Você está na página 1de 32

EXAME NACIONAL DO ENSINO MDIO

PROVA DE REDAO E DE LINGUAGENS, CDIGOS E SUAS TECNOLOGIAS


PROVA DE MATEMTICA E SUAS TECNOLOGIAS

2 DIA
CADERNO

AMARELO
5
2 APLICAO

A COR DA CAPA DO SEU CADERNO DE QUESTES AMARELO. MARQUE-A EM SEU CARTO-RESPOSTA.

ATENO: transcreva no espao apropriado do seu CARTO-RESPOSTA,


FRPVXDFDOLJUDDXVXDOFRQVLGHUDQGRDVOHWUDVPDL~VFXODVHPLQ~VFXODVDVHJXLQWHIUDVH

Saber viver a grande sabedoria.

LEIA ATENTAMENTE AS INSTRUES SEGUINTES: 3. Para cada uma das questes objetivas, so apresentadas
5 opes. Apenas uma responde corretamente questo.
1. Este CADERNO DE QUESTES contm a Proposta de
Redao e 90 questes numeradas de 91 a 180, dispostas 4. O tempo disponvel para estas provas de cinco horas e
da seguinte maneira: trinta minutos.
a) as questes de nmero 91 a 135 so relativas rea de
5. 5HVHUYHRVPLQXWRVQDLVSDUDPDUFDUVHXCARTO-RESPOSTA.
Linguagens, Cdigos e suas Tecnologias;
Os rascunhos e as marcaes assinaladas no CADERNO DE
b) as questes de nmero 136 a 180 so relativas rea de QUESTES no sero considerados na avaliao.
Matemtica e suas Tecnologias.
ATENO: as questes de 91 a 95 so relativas lngua 6. Somente sero corrigidas as redaes transcritas na FOLHA
estrangeira. Voc dever responder apenas s questes DE REDAO.
relativas lngua estrangeira (ingls ou espanhol) escolhida
7. Quando terminar as provas, acene para chamar o aplicador
no ato de sua inscrio.
e entregue este CADERNO DE QUESTES e o CARTO-
2. &RQUD VH R VHX &$'(512 '( 48(67(6 FRQWpP D RESPOSTA/FOLHA DE REDAO.
quantidade de questes e se essas questes esto na ordem
mencionada na instruo anterior. Caso o caderno esteja 8. Voc poder deixar o local de prova somente aps decorridas
incompleto, tenha defeito ou apresente qualquer divergncia, duas horas do incio da aplicao e poder levar seu
comunique ao aplicador da sala para que ele tome as &$'(512'(48(67(6DRGHL[DUHPGHQLWLYRDVDODGH
providncias cabveis. prova nos 30 minutos que antecedem o trmino das provas.

Ministrio
da Educao *Amar25dom1*
*AMAR25DOM2*
LINGUAGENS, CDIGOS E SUAS QUESTO 92
TECNOLOGIAS
Questes de 91 a 135
Questes de 91 a 95 (opo ingls)
QUESTO 91
Mauritius: gender roles and statuses
Division of Labor by Gender. The economic success
of industry has led to low unemployment rates. This has
changed the workplace and home life as women joined the
workforce. This industrialization also led to women being
promoted faster. According to the Minister of Women, 'LVSRQtYHOHPZZZFROLQWVKHUFRP$FHVVRHPPDLR
Family Welfare, and Child Development, a quarter of all
managers are now women. Anncios publicitrios buscam chamar a ateno do
consumidor por meio de recursos diversos. Nesse pster,
Women are the traditional homekeepers of the society. os nmeros indicados correspondem ao()
Between 1985 and 1991 the number of women working
A comprimento do cigarro.
outside the home increased from 22 percent to 41 percent.
With that trend continuing, hired housekeeping and child B tempo de queima do cigarro.
care have become relatively new and important industries. C idade de quem comea a fumar.
The Relative Status of Women and Men. Historically, D expectativa de vida de um fumante.
women have had subordinate roles in Mauritian E quantidade de cigarros consumidos.
VRFLHW\ +RZHYHU WKH &RQVWLWXWLRQ VSHFLFDOO\ SURKLELWV
discrimination based on sex, and women now have access QUESTO 93
to education, employment, and governmental services. 1HZYDFFLQHFRXOGJKWQLFRWLQHDGGLFWLRQ
In March 1998 the Domestic Violence Act was passed. Cigarette smokers who are having trouble quitting
This gave greater protection and legal authority to combat because of nicotines addictive power may some day be
domestic abuse. In that same year it also became a crime able to receive a novel antibody-producing vaccine to help
to abandon ones family or pregnant spouse for more them kick the habit.
than two months, not to pay food support, or to engage in The average cigarette contains about 4 000 different
sexual harassment. chemicals that when burned and inhaled cause the
Women are underrepresented in the government. The serious health problems associated with smoking. But
National Assembly has seventy seats, of which women it is the nicotine in cigarettes that, like other addictive
substances, stimulates rewards centers in the brain and
KROGYH
hooks smokers to the pleasurable but dangerous routine.
Disponvel em: www.everyculture.com. Acesso em: 4 fev. 2013.
Ronald Crystal, who chairs the department of genetic
Questes como o papel de homens e mulheres na medicine at Weill-Cornell Medical College in New York,
sociedade contempornea vm sendo debatidas de where researchers are developing a nicotine vaccine,
GLIHUHQWHV SRQWRV GH YLVWD LQXHQFLDGRV SRU YDORUHV said the idea is to stimulate the smokers immune system
FXOWXUDLV HVSHFtFRV GH FDGD VRFLHGDGH 1R FDVR GDV to produce antibodies or immune proteins to destroy the
Ilhas Maurcio, esses valores sustentam a tomada de nicotine molecule before it reaches the brain.
deciso em torno da BERMAN, J. Disponvel em: www.voanews.com. Acesso em: 2 jul. 2012.

A importncia do reconhecimento da presena feminina Muitas pessoas tentam parar de fumar, mas fracassam e
na estrutura familiar. sucumbem ao vcio. Na tentativa de ajudar os fumantes,
B manuteno da igualdade entre mulheres e homens pesquisadores da Weill-Cornell Medical College esto
no trabalho. desenvolvendo uma vacina que
C proteo legal da mulher contra atos discriminatrios. A diminua o risco de o fumante se tornar dependente
da nicotina.
D representatividade da mulher em cargos polticos.
B seja produzida a partir de molculas de nicotina.
E criao de auxlio mulher abandonada pelo cnjuge. C substitua a sensao de prazer oferecida pelo cigarro.
D ative a produo de anticorpos para combater a nicotina.
E controle os estmulos cerebrais do hbito de fumar.

LC - 2 dia | Caderno 5 - AMARELO - Pgina 2


*AMAR25DOM3*
QUESTO 94 LINGUAGENS, CDIGOS E SUAS
TECNOLOGIAS
Questes de 91 a 135
Questes de 91 a 95 (opo espanhol)
QUESTO 91

Disponvel em: http://bruketa-zinic.com. Acesso em: 3 ago. 2012.

A campanha desse pster, direcionada aos croatas, tem


como propsito
A alertar os cidados sobre a lei em vigor contra a
discriminao.
B conscientizar sobre as consequncias do preconceito
na sociedade.
C reduzir os prejuzos causados por motoristas
Disponvel em: www.sasia.org.ar. Acesso em: 30 maio 2016.
alcoolizadas.
D fazer uma crtica falta de habilidade das mulheres Essa propaganda foi criada para uma campanha de
ao volante. conscientizao sobre a violncia contra a mulher.
As palavras que compem a imagem indicam que a
E evitar os acidentes de trnsito envolvendo mulheres.
A violncia contra a mulher est aumentando.
QUESTO 95 B agresso mulher acontece de forma fsica e verbal.
C violncia contra a mulher praticada por homens.
D agresso mulher um fenmeno mundial.
E violncia contra a mulher ocorre no ambiente domstico.
QUESTO 92
Desde Npoles hasta Johannesburgo, desde Buenos
Aires hasta Barcelona, los actos de xenofobia y racismo
indican que nos encontramos ante un fenmeno global.
'HQLGD SRU OD 5HDO $FDGHPLD GH OD /HQJXD FRPR HO
odio, repugnancia y hostilidad a los extranjeros, la
[HQRIRELD YD GH OD PDQR FRQ ORV XMRV PLJUDWRULRV SRU
razones econmicas o ambientales, y el desplazamiento
IRU]DGRSURYRFDGRSRUORVFRQLFWRVDUPDGRVLQWHUQRV\
las guerras. El otro, el que viste, habla y tiene otra cultura y
XQDUHOLJLyQGLIHUHQWHHVYLVWRFRQVRVSHFKDGHVFRQDQ]D
y temor en los pases del llamado primer mundo. Los
polticos de derecha y los grandes medios ensalzan lo
propio y denigren lo ajeno contribuyendo a crear un clima
BANSKY. Disponvel em: www.weburbanist.com. Acesso em: 2 ago. 2012. de miedo y odio hacia el extrao y desconocido.
%DQVN\pXPJUDWHLURIDPRVR1DREUDSLQWDGD HPXP TAMAYO, G. E. Disponvel em: www.alainet.org. Acesso em: 23 fev. 2012.
muro da cidade de Claremont, Califrnia, em 2007, ele No texto, a relao entre o fenmeno discriminatrio e
fez uso de um trocadilho com a palavra change, o que a postura de polticos de direita e de grandes meios de
FDUDFWHUL]DVHXJUDWHFRPRXPSURWHVWRFRQWUDD comunicao tem a funo de
A escolha da mendicncia como forma de vida. A denunciar as prticas que encobrem as diferenas.
B condio de vida das pessoas em misria. B tornar pblicas as razes econmicas da xenofobia.
C falta de solidariedade dos mais favorecidos. C criticar aqueles que favorecem a apario do medo.
D marginalizao das pessoas desabrigadas. D reclamar das atitudes tomadas pelos pases desenvolvidos.
E incapacidade de os mendigos mudarem de vida. E DSRQWDUDVFDXVDVTXHGHWHUPLQDPRVX[RVPLJUDWyULRV
LC - 2 dia | Caderno 5 - AMARELO - Pgina 3
*AMAR25DOM4*
QUESTO 93 Canta conmigo, canta
La excelente cosecha literaria latinoamericana de la Hermano americano
Libera tu esperanza
segunda mitad del siglo XX puede resumirse en unos
Con un grito en la voz!
cuantos nombres: los del colombiano Gabriel Garca
GMEZ, A. T. Mercedes Sosa: 30 aos. Buenos Aires: Polygram, 1994.
Mrquez, el peruano Mario Vargas Llosa, los argentinos
Jorge Luis Borges y Julio Cortzar, el cubano Alejo Cancin con todos uma cano latino-americana muito
Carpentier, el chileno Jos Donoso, los mexicanos difundida e consagrada pela voz da cantora argentina
Mercedes Sosa. Com relao Amrica Latina, seus
Octavio Paz y Carlos Fuentes... Hay ms escritores versos expressam
GLJQRVGHJXUDUHQHVHFXDGURGHKRQRUSRUVXSXHVWR
A desejo de integrao entre os povos.
Pero en l no podra faltar ninguno de los mencionados.
Carlos Fuentes, fallecido ayer a los 83 aos en Ciudad B entusiasmo por caminhar pela regio.
de Mxico, se labr a pulso su puesto en l. Novelista, C valorizao dos recursos naturais.
ensayista, dramaturgo, guionista de cine, profesor en las D esforo para libertar os oprimidos.
ms destacadas universidades americanas y europeas, E vontade de cantar os tipos humanos.
Fuentes suSR UHHMDU HQ VX REUD HO HVStULWX GH 0p[LFR
forjado en el mestizaje y en la red de complejidades que QUESTO 95
comporta. Pero no slo eso. En todo momento, Fuentes Ante las situaciones adversas algunas personas
fue un paladn de la libertad, tanto en lo relativo a la sufren secuelas a lo largo de toda la vida. Otras, la
imaginacin y el talento creativo que impregna sus obras, mayora, se sobreponen y la intensidad de las emociones
como en lo referente al compromiso social. negativas van decreciendo con el tiempo y se adaptan a
Disponvel em: www.lavanguardia.com. Acesso em: 27 jul. 2012. la nueva situacin.
Apesar da proximidade entre as lnguas portuguesa e Hay un tercer grupo de personas a las cuales la
espanhola, muitas expresses no so equivalentes. No vivencia del trauma las hace crecer personalmente y sus
texto, a expresso a pulso indica que Carlos Fuentes vidas adquieren un nuevo sentido y salen fortalecidas.
A trabalhou em suas obras as questes relativas ao Investigadores de la Unidad de Psicologa Bsica
contexto social de seu pas. de la Universidad Autnoma de Barcelona (UAB) han
B escreveu suas principais obras com base no princpio analizado las respuestas de 254 estudiantes de la
da liberdade de criao. Facultad de Psicologa en diferentes cuestionarios para
C integrou o quadro dos escritores latino-americanos evaluar su nivel de satisfaccin con la vida y encontrar
mais destacados do sculo XX. relaciones con su resiliencia y con la capacidad de
D alcanou o devido reconhecimento literrio dentro e reparacin emocional, uno de los componentes de la
fora de seu pas por mrito prprio. inteligencia emocional, que consiste en la habilidad de
E tratou em suas obras dos principais assuntos da controlar las propias emociones y las de los dems.
cultura mexicana do passado e do presente. Algunas de las caractersticas de las personas
resilientes pueden ser entrenadas y mejoradas, como
QUESTO 94 la autoestima y la regulacin de las propias emociones.
Cancin con todos Con este aprendizaje se podra dotar de recursos a las
Salgo a caminar personas para facilitar su adaptacin y mejorar su calidad
Por la cintura csmica del sur de vida, explica Joaqun T. Limonero, profesor del
Piso en la regin Grupo de Investigacin en Estrs y Salud de la UAB y
Ms vegetal del tiempo y de la luz coordinador del estudio.
Disponvel em: www.tendencias21.net. Acesso em: 28 jul. 2012 (adaptado).
Siento al caminar
Toda la piel de Amrica en mi piel A reportagem cita uma pesquisa que tem como tema o
Y anda en mi sangre un ro comportamento das pessoas diante das adversidades.
Que libera en mi voz De acordo com o texto, um dos objetivos da investigao
Su caudal. com os alunos da Faculdade de Psicologia
Sol de alto Per A entender de que forma os traumas sofridos servem de
Rostro Bolivia, estao y soledad suporte para a resoluo dos problemas que surgiro
Un verde Brasil besa a mi Chile ao longo da vida.
Cobre y mineral B compreender como a adaptao das emoes
Subo desde el sur negativas contribui para o desenvolvimento da
Hacia la entraa Amrica y total inteligncia emocional.
Pura raz de un grito C analisar os vnculos entre a satisfao existencial,
Destinado a crecer D H[LELOLGDGH H D KDELOLGDGH GH UHFXSHUDUVH
Y a estallar. emocionalmente.
Todas las voces, todas D YHULFDU GH TXH IRUPD DV SHVVRDV H[HUFLWDP H
Todas las manos, todas melhoram a autoestima e o controle das emoes.
Toda la sangre puede E sistematizar maneiras de dotar as pessoas de recursos
Ser cancin en el viento. para lidar com as emoes prprias e alheias.

