Você está na página 1de 109

MANUALPRCTICOPARALAVALORACINDEDAOSAL

DOMINIOPBLICOHIDRULICO
Documento cientficotcnicoparalaaplicacindelrgimensancionador enel
mbitodela Confederacin Hidrogrficadel Cantbrico

Febrero de2009
MANUALPRCTICOPARALAVALORACINDEDAOS AL
DOMINIOPBLICOHIDRULICO
Documentocientficotcnicoparalaaplicacindelrgimensancionadorenel
mbitodelaConfederacin HidrogrficadelCantbrico

ElpresenteinformedenominadoManualprcticoparalavaloracindedaosalDominioPblicoHidrulico.
DocumentocientficotcnicoparalaaplicacindelrgimensancionadorenelmbitodelaConfederacin
HidrogrficadelCantbrico,hasidoencargadoporlaConfederacinHidrogrficadelCantbricoalInstitutode
RecursosNaturalesyOrdenacindelTerritoriodelaUniversidaddeOviedo(INDUROT)enoctubrede2008,dentro
del marco del Convenio Especfico establecido entre el Ministerio de Medio Ambiente y Medio Rural Y Marino
(ConfederacinHidrogrficadelNorte C.H.N.)ylaUniversidaddeOviedo,parael Asesoramientosocioeconmico
yjurdicoalaactividaddelaCHN(CN07136),dentrodel segundo periododeprrrogaconcedidoparaelmismo.

Responsableporpartedela DHC Direccin


DURNCUEVA,Toms LVAREZGARCA,Miguelngel
SecretarioGeneral

Coordinacin
GARCADELAFUENTE,Laura

Autores
GONZLEZLVAREZ, Javier
EconomadelosRecursosNaturalesyelMedioAmbiente
GARCADELAFUENTE,Laura
EconomadelosRecursosNaturalesyelMedioAmbiente

Febrero de2009
NDICEGENERAL

1.INTRODUCCIN.................................................................................................................................... 1
2.METODOLOGAPARALAVALORACINECONMICADEDAOSALDPH ........................................ 5
2.1CONCEPTOSYCRITERIOSTCNICOSAPLICABLESENLAVALORACINDEDAOSALDPH. 5
2.2 INFORMACIN GENERAL SOBRE PRECIOS, VALORES Y COSTES DE REFERENCIA
APLICABLESENELMBITODELACHC ........................................................................................................ 7
2.3MDULOSINTEGRALESDEVALORACINPARAACTUACIONESCOMPLEJAS ....................... 15
2.4VALORACINECONMICADELDAOPORTIPOSDEINFRACCIN ....................................... 17
2.5EJEMPLOSPRCTICOSDEVALORACINDEDAOSALDOMINIOPBLICOHIDRULICO.... 46
3.OTRASCONSIDERACIONES .............................................................................................................. 59
3.1IMPLICACIONESDELANUEVANORMATIVASOBRELOSPRINCIPIOSINSPIRADORESDELA
DIRECTIVAMARCODELAGUA..................................................................................................................... 59
3.2IMPLICACIONESSOBREELBENEFICIODELINFRACTOR......................................................... 62
3.3CRITERIOSECONMICOSQUERIGENLAVALORACINDEDAOSALDPH.......................... 64
3.4CONCLUSIONES .......................................................................................................................... 67
DOCUMENTACINUTILIZADA ............................................................................................................... 69
ANEXO1:VALORESDE LOSCOEFICIENTESDE PONDERACIN........................................................ 71
ANEXO2:DOTACIONES DEVERTIDO. .................................................................................................. 75
ANEXO3:PARMETROS DECONTAMINACINYVALORESDEREFERENCIA. .................................. 77
ANEXO4:DETERMINACINDELATOXICIDAD..................................................................................... 83
ANEXO 5: COSTE DEREFERENCIADEL TRATAMIENTODERESIDUOS ENESTADO LQUIDO O EN
FORMADELODOS. ............................................................................................................................................ 85
ANEXO6:EXPEDIENTES DEINFRACCIONESYACTUACIONESDELPLANHIDROLGICOFORESTAL
ANALIZADAS....................................................................................................................................................... 87
ANEXO7:ACTUALIZACINDEPRECIOS,VALORESYCOSTES.......................................................... 91
ANEXO8:COSTESDEREPOSICINENEXTRACCIONESILEGALESDEAGUA.................................. 95
ANEXO 9: COSTES DE REPOSICIN PARA EXTRACCIONES ILEGALES DE AGUA POR
TRANSFERENCIADIRECTA ............................................................................................................................... 99
NDICEDETALLADO

1.INTRODUCCIN.................................................................................................................................... 1
2.METODOLOGAPARALAVALORACINECONMICADEDAOSAL DPH ........................................ 5
2.1CONCEPTOSYCRITERIOSTCNICOSAPLICABLESENLAVALORACINDEDAOSALDPH. 5
2.2 INFORMACIN GENERAL SOBRE PRECIOS, VALORES Y COSTES DE REFERENCIA
APLICABLESENELMBITODELACHC ........................................................................................................ 7
2.3MDULOSINTEGRALESDEVALORACINPARAACTUACIONESCOMPLEJAS ....................... 15
2.4VALORACINECONMICADELDAOPORTIPOSDEINFRACCIN ....................................... 17
2.4.1Extraccionesilegalesdeagua ................................................................................................ 17
2.4.1.1PrincipalesdaosalDPH ............................................................................................... 17
2.4.1.2Metodologaparalavaloracindedaos ........................................................................ 18
2.4.1.3Precios,valoresycostesdereferenciaparalavaloracindeextraccionesilegalesdeagua
............................................................................................................................................................. 21
2.4.2Extraccinderidosyaprovechamientodematerialessinautorizacin................................... 24
2.4.2.1PrincipalesdaosalDPH ............................................................................................... 24
2.4.2.2Metodologaparalavaloracindedaos ........................................................................ 24
2.4.2.3Precios,valoresycostesdereferenciaparalavaloracindeextraccionesderidosyotros
materialessinautorizacin..................................................................................................................... 25
2.4.3 Obras, destrozos, sustracciones, actuaciones u ocupaciones no autorizadas, incluyendo el
depsitodeescombrosylainstalacindeestructurasmviles .................................................................... 26
2.4.3.1PrincipalesdaosalDPH ............................................................................................... 26
2.4.3.2Metodologaparalavaloracinde daos ........................................................................ 28
2.4.3.3 Precios, valores y costes de referencia para la valoracin de obras, destrozos,
sustracciones,actuacionesuocupacionesnoautorizadas...................................................................... 31
2.4.4Cortadearbolado .................................................................................................................. 32
2.4.4.1PrincipalesdaosalDPH ............................................................................................... 32
2.4.4.2Metodologaparalavaloracindedaos ........................................................................ 32
2.4.4.3Precios,valoresycostesdereferenciaparalavaloracindecortasdearbolado ............. 33
2.4.5Aprovechamientos depastos,arados,siembrasyplantacionesnoautorizadas ....................... 36
2.4.5.1PrincipalesdaosalDPH ............................................................................................... 36
2.4.5.2Metodologaparalavaloracindedaos ........................................................................ 37
2.4.5.3Precios,valoresycostesdereferenciaparalavaloracindeaprovechamientosdepastos,
arados,siembrasyplantacionesnoautorizadas..................................................................................... 38
2.4.6Vertidosdeaguasresidualesyvertidosderesiduosenestadolquidooenformadelodos ..... 39
2.4.6.1PrincipalesdaosalDPH ............................................................................................... 39
2.4.6.2Metodologaparalavaloracindedaos ........................................................................ 39
2.4.6.3Precios,valoresycostesdereferenciaparalavaloracindevertidos.............................. 44
2.4.6.4Normassobretomademuestrasyanlisisdevertidosdeaguasresiduales.................... 44
2.5EJEMPLOSPRCTICOSDEVALORACINDEDAOSALDOMINIOPBLICOHIDRULICO.... 46
3.OTRASCONSIDERACIONES .............................................................................................................. 59
3.1IMPLICACIONESDELANUEVANORMATIVASOBRELOSPRINCIPIOSINSPIRADORESDELA
DIRECTIVAMARCODELAGUA..................................................................................................................... 59
3.2IMPLICACIONESSOBREELBENEFICIODELINFRACTOR......................................................... 62
3.3CRITERIOSECONMICOSQUERIGENLAVALORACINDEDAOSALDPH.......................... 64
3.3.1QurepresentaycmosemideelvalordelosdaosalDPH ................................................. 64
3.3.2ProblemasquepresentaactualmentelavaloracineconmicadedaosalDPH..................... 66
3.4CONCLUSIONES .......................................................................................................................... 67
DOCUMENTACINUTILIZADA ............................................................................................................... 69
ANEXO1:VALORESDE LOSCOEFICIENTESDE PONDERACIN........................................................ 71
ANEXO2:DOTACIONES DEVERTIDO. .................................................................................................. 75
ANEXO 3:PARMETROSDECONTAMINACINYVALORESDEREFERENCIA. .................................. 77
ANEXO4:DETERMINACINDELATOXICIDAD..................................................................................... 83
ANEXO 5: COSTE DEREFERENCIADEL TRATAMIENTODERESIDUOS ENESTADO LQUIDO O EN
FORMADELODOS. ............................................................................................................................................ 85
ANEXO6:EXPEDIENTES DEINFRACCIONESYACTUACIONESDELPLANHIDROLGICOFORESTAL
ANALIZADAS....................................................................................................................................................... 87
ANEXO7:ACTUALIZACINDEPRECIOS,VALORESYCOSTES.......................................................... 91
ANEXO8:COSTESDEREPOSICINENEXTRACCIONESILEGALESDEAGUA.................................. 95
ANEXO 9: COSTES DE REPOSICIN PARA EXTRACCIONES ILEGALES DE AGUA POR
TRANSFERENCIADIRECTA ............................................................................................................................... 99
NDICEDETABLAS

Tabla1.Resumendevalores,preciosycostesdereferenciaparalavaloracindedaosenelmbitodela
CHC..................................................................................................................................................................... 10
Tabla2.Mdulosdevaloracinintegralesporsuperficieacondicionada/restaurada ................................. 17
Tabla3.RangodedotacionesnetasadmisiblesparalosgruposdecultivosenlaDemarcacinHidrogrfica
delCantbrico(enm3/ha/ao)............................................................................................................................... 21
Tabla4.Dotacionesdeaguasuministradaenlitrosporhabitantoteyda ................................................... 22
Tabla5Dotacionesdedemandaparacentralesdeproduccinelctrica(hm3/ao/100MW)....................... 22
Tabla6.Dotacionesdedemandaparalaindustriamanufacturera.............................................................. 23
Tabla7.Preciosderidos(enm3)............................................................................................................. 25
Tabla8.Preciosmediosdelamaderaenpie,enEuros/m3(*)................................................................... 34
Tabla 9. Costes de preparacin y plantacin de especies arbreas segn caractersticas del terreno
(/unidad)............................................................................................................................................................. 35
Tabla10.Importesdelasespeciesvegetalesenvivero(/unidad)............................................................. 36
Tabla11.Costesdeeliminacindelavegetacinarbustivasegncaractersticasdelterreno(/hectrea) . 38
Tabla12.Diferenciasbsicasentre valoreconmicoyelcostedeldaoalDPH........................................ 65
Tabla13.Coeficientesdecircunstanciasespeciales(KX)paraextraccionesilegalesdeagua. .................... 71
Tabla14.Coeficientesdecircunstanciasespeciales(KX)paraelrestodeinfracciones. .............................. 72
Tabla15.Valoresdelcoeficientedereversibilidad(KRV). ........................................................................... 72
Tabla16.Valoresdelcoeficientedesensibilidaddelmedioreceptor(KS). .................................................. 73
Tabla 17. Dotaciones de vertido en litros por habitante y da, segn la poblacin abastecida y el nivel de
actividadcomercial ............................................................................................................................................... 75
Tabla18.ParmetrosdecontaminacinyvaloresdereferenciadelGrupoA:sustanciaspeligrosas........... 77
Tabla19.ParmetrosdecontaminacinyvaloresdereferenciadelGrupoB:contaminantes..................... 80
Tabla20.ParmetrosdecontaminacinyvaloresdereferenciadelGrupo C:otroscontaminantes ............ 81
Tabla 21. Coste de referencia () expresado en euros por tonelada(/t) segn el tipo de residuo: estado
lquidooenformadelodo..................................................................................................................................... 85
Tabla 22. Relacin de expedientes de infracciones consultados para la obtencin de informacin sobre
precios,valoresycostesaplicablesenelmbitodelaDemarcacinHidrogrficadelCantbrico. .......................... 87
Tabla23.Relacindeactuacionesconsultadasparalaobtencindeinformacinsobrecostesdereposicin,
incluidas dentro del Plan HidrolgicoForestal y de restauracinde cauces y encalves naturales del Ministerio de
MedioAmbiente ................................................................................................................................................... 89
Tabla24. ValoresdePresupuestodeEjecucinporlaAdministracinactualizados ................................ 91
Tabla25.Relacindecostestericosdereposicinparalavaloracindedaosporextraccionesdeagua
mediante transferenciadirecta*............................................................................................................................. 99
1. INTRODUCCIN

El sistema sancionador que establece la legislacin bsica en materia de aguas


presentaseriosproblemasrelacionadosconsudiseoyaplicacinenlaprcticaporparte
de la Autoridad Sancionadora del Organismo de Cuenca competente. Entre otras
dificultades,cabedestacar:
Lanormativaalaquesedebeatenderenelprocesosancionadorseencuentra
repartida principalmente en dos normas, el Reglamento del Dominio Publico
Hidrulico(DPH)yelTextoRefundidodelaLeydeAguas(TRLA),alolargode
prescripcionescomplejas,quehantenidountratamientodiversoporpartedela
jurisprudenciayquepresentanproblemasdeproporcionalidadenlatipificacinde
lasinfraccionesylaimposicindelassancionescorrespondientes.
Los principios inspiradores de la Directiva Marco delAgua (DMA) an no estn
recogidosenelrgimensancionador. ElprincipalobjetivodelaDirectivaeslograr
que las masas de agua de agua alcancen un buen estado ecolgico y, por lo
tanto, se hace necesario una modificacin de la normativa sancionadora en
materia de aguas que facilite la consecucin de dicho objetivo, incorporando
criterios ambientales que posibiliten cumplir con los aspectos fsicoqumicos,
biolgicosehidromorfolgicosqueexigelaDMA.
Latipificacindelasinfraccionesestnecesariamenteligada,enlamayorparte
deocasiones,alavaloracineconmicadeldaogeneradoporunadeterminada
actuacinenelDominioPublicoHidrulico.Sinembargo,hastaahoranoexista
ningunanormaqueregulaseyunificaselasmetodologasquesehandeaplicar
paravalorarlosdaoscausadosalDominioPblicoHidrulicoporunainfraccin,
conlosconsiguientesproblemastcnicosyjurdicosqueello supone.
La falta de una articulacin objetiva de criterios para la valoracin de daos
ocasionados al DPH representa una de las mayores dificultades a las que se han
enfrentado los organismos de cuenca en materia sancionadora. Razones evidentes de
seguridadjurdicaygarantaparaunaeficazproteccindelrecurso,impelenadisponerde
unametodologaapropiadayuniformequepermitaunaadecuadavaloracindelosdaos
causados al DPH. Para dar solucin a este problema, y en base a lo dispuesto en el

1
INDUROT.UniversidaddeOviedo

artculo326.1delReglamentodelDominioPblicoHidrulico1sehaaprobadolaOrden
MinisterialMAM/85/2008(de16deEnero)porlaqueseestablecenloscriteriostcnicos
paralavaloracindelosdaosalDPH,ascomolasnormassobretomademuestrasy
anlisisdevertidosdeaguasresiduales.
Dichanormacontiene,entreotrascosas,losprocedimientosvalorativosaaplicaren
lavaloracindedaosalDPHenfuncindelanaturalezadelasactuaciones,dandouna
relevancia mayor que hasta el momento a los aspectos ambientales y el estado de
conservacin y proteccin de las zonas afectadas. Como principales novedades que
aportaestanormaestnlaobligatoriedaddevalorardaosapreciosdemercadoreales,
decontabilizarloscostesdelarestauracinambientalqueseannecesarios paradevolver
elDPHaunaestadolomscercanoposiblealoriginalylaobligatoriedaddeincrementar
las valoraciones mediante la aplicacin de coeficientes de mayoracin que ponderen la
mayorsensibilidadyvalornatural delmedioafectado.
Laaplicacindelosnuevoscriteriosdevaloracineconmicadesarrolladosporla
OO.MM. MAM/85/2008 supondrlanecesidadderealizarcambiosrespectoalosmtodos
de valoracin utilizados hasta ahora por los Organismos de Cuenca. Por un lado, por
primera vez se establece la obligacin de valorar los costes de las medidas de
restauracin ambiental que, en su caso, se consideren necesarios. Por otro lado, y
tambinellosuponeunanovedadrespectoalosmtodosaplicadoshastaahoraporlos
Organismos de Cuenca, se deben determinar los valores de tres coeficientes
ponderadoresdeldao relacionadosconlasensibilidadygradodeproteccindelmedio
afectadoyconeltiempoestimadodereversibilidaddeldaocausado.
Finalmente, es preciso sealar algunas dificultades y carencias que se han
detectado alanalizarcondetenimientola OO.MM. MAM/85/2008:
Seconsideranecesarioprofundizarenlainterpretacinyaplicacinprctica
delosnuevospreceptosde la OO.MM, especialmentecuando dichospreceptos
difierensensiblementedeaquellosaplicadostradicionalmenteporlosOrganismos
deCuenca.
Una parte de los nuevos criterios no resultan adecuados desde una ptica
econmica yaque,aunquesupuestaenprcticaagilizayhomogenizaelproceso
valorativo, los conceptos a valorar no representan el valor econmico real del
dao, sino que conducen a cuantificaciones monetarias de otra ndole (por
ejemplo,alutilizarpreciosdemercadodelamadera oridosparavalorardaos).
A pesar de que la nueva normativa establece los conceptos que se deben
incorporar a partir de ahora en la valoracin econmica, sta no establece
valores,preciosycostesdereferenciaaplicableseneldesarrolloprcticode
dichasvaloraciones.
En virtud de todo lo anterior, los captulos siguientes componen un Manual
Prctico elcual simplifica lapuestaenprcticadelosnuevospreceptos incorporados
por la OO.MM MAM/85/2008 indicando aquellos que presentan dudas en cuanto a su
adecuacin,facilitasuaplicacinporpartedelostcnicosdelorganismodecuencay

1 El artculo 326.1 del RDPH establece que La valoracin de los daos al dominio pblico

hidrulicoserealizarporel rganosancionador.A talefecto, ysinperjuiciodelascompetenciasdelas


juntasdeGobierno,elMinisteriodeAmbienteestablecerloscriteriostcnicosparasuvaloracin.

2
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

proporciona valores, precios y costes de referencia aplicables al proceso


sancionadorenelmbitodela Confederacin HidrogrficadelCantbrico2.
Para la realizacin de este documento se ha acudido a distintas fuentes, tanto
documentos e informacin publicada como documentacin proporcionada por la propia
CHC. Adems, se han utilizado como referencia y base trabajos previos del INDUROT
llevados a cabo para la Confederacin Hidrogrfica del Norte relacionados con la
valoracin de daos al DPH. Estos proyectos previos han sido: Ensayo de valoracin
segn los criterioscontenidos en el proyecto de Orden Ministerial para lavaloracin de
daosalDPH (2007) Desarrollodeunametodologaparalavaloracin dedaosalDPH
ydeotroscriteriosparamejorarlaaplicacindedelrgimensancionadorenmateriade
aguas (2006) Avance metodolgico sobre la valoracin de daos en el DPH por
derivacionesyextraccionesdeagua (2005).

2 Sinperjuiciodequeotroscriteriosgeneralesoespecficospuedansercontempladosporelrgano

instructorcuandolascircunstanciasaslorequieran.

3
2. METODOLOGA PARA LA
VALORACIN ECONMICA DE
DAOSALDPH

2.1 CONCEPTOS Y CRITERIOS TCNICOS


APLICABLESENLAVALORACINDEDAOSAL DPH

Como se ha comentado anteriormente, el Reglamento del Dominio Pblico


Hidrulico,aprobadoporelRealDecreto849/1986de11deabril ,estableceloscriterios
paralacalificacindelasinfraccionesalDPH,fijando,enlamayoradeloscasos,unode
carcter objetivo para graduar las infracciones en funcin del valor de los daos
ocasionadosaldominiopblicohidrulico.Delmismomodo,enelartculo326.1delRDPH
se indica que la valoracin de los daos se realizar por el rgano sancionador,
habilitando al Ministerio de Medio Ambiente y Medio Rural y Marino (MARM) para
establecerloscriteriostcnicosparasudeterminacin.
En base a lo dispuesto en este artculo, el MARM ha aprobado la Orden
MAM/85/2008, de 16 de enero , por la que se establecen los criterios tcnicos para la
valoracindedaosalDPH,ylasnormassobretomademuestrasyanlisisdevertidos
deaguasresiduales.Estoscriteriosseaplicarnsinperjuiciodelascompetenciasdelas
Juntas de Gobierno de los organismos de cuenca para la determinacin de las
indemnizacionespordaosyperjuicios,enaplicacindeloprevistoenelartculo28.j)de
laLeydeAguas3.
Entre los criterios generales introducidos por esta nueva norma, cabe destacar,
comonovedadesprincipales,laobligacindecontabilizarloscostesdelarestauracin
ambientalqueseanecesariaparadevolverelDPHaunaestadolomscercanoposibleal

3 Elartculo28.j)delaLeydeAguasatribuyealajuntadeGobiernodelosorganismosdecuencala

funcindeaprobar,ensucaso,criteriosgeneralesparaladeterminacindelasindemnizacionespordaos
y perjuiciosocasionadosaldominiopblicohidrulico.

5
INDUROT.UniversidaddeOviedo

original, y la de incrementar las valoraciones mediante la aplicacin de coeficientes de


mayoracin que ponderen la mayor sensibilidad y valor natural del medio afectado. De
estemodo,lavaloracintotaldedaosalDPHseobtendrapartirdelasumadelvalor
econmicodelDPHafectadoydeloscostesderestauracinambiental,ponderadaporla
aplicacindeloscoeficientessegnlatrascendenciarealdelaafeccin:

Valor del dao=[VDPH x Kx ] + [CRA x KRV x KS ]

Donde:
VDPH eselvaloreconmico,eneuros,delDominioPblicoHidrulicoafectado
KX es un coeficiente adimensional que recoge las especiales circunstancias del
estadodelDominioenelmomentodecometerselainfraccinyque,exceptopara
los casos de extracciones ilegales de agua, est relacionado con la afeccin
causadaalascomunidadesvegetales.
CRA eselcostedelasmedidasderestauracinambientalquerestituyanelDominio
PblicoHidrulicoaunestadolomscercanoposiblealoriginal.
KRV esuncoeficientequeponderaeltiempoquetardarenrecuperarelDominio
PblicoHidrulicosuestadooriginal,enloscasosenqueseaposible.
KS es el coeficiente que refleja la sensibilidad e importancia del medio receptor
donde secomete la infraccin. En el caso de que elmedio receptor tenga varias
clasificacionesasignadas,seutilizarel KS msalto.

Esta frmula de valoracin de daos se aplicar de forma general a todas las


infraccionesenqueasloexijalanormativa,exceptoalasinfraccionesporvertidos
de aguas residuales o residuos en estado lquido o en forma de lodos. Dado el
potencial de este tipo de infracciones para trastornar, degradar o incluso eliminar las
formasdevidavinculadasalmedioacuticoyponerenpeligrolasaludhumana y lasalud
pblicalaOrdenMAM/85/2008estableceunametodologadecalculoespecficapara
calcularelvaloreconmicodelos impactosnegativosgeneradosporestetipode
actuaciones. Dichametodologasedescribe enelapartado2.4.6.
Las tablas con los valores que han de tomar los coeficientes de ponderacin
aparecen detalladas en el Anexo 1. En los siguientes apartados se especificarn la
metodologa de clculo para obtener el valor econmico del dao al DPH para cada
tipologadeinfraccin,ascomolosprecios,valoresycostesdereferenciaaplicablesal
procesosancionadorenelmbitodelaCHC.

6
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

2.2 INFORMACIN GENERAL SOBRE PRECIOS,


VALORES Y COSTES DE REFERENCIA APLICABLES
ENELMBITODELACHC

La presente seccin contiene una recopilacin y descripcin de la informacin


necesariasobreprecios,valoresycostesaaplicarparallevaracabolasvaloracionesde
daosalDPH(incluyendoelcostedelasmedidasderestauracinambiental),deacuerdo
conloscriteriosestablecidosporla OOMMMAM/85/2008.
Esimportanteresaltarque,lagrandiversidaddeposiblesinfraccioneseimpactos
derivadossobreelDPH,haceimposibleunarelacinexhaustivadevaloresqueengloben
latotalidaddelasactuacionesnecesariasparallevaracabounacompletavaloracinde
daos quecontempletodaslasposiblesinfracciones.
Con el objetivo de identificar las infracciones y actuaciones de restauracin
ambientalmscomunesenelmbitodelaCHCyfacilitarlaelaboracindeunarelacin
deprecios,valoresycostes derivadosdedichasactuaciones,sehananalizadotrabajosy
estudiospreviosdevaloracindedaosalDPH extrayendo informacinreferentea:
Losresultadosdeunestudio4 enelquesellevacabounensayodevaloracin
econmica de los daos al DPH segn los nuevos criterios establecidos por el
proyectodelanuevaOrdenMinisterial(proyectoendesarrolloquefinalmenteha
resultado en la Orden MAM/85/2008). Dicho estudio analiz una muestra de24
expedientes sobre actividades infractoras en el mbito de la Confederacin
Hidrogrfica del Norte (el Anexo 6 contiene una relacin de los expedientes
infractoresanalizados).
Se ha revisado otra muestra de 16 actuaciones pertenecientes al vigente Plan
HidrolgicoForestal y de restauracin de cauces y enclaves naturales5,
localizadasenlasCC.AA.deAsturiasyGalicia(elAnexo6contieneunarelacin
de las actuaciones contempladas). Dichas actuaciones estn destinadas, con
carctergeneral,alacondicionamientodelasmrgenesfluviales,larecuperacin
ambientaldelentornodelosrosyelacondicionamientodelentornofluvialparael
usopblico.
Metodologasdevaloracindedaosparainfraccionesespecficas(derivaciones
y extracciones ilegales de agua) analizadas en diversos informes y trabajos
previos6.

4 Muestra de expedientes infractores extrada del proyecto del INDUROT. Ensayo de valoracin

segn los criterios contenidos en el proyecto de Orden Ministerial para la valoracin de daos al DPH.
Asturias,200762p.
5 RelacindeactuacionesextradadelproyectodelINDUROT.Desarrollodeunametodologapara

lavaloracindedaosalDPH ydeotroscriteriosparamejorarlaaplicacindelrgimensancionadoren
materiadeaguas. Asturias,2006229p.
6 INDUTOT. Avance metodolgico sobre la valoracin de daos en el DPH por derivaciones y

extraccionesdeagua.Asturias,200519p.INDUROT.Propuestadecriteriosdevaloracinparaelclculo
delosdaosalDPHporextraccionesyderivacionesdeaguasinconcesinoautorizacin,enelmbitode
laCHN. Asturias,20066p.

