Você está na página 1de 24

E 36-371-A-10

Farmacologa de los opioides


D. Fletcher

Los opioides se emplean como analgsicos en el dolor agudo y crnico. Su accin est
mediada por una interaccin con cuatro receptores especficos. La biologa molecular, la
fisiologa de la nocicepcin y la gentica han permitido avanzar en la comprensin de la
interaccin opioides-sistema nervioso central y perifrico y precisar el impacto del
polimorfismo gentico. La farmacologa clsica permite clasificar los diferentes opioides
segn la naturaleza de su interaccin con los receptores. Las nuevas molculas opioides
son escasas; la futura disponibilidad del tapentadol representa la primera innovacin
desde hace mucho tiempo. Sin embargo, se han desarrollado nuevas vas de
administracin, como las vas transmucosa, transcutnea pasiva y por iontoforesis. La
accin comn a todos los opioides sobre el sistema nervioso central expone a los
pacientes a un efecto sedativo, un efecto depresor respiratorio, una accin psicoafectiva y
una hiperalgesia. Los otros efectos secundarios incluyen nuseas y vmitos,
estreimiento, retencin urinaria, broncoconstriccin y depresin de la tos. Los
antagonistas de accin perifrica ofrecen una accin preventiva sobre los efectos
digestivos. El uso mucho ms amplio de los opioides a largo plazo expone a un aumento
de su empleo inadecuado. Los opioides constituyen una familia de analgsicos de
referencia empleados tanto en la anestesia como en el tratamiento del dolor agudo y
crnico.
2011 Elsevier Masson SAS. Todos los derechos reservados.

Palabras Clave: Opioides; Anestesia: Dolor agudo; Dolor crnico; Farmacologa

Plan Accin cardiovascular 11


Accin sobre el tubo digestivo 11
Accin sobre el ojo 11
Resea histrica 1
Accin sobre el aparato urinario y las vas biliares 11
Estructura general de los opioides y clasificacin 2 Accin sobre el feto 11
Mecanismos y sitios de accin de los opioides 2 Opioides e inmunidad 11
Familia de los receptores opioides 2 Uso clnico 12
Receptor opioide 3 Resea general 12
Receptores opioides j, d y ORL1 3 Agonistas opioides empleados para la anestesia 12
Otros efectores de los opioides endgenos 4 Agonistas opioides empleados para la analgesia 15
Receptores oligmeros 4 Antiopioides 19
Endomorfinas 4 Conclusin 20
Polimorfismo gentico y accin de los opioides 4
Mecanismos de la analgesia opioide 7
Afinidad, eficacia, actividad intrnseca 7
Mecanismos de accin celular 7 Resea histrica
Analgesia perifrica y sistema inmunitario 7
Los efectos del opio probablemente se conocen desde
Desensibilizacin, internalizacin y secuestro
hace ms de 5.000 aos antes de Cristo, poca en la
de los receptores opioides 8 cual los sumerios cultivaban la adormidera para extraer
Receptores morfnicos perifricos 8 de ella el opio con fines religiosos y medicinales. Habr
Control de la analgesia opioide a nivel medular que esperar a 1817 para extraer el principio activo del
y del tronco cerebral 8 opio, que se llam morfina en referencia al dios del
Propiedades farmacodinmicas de los agonistas sueo, Morfeo. Algunos aos ms tarde se aisl la
opioides 8 codena del opio. En la segunda mitad del siglo XIX, se
Accin sobre el sistema nervioso central 8 comenz a emplear la morfina durante intervenciones
Accin respiratoria 10 quirrgicas durante la guerra entre Francia y Prusia y

Anestesia-Reanimacin 1
E 36-371-A-10 Farmacologa de los opioides

durante la guerra civil estadounidense. En 1901, el Cuadro I.


japons Katawata inyect morfina en el espacio suba- Clasificacin de los diferentes opioides.
racnoideo. Durante la primera mitad del siglo XX, han Origen del opioide Propiedad Actividad
aparecido los diferentes opioides agonistas y agonistas-
Naturales Agonistas puros Alta
antagonistas sintticos como la N-alil-norcodena, la
metadona o la N-alil-normorfina. Morfina Morfina Morfina
Codena Fentanilo Fentanilo
Tebana Hidromorfona Hidromorfona

Estructura general Noscapina

de los opioides y clasificacin Semisintticos


Herona
Agonistas parciales
Buprenorfina
Intermedia
Buprenorfina
Opioide es el trmino empleado para definir cual- Derivados Nalbufina
quier sustancia endgena o sinttica que produce de la tebana
efectos similares a la morfina y que se bloquea por un Dihidromorfona
antagonista. El trmino opiceos, ms antiguo, hace
Sintticos Agonista- Dbil
referencia a las sustancias morfnicas sintticas que
antagonistas
poseen una estructura no peptdica.
Benzomorfanos Pentazocina Codena
El opio contiene numerosos alcaloides naturales como
Fenilpiperidinas Nalbufina Dextropropoxifeno
la morfina, la codena, la tebana, la noscapina y la
(fentanilo y deriva-
papaverina. Esta ltima es un relajante de las fibras
dos, petidina,
musculares lisas, mientras que los otros poseen propie- meperidina)
dades analgsicas de distinta importancia. La estructura
Difenilpropilamina
de la morfina se determin en 1902. Es un derivado (metadona)
fenantreno que posee dos anillos planos y dos anillos
alifticos que le otorgan una estructura en T. Algunas Actividad mixta
sustituciones sobre grupos hidroxilos o nitrogenados Petidina
permiten constituir nuevas molculas anlogas a la Tramadol
morfina (Fig. 1). Tapentadol
Los opioides pueden clasificarse en funcin de su
Actividad mixta: un opioide con otro mecanismo de accin que explica
estructura qumica. Desde hace aos, se han producido su accin analgsica.
y estudiado numerosos compuestos semisintticos
(originados por modificacin qumica de la morfina) y
sintticos. As, se pueden clasificar a los opioides en Mecanismos y sitios
sustancias naturales, semisintticas y sintticas (Cua-
dro I). Los opioides tambin pueden clasificarse en de accin de los opioides
funcin de su accin farmacolgica sobre los diferentes
receptores: agonistas puros, agonistas dbiles, agonistas Familia de los receptores opioides
parciales y agonistas-antagonistas, y de su actividad ms La definicin de los receptores opioides fue farmaco-
o menos potente (Cuadro I). lgica hasta 1992, gracias al uso de ligandos de alta
afinidad. Ms tarde, cuatro equipos efectuaron, en el
ratn o en la rata, la clonacin de los receptores d [2],
j [3] y [4]. La farmacologa de los opioides est basada
ahora en los datos de las clonaciones y de las estructuras
Posicin 17 N-CH3 moleculares obtenidas en relacin con estos receptores
opioides [5]. Los receptores opioides forman parte de la
familia de los receptores acoplados a una protena G.
Todos ellos poseen una parte C-terminal intracelular y
una N-terminal extracelular con siete dominios trans-
membrana (Fig. 2). La familia de los receptores opioides
incluye cuatro miembros: (tambin llamado mu, MOP,
HO O OH
Posicin 6 MOR u OP3), d (tambin llamado delta, DOP, DOR u
Posicin 3
OP1), j (tambin llamado kappa, KOP, KOR u OP2) y un
Morfina cuarto receptor, el receptor de tipo opioide 1 (ORL1)
Nombre del Otras (tambin llamado NOP, N/OFQ u OP1) (Cuadro II). Estos
Radical y posicin
opioide Modificaciones receptores se activan mediante ligandos peptdicos
endgenos. Se puede obtener una informacin actuali-
3 6 17 zada sobre la farmacologa de estos receptores en algu-
Morfina -OH -OH -CH3 nas pginas web (www.iuphar.org). Los cuatro receptores

Herona -OCOCH3 -OCOCH3 -CH3 estn ampliamente distribuidos en el sistema nervioso
Hidromorfona -OH =O -CH3 (a)
Codena -OCH3 -OH -CH3
(a) (b)
Oxicodona -OCH3 =O -CH3
Nalbufina
Buprenorfina
Naloxona
-OH
-OH
-OH
-OH
-OCH3
=O
-CH2
-CH2
-CH2CH=CH2
(a) (b)

(a) (b)
(a) (b)
Punto fundamental
Naltrexona -OH =O -CH2
La biologa molecular, la fisiologa de la
nocicepcin y la gentica han permitido
Figura 1. Estructura de la morfina y de los opioides derivados
profundizar la comprensin de la interaccin
de la morfina (segn [1]). Los nmeros 3, 6 y 17 se refieren a la
opioides-sistema nervioso central y perifrico y
posicin del radical en la molcula de morfina tal y como lo
indican. (a) Unin simple entre C7 y C8. (b) OH aadido en C14. precisar el impacto del polimorfismo gentico.

