Pgina 5HODWyULR


5HVXPLGR FRQIRUPH PRVWUDGR QD ILJXUD
DEDL[R(VWHUHODWyULRDSUHVHQWDXPUHVXPRGH
Programaes de sincronizao do Sistema de
(VFDGD5HWUiWLOVLQFURQL]Do}HVGRsistema em
GeralContadores de Erros de Sistema de
Escada Retrtil (todos os eventos indicados no
SDLQHOGHFRQWUROHLQWHUQRGDFDELQD HKRUiULRH
data estampados em ,QIRUPDo}HVGH/RJV.

M32-46

$ V  D E D V  O R F D O L ] D G D V  Q D  S D U WH  L Q IH U L R U  G D  S O D Q L O K D
presentemente aberta prov acesso s trs selees
GHGDGRVGDSODQLOKDGLVSRQtYHOQDLQWHUIDFH.RPDWVXB
5/6B9[OV(VWDVVmRDSiJLQD3ULQFLSDODSiJLQD
5HODWyULRHDSiJLQD'DGRVGHUHJLVWURVFRQIRUPHPRVWUDD
JXUDDEDL[R

Sistema de escada retrtil

M32002

 3DUDYLVXDOL]DURV'DGRVGHUHJLVWURVFOLTXHQDDED
'DGRVGHUHJLVWURVQDSDUWHLQIHULRUGDSODQLOKDFRQIRUPH
PRVWUDDJXUDDEDL[R$SiJLQDGHYHDSDUHFHUFRQIRUPH
PRVWUDDJXUDDEDL[R

M32002

Sistema de escada retrtil

M32-47

8. Para visualizar antecipadamente eventos


HVSHFtILFRVFRPIDFLOLGDGHXWLOL]HDOLVWDGURS
down Eventos em Realce para selecionar um tipo
de evento. Selecione ento um realce colorido e
o boto [Eventos em Realce] para realar todos
os eventos idnticos atravs de registros na
mesma cor. O boto [Limpar Realce] remover o
realce colorido de todas as entradas e permitir
XPDVHOHomRDGLFLRQDOVHQHFHVViULD
O boto [Remover Eventos] remover todos os
eventos realados do log.

ATENO

Utilize o boto [Remover Eventos] com extrema


ateno, visto que ele remove completamente
os eventos do arquivo. Para reter o arquivo de
registros em sua condio original, utilize a
opo Salvar Como aps remover os eventos
a fim de assegurar que o arquivo original
permanece intacto.

M32-48

Sistema de escada retrtil

M32002

 2 V  H Y H Q W R V  W D P E p P  S R G H P  V H U  F O D V V L I L F D G R V
selecionando-se uma das trs opes na caixa de
GLiORJR&ODVVLFDU/RJ2VHYHQWRVUHJLVWUDGRVVHUmR
HQWmRUHDUUDQMDGRVGHDFRUGRFRPDVHOHomR&ODVVLFDU
5HJLVWURHVFROKLGD$FRQJXUDomRRULJLQDOpSURJUDPDGD
para Tipo de Log.