7
INDUROT.UniversidaddeOviedo

Unavezestablecidaslasinfraccionesyactuacionesmshabitualesenelmbitode
laCHC,sehaprocedidoalaestimacindedichosvalores,procesoduranteelcualseha
acudido a diversas fuentes en funcin de lo estipulado en la normativa vigente y la
idoneidaddelainformacinpara cadacasoconcreto:
1. Paraaquellosconceptosenqueasloexigelanormativa7,loscostesovaloresa
aplicar se han tomado directamente de documentacin proveniente de la
Confederacin Hidrolgica del Cantbrico, indicando su procedencia segn
aparecenalolargodelossiguientesapartados(porejemplocnonesdelaCHC,
etc.)
2. De igual forma, en aquellos supuestos o infracciones en que as lo exija la
normativa, se han tomado precios de mercado o valores provenientes de
estadsticasoficiales. Estos precios son de aplicacin directa y nonecesitan de
ninguna otra consideracin ms que su actualizacin a precios de mercado del
momentoenquesedetectelainfraccin(todoslospreciospresentadoseneste
documentohansidoactualizadosaEurosde2009).
3. Finalmente, para los supuestos donde el clculo del valor econmico deriva de
actuacionesllevadasacaboporelOrganismodeCuenca,los preciosymdulos
decosteunitariosutilizadoshansidoobtenidosapartirdelastarifasoficiales
de los propios medios de la Administracin cumpliendo as adems con la
normativa vigente en cuanto a la estimacin de los costes de restauracin
ambiental8.Losvaloresfinalesquesepresentanrespondena Presupuestosde
ejecucinporlaAdministracin ,segninstruccionesdeaplicacindetarifas
delpropioGrupoTRAGSA.Ellotienelassiguientesimplicaciones:
o Enelcasodeaplicacindepreciosdeejecucinporunidaddeobra,las
cuantas incluyen ya los correspondientes costes indirectos (del 1 del
2.5%,segnelcaso).Enelcasodeaplicacindepreciossimples,seha
procedidoaimputarloscitadoscostesindirectos.
o Paraobtenerel Presupuestodeejecucinmaterial sehaaplicadoa
loscostesdeejecucin(preciosporunidadesdeobra),un1%derecargo
en concepto de costes de control de calidad. Posteriormente, para
obtener el Presupuesto de ejecucin por la Administracin, se ha
incrementadoelprimeroenun4%enconceptodegastosgeneralesyse
haaplicadofinalmenteun16%deIVA.
o Loscostesdefuncionamientodelamaquinariaincluyenlamanodeobra
requerida.
o Noseaplicantasasdereplanteonidireccindeobra.
SloenalgncasopuntualenquelastarifasTRAGSAnocontenanlainformacin
requerida,seharecurridoaaplicarpreciosdemercadode otrasfuentes:

7 La OO.MM MAM85/2008 establece que determinados costes sern los que establezcan el

organismo de cuenca competente, a travs del Plan Hidrolgico correspondiente u otros estudios
econmicosyfinancieros..
8 LaOO.MMMAM85/2008,ensuArticulo3CaptuloII,disponequeparacalcularloscostesde

restauracinambiental(CRA)lasunidadesdeobraenlasqueestasfasessedescompongansebasarn
enlastarifasoficialesdelos mediospropiosdelaadministracin

8
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

o TarifasdelaBasedepreciosPaisajismo2005.Ingenierayarquitectura
del paisaje9, consultadas para obtener costes de determinados
suministros como especies vegetales, semillas, tierra vegetal, mallas
vegetalesolaboresespecficascomohidrosiembras,etc.(actualizadosa
Eurosde2009).
o Precios de mercado 2006 de la madera en pie, segn estadsticas de
SADEI10 (actualizadosaEurosde2009).

La Tabla 1, dispuesta a continuacin, contiene un resumen de los valores,


preciosymdulosdecosteunitariosaplicablesalavaloracindedaosalDPHde
acuerdoalaactualnormativavigenteyagrupadossegnlatipologadeldaoalDPH.
Losdaos ocasionadosen la calidad delaguaporvertidosodescargaspuntualeshan
sido excluidos de dicho resumen, ya que la valoracin de dichos daos sigue una
metodologa de clculo especfica y distinta de las dems infracciones, como ya se ha
mencionadoanteriormente.
Dada la diversidad de clculos llevados a cabo para obtener los valores
presentadosacontinuacin,resultaconvenientehacerlassiguientesaclaraciones:
Todos los valores han sido actualizados a precios de 2009, en funcin de la
variacindelIPC(Anexo7).
Paraaquellosvaloresenlosqueesnecesario,sehaprocedidoaimputartantolos
costes indirectos como los incrementos para lograr precios de Presupuesto de
ejecucinporlaAdministracin (Anexo7).
Sehanelaboradounaseriedeprecioscompuestosparafacilitarlavaloracinde
daossegneltipodeinfraccin,basadostantoenpreciossimplescomoprecios
deejecucin. .
Una descripcin ms detallada de los precios, valores y costes aplicables por
cadatipodeactuacinpuedeversealolargodelossiguientesapartados.

9 DehesadelaJara,S.L. BasedepreciosPaisajismo2005.Ingenierayarquitecturadelpaisaje(6
Edicin),conelpatrociniodelaAsociacinEspaoladeParquesyJardinesPblicos.Madrid,2005345p.
10 SociedadAsturiana de Estudios Econmicos eIndustriales (SADEI).CuentasEconmicasdela

AgriculturaAsturiana2006. 2006[ref.de15deEnero2009].DisponibleenWeb http://www.sadei.es

9
INDUROT.UniversidaddeOviedo

Tabla 1. Resumendevalores,preciosycostes dereferenciaparalavaloracindedaosenelmbitodelaCHC.


ValoracineconmicaDPHafectado(VDPH) MedidasRestauracinAmbiental(CRA) Observaciones
Infraccin
Unidad de Unidadde
Costescontemplados Valores CostesContemplados Valores
coste coste

Trasvase 0.30 0.38 m3


Dichoscostesaparecen
Daosporextraccioneso 0.28XVolumen especificadosms
PreciounitariodelaguaXVolumenagua m3 Recargaartificial 0.06 0.13 m3
derivacionesilegalesdeagua deagua detalladamentealolargo
extrada delmanual
Transferenciadirecta 0.01 0.0311 m3

Loscostesdeadquisicindelosmaterialesyahansido

contempladosalcalcularelVDPH
Estasmedidasslosern
Daosporextraccinde necesariascuandola
Costedeadquisicindematerialessimilaresalosextrados
ridosyaprovechamientode magnituddelimpacto
delro X Volumendematerialesextrados Ver Tabla 7 m3
materialessinautorizacin hagaimprobablequeel
Cargay Transportedematerialessueltospor ropuedareponersepor
carreterasenbuenascondiciones,ysinlimitacinde suspropiosmedios
6.11 m3
tonelaje,aunadistanciadehasta30km, incluidoel
retornoenvacoy lostiemposdecargaydescarga*

Enelcaso dequelaextraccinhubieracausadootros Estasmedidasvariarn


daos,loscostesdelasactuacionesparala en funcindelaafeccin
restauracinambientaldelaszonasafectadas alDPH

11 Dichos costes se refieren a la adquisicin de agua obtenida enun sistema alternativo. Habra que sumarles los costes detransporte (Coste estimado de alquiler de camin

cisternaconcapacidadpara10.000litrosyconductor46,20/hora).UnatablaconloscostesestimadosparalareposicindeaguaporTransferenciadirectatabuladosporcantidadde
aguaykilmetrosdetransportepuede verseenAnexo9.

10
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

ValoracineconmicaDPHafectado(VDPH) MedidasRestauracinAmbiental(CRA) Observaciones


Infraccin
Unidad de Unidadde
Costescontemplados Valores CostesContemplados Valores
coste coste

Enlamayoradeloscasosdeinfraccionespor
Destrozos:Costesderivadosdelareparacindelosbienes destrozosysustracciones,noesnecesarioponeren

afectadoscostesdesustitucindeelementosdaados prcticamedidasderestauracinambientalmsallde
reponerloselementosafectados
DaosporDestrozosy
Sustracciones Sustracciones:Costeadquisicinelementomisma
Enlamayoradeloscasosdeinfraccionespor
antigedadcosteadquisicinelementonuevosimilaral
destrozosysustracciones,noesnecesarioponeren
sustrado,reducidoenunaproporcinequivalenteala
prcticamedidasderestauracinambientalms allde
fraccindevidatilquehubieraconsumidoelbien
reponerloselementosafectados
sustrado.

Restitucintopogrfica
delcauceconmedios 69.33 horas
mecnicos
Lasmedidasde
Laboreosuperficialde restauracinambiental
Encasode depsitodeescombros:Retiradade 210.35 ha dependerndelimpacto
Daosprovocadospor Acondicionamientoy mrgenes
InvasionesyOcupaciones escombrosconmediosmecnicos,incluidalacargadelos restauracindelosterrenos generadoporlaactuacin
10.11 m3
materialesretiradosencaminytransporteparasu depsito invadidosporlosdepsitos. Extendidomanualde infractora.Notodaslas
enlugarautorizado,sinincluircnonesavertedero* 17.05 m3 infraccionesnecesitarn
Estasactuacionespueden tierravegetal*
incluir: delaaplicacindetodas
Siembramanual12 70.12 ha estasmedidas.

Plantacinespecies
2.87 13.1014 unidad
arbreas13*

12 AdichocostehayqueaadirelcostedeadquisicindelKg.DeMezcladeSemillasPratenses utilizado(4,74 /Kg.)


13 Alcostedeplantacinhayqueaadirelcostedeadquisicindecadaplantn (Ver Tabla 10)
14 Elcosteaaplicardependerdeltipodesuelo,densidadypendiente (Ver Tabla 9 )

11
INDUROT.UniversidaddeOviedo

ValoracineconmicaDPHafectado(VDPH) MedidasRestauracinAmbiental(CRA) Observaciones


Infraccin
Unidad de Unidadde
Costescontemplados Valores CostesContemplados Valores
coste coste

Retiradadelramajeycarga
97.32 Horas
paratransporte*
Encasodedepsitode
ramajeytroncos: (retirada Lainfraccinpordepsitoderestosderamajey
deramajeycargaen troncosnosuelenecesitardemedidasderestauracin
camin+transportea lugar Transporterestosvegetalesen ambiental.
autorizado) caminvolquete gra101130
1.84 Km.
C.V.(incl.manodeobra)sin
canon

Daosprovocadospor
InvasionesyOcupaciones
Penrgimengeneral 18.23 Horas

Depsitode chatarras y
Generalmente,paraestetipode infraccionesnoes
otrosmaterialesde
necesarioponerenprcticamedidasderestauracin
pequeasdimensiones
ambiental.Encasodesernecesario,sellevarna
(retiradadedepsitos+
Retiradade basurasen cabolasmedidaspertinentesdentrodelasexpuestas
transportealugar 416.88
vehculotodoterrenoy paralossupuestosdedepsitodeescombros.
autorizado) Jornadadetrabajo
recorridomediode150Km.
hastalugarautorizado

12
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

ValoracineconmicaDPHafectado(VDPH) MedidasRestauracinAmbiental(CRA) Observaciones


Infraccin
Unidad de Unidadde
Costescontemplados Valores CostesContemplados Valores
coste coste

Retiradadelasobrasycarga Restitucintopogrfica
Pequeasobrasde encaminparasutransportea 122.39 horas delcauceconmedios 69.33 horas
encauzamiento, lugarautorizado* mecnicos
entubaciones,azudes,
etc. (retiradadelasobras y
caminparacarga+ Transportederestosdeobraa
transportealugar vertederoautorizado,en Laboreosuperficialde
autorizado) 1.75 Km. 210.35 ha Lasmedidasde
camin101130C.V.(incluye mrgenes
manodeobra),sincanon Acondicionamientoy restauracinambiental
restauracindelosterrenos dependerndelimpacto
Daosprovocadosporobras, afectadosporlasobras. generadoporlaactuacin
trabajosyconstrucciones Estasactuacionespueden infractora.Notodaslas
Para construccionessimples:Lavaloracindeldao incluir:
econmicodelDPHafectadoincluyelademolicindelas Extendidomanualde infraccionesnecesitarn
32.12 84.80 m3 17.05 m3 delaaplicacindetodas
obras,sucargaencaminysutransportehastavertederoo tierravegetal*
lugarautorizado* estasmedidas.

Capataz 27.01 horas Siembramanual15 70.12 ha


Otroselementosque
puedensernecesariospara Penrgimengeneral 18.23 horas
Plantacinespecies
laeliminacindelasobras 2.87 13.1017 unidad
arbreas16*
Dumperdeobra,1.500 30.25 horas

15 AdichocostehayqueaadirelcostedeadquisicindelKg.DeMezcladeSemillasPratensesutilizado (4,74 /Kg.)


16 Alcostedeplantacinhayqueaadirelcostedeadquisicindecadaplantn (Ver Tabla 10)
17 Elcostea aplicardependerdeltipodesuelo,densidadypendiente(Ver Tabla 9)

13
INDUROT.UniversidaddeOviedo

ValoracineconmicaDPHafectado(VDPH) MedidasRestauracinAmbiental(CRA) Observaciones


Infraccin
Unidad de Unidadde
Costescontemplados Valores CostesContemplados Valores
coste coste

Siesnecesario,se
DaosporTalasdearbolado rbolestaladosXValordelosmismos VerTabla 8 m3 Plantacinespeciesarbreas18* 2.87 13.1019 unidad aadirelcostede
laboresdemantenimiento
delasplantaciones

El aprovechamientonoautorizadodepastos
Aprovechamientosno ValormediodelaprovechamientoXndehectreas
ha generalmentenonecesitademedidasderestauracin
autorizadosdepastos indebidamenteutilizadas
ambiental

Vegetacin:Rozaselectivay 767.34 ha
manualdematorral (Tabla 11)
Cuandoseanecesario, Extendidomanualdetierra 17.05 m3
habrquellevaracabo vegetal* Dichasactuacionessern
Costesdeeliminacin rboles:Taladodelrbol, unarestauracin necesariascuandolas
DaosporPlantaciones, delaplantacin,costes troceado,extraccindeltocn, consistenteenel plantacionesosiembra
siembrasylaboresdearado deretiradamateria cargaderamasyrestode 31.96 50.30 unidad acondicionamientodel llevenasociadaslabores
noautorizadas vegetalysutransporte materialesyrellenoycompactado terreno ylaboresde delimpiezaqueimpliquen
hastalugarautorizado delhueco* siembraparafacilitarla laeliminacinderazde
recuperacindecubierta lacubiertavegetal
vegetalautctona autctona.
Siembramanual20 70.12 ha
Transporte restosvegetalesen
caminvolquetegra101130 1.84 Km.
C.V.(incl.manodeobra)

*Precioscompuestoselaborados paraestemanualarazdepreciossimplesypreciosdeejecucin

18 Alcostedeplantacinhayqueaadirelcostedeadquisicindecadaplantn (Ver Tabla 10)


19 Elcosteaaplicardependerdeltipodesuelo,densidadypendiente (Ver Tabla 9)
20 AdichocostehayqueaadirelcostedeadquisicindelKg.deMezcladeSemillasPratensesutilizado (4,74 /Kg.)

14
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

2.3 MDULOS INTEGRALES DE VALORACIN PARA


ACTUACIONESCOMPLEJAS

Lavaloracineconmicadeinfraccionesdegranenvergadura,lascualesgeneran
grandes daos sobre el DPH, es especialmente complicada dado el gran nmero de
actuacionesquehabrandesercontempladas.Estoesparticularmenteciertoalahorade
valorar daos por grandes obras, trabajos y estimar los costes de actuaciones de
restauracinambiental complejas.
Como consecuencia, este Manual ofrece una segunda opcin alternativa para
calcular los costes de dichas actuaciones: estimar los costes a travs de mdulos
integrales de valoracin por unidad de superficie a acondicionar o restaurar. Llevar a
cabo a cabo la valoracin utilizando estos mdulos integrales agiliza el proceso
valorativo,alevitartenerquevalorarunelevadonmerodeaspectos.Adems,alestar
elaborados a partir de rangos de costes medios por unidad de superficie, eliminan la
posibilidad de no incluir algunas de las actuaciones necesarias en el proceso de
valoracindedaos.
Enestesentido,laaplicacindeestosmdulosintegralesdevaloracinpuedeser
preferible auna valoracinconceptoaconcepto conloscostesprocedentesdela Tabla 1,
ya que los mdulos contienen una amplia gama de intervenciones. En sntesis, la
aplicacindeloscostesrecogidosenla Tabla2 esrecomendableenlasvaloracionesde
daosasociadasa:
Con carcter general, a cualquier tipo de infraccin por obras, trabajos y
construccionesdegranenvergadura,queafecteaunasuperficieoauntramo
fluvial muy extenso, y que genere un amplio abanico de efectos negativos de
significativa gravedad, que requieran una intervencin integral por parte del
OrganismodeCuenca.
La estimacin del coste de las medidas de restauracin ambiental para
cualquiertipodeactuacininfractora quegenereungranimpactoenelDPH,y
necesite de una restauracin ambiental integral, con un gran nmero de
actuacionesdiferentesydegranenvergadura.
Paralaobtencindelosmdulosintegralesdevaloracin,sehananalizadoparte
delosexpedientesdeinfraccionesdelproyectoEnsayodevaloracinsegnloscriterios
contenidos en el proyecto de Orden Ministerial para la valoracin de daos al DPH,
analizandoloscostesasociadosagrandes obrasy restauracionesambientalescomplejas.
Tambinsehaanalizadoinformacinobtenidadirectamenteapartirdeloscostes
deproyectosderestauracinhidrolgicoforestalycorreccinhidrulicaejecutadasporla
propiaCHN,concretamenteuna muestrade16 actuacionespertenecientesalvigentePlan
HidrolgicoForestalyderestauracindecaucesyenclavesnaturales.Estasactuaciones
estndestinadas,concarctergeneral,alacondicionamientodelasmrgenesfluviales,la
recuperacinambientaldelentornodelosrosyelacondicionamientodelentornofluvial
para el uso pblico. Para el clculo de los mdulos, se ha realizado un anlisis de los

15
INDUROT.UniversidaddeOviedo

costesquesedesprendendeestetipodeactuaciones.Losprincipalescriteriosseguidos
paralaseleccinyanlisisdedichas actuaciones son:
Se hananalizado sloactuacionesyafinalizadas.
Seincluyenloscostesdelasobrascomplementariasquepuedanhaberexistidoy
delosmodificadosdelproyectooriginal,ascomolosderivadosdelasasistencias
tcnicas para la redaccin de los proyectos o la direccin de las obras cuando
existieran.
Seexcluyenloscostesderivadosdelasexpropiacionesdeterrenos,yaqueloque
se persigue en el presente estudio es conocer exclusivamente costes de
restauracin y reposicin del DPH deteriorado o afectado por desequilibrios
importantesdeladinmicafluvial.
LoscostesincluyenIVAybeneficioindustrial.
No se han atendido a cuestiones relacionadas con la financiacin de las
actuaciones desarrolladas, ya que la perspectiva del estudio persigue el
conocimientodeloscostesderivadosdelarestauracindeaquellasaccionesque
daan o degradan el DPH, independientemente de qu Administracin Pblica
sufragadespusesegasto.
Portanto,comoresultadosehaobtenidoinformacinacercadeloscostesreales
finalesderivadosdelacompletaejecucindeobrasyactuacionesdestinadasarestaurar
yacondicionar elDPH ylaszonasasociadasentrelosaos2003y2005.
Todaslasactuaciones(tantolosexpedientesdeinfraccionescomo losproyectos de
restauracin hidrolgicoforestal), combinan en diferente proporcin varios tipos de
acciones,segnlascaractersticasyproblemtica concretadecadazonadeintervencin.
Una breve descripcin de las acciones/infracciones contempladas se presenta a
continuacin:
Obras,trabajosyconstruccionesencaucesyriberas:medidasdestinadasa
la eliminacin de obras como excavaciones, rellenos de tierra, mampostera,
muros, escolleras, canales, compuertas, azudes, encauzamientos, trabajos de
hormigonado,etc.
Restauracin ambiental y forestal: medidas de restauracin ambiental, las
cuales incluyen adecuacin de terrenos, riegos, trabajos de jardinera,
tratamientosdetaludes,hidrosiembras,plantaciones,etc.

El modulo integral de valoracin para obras, trabajos y construcciones ser de


aplicacinparaelclculodelvaloreconmicodelDPHafectado(VDPH)mientrasqueel
mdulodecosteporunidaddesuperficierestauradaseaplicarparacalcularelcostede
lasmedidasderestauracinambiental(CRA).

Conelobjetodelograrmdulosintegralesdevaloracinporunidaddesuperficie
adecuada,sehaatendidotambinalainformacinacercadesuperficiesacondicionadas
concadaactuacin.Finalmente,losvaloresobtenidoshansidoactualizadosapreciosde
2009. Como resultado se han obtenido los siguientes rangos de precios y costes
medios:

16
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Tabla 2. Mdulosdevaloracinintegralesporsuperficieacondicionada/restaurada
RANGODE
TIPODEACTUACINY UNIDADES COSTE VALORES OBSERVACIONESSOBRE
MAGNITUDDEREFERENCIA DECOSTE MEDIO MS VALORESATPICOS
FRECUENTES

Costedelas actuaciones
Costesen tornoa150 /m2 cuando
destinadasa la eliminacindelas Entre6.44y
euros/m2 13.78 setratadegrandesconstrucciones
obras respectoala superficie 37.50
comoviviendas/edificaciones.
acondicionada

Costedelas actuacionesde
Costescercanosalos30 /m2
restauracinambientalyforestal Entre3.75y
euros/m2 11.81 cuandolarestauracinincluye
respectoala superficie 22.21
materialdeprstamos.
restaurada21

Fuente:Elaboracinpropia

2.4VALORACINECONMICADELDAOPORTIPOS
DEINFRACCIN

2.4.1Extraccionesilegalesdeagua

2.4.1.1 PrincipalesdaosalDPH
Lasinfraccionesrelativasaderivacionesoextraccionesdeaguapuedentenerdos
orgenes:
Puedenserfrutodevulnerarlascondicionesimpuestasenunaconcesino
autorizacinadministrativaprevia(porejemplo,sobrepasarloslmitesdecaudal
o volumen de extraccin autorizado, no dejar fluir el caudal mnimo o ecolgico
estipulado en una concesin, etc.) o superar los volmenes mximos
permitidosenelcasodeusosprivativospordisposicinlegal.

21 valor contiene el coste de plantacin de especiesarbreas (reforestacin). Sin embargo, al ser

dichovaloruncostemediodediferentesactuaciones,nodistingueentredistintoscostesdeplantacinpor
diferentes especies, densidad de plantacin o caractersticas de la zona a reforestar. En este sentido, las
Tablas9y10ofrecenunanlisisdecostesmuchomsdetalladoenfuncindelastresvariablescitadas
anteriormente, siendo aconsejable utilizar estos valores para la estimacin de costes de restauracin
ambientalderivadosdetalasderboles.

17
INDUROT.UniversidaddeOviedo

Pueden ser simplemente el resultado de una extraccin o derivacin que no


estabaautorizada.
A pesar de que ambos tipos de infracciones pueden dar lugar a los mismos
impactossobreelmediohdrico,lanormativavigentesloexigeunavaloracineconmica
en aquellos casos de derivaciones o extracciones de agua sin autorizacin.22 Sin
embargo,elrganoinstructorpodrllevaracabodichavaloracinconobjetodegraduar
la sancin a imponer dentro de las bandas establecidas paracada tipo de infraccin o
bienparaexigirlacorrespondienteindemnizacinpordaosyperjuicios.
Adems, deben distinguirse los supuestos de detracciones de aguas
superficiales y aguas subterrneas. En el caso de las primeras se generan,
bsicamente, dosperjuicios:
Enprimerlugar, serestacaudalfluyentealpropioro,pudiendollegaraafectar
a su rgimen ambiental de caudales. La mayor o menor trascendencia de este
daodepender,bsicamente,delcaudalenesetramoderoenelmomentode
laextraccin,delvolumenyduracindelaextraccinoderivacin,delacantidad
deusoseconmicosconsuntivosquehayainmediatamenteaguasabajodelpunto
dederivacin,etc.
En segundo lugar, la minoracin de los recursos disponibles fluyentes puede
llegar a generar problemas en la calidad de las aguas si se merma la
capacidaddedilucindevertidosquetienelamasadeaguaencuestin.La
mayor o menor trascendencia de este dao depende, bsicamente, de los
parmetroscitadosenelpuntoanteriorydeotrascaractersticascomoeltipoy
volumen de vertidos que se estn realizando inmediatamente aguas abajo del
puntodeextraccin.Ladisminucinenlacapacidaddedilucindeuncursofluvial
asociada al descenso de los caudales circulantes puede llegar a tener una
trascendencia notable si, por ejemplo, existe aguas abajo una captacin para
abastecimientoquesepuedaverafectada.
En el caso de la explotacin de las aguas subterrneas, los efectos negativos
esperablesseconcretanenlaposibilidaddeafectaralnivelfretico(alterandoelrgimen
hdrico de manantiales, por ejemplo), y provocar el deterioro medioambiental del propio
acufero.23

2.4.1.2 Metodologaparalavaloracindedaos
Elvaloreconmicodeldominiopblicohidrulicoafectado(VDPH)seobtendr
almultiplicar elvolumendeaguaderivadaoextrada por elcosteunitario delagua:

22 Elincumplimientodelascondicionesimpuestasenlasautorizacionesdeextraccindeaguase

aborda a travs de los artculos 315 b) y 316 b) del RDPH, que las califican de leves o menos graves
respectivamentesegnelhechoinfractordlugaronoalarevocacinocaducidaddelaautorizacin,yno
enbasealavaloracineconmicadelainfraccin.
23 Nienelcasodeaguassuperficialesnieneldesubterrneasseconsideranlosposiblesdaos

derivados de que la detraccin de agua pueda llegar a provocar escasez fsica del recurso para otros
usuarios situados aguas abajo o que utilicen aguas procedentesde un mismo acufero (usosindustriales,
concesiones para abastecimiento humano, etc.), generando prdidas econmicas o de bienestar social
(riesgodedesabastecimiento).

18
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

ValorDPH=Volumenaguaextrada Xcosteunitariodelagua

El volumen de agua extrada se calcular a partir de lo que determine el


correspondiente contador volumtrico, si ste est instalado. En caso de no ser as, el
volumensedeterminarmediantelossiguientescriteriosindirectos:
En materia de agua extrada para regado, la cantidad de agua extrada se
calcularaplicandoalasuperficieregadalasdotacionesestablecidasenelplan
hidrolgicodecuencaparaeltipodecultivodequesetrate.
Enelsupuestodeaguaextradaparaabastecimiento,lacantidaddeaguase
calcularaplicandoal nmerode personas abastecidas ladotacin por persona
prevista en el plan hidrolgico de cuenca. Cuando el agua se destine a
abastecimiento de poblaciones que constituyan generalmente la residencia
habitualdesushabitantes,elcmputoserealizarporperiodosanuales.Encaso
contrario, el cmputo se har por el periodo de tiempo que marca el plan
hidrolgicoparasegundasresidencias.
Enelcasodeaguaderivadaparausosindustriales,laOO.MMMAM/85/2008
establece que la cantidad de agua se calcular aplicando el volumen de agua
previsto en la orden de 24 de septiembre de 1992, por la que se aprueban las
instrucciones y recomendaciones tcnicas complementarias para la elaboracin
delosplaneshidrolgicosdecuencasintercomunitariasoporlaOrdenMinisterial
quelasustituya.EstaordenhasidosustituidaporlaOrdenARM/2656/2008del
10 de Septiembre. Por lo tanto, las dotaciones expresadas en este Manual
recogenlosnuevosvaloresestipuladosenestanuevanormativa.
Finalmente,sepodrcuantificarlacantidaddeaguadetradamediantecualquier
otraprueba,siemprequeestaseajustificableyrazonada,queobreenpoderdela
Administracin y que permita hacer una estimacin volumtrica (por ejemplo
nmerodecamionescisternacargadosilegalmente,etc.)
Enloqueserefierealcosteunitariodelagua,serelquesederivede losanlisis
econmicosdelusodelaguaelaboradosporelorganismodecuenca,oelderivadode
los estudios sobre estos mismos aspectos que con posterioridad se incorporen al plan
hidrolgicodecuenca,enaplicacindeloprevistoenlaDirectivaMarcodelAgua.Hasta
que se incorporen al correspondiente plan dichos estudios, el coste del recurso se
determinarmediantelaaplicacindelos criteriosdevaloracinderivadosdelrgimen
econmicofinanciero del uso del agua de la cuenca. Estos estudios podrn ser
completados, o suplidos en su defecto, con otros criterios provenientes de normas
sectoriales,o por razonesderentabilidadymercado.