2 Anestesia-Reanimacin
Farmacologa de los opioides E 36-371-A-10

N-terminal Receptor opioide


BEC1 BEC2 BEC3
En el animal, el receptor est claramente identificado
como el receptor implicado en el efecto analgsico de los
opioides. En el ratn knock-out para el receptor tras
delecin del exn 2, el efecto analgsico de la morfina-6-
glucurnido (M6G) est totalmente suprimido [7]. No
TM TM TM TM TM TM TM obstante, los ratones knock-out con delecin del exn
1 2 3 4 5 6 7 1 presentan un fenotipo ligeramente diferente con
mantenimiento del efecto analgsico de la M6G y de la
herona [8]. Los estudios que han utilizado oligonucleti-
dos antisentido han permitido observar la gran heteroge-
BIC1 BIC2 BIC3 neidad de los receptores , resultado del splicing
alternativo del cido ribonucleico (ARN) transcrito [5].
Durante este splicing, algunas secuencias del ARN mensa-
C-terminal
jero no se conservan. Se pueden producir diferentes
combinaciones de exones, lo que conduce a diferentes
Figura 2. Estructura del receptor opioide (segn [6]). BIC: protenas a partir de un mismo gen. De esta forma, se
bucle intracelular; BEC: bucle extracelular; TM: hlice transmem- han identificado 25 variantes o subtipos a partir del gen
brana; extremos C y N-terminales. del ratn, 8 a partir del de la rata y 11 a partir del gen
humano. Existe una conservacin interespecie limitada
con importantes diferencias entre humanos y roedores y
Cuadro II. entre la rata y el ratn. Sigue existiendo polmica sobre
Diferentes clasificaciones de los receptores opioides. la importancia funcional de estos subtipos de receptores,
resultado del splicing alternativo, pero es posible que la
Farmacologa International Union Biologa IUPHAR activacin combinada de diferentes variantes del receptor
clsica of Basic and Clinical revisada explique las sutiles diferencias observadas entre los
Pharmacology opioides en cuanto a su eficacia y su tolerancia [5].
(IUPHAR)
d OP1 DOR DOP Receptores opioides j, d y ORL1
j OP2 KOR KOP El receptor es el mediador principal de la accin de
OP3 MOR MOP los opioides, mientras que los receptores j y d slo
ORL1 OP4 NOR NOP actan indirectamente sobre la nocicepcin, modu-
lando la accin sobre el receptor , como por ejemplo
DOP: receptor opioide d, d para el canal deferente; DOR: receptor
opioide delta, receptor opioide d; KOP: receptor opioide j, k para mediante la externalizacin del receptor d tras la
quetociclazocina; KOR: receptor opioide kappa, receptor opioide j; activacin del receptor [9]. Este trfico del receptor d
MOP: receptor opioide , m para morfina; MOR: receptor opioide mu, de las estructuras intracelulares hacia la membrana
receptor opioide ; NOP: receptor opioide de la nociceptina; OP1: neuronal y viceversa puede permitir pensar en un
receptor opioide d; OP2: receptor opioide j; OP3: receptor opioide ;
OP4: receptor opioide ORL1; ORL1: receptor de tipo opioide 1. nuevo enfoque del control del dolor [9]. En el caso de
los receptores ORL, su activacin inhibe el efecto
analgsico ligado a la activacin de los receptores
opioides, lo que hace considerar el sistema del receptor
central y perifrico, as como en las clulas endocrinas ORL como un sistema antiopioide [10]. Esta interaccin
e inmunitarias, por lo que presentan acciones fisiolgi- puede explicar la limitacin del efecto analgsico de la
cas muy variadas. buprenorfina a travs del receptor [11]. El Cuadro III

Cuadro III.
Accin de los receptores opioides sobre la analgesia.
Receptor Acciones agonistas Accin antagonista/KO
Analgesia (Sis, ICV, IT) eficacia en la mayora de los tipos Hiperalgesia (KO)
de dolor inflamatorio Aversin (antagonista Sis, ICV)(a)
Depresin respiratoria, estreimiento, compensacin, altera- Compensacin reducida ligada al alcohol, THC y nicotina
cin del sistema inmunitario, aumento de la locomocin(a) (KO)(a)
Compensacin de la conducta de apego (KO)(a)

d Analgesia, pero dbil o ausente salvo externalizacin inducida Hiperalgesia en los modelos de dolor inflamatorio crnico
(por morfina o inflamacin) (KO)
Convulsiones, antidepresor/ansioltico, alteracin de la movi- Menos tolerancia a la analgesia morfnica (KO)
lidad intestinal(a) Aumento de ansiedad, consumo de alcohol y depresin (KO)(a)

j Analgesia dbil y potencial desvo del efecto alucingeno Antagonista que bloquea la analgesia ligada al estrs
y catatnico Aumento de la sensibilidad a un dolor visceral qumico (KO)
Efecto aversivo, catatonia, alucinaciones, hipertermia(a) Bloqueo de la inmovilidad ligada al estrs (KO)(a)

ORL1 Bloquea la analgesia opioide y aquella ligada al estrs (ICV) Hiperalgesia tras una estimulacin nociceptiva crnica (KO)
Analgsica (IT) Respuestas adaptativas auditivas, memorizacin y aprendizaje
Ansioltica; alteracin de la memoria y del aprendizaje (KO)(a) aumentados; efecto antidepresor (KO)(a)

Las informaciones son extradas de datos conseguidos en roedores. Informaciones complementarias en la pgina web de la International Union of Basic
and Clinical Pharmacology (www.iuphar.org/).
(a)
Efectos que pueden considerarse como efectos secundarios, pero que pueden interactuar con el proceso nociceptivo. Sis: administracin sistmica; IT:
administracin intratecal; ICV: administracin intracerebroventricular; KO: un fenotipo fiable de rata con un receptor inactivo; THC:
tetrahidrocannabinol.

Anestesia-Reanimacin 3
E 36-371-A-10 Farmacologa de los opioides

Orfanina

Proorfanina Nocistatina Orfanina-2

110-127 nociceptina MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ


130-146 orfanina FQFGGFTGARKSARKLANQ
149-165 orfanina-2 FSEFMRQYLVLSMQSSQ

A-mesendorfina dinorfina A
Prodinorfina

Dinorfina B
Pptido F Octapptido Heptapptido
Proencefalina

Proopiomelanocortina

Leu-encefalina g-MSH b-MSH


a-MSH CLIP
Met-encefalina g-LPH b-endorfina
ACTH b-LPH

Figura 3. Precursores del sistema opioide endgeno (segn [18]). ACTH: corticotropina; LPH: hormona lipotropina; MSH: melanotro-
pina; CLIP: corticotropina-lipotropina.

muestra un resumen de la accin de los diferentes


Cuadro IV.
receptores opioides sobre la analgesia.
Afinidad de las endomorfinas por los diferentes receptores.
Otros efectores de los opioides d j ORL1
endgenos b-endorfinas +++ +++ +++ -
Parece ser que los opioides endgenos tienen efecto- Leu-encefalina + +++ - -
res diferentes de los receptores opioides clsicos [12]. Los Met-encefalina ++ +++ - -
receptores N-metil-D-aspartato (RNMDA) pueden modu- Dinorfina ++ + +++ -
larse por la dinorfina. La met-encefalina ha sido califi- Orfanina - - - +++
cada como factor de crecimiento opioide; acta sobre FQ/nociceptina
los tejidos neuronales y no neuronales para regular el Afinidad/baja +; media ++; alta +++. Sin afinidad. ORL1: receptor de tipo
desarrollo, la renovacin celular, la angiognesis, la opioide 1.
cicatrizacin y la accin antitumoral [13]. El receptor del
factor de crecimiento opioide, presente en las neuronas
y la gla, no tiene homologa alguna con los receptores clsicos , j y d [17]. Todas estas endomorfinas provie-
opioides clsicos. La importancia funcional de este nen de tres precursores proteicos, la proencefalina, la
receptor para la analgesia opioide sigue sin estar defi- prodinorfina y la proopiomelanocortina (POMC)
nida con precisin. (Fig. 3). El ligando peptdico del ORL1 tiene un precur-
sor diferente, la proorfanina FQ o pronociceptina. Estos
Receptores oligmeros precursores estn compuestos de cadenas de aminoci-
dos ms largas y se activan por hidrlisis. Estos diferen-
Aparte de los receptores opioides clsicos, existen tes pptidos tienen una selectividad particular para los
homo o heterooligmeros de receptores, lo que puede diferentes receptores opioides, que se resume en el
influir en las seales celulares inducidas por su activa- Cuadro IV. Cada precursor origina pptidos con una
cin [14]. La frecuencia de los oligmeros de receptores afinidad para los tres receptores opioides clsicos [17].
y su importancia funcional siguen siendo difciles de Existe sin embargo una polmica sobre la cuestin de
precisar [15]. Se observan sin embargo interacciones entre saber si la morfina y las endomorfinas son ligandos de
el receptor y otros receptores ligados a la protena G, los receptores opioides en los mamferos [19]. Para la
como el receptor CB1 o a2a. No se ha definido todava morfina endgena, datos recientes parecen sugerir la
la farmacologa precisa de estos oligorreceptores, pero existencia de un papel real, a pesar de la persistencia de
seguramente constituye una era nueva en la farmacolo- la duda sobre las posibilidades de almacenaje y la
ga de los receptores opioides. En este sentido, se puede regulacin de la actividad, a causa de las limitadas
pensar en una definicin diferente del objetivo de posibilidades de la morfina para atravesar las membra-
futuros opioides. Se puede as evocar el rastro de los nas celulares [20]. Los papeles fisiolgicos descritos para
productos con una accin bivalente sobre los receptores las endorfinas son muy numerosos en relacin al sis-
y d, lo que representa una pista farmacolgica intere- tema nervioso, pero tambin en relacin a los sistemas
sante para obtener una analgesia sin algunos efectos cardiovascular, digestivo y respiratorio [21].
secundarios como la tolerancia, que obliga a aumentar
las dosis de opioides para mantener el efecto [16].
Polimorfismo gentico y accin
Endomorfinas de los opioides
Cerca de una treintena de pptidos opioides endge- Parece evidente que varios polimorfismos genticos
nos o endomorfinas activa los receptores opioides contribuyen a modular la nocicepcin y la respuesta

4 Anestesia-Reanimacin
Farmacologa de los opioides E 36-371-A-10

Cuadro V.
Principales impactos del polimorfismo gentico sobre la farmacocintica y farmacodinmica de los opioides en el ser humano.
Gen Variante Opioide Farmacocintica Farmacodinmica
Transportadores
P-gp 3435C<T2677G<T/A Morfina Concentracin mxima mayor Tendencia a necesidades de mayores dosis
en el LCR para 3435TT [23] de morfina para conseguir la analgesia con
3435CT y 3435TT [24]

Fentanilo Ms efectos secundarios si 2677TT y


3435TT [25]

Tramadol Tendencia al aumento de la Cmax


y ABC0-24 si 3435CT y 3435 TT [26]

Metabolismo de las enzimas de fase 1


CYP2D6 Metabolizador lento Codena Limitacin del metabolismo Respuesta analgsica insignificante,
(homocigotos para de la codena en morfina sin efecto respiratorio ni pupilar
alelos nulo)

Tramadol Limitacin del metabolismo Menos efecto opioidrgico, consumo anal-


del tramadol en M1 gsico incrementado

Oxicodona Limitacin del metabolismo


en oximorfona

Metabolizador ultra- Codena Mayor formacin de morfina Efecto opioidrgico incrementado,


rrpido mayores efectos secundarios
(alelo duplicado)

Oxicodona Analgesia y ES aumentados

Metabolismo de los enzimas de fase 2


UGT2B7 79G>T Morfina, M3G, M6G Menor tendencia ratio M6G/M Respuesta analgsica insignificante,
y M3G/M en el heterocigoto sin efecto respiratorio, pupilar