LC - 2 dia | Caderno 5 - AMARELO - Pgina 4


*AMAR25DOM5*
Questes de 96 a 135 QUESTO 97
As plataformas digitais tm ganhado mais espao
QUESTO 96 entre os internautas como ferramenta para exercer a
cidadania. Atravs delas, possvel mapear problemas
Da corrida de submarino festa de aniversrio no trem da cidade e propor solues, utilizando-se das redes
Leitores fazem sugestes sociais para aproximar os moradores e articular projetos.
para o Museu das Invenes Cariocas O espao colaborativo PortoAlegre.cc, um dos mais ativos
no pas, tem 150 participantes e ajudou a estudante de
Falar caraca! a cada surpresa ou acontecimento jornalismo Renata Gomes, 25, a chamar 80 pessoas para
que vemos, bons ou ruins, inveno do carioca, como retirar 1 tonelada de lixo da orla do rio Guaba. Foi a partir
tambm o vacilo. da sugesto de um integrante da plataforma que criei a
Cariocas inventam um vocabulrio prprio. Dizer causa. Foi fundamental porque sempre senti vontade
merrmo e merrmo para um amigo pode at doer um de fazer algo pela cidade, mas no sabia como, diz
Renata. O projeto colaborativo baseia-se no conceito de
pouco no ouvido, mas tipicamente carioca. wikicidade (inspirado na enciclopdia virtual Wikipdia),
Pedir um choro ao garom inveno carioca. em que um territrio real recebe anotaes virtuais das
Chamar um quase desconhecido de querido um pessoas por meio de wikispots, que se referem a uma
praa, uma rua ou um bairro. A ideia de wikicidade
carinho inventado pelo carioca para tratar bem quem
fomentar a cocriao, elaborao e experimentao de
ainda no se conhece direito. sugestes que possam ser aplicadas em uma cidade,
O ele um querido uma forma mais feminina de explica Daniel Bittencourt, um dos desenvolvedores do
elogiar quem j conhecido. projeto PortoAlegre.cc.
SANTOS, J. F. Disponvel em: www.oglobo.globo.com. Acesso em: 6 mar. 2013 (adaptado). DIDON, D. Cidadania 2.0. Vida Simples, n. 119, jun. 2012.

Entre as sugestes apresentadas para o Museu das O texto, ao falar da utilizao das redes sociais e informar
sobre a quantidade de projetos colaborativos espalhados
Invenes Cariocas, destaca-se o variado repertrio
pelo pas, expe a importncia das plataformas digitais
lingustico empregado pelos falantes cariocas nas no exerccio da cidadania. O espao colaborativo
GLIHUHQWHVVLWXDo}HVHVSHFtFDVGHXVRVRFLDO$UHVSHLWR PortoAlegre.cc tem como principal objetivo
desse repertrio, atesta-se o(a) A contratar pessoas para realizarem a limpeza de ruas
A desobedincia norma-padro, requerida em e de margens dos rios.
ambientes urbanos. B sugerir a criao de grupos virtuais de apoio cidade
B inadequao lingustica das expresses cariocas s e sua divulgao na Wikipdia.
situaes sociais apresentadas. C reunir pessoas dispostas a utilizar sugestes virtuais
para a manuteno e a preservao da cidade.
C reconhecimento da variao lingustica, segundo o
grau de escolaridade dos falantes. D divulgar as redes sociais para que mais pessoas
possam interagir e resolver os problemas da cidade.
D LGHQWLFDomRGHXVRVOLQJXtVWLFRVSUySULRVGDWUDGLomR
E aproximar as pessoas de cidades distantes para
cultural carioca. mapear problemas e criar projetos em comum.
E variabilidade no linguajar carioca em razo da faixa
etria dos falantes.

LC - 2 dia | Caderno 5 - AMARELO - Pgina 5


*AMAR25DOM6*
QUESTO 98 QUESTO 99
TEXTO I Fraudador preso por emitir atestados
com erro de portugus
Mais um erro de portugus leva um criminoso s mos
da polcia. Desde 2003, M.O.P., de 37 anos, administrava
D HPSUHVD 00 TXH IDOVLFDYD EROHWLQV GH RFRUUrQFLD
FDUWHLUDV SURVVLRQDLV H DWHVWDGRV GH yELWR WXGR SDUD
anular multas de trnsito. Amparado pela documentao
fajuta de M.O.P., um motorista poderia alegar s Juntas
Administrativas de Recursos de Infraes que ultrapassou
o limite de velocidade para levar uma parente que passou
mal e morreu a caminho do hospital.
O esquema funcionou at setembro, quando M.O.P.
foi indiciado. Atropelara a gramtica. Havia emitido, por
exemplo, um atestado de abril do ano passado em que
estava escrito aneurisma celebral (com l no lugar de r) e
LQVXOFLrQFLDP~OWLSODGHyUJmRV FRPXPOGHVQHFHVViULR
HPLQVXFLrQFLDDOpPGRIDWRGHDH[SUHVVmRPpGLFD
adequada ser falncia mltipla de rgos).
M.O.P. foi indiciado pela 2 Delegacia de Diviso de
Crimes de Trnsito. Na casa do acusado, em So Miguel
Paulista, zona leste de So Paulo, a polcia encontrou um
computador com modelos de documentos.
Lngua Portuguesa, n. 12, set. 2006 (adaptado).

O texto apresentado trata da priso de um fraudador


SEVERINI, G. $KLHURJOtFDGLQkPLFDGR%DO7DEDULQ. leo sobre
que emitia documentos com erros de escrita. Tendo em
tela, 161,6 x 156,2 cm. Museu de Arte Moderna, Nova Iorque, 1912.
vista o assunto, a organizao, bem como os recursos
Disponvel em: www.moma.org. Acesso em: 18 maio 2013. lingusticos, depreende-se que esse texto um(a)
TEXTO II A conto, porque discute problemas existenciais e sociais
de um fraudador.
A existncia dos homens criadores modernos
muito mais condensada e mais complicada do que a das B notcia, porque relata fatos que resultaram no
pessoas dos sculos precedentes. A coisa representada, indiciamento de um fraudador.
SRULPDJHPFDPHQRV[DRREMHWRHPVLPHVPRVH C crnica, porque narra o imprevisto que levou a polcia
expe menos do que antes. Uma paisagem rasgada a prender um fraudador.
por um automvel, ou por um trem, perde em valor D editorial, porque opina sobre aspectos lingusticos
descritivo, mas ganha em valor sinttico. O homem dos documentos redigidos por um fraudador.
moderno registra cem vezes mais impresses do que o
E piada, porque narra o fato engraado de um fraudador
artista do sculo XVIII.
GHVFREHUWRSHODSROtFLDSRUFDXVDGHHUURVGHJUDD
LEGR, F. Funes da pintura. So Paulo: Nobel, 1989.

A vanguarda europeia, evidenciada pela obra e pelo texto,


expressa os ideais e a esttica do
A Cubismo, que questionava o uso da perspectiva por
meio da fragmentao geomtrica.
B Expressionismo alemo, que criticava a arte
DFDGrPLFDXVDQGRDGHIRUPDomRGDVJXUDV
C Dadasmo, que rejeitava a instituio artstica,
propondo a antiarte.
D Futurismo, que propunha uma nova esttica, baseada
nos valores da vida moderna.
E Neoplasticismo, que buscava o equilbrio plstico,
com utilizao da direo horizontal e vertical.

LC - 2 dia | Caderno 5 - AMARELO - Pgina 6


*AMAR25DOM7*
QUESTO 100 QUESTO 102
O Google Art uma ferramenta on-line que permite a
Salvador, 10 de maio de 2012. visitao virtual dos mais importantes museus do mundo
e a visualizao de suas obras de arte. Por meio da
Consultoria PC Speed tecnologia Street View e de um veculo exclusivamente
Sr. Pedro Alberto desenvolvido para o projeto, fotografou-se em 360 graus o
Assunto: Consultoria interior de lugares como o MoMA, de Nova York, o Museu
Van Gogh, em Amsterd, e a National Gallery, de Londres.
Prezado Senhor, O resultado que se pode andar pelas galerias assim como
Manifestamos nossa apreciao pelo se passeia pelas ruas com o Street View. Alm disso, cada
excelente trabalho executado pela equipe museu escolheu uma nica obra de arte de seu acervo
de consultores desta empresa na reviso de para ser fotografada com cmeras de altssima resoluo,
todos os controles internos relativos s reas ou gigapixel. As imagens contm cerca de sete bilhes
administrativas. de pixels R TXH VLJQLFD TXH p PDLV GH PLO YH]HV PDLV
As contribuies feitas pelos membros detalhada do que uma foto de cmera digital comum. Alm
da equipe sero de grande valia para o disso, todas as obras vm acompanhadas de metadados
aperfeioamento dos processos de trabalho de provenincia, tais como ttulos originais, artistas, datas
que esto sendo utilizados.
de criao, dimenses e a quais colees j pertenceram.
Queira, por gentileza, transmitir-lhes Os usurios tambm podem criar suas prprias colees
nossos cumprimentos.
e compartilh-las pela web.
Disponvel em: http://oglobo.globo.com. Acesso em: 3 out. 2013 (adaptado).
Atenciosamente,
As tecnologias da computao possibilitam um novo olhar
Rivaldo Oliveira Andrade sobre as obras de arte. A prtica permite que usurios
Diretor Administrativo e Financeiro
A guiem virtualmente um veculo especial atravs dos
Disponvel em: www.pcspeed.com.br. Acesso em: 1 maio 2012 (adaptado).
melhores museus do mundo.
A carta manifesta reconhecimento de uma empresa pelos B reproduzam as novas obras de arte expostas em
servios prestados pelos consultores da PC Speed. museus espalhados pelo mundo.
Nesse contexto, o uso da norma-padro C criem novas obras de arte em 360 graus, consultem
A FRQVWLWXLXPDH[LJrQFLDUHVWULWDDRXQLYHUVRQDQFHLUR seus metadados e os compartilhem na internet.
e substituvel por linguagem informal.
D visitem o interior e as obras de arte de todos os
B revela um exagero por parte do remetente e torna o
texto rebuscado linguisticamente. museus do mundo em 3D e em altssima resoluo.
C expressa o formalismo prprio do gnero e atribui E visualizem algumas obras de arte em altssima
SURVVLRQDOLVPRjUHODomRFRPXQLFDWLYD resoluo e, simultaneamente, obtenham informaes
D torna o texto de difcil leitura e atrapalha a compreenso sobre suas origens e composio.
das intenes do remetente.
QUESTO 103
E sugere elevado nvel de escolaridade do diretor e
reala seus atributos intelectuais. A perda de massa muscular comum com a
idade, porm, na faixa dos 60 anos que ela se torna
QUESTO 101 clinicamente perceptvel e suas consequncias comeam
Descubra e aproveite um momento todo seu. Quando a incomodar no dia a dia, quando simples atos de subir
voc quebra o delicado chocolate, o irresistvel recheio escadas ou ir padaria se tornam sacrifcios. Esse
cremoso comea a derreter na sua boca, acariciando processo tem nome: sarcopenia. Essa condio ocasiona
todos os seus sentidos. Criado por nossa empresa. a perda da fora e qualidade dos msculos e tem um
Paixo e amor por chocolate desde 1845.
LPSDFWRVLJQLFDQte na sade.
Veja, n. 2 320, 8 maio 2013 (adaptado).
Disponvel em: www.infoescola.com. Acesso em: 19 dez. 2012 (adaptado).
O texto publicitrio tem a inteno de persuadir
A sarcopenia inerente ao envelhecimento, mas seu
o pblico-alvo a consumir determinado produto ou
servio. No anncio, essa inteno assume a forma de quadro e consequentes danos podem ser retardados
um convite, estratgia argumentativa linguisticamente com a prtica de exerccios fsicos, cujos resultados mais
marcada pelo uso de rpidos so alcanados com o(a)
A conjuno (quando). A hidroginstica.
B adjetivo (irresistvel). B alongamento.
C verbo no imperativo (descubra). C musculao.
D palavra do campo afetivo (paixo). D corrida.
E expresso sensorial (acariciando). E dana.

LC - 2 dia | Caderno 5 - AMARELO - Pgina 7


*AMAR25DOM8*
QUESTO 104
Os que fiam e tecem unem e ordenam materiais dispersos que,
de outro modo, seriam vos ou quase. Pertencem mesma linhagem
FIANDEIRA CARNEIRO FUSO L dos gemetras, estabelecem leis e
pontos de unio para o desuno. Antes do fuso, da roca, do tear, das
invenes destinadas a estender L LINHO CASULO ALGODO L
RVRVHFUX]iORVRDOJRGmRDVHGDHUDFRPRVHDLQGDHVWLYHVVHP
TECEDEIRA URDIDURA TEAR L imersos no limbo, nas trevas do
informe. o apelo ordem que os traz claridade, transforma-os
em obras, portanto em objetos humanos, iluminados pelo esprito do
homem. No por ser-nos teis L TRAMA CROCH DESENHO L
que o burel ou o linho representam uma vitria do nosso engenho;
TAPECEIRA BASTIDOR ROCA L sim por serem tecidos, por cantar
QHOHVXPDRUGHPRVHUHQRRUPHHULJRURVRHQODFHGDXUGLGXUDGDV
linhas enredadas. Assim que L COSER AGULHA CAPUCHO L
que suas expresses mais nobres so aquelas em que, com ainda
maior disciplina, floresce o ornamento: no croch, no tapete,
FIANDEIRA CARNEIRO FUSO L no brocado. Ento, como se por uma
espcie de alquimia, de lgebra, de mgica, algodoais e carneiros, casulos,
L TRAMA CASULO CAPUCHO L campos de linho, novamente
surgissem, com uma vida menos rebelde, porm mais perdurvel.
LINS, O. Nove, novena: narrativas. So Paulo: Cia. das Letras, 1998.