Medidasderestauracinambiental
Elconceptoderestauracinambientalimplicaadoptarlasmedidasnecesariaspara
restituir / reponer el Dominio Pblico Hidrulico a un estado lo ms cercano posible al
original. En el caso de las derivaciones y extracciones de agua, la reposicin de la
afeccin,ensentidoestricto,implicarareponeralsistemaencuestinelaguaextrada
osobreexplotada (devolverelaguaalrooacufero).
El problema de las extracciones y derivaciones es que el dao es de difcil
reposicinenlaprctica: devolveralamasadeaguaelvolumenquelehasidoextrado
no es una prctica habitual. Adems, presenta algunos interrogantes metodolgicos

19
INDUROT.UniversidaddeOviedo

relacionadosconelorigendelrecursorepuesto, elmododereposicinutilizado,lacalidad
ycaractersticasdelaguareintegradaalsistema,etc.
La reposicin, ensentido estricto, debera consistirendevolver al sistema agua
similaralaquehasidodetrada,quegeneralmenteseraguaenestadonatural(taly
comofluyeoseacumulaenelro,ocomoseencuentraenelacufero)procedentedeun
sistemadiferentealafectado.
Se han identificado las siguientes posibilidades para reponer al sistema el
aguadetradayvalorarloscostes dellevarlo acabo:
1. Mediante un trasvase desde otra cuenca. Aunque en el mbito de la
DemarcacinHidrogrficadelCantbrico(DHC)estehechoesmenosfrecuente,
estaesunaformahabitualdeintroduciraguaenlossistemasdebuenapartede
la Espaa mediterrnea. En tal caso, los costes de reponer el agua detrada
seranlosderivadosdetrasvasarundeterminadovolumen,esdecir,bsicamente
loscostesdecaptacin,regulacinytransporte24 delaguadereposicin25.
2. Mediantelarecargaartificialdeacuferosenelcasodeextraccionesdeaguas
subterrneas. Esta tcnica,realizadasobre todo en el levante espaol,consiste
envolveraintroduciraguaenacuferossobreexplotados..
3. Medianteunatransferenciadirectadeaguaconmediosmecnicosdesdeotro
sistema cercano. Esta tercera alternativa, de carcter ms bien terico que
prctico, consistira en obtener agua (similar a la detrada) en otro sistema
cercanoquegozaradesolvenciahdricasuficientecomoparacederrecursosin
poner en peligro su propio equilibrio. Se pueden distinguir dos posibilidades de
actuacin:
a. Por ejemplo captar agua procedente de algn sistema general que
contase con embalses de capacidad suficiente, transportarla en un
vehculoapropiadoyverterlaenelpuntodondeseprodujolaextraccino
derivacinirregular.Deestemodo,sedevolveraalsistemaaguadeunas
caractersticassimilaresalasquetenalaquefuedetrada.
b. Suponer que se toma agua procedente del sistema de abastecimiento
general existente en el rea donde se produjo la detraccin irregular
(aguadelaredgeneraldelmunicipioodelncleoencuestin)yluegose
transportara y vertera en el punto de derivacin. No obstante, esta
segundavariantedeclculopresentaalgunosproblemas:porunlado,al
coste de este agua se le debera descontar aquella parte de la tarifa
destinadaarepercutircostesdedepuracinocloracin(comoelfinnoes
devolveralroaguatratada,slodeberanimputarsecostesdecaptacin
ytransporte),yporotrolado,dichoaguanodeberaprocederdelmismo
sistemadelqueelinfractordetrajopreviamenteelrecurso.

24 Costesdeamortizacindelasinfraestructuras,costesdeconservacinymantenimiento,costes

degestin,etc.
25 Estos costes son muy variables dependiendo de la distancia a la que se trasvase agua, de la

antigedadycapacidaddelasobrashidrulicasempleadas,etc.

20
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

2.4.1.3Precios,valoresycostesdereferenciaparalavaloracinde
extraccionesilegalesdeagua
Lalegislacindisponequeserelorganismodecuencaquinestablezcaelcoste
del recurso. De esta forma, la Confederacin Hidrogrfica del Norte, a travs de un
documento aprobado por la Junta de Gobierno26, dictamin que el coste unitario del
agua ilegalmenteextrada enelmbitodelacuencanorteserde0.28 /m3 27. Por lo
tanto,enelmbitodelaCHC:
VDPH=volumenaguaextradax 0.28 /m3.
Enloqueserefierealvolumendeaguaextrada,stesereldeterminadoporel
correspondiente contador volumtrico. En caso de no estar instalado, se aplicarn los
criterios indirectos expuestos anteriormente, y cuyas dotacionesaparecendetalladasen
lassiguientestablas28:
a) Aguaextradapararegado:
Tabla 3. Rangodedotacionesnetasadmisiblesparalosgruposdecultivosenla
DemarcacinHidrogrficadelCantbrico (enm3/ha/ao)
Gruposdecultivo DHC

CultivosBioenergticos:Bioetanol 9002 950


Cerealesgranodeinvierno <1 400
Cultivosforestales <2 650
Cultivosforrajeros 2503 900
Frutalesdefrutocarnosonoctricos 4002 800
Hortalizasairelibre 1 0003 500
Leguminosasgrano 1 6502 500
Mazysorgo 1 7503 950
Patata 1 4503 500
Remolacha 6003 450
Estasdotacionesnoserndeaplicacinenelcasodelaexistenciadeplanes
especiales
Enlasexplotacionesagrcolasendondesepractiquenloscultivosintensivos
estosvaloressepodrnafectar poruncoeficienteenelrangode1.5a1.7
Fuente:OrdenARM/2656/2008

26 Propuestadecriteriosdevaloracinparaelclculodelosdaosaldominiopblicohidrulicopor

extracciones y derivaciones de agua, sin concesin o autorizacin en el mbito de la Confederacin


HidrogrficadelNorte(2006). PropuestasometidaalaaprobacindelajuntadegobiernodelaCHN.
27 LaencuestasobreelsuministroytratamientodelaguaelaboradaporelINErecogequeelprecio

mediodelaguadelasseisCC.AA.comprendidasdentrodelmbitoterritorialdelaCHNfuede0.71/m3.
Dado que este precio corresponde al ciclo integral del agua, seconsider adecuado rebajarlo en un 60%
paradescontarloscostesdesaneamiento,distribucinypotabilizacindelaguaenbaja.
28La Orden MAM/85/2008 establece que la estimacin de agua extrada para regado y
abastecimientosecalculardeacuerdoaladotacinprevistaenelplanhidrolgicodecuenca.Noobstante,
teniendo en cuenta que el nuevo Plan de Cuenca est en proceso de desarrollo en este documento se
presentanlasdotacionesestablecidasenlaOrdenARM/2656/2008porlaqueseapruebanlasinstrucciones
yrecomendacionestcnicasparalaelaboracindelosPlanesHidrolgicosdecuencasintercomunitarias.

21
INDUROT.UniversidaddeOviedo

b) Aguaextradaparaabastecimiento29

Tabla 4.Dotaciones deaguasuministradaenlitros porhabitantotey da


Poblacinabastecidapor
Valorde Rango
elsistema(municipio,
referencia admisible
reametropolitana,etc.)

Menosde50 000habitantes 340 180640

De50 000a100 000 330 180570

De100 000a500 000 280 180490

Msde500 000 270 180340

Fuente:OrdenARM/2656/2008

c) Aguaextradaparausosindustriales

Tabla 5 Dotacionesdedemandaparacentralesdeproduccinelctrica
(hm3/ao/100MW)
Rangodedotacin anualenhm3porcada100MW
Tipodecentral
Circuitorefrigeracincerrado Circuitoderefrigeracin

Nuclear 3.2 3.8 165 190

Ciclocombinado 1.2 1.5 60 100

Carbnofuel 2.3 2.8 90 125

Termosolares 1.6 2.0

Fuente:OrdenARM/2656/2008

29 Deacuerdoconloestipuladoenelartculo3.1.2.2.2delaOrdenARM/2656/2008elclculopara

abastecimientodepoblacinestacionalsellevaracabotransformandolapoblacinestacionalenpoblacin
permanenteequivalenteyutilizandolasdotaciones dereferenciaestablecidasenlaTabla4.

22
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Tabla 6.Dotacionesdedemandaparalaindustriamanufacturera
Dotacin/empleado DotacinVAB
INE Subsector (m3/empleado/ao) (m3/1000)

DA Alimentacin,bebidasytabaco 470 13.3

DB+DC Textil.Confeccin,cueroycalzado 330 22.8

DD Maderaycorcho 66 2.6

DE Papel,edicinyartesgrficas 687 21.4

DG Industriaqumica 1.257 19.2

DH Cauchoyplstico 173 4.9

DI Otrosproductosmineralesnometlicos 95 2.3

DJ Metalurgiayproductosmetlicos 563 16.5

DK Maquinariayequipomecnico 33 1.6

DL Equipoelctrico,electrnicoyptico 34 0.6

DM Fabricacindematerialdetransporte 95 2.1

DN Industriasmanufacturerasdiversas 192 8.0

Fuente: OrdenARM/2656/2008

Costedelasmedidasderestauracinambiental(CRA )
Talycomosehaexpuestoanteriormente,devolveralamasadeaguaelvolumen
delrecursoquehasidoextradonoesunaprcticahabitualyenmuchasocasioneses
ms un ejercicio de valoracin terico que prctico. Tan slo en algunos supuestos
puntualesserarealmentenecesarialareposicindelaguaderivada:
Debidoaunaextraccinmuyimportantesetuvieraquerecurriraintroduciragua
enelsistemadesdeotrosistemafluvialpormediodeuntrasvase.
Si tuviera que realizarse la recarga artificial de un acufero que ha sido
considerablementesobreexplotado.
Cuandotuvieraquerecargarsealgnsistemalacustreoalgnhumedalcuyonivel
de aguahubieradescendidonotablemente.
En todo caso, los costes de reposicin aplicables, tanto para supuestos tericos
como para reposicionesenlaprctica, estarandentrodelrangode valoresofrecidosenla
Tabla1.Unaexplicacinmsdetalladadelaformacindedichoscostesapareceenel
Anexo8.

23
INDUROT.UniversidaddeOviedo

2.4.2Extraccinderidosyaprovechamientodematerialessin
autorizacin

2.4.2.1 PrincipalesdaosalDPH
Enelcasodelasextraccionesderidosdeloscauces,losefectossobreelDominio
Pblico Hidrulico son difciles de predecir y poco generalizables, siendo probables los
aumentosdelacapacidaderosivadelroeneltramoafectado,alalterarlarugosidady
texturadellecho.

2.4.2.2 Metodologaparala valoracindedaos


Enestecaso,elvaloreconmicodelDPHafectado(VDPH)serelresultadode
multiplicar los volmenes de ridos o materiales extrados por el coste unitario de los
mismos:

ValorDPH=Volmenesridos/materialesextrados Xcosteunitario delosmismos

Elcostedelosridosomaterialesaprovechadossedeterminarporelorganismo
de cuenca teniendo en cuenta los precios de mercado. Sin embargo, su importe no
podrserinferioralqueresultaradeaplicar,enelmomentodelaconstatacindelos
hechos, el canon de utilizacin de los bienes de dominio pblico hidrulico (por
aprovechamiento de los bienes de DPH) de acuerdo con lo establecido en el artculo
112.4.c)delaLeydeAguas.Noobstante,laConfederacinHidrogrficadelCantbricono
tieneuncanonestablecidoparaestetipodeaprovechamientodebienesdelDPH.Porlo
tanto,estecriterionoresultadeaplicacinenestecasoaunquehabrdesertenidoen
cuentasilaCHCestipulauncanondeutilizacinenelfuturo.

Medidasderestauracinambiental
En los casos relacionados con extracciones de ridos, se pueden plantear dos
supuestos. En el primero, el funcionamiento natural del propio sistema fluvial hace
prcticamenteinnecesaria cualquierotrotipodeintervencinrestaurativa,yaquelapropia
dinmica fluvial se encargar en un tiempo de reponer las gravas, arenasycantos que
hayan sido extrados. Este supuesto es aplicable a extracciones pequeas moderadas,
quenomodificansustancialmentelascaractersticas dellecho.
Enelsegundosupuesto,casosdegrandesextracciones,lamagnituddelimpacto
haceimprobablequeelropuedarecuperarseporsuspropiosmediosenunplazo
temporalrazonable(grandesextracciones),yseaconsejaunaintervencinparaevitar,a
suvez,lageneracindeotrosimpactosderivados.Entalescasos,habraquecontemplar
costes de restauracin ambiental, como los costes derivados de las actuaciones en los
cauces dirigidas a corregir problemas hidrulicos o desequilibrios geomorfolgicos
causados por la extraccin (como incrementos de la capacidad erosiva del tramo
afectado).Estoscostesincluiran:
Loscostesdeadquisicindematerialessimilaresalosextradosdelro

24
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Los costes de transporte o depsito en el punto de extraccin de materiales


similaresalosextrados.
Enelcasodequelaextraccinhubieracausadootrosdaos,loscostesdelas
actuacionesparalarestauracinambientaldelaszonasafectadas.

2.4.2.3Precios,valoresycostesdereferenciaparalavaloracinde
extraccionesderidosyotrosmaterialessinautorizacin
La OO.MMMAM85/2008 establecequeelcostedelosridosomaterialesextrados
oaprovechadoslodeterminarelorganismodecuenca,teniendoencuentapreciosde
mercado. A tal efecto, a continuacin se muestra una tabla con precios orientativos de
mercadodedistintostiposderidos:

Tabla 7.Preciosderidos(enm3)
ridos Precio(m3)

Arena(encantera) 17.02

Arenademigacribada(encantera) 15.98

Arenabasltica(encantera) 18.58

Garbancillobasltico5/10Mm(encantera) 18.58

Gravilla20/40Mm(encantera) 11.69

Gravillabasltica10/15Mm(encantera) 15.28

GravillaA5/2,6/3,10/5Mm(encantera) 14.97

GravillaA13/7,20/10,25/13Mm(encantera) 12.75

Grava(encantera) 11.49

Grava40/70Mm(encantera) 11.58

Fuente:TRAGSA.MemoriaTarifas2007,actualizadosaeurosde2009

Costedelasmedidasderestauracinambiental(CRA )
Enelcasodequela magnituddelimpacto generadoporlaextraccin deridos,u
otrosmateriales,haga improbablequeelropuedarecuperarse porsuspropiosmedios en
unplazotemporalrazonable,seraaconsejableunaintervencinparaevitar,asuvez,la
generacindeotrosimpactosderivados.Sinembargo,aligualqueenlasextraccionesde
agua,esteesunejerciciomsbiendevaloracintericapuesenlaprcticanosuelen
reponerselosmaterialesextrados.Los costesderestauracinambientalacontemplaren
estecasoseran:lavaloracindedaos
Los costes de transporte o depsito en el punto de extraccin de materiales
similaresalosextrados.(aproximadamente6.11 /m3,ver Tabla 1).
Enelcasodequelaextraccinhubieracausadootrosdaos,loscostesdelas
actuacionesparalarestauracinambientaldelaszonasafectadas.

25
INDUROT.UniversidaddeOviedo

Loscostesdeadquisicindelosmaterialesnoseincluyendentrodeesteapartado
puestoqueyahansidocontempladosparacalcularelvaloreconmicodeldominiopblico
afectado.

2.4.3 Obras, destrozos, sustracciones, actuaciones u


ocupaciones no autorizadas, incluyendo el depsito de
escombrosy lainstalacindeestructurasmviles

EsteapartadoaglutinaunampliogrupodeaccionesconimpactossobreelDPHde
muy diversa ndole. Como consecuencia, a lo largo del anlisis de las infracciones
agrupadasenbajoesteepgrafededesarrollarunanuevasubclasificacinquediferencie
lasdistintasactuacionesysuscorrespondientesimpactossobreelDPH.

2.4.3.1 PrincipalesdaosalDPH

I. Destrozosysustracciones

LassustraccionesyrobosdeloselementospertenecientesalDPHydelosbienes
vinculadosasumantenimiento,controlycuidadosuponen,enprimerlugar,unamerma
del capital y del patrimonio asociado al Dominio Pblico Hidrulico. Sus consecuencias
sonmuyvariadas,yestarnasociadasaldesequilibriodelordenyfuncionamientodelos
recursosqueintegranelDPH(obrashidrulicas,recursoshdricos,vegetacin,etc.).
Los destrozos de los bienes y elementos citados pueden, adems, tener
repercusionesmuyimportantesenelequilibriodelDPH,materializadasenproblemasde
seguridadpblica,garantadeabastecimiento,daosenlacalidaddelagua,alteraciones
delospatronesdecomportamientodelsistemaduranteepisodiosdeavenidas,etc.Sirva
como ejemplo los efectos de los daos causados por el destrozo de un azud para la
captacin deaguasdestinadasaabastecimiento,ladestruccindeuncanaldetrasvaseo
una acequia principal de riego, o la rotura de una instalacin para la desalacin o de
depuracindeaguasresiduales,entreotrascosas.

II. Invasionesyocupaciones

Las invasiones y ocupaciones del DPH y de las zonas adyacentes sujetas a


restriccionesdeusoconmaterialessusceptiblesdeserremovilizadosporelpropioro en
casodecrecidasyavenidas (escombros,chatarras,depsitosdeestircoles,materialesy
estructuradeobras,rollosdeensiladodehierba,etc.).stasgenerannormalmentedos
tiposdeefectos:
Elprimerosecorrespondeconcambiosenelbalancesedimentariodelsistema
fluvial, ya que estos materiales sonsusceptibles de ser arrastrados por el ro y
depositados aguas abajo, provocando, segn el material de que se trate,
desperfectos, degradacin del medio fluvial y/o de la calidad del agua,
acumulacionesenlugaresindeseados,etc.

26
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

El segundo se corresponde con la destruccin de la vegetacin y, en


ocasiones, delarboladoderibera quesedesarrollaenlasmrgenesdelosros
yenlaszonasinundablesadyacentes,yqueconformaamenudounecosistema
dealtovalorbotnicoyfaunstico.
Puedeninducircambiosenladinmicafluvial,alrepresentarobstculosfrentea
los desbordamientos almodificar el patrn decomportamiento de las aguasen
casode inundacin.

III. Obras,trabajosyconstrucciones

Elgrupoqueaglutinalostrabajos,obrasyconstruccionesrealizadasenelcaucey
ensuszonasasociadasconcentraungrannmerodeafeccionesnegativaspotenciales
sobreelDPH,quevaranennaturalezaymagnitudsegneltipodeactuacindequese
trate.Engeneral,los principalesefectosnegativos sepuedenresumircomosigue:
Obrasdeencauzamiento:
o Aumentan la erosin cuando suponen un aumento de la seccin y
disminuyen la rugosidad de las orillas y/o del lecho. Tambin cuando
forman estructuras sobreelevadas que aumentan la profundidad del
cauce.
o Enelcasodecanalizacionessobreelevadas,puedencontribuiraquelas
aguas que han conseguido penetrar tras un episodio de inundacin
queden retenidas durante das o semanas en los terrenos situados tras
losdiquesdeproteccin.
o Refuerzan el proceso de sedimentacin y acumulacin de depsitos
enelcanalylasmrgenescuandoseproduceunaavenidaquesupone
unaumentodecaudalporencimade lacapacidaddelacanalizacin.
o Favorecen la modificacin y/o la degradacin de los hbitats
ribereos,normalmentedebidoaladestruccindirectadelavegetacin
y de los organismos asociados a ella. Adems, contribuyen a alterar el
rgimennaturaldelro,aldesaparecer,enmuchoscasos,aquellasreas
quesecaracterizanporunrgimenmsvariable(comopozosyzonasde
rpidos)caractersticosdemuchostramosfluviales.
o Lasobrasdecanalizacinimpidenelintercambiodeaguasentreelcanal
y la llanura, pudiendo producir modificaciones en los acuferos
aluviales.
Obrasdefijacin/estabilizacindemrgenes:
o Contribuyena aumentarla erosin,aldisminuirlarugosidaddelasorillas
y/odellecho.
o Alteran los patrones de inundacin, ya que pueden provocar el rebote
del flujo, provocando a menudo el desbordamiento en la margen
contraria.

27
INDUROT.UniversidaddeOviedo

Estructurastransversales,talescomo puentes, azudes, entubaciones,saltos


deagua,etc.
o Cuando reducen la seccin natural del canal de crecida, imponen
modificacionesenelfondodelromedianteelprocesoerosivoconocido
como socavacin, que puede acabar desencadenando el descalce y
colapso de muchas de estas estructuras, especialmente durante
episodiosdeavenida.
o En las zonas estrechadas se favorecen los desbordamientos.
Concretamente, estructuras como puentes y entubamientos son
fcilmente obstruibles por la carga transportada por el ro por suparte,
losazudesysaltosdeaguareducenlaalturadelasmrgenesimpuesta
porlasrepresas.
o Saltos de agua, azudes, puentes y presas producen aguas arriba la
elevacinlocaldelnivel delro, queinduce ala sedimentacin.
Cierres,construccionesyedificaciones:
o Aunque se localicen fuera del canal, tienen capacidad para provocar
cambios en la dinmica fluvial (cambios en la direccin de los flujos,
porejemplo),yaqueconstituyenobstculos frentealosdesbordamientos.
o Especialmenteenelcasodelasedificaciones,suponenlapresinyen
sucasoeliminacinirreversibledelacubiertavegetalautctonayde
todosloselementosasociados aella.

2.4.3.2 Metodologaparalavaloracindedaos

I. Destrozosysustracciones

Enestecaso,elvaloreconmicodelDPHafectado(VDPH)seobtendrcomoel
costedereposicindeloselementosafectados.Enelcasode destrozoso deterioros en
lasobrashidrulicasobienesdelDPH,loscostesdereposicinconsistirn,bsicamente,
en:
Loscostesderivadosdelareparacinyrestauracin delosbienesafectados.
Encasodehaberseproducidodaosirreparables,loscostesdesustitucindelos
elementosdaadosporotrossimilares.
En el caso de las sustracciones de los bienes del DPH, como equipos o
elementosnecesariosparasuadecuadomantenimientoyconservacin,laobligacinde
reponer el DPH a su estado original debera consistir en la devolucin del elemento
sustrado en cuestin. La adopcin de una va de valoracin del dao basada en los
costes de reposicin para el Organismo de Cuenca consistira, en este caso, en la
atencina los costes de sustitucin delbiensustrado por uno similar, entendindose
quelacontabilizacindeberacontemplar:

28
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Bienelcostedeadquisicindeunelementosimilarconlamismaantigedad,
O bien el coste de adquisicin de un elemento nuevo similar, reducido en una
proporcin equivalente a la fraccin devida til que ya hubiera agotado el bien
sustrado.

Medidasderestauracinambiental
En la mayora de los casos de infracciones por destrozos y sustracciones, no es
necesarioponerenprcticamedidasderestauracinambientalmsalldereponerlos
elementosafectadospartidaqueyaestacontempladaenlavaloracineconmicadelos
elementosafectadosdelDPH(apartadoanterior).

II. Invasionesy ocupaciones

ElvaloreconmicodelDPHafectado(VDPH)serelequivalentealoscostesde
retiradadelosescombrosuotrosproductos indebidamentedepositados,calculados a
precio de mercado, e incrementados con los costes de transporte de los materiales
retirados hasta instalaciones que resulten adecuadas en virtud de lo establecido en la
legislacinsectorialqueresultedeaplicacin.

Medidasderestauracinambiental
EnelcasodequelasinvasionesyocupacioneshayangeneradodaosalDPH, tras
laretiraradelosmaterialesacumuladossernecesariollevaracaboelcorrespondiente
acondicionamientodelreafluvialafectada.Losdepsitosdematerialespuedencontribuir
a daar o eliminar la vegetacin y el arbolado de las riberas, haciendo necesaria en
ocasiones la reforestacin del arbolado y la restauracin ambiental de las reas
degradadas.
En estecaso, loscostes de medidasderestauracinambiental debern incluir el
acondicionamientoyrestauracindelosterrenosinvadidosconlosdepsitos,entrecuyas
actuacionesestn(siemprequeseanecesario):
Transporteyextendidodetierra
Compactacindesuelos
Realizacindesiembrasylaboresderevegetacin
Plantacionesdearbustosyrboles

III. Obras,trabajosyconstrucciones

En estecaso,de acuerdocon la OO.MM MAM/85/2008, el valor econmico del


dominio pblico afectado (VDPH) ser el equivalente a los costes de demolicin o
desmontaje30 de las obras o instalaciones y retirada de los escombros, calculados a

30 Enteora, los costes de demolicin y desmontaje formaran parte de los costes de restauracin

ambiental,yaquesetratadeloscostesenlosqueincurrelaadministracinparadevolverelDPHauna
situacin lo ms cercana posible a la original. En todo caso, el valor econmico del dominio pblico se
podracalcularapartirdelosvaloresdelosterrenosrsticosysuelonoedificablequehansidoocupados
por las construcciones o tomando en consideracin los servicios ambientales que han dejado de prestar

29
INDUROT.UniversidaddeOviedo

precios de mercado e incrementados con los costes de transporte de los materiales


retirados hasta instalaciones adecuadas en virtud de lo establecido en la legislacin
sectorialdeaplicacin.
ElOrganismodeCuencatendrquedeterminarlasdiferentesunidadesdecmputo
que se tomarn en consideracin para determinar los diferentes costes (metro lineal o
cbico demolido y metro cbico de material retirado, transportado y, en su caso,
depositadoeninstalacionesdegestinfinal).
Generalmente,lamayorpartedelosimpactosprovocadosporestetipodeacciones
tiene reposicin posible en la prctica, de manera que se puede devolver el DPH a un
estado comparable al que tena previamente por medio del desmontaje, el derribo o la
demolicin de las obras acometidas y la posterior restauracin ambiental de la zona
afectada.Enestecaso,laaplicacindelastcnicasdevaloracintalycomoaparecenen
laOO.MMMAM/85/2008yhansidodescritasenesteapartadosepuedellevaracabode
formadirectaysinmayoresdificultades.
No obstante, es preciso apuntar que la posibilidad de demoler o desmontar las
obras o instalaciones se encuentra en ocasiones comprometida por cuestiones de tipo
social. As, si bien por ejemplo la eliminacin de las obras hechas en un cauce, el
desmontaje de cerramientos o la retirada de una estructura de paso sobre un ro son
relativamente factibles de ejecutar, muchas edificaciones residenciales, industriales,
negociosoequipamientospblicos resultan,enlaprctica,dedifcilremocin.
Enefecto,enmuchasocasiones,elgradodeconsolidacinquepuedenhaber
alcanzadoestasedificaciones,laconflictividadsocialy/ojurdicaquepuedeprovocar
suderribo,los problemasdeequidadsocial quepuedensurgirsinoseeliminanalavez
otros elementos que se encuentran en una situacin similar, etc., son factores que
dificultanenlaprcticalareposicindelosdaosocasionadosalDPHylarecuperacin
delmedionaturalafectado.
En este segundo supuesto, se propone calcular el valor del dominio pblico
afectadomedianteunejerciciotericodevaloracin:estavanopresentaraninguna
diferenciasustancialrespectoalaaplicacinhabitualdelavaloracineconmicadelDPH
afectado, y slo estara indicando la imposibilidad de devolverlo a su estado original,
aunqueselleveacabounejerciciotericodevaloracincomosiellofueraposibleenla
prctica.
Enamboscasos,laspartidasqueesprecisoconsiderarparalavaloracindedaos
sonlasmismaseincluyen:
Costesdederriboydemolicindelasestructuras.
En su caso, el levantado o desmontaje de aquellos elementos que fueran
directamentetrasladablesaotroslugares.
Costes de la retirada y transporte de los materiales y escombros hasta
instalacionesadecuadas.

dichosterrenosarazdelaocupacin.Sinembargo,lanormativavigenteestipulaqueelVDPH secalculeen
basealoscostesdedemolicin,yasapareceformuladoenestemanual.

30
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Medidasderestauracinambiental
Las obras, trabajos y construcciones concentran el mayor nmero de afecciones
negativaspotencialessobreelDPH,ysuelennecesitardelarestauracinambientaldelas
reasafectadas,conelfindeintegrardenuevoestaszonasenelDPHyenelentorno
fluvialasociado.As,cuandofueranecesario,laadecuacindelosterrenosliberadosysu
restauracinambientaldeberanincluirlassiguienteslabores:
El acondicionamiento del terreno, pudiendo incluir el aporte de tierra, la
compactacin del suelo, la proteccin y defensa de los terrenos y taludes que
puedanquedardesnudos,etc.
La realizacin desiembraso inclusoreforestacionesparareforzar laestabilidad
de las reas restauradas y favorecer una ms rpida recuperacin de la
vegetacinpropiadellugar.