161C>T Morfina, M3G, M6G Ratio M6G/M y nivel de morfina Menor efecto opioidrgico, incremento
ms bajo en T/T del consumo analgsico
M6G y M3G plasmtico ms bajo
en C/C

COMT 472G>A Morfina Umbral del dolor ms bajo para genotipo


Met/Met. Consumo de morfina reducido
para genotipo Met/Met frente a Met/Val
y Val/Val

Metabolizador ultra- Codena Incremento de la formacin Efecto opioidrgico incrementado,


rrpido de morfina aumento de los efectos secundarios
(alelo duplicado)

Oxicodona Analgesia y ES incrementados

Receptores
Receptor OPRM1 118A>G Morfina Efecto mitico y analgsico reducido para
portadores de alelo G; aumento de la nece-
sidad de morfina en 118G

M6G Efecto mitico y analgsico experimental


reducido en 118G

Alfentanilo Analgesia y efecto depresor respiratorio


que requieren niveles plasmtico 2-4 y 10-
12 veces mayores respectivamente

Receptor R151C; R160W; Morfina Aumento de la eficacia analgsica en los


Mc1R D294H portadores de dos o ms variantes inactivas

M6G Aumento de la eficacia analgsica en los


portadores de dos o ms variantes inactivas
COMT: catecol-O-metiltransferasa; CYP2D6: citocromo P2D6; ES: efectos secundarios; LCR: lquido cefalorraqudeo; M3G: morfina-3-glucurnido;
M6G: morfina-6-glucurnido; Mc1R: receptor 1 de la melanocortina; P-gp: transportadores P-glucoprotena; Cmax: concentracin plasmtica mxima;
AUC: rea bajo la curva.

antinociceptiva a los morfnicos. Este polimorfismo Transportadores P-glucoprotena


puede existir en los transportadores, en el metabo-
lismo y en los receptores diana de los opioides [22] Estos transportadores permiten un transporte activo
(Cuadro V). para la morfina, el fentanilo y el tramadol fuera de la

Anestesia-Reanimacin 5
E 36-371-A-10 Farmacologa de los opioides

clula [22]. Algunas mutaciones estn asociadas a una prevalencia del alelo variante Met158 y del papel
modificacin de los niveles de opioides en el lquido fundamental de la actividad de la COMT en la percep-
cefalorraqudeo (LCR) y el plasma o a una incidencia cin del dolor, este polimorfismo es la clave de nume-
distinta de los efectos secundarios. La b-arrestina, que rosos estudios genticos sobre las diferencias
permite la regulacin en caso de exposicin prolongada interindividuales en la adaptacin y la respuesta al dolor
a los opioides mediante desensibilizacin del receptor , y a otros estmulos estresantes. Prueba de ello es un
puede presentar tambin variantes. De este modo, se ha estudio recientemente publicado que ha analizado los
observado en los pacientes oncolgicos una asociacin efectos conjuntos del SNP Val158Met de la COMT y del
entre una variante del gen de la b-arrestina y una SNP A118G del gen codificador del MOR [29]. As
tolerabilidad mediocre a la morfina que requiere rota- mismo, parece que la actividad de la COMT podra
ciones de opioides. tener un papel en el desarrollo de los dolores crnicos
en los pacientes de riesgo [30].
Citocromo
El citocromo (CYP) forma parte de una superfamilia Receptor
de enzimas hepticas de fase I, con seis subclases. El
CYP2D6 es particularmente interesante, ya que inter- Desde hace 25 aos [31], se ha evocado la nocin de
viene en el metabolismo de un centenar de medica- mltiples formas del receptor sobre bases farmacol-
mentos; el gen codificador para esta enzima es muy gicas. El gen que codifica el receptor humano fue
polimorfnico, con un nmero considerable de alelos clonado en 1993 [32]. Desde entonces, se han identifi-
diferentes (www.cypalleles.ki.se/cyp2d6.htm). Como cado muchos polimorfismos de este gen, entre los cuales
resultado, existe una actividad enzimtica que vara del dos son relativamente prevalentes [33, 34]. El particular
1 al 200%. De esta forma, cada individuo puede ser inters que presenta el polimorfismo A118G se basa en
clasificado como metabolizador rpido, ultrarrpido, el hecho de que la variante G118 es, por un lado,
normal o lento. El CYP2D6 (espartena/debrisocina- relativamente frecuente en la poblacin (del 2 al 40%
oxigenasa) est ausente en el 7-10% de la poblacin segn el grupo tnico) [35] y que, por otro lado, parece
caucsica, lo que hace imposible la conversin de la aumentar de forma considerable la afinidad de la unin,
codena en morfina mediante O-dimetilacin. Resulta por lo menos in vitro, del receptor variante a la b-
pues evidente que sera til conocer el perfil gentico de endorfina [27, 34] . En cambio, en la actualidad slo
cualquier persona antes de prescribir codena [27]. El existen algunos estudios clnicos que examinen el efecto
efecto teraputico del tramadol tambin est modulado del polimorfismo A118G sobre la percepcin dolorosa
por el metabolismo del CYP2D6, ya que una parte del (nocicepcin de base), la respuesta a los morfnicos o
efecto analgsico depende del metabolismo activo del incluso la incidencia de dolores crnicos de tipo neuro-
tramadol formado mediante O-dimetilacin va ptico. Adems, algunos de estos estudios presentan
CYP2D6 [27, 28]. Todava no est del todo clara la resultados contradictorios. Varias series pequeas que
influencia del genotipo del CYP2D6 sobre el efecto de estudian la toxicidad de la M6G, un metabolito activo
otros opiceos como la oxicodona o la hidroxicodona, de la morfina, en funcin del genotipo de MOR, han
pero tambin parece depender del perfil gentico del demostrado que los portadores de la variante G118 pre-
CYP2D6 [27].
sentaban una respuesta clnica reducida [36], un efecto
Gen de la catecol-O-metiltransferasa analgsico menor con la morfina oral sin proteccin
contra la aparicin de una depresin respiratoria [37] o
El gen de la catecol-O-metiltransferasa (COMT) codi- una mayor proteccin contra el efecto txico de la
fica una enzima de fase II implicada en el metabolismo M6G [38]. Estos resultados en el ser humano contradicen
de la dopamina y de la norepinefrina. La variante lo que se esperara si la afinidad de la unin al opiceo
Val158Met del gen COMT est asociada a una reduccin aumentase realmente en presencia del alelo variante
de un factor 3-4 de la actividad enzimtica de la COMT. La
G118, tal como lo sugieren los resultados de Bond et
neurotransmisin mediada por el receptor se activa
al [34]. Un reciente estudio francs se ha centrado en el
generalmente en respuesta a un estmulo doloroso
efecto de varios genes candidatos sobre las necesidades
prolongado. Se encuentra bajo la influencia de la
de morfina en el contexto postoperatorio agudo [39]. En
actividad de la COMT. Las personas homocigotas para
este estudio, realizado con 74 casos tras ciruga colorrec-
Met158 presentan una actividad enzimtica de la COMT
tal, el polimorfismo A118G del MOR no pareca alterar
ms dbil, una de cuyas consecuencias es una reduccin
las dosis de morfina administradas. No obstante, el
regional del contenido neuronal en encefalina, lo cual
podra originar una disminucin de la analgesia end- nmero de pacientes portadores del alelo G118 fue
gena con un incremento de la percepcin dolorosa [27]. demasiado bajo como para poder extraer conclusiones
Como este genotipo es frecuente (32%), este polimor- definitivas. Dos estudios que han valorado el consumo
fismo de nucletido simple (SNP) interviene en la postoperatorio de morfina mediante analgesia contro-
variabilidad interindividual de la percepcin dolorosa. lada por el paciente intravenosa (ACP i.v.) en el con-
Adems, se ha demostrado un efecto farmacogentico texto ginecolgico y ortopdico, han concluido que los
de este SNP en el marco del tratamiento de dolores pacientes homocigotos portadores del alelo variante
crnicos con morfina oral en pacientes oncolgicos. Los G118, requeran mayor dosis de morfina [40, 41]. En el
pacientes portadores del alelo Met158 requeran menos contexto de dolores crnicos, un estudio ha demostrado
morfina que los pacientes homocigotos para Val158 [22, menor prevalencia del alelo G118 en los pacientes
27]. Este efecto aparentemente contradictorio y bidirec- oncolgicos con dolor en comparacin con un grupo
cional del polimorfismo Val158Met, probablemente se control [42]. Por el contrario, no existi diferencia en el
deba al hecho de que en presencia de una actividad consumo de morfina en los pacientes tratados de forma
reducida de la COMT, como en el caso de los pacientes crnica con morfina entre los portadores del alelo
homocigotos para Met158, se produce un aumento G118 y los dems. Todava son necesarios numerosos
compensatorio de la densidad de los MOR (up- estudios para valorar toda la extensin de la influencia
regulation), lo que explicara el aumento de eficacia de la del polimorfismo A118G del MOR sobre el efecto de los
morfina en los pacientes con este genotipo [27]. Los opiceos, que adems valoren todas las formas de
pacientes portadores del alelo variante Met158, a pesar administracin en todas las situaciones clnicas doloro-
de que tienen un umbral de tolerabilidad al dolor ms sas. Un reciente metaanlisis sobre las consecuencias en
bajo, presentan una mejor respuesta a la morfina el ser humano del polimorfismo del receptor slo
cuando se inicia un tratamiento. A causa de la alta presenta una significacin clnica limitada que no