No trecho, retirado do conto Retbulo de Santa Joana CarolinaGH2VPDQ/LQVDPGHH[SUHVVDUXPDLGHLDUHODWLYD


literatura, o autor emprega um procedimento singular de escrita, que consiste em
A entremear o texto com termos destacados que se referem ao universo do tecer e remetem visualmente estrutura
GHXPDWUDPDWHFLGDFRPRVTXHUHWRUQDPSHULRGLFDPHQWHSDUDDOXGLUDRWUDEDOKRGRHVFULWRU
B entrecortar a progresso do texto com termos destacados, sem relao com o contexto, que tornam evidente a
desordem como princpio maior da sua proposta literria.
C insinuar, pela disposio de termos destacados, dos quais um forma uma coluna central no corpo do texto, que a
atividade de escrever remete arte ornamental do escultor.
D dissertar maneira de um cientista sobre os fenmenos da natureza, recriminando-a por estar perpetuamente em
desordem e no criar concatenao entre eles.
E confrontar, por meio dos termos destacados, o ato de escrever atividade dos cientistas modernos e dos alquimistas
antigos, mostrando que esta muito superior do escritor.
QUESTO 105
Como escrever na internet
Regra 1 Fale, no GRITE!
Combine letras maisculas e minsculas, da mesma forma que na escrita comum. Cartas em papel no so
escritas somente com letras maisculas; na internet, escrever em maisculas o mesmo que gritar! Para enfatizar
frases e palavras, use os recursos de _sublinhar_ (colocando palavras ou frases entre sublinhados) e *grifar* (palavras
ou frases entre asteriscos). Frases em maisculas so aceitveis em ttulos e nfases ou avisos urgentes.
Regra 2 Sorria :-) pisque ;-) chore &-( ...
Os emoticons (ou smileys) so cones formados por parnteses, pontos, vrgulas e outros smbolos do teclado.
Eles representam carinhas desenhadas na horizontal e denotam emoes. difcil descobrir quando uma pessoa
est falando alguma coisa em tom de brincadeira, se est realmente brava ou feliz, ou se est sendo irnica, em um
ambiente no qual s h texto; por isso, entram em cena os smileys. Comece a us-los aos poucos e, com o passar do
tempo, estaro integrados naturalmente s suas conversas on-line.
Disponvel em: www.icmc.usp.br. Acesso em: 29 jul. 2013.

O texto traz exemplos de regras que podem evitar mal-entendidos em comunicaes eletrnicas, especialmente em
e-mails e chats. Essas regras
A revelam cdigos internacionalmente aceitos que devem ser seguidos pelos usurios da internet.
B FRQVWLWXHPXPFRQMXQWRGHQRUPDVRUWRJUiFDVLQFOXVDVQDHVFULWDSDGUmRGDOtQJXDSRUWXJXHVD
C representam uma forma complexa de comunicao, pois os caracteres so de difcil compreenso.
D foram desenvolvidas para que usurios de pases de lnguas diferentes possam se comunicar na web.
E UHHWHPUHFRPHQGDo}HVJHUDLVVREUHRXVRGRVUHFXUVRVGHFRPXQLFDomRIDFLOLWDGRUHVGDFRQYLYrQFLDQDLQWHUQHW

LC - 2 dia | Caderno 5 - AMARELO - Pgina 8


*AMAR25DOM9*
QUESTO 106 Nesse texto, o autor reorienta o leitor no processo de
OHLWXUDXVDQGRFRPRUHFXUVRH[SUHVV}HVFRPRUHURPHPH
UHURHVWRXPHUHIHULQGRGHTXHHVWRXIDODQGRDJRUD
digo, estou falando da, esclareo, isto . Todas elas
so expresses lingusticas introdutoras de parfrases,
que servem para
A FRQUPDU
B contradizer.
C destacar.
D UHWLFDU
E sintetizar.
QUESTO 108
1RLWHVGR%RJDUW
Disponvel em: www.ideiasustentavel.com.br. Acesso em: 30 maio 2016 (adaptado).
O Xavier chegou com a namorada mas,
A importncia da preservao do meio ambiente para a prudentemente, no a levou para a mesa com o grupo.
sade ressaltada pelos recursos verbais e no verbais Abanou de longe. Na mesa, as opinies se dividiam.
utilizados nessa propaganda da SOS Mata Atlntica.
No texto, a relao entre esses recursos Pouca vergonha.
A condiciona o entendimento das aes da SOS Mata Deixa o Xavier.
Atlntica. 3RGLDVHUDOKDGHOH
B estabelece contraste de informaes na propaganda. $OLiVpFROHJDGDOKDGHOH
C pIXQGDPHQWDOSDUDDFRPSUHHQVmRGRVLJQLFDGRGD Na sua mesa, o Xavier pegara na mo da moa.
mensagem.
D oferece diferentes opes de desenvolvimento temtico. Est gostando?
E prope a eliminao do desmatamento como P. S.
VXFLHQWHSDUDDSUHVHUYDomRDPELHQWDO &KRFDQWHQp"GLVVHR;DYLHU(GHSRLVFRXQD
QUESTO 107 dvida. Ainda se dizia chocante?
Certa vez, eu jogava uma partida de sinuca, e s Beberam em silncio. E ele disse:
havia a bola sete na mesa. De modo que a mastiguei Quer danar?
lentamente saboreando-lhe os bocados com prazer. E ela disse, sem pensar:
Refiro-me refeio que havia pedido ao garom.
Dei-lhe duas tacadas na cara. Estou me referindo bola. Depois, tio.
Em seguida, sa montando nela e a gua, de que estou ( FDUDP HP VLOrQFLR (OD SHQVDQGR VHUi TXH
falando agora, chegou calmamente fazenda de minha ele ouviu?. E ele pensando fao algum comentrio a
me. Fui encontr-la morta na mesa, meu irmo comia-lhe respeito, ou deixo passar?. Decidiu deixar passar. Mas,
uma perna com prazer e ofereceu-me um pedao:
Obrigado, disse eu, j comi galinha no almoo. SHOR UHVWR GD QRLWH DTXHOH WLR FRX HP FLPD GD PHVD
entre os dois, latejando como um sapo. Ele a levou em
Logo em seguida, chegou minha mulher e deu-me
na cara. Um beijo, digo. Dei-lhe um abrao. Fazia calor. casa. Depois voltou. Sentou com os amigos.
Da a pouco minha camisa estava inteiramente molhada. A, Xavier. E a namorada?
5HURPH D TXH HVWDYD QD FRUGD VHFDQGR TXDQGR Ele no respondeu.
comeou a chover. Minha sogra apareceu para apanhar
VERISSIMO, L. F. O melhor das comdias da vida privada. Rio de Janeiro: Objetiva, 2004.
a camisa.
No tive remdio seno esmag-la com o p. Estou O efeito de humor no texto produzido com o auxlio da
falando da barata que ia trepando na cadeira. quebra de convenes sociais de uso da lngua. Na interao
Malaquias, meu primo, vivia com uma velha de entre o casal de namorados, isso decorrente
oitenta anos. A velha era sua av, esclareo. Malaquias A do registro inadequado para a interlocuo em
WLQKD GH]RLWR OKRV PDV QXQFD VH FDVRX ,VWR p QXQFD contexto romntico.
se casou com uma mulher que durasse mais de um ano.
B da iniciativa em discutir formalmente a relao
Agora, sentado nossa frente, Malaquias fura o corao
com uma faca. Depois corta as pernas e o sangue do amorosa.
porco enche a bacia. C das avaliaes de escolhas lexicais pelos
Nos bons tempos passevamos juntos. Eu tinha um frequentadores do bar.
carro. Malaquias tinha uma namorada. Um dia rolou a D das grias distorcidas intencionalmente na fala do
ULEDQFHLUD 0H UHUR D 0DODTXLDV (QWURX SHOD SUHWRULD namorado.
adentro arrebentando porta e parou resfolegante junto do
MXL]SiOLGRGHVXVWR0HUHURDRFDUUR(D0DODTXLDV E do uso de expresses populares nas investidas
FERNANDES, M. Trinta anos de mim mesmo. So Paulo: Abril Cultural, 1973. amorosas do homem.

LC - 2 dia | Caderno 5 - AMARELO - Pgina 9


*AMAR25DOM10*
QUESTO 109 QUESTO 110
Grupo transforma pele humana em neurnios
Um grupo de pesquisadores dos EUA conseguiu
alterar clulas extradas da pele de uma mulher de 82 anos
sofrendo de uma doena nervosa degenerativa e
conseguiu transform-las em clulas capazes de se
transformarem virtualmente em qualquer tipo de rgo
do corpo. Em outras palavras, ganharam os poderes das
clulas-tronco pluripotentes, normalmente obtidas a partir
da destruio de embries.
O mtodo usado na pesquisa, descrita hoje na
revista Science, existe desde o ano passado, quando um
grupo liderado pelo japons Shinya Yamanaka criou as
chamadas iPS (clulas-tronco de pluripotncia induzida).
Disponvel em: www.superplacas.com.br. Acesso em: 3 ago. 2012.
O novo estudo, porm, mostra pela primeira vez que
possvel aplic-lo a clulas de pessoas doentes, A presena desse aviso em um hotel, alm de informar
SRUWDGRUDV GH HVFOHURVH ODWHUDO DPLRWUyFD (/$  PDO sobre um fato e evitar possveis atos indesejados no local,
que destri o sistema nervoso progressivamente. tem como objetivo implcito
Pela primeira vez, seremos capazes de observar A isentar o hotel de responsabilidade por danos
clulas com ELA ao microscpio e ver como elas morrem, causados aos hspedes.
disse Valerie Estess, diretora do Projeto ALS (ELA, em B impedir a destruio das cmeras como meio de
LQJOrV  TXH QDQFLRX SDUWH GD SHVTXLVD 2EVHUYDU HP apagar evidncias.
detalhes a degenerao pode sugerir novos mtodos
para tratar a ELA. C assegurar que o hotel resguardar a privacidade dos
KOLNERKEVIC, I. Folha de S. Paulo. 1 ago. 2008 (adaptado).
hspedes.
A anlise dos elementos constitutivos do texto e a D LQLELUDVSHVVRDVGHFLUFXODUHPXPDiUHDHVSHFtFD
LGHQWLFDomRGHVHXJrQHURSHUPLWHPDROHLWRULQIHULUTXH do hotel.
o objetivo do autor E desestimular os hspedes que requisitem as imagens
A apresentar a opinio da diretora do Projeto ALS. gravadas.
B expor a sua opinio como um especialista no tema. QUESTO 111
C descrever os procedimentos de uma experincia Apesar de
FLHQWtFD
No lembro quem disse que a gente gosta de uma
D defender a pesquisa e a opinio dos pesquisadores pessoa no por causa de, mas apesar de. Gostar daquilo
dos EUA. que gostvel fcil: gentileza, bom humor, inteligncia,
E informar os resultados de uma nova pesquisa feita simpatia, tudo isso a gente tem em estoque na hora
nos EUA. em que conhece uma pessoa e resolve conquist-la.
2VGHIHLWRVFDPJXDUGDGLQKRVQRVSULPHLURVGLDVHVy
ento, com a convivncia, vo saindo do esconderijo e
revelando-se no dia a dia. Voc ento descobre que ele
no apenas gentil e doce, mas tambm um tremendo
casca-grossa quando trata os prprios funcionrios. E ela
no apenas segura e determinada, mas uma chorona
que passa 20 dias por ms com TPM. E que ele ronca, e
que ela diz palavro demais, e que ele supersticioso por
bobagens, e que ela enjoa na estrada, e que ele no gosta
de criana, e que ela no gosta de cachorro, e agora?
Agora, convoquem o amor para resolver essa encrenca.
MEDEIROS, M. Revista O Globo, n. 790, 12 jun. 2011 (adaptado).

H elementos de coeso textual que retomam


informaes no texto e outros que as antecipam. Nos
trechos, o elemento de coeso sublinhado que antecipa
uma informao do texto
A Gostar daquilo que gostvel fcil [...].
B [...] tudo isso a gente tem em estoque [...].
C [...] na hora em que conhece uma pessoa [...].
D [...] resolve conquist-la.
E [...] para resolver essa encrenca.

LC - 2 dia | Caderno 5 - AMARELO - Pgina 10


*AMAR25DOM11*
QUESTO 112 QUESTO 114
O hip hop WHP VXD ORVRD SUySULD FRP YDORUHV
construdos pela condio das experincias vividas nas
periferias de muitas cidades. Colocando-se como um
contraponto misria, s drogas, ao crime e violncia, o
hip hop busca interpretar a realidade social. Seu objetivo
justamente encontrar sadas e fornecer uma alternativa
populao excluda.
SOUZA, J.; FIALHO, V. M.; ARALDI, J. Hip hop: da rua para a escola. Porto Alegre: Sulina, 2008.