DIAGRAMAS DE MENU
As pginas a seguir contm diagramas para auxiliar o
XVXiULRDQDYHJDUDWUDYpVGRVGLYHUVRVPHQXVGDVIXQo}HV
do painel de controle interno da cabina.
&RQJXUDomRGD&RQWURODGRUD
$ ILJXUD  IRUQHFH LQIRUPDo}HV GH DOWHUDomR RX
DWXDOL]DomRGRVSDUkPHWURVGR6LVWHPDGH(VFDGD5HWUiWLO
WDLVFRPRVLQFURQL]DomRGDHVFDGDHGDIRQWHGHHQHUJLD
,QIRUPDo}HVSDUD&RQWDWR
$ILJXUDIRUQHFHLQIRUPDo}HVSDUDFRQWDWRFRPD
.RPDWVXDUHVSHLWRGHTXHVW}HVWpFQLFDVUHIHUHQWHVDR
Sistema de Escada Retrtil.
Apresentar Registros Recentes
$JXUDIRUQHFHLQIRUPDo}HVVREUHDYLVXDOL]DomRGH
dados operacionais do Sistema de Escada Retrtil no painel
de controle interno da cabina.
Programaes do Sistema
$JXUDIRUQHFHLQIRUPDo}HVVREUHDYLVXDOL]DomRGDV
programaes de sistema do Sistema de Escada Retrtil.
&DUUHJDU5HJLVWURVQD0HPyULD86%
$JXUDIRUQHFHLQIRUPDo}HVVREUHDWUDQVIHUrQFLDGRV
dados operacionais do Sistema de Escada Retrtil para uma
PHPyULD86%2VGDGRVHQWmRSRGHPVHUEDL[DGRVSDUDXP
computador ou banco de dados para anlise.
'LDJQyVWLFRV
$ILJXUDIRUQHFHXPDOLVWDDEUDQJHQWHGHHYHQWRV
do sistema e a Integridade das Comunicaes do sistema
exibida como uma porcentagem.

M32002

Sistema de escada retrtil

M32-49

EXIBIO DE ACESSO PRINCIPAL


Exibe a presente condio da escada

Para acessar o MENU DA CONTROLADORA


pressione os botes [ENTER]
ou [EXIT]
MENU DA CONTROLADORA
Exibe o Menu da Raiz Principal
Opes

Programaes do Sistema
Exibe as Programaes Atuais do Sistema

Utilize o boto [BAIXO] para rolar


a tela para &RQJ&RQWURODGRUD e
ento pressione [ENTER]
&RQJ&RQWURODGRUD
$FHVVRjVHQKDSDUDDOWHUDomR
das Programaes do Sistema
Para retornar
EXIBIO DE ACESSO PRINCIPAL
pressione o boto [EXIT].
Mostrar Registros Recentes
([LEHDV~OWLPDVKRUDHGDWD
de eventos estampados
&DUUHJDU5HJLVWURVQD0HPyULD86%
Permite baixar o registros dos dados
YLD0HPyULD86%
'LDJQyVWLFRV
Exibe um resumo da Integridade dos
Eventos e Comunicaes

)RQH +555-555-1212
([LEH'HWDOKHVGR&RQWDWR.RPDWVX

INSERIR ID DO USURIO
,QVLUDDVHQKDGHDFHVVR
Utilize as teclas das setas para selecionar.
Para alterar a Opo &RQJ&RQWURODGRUDXWLOL]HRVERW}HV[UP] e [DOWN]
SDUDSURJUDPDUXPFyGLJRDOIDQXPpULFRRXHIHWXDUXPDVHOHomR RVERW}HV
[LEFT] e [RIGHT]PRYHUmRRFXUVRUDWUDYpVGRVFDPSRV 4XDQGRFRQFOXtGR
pressione [ENTER] para aceitar.
OPES CONFIG CONTROLADORA
,'GR9HtFXOR(PROGRAMA ID DO VECULO)
Tipo de Escada 352*5$0$7,32'((6&$'$VRPHQWH(VFDGD*LUDWyULDGHGXSODDomR
Sincronizao da Escada $MXVWDWHPSRGHDFLRQDPHQWRGD6,1&521,=$d2
'$(/(9$d2'$(6&$'$HPLQFUHPHQWRVGHV
&RQJXUDomRGD)LDomR 3URJUDPD5HOrV,1,%,53$5$5()5(,2'((67$&,21$0(172
INIBIR 6LP1mR PARAR E 121& FREIO DE ESTACIONAMENTO 121&
Sincronizao da Fonte de Energia $MXVWD6,1&521,=$d2'$)217('((1(5*,$SDUD
5HFDUJDGR$FXPXODGRUHPLQFUHPHQWRVGHV
Luz de Embarque $MXVWD6,1&521,=$d2'2$&(1',0(172'$/8='((0%$548(
HPLQFUHPHQWRVGHV