6 Anestesia-Reanimacin
Farmacologa de los opioides E 36-371-A-10

sugiere por ahora la posibilidad de una individualiza- intrnseca. El fentanilo y sus derivados presentan una
cin de los enfoques teraputicos sobre bases genti- ocupacin fraccional de los receptores ms reducida que
cas [43, 44]. la morfina, lo que explica que la morfina sea un agonista
puro de menor potencia de accin que el fentanilo y sus
Receptor 1 de la melanocortina derivados [47]. Adems, parece que la interaccin ligando-
receptor puede ser ms compleja que la simple reproduc-
Estudios sobre el ratn knock-out han permitido cin de una actividad intrnseca [46].
identificar un gen que parece afectar a la percepcin del
dolor. El gen del receptor 1 de la melanocortina (Mc1R)
determina el color de la piel y del pelo, es el responsable Mecanismos de accin celular
del fenotipo de los pelirrojos (piel plida con eflides) Las consecuencias de la interaccin entre opioides y
y parece inhibir el dolor exclusivamente en los ratones receptores son complejas y se han tratado en revistas
hembras [45]. En un estudio en el ser humano, Mogil et especializadas [48]. Los receptores opioides se emparejan
al determinaron que el polimorfismo del Mc1R aumen- con protenas G de tipo Gi/o, inhibiendo as la adeni-
taba efectivamente la respuesta a la petidina (un ago- lato ciclasa y disminuyendo por tanto el contenido
nista j) slo en las mujeres pelirrojas, lo cual indica que intraceluar en AMP cclico. As permiten abrir los
este gen tiene un papel inesperado en la modulacin de canales de potasio, lo cual provoca una hiperpolariza-
las vas j-especficas en la mujer [45]. cin celular a nivel postsinptico e inhibe la abertura de
los canales de calcio dependientes de voltaje reduciendo
la liberacin de neurotransmisores a nivel presinptico.
Mecanismos de la analgesia El conjunto de estos efectos conduce a una reduccin de
la excitabilidad neuronal (Fig. 4). Los receptores opioi-
opioide des pueden emparejarse con muchos sistemas de segun-
dos mensajeros como las protenas activadas por
mitgenos (MAP) cinasas o la cascada de la fosfolipasa
Afinidad, eficacia, actividad intrnseca C, provocando la formacin de inositol trifosfato y de
Como toda sustancia que acta sobre un receptor, los diacilglicerol. A pesar del reducido nmero de receptores
opioides se definen por una afinidad y una eficacia [46]. en comparacin con el nmero posible de agonistas, la
La afinidad de una sustancia para un receptor caracteriza diversidad de la respuesta se basa sin duda en elementos
la facilidad con la que esta sustancia se fija en su lugar como el polimorfismo de los receptores, la duracin de
de recepcin especfico. La afinidad de los opioides en la accin, las interacciones con complejos de receptores,
relacin con el receptor determina su semivida de las caractersticas de la activacin intracelular y el trfico
disociacin. Por ejemplo, el sufentanilo, que presenta intracelular de estos receptores.
una afinidad 16 veces mayor que el fentanilo, tiene
igualmente una semivida de disociacin ms larga Analgesia perifrica y sistema
(25 frente a 1,2 minutos). La eficacia representa la
propiedad que permite al ligando, una vez unido al
inmunitario
receptor, producir una respuesta. Esta eficacia segura- Parece ser que los precursores de los opioides y de la
mente vare en funcin de las condiciones de interaccin orfanina-FQ se expresan en clulas del sistema inmuni-
y las consecuencias de esta interaccin ligando-receptor. tario. Los derivados de la POMC y de la proencefalina
La actividad intrnseca que permite clasificar los ligandos se han estudiado ms a fondo. Se ha identificado una
en agonistas puros, parciales, antagonistas neutros o expresin de POMC en los leucocitos de una amplia
agonistas inversos hace referencia al efecto mximo variedad de especies [49]. Los ARN mensajeros (ARNm)
(Emax) de un ligando dado en un sistema dado. No todos de la preproencefalina y las enzimas necesarias para la
los agonistas puros desarrollan la misma actividad transformacin postraduccin estn presentes en los

Receptor
opioide m

Gi/o
Morfina
Ca2+
Neurotransmisores
Morfina K+
Receptor
opioide m
Adenilato
ciclasa Gi/o

Na+
Membrana AMPc
celular Excitabilidad
elctrica

Regulacin de
PKA numerosos procesos
Citoplasma
celulares

CREB
Expresin
del gen alterado
Ncleo

Figura 4. Acciones de los opioides al nivel celular (segn [1]).


AMPc: cido monofosfrico cclico; PKA: protena cinasa dependiente del
AMPc; CREB: cAMP response element binding protein; Ca: calcio; Na: sodio; K: potasio.

Anestesia-Reanimacin 7
E 36-371-A-10 Farmacologa de los opioides

Ganglio
Raqudeo Crtex
Opioides
M +
Pptido
opioide endgeno
Tlamo + PAG Hipotlamo
Asta dorsal de
la mdula espinal Opioides
Receptor Sustancia P + +
opioide o CGRP
Interleucina 1
Opioide + NRPG + NRM Fascculo LC
exgeno Receptor dorsolateral
L interleucina 1
Noradrenalina

5HT Encefalinas

Neurona aferente
Figura 5. Esquema de la analgesia morfnica perifrica (se- Asta dorsal nociceptiva
gn [1]). L: linfocito; M: macrfago; CGRP: pptido relacionado
con el gen de la calcitonina.

linfocitos T y B, los macrfagos y los mastocitos de los Opioides


mamferos [50]. Estos pptidos opioides derivados del Periferia
sistema inmunitario parecen tener un papel importante Figura 6. Esquema de los lugares de accin de los opioides a
en el caso del dolor inflamatorio [49]. nivel de las vas del dolor (segn [1]). +: efecto activador; -: efecto
inhibidor; : efecto bidireccional activador o inhibidor. LC: locus
coeruleus; NRM: ncleo del rafe magnus; NRPG: nucleus reticu-
Desensibilizacin, internalizacin laris paragigantocellularis; PAG: sustancia gris periacueductal;
y secuestro de los receptores opioides 5HT: serotonina.
Los mecanismos son complejos e implican a los
receptores (desensibilizacin, internalizacin), a meca-
nismos intracelulares y a la activacin de los sistemas gamma-amino-butrico (GABA) y se considera excitado-
pronociceptivos [51]. La tolerancia aguda a los opioides ra [58]. La activacin del receptor ha de inhibir estas
hace referencia a fenmenos de fosforilacin de los clulas y bloquear as el paso de la informacin noci-
receptores y j por la protena cinasa C, la protena ceptiva por la va polisinptica. El ORL1, presente en la
cinasa A y la cinasa receptora b-adrenrgica [51]. Como mdula, parece presentar interacciones complejas con su
otros receptores ligados a la protena G, los receptores ligando OFQ/N, que es proalgsico en dosis bajas [59] y
y d pueden sufrir endocitosis. En cambio, el receptor j analgsico en dosis altas [60]. La liberacin de opioides
no sufre ninguna endocitosis. Esta endocitosis sigue vas en la mdula espinal es la ltima etapa de una serie de
diferentes para los dos receptores y depende del tipo de circuitos neuronales que modulan el mensaje nocicep-
agonista. Esta externalizacin interviene tras la fosfori- tivo. Los opioides intervienen a todos los niveles. El
lacin, lo que facilita la interaccin con las b-arrestinas. sistema ms estudiado es la va descendente que une el
ncleo del rafe mayor (NRM), la sustancia gris periacue-
ductal (SGPA) y el asta dorsal (Fig. 6) [61, 62]. Cuando se
Receptores morfnicos perifricos estimula el NRM [63] o la SGPA [64] se obtiene una
Los receptores opioides sintetizados en el ganglio de analgesia mediada por los opioides. Se asocia una
la raz dorsal pueden activarse con opioides derivados regulacin adrenrgica y serotoninrgica sin que se
del sistema inmunitario. En cada inflamacin, la fun- pueda claramente definir el papel de los dos tipos de
cin perifrica de los receptores opioides aumenta por el regulacin. La SGPA activa al NRM mediante dos neu-
mayor transporte axonal hacia la periferia [49], por un ronas liberando aminocidos neuroexcitadores. El NRM
pH elevado [52] y por un desarrollo de aferencias prima- posee clulas ON y OFF que, respectivamente, facilitan
rias en los tejidos inflamatorios [53]. El acceso de los e inhiben el mensaje nociceptivo al nivel medular [61,
62].
ligandos opioides a los receptores opioides se ve por
tanto aumentado en caso de inflamacin de los tejidos,
lo que constituye, en este caso, un primer nivel de
modulacin del mensaje nociceptivo. Los receptores Propiedades
opioides tambin estn presentes a nivel del ganglio
raqudeo, con posible migracin hacia las terminaciones farmacodinmicas
perifricas y centrales de las neuronas aferentes prima- de los agonistas opioides
rias (Fig. 5). Sobre las fibras aferentes primarias (A? y C)
de la rata, se observan un 20% de receptores , un 15%
de receptores d y un 10% de receptores j [54]. Accin sobre el sistema nervioso
central
Control de la analgesia opioide a nivel Analgesia
medular y del tronco cerebral
Los mecanismos celulares de esta accin analgsica ya
Los cuatro tipos de receptores opioides estn presen- se han detallado. La analgesia producida por los opioi-
tes en las neuronas de la mdula espinal. Se puede des es intensa, constante y dependiente de la dosis.
hablar por tanto de una accin espinal de los opioi- Existe para los dolores por exceso de nocicepcin, pero
des [55]. Los receptores se expresan en la capa 2 de tambin para los dolores neuropticos. La accin es
Rexed con neuronas que presentan dendritas orientadas independiente de la existencia de una inflamacin y se
en direccin rostrocaudal y axones que se dirigen a las traduce por un aumento del umbral nociceptivo inde-
capas I o III-IV [56, 57]. La mayora de estas interneuronas pendientemente del estmulo empleado. Los opioides se
que expresan el receptor no expresa el receptor cido clasifican en funcin de su efecto analgsico mximo en