As autoras abordam no texto um movimento cultural que


tambm tem caractersticas reconhecidas
A nos traos e formas que representam personagens de
olhos desproporcionalmente maiores e expressivos,
conhecidos como mang.
B nas formas de se vestir e de cortar os cabelos com
objetivos contestadores ordem social, prprios do
movimento punk.
C nas frases e dizeres de qualquer espcie, rabiscados
sobre fachadas de edifcios, que marcam a pichao.
D nos movimentos leves e sincronizados com os ps
ROTELLA, M. Marilyn, 1962. que deslocam o danarino, denominado moonwalk.
Disponvel em: www.nyu.edu. Acesso em: 30 maio 2016.
E nas declamaes rpidas e ritmadas de um texto,
A tcnica da dcollage, utilizada pelo artista Mimmo com alturas aproximadas, caractersticas do rap.
Rotella em sua obra Marilyn, um procedimento artstico
representativo da dcada de 1960 por QUESTO 115
A visar a conservao das representaes e dos registros O que Web6HPkQWLFD"
visuais. Web Semntica um projeto para aplicar conceitos
B EDVHDUVH QD UHFLFODJHP GH PDWHULDO JUiFR inteligentes na internet atual. Nela, cada informao
contribuindo para a sustentabilidade. YHP FRP XP VLJQLFDGR EHP GHQLGR H QmR VH
C encobrir o passado, abrindo caminho para novas encontra mais solta no mar de contedo, permitindo
formas plsticas, pela releitura. uma melhor interao com o usurio. Novos motores
D fazer conviver campos de expresso diferentes e de busca, interfaces inovadoras, criao de dicionrios
LQWHJUDUQRYRVVLJQLFDGRV de sinnimos e a organizao inteligente de contedos
so alguns exemplos de aprimoramento. Dessa forma,
E abolir o trabalho manual do artista na confeco das voc no vai mais precisar minerar a internet em busca
imagens recontextualizadas. daquilo que voc procura, ela vai passar a se comportar
QUESTO 113 como um todo, e no mais como um monte de informao
empilhada. A implementao deste paradigma comeou
O bonde abre a viagem,
recentemente, e ainda vai levar mais alguns anos at que
No banco ningum,
entre completamente em vigor e d um jeito em toda a
Estou s, stou sem.
enorme baguna que a internet se tornou.
Depois sobe um homem,
Disponvel em: www.tecmundo.com.br. Acesso em: 6 ago. 2013 (adaptado).
No banco sentou,
Companheiro vou. Ao analisar o texto sobre a Web Semntica, deduz-se que
O bonde est cheio, esse novo paradigma auxiliar os usurios a
De novo porm A armazenar grandes volumes de dados de modo mais
No sou mais ningum. disperso.
ANDRADE, M. Poesias completas. Belo Horizonte: Vila Rica, 1993. B localizar informaes na internet com mais preciso.
O desenvolvimento das grandes cidades e a consequente C captar os dados na internet com mais velocidade.
concentrao populacional nos centros urbanos geraram
D SXEOLFDUGDGRVFRPVLJQLFDGRVQmRGHQLGRV
mudanas importantes no comportamento dos indivduos
em sociedade. No poema de Mrio de Andrade, publicado E navegar apenas sobre dados j organizados.
na dcada de 1940, a vida na metrpole aparece
representada pela contraposio entre
A a solido e a multido.
B a carncia e a satisfao.
C a mobilidade e a lentido.
D a amizade e a indiferena.
E a mudana e a estagnao.

LC - 2 dia | Caderno 5 - AMARELO - Pgina 11


*AMAR25DOM12*
QUESTO 116 QUESTO 118
Poema tirado de uma notcia de jornal
Joo Gostoso era carregador de feira livre e morava
no morro da Babilnia num barraco sem nmero.
Uma noite ele chegou no bar Vinte de Novembro
Bebeu
Cantou
Danou
Depois se atirou na lagoa Rodrigo de Freitas e
morreu afogado.
BANDEIRA, M. Estrela da vida inteira: poesias reunidas. Rio de Janeiro: Jos Olympio, 1980.

1R SRHPD GH 0DQXHO %DQGHLUD Ki XPD UHVVLJQLFDomR


de elementos da funo referencial da linguagem pela
A atribuio de ttulo ao texto com base em uma notcia
veiculada em jornal.
CASTRO, A. Sem ttulo. Escultura em ao, Minas Gerais, 1990.
B utilizao de frases curtas, caractersticas de textos
Disponvel em: www.institutoamilcardecastro.com.br. Acesso em: 2 ago. 2013.
do gnero jornalstico.
A escultura do artista construtivista Amlcar de Castro C indicao de nomes de lugares como garantia da
representativa da arte contempornea brasileira e tem o veracidade da cena narrada.
trao estrutural marcado por elementos como
D enumerao de aes, com foco nos eventos
A o corte e a dobra. acontecidos personagem do texto.
B a fora e a visualidade. E apresentao de elementos prprios da notcia, tais
C o adereo e a expresso. como quem, onde, quando e o qu.
D o rompimento e a inrcia. QUESTO 119
E a decomposio e a articulao.
%ULQTXHGRVFDQWDGRV
QUESTO 117 Os brinquedos cantados so atividades diretamente
Receitas de vida por um mundo mais doce relacionadas com o ato de cantar e ao conjunto dessas
canes, a que chamamos de cancioneiro folclrico
P de moleque infantil. difcil determinar sua origem. Parece que
Ingredientes essas canes sempre existiram, sempre encantaram o
OKRVTXHQmRSDUDPTXLHWRV povo e embalaram as criancinhas. A maioria parece ter
chegado com os colonizadores portugueses, sofrendo
3 sobrinhos da mesma espcie LQXrQFLD DPHUtQGLD H DIULFDQD GHYLGR j FRORQL]DomR H
1 cachorro que adora uma farra SRVWHULRUPHQWHDRWUiFRGHHVFUDYRVSDUDR%UDVLO
PGHVHPDQDDRDUOLYUH Analisando as letras de alguns brinquedos cantados,
podemos observar que elas desenvolvem vrias
Preparo habilidades motoras, como: motricidade ampla, ritmo,
Junte tudo com os ingredientes do Acar Naturale, equilbrio, direcionalidade, lateralidade, percepo
mexa bem e deixe descansar. No as crianas, que no espao-temporal, tnus muscular, entre outras. E no
vai adiantar. Sirva imediatamente, porque p de moleque FRJQLWLYR DV OHWUDV H FRUHRJUDDV DMXGDP D FULDQoD D
no para. Quer essa e outras receitas completas? desenvolver a ateno, a imaginao e a criatividade.
Entre no site cianaturale.com.br. ZOBOLI, F.; FURTUOSO, M. S.; TELLES, C. O brinquedo cantado na escola:
uma ferramenta no processo de aprendizagem. Disponvel em:
www.efdeportes.com. Acesso em: 14 dez. 2012 (adaptado).
Onde tem doce, tem Naturale.
O brinquedo cantado um importante componente
Revista Sade, n. 351, jun. 2012 (adaptado).
da cultura corporal brasileira, sendo vivenciado com
O texto resultante do hibridismo de dois gneros IUHTXrQFLDSRUPXLWDVFULDQoDV,GHQWLFDVHRVHXYDORU
textuais. A respeito desse hibridismo, observa-se que a para a tradio cultural no(a)
A receita mistura-se ao gnero propaganda com a A ampliao dada fora motora das crianas devido
QDOLGDGHGHLQVWUXLUROHLWRU ao uso da msica e das danas.
B UHFHLWD p XWLOL]DGD QR JrQHUR SURSDJDQGD D P GH B condio educativa fundamentada no uso de jogos
divulgar exemplos de vida. sem regras previamente estabelecidas.
C propaganda assume a forma do gnero receita para C histrico indeterminado dessa forma de brincadeira
divulgar um produto alimentcio. representativa do cancioneiro folclrico.
D propaganda perde poder de persuaso ao assumir a D uso de tcnicas, facilmente adotadas por qualquer
forma do gnero receita. FULDQoDTXHLQWHQVLFDPDPRWULFLGDGHHVSRUWLYD
E receita est a servio do gnero propaganda ao E possibilidade de contribuio para o desenvolvimento
solicitar que o leitor faa o doce. integral do indivduo.

LC - 2 dia | Caderno 5 - AMARELO - Pgina 12


*AMAR25DOM13*
QUESTO 120 QUESTO 122
eu acho um fato interessante... n... foi como meu pai e
minha me vieram se conhecer... n... que... minha me
morava no Piau com toda famlia... n... meu... meu
av... materno no caso... era maquinista... ele sofreu um
acidente... infelizmente morreu... minha me tinha cinco
anos... n... e o irmo mais velho dela... meu padrinho...
tinha dezessete e ele foi obrigado a trabalhar... foi trabalhar
no banco... e... ele foi... o banco... no caso... estava...
com um nmero de funcionrios cheio e ele teve que ir
para outro local e pediu transferncia prum local mais
perto de Parnaba que era a cidade onde eles moravam
e por engano o... o... escrivo entendeu Paraba... n...
e meu... e minha famlia veio parar em Mossor que
era exatamente o local mais perto onde tinha vaga pra
funcionrio do Banco do Brasil e:: ela foi parar na rua do
meu pai... n... e comearam a se conhecer... namoraram
onze anos... n... pararam algum tempo... brigaram...
lgico... porque todo relacionamento tem uma briga... n...
e eu achei esse fato muito interessante porque foi uma
coincidncia incrvel... n... como vieram a se conhecer...
namoraram e hoje... e at hoje esto juntos... dezessete
anos de casados
CUNHA, M. A. F. (Org.). Corpus, discurso & gramtica: a lngua falada
e escrita na cidade de Natal. Natal: EdUFRN, 1998.

Na produo dos textos, orais ou escritos, articulamos as


informaes por meio de relaes de sentido. No trecho
de fala, a passagem brigaram... lgico... porque todo
UHODFLRQDPHQWRWHPXPDEULJDHQXQFLDXPDMXVWLFDWLYD
em que "brigaram" e "todo relacionamento tem uma briga" Disponvel em: http://portal.saude.gov.br. Acesso em: 30 jul. 2012.
so, respectivamente,
Entre as funes de um cartaz, est a divulgao de
A causa e consequncia.
campanhas. Para cumprir essa funo, as palavras e as
B premissa e concluso. imagens desse cartaz esto combinadas de maneira a
C PHLRHQDOLGDGH A evidenciar as formas de contgio da tuberculose.
D exceo e regra. B mostrar as formas de tratamento da doena.
E fato e generalizao. C discutir os tipos da doena com a populao.
QUESTO 121 D alertar a populao em relao tuberculose.
Do amor ptria E combater os sintomas da tuberculose.
So doces os caminhos que levam de volta ptria. QUESTO 123
No ptria amada de verdes mares bravios, a mirar em A educao fsica ensinada a jovens do ensino
bero esplndido o esplendor do Cruzeiro do Sul; mas a mdio deve garantir o acmulo cultural no que tange
XPD RXWUD PDLV tQWLPD SDFtFD H KDELWXDO  XPD FXMD oportunizao de vivncia das prticas corporais; a
terra se comeu em criana, uma onde se foi menino
compreenso do papel do corpo no mundo da produo, no
ansioso por crescer, uma onde se cresceu em sofrimentos
que tange ao controle sobre o prprio esforo, e do direito
H HVSHUDQoDV SODQWDQGR FDQo}HV DPRUHV H OKRV DR
ao repouso e ao lazer; a iniciativa pessoal nas articulaes
sabor das estaes.
MORAES, V. Poesia completa e prosa. Rio de Janeiro: Nova Aguilar, 1987.
coletivas relativas s prticas corporais comunitrias; a
iniciativa pessoal para criar, planejar ou buscar orientao
O nacionalismo constitui tema recorrente na literatura para suas prprias prticas corporais; a interveno poltica
romntica e na modernista. No trecho, a representao sobre as iniciativas pblicas de esporte e de lazer.
da ptria ganha contornos peculiares porque Disponvel em: www.portal.mec.gov.br. Acesso em: 19 ago. 2012.
A o amor quilo que a ptria oferece grandioso e Segundo o texto, a educao fsica visa propiciar ao
eloquente. indivduo oportunidades de aprender a conhecer e a
B os elementos valorizados so intimistas e de perceber, de forma permanente e contnua, o seu prprio
dimenso subjetiva. corpo, concebendo as prticas corporais como meios para
C o olhar sobre a ptria ingnuo e comprometido pela A ampliar a interao social.
inrcia.
B atingir padres de beleza.
D o patriotismo literrio tradicional subvertido e motivo
de ironia. C obter resultados de alta performance.
E a natureza determinante na percepo do valor D reproduzir movimentos predeterminados.
da ptria. E alcanar maior produtividade no trabalho.
LC - 2 dia | Caderno 5 - AMARELO - Pgina 13
*AMAR25DOM14*
QUESTO 124
TEXTO I
Mama frica
Mama frica (a minha me)
me solteira
e tem que fazer
mamadeira todo dia
alm de trabalhar
como empacotadeira
nas Casas Bahia
Mama frica tem tanto o que fazer
alm de cuidar nenm
alm de fazer denguim
OKLQKRWHPTXHHQWHQGHU
Mama frica vai e vem
mas no se afasta de voc
quando Mama sai de casa
VHXVOKRVVHRORGXQ]DP
rola o maior jazz
Mama tem calos nos ps
Mama precisa de paz
Mama no quer brincar mais
OKLQKRGiXPWHPSR
tanto contratempo
no ritmo de vida de Mama
CHICO CSAR. Mama frica. So Paulo: MZA Music, 1995.

TEXTO II
FAMLIAS

os filhos so s de um dos
Em
parceiros ou de ambos, de

54,9% 16,3% relacionamentos anteriores,


um indicativo de aumento
das famlias no Brasil so desses grupos, das unies reconstitudas.
formadas por casais com filhos.

Mulheres so das famlias, dos lares o rendimento delas


responsveis por 37,3% mas em 62,7% ajuda no sustento da casa.

Elas tm cada vez


menos filhos 1,9 por mulher.

E engravidam mais tarde: aos 26,8 anos de idade.

Fonte: IBGE
A nova famlia brasileira. Disponvel em: http://veja.abril.com.br. Acesso em: 17 dez. 2012 (adaptado).