Opes de exibio

Ajuste do intervalo de tempo de exibio do menu $MXVWDRVLQWHUYDORVGHH[LELomRGRPHQX


em incrementos de 10 segundos)
Ajuste do intervalo de tempo de exibio da tela $MXVWDRVLQWHUYDORVGHH[LELomRGDVWHODV
em incrementos de 10 segundos)
Ajuste do tempo de pausa do sinal sonoro (bip) $MXVWDRVLQWHUYDORVGHH[LELomRGRPHQXHP
incrementos de 1 segundo)
Bloqueio de Entrada da Cabina $MXVWDR%ORTXHLRGH(175$'$'$&$%,1$SDUD/,*RX'(6/
CoQJXUDomRGH8VXiULR 9LVXDOL]D$FHVVRj6HQKDGR8VXiULR0HVWUHH8VXiULR5HVWULWRH
SURJUDPDU$FHVVRj6HQKDGH8VXiULRVHDGLFLRQDLV
3URJUDPDU'DWD+RUD(Programa Data e Hora para Sincronizao de Registro de Dados)
IQVHUomRGRQ~PHURGHWHOHIRQH $OWHUDRQ~PHURGHWHOHIRQHDVHUFKDPDGRSDUDVROLFLWDURV
servios Komatsu)
Limpar Registros /LPSDUHJLVWURVGHGDGRVDWXDLV3UHVVLRQH>(17(5@SDUDOLPSDURX>(;,7@SDUDVDLU 
3URJUDPDU&RQJXUDo}HV2ULJLQDLV  5HWRUQDWRGDVDV3URJUDPDo}HVDRVVHXV9DORUHVGH&RQJXUDomRULJLQDO
Programao de Servios de Manuteno (Programa Indicadores de Intervalos de Manuteno)
3URJUDPD,QWHUYDORVGH0DQXWHQomR1tYHO (0 a 30.000 operaes)
3URJUDPD,QWHUYDORVGH0DQXWHQomR1tYHO (0 a 30.000 operaes)
3URJUDPD,QWHUYDORVGH0DQXWHQomR1tYHO (20 a 5.000 operaes)

),*85$(VWUXWXUDGR0HQXGR3DLQHOGH&RQWUROH&RQJ&RQWURODGRUD
M32-50

Sistema de escada retrtil

M32002

EXIBIO DE ACESSO PRINCIPAL


Exibe a presente condio da escada

Para acessar o MENU DA CONTROLADORA


pressione os botes [ENTER]
ou [EXIT]

MENU DA CONTROLADORA
Exibe o Menu da Raiz Principal
Opes

3DUDYLVXDOL]DURV5HJLVWURV5HFHQWHVXWLOL]HRVERW}HV[CIMA] e [BAIXO]
para rolar atravs dos dados registrados das ltimas 50 entradas.
MOSTRA A OPO LOGS RECENTES

Programaes do Sistema
Exibe as Programaes
Atuais do Sistema
&RQJ&RQWURODGRUD
$FHVVRjVHQKDSDUDDOWHUDomRGDV
Programaes do Sistema

Mostrar Registros Recentes


([LEHDV~OWLPDVKRUDHDGDWD
de eventos estampados

&DUUHJDU5HJLVWURVSDUDD0HPyULD86%
Permite baixar os registros dos dados
YLD0HPyULD86%

'LDJQyVWLFRV
Exibe um resumo da Integridade
dos Eventos e Comunicaes

DETALHES DO CONTATO
3DUDDVVLVWrQFLDWpFQLFD
OLJXH
+555-555-1212
Ou visite
www.abc123.com
SDUDGHWDOKHVGRFRQWDWR

$VLQIRUPDo}HVFRPRV'HWDOKHVGR&RQWDWRVmR
H[LELGDVFRQIRUPHDFDL[DGHWH[WRjHVTXHUGD6H
YRFrQHFHVVLWDUGHDVVLVWrQFLDWpFQLFDYRFrSRGH
ligar para a Komatsu atravs do nmero indicado.