8 Anestesia-Reanimacin
Farmacologa de los opioides E 36-371-A-10

agonistas puros, con un efecto importante, y en agonis- toxicmano rehabilitado, el paciente tratado crnica-
tas parciales, con un menor efecto mximo. mente por los morfnicos o en el postoperatorio [65, 75].
La aparicin de una HIO en el postoperatorio tras la
administracin de remifentanilo parece ser dependiente
de la dosis [76]. La HIO se traduce por un cuadro de
tolerancia a los opioides con necesidad de aumentar las
Punto fundamental dosis para que resulte eficaz. Para diferenciarla de una
simple tolerancia a los opioides o de un aumento de la
causa del dolor, hay que apoyarse lo mejor posible en el
Exceptuando su accin analgsica, la accin uso de pruebas nociceptivas cuantificadas para buscar
comn a todos los opioides sobre el sistema signos de alodinia (reduccin del umbral nociceptivo) o
nervioso central expone a los pacientes a un de hiperalgesia (aumento de la respuesta dolorosa para
efecto sedativo, un efecto depresor respiratorio, un estmulo doloroso) y sobre signos clnicos asociados,
una accin psicoafectiva y una hiperalgesia. Los como la aparicin de una alodinia clnica, una modifi-
dems efectos secundarios incluyen nuseas y cacin de la topografa o de las distintas caractersticas
vmitos, estreimiento, retencin urinaria, del dolor [66] (Fig. 8). Los datos en el paciente que
broncoconstriccin y depresin de la tos. demuestran una HIO con pruebas cuantificadas se
encuentran en el postoperatorio [75] y en el paciente con
dolor crnico tratado con opioides [77]. La prevencin
podra basarse en la rotacin de opioides [78], la reduc-
cin de las dosis de morfnicos empleando el principio
Hiperalgesia de la asociacin con los analgsicos no morfnicos o con
los anestsicos locales empleados en las tcnicas loco-
A pesar de un escepticismo inicial, la hiperalgesia
rregionales. Se recomiendan igualmente ciertos produc-
inducida por los opioides (HIO) es un concepto con-
tos calificados de antihiperalgsicos asociados con
firmado tanto por la investigacin animal como por la
opioides para limitar el riesgo de HIO: los antagonistas
investigacin en el voluntario sano y en la clnica [65-
68]. Este importante concepto, aparecido al inicio de la del RNMDA [75], los inhibidores de la ciclooxigenasa 2
(COX-2) [79], los agonistas a2 [65, 66] y el propofol [80].
dcada de 2000 [67], conduce a la nueva nocin de que
los opioides pueden tener un efecto pronociceptivo Acciones psicomotoras
mediante una accin de sensibilizacin del sistema
nervioso. En el animal, las hiptesis fisiopatolgicas Los opioides pueden ser el origen de dos comporta-
son complejas y sugieren causas perifricas [69], medu- mientos opuestos: un estado de sedacin, que es el
lares y supramedulares que implican principalmente a efecto secundario ms frecuente tras las nuseas y
los sistemas del RNMDA (Fig. 7), pero tambin a las vmitos, o un estado de agitacin psicomotora, ms
citocinas, la dinorfina y la serotonina [65]. La inflama- frecuente en algunos pacientes (ancianos, nios peque-
cin medular con la activacin glial por los morfnicos os). Debe recordarse la posible relacin con una HIO.
a travs de los receptores tipo Toll tambin parece La depresin del sistema nervioso central se efecta a
desempear una funcin [70]. Existen adems factores un nivel subcortical, en la formacin reticulada y en el
genticos que explican una variabilidad de este fenme- sistema lmbico.
no [71, 72]. Esta HIO parece existir para todos los opioi-
des, incluso aunque el remifentanilo presente una Acciones psicoafectivas
accin especfica de activacin del RNMDA, lo que, Las reacciones psicoafectivas son de dos tipos: casi
asociado con su cintica de accin muy determinada, siempre, en el paciente con dolor, los opioides provocan
aumenta an ms el fenmeno [73]. Se ha observado in euforia y sensacin de bienestar con depresin de las
vivo en el animal que un retiro progresivo permita emociones y de la agresividad. Ms raramente, los
limitar este fenmeno de hiperalgesia inducida por el opioides provocan una disforia con una sensacin
remifentanilo [74]. Esta observacin se ha obtenido en el general de malestar, angustia y alucinaciones. Parece

Inflamacin
Morfnico

+ Glutamato
+
+ +
R PKC RNMDA Introduccin de COx-2
R
Ca2+
+
inhibicin Activacin

+ Hiperalgesia/alodinia
Nocicepcin
Analgesia

Resultado

Analgesia Hiperalgesia
Figura 7. Mecanismos de la hiperalgesia opioide; papel del receptor N-metil-D-aspartato (RNMDA). COX-2: ciclooxigenasa 2;
R: receptor opioide ; PKC: protena cinasa C; Ca2+: calcio.

Anestesia-Reanimacin 9
E 36-371-A-10 Farmacologa de los opioides

empleadas con empeoramiento de las sintomatolo-


ga [85]. La prescripcin en un paciente con antecedentes
de toxicomana (drogas o alcohol) obliga a emplear
dosis mayores de opioides, as como una combinacin
Tolerancia al dolor
con sedantes [86]. Esta toxicomana a veces es difcil de
identificar [87].
El uso inapropiado de los opioides prescritos est en
aumento [88]. El uso puede ser inadecuado (modos de
administracin o indicacin impropios) o deliberada-
mente desviado. Parece que el 55% de los pacientes
tratados de forma inadecuada obtuvo los opioides
gracias a un amigo o a un miembro de la familia. La
principal causa parece ser el incremento de la disponi-
Dosis A bilidad de este tipo de prescripcin en particular para el
dolor crnico no oncolgico. Este uso inapropiado
puede provocar sobredosis mortales cuya cantidad
tambin est en aumento [89]. Los factores de riesgo son
el nomadismo mdico, el sexo masculino y el bajo nivel
Tolerancia al dolor

de educacin [89].
Efectos neuroendocrinolgicos
A nivel del hipotlamo, los opioides inhiben la
liberacin de hormona liberadora de gonadotropinas
(GnRH), factor liberador de corticotropina (CRF), hor-
mona luteinizante (LH), hormona foliculoestimulante (FSH),
corticotropina (ACTH) y hormona antidiurtica (ADH).
Dosis B Existe sin embargo una posible tolerancia con la admi-
Figura 8. Diferencia entre tolerancia e hiperalgesia. Se- nistracin crnica de opioides, por ejemplo, con la
gn [65]. En este modelo experimental hipottico en el volunta- desaparicin de las anomalas menstruales durante un
rio sano, se mide la tolerancia a un estmulo doloroso (fro tratamiento morfnico de sustitucin, que se observa en
doloroso) en funcin de la dosis de morfnico administrada caso de administracin intermitente de herona.
(remifentanilo) en un paciente sin tratamiento opioide crnico o
tomndolos de forma crnica. La respuesta del primer grupo es
Prurito
la lnea continua; la del segundo es la lnea de puntos. El prurito aparece con los opioides administrados por
A. Hiperalgesia morfnica. La respuesta inicial est desplazada cualquier va, pero su incidencia es mayor en caso de
hacia abajo, lo que traduce una hiperalgesia antes del inicio del administracin espinal. El mecanismo parece estar
tratamiento morfnico y despus se desplaza hacia abajo y a la mediado por las neuronas espinales y es reversible con
derecha, lo que traduce una reduccin de la eficacia y una la naloxona.
tolerancia a lo largo de toda la curva.
B. Tolerancia morfnica. La respuesta inicial es normal, lo que Accin respiratoria
traduce ausencia de hiperalgesia. A continuacin la curva
dosis-respuesta se desplaza a la derecha, lo que traduce una Depresin respiratoria
tolerancia. Los opioides disminuyen de forma dependiente de la
dosis la respuesta de los centros respiratorios bulbares a
los estmulos hipoxmicos e hipercpnicos [90] . Esta
que los opioides pueden causar euforia y sensacin de accin de depresin respiratoria es indisociable del
recompensa interactuando con la dopamina en zonas efecto analgsico. El efecto sobre la respuesta al CO2 es
especficas como el ncleo accumbens, parte del estriado ms rpido y ms importante; el estmulo hipoxmico
implicada en la motivacin y en el afecto. persiste durante ms tiempo. El aporte de oxgeno
No existe relacin demostrada en el ser humano entre aumenta pues el riesgo de depresin respiratoria. La
la administracin prolongada de opioides y la aparicin depresin respiratoria es la causa principal de muerte en
de una depresin [81] o una alteracin de las funciones las intoxicaciones por opioides. Se acompaa siempre de
cognitivas [81]. una disminucin de la vigilancia acompaada de seda-
cin. Todos los opioides ejercen esta accin al mismo
Tolerancia, dependencia fsica, adiccin, nivel con dosis equianalgsicas. La repercusin sobre la
sensibilidad al CO2 es evidente con las ms pequeas
uso inadecuado
dosis analgsicas [90]. Este efecto aparece entre
La tolerancia o hbito designa la disminucin de un 5-10 minutos tras la administracin de morfina intrave-
efecto farmacolgico o la necesidad de aumentar la nosa y entre 30-90 minutos tras la administracin de
dosis necesaria para obtener el mismo efecto farmacol- morfina subcutnea. El efecto depresor respiratorio
gico. La dependencia es una bsqueda compulsiva del mximo es mayor cuanto mayor es la liposolubilidad
producto como consecuencia de una primera adminis- del opioide [90]. Se puede demostrar que, durante prue-
tracin. Puede ser fsica y estar asociada a un sndrome bas de estimulacin al CO2, las curvas que recogen el
de abstinencia o sicolgica (adiccin o dependencia). volumen de ventilacin de CO2 espirado se desplazan
Estas diferentes manifestaciones son la consecuencia de hacia la derecha, con un aplanamiento de sus pendien-
consumos repetidos de opioides y aparecen tras un cese tes. Los opioides tambin deprimen los centros bulbares
brusco de la administracin del opioide o de la admi- implicados en la regulacin de la frecuencia respiratoria
nistracin de un antagonista. Esta adiccin es rara en el con bradipnea y respiracin peridica de Cheyne-Stokes
contexto del tratamiento crnico del dolor oncolgi- (fases de respiracin de amplitud creciente y decreciente
co [82]. El dolor crnico no oncolgico, para el cual la con intervalos de pausas) [90]. La bradipnea se asocia a
prescripcin se ha extendido, representa sin duda un aumento compensador del volumen corriente. La
alguna una categora ms amplia de pacientes [83, 84]. De frecuencia respiratoria y el volumen corriente no permi-
esta forma, la migraa tratada con opioides puede ser ten valorar de forma fiable la importancia de la depre-
responsable de un aumento de las dosis de opioides sin respiratoria. Por va espinal, los opioides pueden