A pesquisa, realizada pelo IBGE, evidencia caractersticas das famlias brasileiras, tambm tematizadas pela cano
Mama frica. Ambos os textos destacam o(a)
A preocupao das mulheres com o mercado de trabalho.
B responsabilidade das mulheres no sustento das famlias.
C comprometimento das mulheres na reconstituio do casamento.
D GHGLFDomRGDVPXOKHUHVQRFXLGDGRFRPRVOKRV
E importncia das mulheres nas tarefas dirias.
LC - 2 dia | Caderno 5 - AMARELO - Pgina 14
*AMAR25DOM15*
QUESTO 125 Com base no contexto da Segunda Guerra Mundial, o livro
A rosa do povo revela desdobramentos da viso potica.
No fragmento, a expressividade lrica demonstra um(a)
A defesa da esperana como forma de superao das
atrocidades da guerra.
B desejo de resistncia s formas de opresso e medo
produzidas pela guerra.
C olhar pessimista das instituies humanas e sociais
VXEPHWLGDVDRFRQLWRDUPDGR
D exortao solidariedade para a reconstruo dos
espaos urbanos bombardeados.
E esprito de contestao capaz de subverter a condio
de vtima dos povos afetados.
PICASSO, P. Les desmoiselles dAvignon. leo sobre tela,
243,9 x 233,7 cm. Museu de Arte Moderna, Nova Iorque, 1907. QUESTO 127
Disponvel em: www.moma.org. Acesso em: 13 set. 2012. Ela muito diva!, gritou a moa aos amigos, com uma
A obra Les desmoiselles dAvignon, do pintor espanhol cmera na mo. Era a quinta edio da Campus Party, a
Pablo Picasso, um dos marcos iniciais do movimento feira de internet que acontece anualmente em So Paulo,
FXELVWD(VVDREUDOLDVHWDPEpPDR3ULPLWLYLVPRXPD na ltima tera-feira, 7. A diva em questo era a cantora
vez que sua composio recorre manifestao cultural
de tecnobrega Gaby Amarantos, a Beyonc do Par.
de um determinado grupo tnico, que se caracteriza por
Simptica, Gaby sorriu e posou pacientemente para todos
A produo de mscaras ritualsticas africanas.
os cliques. Pouco depois, o rapper Emicida, palestrante
B rituais de fertilidade das comunidades celtas. ao lado da paraense e do tambm rapper MV Bill, viveria a
C festas profanas dos povos mediterrneos. mesma tietagem. Se cenas como essa hoje em dia fazem
D culto nudez de populaes aborgenes. parte do cotidiano de Gaby e Emicida, ambos garantem
E danas ciganas do sul da Espanha. que isso se deve dimenso que suas carreiras tomaram
QUESTO 126 atravs da internet o sucesso na rede era justamente
o assunto da palestra. Ambos vieram da periferia e so
Anoitecer marcados pela disponibilizao gratuita ou a preos muito
A Dolores baixos de seus discos, fenmeno que ampliou a audincia
a hora em que o sino toca, para alm dos subrbios paraenses e paulistanos. A dupla
mas aqui no h sinos; at j realizou uma apresentao em conjunto, no Beco
h somente buzinas, 203, casa de shows localizada no Baixo Augusta, em So
sirenes roucas, apitos Paulo, frequentada por um pblico de classe mdia alta.
DLWRVSXQJHQWHVWUiJLFRV Disponvel em: www.cartacapital.com.br. Acesso em: 28 fev. 2012 (adaptado).

uivando escuro segredo; As ideias apresentadas no texto estruturam-se em torno


desta hora tenho medo. de elementos que promovem o encadeamento das ideias
[...] e a progresso do tema abordado. A esse respeito,
LGHQWLFDVHQRWH[WRHPTXHVWmRTXH
a hora do descanso, A a expresso pouco depois, em Pouco depois, o
mas o descanso vem tarde, rapper Emicida, indica permanncia de estado de
o corpo no pede sono, coisas no mundo.
depois de tanto rodar;
B o vocbulo tambm, em e tambm rapper MV Bill,
pede paz morte mergulho
retoma coesivamente a expresso o rapper Emicida.
no poo mais ermo e quedo;
desta hora tenho medo. C o conectivo se, em Se cenas como essa, orienta
o leitor para concluses contrrias a uma ideia
Hora de delicadeza, anteriormente apresentada.
agasalho, sombra, silncio. D RSURQRPHLQGHQLGRLVVRHPLVVRVHGHYHPDUFD
Haver disso no mundo? uma remisso a ideias do texto.
antes a hora dos corvos,
bicando em mim, meu passado, E as expresses a cantora de tecnobrega Gaby
meu futuro, meu degredo; Amarantos, a Beyonc do Par'", ambos e a dupla
desta hora, sim, tenho medo. formam uma cadeia coesiva por retomarem as
ANDRADE, C. D. A rosa do povo. Rio de Janeiro: Record, 2005 (fragmento). mesmas personalidades.

LC - 2 dia | Caderno 5 - AMARELO - Pgina 15


*AMAR25DOM16*
QUESTO 128 QUESTO 130
O acervo do Museu da Lngua Portuguesa o nosso
idioma, um patrimnio imaterial que no pode ser, por

.
OP
SOU F PARA DOAR SANGUE

AP
M ORO
isso, guardado e exposto em uma redoma de vidro. DE FUTEBOL. VOC PRECISA

SIC
AD
CONHECER A PESSOA?
Assim, o museu, dedicado valorizao e difuso da PRONTO. AGORA VOC J
CONHECE A BIANCA.
lngua portuguesa, reconhecidamente importante para a AMO LIVROS. ADORO
Assim como ela, milhares de pessoas
CINEMA.
preservao de nossa identidade cultural, apresenta uma precisam de doao de sangue.

forma expositiva diferenciada das demais instituies TENHO


15 ANOS.
museolgicas do pas e do mundo, usando tecnologia
TENHO LEUCEMIA E PRECISO
de ponta e recursos interativos para a apresentao de DE DOAO DE SANGUE.
Seja para quem for,
seus contedos. seja doador.
Disponvel em: www.museulinguaportuguesa.org.br. Acesso em: 16 ago. 2012 (adaptado).

De acordo com o texto, embora a lngua portuguesa Procure o Hemocentro mais prximo.

seja um patrimnio imaterial, pode ser exposta em um


museu. A relevncia desse tipo de iniciativa est pautada
no pressuposto de que Disponvel em: http://portal.saude.gov.br. Acesso em: 8 nov. 2013 (adaptado).
A a lngua um importante instrumento de constituio Na campanha publicitria, h uma tentativa de
social de seus usurios. sensibilizar o pblico-alvo, visando lev-lo doao de
B o modo de falar o portugus padro deve ser divulgado sangue. Analisando a estratgia argumentativa utilizada,
ao grande pblico. percebe-se que
C a escola precisa de parceiros na tarefa de valorizao A a exposio de alguns dados sobre a jovem procura
da lngua portuguesa. provocar compaixo, visto que, em razo da doena,
ela vive de maneira diferente dos demais jovens de
D o contato do pblico com a norma-padro solicita o
sua idade.
uso de tecnologia de ltima gerao.
B a campanha defende a ideia de que, para doar,
E as atividades ldicas dos falantes com sua prpria preciso conhecer o doente, considerando que foi
lngua melhoram com o uso de recursos tecnolgicos. SUHFLVRDSUHVHQWDUDMRYHPSDUDJHUDULGHQWLFDomR
QUESTO 129 C o questionamento seguido da resposta prope
UHH[mR SRU SDUWH GR S~EOLFRDOYR YLVWR TXH R WH[WR
Descobrimento
critica a prtica de escolher para quem doar.
Abancado escrivaninha em So Paulo
D as escolhas verbais associadas imagem parecem
Na minha casa da rua Lopes Chaves contraditrias, pois constroem uma aparncia
De sopeto senti um frime por dentro. incompatvel com a de uma jovem doente.
E DFDPSDQKDH[SORUDDH[SUHVVmRGDMRYHPDPGH
Fiquei trmulo, muito comovido
gerar comoo no leitor, levando-o a doar sangue
Com o livro palerma olhando pra mim. para as pessoas com leucemia.
No v que me lembrei que l no norte, meu Deus! Muito QUESTO 131
longe de mim,
O ltimo longa de Carlo acompanha a operria
Na escurido ativa da noite que caiu, Silmara, que vive com o pai, um ex-presidirio, numa casa
Um homem plido, magro de cabelos escorrendo nos olhos da periferia paulistana. Ciente de sua beleza, o que lhe
d certa soberba, a jovem acredita que ter um destino
Depois de fazer uma pele com a borracha do dia, diferente do de suas colegas. Cruza o caminho de dois
Faz pouco se deitou, est dormindo. cantores por quem apaixonada. E constata, na prtica,
que o romantismo dos contos de fada tem perna curta.
Esse homem brasileiro que nem eu... VOMERO, M. F. Romantismo de araque. Vida Simples, n. 121, ago. 2012.
ANDRADE, M. Poesias completas. So Paulo: Edusp, 1987.
Reconhece-se, nesse trecho, uma posio crtica aos
O poema Descobrimento, de Mrio de Andrade, marca ideais de amor e felicidade encontrados nos contos de
a postura nacionalista manifestada pelos escritores fada. Essa crtica traduzida
modernistas. Recuperando o fato histrico do A pela descrio da dura realidade da vida das operrias.
descobrimento, a construo potica problematiza a
B pelas decepes semelhantes s encontradas nos
UHSUHVHQWDomRQDFLRQDODPGH
contos de fada.
A resgatar o passado indgena brasileiro. C pela iluso de que a beleza garantiria melhor sorte na
B criticar a colonizao portuguesa no Brasil. vida e no amor.
C defender a diversidade social e cultural brasileira. D pelas fantasias existentes apenas na imaginao de
D promover a integrao das diferentes regies do pas. pessoas apaixonadas.
E valorizar a Regio Norte, pouco conhecida pelos E pelos sentimentos intensos dos apaixonados
brasileiros. enquanto vivem o romantismo.

LC - 2 dia | Caderno 5 - AMARELO - Pgina 16


*AMAR25DOM17*
QUESTO 132 QUESTO 134
Esa e Jac Adoante
Ora, a est justamente a epgrafe do livro, se eu lhe Quatro gotas do produto contm 0,04 kcal e equivalem
quisesse pr alguma, e no me ocorresse outra. No ao poder adoante de 1 colher (de ch) de acar.
somente um meio de completar as pessoas da narrao Ingredientes gua, sorbitol, edulcorantes (sucralose
com as ideias que deixarem, mas ainda um par de lunetas e acesulfame de potssio); conservadores: benzoato de
para que o leitor do livro penetre o que for menos claro ou sdio e cido benzoico, acidulante cido ctrico e regulador
totalmente escuro. de acidez citrato de sdio.
Por outro lado, h proveito em irem as pessoas da No contm glten.
minha histria colaborando nela, ajudando o autor, por Informao nutricional poro de 0,12 mL (4 gotas).
uma lei de solidariedade, espcie de troca de servios, 1mRFRQWpPTXDQWLGDGHVLJQLFDWLYDGHFDUERLGUDWRV
entre o enxadrista e os seus trebelhos. SURWHtQDVJRUGXUDVWRWDLVJRUGXUDVWUDQVEUDDOLPHQWDU
e sdio.
Se aceitas a comparao, distinguirs o rei e a dama,
Consumir preferencialmente sob orientao de
o bispo e o cavalo, sem que o cavalo possa fazer de torre, nutricionista ou mdico.
nem a torre de peo. H ainda a diferena da cor, branca Cosmed Indstria de Cosmticos e Medicamentos S/A. Barueri, SP.
e preta, mas esta no tira o poder da marcha de cada
Esse texto, rtulo de um adoante, tem como objetivo
SHoDHDQDOXPDVHRXWUDVSRGHPJDQKDUDSDUWLGDH
transmitir ao leitor informaes sobre a
assim vai o mundo.
ASSIS, M. Obra completa. Rio de Janeiro: Nova Aguilar, 1964 (fragmento).
A composio nutricional do produto.
O fragmento do romance Esa e Jac mostra como o B necessidade de consultar um especialista antes
do uso.
narrador concebe a leitura de um texto literrio. Com base
nesse trecho, tal leitura deve levar em conta C medida exata de cada ingrediente que compe a
frmula.
A o leitor como pea fundamental na construo dos
sentidos. D quantidade do produto que deve ser consumida
diariamente.
B a luneta como objeto que permite ler melhor.
E correspondncia calrica existente entre o adoante
C RDXWRUFRPR~QLFRFULDGRUGHVLJQLFDGRV e o acar.
D o carter de entretenimento da literatura.
QUESTO 135
E a solidariedade de outros autores.
Casamento
QUESTO 133 H mulheres que dizem:
Meu marido, se quiser pescar, pesque,
mas que limpe os peixes.
Eu no. A qualquer hora da noite me levanto,
ajudo a escamar, abrir, retalhar e salgar.
to bom, s a gente sozinhos na cozinha,
de vez em quando os cotovelos se esbarram,
ele fala coisas como este foi difcil
prateou no ar dando rabanadas
e faz o gesto com a mo.
O silncio de quando nos vimos a primeira vez
atravessa a cozinha como um rio profundo.
3RUPRVSHL[HVQDWUDYHVVD
vamos dormir.
Coisas prateadas espocam:
somos noivo e noiva.
RIC. Disponvel em: www.nanquim.com.br. Acesso em: 8 dez. 2012.
PRADO, A. Poesia reunida. So Paulo: Siciliano, 1991.
O texto faz referncia aos sistemas de comunicao O poema de Adlia Prado, que segue a proposta moderna
e informao. A crtica feita a uma das ferramentas de tematizao de fatos cotidianos, apresenta a prosaica
miditicas se fundamenta na falta de ao de limpar peixes na qual a voz lrica reconhece uma
A opinio dos leitores nas redes sociais. A expectativa do marido em relao esposa.
B recursos tecnolgicos nas empresas jornalsticas. B imposio dos afazeres conjugais.
C instantaneidade na divulgao da notcia impressa. C disposio para realizar tarefas masculinas.
D credibilidade das informaes veiculadas nos blogs. D dissonncia entre as vozes masculina e feminina.
E adequao da linguagem jornalstica ao pblico jovem. E forma de consagrao da cumplicidade no casamento.
LC - 2 dia | Caderno 5 - AMARELO - Pgina 17
*AMAR25DOM18*
INSTRUES PARA A REDAO
x O rascunho da redao deve ser feito no espao apropriado.
x 2WH[WRGHQLWLYRGHYHVHUHVFULWRjWLQWDQDIROKDSUySULDHPDWpOLQKDV
x A redao que apresentar cpia dos textos da Proposta de Redao ou do Caderno de Questes ter o nmero de linhas copiadas
desconsiderado para efeito de correo.
Receber nota zero, em qualquer das situaes expressas a seguir, a redao que:
x tiver at 7 (sete) linhas escritDVVHQGRFRQVLGHUDGDWH[WRLQVXFLHQWH
x fugir ao tema ou que no atender ao tipo dissertativo-argumentativo.
x apresentar proposta de interveno que desrespeite os direitos humanos.
x apresentar parte do texto deliberadamente desconectada do tema proposto.