Utilize o boto [BAIXO] para rolar para


1~PHURGR7HOHIRQH e
ento pressione [ENTER]

)RQH +555-555-1212
([LEH'HWDOKHVGR&RQWDWR.RPDWVX

Para retornar para EXIBIO DE ACESSO


PRINCIPAL pressione o boto [EXIT]

127$2Q~PHURGRWHOHIRQHGHFRQWDWRGD$VVLVWrQFLD7pFQLFDSRGHVHUDOWHUDGR
DWUDYpVGH&RQJ&RQWURODGRUD2DFHVVRjVHQKDSRGHVHUVROLFLWDGRSDUDHQWUDUQDV
RSo}HVGRVXEPHQX&RQJ&RQWURODGRUD6HKRXYHU$VVLVWrQFLD7pFQLFDDSURYDGDSHOD
.RPDWVXQDORFDOLGDGHLQVLUDRUHVSHFWLYRQ~PHURGRWHOHIRQHGHFRQWDWR

),*85$(VWUXWXUDGR0HQXGR3DLQHOGH&RQWUROH,QIRUPDo}HVSDUD&RQWDWR

M32002

Sistema de escada retrtil

M32-51

EXIBIO DE ACESSO PRINCIPAL


Exibe a presente condio da escada

Para acessar o MENU DA CONTROLADORA


pressione os botes [ENTER]
ou [EXIT]

MENU DA CONTROLADORA
Exibe o Menu da Raiz Principal
Opes

Programaes do Sistema
Exibe as Programaes
Atuais do Sistema

3DUDYLVXDOL]DURV5HJLVWURV5HFHQWHVXWLOL]HRVERW}HV[CIMA] e [BAIXO]
para rolar atravs dos dados registrados das ltimas 50 entradas.

MOSTRA A OPO LOGS RECENTES

&RQJ&RQWURODGRUD
$FHVVRjVHQKDSDUDDOWHUDomRGDV
Programaes do Sistema

Utilize o boto [DOWN] para rolar a tela


para Carregar Registros e ento pressione
[ENTER]

Mostrar Registros Recentes


([LEHDV~OWLPDVKRUDHDGDWD
de eventos estampados

50 LTIMOS EVENTOS

6LVWHPDGH$FHVVR
Levantado por Comando

6LVWHPDGH$FHVVR
Baixado por Comando

$ V  L Q I R U P D o } H V  G H  5 H J L V W U R V  5 H F H Q W H V  V m R
H[LELGDV QD FDL[D GH WH[WR j HVTXHUGD FRP GRLV
RULItFLRVHVWDPSDGRVGHKRUDHGDWDVHQGRH[LELGRV
simultaneamente. Ao rolar a tela para baixo o evento do
WRSRVDLUiHRVGRLVSUy[LPRVHYHQWRVVHUmRH[LELGRV

Para retornar EXIBIO DE ACESSO


PRINCIPAL pressione o boto [EXIT].

&DUUHJDU5HJLVWURVSDUDD0HPyULD86%
Permite baixar os registros dos dados
YLD0HPyULD86%

'LDJQyVWLFRV
Exibe um resumo da Integridade
dos Eventos e Comunicaes

)RQH +555-555-1212
([LEH'HWDOKHVGR&RQWDWR.RPDWVX

127$2UHJLVWURpXPUHJLVWURGHURODJHP4XDQGRFRPSOHWRHOHVREUHVFUHYHRVGDGRV
registrados anteriores. A capacidade de registros de dados atuais de 3.000 pontos de
GDGRVHpDUPD]HQDGDHPXPDPHPyULDQmRYROiWLOIRUQHFHQGRXPEDQFRFRQWtQXRGH
GDGRVHVWDPSDGRVGHKRUDHGDWDGLVSRQtYHLVSDUDGRZQORDGSDUDXPDPHPyULD86%