10 Anestesia-Reanimacin
Farmacologa de los opioides E 36-371-A-10

reducir el volumen corriente inhibiendo las motoneuro- Los productos utilizados para prevenir o tratar las
nas de los msculos intercostales [90]. El efecto mximo nuseas y vmitos son los neurolpticos (droperidol,
se traduce en una apnea. Se han descrito tambin picos haloperidol), los setrones (ondansetrn) y los corticoides
de desaturacin en los pacientes con ventilacin espon- (dexametasona) [92, 93].
tnea tratados con opioides, en los cuales se han produ-
cido apneas oclusivas [90] . Se empieza a conocer la Estreimiento
accin a nivel cortical [90].
El efecto de los opioides sobre el trnsito digestivo
Rigidez torcica tiene un mecanismo perifrico. Se traduce por una
Se trata de una rigidez muscular inducida por una reduccin de las contracciones propulsoras del intestino
accin central, principalmente visible con los opioides delgado y del colon. La prolongacin del trnsito
que se emplean para la anestesia debido a su potencia, expone a una reabsorcin ms importante de agua que,
la va y las dosis utilizadas. asociada a la reduccin de las secreciones biliar, pan-
cretica e intestinal, aumenta la viscosidad del conte-
Broncoconstriccin nido intestinal. El tono del esfnter anal aumenta y la
La broncoconstriccin se debe a una accin directa de sensacin de distensin rectal se reduce. Este estrei-
los opioides sobre el msculo liso bronquial a causa de miento es el mayor efecto secundario de los opioides en
la liberacin de histamina. Los opioides ms implicados los dolores crnicos. Justifica el uso preventivo o
son la morfina y la petidina. curativo de laxantes. La va transcutnea expone menos
al estreimiento que la va oral. Este leo es an mayor
Depresin de la tos en el postoperatorio, debido a las consecuencias infla-
Los opioides deprimen la tos desde las dosis ms matorias de la ciruga [94]. El uso de antagonistas opioi-
pequeas. Este efecto no es paralelo a la depresin des de accin perifrica es un progreso capital en el
respiratoria y parece estar mediado por receptores control de este estreimiento causado por los opioides.
medulares menos sensibles a la naloxona que aquellos
implicados en la analgesia.
Accin sobre el ojo
Accin cardiovascular Los opioides ejercen una accin mitica por estimu-
lacin del ncleo parasimptico del nervio motor ocular
Accin sobre la frecuencia cardaca comn. La miosis de los opioides se antagoniza con la
Los opioides provocan una bradicardia sinusal por atropina, los gangliopljicos y la naloxona.
estimulacin del nervio vago a nivel del suelo del tercer
ventrculo. Esta bradicardia se antagoniza con atropina.
Accin sobre el aparato urinario
Accin sobre los vasos y las vas biliares
Los opioides liberadores de histamina provocan una
vasodilatacin arteriolar y venosa dependiente de la Los opioides aumentan el tono de las fibras circulares
dosis. El bloqueo de los receptores H1 y H2 antagoniza del esfnter vesical y disminuyen la tonicidad y la
este efecto hipotensor. actividad de las fibras longitudinales por va medular.
Todos lo opioides pueden, en caso de hipertona Esto favorece la retencin de orina. La incidencia es
simptica reducida por el efecto analgsico, provocar mayor con los opioides administrados por va espinal.
una hipotensin. Este efecto es muy significativo en Un efecto perifrico similar se observa en las vas
caso de hipovolemia asociada. biliares con, como consecuencia, una hiperpresin
importante de las vas excretoras biliares que aparece
Acciones sobre la contractilidad miocrdica 15 minutos tras la inyeccin de 10 mg de morfina
Cuando no hay enfermedad cardaca existente o subcutnea y que puede durar 2 horas.
hipertona simptica, los opioides no actan sobre la
contractilidad miocrdica.
Accin sobre el feto
Accin sobre el tubo digestivo El feto se expone a una depresin respiratoria en caso
de administracin a la madre.
Nuseas y vmitos
Las nuseas y vmitos son los efectos secundarios
ms frecuentes de los opioides, con una incidencia Opioides e inmunidad
media del 30% (20-60%), tanto en postoperatorio como Las acciones de los opioides sobre el sistema inmuni-
en el dolor crnico. La incidencia es similar indepen- tario son complejas. Existe un posible impacto directo
dientemente de la va de administracin. Se ha estable- de los opioides sobre las clulas inmunitarias e indirecto
cido una relacin entre la dosis de opioide utilizada y la
mediante mecanismos neuronales [49]. Se ha observado
incidencia de los efectos secundarios [91]. En cambio, los
un efecto agudo por va de la activacin del sistema
opioides pueden variar en su capacidad de causar estas
simptico y una accin a ms largo tiempo por va del
nuseas y vmitos. Por tanto, es lgico proponer una
rotacin de los opioides en dosis equianalgsica cuando eje hipotlamo-hipofisario. Las acciones sobre las clulas
el paciente se queja de estos efectos secundarios. Los de la inflamacin pasan por mecanismos diferentes por
mecanismos de estas nuseas y vmitos son perifricos va de los receptores opioides y d con inhibicin del
y centrales. La accin central es una estimulacin del NF-jB y activacin de la MAP-cinasa. El efecto global de
rea postrema. Cualquier estimulo adicional de esta los opioides parece ser una depresin de la inmunidad.
zona, como las aferencias vestibulares en la deambula- En modelos animales, se observa una mayor susceptibi-
cin, aumenta el riesgo. Esto explica la mayor inciden- lidad a las infecciones y a la difusin tumoral. Por el
cia de las nuseas y vmitos durante el movimiento. La contrario, los opioides inhiben la accin inmunosupre-
accin perifrica es un retraso del vaciado gstrico por sora del dolor. Los efectos inmunitarios de los opioides
atona de las fibras longitudinales gstricas y la hiperto- podran depender del contexto de prescripcin [95]. Hoy
na del ploro. da no se dispone de datos claros en el ser humano [95].

Anestesia-Reanimacin 11
E 36-371-A-10 Farmacologa de los opioides

Uso clnico Keo depende de las propiedades fisicoqumicas de las


molculas. La fraccin difusible es la fraccin libre (no
unida a las protenas plasmticas) y no ionizada.
Resea general Depende del grado de fijacin a las protenas plasmti-
Los opioides representan una familia capital en el cas y del pKa. Todos los morfnicos son bases dbiles. El
tratamiento del dolor agudo y crnico y la anestesia- pKa del alfentanilo es el ms bajo, por lo que su frac-
reanimacin. Estn disponibles mltiples recomenda- cin difusible es importante a pesar de una alta fijacin
ciones que definen las modalidades de utilizacin en el proteica [101]. Sucede lo mismo con el remifentani-
dolor agudo postoperatorio [96], en traumatologa y en lo [102]. El pKa del sufentanilo es ligeramente inferior al
urgencias (www.sfar.org/article/42/modalites-de-la- del fentanilo, pero, como su fijacin proteica es ms
sedation-et-ou-de-l-analgesie-en-situation- fuerte, su fraccin difusible es igual a la del fentanilo.
extrahospitaliere-ce-1999), cuidados paliativos, dolor Las fracciones difusibles del fentanilo y del sufentanilo
crnico oncolgico [97-99], dolor crnico no oncolgi- varan significativamente con el pH plasmtico,
co [6], anestesia-reanimacin, paciente anciano [100] y en teniendo en cuenta sus valores de pKa. Por el contrario,
el nio. Los grandes ejes de estas recomendaciones la fraccin difusible del alfentanilo no se modifica para
consisten en utilizar los opioides asociados con otros variaciones de pH entre 7,20 y 7,60.
analgsicos, en identificar el efecto analgsico para La difusin de la base no unida a las protenas (frac-
permitir utilizar las dosis mnimas eficaces, la mejor va cin difusible) depende de dos factores: la liposolubili-
adaptada al contexto de prescripcin y saber utilizar los dad y el volumen del compartimento central [103]. La
diferentes opioides disponibles. difusin de los morfnicos a ambos lados de la barrera
hematoenceflica es pasiva, responde al gradiente de
Agonistas opioides empleados concentracin transmembrana y se efecta con ms
rapidez cuanto mayor es la liposolubilidad de la mol-
para la anestesia cula. De esta forma, cuando el agente es muy liposolu-
ble, la difusin transmembrana es importante y el
Generalidades
equilibrio de concentracin se alcanza rpidamente
Estos productos se utilizan principalmente por va entre el plasma y el sistema nervioso central (SNC). Por
intravenosa en anestesia o reanimacin y ms rara- el contrario, cuando el morfnico es poco liposoluble,
mente por va espinal en dolor agudo postoperatorio o no se puede alcanzar el equilibrio. Los morfnicos
en dolor crnico. El fentanilo, el sufentanilo, el alfenta- difieren por su liposolubilidad. El fentanilo y el sufen-
nilo y el remifentanilo tienen un efecto analgsico tanilo son los ms liposolubles. La base del fentanilo es
similar al que se observa con la morfina. Sin embargo, ligeramente ms liposoluble que la del sufentanilo pero,
son ms potentes, con, por ejemplo, una potencia del como el porcentaje de base para un pH de 7,40 es
fentanilo y del sufentanilo de 100 a 1.000 veces mayor mayor para el sufentanilo que para el fentanilo, la
respectivamente que la morfina. Los dems efectos liposolubilidad del sufentanilo en el organismo es
farmacodinmicos son as mismo similares a los descri- superior a la del fentanilo. El alfentanilo pertenece a los
tos para los opioides. La ausencia de liberacin de morfnicos de liposolubilidad intermedia, entre la
histamina no expone a un efecto vasodilatador con morfina y el fentanilo.
estabilidad cardiovascular. Los efectos secundarios son El volumen del compartimento central (V1) tambin
similares a los descritos en los opioides. La rigidez es determinante para todo lo relacionado con la canti-
torcica mediada por va central es la nica especfica dad de molculas que difunden en el SNC, ya que esta
debido a su potencia y a las dosis utilizadas por va difusin depende de la concentracin. A mayor reduc-
intravenosa. cin del V1, mayor concentracin inicial del medica-
mento en este compartimento. El alfentanilo tiene un
Farmacocintica de los opioides empleados V1 particularmente pequeo, en comparacin con el
para la anestesia fentanilo y el sufentanilo, a pesar de que las concentra-
Los plazos y duracin de accin de los opioides por ciones iniciales equivalentes para una misma dosis
va intravenosa dependen de dos parmetros farmacoci- inyectada son siete veces ms importantes para el
nticos: la semivida de equilibrio en el sitio de accin alfentanilo que para el fentanilo y el sufentanilo.
(t1/2 Keo) y la semivida observada en el contexto clnico Debido al conjunto de razones ya citadas, el ndice de
o la semivida contextual que se origina por un estmulo difusin responde a la siguiente ecuacin: ndice de
informatizado de la cintica donde intervienen otros difusin = fraccin difusible liposolubilidad/V1.
parmetros farmacocinticos y la duracin de la El Cuadro VI muestra los valores de ndice de difu-
perfusin. sin de diferentes morfnicos respecto a la petidina,
tomada como referencia (ndice de difusin = 1).
Semivida en el sitio de accin El fentanilo y sus dos derivados tienen mejores
Se calcula la t1/2 Keo para varios opioides. Es igual a ndices de difusin que la morfina y la petidina. En
5 minutos para el fentanilo y el sufentanilo, y de consecuencia, para la morfina existe una importante
1 minuto para el alfentanilo y el remifentanilo. Esta t1/2 diferencia en la evolucin de las concentraciones entre