TEXTOS MOTIVADORES
TEXTO I
Ascendendo condio de trabalhador livre, antes ou depois da abolio, o negro se via jungido a novas formas
de explorao que, embora melhores que a escravido, s lhe permitiam integrar-se na sociedade e no mundo cultural,
que se tornaram seus, na condio de um subproletariado compelido ao exerccio de seu antigo papel, que continuava
sendo principalmente o de animal de servio. [...] As taxas de analfabetismo, de criminalidade e de mortalidade dos
QHJURVVmRSRULVVRDVPDLVHOHYDGDVUHHWLQGRRIUDFDVVRGDVRFLHGDGHEUDVLOHLUDHPFXPSULUQDSUiWLFDVHXLGHDO
professado de uma democracia racial que integrasse o negro na condio de cidado indiferenciado dos demais.
RIBEIRO, D. O povo brasileiro: a formao e o sentido do Brasil. So Paulo: Companhia das Letras, 1995 (fragmento).

TEXTO II
LEI N 7.716, DE 5 DE JANEIRO DE 1989
'HQHRVFULPHVUHVXOWDQWHVGHSUHFRQFHLWRGHUDoDRXGHFRU
Art. 1 Sero punidos, na forma desta Lei, os crimes resultantes de discriminao ou preconceito de raa, cor,
etnia, religio ou procedncia nacional.
Disponvel em: www.planalto.gov.br. Acesso em: 25 maio 2016 (fragmento).

TEXTO III TEXTO IV


OTXHVmRDo}HVDUPDWLYDV
$o}HV DUPDWLYDV VmR SROtWLFDV S~EOLFDV IHLWDV SHOR
governo ou pela iniciativa privada com o objetivo de corrigir
desigualdades raciais presentes na sociedade, acumuladas ao
longo de anos.
8PD DomR DUPDWLYD EXVFD RIHUHFHU LJXDOGDGH GH
RSRUWXQLGDGHV D WRGRV $V Do}HV DUPDWLYDV SRGHP VHU GH
trs tipos: com o objetivo de reverter a representao negativa;
para promover igualdade de oportunidades; e para combater o
preconceito e o racismo.
Em 2012, o Supremo Tribunal Federal (STF) decidiu por
XQDQLPLGDGH TXH DV Do}HV DUPDWLYDV VmR FRQVWLWXFLRQDLV
e polticas essenciais para a reduo de desigualdades e
discriminaes existentes no pas.
1R %UDVLO DV Do}HV DUPDWLYDV LQWHJUDP XPD DJHQGD GH
combate herana histrica de escravido, segregao racial
e racismo contra a populao negra.
Disponvel em: www12.senado.leg.br. Acesso em: 25 maio 2016. Disponvel em: www.seppir.gov.br. Acesso em: 25 maio 2016 (fragmento).

PROPOSTA DE REDAO
A partir da leitura dos textos motivadores e com base nos conhecimentos construdos ao longo de sua
formao, redija texto dissertativo-argumentativo em modalidade escrita formal da lngua portuguesa sobre o tema
Caminhos para combater o racismo no Brasil, apresentando proposta de interveno que respeite os direitos
humanos. Selecione, organize e relacione, de forma coerente e coesa, argumentos e fatos para defesa de seu
ponto de vista.

LC - 2 dia | Caderno 5 - AMARELO - Pgina 18


*AMAR25DOM19*
MATEMTICA E SUAS TECNOLOGIAS QUESTO 138
Questes de 136 a 180 Dispondo de um grande terreno, uma empresa de
entretenimento pretende construir um espao retangular
QUESTO 136 para shows HHYHQWRVFRQIRUPHDJXUD
O quadro apresenta a ordem de colocao dos seis Palco
primeiros pases em um dia de disputa nas Olimpadas.
A ordenao feita de acordo com as quantidades de
medalhas de ouro, prata e bronze, respectivamente.
Pas Ouro Prata %URQ]H Total
1 China 9 5 3 17
2 EUA 5 7 4 16 rea para o pblico y (metro)
3 Frana 3 1 3 7
4 Argentina 3 2 2 7
5 Itlia 2 6 2 10
6 Brasil 2 5 3 10
Se as medalhas obtidas por Brasil e Argentina fossem x (metro)
reunidas para formar um nico pas hipottico, qual a
posio ocupada por esse pas?
A 1 A rea para o pblico ser cercada com dois tipos de
materiais:
B 2
 nos lados paralelos ao palco ser usada uma tela
C 3
do tipo A, mais resistente, cujo valor do metro linear
D 4 R$ 20,00;
E 5  nos outros dois lados ser usada uma tela do tipo
QUESTO 137 B, comum, cujo metro linear custa R$ 5,00.
1D JXUD HVWmR UHSUHVHQWDGDV WUrV UHWDV QR SODQR A empresa dispe de R$ 5 000,00 para comprar todas
cartesiano, sendo P, Q e R os pontos de interseces as telas, mas quer fazer de tal maneira que obtenha a
entre as retas, e A, B e C os pontos de interseces maior rea possvel para o pblico.
dessas retas com o eixo x.
y A quantidade de cada tipo de tela que a empresa deve
comprar
t
s A 50,0 m da tela tipo A e 800,0 m da tela tipo B.
B 62,5 m da tela tipo A e 250,0 m da tela tipo B.
C 100,0 m da tela tipo A e 600,0 m da tela tipo B.
r Q D 125,0 m da tela tipo A e 500,0 m da tela tipo B.
P E 200,0 m da tela tipo A e 200,0 m da tela tipo B.
R
QUESTO 139
Um clube tem um campo de futebol com rea total
A B C x de 8 000 m2, correspondente ao gramado. Usualmente, a
poda da grama desse campo feita por duas mquinas
do clube prprias para o servio. Trabalhando no mesmo
2
(VVD JXUD p D UHSUHVHQWDomR JUiFD GH XP VLVWHPD ritmo, as duas mquinas podam juntas 200 m por hora.
linear de trs equaes e duas incgnitas que Por motivo de urgncia na realizao de uma partida
A possui trs solues reais e distintas, representadas de futebol, o administrador do campo precisar solicitar
pelos pontos P, Q e R, pois eles indicam onde as ao clube vizinho mquinas iguais s suas para fazer o
retas se intersectam. servio de poda em um tempo mximo de 5 h.
B possui trs solues reais e distintas, representadas Utilizando as duas mquinas que o clube j possui, qual
pelos pontos A, B e C, pois eles indicam onde as retas o nmero mnimo de mquinas que o administrador do
intersectam o eixo das abscissas. campo dever solicitar ao clube vizinho?
C SRVVXL LQQLWDV VROXo}HV UHDLV SRLV DV UHWDV VH A 4
intersectam em mais de um ponto. B 6
D no possui soluo real, pois no h ponto que C 8
pertena simultaneamente s trs retas.
D 14
E possui uma nica soluo real, pois as retas possuem
pontos em que se intersectam. E 16

MT - 2 dia | Caderno 5 - AMARELO - Pgina 19


*AMAR25DOM20*
QUESTO 140 QUESTO 142
2 JUiFR PRVWUD D PpGLD GH SURGXomR GLiULD GH Um vendedor de assinaturas de TV a cabo teve,
petrleo no Brasil, em milho de barris, no perodo de nos 7 primeiros meses do ano, uma mdia mensal de
2004 a 2010. 84 assinaturas vendidas. Devido a uma reestruturao
2,5 da empresa, foi exigido que todos os vendedores
2,0
1,97 2,00 WLYHVVHP DR QDO GR DQR XPD PpGLD PHQVDO GH 
1,78 1,79 1,85
1,68 assinaturas vendidas. Diante disso, o vendedor se viu
Barris (milho)

1,49
1,5 forado a aumentar sua mdia mensal de vendas nos
1,0 5 meses restantes do ano.
0,5 Qual dever ser a mdia mensal de vendas do vendedor,
nos prximos 5 meses, para que ele possa cumprir a
0
2004 2005 2006 2007 2008 2009 2010 Ano exigncia da sua empresa?
Estimativas feitas naquela poca indicavam que A 91
a mdia de produo diria de petrleo no Brasil, em B 105
2012, seria 10% superior mdia dos trs ltimos anos
DSUHVHQWDGRVQRJUiFR C 114
Disponvel em: http://blogs.estadao.com.br. Acesso em: 2 ago. 2012. D 118
6HHVVDVHVWLPDWLYDVWLYHVVHPVLGRFRQUPDGDVDPpGLD E 120
de produo diria de petrleo no Brasil, em milho de
barris, em 2012, teria sido igual a QUESTO 143
A 1,940. Num mapa com escala 1 : 250 000, a distncia entre
B 2,134. as cidades A e B de 13 cm. Num outro mapa, com escala
1 : 300 000, a distncia entre as cidades A e C de 10 cm.
C 2,167.
Em um terceiro mapa, com escala 1 : 500 000, a distncia
D 2,420. entre as cidades A e D de 9 cm. As distncias reais entre
E 6,402. a cidade A e as cidades B, C e D so, respectivamente,
QUESTO 141 iguais a X, Y e Z (na mesma unidade de comprimento).
O governo de uma cidade est preocupado com a As distncias X, Y e Z, em ordem crescente, esto dadas em
possvel epidemia de uma doena infectocontagiosa A X , Y , Z.
causada por bactria. Para decidir que medidas tomar,
B Y , X , Z.
deve calcular a velocidade de reproduo da bactria.
Em experincias laboratoriais de uma cultura bacteriana, C Y , Z , X.
inicialmente com 40 mil unidades, obteve-se a frmula D Z , X , Y.
para a populao:
E Z , Y , X.
p(t) 40  23t
em que t o tempo, em hora, e p(t) a populao, em QUESTO 144
milhares de bactrias. Um banco de sangue recebe 450 mL de sangue de
Em relao quantidade inicial de bactrias, aps 20 min, cada doador. Aps separar o plasma sanguneo das
a populao ser hemcias, o primeiro armazenado em bolsas de 250 mL
A reduzida a um tero. de capacidade. O banco de sangue aluga refrigeradores
B reduzida metade. de uma empresa para estocagem das bolsas de plasma,
segundo a sua necessidade. Cada refrigerador tem uma
C reduzida a dois teros.
capacidade de estocagem de 50 bolsas. Ao longo de uma
D duplicada. semana, 100 pessoas doaram sangue quele banco.
E triplicada.
Admita que, de cada 60 mL de sangue, extraem-se
40 mL de plasma.
O nmero mnimo de congeladores que o banco precisou
alugar, para estocar todas as bolsas de plasma dessa
semana, foi
A 2.
B 3.
C 4.
D 6.
E 8.

MT - 2 dia | Caderno 5 - AMARELO - Pgina 20


*AMAR25DOM21*
QUESTO 145 QUESTO 147
Um agricultor vive da plantao de morangos que Para evitar uma epidemia, a Secretaria de Sade de
so vendidos para uma cooperativa. A cooperativa faz um uma cidade dedetizou todos os bairros, de modo a evitar
contrato de compra e venda no qual o produtor informa a a proliferao do mosquito da dengue. Sabe-se que o
rea plantada. nmero f de infectados dado pela funo f(t) 2t  120t
Para permitir o crescimento adequado das plantas, as (em que t expresso em dia e t 0 o dia anterior
mudas de morango so plantadas no centro de uma rea primeira infeco) e que tal expresso vlida para os
UHWDQJXODUGHFPSRUFPFRPRPRVWUDDJXUD 60 primeiros dias da epidemia.
A Secretaria de Sade decidiu que uma segunda
dedetizao deveria ser feita no dia em que o nmero de
infectados chegasse marca de 1 600 pessoas, e uma
segunda dedetizao precisou acontecer.
20 cm

20 cm
A segunda dedetizao comeou no
A 19 dia.
B 20 dia.
C 29 dia.
D 30 dia.
E 60 dia.

10 cm 10 cm QUESTO 148
Uma empresa europeia construiu um avio solar,
Atualmente, sua plantao de morangos ocupa
FRPR QD JXUD REMHWLYDQGR GDU XPD YROWD DR PXQGR
uma rea de 10 000 m2, mas a cooperativa quer que ele
utilizando somente energia solar. O avio solar tem
aumente sua produo. Para isso, o agricultor dever
comprimento AB igual a 20 m e uma envergadura de asas
aumentar a rea plantada em 20%, mantendo o mesmo
CD igual a 60 m.
padro de plantio.
O aumento (em unidade) no nmero de mudas de
morango em sua plantao deve ser de
A 10 000.
B 60 000.
C 100 000.
D 500 000.
E 600 000.
QUESTO 146

Uma indstria de perfumes embala seus produtos,


atualmente, em frascos esfricos de raio R, com volume
Para uma feira de cincias, uma equipe de alunos
4
dado por S(R)3. fez uma maquete desse avio. A escala utilizada pelos
3 alunos foi de 3 : 400.
Observou-se que haver reduo de custos se forem A envergadura CD na referida maquete, em centmetro,
R igual a
utilizados frascos cilndricos com raio da base , cujo
R
2 3 A 5.
volume ser dado por S h, sendo h a altura da nova
3 B 20.
embalagem. C 45.
D 55.
Para que seja mantida a mesma capacidade do frasco E 80.
esfrico, a altura do frasco cilndrico (em termos de R)
dever ser igual a

A 2R.
B 4R.
C 6R.
D 9R.
E 12R.