2.4.3.3Precios,valoresycostesdereferenciaparalavaloracinde
obras, destrozos, sustracciones, actuaciones u ocupaciones no
autorizadas
Talycomosehavistoalolargodelapartadoprecedente,estegrupoaglutinaun
enormenmerodeafeccionesnegativaspotencialessobreelDPH,haciendomuydifcil
especificar que actuaciones ycostes acarrearn cada una de las infracciones, variando
dichasactuacionesycostesasociadosenfuncindelamagnitud,situacingeogrficay
tipologa del impacto. Por lo tanto, el valor econmico del DPH afectado (VDPH) se
calculardeformaindividualparacadacasoconcreto.Entodocaso,esimportarteresaltar
que para todos los casos ser obligatorio incorporar a la valoracin de daos los
costesdetransportedelosmaterialesretirados hastainstalacionesadecuadas,siendo
staunadelasnovedadesaportadasporlaactualnormativavigente.
Noobstante,conelfindefacilitarlavaloracineconmicadeestasinfracciones,la
Tabla 1 presenta una relacin con las actuaciones y costes asociados ms probables
derivadosdelasinfracciones mscomunes.
Una alternativa para realizar la valoracin de daos, especialmente aquellos
derivados de grandes obras o actuaciones de restauracin ambiental que llevan
aparejadas un gran nmero de intervenciones, es la aplicacin de los mdulos
integralesdevaloracin presentadosenelapartado2.3.Dichosmduloscomprenderan
tantoelclculodelvaloreconmicodelDPHafectado,comolos costesdelasmedidasde
restauracinambientalpor unidaddesuperficierestaurada.

Costedelasmedidasderestauracinambiental(CRA )
AligualqueocurreconloscostesasociadosalclculodelvaloreconmicodelDPH
afectado, las medidas de restauracin ambiental derivadas de un impacto negativo
generadoporestetipodeinfraccinpuedensermuyvariadas.Unarestauracinambiental
completacomprenderalassiguientesactuaciones:
Restitucintopogrficadelcauce.Suelellevarseacaboconmediosmecnicos,
cuyocosteunitarioes 69.33 /hora.

31
INDUROT.UniversidaddeOviedo

Laboreo superficial de mrgenes. Ser necesario llevar a cabo esta actuacin


cuando los mrgenes del ro hayan sido daados como consecuencia de las
obras,depsitos,etc.llevadosacabo.Elcosteunitarioes de 210.35 /ha
Extendidodetierravegetal.Elcosteunitariodelextendidodetierraesde17.05
/m3,incluyendodichovalorelcostedelatierraylamanodeobra.
Siembradesemillaspratenses.Parafavorecerelcrecimientodecubiertavegetal
autctona,puedesernecesarialasiembradesemillaspratenses.Elcostedela
siembramanuales70.12 /haperoadichocostehayqueaadirleelimportedel
kilogramodesemillas,quesesitaen 4.74 /Kg.
Reforestacinconespeciesarbreas.Elcosteunitariodeplantacindeespecies
arbreasvariarenfuncindelasespeciesaplantar,ladensidaddeplantacin,
el tipo de suelo y la pendiente del lugar a reforestar oscilando entre 2.87 y
13.10 /unidad.Enelsiguienteapartadosepresentaunamatriz (Tabla 9) conuna
tabulacindeloscostesenfuncindelasestasvariables.

2.4.4Cortadearbolado

2.4.4.1 PrincipalesdaosalDPH
La tala de la vegetacin arbrea existente en las riberas y en las zonas
inundablesasociadasalcauceocasionadiferentestiposdeimpactosnegativossobreel
DPH,entrelosquecabedestacarlossiguientes:
Se contribuye a aumentar la capacidad erosiva de la corriente, especialmente
anteepisodiosdeavenida.
Se elimina la vegetacin autctona, deteriorndose o destruyndose el hbitat
demuchasespeciesasociadasalmediofluvial.
Desaparecen los serviciosecolgicos que presta estetipodevegetacin,comosu
importante papel en la regulacin de los recursos hdricos del sistema y su
contribucinalmantenimientodelabuena calidaddelasaguas.

2.4.4.2 Metodologaparalavaloracindedaos
Elvaloreconmicodeldominiopblicohidrulicoafectado(VDPH)seobtendr
delresultadodemultiplicarlacantidadderbolesindebidamentetaladosporelvalor
de mercadodelosmismos:
ValorDPH =cantidaddemaderataladaXvalordemercadodelamadera
Dichoimporte,excluidosloscostesderestauracinambiental,nopodrserinferior
alqueresultaradeaplicar,enelmomentodelaconstatacindeloshechos,elcanonpor
utilizacindelosbienesdedominiopblicohidrulicodeacuerdoconloestablecidoenel
artculo112.4.c)delaLeydeAguas.LaCHNestableci,atravsdeuninformeinternode
Marzode2000,uncanondeaprovechamientodebienesdelDPHespecficoparalatala

32
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

de rboles nacidos espontneamente en terrenos del DPH. Dicho canon habr de ser
tenidoencuentaparaelclculodelvaloreconmicodelDPHafectado31.
La cantidad de madera talada por cada rbol se establecer de forma directa
mediante el clculodel volumenexacto del rbolcuando sea posiblesu determinacin.
Cuando ello no fuera posible, el clculo se har de forma indirecta y tomando en
consideracinelrendimientomediodelrboldequesetrate.
Elcostedelamaderataladasecalculardeacuerdoconpreciosdemercadoyen
funcindelaespeciedequesetrate.Adems,sifuesenecesario,alvalordelamadera
seaadirelcorrespondienteaotrosproductosdistintos.Enelcasodequedeterminados
rbolestenganunvalorespecialseaplicarnsistemasdevaloracinqueincluyanestas
caractersticas32.

Medidasderestauracinambiental
Lataladelavegetacinarbreapropiadelaszonasribereasydelentornofluvial
representaunaagresindelDPHyalaszonasadyacentescuyareposicinasuestado
anterior no es posible generalmente, salvo que se sustituyan los ejemplares eliminados
por otros de la misma especie y edad, lo cual no sucede en la prctica. Sin embargo,
resulta posible en la realidad la restauracin ambiental a travsde la sustitucin de los
ejemplares talados por individuos de la misma especie ms jvenes, mediante una
reforestacindelreaafectadaquerepongalascondicionesnecesariasparaquelazona
semantengaamedioplazoenlascondicionesquetenainicialmenteyserecuperedel
daoloantesposible.
Enconsecuencia,lasmedidasderestauracinambientaldeberncontemplar:
Lapreparacindelterrenoyloscostesdeplantacin.
Elprecioenviverodelaadquisicindelosplantonesdelasespeciesareponer.
Cuando se considere necesario para garantizar el xito de la reforestacin, el
coste de la realizacin de labores de proteccin y mantenimiento de las
plantaciones (riegos, abonados, aporcados, proteccin mediante cercados,
reposicionesdemarras,podas,otrostratamientossilvcolas,etc.).

2.4.4.3Precios,valoresycostesdereferenciaparalavaloracinde
cortas dearbolado
Comosehaexplicadoanteriormente,el valoreconmicodelDPHafectado(VDPH)
serelresultadodemultiplicarlacantidadderbolestalados(volumen)porelvalor
demercadodelosmismos.Sinoesposibleestablecerdeformadirectalacantidad
demaderataladaporcadarbol,elclculosehardeformaindirectaytomandoen
consideracin el rendimiento medio del rbol de que se trate. De acuerdo a un
informeinternodelaCHNenMarzode2000,elclculodevolumendemaderataladase
utilizarlasiguientefrmula:

31 Verapartado2.4.4.3

32 Unmtododevaloracindearboladoconcaractersticasornamentales,singulares,culturales,etc

es la llamada Norma Granada, auspiciada por la Asociacin de Parques y Jardines Pblicos, siendo la
ltimarevisinlapublicadaen2006.

33
INDUROT.UniversidaddeOviedo

D2
V =p r2 H 0,6 V =p H 0,6
4
Donde:
p=3,1416
r2 D2=radioodimetroalcuadradodelrboltalado
H=Laalturaestimadadelrboltalado
0,6=Coeficientedeminoracinparacorregirelhechodequelosrbolesnotienen
formacilndricaperfecta

En cuanto al precio de mercado de la madera, la siguiente tabla muestra los


preciosdelamaderaenpieactualizadosaeurosde2009:

Tabla 8.Preciosmediosdelamaderaenpie,enEuros/m3(*)

Categora Madera Euros/m3


PinoSilvestre 23.25
Conferas

PinoPinaster 21.38

PinoRadiata 21.40

Nogal 240.53

Chopo 29.24

Abedul 24.85

Aliso 21.60

Haya 30.69
Frondosas

Castao 33.40

QuercusRobur 27.69

Olmo 34.37

Eucalipto 20.54

Fresno 34.31

Otrasfrondosas 34.31
(*)Preciosmediosobtenidossegnla
utilizacindelm3 (aserrio,apeasotrituracin)
Fuente: SADEI(2006): CuentasEconmicasdelaAgriculturaAsturiana

Deacuerdoconlanormativa,elvaloreconmicodelDPHafectado (VDPH) nopodr


serinferiorqueelcanondeaprovechamientodelosbienesdelDPHestipuladopor
laCHNparaelcasodecortadearboladoparamaderaen12.62/m3.Encasodeque
el destino de la madera sea para lea, este canonse reducirhasta6.61 /m3. Dicho
canon es sensiblemente inferior que el precio de mercado de la madera en pie,

34
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

presentadoenlaTabla 833,porlotantono variarnalalzalasvaloracionesllevadasacabo


porlostcnicosdelaCHCseacuerdoalospreciosdemercado.
Finalmente,sifuesenecesario,alcostedelamaderaseaadirelcorrespondiente
a otros productos distintos, como produccin de frutos, etc. En el caso de que
determinados rboles tengan un valor especial se aplicarnsistemas de valoracin que
incluyan estas caractersticas, como la Norma Granada de valoracin de rboles
ornamentales.

Costedelasmedidasderestauracinambiental(CRA )
En estecaso,larestauracinambientalsellevaacaboatravsdelasustitucinde
los ejemplares talados por individuos de la misma especie ms jvenes, mediante una
reforestacin del rea afectada. Por lo tanto, las medidas de restauracin ambiental
deberncontemplarlapreparacindelterrenoyloscostesdeplantacin,aloquehayque
sumarelimportedeadquisicinenviverodelosplantonesareponer.
Los costes de preparacin y plantacin variarn en funcin del tipo de suelo,
densidaddelaplantacinylapendientedelterreno.Acontinuacinsepresentaunatabla
conloscostesdepreparacinyplantacintabuladaenfuncindeestascaractersticas:

Tabla 9.Costesdepreparacinyplantacindeespeciesarbreassegn
caractersticasdelterreno(/unidad)
Pendiente

Tipode
Densidad
suelo <=50% >50%

suelto 2.87 3.69


hoyos/ha

trnsito
>700

pedregoso 10.03 11.98

suelto 3.35 4.00


hoyos/ha
<=700

trnsito

pedregoso 11.02 13.10

Fuente: Elaboracinpropiaapartirde TRAGSA.MemoriaTarifas2007


(actualizados aEurosde2009)

33 Esteprecioalabajaseproduce
yaquelaCHNconsideraquelamayorpartedelassolicitudesde
autorizacindetalasenelDPHserefierenarbolesfueradebosqueysituadosenzonasfrecuentemente
inundables,loqueproduceunaincidenciaalabajaenlosprecios.

35
INDUROT.UniversidaddeOviedo

Tabla 10.Importesdelasespeciesvegetalesenvivero(/unidad)

Especievegetal Costeunitario
SuministrodeAlnusglutinosa(Aliso),de2savias,arazdesnuda 1.03

SuministrodeSambucusnigra(Saco),de1savia,arazdesnuda 0.38

SuministrodeFraxinusexcelsior(Fresnoatlntico),de2savias,arazdesnuda 0.98

SuministrodeSalixalba(Saucecomn),de1savia,arazdesnuda 1.10

SuministrodePopulusnigra(Chopo),de2savias,arazdesnuda 2.59

SuministrodeCastaneasativa(Castao),de2savias,arazdesnuda 1.60

SuministrodeCorylusavellana(Avellano),de2savias,arazdesnuda 0.77

SuministrodeQuercusRobur(RobleCarballo),de 2savias,arazdesnuda 1.55

Fuente:DehesadelaJara(2005): BasedepreciosPaisajismo (actualizados)

Cuando se considere necesario para garantizar el xito de la reforestacin, se


aadiraloscostesdelasmedidasderestauracinambientalelcostedelarealizacinde
laboresdeproteccinymantenimientodelasplantaciones(riegos,abonados,aporcados,
proteccin mediante cercados, reposiciones de marras, podas, otros tratamientos
silvcolas,etc.).

2.4.5 Aprovechamientos de pastos, arados, siembras y


plantacionesnoautorizadas

2.4.5.1 Principalesdaos alDPH


Lasplantacionesdealtadensidadyloscultivostambinacarreandiversosimpactos
negativossobreelmediohdrico.Entreellos:
Contribuyen a reforzar los procesos sedimentarios, ya que rboles enteros
puedenllegaraserdescalzadosporlafuerzadelacorrienteylosmaterialesde
loscampospuedenserdepositadosaguasabajoenformadebarro.
Alconstituirobstculosfrenteaundesbordamiento,provocanel desvoeincluso
laretencindelosflujos ydelossedimentos.
Suponen el desplazamiento de la cubierta vegetal autctona y de todos los
elementosvinculadosaella,conlaconsiguiente prdidadelhbitatribereo.
Ademsdeladestruccindirectadelavegetacinyorganismos vinculadosaella,
generaunaumentodelaturbidezquepuedealterarlosecosistemasaguasabajo.

36
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

2.4.5.2 Metodologaparalavaloracindedaos
Enelcasode aprovechamientosnoautorizadosdepastos,elvaloreconmico
del dominio pblico hidrulico afectado (VDPH) se obtendr de multiplicar el valor
mediodeaprovechamientoporelnmerodehectreasindebidamenteutilizadas.El
OrganismodeCuencadeterminarlosimportesdelpreciomediodeaprovechamientode
pastosporhectrea,segnelterrenoconcretodequesetrate.
Cuandosetratedeplantaciones,siembras,ylaboresdearadonoautorizadas,
el valor econmico del DPH afectado (VDPH) ser el equivalente a los costes de
eliminacindelarboladoolavegetacindequesecompongalasiembraoplantacin
encuestin, elcostedelaretiradadelamateriavegetal extrada ysutransporte hasta
instalacionesqueresultenadecuadas34.
En todo caso, el importe de los daos, excluidos los costes de restauracin
ambiental, no podr ser inferior al que resultara de aplicar, en el momento de
constatacindeloshechos,elcanondeutilizacindelosbienesdedominiopblico
hidrulicoo,enelcasodeaprovechamientosdepastos,poraprovechamientodebienes
delDPH,deacuerdoconloestablecidoenelartculo112.4.a)yc)respectivamente.No
obstante, actualmente la CHC no tiene establecido ningn canon para la utilizacin o
aprovechamiento de este tipo de bienes y, en consecuencia, este criterio no es de
aplicacinparaestecasoconcretoaunquetendrquesertenidoencuentasienelfuturo
seestablecendichoscnonesenelmbitodelaCHC.

Medidasderestauracinambiental
Cuando serealizanplantaciones,siembrasolaboresdearado noautorizadas,
dichas actuaciones suelen llevar asociados trabajos de limpieza de la vegetacin
autctona.Estostrabajosdelimpiezapuedencomprendervariosniveles:enelcasode
quesetratedelaboresbasadasenlarozaysiegadelavegetacinriberea,lareposicin
natural del propio sistema fluvial hace prcticamente innecesario cualquier otro tipo de
intervencinrestaurativa.
Sin embargo, en aquellos otros supuestos en los que las labores de limpieza
consistieraneneldecapadodelapartesuperiordelsueloy/olaeliminacinderazdela
vegetacin herbcea y arbustiva, se introduce un problema de desestabilizacin de las
orillasydeunamayorexposicinalaerosindelosterrenosquequedandesnudosen
casodeproducirsedesbordamientosyavenidas.
Portanto,enestesegundosupuesto,loscostesdereposicinsetraducirnen
laimputacindedeterminadoscostesdestinadosalarestauracinambientaldelazona
afectada,mediante,porejemplo:
El acondicionamiento del terreno, pudiendo incluir el aporte de tierra, la
compactacindelsuelo,suproteccinydefensa,etc.

34 De nuevo, desde un punto de vista econmico, los costes de eliminacin de la plantacin en

cuestin se incluiran dentro del apartado de costes de restauracin ambiental. Sin embargo, la OO:MM
MAM/85/2008establece que los costes de eliminacin seanlosequivalentes al valor econmico del DPH
afectado,criterioquesigueestemanualconelfindeajustarsealanormativavigente.

37
INDUROT.UniversidaddeOviedo

Larealizacindesiembrasparadarmayorestabilidadalsueloyfijarelterreno,
favoreciendo una ms rpida recuperacin natural de la vegetacin propia del
lugar.

2.4.5.3Precios,valoresycostesdereferenciaparalavaloracinde
aprovechamientos de pastos, arados, siembras y plantaciones no
autorizadas
En el caso de plantaciones, siembras, y labores de arado no autorizadas, el
valor econmico del DPH afectado (VDPH) ser el equivalente a los costes de
eliminacindelarboladoola vegetacindequesecompongalasiembraoplantacinen
cuestin,aloquehayqueaadirle elcostedelaretiradadelamateriavegetalextrada
ysu transporte hastainstalacionesqueresultenadecuadas.
Los costes de eliminacin de la vegetacin arbustiva variarn en funcin del
dimetrobasaldelavegetacin,elporcentajedecubiertavegetaldelsueloylapendiente:

Tabla 11.Costesdeeliminacindelavegetacinarbustivasegncaractersticasdel
terreno(/hectrea)

Vegetacincondimetro Pendiente
basal<=3cm
<=50% >50%

<=50% 291.52 351.83


%Cubiertavegetal

>50%<=80% 753.94 904.73

>80% 1 045.47 1 256.57

Fuente: Elaboradoapartirde: TRAGSA.MemoriaTarifas2007 (Costesactualizados


aEurosde2009)

Cuando la plantacin est compuesta por rboles, sus costes de eliminacin


variarnconrespectoalaeliminacindevegetacinarbustiva.Laspartidascontempladas
para el clculo de dichocoste son: Talado de rbol, troceado del mismo, extraccin de
tocn,cargaderamas,tocnyrestodeproductosresultantesyrellenoycompactadodel
huecoresultantecontierraspropias.Elrangodecostesdeesteprocesovarade31.96
/unidada50.30 /unidad,enfuncindequeeldimetrodelrbolseainferiorosuperior
a30 cmrespectivamente.
A estos costes, tanto los de eliminacin de vegetacin arbustiva como especies
arbreas,hayque aadirlesloscostesdetransporte hasta lugarautorizado:
Transporterestosvegetalesencamin: 1.84 /Km.

Costedelasmedidasderestauracinambiental(CRA )
Para aquellos supuestos en los que las labores de limpieza asociados a las
siembras o plantaciones consisten en el decapado de la parte superior del suelo y/o la
eliminacin de raz de la vegetacin herbcea y arbustiva, se hace necesaria una

38
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

actuacin encaminada a la restauracin ambiental de la zona afectada, la cual puede


incluir:
Extendidomanualdetierravegetal 17.05 /m3
Siembra manual de mezcla de semillas pratenses para recuperar la cubierta
vegetal 70.12 /ha (a dicho coste hay que sumarle el importe en vivero del
kilogramodesemillaspratenses 4.74 /Kg.)

2.4.6 Vertidos de aguas residuales y vertidos de residuos en


estadolquidooenformadelodos

2.4.6.1 PrincipalesdaosalDPH
Resulta clara la incidencia directa de los vertidos sobre la calidad de los
recursos hdricos, y su potencial para alterar las caractersticas fsicoqumicas y de
temperatura del agua y, por ende, para trastornar, degradar o incluso eliminar las
formasdevidavinculadasalmedioacuticoyponerenpeligrolasaludhumanayla
seguridadpblica.
Especialmencinrequieren,enestecaso,lasconsecuenciasquepuedenllegara
tener las descargas y derrames ocasionales altamente contaminantes, incluidos
dentrodelacategoradevertidosderesiduosenestadolquidooenformadelodos,en
ocasiones conefectosdevastadoresparaelmedioambienteacutico.

2.4.6.2 Metodologaparalavaloracin dedaos


La Orden Ministerial MAM/85/2008 hace especial hincapi en la valoracin de
daosproducidosporvertidosenlacalidaddelagua,dadosuspotencialesimpactos
negativos sobre las formas devidaasociadas al medio acutico y la salud humana. En
consecuencia,seestablecenunoscriteriosdevaloracinespecficosydistintivospara
estetipodeinfracciones.Asimismo,yteniendoencuentaquelosdaosenlacalidaddel
aguasonnormalmentededifcilcuantificacintantoporlapropiapeculiaridaddelmedio,
comoporlacomplejacaracterizacindelosvertidosqueloprovocanestableceadems
reglas objetivas sobre las metodologas de toma demuestras yanlisis devertidos de
aguasresiduales.
DichaOrdendisponequelavaloracindeldaoalacalidaddeagua,alosefectos
dedeterminarlacuantadelassancioneseindemnizacionesderivadasdelasinfracciones
relacionadas con vertidos, se llevar a cabo de acuerdo con lo dispuesto en el artculo
326.2 del RDPH: Si los daos se hubiesen producido en la calidad del agua, para su
valoracin se atender al coste del tratamiento del vertido, a su peligrosidad y a la
sensibilidad del medio receptor. De este modo, se establecen frmulas especficas de
estimacinobjetivadelosdaosproducidos,tantoparalosvertidosdeaguasresiduales
como para los vertidosde residuos de naturaleza lquida o lodos, que tienen encuenta
estostrespreceptos.
Estesistemaobjetivodevaloracindedaosservlidoparacualquiervertidoen
cualquier cauce y encualquier momento. No obstante, se podr prescindir deaplicar la
frmulaobjetivadevaloracindedaosenlossiguientescasos:

39
INDUROT.UniversidaddeOviedo

Supuestos especiales en que las circunstancias exijan una valoracin


individualizada,previoacuerdorazonadodelorganismo decuencacompetente.
Cuandose considere la comisin de una infraccin de carcter leve sin que se
apreciendaosaldominiopblicohidrulico.
Como ya se ha expuesto anteriormente, la OO.MM MAM85/2008 establece dos
mtodos de valoracin de los daos producidos vertidos en funcin de si stos son
vertidos de aguas residuales, o vertidos de residuos de naturaleza lquida o lodos (los
cuales incluyenlasdescargasoderramespuntualesnoautorizables).

I. Valoracindedaosporvertidosdeaguasresiduales

Los daos en la calidad del agua por vertidos de aguas residuales se valorarn
atendiendo al coste del tratamiento del vertido, a supeligrosidad y a lasensibilidad del
medioreceptorconarregloalasiguiente frmuladeestimacinobjetiva:
Valor()= aV KPV KS KRV = 0.12[ m3 ] Q[m3 d] t[d] KPV KS KRV
enlaque:
a= Coste de referencia de tratamiento del vertido en euros por metro cbico
(/m3),seestablececomo0.12 /m3.
V=Volumendevertidoenmetroscbicos(m3).
Q=Caudaldevertidoenmetroscbicos porda(m3/d)
t=Duracindelvertidoendas(d).
KPV =Coeficienteadimensionalrelativoalapeligrosidaddelvertido.
KS =Coeficienteadimensionalrelativoalasensibilidaddelmedio.
KRV =Coeficienteadimensionalrelativoalareversibilidaddel impacto.

La determinacin del caudal de vertido (Q) se llevar a cabo conforme a los


siguientescriterios:
a) Sepresumir,salvopruebaencontrario,queentredostomasdemuestradeuna
actividadproductivaconstante,elcaudaldevertidotambinesconstante.
b) Seutilizarelvalordelcaudalmedidoenelmomentodelatomadelamuestra.
En caso de disponer valores en continuo de caudal a lo largo de un da, se
utilizarelvalormediodeesosvalores.
c) En caso de no ser posible la medicin del caudal se realizarn estimaciones
indirectasapartirde:datosdeconsumodeagua,nmerodetrabajadores,tipode
produccin,ocualesquieraotrosparmetrosdebidamentejustificados.
d) Enelcasodevertidosdeaguasresidualesurbanassincaudalmedidooprefijado,
elcaudaldevertidosepodrdeterminarapartirdelasdotacionesdevertidoen
litros por habitante y da, segn la poblacin abastecida y el nivel de actividad
comercialdela tablaquefiguraen Anexo2.

40
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Ladeterminacindeltiempodevertido(t)serealizarconformealossiguientes
criterios:
a) El caudal de vertido medido o estimado en un determinado momento se
considerar estable durante las 24 horas del da, siempre que no se deduzca,
justificadamente,otrovalorapartirdelosdatosqueobrenen poderdelorganismo
decuenca.
b) Permaneciendolasdemscircunstanciasconstantes,sepresumir,salvoprueba
delocontrario,queentredostomasdemuestraelvertidohatenidolugardurante
todoelperodointermedio.
c) Encasodevertidosocasionalesdeaguasresidualessepresumir,salvoprueba
delocontrario,queeltiempodevertidohasido,comomnimo,deunda.
La determinacin de la peligrosidad del vertido (Coeficiente K PV) se llevar a
caboconformealossiguientesprocedimientos:
a) El coeficiente KPV se calcular para cada una de las muestras conforme a las
siguientes frmulas, estipuladas en funcin de los diferentes grupos de
parmetrosdecontaminacin(GruposA,ByCexplicadosmsadelanteeneste
documento)ydelcoeficientedereferenciaU:
ParmetrosdelGrupoA:
Para1<U<100.KPV =0.7U+0.2.
Para U 100.KPV =70.2.
ParmetrosdelGrupoB:
Para1<U<100.KPV =0.5U+0.4.
ParaU 100.KPV =50.4
ParmetrosdelGrupoC:
Para1<U<100.KPV =0.13U+0.8.
ParaU 100.KPV =13.8.
ParmetrosGruposA,B,yCcuando:
U 1.KPV =0.
b) Enelcaso dedisponersededosmuestras,elvalordeKPV queseutilizarserel
correspondientealamediaaritmticadelKPV decadaunadelasmuestras.
c) Encasodedisponersedemsdedosmuestras,serealizarlamediadelKPV de
cada dos muestras consecutivas, la cual se considerar como KPV de cada
intervalodetiempotranscurridoentrelasdostomasdemuestra.Setomarcomo
KPV paraelclculolamediaponderadaporeltiempodelKPV encadaintervalo.
d) Enelcasodeanalizarsevariosparmetros,secalcularelKPV paracadaunode
ellosysetomar,aefectosdelavaloracin,aquelqueresulteconelvalorms
alto.

41
INDUROT.UniversidaddeOviedo

El valor de referencia U para cada muestra, a efectos de la aplicacin de las


frmulasindicadasanteriormente,sedeterminardelasiguienteforma:
a) El coeficiente U es igual al cociente entre el valor medido de un determinado
parmetroenlamuestradevertidoyelvalordereferenciadedichoparmetro:
Vm
U =
Vr
siendo:
Vm:Valormedido,esdecir,elresultadoanalticoobtenidoenlamuestradelvertido.
Vr: Valor de referencia, es decir, el valor lmite de emisin que figura en la
autorizacindelvertido.Sisecarecedeautorizacin,onoestdefinidounvalorlmitede
emisinparaeseparmetroendichaautorizacin,seaplicaranlosvaloresqueaparecen
en el Anexo3.
b) Para los parmetros pH y temperatura, el valor del coeficiente U se obtendr a
partirdelasiguienteexpresin:
Vr + Vr + Vm
U =
Vr
c) Cuandoelvalordereferenciaestestablecidocomounintervalodevalores,se
tomarcomoVr elvalordelintervalodelquesededuzcaunUmenor.
d) Para el caso de parmetros microbiolgicos, el valor de U se obtendr de la
expresin:
U =logVm - Vr
Losparmetrosdecontaminacin,utilizadosparacalcularlafrmuladelKPV,se
dividenentresgrupos(A,ByC),talycomoserecogeenelAnexo 3,enfuncindelgrado
depeligrosidaddelosmismos:
a) ElGrupoAincluyelassustanciaspeligrosasquefiguranenelAnexoIVdelRDPH
b) El Grupo B incluye contaminantes de menor peligrosidad que las anteriores.
TambinseincluyeenestegrupoBunparmetrosobrelatoxicidaddelvertido
sobreorganismosacuticos.Paralaconsideracindeesteparmetroseseguirn
loscriteriosquese establecenenel Anexo4.
c) ElGrupoCincluyeotroscontaminantesmenospeligrososquelosquefiguranen
losGruposanteriores.