),*85$(VWUXWXUDGR0HQXGR3DLQHOGH&RQWUROH0RVWUDU5HJLVWURV5HFHQWHV

M32-52

Sistema de escada retrtil

M32002

EXIBIO DE ACESSO PRINCIPAL


Exibe a presente condio da escada

Para acessar o MENU DA CONTROLADORA


pressione os botes [ENTER]
ou [EXIT]

MENU DA CONTROLADORA
Exibe o Menu da Raiz Principal
Opes

Utilize o boto [DOWN] para rolar a tela


para Carregar Registros e ento pressione
[ENTER]

3DUDYLVXDOL]DUDVDWXDLV3URJUDPDo}HVGR6LVWHPDXWLOL]HRVERW}HV
[UP] e [DOWN] para rolar atravs das opes.

OPES DE PROGRAMAES DO SISTEMA


ID H[LEHRQ~PHURGRYHtFXORVHSURJUDPDGR
Sistema de Atuao Simples ou Duplo VRPHQWH(VFDGD*LUDWyULDGHGXSODDomR

Programaes do Sistema
Exibe as Programaes
Atuais do Sistema

Sistema IS H[LEHDSRVLomRDWXDOGHHVFDGD&LPDRX%DL[R
Bloqueio de Entrada da Cabina/LJDGRRX'HVOLJDGR FRQJXUDomRRULJLQDOHP'HVOLJDGR
+RUiULRVGH6ROHQyLGH/,*

Para retornar EXIBIO DE ACESSO


PRINCIPAL pressione o boto [EXIT].

&RQJ&RQWURODGRUD
$FHVVRjVHQKDSDUDDOWHUDomRGDV
Programaes do Sistema

Mostrar Registros Recentes


([LEHDV~OWLPDVKRUDHDGDWD
de eventos estampados

&DUUHJDU5HJLVWURVSDUDD0HPyULD86%
Permite baixar os registros dos dados
YLD0HPyULD86%

Sistema CIMA
CIMA FRQJXUDomRRULJLQDOHPVHJXQGRV  VRPHQWH(VFDGD*LUDWyULD
DENTRO FRQJXUDomRRULJLQDOHPVHJXQGRV  VRPHQWH(VFDGD*LUDWyULD
BAIXO FRQJXUDomRRULJLQDOHPVHJXQGRV  VRPHQWH(VFDGD*LUDWyULD
Sistema BAIXO
CIMA FRQJXUDomRRULJLQDOHPVHJXQGRV  VRPHQWH(VFDGD*LUDWyULD
FORA FRQJXUDomRRULJLQDOHPVHJXQGRV  VRPHQWH(VFDGD*LUDWyULD
BAIXO FRQJXUDomRRULJLQDOHPVHJXQGRV
CONTINUA FRQJXUDomRRULJLQDOHPVHJXQGRV
Horrios de Fonte de Energia LIG
Recarga C.A FRQJXUDomRRULJLQDOHPVHJXQGRV
Sistema CIMA FRQJXUDomRRULJLQDOHPVHJXQGRV
Luz de Embarque FRQJXUDomRRULJLQDOHPVHJXQGRV
)HFKDPHQWRGR0HQX FRQJXUDomRRULJLQDOHPVHJXQGRV
)HFKDPHQWRGD7HOD FRQJXUDomRRULJLQDOHPVHJXQGRV

'LDJQyVWLFRV
Exibe um resumo da Integridade
dos Eventos e Comunicaes

Pausa do Alarme Sonoro FRQJXUDomRRULJLQDOHPVHJXQGRV


127$7RGDVDV3URJUDPDo}HVGR6LVWHPDVmRDMXVWiYHLVSHOR8VXiULRYLGH&RQJ&RQWURODGRUD

)RQH +555-555-1212
([LEH'HWDOKHVGR&RQWDWR.RPDWVX

),*85$(VWUXWXUDGR0HQXGR3DLQHOGH&RQWUROH3URJUDPDo}HVGR6LVWHPD

M32002

Sistema de escada retrtil

M32-53

EXIBIO DE ACESSO PRINCIPAL


Exibe a presente condio da escada

Para acessar o MENU DA CONTROLADORA


pressione os botes [ENTER]
ou [EXIT]
MENU DA CONTROLADORA
Exibe o Menu da Raiz Principal
Opes
Programaes do Sistema
Exibe as Programaes
Atuais do Sistema
&RQJ&RQWURODGRUD
$FHVVRjVHQKDSDUDDOWHUDomRGDV
Programaes do Sistema
Mostrar Registros Recentes
([LEHDV~OWLPDVKRUDHDGDWD
de eventos estampados