MT - 2 dia | Caderno 5 - AMARELO - Pgina 21


*AMAR25DOM22*
QUESTO 149
A bocha um esporte jogado em canchas, que so terrenos planos e nivelados, limitados por tablados perimtricos
de madeira. O objetivo desse esporte lanar bochas, que so bolas feitas de um material sinttico, de maneira a
situ-las o mais perto possvel do bolim, que uma bola menor feita, preferencialmente, de ao, previamente lanada.
A Figura 1 ilustra uma bocha e um bolim que foram jogados em uma cancha. Suponha que um jogador tenha lanado
XPDERFKDGHUDLRFPTXHWHQKDFDGRHQFRVWDGDQREROLPGHUDLRFPFRQIRUPHLOXVWUDD)LJXUD

A B
d

Figura 1 Figura 2

Considere o ponto C como o centro da bocha, e o ponto O como o centro do bolim. Sabe-se que A e B so os
pontos em que a bocha e o bolim, respectivamente, tocam o cho da cancha, e que a distncia entre A e B igual a d.
Nessas condies, qual a razo entre d e o raio do bolim?
A 1
2 10
B
5
10
C
2
D 2
E 10
QUESTO 150
Em um trabalho escolar, Joo foi convidado a calcular as reas de vrios quadrados diferentes, dispostos em
VHTXrQFLDGDHVTXHUGDSDUDDGLUHLWDFRPRPRVWUDDJXUD

1 2 3 4 5 6
O primeiro quadrado da sequncia tem lado medindo 1 cm, o segundo quadrado tem lado medindo 2 cm, o terceiro
TXDGUDGRWHPODGRPHGLQGRFPHDVVLPSRUGLDQWH2REMHWLYRGRWUDEDOKRpLGHQWLFDUHPTXDQWRDiUHDGHFDGD
quadrado da sequncia excede a rea do quadrado anterior. A rea do quadrado que ocupa a posio n, na sequncia,
foi representada por An.
Para n t 2, o valor da diferena An  An1, em centmetro quadrado, igual a
A 2n  1
B 2n  1
C 2n  1
D (n  1)2
E n2  1

MT - 2 dia | Caderno 5 - AMARELO - Pgina 22


*AMAR25DOM23*
QUESTO 151 QUESTO 153
Nas construes prediais so utilizados tubos de O Brasil o quarto produtor mundial de alimentos e
diferentes medidas para a instalao da rede de gua. tambm um dos campees mundiais de desperdcio.
Essas medidas so conhecidas pelo seu dimetro, muitas So produzidas por ano, aproximadamente, 150 milhes
vezes medido em polegada. Alguns desses tubos, com
1 3 5 de toneladas de alimentos e, desse total, 2 so produtos
medidas em polegada, so os tubos de , e . 3
2 8 4 de plantio. Em relao ao que se planta, 64% so
Colocando os valores dessas medidas em ordem perdidos ao longo da cadeia produtiva (20% perdidos na
crescente, encontramos colheita, 8% no transporte e armazenamento, 15% na
1 3 5 indstria de processamento, 1% no varejo e o restante no
A , , processamento culinrio e hbitos alimentares).
2 8 4
Disponvel em: www.bancodealimentos.org.br. Acesso em: 1 ago. 2012.

1 5 3 O desperdcio durante o processamento culinrio e


B , ,
2 4 8 hbitos alimentares, em milho de tonelada, igual a
3 1 5 A 20.
C , ,
B 30.
8 2 4
C 56.
3 5 1
D , , D 64.
8 4 2
E 96.
5 1 3
E , , QUESTO 154
4 2 8
O veculo terrestre mais veloz j fabricado at hoje o
QUESTO 152 Sonic Wind LSRV, que est sendo preparado para atingir
Um lapidador recebeu de um joalheiro a encomenda a velocidade de 3 000 km/h. Ele mais veloz do que o
para trabalhar em uma pedra preciosa cujo formato Concorde, um dos avies de passageiros mais rpidos j
o de uma pirmide, conforme ilustra a Figura 1. Para feitos, que alcana 2 330 km/h.
tanto, o lapidador far quatro cortes de formatos iguais
nos cantos da base. Os cantos retirados correspondem a
pequenas pirmides, nos vrtices P, Q, R e S, ao longo
dos segmentos tracejados, ilustrados na Figura 2.
S S

P R P R

Q Q

3DUDXPDGLVWkQFLD[DDYHORFLGDGHHRWHPSRVmR
inversamente proporcionais.
O O BASILIO, A. Galileu, mar. 2012 (adaptado).

Figura 1 Figura 2 Para percorrer uma distncia de 1 000 km, o valor mais
Depois de efetuados os cortes, o lapidador obteve, a partir prximo da diferena, em minuto, entre os tempos
da pedra maior, uma joia polidrica cujos nmeros de gastos pelo Sonic Wind LSRV e pelo Concorde, em suas
faces, arestas e vrtices so, respectivamente, iguais a velocidades mximas,
A 9, 20 e 13. A 0,1.
B 9, 24 e 13. B 0,7.
C 7, 15 e 12. C 6,0.
D 10, 16 e 5. D 11,2.
E 11, 16 e 5. E 40,2.

MT - 2 dia | Caderno 5 - AMARELO - Pgina 23


*AMAR25DOM24*
QUESTO 155 QUESTO 157
Um produtor de maracuj usa uma caixa-dgua, Um grupo de escoteiros mirins, numa atividade no
com volume V, para alimentar o sistema de irrigao parque da cidade onde moram, montou uma barraca
de seu pomar. O sistema capta gua atravs de um conforme a foto da Figura 1. A Figura 2 mostra o esquema
furo no fundo da caixa a uma vazo constante. Com da estrutura dessa barraca, em forma de um prisma reto,
a caixa-dgua cheia, o sistema foi acionado s 7 h em que foram usadas hastes metlicas.
da manh de segunda-feira. s 13 h do mesmo dia,
verificou-se que j haviam sido usados 15% do volume
da gua existente na caixa. Um dispositivo eletrnico
interrompe o funcionamento do sistema quando o F E
volume restante na caixa de 5% do volume total,
para reabastecimento.
Supondo que o sistema funcione sem falhas, a que horas
o dispositivo eletrnico interromper o funcionamento? D C

A s 15 h de segunda-feira. A B

B s 11 h de tera-feira. Figura 1 Figura 2

C s 14 h de tera-feira. Aps a armao das hastes, um dos escoteiros


D s 4 h de quarta-feira. observou um inseto deslocar-se sobre elas, partindo do
E s 21 h de tera-feira. vrtice A em direo ao vrtice B, deste em direo ao
vrtice E H QDOPHQWH IH] R WUDMHWR GR YpUWLFH E ao C.
QUESTO 156 Considere que todos esses deslocamentos foram feitos
Uma regio de uma fbrica deve ser isolada, pois nela pelo caminho de menor distncia entre os pontos.
RV HPSUHJDGRV FDP H[SRVWRV D ULVFRV GH DFLGHQWHV A projeo do deslocamento do inseto no plano que
Essa regio est representada pela poro de cor cinza contm a base ABCD dada por
(quadriltero de rea S)QDJXUD
y A

9 B

C
S

3
D

0 4 8 x E
Para que os funcionrios sejam orientados sobre a
localizao da rea isolada, cartazes informativos sero
D[DGRV SRU WRGD D IiEULFD 3DUD FRQIHFFLRQiORV XP QUESTO 158
programador utilizar um software que permite desenhar Uma caixa-dgua em forma de um paraleleppedo
essa regio a partir de um conjunto de desigualdades retngulo reto, com 4 m de comprimento, 3 m de largura e
algbricas. 2 m de altura, necessita de higienizao. Nessa operao,
As desigualdades que devem ser utilizadas no referido a caixa precisar ser esvaziada em 20 min, no mximo.
software, para o desenho da regio de isolamento, so A retirada da gua ser feita com o auxlio de uma bomba
de vazo constante, em que vazo o volume do lquido
A 3y  x d 0; 2y  x t 0; y d 8; x d 9 que passa pela bomba por unidade de tempo.
B 3y  x d 0; 2y  x t 0; y d 9; x d 8 A vazo mnima, em litro por segundo, que essa bomba
C 3y  x t 0; 2y  x d 0; y d 9; x d 8 dever ter para que a caixa seja esvaziada no tempo
D 4y  9x d 0; 8y  3x t 0; y d 8; x d 9 estipulado
E 4y  9x d 0; 8y  3x t 0; y d 9; x d 8 A 2.
B 3.
C 5.
D 12.
E 20.
MT - 2 dia | Caderno 5 - AMARELO - Pgina 24
*AMAR25DOM25*
QUESTO 159 QUESTO 161
Um terreno retangular de lados cujas medidas, em O recinto das provas de natao olmpica utiliza a mais
metro, so x e y ser cercado para a construo de um avanada tecnologia para proporcionar aos nadadores
parque de diverses. Um dos lados do terreno encontra-se condies ideais. Isso passa por reduzir o impacto da
jVPDUJHQVGHXPULR2EVHUYHDJXUD ondulao e das correntes provocadas pelos nadadores
x no seu deslocamento. Para conseguir isso, a piscina
de competio tem uma profundidade uniforme de 3 m,
TXHDMXGDDGLPLQXLUDUHH[mRGDiJXD RPRYLPHQWR
contra uma superfcie e o regresso no sentido contrrio,
atingindo os nadadores), alm dos j tradicionais 50 m
y de comprimento e 25 m de largura. Um clube deseja
reformar sua piscina de 50 m de comprimento, 20 m de
largura e 2 m de profundidade de forma que passe a ter
as mesmas dimenses das piscinas olmpicas.
Disponvel em: http://desporto.publico.pt. Acesso em: 6 ago. 2012.

Aps a reforma, a capacidade dessa piscina superar a


capacidade da piscina original em um valor mais prximo de
A 20%.
B 25%.
Para cercar todo o terreno, o proprietrio gastar C 47%.
R$ 7 500,00. O material da cerca custa R$ 4,00 por
metro para os lados do terreno paralelos ao rio, e D 50%.
R$ 2,00 por metro para os demais lados. E 88%.
Nessas condies, as dimenses do terreno e o custo
QUESTO 162
total do material podem ser relacionados pela equao
A 4(2x  y) 7 500 O sdio est presente na maioria dos alimentos
industrializados, podendo causar problemas cardacos
B 4(x  2y) 7 500
em pessoas que ingerem grandes quantidades desses
C 2(x y) 7 500 alimentos. Os mdicos recomendam que seus pacientes
D 2(4x  y) 7 500 diminuam o consumo de sdio.
E 2(2x  y) 7 500 Com base nas informaes nutricionais de cinco
QUESTO 160 marcas de biscoitos (A, B, C, D e E), construiu-se o
JUiFRTXHUHODFLRQDTXDQWLGDGHVGHVyGLRFRPSRUo}HV
Para comemorar o aniversrio de uma cidade, a
prefeitura organiza quatro dias consecutivos de atraes de diferentes biscoitos.
culturais. A experincia de anos anteriores mostra que, de
um dia para o outro, o nmero de visitantes no evento 250 C
triplicado. esperada a presena de 345 visitantes para
Quantidade de sdio

o primeiro dia do evento. 200 E


por poro (mg)

Uma representao possvel do nmero esperado de 150


participantes para o ltimo dia
A 3 u 345 100 A
B
D

B (3  3  3) u 345 50
C 33 u 345
D 3 u 4 u 345 0 10 20 30 40 50 60 70 80 90 100
E 34 u 345 Poro de biscoitos (g)

Qual das marcas de biscoito apresentadas tem a menor


quantidade de sdio por grama do produto?
A A
B B
C C
D D
E E

MT - 2 dia | Caderno 5 - AMARELO - Pgina 25


*AMAR25DOM26*
QUESTO 163 Suponha que os passageiros que utilizam seus prprios
$Wp QRYHPEUR GH  QmR KDYLD XPD OHL HVSHFtFD veculos deixem seus carros nesse estacionamento por
TXHSXQLVVHIUDXGHHPFRQFXUVRVS~EOLFRV,VVRGLFXOWDYDR um perodo de dois dias.
HQTXDGUDPHQWRGRVIUDXGDGRUHVHPDOJXPDUWLJRHVSHFtFR Para tornar atrativo a esses passageiros o uso do
do Cdigo Penal, fazendo com que eles escapassem da estacionamento, o valor, em real, cobrado por dia de
Justia mais facilmente. Entretanto, com o sancionamento estacionamento deve ser, no mximo, de
da Lei 12.550/11, considerado crime utilizar ou divulgar A 35,00.
indevidamente o contedo sigiloso de concurso pblico,
B 40,00.
com pena de recluso de 12 a 48 meses (1 a 4 anos). Caso
esse crime seja cometido por um funcionrio pblico, a C 45,00.
D 70,00.
pena sofrer um aumento de 1 .
3 E 90,00.
Disponvel em: www.planalto.gov.br. Acesso em: 15 ago. 2012.
QUESTO 166
Se um funcionrio pblico for condenado por fraudar um
concurso pblico, sua pena de recluso poder variar de O ndice de Massa Corporal (IMC) pode ser
considerado uma alternativa prtica, fcil e barata para
A 4 a 16 meses. a medio direta de gordura corporal. Seu valor pode
B 16 a 52 meses. Massa
ser obtido pela frmula IMC = , na qual a massa
C 16 a 64 meses. ( Altura )2
D 24 a 60 meses. em quilograma e a altura, em metro. As crianas,
E 28 a 64 meses. naturalmente, comeam a vida com um alto ndice
GH JRUGXUD FRUSyUHD PDV YmR FDQGR PDLV PDJUDV
QUESTO 164 conforme envelhecem, por isso os cientistas criaram um
Uma pessoa est disputando um processo de seleo IMC especialmente para as crianas e jovens adultos, dos
para uma vaga de emprego em um escritrio. Em uma dois aos vinte anos de idade, chamado de IMC por idade.
das etapas desse processo, ela tem de digitar oito textos. 2JUiFRPRVWUDR,0&SRULGDGHSDUDPHQLQRV
A quantidade de erros dessa pessoa, em cada um dos Grfico IMC por idade - meninos
textos digitados, dada na tabela.
Nmero 34
Texto 32
de erros Excesso de peso
30
I 2 28
II 0 o
26 pes
o de
III 2 24 ess
exc
IV 2 22
isco de
IMC (kg/m)

20 R
V 6 Normal
18
VI 3 16
VII 4 14
12
VIII 5 10
Nessa etapa do processo de seleo, os 8
AbaixoDO
ABAIXO do PESO
peso
candidatos sero avaliados pelo valor da mediana do 6
nmero de erros. 4
2
A mediana dos nmeros de erros cometidos por essa 0
pessoa igual a 2 3 4 6 7 9 10 12 13 14 15 16 18 19 20
A 2,0. Idade (ano)
B 2,5. 8PD PmH UHVROYHX FDOFXODU R ,0& GH VHX OKR XP
C 3,0. menino de dez anos de idade, com 1,20 m de altura e
D 3,5. 30,92 kg.
Disponvel em: http://saude.hsw.uol.com. Acesso em: 31 jul. 2012.
E 4,0.
Para estar na faixa considerada normal de IMC, os valores
QUESTO 165 mnimo e mximo que esse menino precisa emagrecer,
O gerente de um estacionamento, prximo a um em quilograma, devem ser, respectivamente,
grande aeroporto, sabe que um passageiro que utiliza A 1,12 e 5,12.
seu carro nos traslados casa-aeroporto-casa gasta cerca B 2,68 e 12,28.
de R$ 10,00 em combustvel nesse trajeto. Ele sabe,
C 3,47 e 7,47.
tambm, que um passageiro que no utiliza seu carro nos
traslados casa-aeroporto-casa gasta cerca de R$ 80,00 D 5,00 e 10,76.
com transporte. E 7,77 e 11,77.
MT - 2 dia | Caderno 5 - AMARELO - Pgina 26
*AMAR25DOM27*
QUESTO 167 Considerando as grandezas tempo (em hora), no
O proprietrio de um restaurante deseja comprar um HL[R GDV DEVFLVVDV H HFiFLD GR PHGLFDPHQWR HP
tampo de vidro retangular para a base de uma mesa, SRUFHQWDJHP QRHL[RGDVRUGHQDGDVTXDOpRJUiFR
FRPRLOXVWUDDJXUD que representa tal estudo?