Elvalordelcoeficienterelativoalasensibilidaddel medioreceptor(K S)deber


estarrelacionadoconlosobjetivosmedioambientalesdelmedioreceptor,envirtuddelos
estudiossobreestosaspectosquerealicenlosorganismosdecuencayqueseincorporen
alplanhidrolgicodecuenca,enaplicacindeloprevistoenelRDLegislativo1/2001,de
20dejulio.

42
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Hastaqueseincorporenalplanhidrolgicodecuencalosanlisisindicadosenel
prrafo anterior, el valor del coeficiente KS derivar de la clasificacin prevista para el
clculodelvalordeldaoalDPHparaelrestodetiposdeactuacin (Anexo1)
Asmismo,elvalordelcoeficienterelativoalareversibilidaddel impacto(K RV),
serelmismoqueelutilizadoparacalcularelvalordeldaodelosapartadosanteriores.
Aqu cabe destacar que el coeficiente de reversibilidad del impacto (KRV) pondera el
tiempo que tardarel dominio pblico hidrulico en recuperar su estadooriginal, y ste
ser estimado por los tcnicos del organismo de cuenca. A la hora de analizar dicho
tiempoenelcasodelosvertidos,serimportantecontemplarla sensibilidadcuantitativa
del medio receptor. Es decir, se ha de tener en cuenta la capacidad de dilucin del
caucereceptor,analizandoelcaudalreceptor,lacantidaddecontaminantesyapresente
enelmedioantesderecibirelafluenteylacalidaddeltramoaguasdebajodeste.Estos
elementos tendrn una influencia decisiva sobre el tiempo de recuperacin del dominio
pblicohidrulico.

II. Valoracindedaosporvertidosderesiduosenestadolquidooenformade
lodos

Losdaosproducidosenlacalidaddelaguaporelvertidoderesiduosenestado
lquido o en forma de lodos que no sean susceptibles de autorizacin, as como los
producidospordescargasoderramesdetipopuntualydealtacargacontaminante,
tambinsevalorarnatendiendoalcostedelvertido,asupeligrosidadyalasensibilidad
delmedioreceptorperoconarregloalasiguientefrmuladeestimacin:

Valor ( ) =450+ b M KRV KS = 450[] + b [ t] M[t] KRV KS


enlaque:
450=Valoracinmnimaeneuros().
b=Costedereferenciadetratamientodelvertidoeneurosportonelada(/t),que
secalculasegnlo establecidoenel Anexo5.
M=Masadelresiduovertidoentoneladas(t)
KRV =Coeficienteadimensionalrelativoalareversibilidaddelimpacto,detalladoen
el Anexo1.
KS =Coeficienteadimensionalrelativoalasensibilidaddelmedioreceptor(Anexo
1)
Los vertidos ocasionales o puntuales, normalmente de una elevada carga
contaminante,representanhechosnoautorizablesyqueproducenungranimpactoenel
medioreceptor.Adems,suvolumenyduracinsonmuydifcilesdedeterminardeforma
exactayloscostesdesutratamientonosoncomparablesaloscostesdedepuracinde
losvertidoshabituales(vertidosurbanosoindustrialesregulados).
Este grupo engloba, bsicamente, descargas de purines, derrames de
hidrocarburos y aceites, lavados de gasoil y productos qumicos, vertidos de
excedenteslcteos,etc. Eladecuadotratamientoyeliminacindeestosproductosnose
asemeja normalmente a un proceso de depuracin de aguas residuales como los
habituales,sinoqueprecisa,engeneral,deunprocedimientomscomplejoycostosoque

43
INDUROT.UniversidaddeOviedo

puede abarcar desde la recogida selectiva del residuo hasta su almacenamiento,


tratamiento y eliminacin en plantas autorizadas y especializadas al efecto. Como
consecuencia de ello, laexpresin genrica utilizadaparacalcular elvalor deldao por
estetipodevertidosincorporaunimportemnimo(450 )ascomo uncostedereferencia
deltratamientodevertidomuchomsaltoqueeldelosvertidosresidualescontinuados,
establecidoen0.12 /m3.

2.4.6.3Precios,valoresycostesdereferenciaparalavaloracinde
vertidos
En el caso de vertidos, la metodologa de clculo estipulada en la Orden
MAM/85/2008, y explicada en el apartado precedente, ya incluye todos los valores y
costes de referencia aplicables a la valoracin de daos por vertidos haciendo
innecesarialapresentacindeunarelacindevaloresen esteapartado.

2.4.6.4 Normas sobre toma de muestras y anlisis de vertidos de


aguasresiduales
Puestoquelosdaosenlacalidaddelaguasondedifcilcuantificacin,tantoporla
propiapeculiaridaddelmedio,comoporlacomplejacaracterizacindelosvertidosquelo
provocan la nueva normativa establece unas reglas objetivas sobre la metodologa de
tomademuestrasyanlisisdevertidosdeaguasresiduales.
No obstante, no ser necesaria la toma de muestras del vertido cuando, por el
conocimiento de su origen y la observacin de sus caractersticas externas, pueda
razonadamentedeterminarsesucomposicinonaturalezacontaminante.
A continuacin se exponen las normas para la tomade muestras de vertido tal y
comoaparecenrecogidasenla OO.MMMAM/85/2008:
1.LasoperacionesdetomademuestrasdelvertidosedocumentarnenunActa
deConstanciayTomademuestrasdevertidosquecontendr,almenos,lainformacin
quefiguraenelAnexoVIdelaOO.MMMAM/85/2008.Constardetresejemplares,en
formato idntico destinndose el primero al organismo de cuenca, el segundo al
laboratorioresponsabledelanlisisdelamuestraOficialyelterceroparaelrepresentante
del titular del vertido. Cada muestra deber acompaarse de la cadena de custodia
correspondientequecontenga,almenos,lainformacinquefiguraenelAnexoVIIdela
OO.MMMAM/85/2008.
2. Con carcter general, la toma de muestras tendr lugar en presencia de un
representante del titular del vertido o de la persona en quien delegue a estos efectos,
quienpodracompaaralrepresentantedelaAdministracinentodaslasoperacionesy
a quien se facilitar la oportunidad de manifestar en el Acta cuanto a su derecho
convenga.Enotrocaso,sedejarconstanciaenelActadelosmotivos porlosqueellono
fueraposible.
3. Se tomar la muestra del vertido al dominio pblico hidrulico. Adems, podr
realizarselatomademuestraencualquierotropuntoqueseconsidereconvenientepara
determinar adecuadamente la naturaleza y el alcance del vertido. En el supuesto de
reutilizacindeaguaslatomasehar,entodocaso,enelpuntodeentregadelasaguas
depuradasoenelpuntodeentregadelasaguasregeneradas.

44
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

4.Lamuestrasetomarporduplicado(oficialycontradictoria)yseprecintarne
identificarnconvenientementeenpresenciadelrepresentantedeltitulardelvertido.
5.LamuestraOficialquedarenpoderdelorganismodecuenca,alobjetodeser
analizada en su Laboratorio o en el de una Entidad colaboradora de la Administracin
hidrulicahomologadasatalefectoenvirtuddelaOrdenMAM/985/2006,de23demarzo,
por la que se desarrolla el rgimen jurdico de las entidades colaboradoras de la
administracinhidrulicaenmateriadecontrolyvigilanciadecalidaddelasaguasyde
gestindelosvertidosaldominiopblicohidrulico.
6.LamuestraContradictoriaseentregaralinteresadoo,ensudefecto,quedara
sudisposicin,durantelosdosdashbilessiguientesalafechadelatomademuestras,
en la sede del laboratorio del organismo de cuenca o en el que ste designe, para su
posibleanlisiscontradictorioenellaboratorioqueelinteresadoelija.Ellaboratorioque
analicelamuestraContradictoriadeberestaracreditadoporunaentidaddeacreditacin
que garantice el cumplimiento de los requisitos establecidos en la Norma UNEEN
ISO/IEC 17025, o la que en el futuro la sustituya. El alcance de la acreditacin del
laboratorio elegido para analizar la muestra Contradictoria deber incluir los
contaminantes quesevanaanalizar.
7. El interesado ser responsable de la correcta conservacin de la muestra
Contradictoria y de la garanta e inviolabilidad de la cadena de custodia, desde su
recogidahastasuentregaenellaboratorioporlelegido.Aestosefectos,ellaboratorio
que reciba la muestra deber suscribir un documento, que ser entregado por el
interesado al organismo de cuenca en el que se har constar, al menos, la siguiente
informacin:
a)Identificacindellaboratorioydesurepresentantelegal,conindicacinexpresa
delcumplimientodelosrequisitossealadosenelapartado6.
b)Identificacindelaempresaquehizoentregadelamuestra.
c) Datos identificativos de la muestra e informacin acreditativa de la garanta e
inviolabilidaddelacadenadecustodia,desdelarecogidadelamuestraporelinteresado
hastasurecepcinporellaboratorio.

45
INDUROT.UniversidaddeOviedo

2.5 EJEMPLOS PRCTICOS DE VALORACIN DE


DAOSALDOMINIOPBLICOHIDRULICO

Extraccioneshdricas

EjemploI:Valoracindedaos enelcasodeunaextraccinilegaldeagua

Se supone el caso de una industria de productos metlicos con 25 empleados, cuyo establecimiento se
localiza en Asturias y a la cual se abre un expediente sancionador al haberse constatado que ha estado
derivandoaguadelroLenasinconcesinadministrativa. Dichaextraccinhaacontecidodurante2meses.
Lavaloracinser:
Valor del dao= [VDPH x Kx] + [CRA x KRV x KS ]
DondeelValorDPH =VolumenaguaextradaX 0.28 /m3
Elvolumendeaguasecalculardeacuerdoalatabla6(Dotacionesparaindustriamanufacturera)563
m3/empleado./ao.Porloque,Volumenaguaextrada=563x25x1/6=2.346m3
ValorDPH =2.346 m3 X0.28 /m3=656.88
Seconsideraqueenestecasonosonnecesariasmedidasderestauracinambientalyaqueelropuede
recuperarseporsuspropiosmedios.Portanto,tanslohandeaplicarseloscoeficientesdeponderacin:
KX Seestimaqueelcaudalextradoesmenordel50%delcaudalcirculantemedio,yelcaudalaguas
abajonoesmenorqueelcaudalecolgico KX =1
KRV Eltiempodereversibilidaddeldaoestimadoesde01ao,KRV =1
KS EnestecasoeltramoderoafectadonotieneclasificacinKS =1
PorlotantoelValordeldao=656.88x1+(0x1x1)=656.88
ValordeldaoalDPH=656.88Euros

46
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

EjemploII:Valoracindedaos enelcasodeunaextraccinilegaldeagua (situacinextrema)

Sesuponeelcasodeunaderivacindeaguailegaldeunacuferoparaunazonadecultivosforrajeros.El
tiempoentreeliniciodelacampaaderiegoylaconstatacindeloshechoshasidode6meses,siendola
superficiedecultivode3hectreas.Lavaloracinser:
Valor del dao= [VDPH x Kx] + [CRA x KRV x KS ]
DondeelValorDPH =VolumenaguaextradaX0.28 /m3
Elvolumendeaguasecalculardeacuerdoalatabla3(Rangodedotacionesnetasadmisiblesparagrupos
decultivoenlaDHC)Dichatablaestablecequelasdotacionespodrnsituarsedentrodelrango250a
3 900m3/ha./ao.Enestecasoseestipulaqueladotacinserde2 000m3/ha/ao.Porloque,Volumen
aguaextrada=2 000x3x1/2=3 000m3
ValorDPH =3 000 m3 X0.28 /m3=840
En este caso se considera necesaria la reposicin del acufero por estar sobreexplotado y en riesgo de
desaparicin.Portanto,elcostedelasmedidasderestauracinambientalderivardelcostedereposicin
del agua detrada. Se toma como precio de referencia de la recarga artificial de acuferos 0.0535 /m3,
suponiendoquelarecargasellevaacabomedianteelaprovechamientodeexcedentesdeunrocercano
mediantelaconstruccinderepresas,ascomotrabajosdenivelacinyescarificacin.
Portanto,CRA =3000 x0.05=150
Loscoeficientesdeponderacintomarnlossiguientesvalores:
KX Acuferodeclaradosobreexplotado KX =2
KRV Tiempodereversibilidadestimado15aos,KRV =1.4
KS AguassubterrneasKS =1.5
PorlotantoelValordeldao=(840x2)+(150x1.4x1.5)=1 995
ValordeldaoalDPH=1 995Euros
Destacarque, comoseharesaltadoalolargodeldocumento,enlaprcticasonpocaslasocasionesdonde
sellevacabolareposicindeaguaextradaoretradailegalmente.Sinembargo,esimportantesabercon
quemecanismossecontaraparallevarseacabo,ascomo suscostesasociados.

35 Se ha tomado el valor estimado de coste de una recarga mediante aprovechamiento de

excedentesdeunrocercano.Estasestimacionesderivandeestudiossobrecostesdelarecargaartificial
deacuferosrealizadosporelIGME,actualizadosapreciosde2009,ycuyorangodevaloresapareceenla
Error!Noseencuentraelorigendelareferencia..

47
INDUROT.UniversidaddeOviedo

Extraccinderidosdelro

EjemploIII:Valoracindedaos enelcasodeunaextraccinderidosdelro

SedetectalarealizacindeunaextraccinderidosdelcaucedelroBurbiasincontarconautorizacin.El
volumentotalderidosextradosseestimaen520m3,mezcladegravas,gravillasyarena.Lavaloracin
ser:
Valor del dao= [VDPH x Kx] + [CRA x KRV x KS ]
DondeelValorDPH = volumendematerialesextrados X costedeadquisicindelosmateriales
Paraelclculodelvaloreconmico,losmaterialesextradossedescomponenen:130m3 deGrava40/70
mm(encantera),130m3 de GravillaA13/7,20/10,25/13Mm(encantera),130m3 de Gravilla20/40Mm(en
cantera)y130m3 deArena(encantera).Deacuerdoconlatabla7,elcostededichosmaterialesaprecios
demercadoser:
ValorDPH =(130x11.58)+(130x12.75)+(130x11.69)+(130x17.02)=6 895.2
En este caso, la magnitud del impacto generado por la extraccin de ridos, hace improbable que el ro
puedarecuperarseporsuspropiosmediosenunplazotemporalrazonable.Porlotanto,esnecesariauna
intervencin para evitar la generacin de otros impactos derivados. El coste de estas medidas incluir el
costedeadquisicindelosmateriales(ridos)areponeryloscostesdetransporteydepsito:
Costedeadquisicindelosmateriales Elimporteapreciosdemercadodelosridoscalculado
paraelVDPHhabrdeserincrementadoparaconseguirlosvaloresfinalesdePresupuestode
ejecucin por la administracin (1% costes indirectos, 1% costes de control de calidad, 4% de
gastos generalesy16% deIVA)36 6 825.2x1.01x1.01x1.04x1.16=8 485.57
Costesdetransporteydepsito Cargaytransportedematerialessueltosa30Km.dedistancia,
incluyendotiemposcargaydescarga 6.11 /m3.
Portanto,CRA =8 485,57+(6.11 x520)=11 662.77
Loscoeficientesdeponderacintomarnlossiguientesvalores:
KX SeconsideraquelainfraccinnohadaadoalacomunidadvegetalKX =1
KRV Eltiempodereversibilidaddeldaoseestimaen01aoKRV =1
KS Elimpactose generaenuntramoderoconaguasaptasparalavidadelossalmnidosKS =1.5
PorlotantoelValordeldao=(6 895.2x1)+(11 662.77x1x1.5)=24 389.35
ValordeldaoalDPH=24 389.35Euros

36 AplicacindelArtculo3 Captulo2dela OO.MMMAM85/2008, queestablecequeparacalcular

loscostesderestauracinambiental(CRA) lasunidadesdeobraenlasqueestasfasessedescompongan
sebasarnenlastarifasoficialesdelosmediospropiosde laadministracin.

48
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Destrozosysustracciones

EjemploIV:Valoracindedaos enelcasodedestrozosysustracciones

Sesuponeelcasodelaaperturadeunexpedientesancionadoraunaempresadelsectordelaconstruccin
porlosdestrozoscausadosenunaconduccinde400mmdedimetro,destinadaaaltransportedeagua
paraabastecimiento(tramoafectado6metros)ylasupuestasustraccindeunequipodebombeoquetena
unaantigedadde5aos.Lavaloracinser:
Valor del dao= [VDPH x Kx] + [CRA x KRV x KS ]
EleconmicodelDPHafectado(VDPH)consistirenlaimputacindeloscostesdereparacindeltramode
conduccinafectada(6m),ydelcostedereposicindelequiposustrado:
Suministro y colocacin detubera defundicin dctil de 400mm de dimetro interior, incluidas
juntas,elementosdeuninyaccesorios,colocadaenzanjapreviacompactacindelfondodela
misma 229.71 /mx6m=1 378.26
Excavacin en zanja por medios mecnicos, en terreno disgregado, con una profundidad hasta
1.5m 11.82 /m3x6m3=70.92
Relleno y compactacin de zanjas, por medios mecnicos, con suelos tolerables o adecuados,
procedentes de la propia excavacin y seleccionados, medido elvolumen ejecutado en obra
4.52 /m3x6m3=33.12
A los equipos electromecnicos se les supone una vida til de 20 aos, por lo tanto el equipo sustrado
habraconsumidounacuartapartedeesta,siendoestafraccinelcosteaimputar:
Bombasumergiblede10CVdepotencia,congradodeproteccinIP68 6 540porloqueel
75%delvalordenuevaadquisicindelequipodebombeoser 4 905
ValorDPH =1 378.26+70.92+33.12+4. 905=6 387.337
Seconsideraquedichainfraccinnohageneradoimpactosnegativossobreelmediohdricoquerequieran
unaactuacinderestauracinambiental. Porlotanto,tanslohadeaplicarseelcoeficientedeponderacin
decircunstanciasespeciales,queafectaal VDPH:
KX Lainfraccinnohadaadoalacomunidadvegetal KX =1
KRV Eltiempodereversibilidaddeldaoseestimaen01aoKRV =1
KS ElimpactosegeneraenuntramoderoconaguasdestinadasaaguapotableKS =1.5
PorlotantoelValordeldao=(6 387.3x1)+(0x1x1.5)=6 387.3
ValordeldaoalDPH=6 387.3Euros

37 ParaelclculodeestoscostessehautilizadolaBasedePreciosPaisajismo2005.Ingenieray

ArquitecturadelPaisaje, actualizandolosimportesaEurosde2009.

49
INDUROT.UniversidaddeOviedo

Invasionesyocupaciones

EjemploV:Valoracindedaos enelcasodedepsitoderamajesytroncos

Sesuponelaaperturadeunexpedientepordepsitoderamaje(restosdecortadearbolado)enelcaucey
zona de servidumbre del ro Tua sin contar con autorizacin. Se estima que el tiempo empleado en la
retiradaycargadelramajeson4horas,situndoseellugarautorizadoparadepositarlosrestosaunos20
Km.Lavaloracinsellevaracaboselasiguienteforma:
Valor del dao= [VDPH x Kx] + [CRA x KRV x KS ]
DondeelValor DPH =costesderetiradadelramajeycargaencamin+transportedelosrestoshastalugar
autorizado
Costes de retirada del ramaje y camin volquete gra para su transporte 97.3238 /hora x 4
horas=389.28
Transportederestosvegetalesencaminvolquetegra101130CV 1.84 /Km.x20=36.8
ValorDPH =389.28+36.8=426.08
El depsitoderestosderamajenohageneradoimpactosquenecesitendeunarestauracinambiental.
Loscoeficientesdeponderacintomarnlossiguientesvalores:
KX LainfraccinnohadaadoalacomunidadvegetalKX =1
KRV Eltiempodereversibilidaddeldaoseestimaen01aoKRV =1
KS ElimpactosegeneraenuntramoderoconaguasaptasparalavidadelossalmnidosKS =1.5
PorlotantoelValordeldao=(426.08x1)+(0x1x1.5)=426.08

ValordeldaoalDPH=426.08Euros

38 Loscostesderetiradadelramajeincluyen2PeonesRgimenGeneralconmotosierra

50
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Invasionesyocupaciones

EjemploVI:Valoracindedaos enelcasodedepsitodeescombros

Sesuponelaaperturadeunexpedientesancionadorpordepsitodeescombrosenzonasdeservidumbre,
polica y DPH de la margen izquierda del ro Airola, sin contar con autorizacin. El volumen de los
escombrosdepositadosesde150m3.Lavaloracinsellevaracaboselasiguienteforma:
Valor del dao= [VDPH x Kx] + [CRA x KRV x KS ]
DondeelValor DPH =costesdelaretiradadelosescombroseincrementadosconloscostesdetransporte
delosmaterialeshastalugarautorizado
Retirada de escombros con medios mecnicos, incluida la carga de los materiales retirados en
caminytransporteparasudepsitoenlugarautorizado 10.11 /m3 x150m3 =1 516
Se considera que el impacto generado por el depsito de estos escombros hace necesario el
acondicionamientoyrestauracindelosterrenosinvadidos.Loscostesderestauracinambientalpodran
corresponderalossiguientesconceptos:
Restauracintopogrficadelcauceconmediosmecnicos69.33 /horax16horas=1 109.28
Laboreosuperficialdemrgenes 210.35 /hax0.015ha=3.15
Extendidomanualdetierravegetal 17.05 /m3 x45m3=767.25
Siembramanualsemillaspratenses (70.12 /hax0.015)+(4.74/Kg.Semillasx5Kg)=24.75
Preparacin y plantacin de especies arbreas en terreno sueltotrnsito, densidad > 700
hoyos/haypendientedelterreno<50%,ysuministrodeplantonesdevivero(2.87/unidadx
23uds).+(15saucesx1.10/unidad)+(4Alisosx1.03/unidad)+(4Fresnosatlnticosx0.98
/unidad)=90.55
Porloque,CRA =1994.98
Loscoeficientesdeponderacinpodrntomarlossiguientesvalores:
KX LacomunidadvegetalafectadamayoritariamenteesunasaucedaKX =1.6
KRV Eltiempodereversibilidaddeldaoseestimaen>5aosKRV =1.8
KS ElimpactosegeneraenuntramoderosinclasificacinKS =1
PorlotantoelValordeldao=(1 516x1.6)+(1 994.98x1.8x1)=6 016.56
ValordeldaoalDPH=6 01656Euros

51
INDUROT.UniversidaddeOviedo

Obras,trabajosyconstrucciones

EjemploVII:Valoracindedaos porobras(entubaciones)

Sesuponelaaperturadeunexpedientesancionadorporlarealizacindeobrasdeentubamientodelcauce
del regato Fial, con tubos de hormign de 0.80 cm de dimetro y una longitud de 30 m, sin contar con
autorizacin.Lavaloracinsellevaracaboselasiguienteforma:
Valor del dao= [VDPH x Kx] + [CRA x KRV x KS ]
DondeelValor DPH =costesdedemolicinodesmontajedelasobraseincrementadosconloscostesde
transportedelosmaterialesretiradoshastalugarautorizado.
Retiradadelasobrasycargaencaminparasutransporte(incluyetrabajoderetroexcavadoray
camin101130CV) 122.39 /horax8horas=979.12
Transporte de restos de obra a vertedero autorizado (en camin 101130 CV) 1.75 /km x
20km=35
VDPH = 1 014.12
En este caso, se considera que la restauracin ambiental incluira tan slo la restitucin topogrfica del
cauce:
Restauracintopogrficadelcauceconmediosmecnicos69.33 /horax4horas=277.32
Porloque,CRA =277.32
Loscoeficientesdeponderacinpodrntomarlossiguientesvalores:
KX LacomunidadvegetalnosehavistoafectadaKX =1
KRV Eltiempodereversibilidaddeldaoseestimaen01aoKRV =1
KS ElimpactosegeneraenuntramoderosinclasificacinKS =1
PorlotantoelValordeldao=(1 014.12x1)+(277.32x1x1)=1 291.44

ValordeldaoalDPH=1 291.44Euros

52
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Obras,trabajosyconstrucciones (mediantemdulosintegralesdevaloracin)

EjemploVIII:Valoracindedaos porobrasdemayormagnitud

Se supone la apertura de un expediente sancionador por la realizacin de obras consistente en la


construccin de un estanque con muros de hormign en el cauce del ro Revolta, con la finalidad de
almacenaraguaspararegadosincontarconautorizacin.Lavaloracinsellevaracaboselasiguiente
forma:
Valor del dao= [VDPH x Kx] + [CRA x KRV x KS ]
Enestecasolavaloracinsellevaracabomediante mdulosintegralesdevaloracin alconsiderarque,
tanto la retirada de las obras como la restauracin ambiental, necesitaran de un elevado nmero de
actuacionesdiversas.
Valor DPH =costesdedemolicinodesmontajedelasobraseincrementadosconloscostesdetransporte
delosmaterialesretiradoshasta lugarautorizado.
Coste de las actuaciones destinadas a la eliminacin de las obras respecto a la superficie
acondicionada, siendo el rea afectada de 225 m2 (incluye demolicin obras, mano de obra,
transportedemateriales,etc) 13.78 /m2 x225m2 =3 100.5
VDPH = 3100.5
Elcostedelasactuacionesderestauracinambientalrespectoalasuperficierestauradaincluyeunagran
diversidaddeconceptoscomolarestitucintopogrficadelcauce,aportedetierra,materialesdeprstamo,
siembras,etc
Costeactuacionesrestauracinambientalrespectoalasuperficierestaurada 11.81 /m2 x225
m2 =2 657.25
Porloque,CRA =2 657.25
Loscoeficientesdeponderacinpodrntomarlossiguientesvalores:
KX LainfraccinaafectadoalrestodeecosistemasnoincluidosKX =1.2
KRV Eltiempodereversibilidaddeldaoseestimaen15aosKRV =1.4
KS ElimpactosegeneraenuntramodelrodeclaradocomozonasensibleKS =1.5
PorlotantoelValordeldao=(3 100.5x1.2)+(2 657.25x1.4x1.5)=9 300.82

ValordeldaoalDPH=9 300.82Euros

53
INDUROT.UniversidaddeOviedo

Cortadearbolado

EjemploIX:Valoracindedaos porcortadearbolado

Sesuponelaaperturadeunexpedientesancionadorporlataladerboles(fresnosyalisos)enlazonade
ribera del ro Covadonga sin contar con autorizacin. La estimacin de rboles talados asciende a 87
fresnosy6alisos.Lavaloracinsellevaracaboselasiguienteforma:
Valor del dao= [VDPH x Kx] + [CRA x KRV x KS ]
DondeelValorDPH = rbolestaladosxvalordelosmismos
Suponiendoqueenestecasohasidoposibleestablecerelvolumendemaderataladasiendo14.9
m3 enlosFresnosy0,53m3 enlosAlisos.Portanto,aplicandolospreciosdemaderaenpiedela
tabla8 (34.31 /m3 x14.9m3)+(21.60 /m3 x0.53m3)=522.67
Porloque,VDPH = 522.67
La restauracin ambiental sellevar cabo a travs de la sustitucin de los rbolestalados por otros ms
jvenesdelamismaespecie,medianteunareforestacindelreaafectada.Suponiendoqueladensidades
> 700 rboles por hectrea, la pendiente del terreno es < 50%, y el tipo de suelo es sueltotrnsito, los
costessern:
Preparacin y plantacin de especies arbreas en terreno sueltotrnsito, densidad > 700
hoyos/haypendientedelterreno<50%,mselimportedesuministrodeplantonesdevivero
(2.87 /unidad x 93 unidades). + (6 Alisos x 1.03 /unidad) + (87 Fresnos atlnticos x 0.98
/unidad)=359.15
CRA = 359.15
Loscoeficientesdeponderacinpodrntomarlossiguientesvalores:
KX LacomunidadvegetalafectadaesunaFresnedaKX =1.8
KRV Eltiempodereversibilidaddeldaoseestimaen>5aosKRV =1.8
KS Elimpactosegeneraenunazonadeclaradadeproteccinespecial(LICRoSella)KS =2
PorlotantoelValordeldao=(559.47x1.8)+(359.15x1.8x2)=2 299.99
ValordeldaoalDPH=2 299.99Euros