3DUD&DUUHJDU5HJLVWURVSDUDD0HPyULD86%VHUiQHFHVViULDXPD0HPyULD86%TXH
VHUiFRQHFWDGDjSRUWDQRODGRGLUHLWRLQIHULRUGR3DLQHOGH&RQWUROH,QWHUQRGD&DELQD
6RPHQWHLQVLUDD0HPyULD86%TXDQGRDLQGLFDomRGHSURQWLGmRGDWHODRLQGLFDU
23d2'(&$55(*$5/2*63$5$$0(05,$86%

7UDQVIHUrQFLDGRVGDGRVSDUDD
0HPyULD86%;FRPSOHWD

3URFHVVDPHQWRGD0HPyULD86%
Completo
(QWUDU6DLUSDUDFRQUPDU

Dispositivo USB encontrado


,QLFLDOL]DQGRWUDQVIHUrQFLD

$SyVLQVHULUD0HPyULD86%DWUDQVIHUrQFLD
de dados automtica atravs das
VHJXLQWHVWUrVH[LELo}HVGDWHOD$RFRQFOXLU
pressione o boto [ENTER] ou [EXIT]
SDUDFRQUPDURGRZQORDG.

)DYRULQVHULUXPD0HPyULD86%

7UDQVIHUrQFLDGRVGDGRVSDUDD
0HPyULD86%IDOKRX
Erro Geral
&yGLJRGH(UUR
(QWUDU6DLUSDUD&RQUPDU

$SyVSUHVVLRQDURERWmR [ENTER]
dever aparecer a exibio acima.
,QVLUDD0HPyULD86%QDSRUWD86%

6HQmRKRXYHUUHVSRVWDDHVWDLQGLFDomR
GH SURQWLGmR GD WHOD D RSomR VHUi
interrompida e aparecer a mensagem
de erro acima.

Utilize o boto [DOWN] para rolar a tela


para Carregar Registros e
ento pressione [ENTER]
&DUUHJDU5HJLVWURVSDUDD0HPyULD86%
Permite baixar o registros dos dados via
0HPyULD86%
Para retornar
EXIBIO DE ACESSO PRINCIPAL
pressione o boto [EXIT].
)RQH +555-555-1212
([LEH'HWDOKHVGR&RQWDWR.RPDWVX

127$4XDQGRDVHTrQFLDDFLPDHVWLYHUFRQFOXtGDVLPSOHVPHQWHUHPRYDD
0HPyULD86%GD3RUWD

),*85$(VWUXWXUDGR0HQXGR3DLQHOGH&RQWUROH&DUUHJDU5HJLVWURVSDUDD0HPyULD86%

M32-54

Sistema de escada retrtil

M32002

EXIBIO DE ACESSO PRINCIPAL


Exibe a presente condio da escada

Para acessar o MENU DA CONTROLADORA


pressione os botes [ENTER]
ou [EXIT]

MENU DA CONTROLADORA
Exibe o Menu da Raiz Principal
Opes
Programaes do Sistema
Exibe as Programaes
Atuais do Sistema
&RQJ&RQWURODGRUD
$FHVVRjVHQKDSDUDDOWHUDomRGDV
Programaes do Sistema

Mostrar Registros Recentes


([LEHDV~OWLPDVKRUDHDGDWD
de eventos estampados
&DUUHJDU5HJLVWURVSDUDD0HPyULD86%
Permite baixar os registros dos dados
YLD0HPyULD86%

3DUDYLVXDOL]DUDVDWXDLV3URJUDPDo}HVGR6LVWHPDXWLOL]HRVERW}HV
[UP] e [DOWN] para rolar atravs das opes.