Cuadro VI.
Fraccin difusible e ndice de difusin.
Opioide pKa (pH 7,4) Base (%) (pH 7,4) Fraccin libre (%) V1 (l) Coeficiente ndice de
octanol/agua (pH 7,4) difusin (pH 7,4)
Morfina 7,9 23 70 23 1,4 1,1
Petidina 8,6 7 30 88 39 1
Alfentanilo 6,5 89 9 11 128 100
Fentanilo 8,4 9 16 60 813 20,4
Sufentanilo 8,0 20 7 50 1 778 53,5
Remifentanilo 7,1 67 30 8 17,9 -
V1: volumen del compartimento central.

12 Anestesia-Reanimacin
Farmacologa de los opioides E 36-371-A-10

Cuadro VII.
Farmacocintica de los morfnicos empleados para la anestesia.
Semividas Volmenes Depuracin Metabolismo Coeficiente
de distribucin plasmtica de extraccin
(ml/kg/min) heptica
Distribucin Eliminacin
Nombre t1/2a (min) t1/2b (min) t1/2d (h) Inicial (l/kg) Total (l/kg)
genrico
Morfina 1,2 9 1,7 0,13 3,4 23 CYP2D6 0,7
Fentanilo 1,8 13,4 3,7 0,36 4 12,7 CYP2D6 0,7
Alfentanilo 1,3 9,4 1,5 0,12 1 7,6 CYP3A4 0,61
Sufentanilo 1,4 17,7 2,7 0,16 1,8 12,7 CYP3A4 0,8
Remifentanilo 0,9 6,3 0,59 0,12 0,34 40 Esterasas
tisulares
Los valores se refieren a las medias. t1/2a: semivida de distribucin rpida; t1/2b: semivida de distribucin lenta; t1/2d: semivida de eliminacin; CYPx:
subtipo de citocromo P450.

el SNC y el plasma, lo que no es el caso de una mol-


cula muy difusible como el fentanilo, para la cual el 100 Fentanilo
pico de concentracin en el LCR se alcanza muy rpi-

Semivida aparente (min)


damente, en algunos minutos, y el descenso en el SNC 75
es paralelo al del plasma. Estos datos farmacocinticos Alfentanilo
explican el corto tiempo de accin del fentanilo y su
breve duracin cuando la dosis inyectada no es muy 50
importante; el descenso en el SNC se efecta por redi-
Sufentanilo
fusin del morfnico desde los lugares de accin hacia el 25
plasma y, a continuacin, hacia los msculos. Los
ndices de difusin del alfentanilo y del sufentanilo son Remifentanilo
todava muy altos a pesar de que los picos de concen- 0
tracin en el SNC deberan ser todava ms precoces que 0 100 200 300 400 500 600
en el caso del fentanilo. De hecho, los tiempos de
accin son ms cortos, sobre todo para el alfentanilo. Duracin de la perfusin (min)
Figura 9. Semivida contextual de los opioides empleados en
Semivida de eliminacin, volumen de distribucin
anestesia-reanimacin. Estimulacin del tiempo necesario para
y depuracin plasmtica
una disminucin del 50% de la concentracin plasmtica (semi-
Como para todos los medicamentos, la semivida de vida aparente) tras duraciones variables de perfusin continua de
eliminacin es proporcional al volumen de distribucin fentanilo, alfentanilo, sufentanilo y remifentanilo.
(Vd) e inversamente proporcional a la depuracin total
(C1). El volumen de distribucin de los morfnicos est
constituido principalmente por la musculatura, a causa sistema nervioso central y el plasma. Parece que la
de su vascularizacin [104]. Estas distribuciones y redis- biodisponibilidad de los opioides por va espinal est
tribuciones del morfnico en los msculos dependen as guiada principalmente por su hidrofobicidad; los pro-
mismo de su liposolubilidad (a mayor liposolubilidad ductos ms hidrfobos (fentanilo, alfentanilo, sufenta-
del morfnico, mayor Vd). No sorprende, por tanto, nilo) son los menos biodisponibles [106]. Otros estudios
constatar que el volumen total aparente de distribucin han demostrado que la morfina era el producto con la
en equilibrio (Vdss) del alfentanilo sea menor que el del mayor biodisponibilidad local y, por tanto, con una
fentanilo y el sufentanilo (Cuadro VII). El gran Vdss del accin especfica a nivel espinal; que el fentanilo estaba
fentanilo es la causa de su larga semivida de elimina- almacenado en la grasa peridural, el sufentanilo en la
cin, aunque su depuracin plasmtica sea elevada. El grasa de la sustancia blanca, y el alfentanilo era rpida-
factor que limita la eliminacin del fentanilo del mente reabsorbido a nivel sistmico. Parece pues que la
organismo no es el metabolismo heptico, sino el accin analgsica del sufentanilo es menor por va
volumen de distribucin. espinal que por va sistmica [107]. Por tanto, la reco-
mendacin clnica es emplear de forma prioritaria la
Semivida contextual
morfina por va espinal si se busca un efecto especfico.
La semivida contextual es un parmetro farmacocin-
tico, resultado de una simulacin informatizada. Su Fentanilo
definicin consiste en el tiempo de descenso del 50% en
el compartimento central tras duraciones variables de Farmacocintica
perfusin continua. Este dato refleja la acumulacin del El gran volumen de distribucin del fentanilo es el
opioide en el organismo. La semivida contextual para responsable de su larga semivida de eliminacin, con un
una perfusin de 4 horas es de 3,7 minutos en el caso riesgo de acumulacin en caso de administracin de
del remifentanilo, de 33,9 minutos para el sufentanilo, una dosis nica alta, de dosis repetidas o de una admi-
de 58,5 minutos para el alfentanilo y de 262 minutos nistracin prolongada. En estos casos, el fentanilo se
para el fentanilo [105] (Fig. 9). convierte en un morfnico de muy larga duracin de
accin. La segunda consecuencia del gran Vdss es la
Farmacologa de la va peridural recirculacin del fentanilo desde el territorio muscular
La administracin de los opioides por va espinal durante el recalentamiento en la fase del despertar a
pretende actuar directamente sobre el sistema nervioso causa de la reversibilidad de la vasoconstriccin intrao-
(mdula y cerebro) y limitar la difusin sistmica, ya peratoria de este territorio. Estas recirculaciones originan
que tiene una accin especfica. La farmacologa de los picos secundarios a lo largo de la fase de eliminacin y
opioides por va espinal es compleja. Los espacios pueden de esta forma contribuir a las depresiones
epidural e intratecal estn relacionados entre s y con el respiratorias secundarias descritas con el fentanilo