54
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Plantaciones,siembrasylaboresdearadonoautorizadas

EjemploX:Valoracindedaos porunaplantacinnoautorizada

Sesuponelaaperturadeunexpedientesancionadoraunparticularporlaplantacin,sinautorizacin,de12
rboles frutales que llegan a invadir el DPH. Adems, dicha plantacin ha llevado asociada trabajos de
limpiezadelavegetacinarbustivapropiadellugar.Lavaloracinsellevaracaboselasiguienteforma:
Valor del dao= [VDPH x Kx] + [CRA x KRV x KS ]
DondeelValorDPH = costesdeeliminacindelaplantacin+transportedelosrestoshastalugarautorizado
Taladoderboldedimetro1530 cm,troceadodelmismo,extraccindetocn,cargaderamas,
tocn y resto de productos resultantes, relleno y compactado del hueco resultante con tierras
propias. 31.96 /unidadx12rboles=383.52
Transportederestosvegetalesencaminvolquetegra101130CValugarautorizadosituadoa
unos20Kmdedistancia 1.84 /Km.x20Km.=36.8
Porloque,VDPH = 522.67
Se supone que los trabajos de limpieza llevados a cabo hacen necesario un acondicionamiento de 0,01
hectreasdeterrenoparafavorecerlarecuperacinnaturaldelavegetacinexistenteantesdelaactuacin
infractora:
Extendidomanualdetierravegetal 17.05 /m3 x40m3=682
Siembramanualsemillaspratenses (70.12 /hax0.01)+(4.74/Kg.Semillasx 4Kg)=19.66
Porloque,CRA =701.66
Loscoeficientesdeponderacinpodrntomarlossiguientesvalores:
KX LacomunidadvegetalafectadaseconsideracomorestodeecosistemasKX =1.2
KRV Eltiempodereversibilidaddeldaoseestimaen01 aoKRV =1
KS ElimpactosegeneraenuntramoderosinclasificacinKS =1
PorlotantoelValordeldao=(522.67x1.2)+(701.66x1x1)=1 328.86
ValordeldaoalDPH=1 328.86Euros

55
INDUROT.UniversidaddeOviedo

Vertidosdeaguasresiduales

EjemploXI:Valoracindedaosprovocadosporunvertidoindustrial

Se considera el supuesto de una piscifactora que cuenta con autorizacin de vertido, pero incumple los
valores mximos de concentracin exigidos en la misma en relacin a determinados parmetros
contaminantes, siendo el Fsforo (P) el elemento identificado con mayor ndice de peligrosidad. La
piscifactoravierteauntramoderosalmoncola. Elcauce receptoresunroasturiano (supongamosquees
elroAller) alqueseleestimauncaudaltericomediode7 000 l/salaalturadelpuntodevertido.
Parmetrosdelvertido
Vertido 1 000 m3/da(11.57 l/s)
Fsforo(P) 7.5 mg/l(Valordereferenciasegnlaautorizacindevertido<0.3 mg/l)
Tiempodeduracindelvertido=2 das

Los daos en la calidad del agua por vertidos de aguas residuales se valorarn atendiendo al coste del
tratamientodelvertido,asupeligrosidadyalasensibilidaddelmedioreceptorconarregloalasiguiente
frmuladeestimacinobjetiva:
[ ] [ ]
Valor() = a V KPV KS KRV = 0.12 m3 Qm3 d t[d] KPV KS KRV

Porlotanto, Valor()=0.12 / m3 x1 000 m3/da x2dasxKPV xKS xKRV


Elclculodelcoeficienteadimensionalrelativoalapeligrosidaddelvertido(KPV)sehardeacuerdoalos
valorespresentadosenelanexo3:
ElcoeficienteUsedeterminarcomoelcocienteentreelvalormedidodelparmetro(fsforo)yelvalorde
referenciadedichoparmetro
7,5
U = = 25
0,3
En funcin de su grado de peligrosidad (anexo IV RDPH), el fsforo se incluye dentro del Grupo de
contaminantesBporloqueelKPV secalculadeacuerdoalasiguienteexpresin:
Como1<U(25)<100KPV =0.5U+0.4=(0.5*25)+0.4=12,9
KS Talycomosehaexpuestoenlapresentacindelsupuesto,elimpactosegeneraenuntramodero
conaguasaptasparalavidadelossalmnidos(columnadeinfraccionesporvertidos)KS =2
KRV Dadoelelevadocaudalestimadomediodelroreceptor,seconsideraqueeltiempodereversibilidad
deldaopodrserde01aoKRV =1
Porloque, Valor()=0.12 / m3 x 1 000 m3/da x2dasx12.9x2 x1=6 192

ValordeldaoalDPH=6 192Euros

56
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Descargasoderramespuntuales

EjemploXII:Valoracindedaos provocadosporunderramedeleche

Seconsideraelcasodeuncamincisterna que vierteunexcedente delechealro,estimndoseelvolumen


vertidoenunos 5 m3 (aproximadamente5.15toneladas39). Elcaucereceptoreselmismoqueenelsupuesto
anterior, alque sele estima un caudaltericomedio de 7 000 l/s a la altura del punto de vertido, que se
encuentrasituadoenelcursomediodeestero.
Losmscaractersticodeestosvertidoslcteosessuelevadacargaorgnica,reflejadaenladeterminacin
deparmetroscomolaDBO5ylaDQO,queformanpartedelgrupo decontaminantesC.
Parmetrosdelvertido
Cantidaddescargada(C) unos5 m3.(5.15toneladas)

Losdaosproducidosenlacalidadelaguaporelvertidoderesiduosenestadolquidooenformadelodos
quenoseansusceptiblesdeautorizacindeacuerdoconlalegislacindeaguas,ascomolosproducidos
por descargas o derrames de tipo puntual y de alta carga contaminante, tambin se valorarn
atendiendoalcostedelvertido,asupeligrosidadyalasensibilidaddelmedioreceptorperoconarregloala
siguientefrmuladeestimacin:
KRV KS
Valor () =450+ b M KRV KS = 450[] + b [ t] M[t]
b es el coste de referencia detratamiento del vertido en euros por tonelada(/t). De acuerdo a latabla
presentada en el anexo x, teniendo en cuenta que los parmetros de contaminacin son de alta carga
orgnica,elcostedereferenciaesde150 /t b =150 /t

KRV Dadoelelevadocaudalestimadomediodelroreceptor,ylabajapeligrosidaddelosparmetrosdel
vertido,seconsideraqueeltiempodereversibilidaddeldaopodrserde01aoKRV =1
KS Talycomosehaexpuestoenlapresentacindelsupuesto,elimpactosegeneraenuntramodero
conaguasaptasparalavidadelossalmnidos(columnadeinfraccionesporvertidos)KS =2
Porloque, Valor()= 450 +(150/tx5.15ton.x1x2)=1 995
ValordeldaoalDPH=1 995Euros
En este supuesto se demuestra la mayor penalizacin a los vertidos no autorizables o aquellos por
descargasoderramespuntualesyaquepor5m3 devertidoelvaloreconmicodeldaoes1.995 mientras
queenelsupuestoanterior,paraparmetrosdevertidoparecidos,elvaloreconmicodeldaoesde6.192
por2.000m3.

39 DeacuerdoalaTabladepesosespecficosdelquidos,elfactordeconversindelalecheesde

1 030Kg/m3.

57
3.OTRASCONSIDERACIONES

3.1 IMPLICACIONES DE LA NUEVA NORMATIVA


SOBRE LOS PRINCIPIOS INSPIRADORES DE LA
DIRECTIVAMARCODEL AGUA

Tradicionalmente, uno de los principales problemas que presenta la legislacin


bsica del rgimen sancionador en materia de aguas, aparte de la falta de criterios
objetivosparadesarrollarlasvaloracioneseconmicas,esquelosprincipiosinspiradores
delaDirectivaMarcodelAgua(DMA)annoestnrecogidosendichorgimen.Porlo
tanto,esimportanteanalizarquefectostendrlaaplicacindelanuevanormativasobre
losrequerimientosdelaDMAparaelrgimensancionadorenmateriadeaguas.
LaDMA,dadasubasejurdica,notienecapacidadparaestablecerlimitacionesa
losusosdelagua(exceptoadeterminadosvertidos),perosparaestablecerobligaciones:
laDMApuedepreverlaadopcindemedidaseinstrumentosdirigidosalaconsecucinde
losobjetivosmedioambientalesquepersigue(enelmarcodelapolticamedioambiental
comunitaria). Por ello, parece evidente que su implementacin tendr influencia sobre
ciertos usos del agua y otros mbitos estrechamente relacionados con ellos, como la
planificacindeobrashidrulicasolaordenacindelterritorio.
En efecto, la utilizacin del agua con fines productivos o la realizacin de
actividades y acciones con potencial incidencia sobre el sistema hdrico y su estado
ecolgico deben quedar supeditadas al mantenimiento riguroso de un adecuado
estado delasmasasdeagua.Ellodetermina,entreotrascosas, lanecesidaddeque,por
unlado,lasinstitucionespblicasexijanunaejecucinrigurosadelanormativavigentey,
por otro lado, sean capaces de adoptar nuevos instrumentos y normas de control para
impedirqueempeoreelestadoecolgicodelasmasasdeaguayevitarlaproduccinde
daosambientalesirreversibles40.

40 Congreso Nacional del Medio Ambiente (CONAMA VII) (2004): Aplicaciones de la Directiva Marco del

Agua,DocumentodelGrupo deExpertosGT9,Barcelona,128pp.

59
INDUROT.UniversidaddeOviedo

El primer supuesto se ve favorecido por el hecho de que la normativa de aguas


contiene una regulacin de la utilizacin del dominio pblico hidrulico que cumple
plenamente con las condiciones de la Directiva en relacin a las autorizaciones
administrativasparaactividadesquepuedansercontaminantes,yadems,estableceun
rgimen de concesiones y autorizaciones que es, administrativamente, mucho ms
exigentequelapropiaDirectiva,puestoquesonnecesariasparacualquierusoprivativo
de los bienes pertenecientes al dominio pblico hidrulico y no slo para aquellos que
puedancontaminarelagua41.
Elsegundosupuesto(laadopcindenuevosinstrumentosynormasdecontrolpara
impedirqueempeoreelestadodelasmasasdeaguayevitarqueseproduzcandaos
ambientalesirreversibles),exigeunamodificacindelsistemasancionadorquefacilitela
consecucindeunbuenestadoecolgicodelasmasasdeagua,principalobjetivodela
DMA. Lanuevanormativaimplantada porelMinisteriodeMedioambienteyMedioRural
y Marino (la Orden MAM/85/2008) ha introducido por primera vez la obligatoriedad de
incrementarlasvaloracionesponderandolamayorsensibilidadyvalornaturaldelmedio
afectado, dando as una mayor relevancia que hasta el momento a los aspectos
ambientales y el estado de conservacin y proteccin de las zonas afectadas. No
obstante, este avance es escaso en comparacin con las exigencias ambientales que
acarreaelconceptodebuenestadoecolgicopromovidoporlaDMA:mientrasquesta
esunanormaeminentementeambientalydefineyobligaaespecficosparmetros
fsicoqumicos, biolgicos e hidromorfolgicos de los recursos hdricos los
parmetros de ponderacin de la MAM/85/2008 siguen centrados en vagos
conceptos de calidad de las aguas (por ejemplo la clasificacin de los tramos de ro
comozonasaptasparaelbao,lavidade salmnidos,etc.)
Porotrolado,laDMA,ensuArtculo23,haceunareferenciaexplicitaalrgimen
sancionador de los Estados Miembros estableciendo tres criterios bsicos que ha de
cumplir:lassancionesaimponerdebenser efectivas,proporcionadasydisuasorias .
En primer lugar, y en relacin al principio de efectividad, hay que decir que la
Directiva exige a los Estados Miembros que garanticen la correcta aplicacin de sus
disposiciones mediante un rgimen sancionador adecuado. En este sentido, la nueva
normativanoaportanovedades,yaquenoincideenlascompetenciasdelasdiferentes
administracionesalahoradeimponerlassancionesrelativasalosusosdelDPH.
En segundo lugar, la exigencia del principio de proporcionalidad entre la
trascendenciadelasactuacionesinfractorasylascuantaseconmicasdelassanciones,
sisevedirectamenteafectadaporlaaplicacindela OO.MMMAM/85/2008.Lascuantas
econmicas estn estrechamente ligadas a la valoracin econmica de los daos
causadosenelDominioPblicoHidrulico,deformaqueunavezestimadalacuantade
stos,setipificalagravedaddelainfraccinyseimponelasancin.
Con el objetivo de analizar el impacto especfico de la aplicacin de la nueva
normativasobreelprincipiodeproporcionalidad,elINDUROTllevacaboen200742 un
ensayo valorativo destinado a poner de manifiesto las diferencias que surgan entre los

41SnchezdeMiguel,M.C.yA.MuoaBlas. Elnuevomarcocomunitariodegestindelosrecursoshdricos
ylaadaptacindelapolticadeaguasenelEstadoespaol,ponenciapresentadaenelVICongresoIbrico
sobre PlanificacinyGestindeAguas,Tortosa2004.
42 INDUROT. EnsayodevaloracinsegnloscriterioscontenidosenelproyectodeOrdenMinisterialparala
valoracindedaosalDPH. Asturias,2007.

60
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

anterioresprocedimientosvalorativosylosestablecidosporelanteproyectodelanueva
Orden Ministerial. Para la realizacin dicho estudio se eligi una muestra de 24
expedientes de infracciones, todas cometidas en 2005 excepto una (de 2001), y en las
quelosserviciosdelaCHNhabanrealizadoensudaunavaloracindedaosalD.P.H.
paradeterminarlacalificacindelainfraccin.Dichosexpedientesestabanrelacionados
fundamentalmenteconinfraccionesporobrasydepsitos.
Tomandocomo punto de partida el tipo de valoracin realizada en su da por los
tcnicos de la CHN (las mismas dimensiones, unidades de obra, tipo de recursos
empleados,etc.), se volvi avalorareldaocausadoalD.P.H.,teniendoencuenta, como
exigelanorma,preciosdemercadode2005ylavaloracindetodosaquelloselementos
queahorasedeberancontemplarenlavaloracinyensudanosetuvieronencuenta
(fundamentalmente,costesdetransportedematerialesaunlugarautorizadooadecuado).
Estodaraunaideadelvalordeldaoquehabraresultadodeaplicar,enelmomentode
tramitarseelexpediente,lavaloracin exigidaporlaOO.MM.
Dicho estudio lleg a la conclusin de que las infracciones inicialmente
calificadas como Leves fueron especialmente sensibles a la aplicacin de los
nuevos criterios valorativos, y en una proporcin del 57% pasaron a ser
consideradascomo Menosgraves alaluzdelaaplicacindelanuevanormativay
sin tener en cuenta la trascendencia de los coeficientes de mayoracin que propone la
Orden (cuya aplicacin incrementa este porcentaje). Este efecto es especialmente
intenso enelcasodelos expedientesde OBRAS ,quetraslavaloracindeldaoyde
loscostesambientalessegnlaOrdenMinisterial,pasaron en un70% asercalificadasde
Menosgraves .
Esta proporcin se reduce sustancialmente en el caso de las infracciones
inicialmenteconsideradasMenosgraves,calificacinquesemuestramsrobustaalos
incrementosdelasvaloracionesefectuadasdadalaamplitudenelrecorridodelintervalo
recogido por la legislacin vigente (desde 450.76 hasta 4 507.59 ). An as, del orden
del30%deestasinfraccionespasaran,alaluzdelanuevaOO.MM.asercalificadas
como Graves yello,incluso,sintenerencuentalatrascendenciadeloscoeficientesde
mayoracin recogidos por la Orden. No obstante, la aplicacin de dos de estos
coeficientes segn las circunstancias reales que presentaba cada caso (afeccin a
comunidadesvegetalesy tiempoderecuperacin delmedio afectado) parece tener una
capacidad significativa para alterar la calificacin de las infracciones inicialmente
consideradasMenosgraves,queenun50%pasaranaltramoGraves.
Estos resultados dan una muestra clara de la profunda trascendencia que la
aplicacin de esta nueva norma tiene s no se lleva a cabo una modificacin de las
cuantasquemarcanlosintervalosdedaosalosquecorrespondecadanivelde
calificacin. Su aplicacin actual, sin una reforma de la legislacin bsica de aguas,
introducira,adems,unseveroproblemadealteracindelaproporcionalidadentre
losdaoscausadosalD.P.H.ylas multasimpuestasenelcaso,sobretodo,delas
infraccionesleves,quesetraduciraenunnotableendurecimientoenlaaplicacindel
sistemasancionadorsobreaquellasactuacionesconmenorimpactonegativoenelmedio
hdrico.
Por lo tanto, se puede concluir que la aplicacin de los nuevos criterios de
valoracin,establecidosenlaOO.MMMAM/85/2008,tendrunatranscendencianegativa
sobrelaproporcionalidaddelrgimensancionadorenmateriadeaguas,distanciandoan
mslaactualnormativavigentedelprincipiodeproporcionalidadexigidoporlaDirectiva

61
INDUROT.UniversidaddeOviedo

MarcodelAgua.Adems,esteensayovalorativo,ponedemanifiestodenuevounodelos
problemas tradicionales de del rgimen de sanciones, expuesto al principio de este
documento: la normativa a la que se debe atender en el proceso sancionador se
encuentra repartida en dos normas, el Reglamento del Dominio Publico Hidrulico y el
Texto Refundido de la Ley de Aguas, las cuales no estn debidamente armonizadas, y
estoseguirgenerandoproblemasenelfuturo.
En tercer y ltimo lugar, la DMA incorpora el principio de disuasin de las
sanciones,elcualhacereferenciaalacapacidaddestasparadesincentivaroretraeral
infractor, haciendo que el beneficio personal esperado al cometer una accin de las
tipificadasenlanormativaseainferioralcosteprobablequepuedasoportardichoagente.
Latrascendenciadeesteprincipio seabordaen elsiguienteapartado.

3.2 IMPLICACIONES SOBRE EL BENEFICIO DEL


INFRACTOR

EltercerprincipiorecogidoenlaDMAencuestionesdemateriasancionadora,esla
capacidaddisuasoriaylaefectividaddelsistemaparaconseguirlosfinesperseguidos. La
capacidad disuasoria est determinada por el diseo de las sanciones y las
consideracionesacercadelaconductadelosindividuos.
En este sentido, parece evidente que un agente (una persona, un colectivo, una
empresa, un ente pblico, etc.) tendr un incentivo para incumplir la normativa en
materiadeaguassielbeneficionetoqueesperaobtenercontalcomportamientoesmayor
que el que tiene en situacin normal de cumplimiento. A su vez, el beneficio neto de
infringir se puede definir como la diferencia entre el provecho esperado por incumplir
(puede ser un beneficio, un coste evitado, etc.) la legislacin, y el coste probable de
hacerlo (todas las penas yactuaciones impuestas por la normativa que lesuponganun
costealindividuo,multiplicadasporlaprobabilidaddeserdescubiertoinfringiendo).
Esdecir,elagenteinfringirlanormativasiemprequeelincrementoesperadode
beneficios (diferencia entre el beneficio en condiciones normales y el que obtiene si
incumple)seamayorqueelcostequeprobablementetengaquesoportarsisedetectael
incumplimiento.
En sntesis, lo anterior ilustra un sencillo principio: nunca debe ser ms
beneficiosoparaelagenteinfringirquecumplirlanormativa.Portanto,ydejandoa
un lado las cuestiones relacionadas con la probabilidad de ser descubierto para poder
simplificar los clculos, el problema central se reduce a comparar el beneficio adicional
queelinfractorobtieneyloscostesqueleimponeelsistemasinocumplelanormativa.
Estosltimossonrelativamentefcilesdedeterminar:setrata,bsicamente,delacuanta
delamultamsloscostesogastosderivadosdetenerquedevolverelelementodaadoa
su estado original o, en su defecto, tener que indemnizar por los daos y perjuicios
ocasionados.
Tradicionalmente,enelsistemasancionadorpordaosalDPHlaconsideracinde
losbeneficiosobtenidosporelinfractornohasidounodelosprincipiosalosque
se atenda para tipificar las infracciones, y por tanto, para determinar las multas

62
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

mnimas, sino que operaba como uno de los criterios a los que se debe atender para
calificarlagravedaddelasinfracciones.Esdecir,enlaprcticaelbeneficiodelinfractor
quedabarelegado a la posibilidadde ser utilizado como un criteriocomplementario que
permitaseparar,deformajustificada,lamultaimpuestadelamnimaquecorrespondea
un determinado nivel de gravedad. Esto introduca importantes problemas de falta de
capacidaddisuasoriaydeefectividadprcticadelassanciones.
Sinembargo,loscriteriosestablecidospor lanuevaOrdenMinisterial introducen,
aunque de forma indirecta, consideraciones sobre el beneficio obtenido por el
infractoralahoradevalorarlosdaoseconmicosproducidossobreelDPH.Lanueva
normativanoestipulaunmtodo concretoparaestimarelposiblebeneficioobtenidoporel
infractor,peroalvalorareldominiopblicoafectadoapreciosdemercado,incluirelcoste
detratamientodevertidoodemandarquelavaloracineconmicanoseainferiorquelos
cnonescorrespondientesconsigueque,almenoslavaloracineconmicadeldao,se
equipareconelposiblelucrodelinfractordesincentivandodichasactividadesilegales.
Acontinuacinsedetallalasdiversasformasenquepuedeconcretarseellucroal
cometer una infraccin, y como los nuevos criterios de valoracin afectan a estas
actividades:
Puede concretarse en un beneficio econmico directo. Ello ocurre en muy
pocas ocasiones, asociadas con la comercializacin o utilizacin directa de
algunosdelosbienesdelDPH:porejemplo,sisecomercializalamaderatalada
enunbosquederibera.
Puedeconcretarseenuncosteevitado.Estoesloqueocurrenormalmente,ya
que la libre disposicin y uso de los bienes del DPH le suponen un ahorro de
costesogastos,loscualesintentaevitar,amparndoseenlaprobabilidaddeno
ser descubierto infringiendo. Algunos ejemplos son derivar agua superficial o
subterrneademaneranoautorizada(queevitatenerquepagarunaconcesino,
en su caso, la tarifa del agua establecida en el lugar), realizar determinados
vertidosyderramesalasaguas(evitandopagartodoopartedelcanondecontrol
de vertidos, o evitando incurriren loscostes de dar un tratamiento adecuado al
residuo en cuestin), extraer ridos del cauce (evitando adquirirlos pagando un
preciodemercado),etc.
LaOrdenMAM/85/2008 establecequela valoracindeldaoalDPHporcortade
arboladoselleveacaboutilizandopreciosdemercadodelamaderaenpie,odeotros
productosresultantes.Estoequiparala valoracineconmicadeldaoconelposiblelucro
delinfractorporllevaracaboestainfraccin.Delmismomodo,contemplalavaloracin
los costes evitados mediante la inclusin del coste de tratamiento de vertido o el
preciodemercadodelosridos.
Adems, la nueva normativa establece que, para muchas de las infracciones, la
valoracin econmica del DPH afectado (VDPH) no podr ser inferior al importe que
resultara de aplicar, en el momento de la constatacin de los hechos, el canon
correspondienteporutilizacinoaprovechamientodelosbienesdelDPH.Sinembargo,
estaobligacinesdedifcilaplicacinenelmbito delaCHN,yaquetanslotiene
establecidos dichoscnones para el caso de tala derboles y la navegacin de aguas
continentalesenlaCuencaNorte.

63
INDUROT.UniversidaddeOviedo

No obstante, es importante resaltar que la valoracin econmica en s no se


corresponde con el coste en el que incurre el infractor si es descubierto por las
autoridades. Dicha valoracin econmica sirve de base para la tipificacin de las
infracciones y, posteriormente, el establecimiento de las multas o cuantas a pagar. En
consecuencia, en aquellas ocasiones en que resulte conveniente43, la estimacin del
valoreconmicodelDPHafectado(VDPH)yelimportedeloscostesderestauracin
ambiental (CRA) deben operar como un valor de referencia a alcanzar con la
imposicin de la multa, o en su caso, de lasuma de la multay la indemnizacin o la
multaylaobligacindereposicindeldao.

3.3 CRITERIOS ECONMICOS QUE RIGEN LA


VALORACINDEDAOSALDPH

3.3.1Qurepresentaycmosemideelvalordelosdaosal
DPH

Elcriteriocentralentornoalcualgiraelrgimensancionadorylatipificacindelas
actuacionesquesuponganunaagresinalDPHeseldel valoreconmicodelosdaos
ocasionadosenelmismo.Ensentidoeconmico,elvalordelosdaossobreelmedio
ambienteequivalealaprdidaeconmica(prdidadebienestar)queseproduceal
degradarseodesaparecerunservicio,funcinopropiedadambientaldeterminada.
A la hora de hablarsobre las tcnicas existentes para la valoracin monetaria de
daos medioambientales se puede identificar una amplia familia de mtodos de
estimacin.Estafamiliacomprendetantomtodosdevaloracineconmicaensentido
estricto (basados en curvas de demanda, en preferencias sociales) como un grupo
diferentedetcnicasdevaloracinbasadasen precios establecidosporlosmercados.
En teora, los enfoques de valoracin econmica y los basados en precios son
bastante distintos (Brouwer y Pearce, 2005). Los primeros no estn afectados por
mercados, estn basados en las preferencias de los individuos y proporcionan
directamente medidas de bienestar y estimaciones de beneficios y prdidas
medioambientalesporestarazn,sonmuyimportantesenlosanlisiscostebeneficiode
polticas y programas relacionados con el medio ambiente (merece la pena desde el
punto de vista del beneficio social abordar una determinada medida ambiental?). Las
segundastcnicas,entrelasqueseencuentranlosenfoquesbasadosencostes,parten
de las observaciones de precios de mercado, que no tienen por qu reflejar el valor
econmico de un bien (cunto cuesta llevar a cabo una determinada poltica o
actuacin?). Adems, aunque estos ltimos mtodos proveen informacin til para
determinarloscostesdeprotegeroreponeractivosmedioambientales,nosoncapacesde
aportarinformacinsobrelosbeneficiosdehacerlo.

43 Aquellas en las que el beneficio del infractor se convierte en una de las magnitudes ms

relevantesaconsiderar,yaqueladiferenciaentresucuantayelcosteprobablequetengaquesoportarel
infractorencasodeserdescubiertorepresentanparaelagenteunincentivocontinuoaincumplir.