23d(6'(5(*,67526'(',$*167,&26
Eventos Ativos (Uma relao abrangente de eventos do sistema com indicao de
FRUUHQWHPHQWHDWLYRVRXLQDWLYRV )DOKDQDV&RPXQLFDo}HV)XVtYHOGH$4XHLPDGR
%RELQD6XSHULRUFRP'HIHLWR%RELQD,QIHULRUFRP'HIHLWR%RELQD,QWHUQDFRP'HIHLWR
>6RPHQWH(VFDGD*LUDWyULD@%RELQD([WHUQDFRP'HIHLWR>6RPHQWH(VFDGD*LUDWyULD
%RELQDGD%RPEDFRP'HIHLWR)RQWHGH(QHUJLDFRP'HIHLWR5HOrGH,QLELomRFRP'HIHLWR
(VFDGD)RUDGR/LPLWH1mR$WLQJH/LPLWH3HUPDQHFHQR/LPLWH1tYHOGHOHR%DL[R
>)XWXUD,QFOXVmR@9ROWDJHP$EDL[RQR&RPDQGR9ROWV$EDL[R9ROWV$FLPD5HWpPHP&,0$
5HPRWR6XSHULRU5HWpPHP%$,;25HPRWR6XSHULRU5HWpPHP&,0$5HPRWR,QIHULRU
5HWpPHP%$,;25HPRWR,QIHULRU5HFDUJDGD3UHVVmR!+RUD(UJXLGRSHOR)UHLRGH
(VWDFLRQDPHQWR6HUYLoR/9HQFLGR6HUYLoR/9HQFLGR
Integridade das Comunicaes (Monitora a integridade das comunicaes entre o Painel
de Controle Interno da Cabina e o Quadro de Controle Principal na Fonte de Energia. Os
UHVXOWDGRVVmRH[LELGRVFRPRXPYDORUSHUFHQWXDOGHYiULRVSHUtRGRVGHWHPSRDWpKRUDV
(PXPVLVWHPDVDXGiYHODSHUFHQWDJHPQmRGHYHVHULQIHULRUD 2VLQWHUYDORVGH
WHPSRH[LELGRVVmRGHVHJXQGRVPLQXWRVKRUDVHKRUDV
Registro Eliminado por ltimo ([LEHDGDWDHPTXHRUHJLVWURVIRLHOLPLQDGRSRU~OWLPR

Utilize o boto [BAIXO] para rolar a tela


para Diagnostics e
.
ento pressione [ENTER]
'LDJQyVWLFRV
Exibe um resumo da Integridade
dos Eventos e Comunicaes

Espao Total do Registro (Exibe o espao remanescente de armazenagem do registros


como um percentual)
9HUV}HVGH&yGLJR ([LEHDVYHUV}HVDWXDLVGHFyGLJRGHVRIWZDUHGRV1yVGH&RQWUROH
Interno da Cabina e de Controle Hidrulico)
2SHUDo}HVDWp6HUYLoR/9HQFLGR (Exibe as operaes remanescentes de acesso ao
VLVWHPDDQWHULRUHVjDWLYDomRGR,QGLFDGRUGH1tYHOGH6HUYLoR
Operaes at Servio L2 Vencido (Exibe as operaes remanescentes de acesso ao
VLVWHPDDQWHULRUHVjDWLYDomRGR,QGLFDGRUGH1tYHOGH6HUYLoR

Para retornar EXIBIO DE ACESSO


PRINCIPAL pressione o boto [EXIT].

)RQH +555-555-1212
([LEH'HWDOKHVGR&RQWDWR.RPDWVX

),*85$(VWUXWXUDGR0HQXGR3DLQHOGH&RQWUROH'LDJQyVWLFRV

M32002

Sistema de escada retrtil

M32-55

NOTAS

M32-56

Sistema de escada retrtil

M32002