100
90
80

Eficcia (%)
70
60
50
A 40
30
20
10

0 1 2 3 4 5 6 7 8 9 10 11 12 Tempo (h)

Sabe-se que a base da mesa, considerando a borda


100
externa, tem a forma de um retngulo, cujos lados medem 90
AC 105 cm e AB 120 cm. 80

Eficcia (%)
70
Na loja onde ser feita a compra do tampo, existem
60
cinco tipos de opes de tampos, de diferentes dimenses, 50
e todos com a mesma espessura, sendo: B 40
30
Tipo 1: 110 cm u 125 cm 20
Tipo 2: 115 cm u 125 cm 10
Tipo 3: 115 cm u 130 cm 0 1 2 3 4 5 6 7 8 9 10 11 12 Tempo (h)
Tipo 4: 120 cm u 130 cm
Tipo 5: 120 cm u 135 cm
O proprietrio avalia, para comodidade dos usurios, 100
90
que se deve escolher o tampo de menor rea possvel 80
Eficcia (%)

que satisfaa a condio: ao colocar o tampo sobre a 70


base, de cada lado da borda externa da base da mesa, 60
deve sobrar uma regio, correspondendo a uma moldura 50

em vidro, limitada por um mnimo de 4 cm e mximo de C 40


30
8 cm fora da base da mesa, de cada lado. 20
Segundo as condies anteriores, qual o tipo de tampo 10

de vidro que o proprietrio avaliou que deve ser escolhido? 0 1 2 3 4 5 6 7 8 9 10 11 12 Tempo (h)

A 1
B 2
C 3 100
90
D 4 80
Eficcia (%)

70
E 5 60
50
QUESTO 168
D 40
Uma empresa farmacutica fez um estudo da 30

HFiFLD HPSRUFHQWDJHP GHXPPHGLFDPHQWRGXUDQWH 20


10
12 h de tratamento em um paciente. O medicamento foi
administrado em duas doses, com espaamento de 6 h 0 1 2 3 4 5 6 7 8 9 10 11 12 Tempo (h)

entre elas. Assim que foi administrada a primeira dose,


D HFiFLD GR UHPpGLR FUHVFHX OLQHDUPHQWH GXUDQWH  K
DWpDWLQJLUDPi[LPDHFiFLD  HSHUPDQHFHXHP 100

Pi[LPD HFiFLD GXUDQWH  K$SyV HVVDV  K HP TXH D 90


80
HFiFLD IRL Pi[LPD HOD SDVVRX D GLPLQXLU OLQHDUPHQWH
Eficcia (%)

70
DWLQJLQGR  GH HFiFLD DR FRPSOHWDU DV  K LQLFLDLV 60
de anlise. Nesse momento, foi administrada a segunda 50
dose, que passou a aumentar linearmente, atingindo a E 40
30
Pi[LPD HFiFLD DSyV  K H SHUPDQHFHQGR HP 
20
SRU  K 1DV KRUDV UHVWDQWHV GD DQiOLVH D HFiFLD 10
GHFUHVFHX OLQHDUPHQWH DWLQJLQGR DR QDO GR WUDWDPHQWR
0 1 2 3 4 5 6 7 8 9 10 11 12 Tempo (h)
GHHFiFLD
MT - 2 dia | Caderno 5 - AMARELO - Pgina 27
*AMAR25DOM28*
QUESTO 169 QUESTO 171
Alguns equipamentos eletrnicos podem queimar A diretoria de uma empresa de alimentos resolve
durante o funcionamento quando sua temperatura interna apresentar para seus acionistas uma proposta de novo
atinge um valor mximo TM. Para maior durabilidade dos produto. Nessa reunio, foram apresentadas as notas
seus produtos, a indstria de eletrnicos conecta sensores mdias dadas por um grupo de consumidores que
de temperatura a esses equipamentos, os quais acionam experimentaram o novo produto e dois produtos similares
um sistema de resfriamento interno, ligando-o quando a concorrentes (A e B).
temperatura do eletrnico ultrapassa um nvel crtico TC, Nota mdia
e desligando-o somente quando a temperatura cai para 9,0
valores inferiores a Tm 2 JUiFR LOXVWUD D RVFLODomR GD
temperatura interna de um aparelho eletrnico durante as 8,5
seis primeiras horas de funcionamento, mostrando que seu
sistema de resfriamento interno foi acionado algumas vezes.
8,0
Temperatura (C)

7,5
TM

7,0

TC 6,5

6,0
Tm Forma Textura Cor Tamanho Sabor Odor

Proposto A B
A caracterstica que d a maior vantagem relativa ao
produto proposto e que pode ser usada, pela diretoria,
Tempo (h) para incentivar a sua produo a
0 1 2 3 4 5 6
A textura.
Quantas foram as vezes que o sensor de temperatura B cor.
acionou o sistema, ligando-o ou desligando-o?
C tamanho.
A 2
D sabor.
B 3
E odor.
C 4
D 5 QUESTO 172
E 9 O pacote de salgadinho preferido de uma menina
vendido em embalagens com diferentes quantidades.
QUESTO 170 A cada embalagem atribudo um nmero de pontos
3DUD HVWLPXODU R UDFLRFtQLR GH VXD OKD XP SDL IH] na promoo:
o seguinte desenho e o entregou criana juntamente Ao totalizar exatamente 12 pontos em embalagens
com trs lpis de cores diferentes. Ele deseja que a e acrescentar mais R$ 10,00 ao valor da compra, voc
menina pinte somente os crculos, de modo que aqueles ganhar um bichinho de pelcia.
que estejam ligados por um segmento tenham cores Esse salgadinho vendido em trs embalagens com
diferentes. as seguintes massas, pontos e preos:
A B Massa da Pontos da
Preo (R$)
embalagem (g) embalagem
50 2 2,00
100 4 3,60
D C 200 6 6,40
De quantas maneiras diferentes a criana pode fazer o A menor quantia a ser gasta por essa menina que a
que o pai pediu? possibilite levar o bichinho de pelcia nessa promoo
A 6 A R$ 10,80.
B 12 B R$ 12,80.
C 18 C R$ 20,80.
D 24 D R$ 22,00.
E 72 E R$ 22,80.
MT - 2 dia | Caderno 5 - AMARELO - Pgina 28
*AMAR25DOM29*
QUESTO 173
A tabela apresenta parte do resultado de um espermograma (exame que analisa as condies fsicas e composio
do smen humano).

Espermograma
Caractersticas Padro 30/11/2009 23/03/2010 09/08/2011 23/08/2011 06/03/2012
Volume (mL) 2,0 a 5,0 2,5 2,5 2,0 4,0 2,0
Tempo de
At 60 35 50 60 59 70
liquefao (min)
pH 7,2 a 7,8 7,5 7,5 8,0 7,6 8,0
Espermatozoide
> 20 000 000 9 400 000 27 000 000 12 800 000 24 200 000 10 200 000
(unidade / mL)
Leuccito
At 1 000 2 800 1 000 1 000 900 1 400
(unidade / mL)
Hemcia
At 1 000 800 1 200 200 800 800
(unidade / mL)
Para analisar o exame, deve-se comparar os resultados obtidos em diferentes datas com o valor padro de cada
caracterstica avaliada.
O paciente obteve um resultado dentro dos padres no exame realizado no dia
A 30/11/2009.
B 23/03/2010.
C 09/08/2011.
D 23/08/2011.
E 06/03/2012.
QUESTO 174
Admita que um tipo de eucalipto tenha expectativa de crescimento exponencial, nos primeiros anos aps seu
plantio, modelado pela funo y(t) a t  1, na qual y representa a altura da planta em metro, t considerado em ano, e
apXPDFRQVWDQWHPDLRUTXH2JUiFRUHSUHVHQWDDIXQomRy.
y (metro)

32

0,5
0 6 t (ano)
Admita ainda que y(0) fornece a altura da muda quando plantada, e deseja-se cortar os eucaliptos quando as
mudas crescerem 7,5 m aps o plantio.
O tempo entre a plantao e o corte, em ano, igual a
A 3.
B 4.
C 6.
D log2 7.
E log2 15.

MT - 2 dia | Caderno 5 - AMARELO - Pgina 29


*AMAR25DOM30*
QUESTO 175 QUESTO 177
Uma empresa registrou seu desempenho em Para que o pouso de um avio seja autorizado em um
GHWHUPLQDGRDQRSRUPHLRGRJUiFRFRPGDGRVPHQVDLV aeroporto, a aeronave deve satisfazer, necessariamente,
do total de vendas e despesas. as seguintes condies de segurana:
I. a envergadura da aeronave (maior distncia
9
entre as pontas das asas do avio) deve ser, no
8 mximo, igual medida da largura da pista;
7 II. o comprimento da aeronave deve ser inferior a 60 m;
III. a carga mxima (soma das massas da aeronave
6
e sua carga) no pode exceder 110 t.
5 Suponha que a maior pista desse aeroporto tenha
4 0,045 km de largura, e que os modelos de avies utilizados
pelas empresas areas, que utilizam esse aeroporto,
3
sejam dados pela tabela.
2
Dimenses
1 Modelo Carga mxima
(comprimento u envergadura)
0
Jan Fev Mar Abr Mai Jun Jul Ago Set Out Nov Dez
A 44,57 m u 34,10 m 110 000 kg
B 44,00 m u 34,00 m 95 000 kg
Total vendas Despesas
C 44,50 m u 39,50 m 121 000 kg
O lucro mensal obtido pela subtrao entre o total
de vendas e despesas, nesta ordem. D 61,50 m u 34,33 m 79 010 kg
Quais os trs meses do ano em que foram registrados os E 44,00 m u 34,00 m 120 000 kg
maiores lucros?
Os nicos avies aptos a pousar nesse aeroporto, de
A Julho, setembro e dezembro. acordo com as regras de segurana, so os de modelos
B Julho, setembro e novembro. A A e C.
C Abril, setembro e novembro. B A e B.
D Janeiro, setembro e dezembro. C B e D.
E Janeiro, abril e junho. D B e E.
QUESTO 176 E C e E.
Um casal, ambos com 30 anos de idade, pretende QUESTO 178
fazer um plano de previdncia privada. A seguradora
SHVTXLVDGDSDUDGHQLURYDORUGRUHFROKLPHQWRPHQVDO Com o objetivo de trabalhar a concentrao e a
estima a probabilidade de que pelo menos um deles sincronia de movimentos dos alunos de uma de suas
esteja vivo daqui a 50 anos, tomando por base dados da turmas, um professor de educao fsica dividiu essa
populao, que indicam que 20% dos homens e 30% das turma em trs grupos (A, B e C) e estipulou a seguinte
mulheres de hoje alcanaro a idade de 80 anos. atividade: os alunos do grupo A deveriam bater palmas a
cada 2 s, os alunos do grupo B deveriam bater palmas a
Qual essa probabilidade? cada 3 s e os alunos do grupo C deveriam bater palmas
A 50% a cada 4 s.
B 44% O professor zerou o cronmetro e os trs grupos
C 38% comearam a bater palmas quando ele registrou 1 s.
Os movimentos prosseguiram at o cronmetro
D 25%
registrar 60 s.
E 6%
Um estagirio anotou no papel a sequncia formada
pelos instantes em que os trs grupos bateram palmas
simultaneamente.
Qual o termo geral da sequncia anotada?
A 12 n, com n um nmero natural, tal que 1 d n d 5.
B 24 n, com n um nmero natural, tal que 1 d n d 2.
C 12 (n  1), com n um nmero natural, tal que 1 d n d 6.
D 12 (n  1)  1, com n um nmero natural, tal que
1 d n d 5.
E 24 (n  1)  1, com n um nmero natural, tal que
1 d n d 3.

MT - 2 dia | Caderno 5 - AMARELO - Pgina 30


*AMAR25DOM31*
QUESTO 179
Pretende-se construir um mosaico com o formato de um tringulo retngulo, dispondo-se de trs peas, sendo
GXDVGHODVWULkQJXORVUHWkQJXORVFRQJUXHQWHVHDWHUFHLUDXPWULkQJXORLVyVFHOHV$JXUDDSUHVHQWDFLQFRPRVDLFRV
formados por trs peas.

30

46
60
30
90
90 30 90 44
30 30 68
60
68
30
22
30 90 60 90 90 60 30 22 90

Mosaico 1 Mosaico 2 Mosaico 3

30

120
60
50 25
60
90 120
90 30
65 30 60
80 50 65 25 30
Mosaico 4 Mosaico 5

1DJXUDRPRVDLFRTXHWHPDVFDUDFWHUtVWLFDVGDTXHOHTXHVHSUHWHQGHFRQVWUXLUpR
A 1.
B 2.
C 3.
D 4.
E 5.
QUESTO 180
Uma caixa contm uma cdula de R$ 5,00, uma de R$ 20,00 e duas de R$ 50,00 de modelos diferentes. Retira-se
aleatoriamente uma cdula dessa caixa, anota-se o seu valor e devolve-se a cdula caixa. Em seguida, repete-se o
procedimento anterior.
A probabilidade de que a soma dos valores anotados seja pelo menos igual a R$ 55,00
1
A
2
1
B
4
3
C
4
2
D
9
5
E
9

MT - 2 dia | Caderno 5 - AMARELO - Pgina 31


*AMAR25DOM32*

Transcreva a sua Redao para a Folha de Redao.

10

HO
11

12

UN O
C
13

S A
14

A D
15

R RE
16

17

18

19

20

21
DA
22

23

24

25

26

27

28

29

30

LC - 2 dia | Caderno 5 - AMARELO - Pgina 32

Interesses relacionados