64
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Tabla 12.Diferenciasbsicasentrevaloreconmicoy el costedeldaoalDPH


Valoreconmicodel RequierelaaplicacindeTCNICASDE Difcilmente
Daosal impactoambiental? VALORACINECONMICA abordables
DPH
Coste(deldao) RequieredisponerdeINFORMACINBASADA Esposible
ambiental? ENCOSTES/PRECIOS abordarlo

Sin embargo, existen algunas razones de peso por las que, en determinadas
ocasiones,puedeservlidooinclusorecomendableadoptarunenfoquedecostes44
paravalorarmonetariamenteundaoambiental:
La aplicacin de mtodos de valoracin econmica suele requerir estudios
relativamentecostosospararecabarlainformacinyprofesionalesconunamplio
conocimientodelaaplicacindelosdistintosmtodos.
Los mtodos de valoracin econmica arrojan resultados difcilmente
generalizables o extrapolables fuera del contexto del propio estudio, por lo que
son bastante especficos y requieren ser diseados y aplicados de forma
particularizadayespecfica.
Losenfoquesdevaloracinbasadosencostesseintegranbastantebienconel
resto del anlisis econmico que introduce la Directiva Marco del Agua,
especialmenteconlaevaluacincosteefectividaddemedidas.
En la prctica, se suele disponer de abundante informacin sobre costes, en
contraposicin al escaso conocimiento de preferencias sociales y valores
econmicosdelosrecursosnaturales(entreellos,elagua).
Concretamente, para el caso de valoracin econmica de daos al DPH, existe
adems un aspecto que resulta clave a la hora de inclinarse por tcnicas valorativas
basadasencostes:elanlisisdelosprincipiosquesubyacenenlanormativavigenteen
materiadeaguas.Porunlado,lanormativapersigueenltimotrminolaproteccindel
DPH, ya que su buen estado es, indirectamente, garanta de continuidad de los usos
socioeconmicos y funciones ambientales que dependen de l, y est en lnea con el
principal objetivo de la DMA de conseguir el buen estado ecolgico de las masas de
agua.Porello,unodelosobjetivosesencialesdelrgimensancionadoresquelos
daos ocasionadosporactuacionesinfractoras sean,entodocasoeindependientemente
de la sancin impuesta, reparados, de forma que el DPH sea devuelto a su estado
original:paraello,elinfractoresobligadoareponerlosdaoscausadossiemprequeello
sea posible o, en su defecto, la Administracin puede encargarse de la ejecucin
subsidiaria.Almismotiempo,algunaspartesdelarticuladoponentambindemanifiestola
relevancia recaudatoria del sistema sancionador de cara a afrontar las inversiones o
reparacionesnecesariaspararestituirelDPHasuestadoprimitivo.Muestrasdetodolo
anteriorsepuedenencontrarenlosartculos118delaLeydeAguasy323,325,338y
339delReglamentodelDPH.
Por tanto, y a la luz de los principios que rigen la actual normativa de aguas, se
puede establecer un claro paralelismo entre la alusin de la legislacin al valor de los
daosalDPHylanecesidaddeestimarenlaprcticaloscostesmonetariosdedevolver

44 Entendido comoun secondbest (losegundomsapropiado).

65
INDUROT.UniversidaddeOviedo

el DPH al estado anterior a la produccin del dao. Este hecho resulta clave para la
eleccin del enfoque valorativo ms recomendable, que descarta definitivamente la
aplicacindeotrosmtodosyadescritoscomolosde valoracineconmica olautilizacin
de algunas otras tcnicas que tambin incorporan precios de mercado (costes de
sustitutivos, costesdelosdaosevitados,funciones dosisrespuesta,etc.)45.
Enestesentido,lanormativaespaolaenmateriasancionadoradelrgimende
aguasseadecuaaestospreceptosadoptandounenfoquevalorativobasadoenla
estimacin de los costes ambientales de las actuaciones infractoras. Es decir, la
valoracin econmica se concreta en la cuantificacin monetaria de los esfuerzos por
devolver el DPH a su estado original. Aqu cabe destacar que el enfoque adoptado no
consideralosposiblescostessobreterceros (otrosagenteseconmicosdistintosdela
Administracin)quesepuedanderivardeunaactuacininfractora(prdidaseconmicas
enactividadesproductivas,riesgosparalasalud,etc.),ysecentraenlosdaossobreel
DPHquetrasladenosuponganuncosteefectivoalaAAPPresponsabledevelarporsu
buenestadoycalidad.
Noobstante,lanormativavigentepresentaalgunosproblemasdesdeunpuntode
vistaeconmicoquelaintroduccindelanuevaOrdenMAM/85/2008nohaconseguido
subsanar.Unanlisisdedichasdificultadessepresentaacontinuacin.

3.3.2 Problemas que presenta actualmente la valoracin


econmicadedaosalDPH

A pesar de que la nueva OO.MM ha conseguido mejorar y agilizar el rgimen


sancionador, estableciendo mtodos de valoracin homogneos e introduciendo nuevos
conceptoscomolaobligacindecontabilizarloscostesderestauracinambientalyuna
mayoratencinalosaspectosambientales,partedelosnuevoscriteriosannoresultan
adecuadosdesdeunapticaeconmica.Lasprincipalescarenciasquesehandetectado
son:

45Aunque de nuevo se trata en general de enfoques basados en precios (excepto las funciones dosis
respuesta,queseconsiderancomotcnicasdevaloracineconmica),puedenresultartilesalahorade
valorar el aprovechamiento de determinados recursos naturales y los beneficios que generan para la
sociedaddeterminadosserviciosambientales.Elmtododelcostedelsustitutivotratadeanalizarelcoste
deunbienoserviciodemercadocuyoprecioesconocido,yquepuedeserunsustitutivodelrecursonatural
o servicio ambiental estudiado (un ejemplo tpico es el del anlisis del valor de las leas por medio del
estudiodelpreciodemercadodeotroscombustiblesalternativoscomoelcarbn,elpetrleo, elgas,etc.).El
costedelosdaosevitadosseusaparavalorarciertosserviciosyfuncionesambientales(sobretodolasde
carcterprotector,comolaproteccincontralaerosin,lasavenidas,lacalidaddelagua,etc.)analizandoel
coste de los daos que se evitan cuando tales funciones discurren normalmente, lo que es lo mismo, el
coste de los daos que potencialmente se produciran si stas no existiesen o sufrieran un deterioro (por
ejemplo,sepuedevalorarlafuncindeproteccinanteavenidasquecumpleunbosquederiberaapartirde
los daos evitados, es decir, los costes que previsiblemente seproduciran si no existiera el bosque. Las
funcionesdosisrespuestasonungrupodetcnicasadecuadascuandoexisteunarelacinentreunrecurso
natural (que acta como un insumo) o la calidad ambiental y la produccin de bienes o servicios de
mercado,demodoqueesposibleconocercuntoinfluyelacomponenteambientalenlaproduccin(ypor
ende,enelbeneficio)delbienprivado(porejemplo, culessonlasprdidasesperadasenlascosechasante
unaumentodelalluviacidaylacontaminacindelaire).

66
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Amenudo, lasvaloracionessebasanenlautilizacindepreciosdemercado
que,aunquefacilitayagilizalafasevalorativa,noconducealaobtencindel
valor econmicorealdel dao,sinoacuantificacionesmonetariasdeotrandole
(msrelacionadasconelbeneficiodelinfractoruotrasconsideraciones).
Relacionado con lo anterior, con frecuencia se suelen mezclar en los clculos
conceptos totalmente diferentes, y que es preciso distinguir bien, como son
los costes de reposicin o costes ambientales y los beneficios obtenidos
porelinfractor.
Finalmente, tambin produceconfusin desde unpunto devista econmico, los
conceptos a valorar en algunos de los apartados de la norma y la terminologa
utilizadaparadefinirlos.Esteeselcasocuando loscostesdeeliminacin (como
porejemploloscostesdedemolicindelasobrasoloscostesdeeliminacinde
lasplantaciones) seagrupanbajoelepgrafede valoreconmicodeldaoal
DPHafectado(VDPH) ,cuandoenrealidadsetratadecostesderestauracin
ambiental, puesto que son los costes en los que incurre la Administracin
competenteparadevolverelDPHaunestadolomscercanoposiblealoriginal.
Porlotanto,conelobjetivodeconseguirunametodologadevaloracindedaos
al DPH correcta desde un punto de vista econmico, habra que corregir este tipo
confusionesquerestansolvenciayexactitudalprocesovalorativodelosdaos.

3.4CONCLUSIONES

LaOO.MMMAM/85/2008estableceloscriteriostcnicosaplicablesalavaloracin
delosdaosalDominioPblicoHidrulico,dandounarelevancianotablealosaspectos
ambientales y el estado de conservacin y proteccin de las zonas afectadas. El
establecimiento de dichos criterios ha servido para superar la falta de una articulacin
objetiva y uniforme de procedimientos de valoracin, lo que representaba una de las
mayoresdificultadesalasquesehanenfrentabanlosOrganismosdeCuencaalahorade
aplicarelrgimensancionadorenmateriadeaguas.Sinembargo,laredaccindedicha
normativa no profundiza en la interpretacin y aplicacin de los nuevos criterios
establecidos, ni establece costes, precios y valores directamente aplicables por los
organismosdecuenca enelprocesodevaloracindedaosalDPH.
Este Manual Prctico ha intentando solventar los problemas que podran
presentarse a la hora de aplicar la nueva normativa, ofreciendo una explicacin ms
detalladadelosconceptosquedebenincorporarseala valoracindedaosporcadatipo
deinfraccinalDPH,ascomofacilitandolaaplicacin delosnuevospreceptosporparte
de los tcnicos del organismo de cuencay proporcionandovalores,costesy precios de
mercado aplicables durante el proceso sancionador en el mbito de la Confederacin
HidrogrficadelCantbrico.
Lanuevanormativanoslotieneunefectodirectosobrelahomogeneizacindelos
criteriosaplicablesalavaloracineconmicadelosdaosproducidosalDPH,sinoque
influye indirectamente a otros elementos que afectan a la eficacia y efectividad del
rgimen sancionador en materia de aguas. Por un lado, la aplicacin de los nuevos
criterios puede tener una trascendencia negativa sobre la proporcionalidad del proceso

67
INDUROT.UniversidaddeOviedo

sancionadorsiendonecesariaunarevisindelascuantaseconmicasapagarportipo
deinfraccin,establecidasenlaLeydeAguas.Porotrolado,incorporadeunaformams
eficazconsideracionessobreelbeneficiodelinfractor,lascualesnosetenanencuenta
encriteriosdevaloracinprecedentes.
Finalmente, la normativa vigente an presenta interrogantes en cuanto a la
conciliacin de los criterios con la teora econmica que han de solventarse para
garantizarunametodologadevaloracinadecuadaycorrecta.

68
DOCUMENTACINUTILIZADA

Asturias.SociedadAsturianadeestudiosEconmicoseIndustriales(SADEI) Cuentas
econmicasdelaagriculturaasturiana2006.2006[ref.de15deenero2009]
Disponible enWEB enladireccin http://www.sadei.es.
BalairnPrez,L. Gestinderecursoshdricos,EdicionesUPC,Barcelona,2000478pp.
Brouwer,R.yPearce,D. CostBenefitAnalysisandwaterresourcemanagement. Edward
Edgal,UK,2005404pp.
ConfederacinHidrogrficadelNorte. PlanHidrolgicoNorteIyII.Sntesis.Varios
volmenes. 1997.
ConfederacinHidrogrficadelNorte. Informesobrelosartculos5y6delaDirectiva
Marco2000/60/CE. 2005.
ConfederacinHidrogrficadelNorte. DocumentosparalaimplantacindelaDirectiva
MarcodelAgua. 2005
CongresoNacionaldeMedioAmbiente(CONAMAVII). AplicacionesdelaDirectivaMarco
delAgua. DocumentodelGrupodeExpertosGT9,Barcelona,2004128pp.
DehesadelaJara,S.L. BasedepreciosPaisajismo2005.IngenierayArquitecturadel
Paisaje(6Edicin),conelpatrociniodelaAsociacinEspaola deParquesy
JardinesPblicos. Madrid,2005345p.
EdwardsJonesetal. EcologicalEconomics:anintroduction. BlackwellScience,Oxford,
UK,2000266pp.
Espaa.MinisteriodeAgricultura,PescayAlimentacin. Anuariodeestadstica
agroalimentaria2004,disponible[ref.de14deenero2009]DisponibleenWEBen
ladireccin http://www.mapa.es/es/estadistica/pags/anuario/introduccion.htm
Espaa.MinisteriodeAgricultura,PescayAlimentacin. EstadsticadePrecios
percibidos,pagadosysalariosagrarios2005.[ref.de09deenero2009]Disponible
enWEB enladireccin
http://www.mapa.es/es/estadistica/pags/PreciosPercibidos/salariosagrarios/salarios
_agrarios.htm

69
INDUROT.UniversidaddeOviedo

Espaa.MinisteriodeMedioAmbienteyMedioRuralyMarino. PlanHidrolgicoForestaly
derestauracindecaucesyenclavesnaturalesenAsturiasyGalicia,Secretarade
EstadodeAguasyCostas2000.
INDUROT. EnsayodevaloracinsegnloscriterioscontenidosenelProyectodeOrden
MinisterialparalavaloracindedaosalDPH.Asturias,2007.
SahnArtiga,B.yJ.M.MurilloDaz. Identificacindeaccionesyprogramacinde
actividadesdederecargaartificialdeacuferosenlascuencasintercomunitarias,
IGME.2000.

70
ANEXO 1: VALORES DE LOS
COEFICIENTESDEPONDERACIN

Tabla 13.Coeficientesdecircunstanciasespeciales(K X)paraextraccionesilegalesdeagua.

TIPODE
ESTADOCUANTITATIVO K X
EXTRACCIN

Caudalextradoilegalmentemenordel50%del
caudalmedioestimadocirculanteporelcauce
duranteelperododelainfraccin.Elcaudal 1.0
aguasdebajodelaextraccinnoesinferiorque
elcaudalecolgico.

Aguas Caudalextradoilegalmentesuperioral50%del
superficiales caudalmedioestimadocirculanteporelcauce
duranteelperododelainfraccin.Elcaudal 1.2
aguasdebajodelaextraccinnoesinferiorque
elcaudalecolgico.

Caudalescirculantesinmediatamenteaguas
debajodelaextraccinmenoresalcaudal 2.0
ecolgico.

Sinefectosnotablesenelmedioy/oenlos
1.0
nivelesdeotrospozosdelmismoacufero.
Aguas
subterrneas
Acuferosdeclaradossobreexplotadosymasas
deaguasubterrneaenriesgodenocumplirlos 2.0
objetivosmedioambientales

Ambostipos Situacindeclaradadesequa. 2.0

Fuente:OO.MMMAM/85/2008

71
INDUROT.UniversidaddeOviedo

Tabla 14.Coeficientesdecircunstanciasespeciales(K X)paraelrestodeinfracciones.


COMUNIDADVEGETAL
K X
AFECTADA
Abedulares 2
Adelfares 1.6
Alamedas 1.8
Alisedas 2
Alocares 1.6
Avellanedas 2
Choperas 1.4
Fresnedas 1.8
Hayedos,robledales,melojaresyencinares 1.8
Loreras 2
Mimbreras 1.6
Olmedas 1.8
Saucedas 1.6
Tarayales 1.8
Restodeecosistemas 1.2
Lainfraccinnohadaadoalacomunidad
1
vegetal
Fuente: OO.MMMAM/85/2008

Tabla 15.Valoresdelcoeficientedereversibilidad(K RV).


TIEMPODEREVERSIBILIDAD K RV
0 1ao 1
1 5aos 1.4
>5aos 1.8
Irreversible 2
Fuente: OO.MMMAM/85/2008

72
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Tabla 16.Valoresdelcoeficientedesensibilidaddelmedioreceptor(K S).


K S
CLASIFICACINDELMEDIORECEPTOR(1) Restode Infracciones
infracciones porvertidos
Reservasnaturalesfluviales
2.0
Zonasdeclaradasdeproteccinespecial

Zonassensibles(2)
3.0
Aguasdestinadasalaproduccindeaguapotable

Permetrosdeproteccin(3)
1.5
Aguassubterrneas

Aguasaptasparalavidadelossalmnidos 2.0

Zonasaptasparaelbao 1.8

Aguasaptasparalavidadelosciprnidos
1.2 1.3
Aguasaptasparalacrademoluscos

Sinclasificacin 1.0 1.0


Fuente: OO.MMMAM/85/2008
(1) Segn real decreto 927/1988 y teniendo en cuenta los objetivos, para cada
horizontetemporal,delplanhidrolgicodecuencavigente.
(2) Zonas sensibles declaradas por Resolucin de 10 de julio de 2006 (BOE

28/7/06)
(3) Permetroscontempladosenelartculo56.3delTextoRefundidodelaLeyde

Aguas.

73
ANEXO 2: DOTACIONES DE
VERTIDO.

Tabla 17. Dotacionesdevertidoenlitrosporhabitanteyda,segnlapoblacinabastecida


yelniveldeactividadcomercial
Poblacinabastecida Actividad comercial Actividadcomercial Actividad comercial
(habitantes) alta media baja

<10.000 220L/hab./da 190L/hab./da 170L/hab./da

10 000 50 000 240L/hab./da 220L/hab./da 190L/hab./da

50 000 250 000 280L/hab./da 250L/hab./da 220L/hab./da

>250 000 330L/hab./da 300L/hab./da 260L/hab./da

Fuente: OO.MMMAM/85/2008

75
ANEXO 3: PARMETROS DE
CONTAMINACIN Y VALORES DE
REFERENCIA.

Tabla 18. ParmetrosdecontaminacinyvaloresdereferenciadelGrupoA:sustancias


peligrosas.
Reglamentodonde
aparecen
GrupoA Vr(mg/l)
I II III
1,1,1 Tricloroetano 0.1 x

1,2 Dicloroetano 0.01 x x

Alacloro 0.0003 x

Aldrn 0.00001 x

Antraceno 0.0001 x

Arsnico 0.05 x

Atrazina 0.001 x x

Benceno 0.03 x x

Benzo(a)pireno 0.00005 x

Benzo(b)fluoranteno 0.00003 x

Benzo(g,h,i)perileno 0.000002 x

Benzo(k)fluoranteno 0.00003 x

C1013cloroalcalanos 0.0004 x

Cadmio 0.005 x x

77
INDUROT.UniversidaddeOviedo

Reglamentodonde
aparecen
GrupoA Vr(mg/l)
I II III
Cianurostotales 0.04 x

Clorobenceno 0.02 x

Clorofenvinfos 0.0001 x

Cloropirifos 0.00003 x

Cobre 0.005 x

Cromo 0.05 x

Di(2etilhexil)ftalato 0.0013 x

Diclorobenceno 0.02 x

DDTymetabolitos 0.000025 x

Diclorometano 0.02 x

Dieldrn 0.00001 x

Pentabromodifenilter 0.0000005 x

Diurn 0.0002 x

Endosulfn 0.000005 x

Endrn 0.000005 x

Etilbenceno 0.03 x

Fluoranteno 0.0001 x

Fluoruros 1.7 x

Hexaclorobenceno 0.00003 x x

Hexaclorobutadieno 0.0001 x x

Hexaclorociclohexano 0.0001 x x

Indeno(1,2,3cd)pireno 0.000002 x

Isodrn 0.000005 x

Isoproturn 0.0003 x

Lindano 0.0001 x

Mercurio 0.001 x x

Metolacloro 0.001 x

Naftaleno 0.005 x x

Nquel 0.05 x x

Nonilfenoles 0.003 x

Octilfenoles 0.0001 x

78
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Reglamentodonde
aparecen
GrupoA Vr(mg/l)
I II III
Pentaclorobenceno 0.000007 x

Pentaclorofenol 0.002 x x

Percloroetileno 0.01 x

Plomo 0.05 x x

Selenio 0.001 x

Simazina 0.001 x x

Terbutilazina 0.001 x

Tetraclorurodecarbono 0.012 x

Tolueno 0.05 x

Tributilestao 0.00002 x

Triclorobencenos 0.0004 x x

Tricloroetileno 0.01 x

Cloroformo 0.012 x

Trifluralina 0.00003 x

Xileno 0.03 x

Zinctotal 0.03 x

ListaI:sustanciascontenidasenlaOrden de12/Noviembre/ 1988


ListaII:sustanciascontenidasenelRD995/2000,de2dejunio,
por el que se fijan objetivos de calidad para determinadas
sustanciascontaminantesysemodificaelRDPH
ListaIII:sustancias contenidas en la Decisin N 2455/2001/CE
del Parlamento Europeo y del Consejo de 20 de noviembre de
2001,porlaqueseapruebalalistadesustanciasprioritariasen
elmbitodelapolticadeaguas.

Fuente: OO.MMMAM/85/2008

79
INDUROT.UniversidaddeOviedo

Tabla 19. ParmetrosdecontaminacinyvaloresdereferenciadelGrupoB:contaminantes


GrupoB Vr(mg/l)
Amoniototal 1

Bario 1

Berilio 1

Boro 1

Clorototal 0.005

Cobalto 1

ndicedefenoles 0.1

Fsforototal 0.4

Fosfatos 0.7

Hidrocarburos 1

Hierro 2

Manganeso 1

Magnesio 1

Nitratos 50

Nitritos 0.03

NitrgenoKjeldahl 3

Tensoactivosaninicos 0.5

ToxicidadenUT 1

Vanadio 1

Biocidasyproductosfitosanitarios 0.001

ContaminantesanexoIIRDPH,no

definidosenlosgruposAni C

Fuente: OO.MMMAM/85/2008

80
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Tabla 20. ParmetrosdecontaminacinyvaloresdereferenciadelGrupoC:otros


contaminantes
GrupoC unidades Vr
Incrementotemperaturadelagua C Tdelmedio3C

Unidadesde
Ph 5.59
pH

Conductividadelctricaa20C S/cm 1 000

Cloruros mg/L 200

Sulfatos mg/L 250

Color mgPt/L 200

Slidosensuspensin mg/L 25

DBO5 a20Csinnitrificacin mg/L 7

DBO mg/L 30

Coliformesfecales UFC/100ml 20 000

Coliformestotalesa37C UFC/100ml 50 000

Enteovirus PFU/10ml 0

Estreptococosfecales UFC/100ml 10 000

Salmonelas En1L Ausencia

Otrosparmetrosmicrobiolgicos

Fuente: OO.MMMAM/85/2008

81
ANEXO 4: DETERMINACIN DE LA
TOXICIDAD.

Uno de los parmetros incluidos dentro del Grupo B de contaminantes es aquel


relativo a la toxicidad del vertido sobre organismos acuticos. Para la consideracin de
esteparmetroseseguirnloscriteriosqueseestablecenacontinuacin:
a) La toxicidad de una muestra se mide mediante los ensayos de toxicidad aguda
sobrepeces,daphniayalgasrealizadosconformealassiguientesnormas:
Testdetoxicidadagudaenpeces.EnsayoCEEC.1.,OCDE203
TestdeinmovilidaddeDaphniamagna.EnsayoCEEC.2.,OCDE202
Testdeinhibicindelcrecimientodealgas.EnsayoCEEC.3.,OCDE201

b) LaToxicidadseexpresaenunidadesdetoxicidad(UT)ysecalculadeacuerdoa
lasiguienteexpresin:
Toxicidad(UT)=100/CL(E)50
Siendo CL(E)50 la concentracin letal/efectiva media que corresponde a la
proporcindevertidoqueoriginalamortalidadoinhibicindelamovilidaddel50%delos
individuosexpuestos(enelcasodepecesydaphniasrespectivamente)olainhibicinde
un50%enelcrecimientodelasalgas.
c) Encadamuestradebenrealizarselostresensayosdetoxicidadindicadosenel
prrafoa).
d) ElvalorVmdelamuestraeselmayordeToxicidadobtenida,expresadaenUT,
delostresensayosrealizados.
El valor Vr para vertidos autorizadoscorresponder ala Toxicidad calculada para
unamuestrapreconstituida,enlaqueseincluyanelconjuntodecontaminantesrecogidos
enlaautorizacindevertido,alasmximasconcentracionesautorizadas.
ElvalordeVrparalosvertidosnoautorizadosserecogeenlatabla19delAnexo3.

83
ANEXO5:COSTEDEREFERENCIA
DEL TRATAMIENTO DE RESIDUOS
ENESTADOLQUIDOOENFORMA
DELODOS.

Tabla 21. Costedereferencia()expresadoeneurosportonelada(/t)segneltipode


residuo:estadolquidooenformadelodo
Tipoderesiduo /tonelada

Residuosclasificadoscomopeligrososenestadolquido
Lixiviadosdevertederosderesiduospeligrosos 1 000
Lodosclasificadoscomopeligrosos
ResiduosnopeligrososenestadolquidoquecontienensustanciasdelGrupoAoBenumeradasenel
Anexo3deestedocumento 400
Lixiviadosdevertederosderesiduosurbanos
LodosnopeligrososconsustanciasdelGrupoA oBenumeradasenelAnexo3
Purinesoestircollquidoprocedentedelganado
Residuoslquidosdelaindustriaalimentaria(comoalpechinesdealmazaras,etc.)
Otrosresiduosconaltocontenidoenmateriaorgnica 150
Lixiviadosdevertederosdemateriasinertes
Lodos residuales de estaciones de depuracin quetraten aguas residuales domsticas, urbanas o de
composicinsimilar
Valorms
aproximado
Otrosresiduoslquidosnocatalogadosenningunodelostiposanteriores segnla
composicin
delresiduo

Fuente: OO.MMMAM/85/2008

85
ANEXO 6: EXPEDIENTES DE
INFRACCIONES Y ACTUACIONES
DEL PLAN HIDROLGICO
FORESTALANALIZADAS.

Tabla 22. Relacindeexpedientesdeinfraccionesconsultadosparalaobtencinde


informacinsobreprecios,valoresycostesaplicablesenelmbitodelaDemarcacin
HidrogrficadelCantbrico.

Expediente Hechosancionable

Realizacindeobrasconsistentesenlaconstruccindeunapiscina(5*9m)enlazonadeservidumbrey
policadelamargenizquierdadelarroyoOnaoyzonadepolicadelamargenderechadelroGea,
instalacindedepsitodegassobrelazonadepolicadelamargenderechadelroOnao,
S/33/0236/05 encauzamientodelArroyoOnaoalolargode5m medianteconduccionesde0.40m dedimetro y
rellenodetierrassobreelmismotramo parapasodemaquinaria,ycruceareodeconduccindeagua
sobreelcaucedelroGeamediantesujecinendosapoyosdehormignenzonadepolicay
servidumbredelmismoro,sincontarconlapreceptivaautorizacinadministrativa.
S/33/0238/05 Incumplimientodelascondicionesdeunaautorizacin,consistenteennoretirarla obradepaso
constituidaporconduccionesdehormign de600mmdedimetro del caucedelarroyo dela
Ferrera,causandodaosalDPH.
S/33/0225/05 Coberturadeunarroyo afluentedelarroyoSantaOlaya medianteconduccionesdehormign de0.5m
dedimetroalolargode50m yrellenodetierras sobrelazonadepolica,servidumbrey cauce del
mismoarroyoenSantaOlaya(Somado).
S/33/0226/05 Iniciarlasobrasde acondicionamientodelcamino aBraalamosa enzonade servidumbreypolicade
lamargenizquierday riberadelcaucedelarroyoBraalamosa.

S/33/0227/05 Obrasconsistentesenlainstalacindeuna tuberaenelcaucedelarroyo RegueradeRuarnaatravs


delaqueseextraeaguacondestinoaunabrevaderodeganado,sincontarconautorizacin.

Obrasconsistentesenlaexcavacindecimientosdeunaviviendayacumulacindetierrasenzonade
policadedosarroyosafluentesdelarroyoReconcoexcavacindestinadaalaconstruccindeunafosa
S/33/0206/05 spticaydepsitodemateriales,ascomolacolocacindeunacasetadeobraenzonadeservidumbrede
lascorrientescitadas construccindeobradepaso de6m.delongitudy1mdedimetro sobreel
caucedelarroyo Reconco ydepsitoderamajeyrestosdevegetacinarbreasobreelcaucede
losdosafluentescitados,sincontarconautorizacin.

87
INDUROT.UniversidaddeOviedo

Expediente Hechosancionable

S/33/0200/05
Obrasde encauzamientodearroyo delaFuentealolargode30m,sincontarconautorizacin.

S/33/0182/05 Obrasde construccindedosazudesdepiedrasobreelcaucedeunarroyo queesafluentedelro


Llorn,alaalturadelosP.K.1.2y2.35delacarreteraCastaedoColinas,sincontarconautorizacin.

S/33/0171/05 Obrasde construccindeunaescollera de5mdealturay32mdelongitud enlariberaizquierdadel


caucedelarroyoVillafra,yobrasdeedificacinconescolleradecontencinenzonadepolicadela
margenizquierdadelmismoarroyo,sincontarconlapreceptivaautorizacin.
S/36/0059/05 Realizacindeobrasde construccin deunaviviendaenzonadepolicadelamargenizquierdadelro
Pereiras,ascomo dosmurosdegranito enlamismamargen queinvadeelcauce delcitadoroycausa
daosalDPH,sincontarconautorizacin.
S/36/0070/05 Realizacindeobrasde entubamientodelcauce delregatoFialcontubosdehormignde0.80cmde
dimetroenunlongitudde30m,sinautorizacin.

S/32/0041/05 Realizacindeobrasde construccindeunestanqueconmurosdehormignenelcauce delro


Revolta,conlafinalidaddealmacenaraguaspararegadodefincas,sinautorizacin.

S/24/0028/05 Realizacindeobrasconsistentes cimentacindedosbases dehormignsobredosestructurasde


piedradeunantiguopuente (dimensin4x4x0.3=4.8m3),enambasmrgenesdel caucedelro
Selmo,sincontarconautorizacin.
S/39/0136/05 Realizacindeobrasconsistentesenla construccindeunalosadehormignyunaarqueta
(dimensiones1.20x1.20x0.25) enelcauce delroBesaya,sincontarconautorizacin.

S/39/0125/05 Realizacindeobrasconsistentesenla construccindeunmurodeescollera,enlariberaizquierda


delroBesaya,sincontarconautorizacin.

S/39/0106/05 Realizacindeobrasconsistentesenla construccindeunapasarelasobreelcauce delarroyo


Pandillo,sincontarconautorizacin.
Construccindeuncierredemallametlicaybloquesdehormignalolargode 88m.enzonade
S/33/0233/05 servidumbredelamargenderechadelroEspaa,sincontarconlapreceptivaautorizacin,(y
construccindeotrocierretransversalalcauceenzonadeservidumbreypolicadelmismoro)y
depsitodebotesdepinturaenelcauce que constituyenunpeligrodecontaminacindelasaguasyde
degradacindesuentorno.
S/33/0455/05 Talade fresnos,castaos,acacias,avellanos,alisosyotros rbolesenzonaderibera izquierdadelro
Covadonga, depsitoderamajesobresucauce, rellenodetierrassobre lazonadeservidumbredela
margenizquierdayel cauce delmismoro.
S/24/0062/01 Realizacindeuna extraccinderidosdelcauce delroBurbia,sincontarconautorizacin, y
modificacindelarasantedelcauce,enlazonade laplayafluvialdeVillafrancadelBierzo.

S/33/0219/05 Depsitoderamaje (restosdecortasdearbolado) enelcauce yzonadeservidumbredelamargen


derechadelroTua,sincontarconautorizacin,enlasinmediacionesdelacarreteraAS310.

S/33/0214/05 Realizacindetaladerbolesyejecucindeunapistaenzonadepolicayservidumbredeambas
mrgenesdelroBraedooBrusquete,ydelarroyoLasMestas,afluentedelanterior,y depsitode
ramajeytroncosen zonadeservidumbrey caucedeambosros,sincontarconautorizacin.
S/32/0054/05 Depsitodeescombrosenzonasde servidumbre,policay DPHdelamargenizquierda delroAirola,
sinautorizacin.

S/32/0046/05 Depsitodeescombrosdepizarraen zonasdepolica,servidumbredelamargenderechay cauce del


roCasaio,sinautorizacin.

S/32/0024/05 Depsitodeescombrosdepizarraen zonasdepolica,servidumbrey cauce delroCasaio,sin


autorizacin.

88
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Tabla 23. Relacindeactuacionesconsultadasparalaobtencindeinformacinsobre


costesdereposicin,incluidasdentrodelPlanHidrolgicoForestalyderestauracinde
caucesyencalvesnaturalesdelMinisteriodeMedioAmbiente

TTULODELPROYECTO

Acondicionamientodelaconfluencia delosrosRatoyFervedoira(Modificacin1)

AcondicionamientodelcauceymrgenesdelroAsmaenChantada,TramoII(Modificacinn1)

OrdenacindemrgenesfluvialesdelrioNarlaenFriol

ObrascomplementariasdeordenacindemrgenesfluvialesdelrioNarlaenFriol

OrdenacindelamargenizquierdadelroMioenLugo

OrdenacindemrgenesfluvialesdelrioNavia,enNaviadeSuarna

RecuperacindelentornodelaconfluenciadelosrosMioyFervedoriayordenacindemrgenesdelroFervedoira
entreelcruceNVIysudesembocaduraenelMio(Modificacin1)

Recuperacin del entorno natural y ordenacin demrgenes del ro Fervedoria entresuconfluencia con el Rato y la
N.630(Modificacin1)

AcondicionamientodelcauceymrgenesdelroCabeasupasoporMonfortedeLemos(Modificacin1)

AcondicionamientodelcauceyrecuperacindelentornonaturaldelroMioenFonmia(Modificacin1)

AcondicionamientodemrgenesyrecuperacindelentornonaturaldelroMioenMeira

AcondicionamientodelamargenderechadelroAvia,T.M.deRibadavia(Modificacin1)

OrdenacindemrgenesdelroMaceda,T.M.deMaceda

Acondicionamiento de la margen derecha del ro Mio en Ourense entre el Puente Romano y el Puente Ribeirio
(Modificacinn2)

OrdenacinhidrulicadelroCarrocedoenLlanes(Modicacinn1)

ObrascomplementariasdelproyectodeordenacinhidrulicadelroCarrocedoenLlanes(Modicacinn1)

ProteccindelenclavenaturaldelroCubiaenGrado(Modificacinn1)

RecuperacindemrgenesdelroNoraenPoladeSiero,TramoelBoladroRecua(Modificacinn1)

89
ANEXO 7: ACTUALIZACIN DE
PRECIOS,VALORESYCOSTES

Tabla 24. Valoresde PresupuestodeEjecucinporlaAdministracin actualizados

Presupuestode Valoresen
Unidad Costes Coste
Conceptos Coste ejecucinporla Eurosde
decoste indirectos total
administracin 2009

Transportedematerialessueltosen
caminporcarreterasenbuenas
condiciones,ysinlimitacin detonelaje,
aunadistancia<=30kmderecorridode Preciode
4.22 m3 4.22 5.14 5.50
cargaparasudepsitoenlugar ejecucin
autorizado,incluidoelretornoenvacoy
lostiemposdecargaydescarga.No
incluyecnonesavertedero.

Cargapalamecnica,transporteD<=5 Preciode
0.47 m3 0.47 0.57 0.61
m ejecucin

Penespecializadorgimengeneral
16.17 Horas 1% 16.33 19.90 21.27
conmotosierra(2PEONES)

Caminvolquetegra101/130CV
40.55 Horas 1% 40.96 49.90 53.35
(incluyemanodeobra)

Transportedelosrestosvegetalesen
Preciode
camin101130CVvolquetegra 1.41 Km. 1.41 1.72 1.84
ejecucin
(incluyemanodeobra),sincanon

Retroexcavadoracadenas5170C.V.
51.93 Horas 2.5% 53.23 64.86 69.33
(incluyemanodeobra)

Camin101130CV(incluyemanode
38.43 Horas 2.5% 39.39 48.00 51.31
obra)

Penrgimengeneral 13.86 Horas 1% 14.00 17.06 18.23

Retiradadebasurasenvehculotodo
jornadade Preciode
terrenoyrecorridomediode150km 320.05 320.05 389.97 416.88
trabajo ejecucin
hastapuntodedepsitoautorizado

91
INDUROT.UniversidaddeOviedo

Presupuestode Valoresen
Unidad Costes Coste
Conceptos Coste ejecucinporla Eurosde
decoste indirectos total
administracin 2009

Retiradadeescombrosconmedios
mecnicos,incluidalacargadelos
materialesretiradosencaminy
7.57 m3 2.5% 7.76 9.45 10.11
transporteparasudepsitoenlugar
autorizado,sinincluircnonesa
vertedero

Transporte delatierrayrestosdeobras
avertederoautorizado, encamin101 Preciode
1.34 KM 1.34 1.63 1.75
130CV(incluyemanodeobra),sin ejecucin
canon

Martillohidrulicohasta500kg,
1.31 HORAS 2.5% 1.34 1.64 1.75
completo

Demolicinmurodehormigno
Preciode
mamposteraconcompresor,incluso 60.41 m3 60.41 73.61 78.69
ejecucin
despejedeescombros.

Demolicindeelementosdehormign
armadodeespesordesde30a50cm, Preciode
19.99 m3 19.99 24.36 26.04
conmartillohidrulico,inclusodespeje ejecucin
deescombros

Capataz 20.53 horas 1.0% 20.74 25.27 27.01

Dumperdeobra,1500l 22.66 horas 2.5% 23.23 28.30 30.25

Restitucintopogrficacaucecon
51.93 horas 2.5% 53.23 64.86 69.33
mediosmecnicos

Preciode
Laboreosuperficialdemrgenes 161.49 ha 161.49 196.77 210.35
ejecucin
Extendidomanualdetierravegetal* 12.96 m3 1% 13.09 15.95 17.05

Preciode
Siembramanual 53.83 ha 53.83 65.59 70.12
ejecucin

Mezclasemillaspratenses 3.6 Kg 1.0% 3.64 4.43 4.74

Plantacindeespeciesarbreas,suelo
Preciode
sueltotrnsito,densidad>700 2.2 unidad 2.2 2.68 2.87
ejecucin
hoyos/ha,pendiente<=50%

Plantacindeespeciesarbreas,suelo
Preciode
sueltotrnsito,densidad<=700 2.57 unidad 2.57 3.13 3.35
ejecucin
hoyos/ha,pendiente<=50%

Plantacindeespeciesarbreas,suelo
Preciode
sueltotrnsito,densidad<=700 3.07 unidad 3.07 3.74 4.00
ejecucin
hoyos/ha,pendiente>50%

Plantacindeespeciesarbreas,suelo
Preciode
sueltotrnsito,densidad>700 2.83 unidad 2.83 3.45 3.69
ejecucin
hoyos/ha,pendiente>50%

Plantacindeespeciesarbreas,suelo
Preciode
pedregoso,densidad>700hoyos/ha, 7.7 unidad 7.7 9.38 10.03
ejecucin
pendiente<=50%

92
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

Presupuestode Valoresen
Unidad Costes Coste
Conceptos Coste ejecucinporla Eurosde
decoste indirectos total
administracin 2009

Plantacindeespeciesarbreas,suelo
Preciode
pedregoso,densidad<=700hoyos/ha, 8.46 unidad 8.46 10.31 11.02
ejecucin
pendiente<=50%

Plantacindeespeciesarbreas,suelo
Preciode
pedregoso,densidad<=700hoyos/ha, 10.06 unidad 10.06 12.26 13.10
ejecucin
pendiente>50%

Plantacindeespeciesarbreas,suelo
Preciode
pedregoso,densidad>700hoyos/ha, 9.2 unidad 9.2 11.21 11.98
ejecucin
pendiente>50%

Rozamanual,d.<=3cm,cabidacubierta Preciode
223.81 ha 223.81 272.70 291.52
<=50%,pendiente<=50% ejecucin

Rozamanual,d.<=3cm,cabidacubierta Preciode
578.82 ha 578.82 705.27 753.94
>50% <=80%,pendiente<=50% ejecucin

Rozamanual,d.<=3cm,cabidacubierta Preciode
802.64 ha 802.64 977.99 1045.47
>80%,pendiente<=50% ejecucin

Rozamanual,d.<=3cm,cabidacubierta Preciode
270.11 ha 270.11 329.12 351.83
<=50%,pendiente>50% ejecucin

Rozamanual,d.<=3cm,cabidacubierta Preciode
694.59 ha 694.59 846.33 904.73
>50%<=80%,pendiente>50% ejecucin

Rozamanual,d.<=3cm,cabidacubierta Preciode
964.71 ha 964.71 1175.46 1256.57
>80%,pendiente>50% ejecucin

Rozaselectivaymanualdematorral Preciode
589.11 ha 589.11 717.81 767.34
(preciomedio) ejecucin

Taladodelrbol,troceado,preparacin Basede
ysacademaderaalugardecarga 20.89 m3 precios 20.89 25.45 27.21
(preciomedio) paisajismo

SuministrodeAlnusglutinosa(Aliso),de
0.76 unidad 1% 0.77 0.94 1.03
2savias,arazdesnuda

SuministrodeSambucusnigra(Saco),
0.28 unidad 1% 0.28 0.34 0.38
de1savia,arazdesnuda

SuministrodeFraxinusexcelsior
(Fresno atlntico),de2savias,araz 0.72 unidad 1% 0.73 0.89 0.98
desnuda

SuministrodeSalixalba(Sauce
0.81 unidad 1% 0.82 1.00 1.10
comn),de1savia,arazdesnuda

SuministrodePopulusnigra(Chopo),
1.91 unidad 1% 1.93 2.35 2.59
de2savias,arazdesnuda

SuministrodeCastaneasativa
1.18 unidad 1% 1.19 1.45 1.60
(Castao),de2savias,arazdesnuda

93
INDUROT.UniversidaddeOviedo

Presupuestode Valoresen
Unidad Costes Coste
Conceptos Coste ejecucinporla Eurosde
decoste indirectos total
administracin 2009

SuministrodeCorylusavellana
0.57 unidad 1% 0.58 0.70 0.77
(Avellano),de2savias,arazdesnuda

SuministrodeQuercusRobur(Roble
1.14 unidad 1% 1.15 1.40 1.55
Carballo),de2savias,arazdesnuda

Preciode
Arena(encantera) 15.92 m3 17.02
mercado

Preciode
Arenademigacribada(encantera) 14.95 m3 15.98
mercado

Preciode
Arenabasltica(encantera) 17.38 m3 18.58
mercado

Garbancillobasltico5/10Mm(en Preciode
17.38 m3 18.58
cantera) mercado

Preciode
Gravilla20/40Mm(encantera) 10.94 m3 11.69
mercado

Gravillabasltica10/15Mm(en Preciode
14.29 m3 15.28
cantera) mercado

GravillaA5/2,6/3,10/5Mm(en Preciode
14 m3 14.97
cantera) mercado

GravillaA13/7,20/10,25/13Mm(en Preciode
11.93 m3 12.75
cantera) mercado

Preciode
Grava(encantera) 10.75 m3 11.49
mercado

Preciode
Grava40/70Mm(encantera) 10.83 m3 11.58
mercado

PinoSilvestre 21.75 m3 SADEI 23.25


PinoPinaster 20.00 m3 SADEI 21.38
PinoRadiata 20.02 m3 SADEI 21.40
Nogal 225.00 m3 SADEI 240.53
Chopo 27.35 m3 SADEI 29.24
Abedul 23.25 m3 SADEI 24.85
Aliso 20.21 m3 SADEI 21.60
Haya 28.71 m3 SADEI 30.69
Castao 31.24 m3 SADEI 33.40
QuercusRobur 25.90 m3 SADEI 27.69
Olmo 32.15 m3 SADEI 34.37
Eucalipto 19.21 m3 SADEI 20.54
Fresno 32.10 m3 SADEI 34.31
Otrasfrondosas 32.10 m3 SADEI 34.31

94
ANEXO 8: COSTES DE
REPOSICIN EN EXTRACCIONES
ILEGALESDEAGUA

Enloscasosdeextraccionesilegalesdeaguadondeseanecesarioreponerelagua
detrada, se presentan tres posibilidades reposicin y valoracin de dichos costes:
medianteuntrasvasedesdeotracuenca,mediantelarecargaartificialdeacuferosy
mediante una transferencia directa de agua por medios mecnicos. Los costes
aplicablesenelmbitodelaDHCparadichasalternativassonlossiguientes:
1. Medianteuntrasvasedesdeotracuenca.Loscostesdelostrasvasessonmuy
variables dependiendo de la distancia a la que se trasvase el agua, de la
antigedadycapacidaddelasobraspblicasempleadas,etc.Noobstante,enel
mbitodelaCHNserainteresanteaplicarloscostesunitarios(eneurosporm3
trasvasado)deltrasvasereversibleEbroBesaya,quesonconocidosporlaCHN
alserlaencargadadegestionarestesistemayelcorrespondientecanon.
Amodoilustrativo,elManualdeGestindeRecursosHdricos(Balairn,2000)
apuntaaque,enelcasodelostrasvasesquesuponenuntransportedeaguas
superficiales relativamente importante en volumen y distancia, las experiencias
existentesenEspaaapuntanhaciaunoscostesmediosquepodranoscilarentre
los0,24y0,30 /m3 (obrasdetransportecomocanales,acueductosytneles,as
comootrosdispositivosnecesariosderegulacin,bombeo,turbinacin,etc.)
2. Mediantelarecargaartificialdeacuferosenelcasodeextraccionesdeaguas
subterrneas. Engeneral,estoscostessonmejorconocidosydemsfcilclculo
queloscostesreferidosaaguassuperficialesvaran,bsicamente,enfuncindel
volumen extrado (a mayor volumen, menores costes unitarios) y de la
profundidad del sondeo (a mayor profundidad, mayores costes). Gracias a
distintosestudiosrecientesdelIGME,sedisponedeinformacinacercadelcoste
unitario de reposicin (recarga artificial de acuferos) en base a algunas
experienciasquesehanllevadoacaboenelLevanteespaol.Engeneral,dichos

95
INDUROT.UniversidaddeOviedo

costessesitanentre0,04y0,1/m3.Unarelacindetalladadedichosestudios
apareceenlasiguientetabla:

Tabla 25. CostesderecargaartificialdeacuferosestimadosenestudiosdelIGME


AGUA
REFERENCIA ACUFERO COSTE OBSERVACIONES
RECARGADA

AcuferodeVergel RecargaconexcedentesdelroGironamediante
Murilloetal. 0.006
(PlanadeGanda Hasta8 hm3/ao. infiltracinporpozos,aprovechandoantiguas
(2001) 0.012 euros/m3
Denia) instalacionesabandonadas.

Acuferode Tcnicaderecargabasadaenlaconstruccindeuna
SahnyMurillo Torreblanca(Plana presaparalaretencindeaguasdeavenidas
(2000) deOropesa 0.048 euros/m3 23 hm3/ao
(infiltracinporelcauce).Datosdelestudiode
Torreblanca) viabilidadrealizadoen1982(costesdeeseao).

Armayor etal. AprovechamientodeexcedentesdelroJalnGorgos


AcuferodeJvea Mnimode Entornoa
(2000) mediantelaconstruccinrepresas,ascomotrabajos
0.06 euros/m3 1 hm3/ao
denivelacinyescarificacin.

Armayoretal. Recargamediantelaconstruccindediquesy
AcuferodeOrba 0.09
(2000b) 0.2 hm3/ao pequeaspresasenelcaucedelroGironayun
0.1081 euros/m3
represamientoenelbarrancodeFontilles.

3. Medianteunatransferenciadirectadeaguaconmediosmecnicosdesdeotro
sistemacercano.Comayaseexpusoanteriormente,estaterceraalternativaesla
menos probable en la prctica. En caso de llevarse a cabo, a continuacin se
presentancostesunitariosaproximadosparalasdosposibilidadesdeactuacin:

a. Paraestavariantedelclculosedebeimputar:
Elcostedeadquisicindelaguaobtenidaenunsistemaalternativo.Este
agua se entiende que debe estar en estado natural, similar a la que fue
derivadairregularmente,porloquepodraprocederdealgnembalse,azudo
captacin existente. Como es sabido, el recurso hdrico en estado puro no
tienepreciodemercado,y elvalormscercanoqueselepuedeasimilaresel
correspondientealcostedesucaptacinyregulacin,esdecir,porobtener
un determinado volumense abonaraunacantidadequivalente a loscostes
de captacin y, en su caso, regulacin en que haya incurrido el gestor del
recurso (por ejemplo CADASA, una empresa municipal de aguas, la propia
CHN,etc.)
A travs de estudios e informacin aportada por la propia CHN se ha
estimado que los costes unitarios (en 2002) de las infraestructuras de
captacin y transporte de agua en alta del sistema de CADASA y del
municipal de Gijn (EMA) 46 podran situarse en unos 0.030.04 euros/m3,

46 EstossistemasestnrepresentadosprincipalmenteporlasinfraestructurasderegulacindelAlto

NalngestionadasporCADASA,lasdecaptacindelmunicipiodeGijngestionadasporlaEMAylasde
captacin, regulacin y transporte en alta del sistema AramoQuirsAlfilorios, gestionadas por CHN. El
sistemadesuministrodeCADASAdesdealAltoNalncaptayregulalasaguaspormediode dosembalses,
Tanes y Rioseco. Por su parte, el municipio de Gijn (EMA) integra como infraestructuras propias de su

96
ManualPrcticoparalavaloracindedaosalDominioPblicoHidrulico

mientras que el coste orientativo del m3 de agua procedente del sistema


AramoQuirsAlfilorios (en 2005) podra rondar los 0.0413 euros47. Ello
implicaqueloscostesdesucaptacinyregulacinsuperficialenlossistemas
asturianos ms importantes son muy bajos, ya que eliminando la fase de
transporteenalta podranquedar reducidosaunos 0.010.02 euros/m3.
Elcostedetransportedelaguaenunvehculocisternahastaelpuntode
vertido.Estecostedependerdelacapacidaddelcamincisternay,sobre
todo, de la distancia existenteentre elsistemasolvente de almacenamiento
deaguaenestadonaturalmscercanoyelpuntodevertido(quedebeserel
mismodondeseprodujoladerivacinirregular) Costeestimadodealquiler
decamincisternaconcapacidadpara10.000litrosyconductor:46,20 /hora
(La Tabla 25 presenta una tabla con los costes de reposicin pora esta
variantedelclculotabuladaporcantidaddetradadeaguaytiempoestimado
dealquilerdelcamincisterna)

b. Siseoptaporlavarianteb)declculo,sedebeimputar:
El coste de adquisicin del agua procedente del sistema de
abastecimiento general existente en el rea donde se produjo la
detraccin irregular. Este coste equivale a la tarifa del agua vigente en el
lugar,que(tericamente)incorporaraloscostesderivadosdetodaslasfases
del ciclo integral del agua (captacin y transporte, depuracin, depsito,
distribucin,saneamiento,etc.).Comoloqueinteresadevolveralroesagua
sintratar,similaracomoseencuentraenestadonatural,deberadescontarse
de la tarifa aquella parte del precio que se debe a costear las fases de
cloracin, saneamiento, etc. Para mantener la uniformidad con el coste
unitariodelaguautilizadoparacalcularelVDPH,sereducirlatarifadelagua
enun60%paracontabilizarsloelcostetericodesucaptacinytransporte
porlaredgeneralhastaelpuntodesalidadelagua.
Al igual que en el caso anterior, el coste de transporte del agua en un
vehculocisternahastaelpuntodevertido.

sistemalasdecaptacinyconduccindeaguadesdeelmanantialdeLosArrudos(Caso)ylosbombeosy
conduccionesdesdediversosmanantialesyacuferosdelmunicipio.Paraelclculodecostesunitariosen
2002 se tienen en cuenta costes de amortizacin de infraestructuras de captacin y transporte en alta de
ambos sistemas (EMA y CADASA), costes de funcionamiento, explotacin, gestin y reposicin de las
infraestructurasyunvolumentotalsuministradodeaproximadamente73 hm3/ao.
47 El sistema AramoQuirsAlfilorios se compone infraestructuras muy diversas: bombeos,

captacionesdemanantiales,conducciones,tnelesyunapresa.Apartir deinformacinrelativaaloscostes
de las infraestructuras ms significativas del sistema (embalse de Alfilorios y tnel del Aramo) y para un
volumensuministradodeaproximadamente22 hm3/ao.

97
ANEXO 9: COSTES DE REPOSICIN PARA EXTRACCIONES
ILEGALESDEAGUAPORTRANSFERENCIADIRECTA

Tabla 25.Relacindecostestericosdereposicinparalavaloracindedaosporextraccionesdeaguamediantetransferenciadirecta*
Caudal Tiempoestimadoendesplazamientos(enhoras)
detrado
(en 0.25 0.5 1.0 1.5 2.0 2.5 3.0 3.5 4.0 4.5 5.0 5.5 6.0
litros)
1000 21.06 36.09 66.15 96.21 126.27 156.33 186.39 216.45 246.51 276.57 306.63 336.69 366.75
2000 27.09 42.12 72.18 102.24 132.30 162.36 192.42 222.48 252.54 282.60 312.66 342.72 372.78
3000 33.13 48.16 78.22 108.28 138.34 168.40 198.46 228.52 258.58 288.64 318.70 348.76 378.82
4000 39.16 54.19 84.25 114.31 144.37 174.43 204.49 234.55 264.61 294.67 324.73 354.79 384.85
5000 45.19 60.22 90.28 120.34 150.40 180.46 210.52 240.58 270.64 300.70 330.76 360.82 390.88

99
INDUROT.UniversidaddeOviedo

Caudal Tiempoestimadoendesplazamientos(enhoras)
detrado
(en 0.25 0.5 1.0 1.5 2.0 2.5 3.0 3.5 4.0 4.5 5.0 5.5 6.0
litros)
6000 51.22 66.25 96.31 126.37 156.43 186.49 216.55 246.61 276.67 306.73 336.79 366.85 396.91
7000 59.38 74.97 106.15 137.33 168.51 199.69 230.87 262.05 293.23 324.41 355.59 386.77 417.95
8000 65.64 81.23 112.41 143.59 174.77 205.95 237.13 268.31 299.49 330.67 361.85 393.03 424.21
9000 71.89 87.48 118.66 149.84 181.02 212.20 243.38 274.56 305.74 336.92 368.10 399.28 430.46
10000 78.15 93.74 124.92 156.10 187.28 218.46 249.64 280.82 312.00 343.18 374.36 405.54 436.72
15000 123.34 153.96 215.20 276.44 337.68 398.92 460.16 521.40 582.64 643.88 705.12 766.36 827.60
20000 156.30 187.48 249.84 312.20 374.56 436.92 499.28 561.64 624.00 686.36 748.72 811.08 873.44
25000 201.49 247.70 340.12 432.54 524.96 617.38 709.80 802.22 894.64 987.06 1079.48 1171.90 1264.32
30000 234.45 281.22 374.76 468.30 561.84 655.38 748.92 842.46 936.00 1029.54 1123.08 1216.62 1310.16
35000 279.64 341.44 465.04 588.64 712.24 835.84 959.44 1083.04 1206.64 1330.24 1453.84 1577.44 1701.04
40000 312.60 374.96 499.68 624.40 749.12 873.84 998.56 1123.28 1248.00 1372.72 1497.44 1622.16 1746.88
45000 357.79 435.18 589.96 744.74 899.52 1054.30 1209.08 1363.86 1518.64 1673.42 1828.20 1982.98 2137.76
50000 390.75 468.70 624.60 780.50 936.40 1092.30 1248.20 1404.10 1560.00 1715.90 1871.80 2027.70 2183.60
55000 435.94 528.92 714.88 900.84 1086.80 1272.76 1458.72 1644.68 1830.64 2016.60 2202.56 2388.52 2574.48
60000 468.90 562.44 749.52 936.60 1123.68 1310.76 1497.84 1684.92 1872.00 2059.08 2246.16 2433.24 2620.32
65000 514.09 622.66 839.80 1056.94 1274.08 1491.22 1708.36 1925.50 2142.64 2359.78 2576.92 2794.06 3011.20
70000 547.05 656.18 874.44 1092.70 1310.96 1529.22 1747.48 1965.74 2184.00 2402.26 2620.52 2838.78 3057.04
75000 592.24 716.40 964.72 1213.04 1461.36 1709.68 1958.00 2206.32 2454.64 2702.96 2951.28 3199.60 3447.92
80000 625.20 749.92 999.36 1248.80 1498.24 1747.68 1997.12 2246.56 2496.00 2745.44 2994.88 3244.32 3493.76
85000 670.39 810.14 1089.64 1369.14 1648.64 1928.14 2207.64 2487.14 2766.64 3046.14 3325.64 3605.14 3884.64
90000 703.35 843.66 1124.28 1404.90 1685.52 1966.14 2246.76 2527.38 2808.00 3088.62 3369.24 3649.86 3930.48
95000 748.54 903.88 1214.56 1525.24 1835.92 2146.60 2457.28 2767.96 3078.64 3389.32 3700.00 4010.68 4321.36
100000 781.50 937.40 1249.20 1561.00 1872.80 2184.60 2496.40 2808.20 3120.00 3431.80 3743.60 4055.40 4367.20
*Costes estimadosteniendoencuenta:
Uncostedeadquisicindelaguasintratarde0.02 euros/m3
Elcostedealquilerdecamincisternayconductor(concapacidadpara6 000 y 10 000litros),medidoeneuros/hora.
Untiempoestimadodecargaydescargade1horaparaelcasodeuncamincisternadeconcapacidadpara10 000 litros

100
101