Anestesia-Reanimacin 13
E 36-371-A-10 Farmacologa de los opioides

durante el perodo del despertar [108]. El fentanilo se tratan sobre el fentanilo en perfusin continua demues-
metaboliza en el hgado, bajo el efecto de la isoenzima tran que el volumen de distribucin del sufentanilo
3A4 del citocromo P450, esencialmente en norfentanilo, haba sido subestimado y que, por el contrario, su Vdss
metabolito que parece ser inactivo desde el punto de era incluso mayor que el del fentanilo. Esta distribucin
vista farmacolgico y que se excreta por va urinaria. del sufentanilo ms importante que la del fentanilo
Menos del 7% de la dosis se excreta sin cambios en la explica un decrecimiento plasmtico ms rpido y
orina y slo alrededor del 1% se elimina igual por las profundo y, por tanto, una semivida de decrecimiento
heces. El porcentaje de unin del fentanilo con las de las concentraciones en el compartimento central
protenas plasmticas es del 80-85%. particularmente corta [105]. Las concentraciones plasm-
ticas se vuelven rpidamente inferiores a los umbrales
Farmacocinticas particulares plasmticos eficaces. De esta forma, la duracin de
Va transdrmica. El uso de una difusin pasiva del accin es ms corta que la del fentanilo y, en caso de
fentanilo a travs de la piel ha permitido desarrollar el perfusin continua, una acumulacin significativa del
fentanilo transdrmico, que permite la utilizacin de sufentanilo en el organismo, susceptible de inducir una
este morfnico para el dolor crnico. Por va transcut- prolongacin del efecto tras la interrupcin del trata-
nea, el fentanilo se caracteriza por una velocidad de miento, debera aparecer para duraciones de perfusin
absorcin lenta constante que confiere a su comporta- ms largas que con el fentanilo [105].
miento farmacocintico una inercia relativa. Esta inercia
Presentacin y uso clnico
se debe a un almacenamiento cutneo del fentanilo,
principalmente en la capa crnea de la epidermis. Este El sufentanilo es el opioide que se emplea ms a
efecto de reservorio cutneo se traduce por el menudo tanto en la anestesia como en la reanima-
aumento progresivo de las concentraciones plasmticas, cin (ampollas de 10 y 50 ml a razn de 5 g/ml).
que alcanzan un estado de equilibrio aproximadamente
a las 24 horas y una semivida de eliminacin aparente Alfentanilo
de alrededor de 20 horas, ms lenta que por va intra- Farmacocintica
venosa. Probablemente debido a la dosis de carga
Al contrario que el fentanilo, el alfentanilo presenta
contenida en la capa adhesiva del sistema transdrmico,
un volumen de distribucin mucho ms pequeo [109]
se observa que alrededor del 80% del valor mximo de
(Cuadro VII). Para el alfentanilo, las consecuencias son
las concentraciones plasmticas se alcanza a partir de la
las siguientes:
12.a hora, las concentraciones aumentan despus pro-
semivida de eliminacin corta a pesar de que la
gresivamente y se estabilizan entre la 24.a y la 48.a hora
depuracin es menor que el del fentanilo;
y se mantienen hasta la 72.a hora. La cintica de esta
ausencia de recirculacin;
va transdrmica puede ser modificada por la zona de
acumulacin en los msculos mucho menor que en
aplicacin, la temperatura y la circulacin cutnea (si la
el caso del fentanilo.
temperatura es elevada, se observa una vasodilatacin
Por el contrario, la distribucin del alfentanilo es
que favorece la absorcin) y el estado de la piel (la
rpida y la farmacocintica de este tipo de medicamento
existencia de quemaduras aumenta la absorcin).
es mucho ms susceptible de ser modificada por retrasos
Va iontofortica. La va iontofortica, que no se
en la eliminacin heptica que el fentanilo [110]. Estos
utiliza desde finales de 2008 consista en permitir una
retrasos de eliminacin son responsables de acumula-
ionizacin intermitente del fentanilo contenido en un
cin del alfentanilo en caso de administracin prolon-
reservorio colocado sobre la piel, con la consiguiente
gada e inducen a una imprecisin en la prediccin de
posibilidad de administracin transcutnea de bolos de
las concentraciones plasmticas alcanzadas con una
fentanilo. Este dispositivo se ha abandonado como
perfusin continua [111]. Corresponden a disminuciones
consecuencia de activaciones espontneas del disposi-
de la depuracin plasmtica consecutivas a anomalas de
tivo de administracin. La cintica del dispositivo
la actividad metablica de las enzimas que participan en
presentaba un pico a los 15 minutos (0,5-1,5 ng/ml) y
la degradacin del alfentanilo. El alfentanilo se metabo-
una semivida de absorcin de 15 minutos. El peso, la
liza a nivel heptico mediante enzimas especficas del
edad, la raza y el sexo no influan. La absorcin aumen-
citocromo P450 (Cuadro VII). Se estima que el 10% de
taba en 24 horas (dosis inicial igual al 40% de la dosis
los pacientes sin afectacin heptica puede presentar
final a las 24 horas). No haba metabolismo cutneo; el
retrasos de metabolizacin del alfentanilo a causa de un
92% del fentanilo liberado estaba presente en la circu-
polimorfismo gentico en la sntesis de estas enzi-
lacin sistmica. Exista una absorcin pasiva muy
mas [112]. El metabolismo heptico del alfentanilo se
limitada estimada en 2,3 g/h de fentanilo.
altera tambin en caso de insuficiencia hepatocelular, de
Va transmucosa. La liposolubilidad del fentanilo ha
disminucin del gasto cardaco y de interacciones
permitido proponer dos formas de administracin
farmacolgicas con la cimetidina y la eritromicina, lo
transmucosa, la primera a travs de la mucosa nasal y la
que obliga a emplear el alfentanilo con prudencia en un
segunda a travs de la mucosa bucal.
paciente tratado con este antibitico.
Presentacin y uso clnico
Presentacin y uso clnico
El fentanilo se utiliza poco actualmente tanto en la El alfentanilo est disponible por va intravenosa
anestesia como en la reanimacin a causa del riesgo de (ampollas de 2, 5, 10 y 20 ml a razn de 500 g/ml;
acumulacin. Por el contrario, su uso se desarrolla en ampollas de 2 ml a razn de 500 g/ml). Su uso ptimo
nuevas formas galnicas, como la va transdrmica est destinado a situaciones cortas en las que es posible
(parche de 12,5, 25, 50 y 100 g/h que se colocan cada realizar su titulacin con escasos efectos prolongados en
3 das); recientemente se han abandonado la va trans- el tiempo.
mucosa y la va iontofortica.
Remifentanilo
Sufentanilo
Farmacocintica
Farmacocintica
La potencia del remifentanilo es similar a la del
Tras unos primeros estudios farmacocinticos, el fentanilo y es entre 20-30 veces ms importante que la
sufentanilo ha sido clasificado como intermedio entre el del alfentanilo. El remifentanilo es nico, ya que se
fentanilo y el alfentanilo (Cuadro VII). Pareca que se metaboliza gracias a colinesterasas no especficas pre-
acumulaba menos que el fentanilo. Los estudios que sentes en numerosos tejidos. El metabolito principal, el

14 Anestesia-Reanimacin
Farmacologa de los opioides E 36-371-A-10

Cuadro VIII.
Perfil de accin clnica de los opioides empleados para la analgesia.
Medicamento Administracin Inicio de accin Pico de accin Duracin Semivida de Notas
(min) (h) de la accin (h) eliminacin (h)
Morfina v.o. 15 1-2 4-5 2-3 Primera eleccin
s.c. 15-30 1-1,5 4-5 para la analgesia
i.v. 5 min 0,25 4-5

Codena v.o. 30-60 1-2 4-6 3-4 Eficacia y toleran-


cia variables

Hidromorfona v.o. 30 1,5-2 4 2,5-3

Oxicodona v.o. 15 0,5-1 3-6 3-4

Nalbufina i.m. 30 1 3-6 3-4


i.v. 3 min

Dextropropoxi- v.o.
feno

Tramadol i.v. 15-30 2 4-6 6


v.o.
v.o.

Tapentadol v.o. 30 1,5 4-6 4,3 Peticin de AC en


2009
AC: autorizacin de comercializacin; i.v.: intravenoso; s.c.: subcutneo; i.m.: intramuscular; v.o.: va oral; LP: liberacin sostenida.

remifentanilo cido, es ms de 1.000 veces menos


potente que el remifentanilo. La semivida terminal de
este metabolito es de 90-130 minutos. En la circulacin
extracorprea, la hipotermia disminuye un 20% la
Punto fundamental
depuracin del remifentanilo mediante inhibicin de las Tras aos de esfuerzos para luchar contra la fobia
esterasas tisulares. No se altera pues el metabolismo
de los opioides y ampliar su prescripcin, ha
heptico ni la funcin renal. Por el contrario, la dosis
debe reducirse en el anciano y adaptarse a la masa
llegado la hora de reflexionar sobre los medios
magra en el obeso. El volumen de distribucin es para emplearlos de la mejor manera posible. Su
pequeo, cercano al del alfentanilo, con una elevada accin hiperalgsica es un nuevo dato que se
depuracin total, ocho veces superior al del alfentanilo asocia a otro mejor conocido, la tolerancia. Estos
(40 ml/kg/min). La semivida contextual es de 3 minutos dos datos proponen un control razonado de los
independientemente de la duracin de la perfusin. opioides para el dolor crnico que priorice las
Presentacin y uso clnico
dosis mnimas eficaces y las asociaciones con otros
analgsicos.
El remifentanilo est disponible por va intravenosa
(ampolla de 2 mg). El remifentanilo es muy til para
intervenciones de corta duracin y puede permitir, en la
ciruga mayor, un despertar ms rpido. Sin embargo, el Morfina
remifentanilo, a causa de su cintica y de una accin
Farmacocintica general
especfica sobre el RNMDA, origina un dolor postopera-
torio intenso tras la ciruga mayor [75]. La hiperalgesia Como la mayora de los dems opioides, es una base
inducida por el remifentanilo parece ser dependiente de dbil (el 79% est en forma ionizada a un pH de 7,4).
la dosis [76]. La prevencin del dolor postoperatorio se Difunde lentamente a travs de la barrera hematoence-
basa en una disminucin de las dosis de remifentani- flica. Tras la absorcin, la morfina se fija principal-
lo [75], una anticipacin mediante analgsicos morfnicos mente a la albmina (el 30-35%). La morfina se
y no morfnicos [113] , la asociacin con tcnicas de metaboliza fundamentalmente en el hgado por el
anestesia locorregional [114] y en la asociacin con citocromo CYP2D6 y, a continuacin, por glucurocon-
ketamina perioperatoria [75]. jugacin. La semivida de eliminacin en el adulto joven
es de 2 horas. Los metabolitos son la morfina-3-
Agonistas opioides empleados glucurnido (M3G; el 50% de los metabolitos) y la M6G
(10% de los metabolitos). La M3G, la ms importante
para la analgesia en cantidad, no presenta accin analgsica, pero puede
ser responsable de toxicidad neurolgica con efectos
Generalidades excitadores en el animal, efectos que no se han confir-
El Cuadro VIII recoge los elementos sintticos sobre la mado en el ser humano [115]. La M6G tiene una accin
farmacocintica de los distintos opioides empleados en analgsica dos veces ms importante que la de la mor-
la anestesia. En general, los opioides se absorben por va fina y una semivida de eliminacin mucho ms larga
oral con una biodisponibilidad reducida por el primer (10 horas en el LCR). En el postoperatorio, la M3G
paso heptico. Las vas transmucosa y transcutnea parece ejercer un ligero efecto antagonista que podra
estn reservadas para los opioides lipfilos. ser clnicamente significativo despus de 1-2 das [116]. El

Anestesia-Reanimacin 15
E 36-371-A-10 Farmacologa de los opioides

papel de la M6G en la analgesia resulta importante en Este hecho sugiere, como mnimo, la necesidad de un
caso de administracin crnica de morfina. La M6G es tratamiento combinado que emplee anestsicos locales
adems la base de un desarrollo especfico como anal- por va peridural, o incluso una inadecuacin de este
gsico intravenoso [117]. Existe una recirculacin entero- tipo de tratamiento para el dolor agudo.
heptica que explica la presencia de morfina en las Factores de variacin de la farmacocintica.
heces y en la orina varios das despus de la ltima Edad. La morfina intravenosa puede dosificarse en
toma. Los metabolitos son a continuacin eliminados dosis similares en el anciano [129, 130]. Por el contrario,
por va renal, principalmente en forma de M3G. La las dosis de morfina empleadas en el mantenimiento de
insuficiencia renal aumenta pues de forma clara el la analgesia pueden reducirse un 40% en esta
riesgo de acumulacin de los metabolitos de la morfina. poblacin [130].
Insuficiencia renal y heptica. La alteracin de la
Modalidades de administracin particulares funcin renal es la responsable de una acumulacin de
Administracin perifrica. En caso de inflamacin, metabolitos de la morfina que favorece las sobredosis.
los opioides pueden tener una accin analgsica perif- La insuficiencia renal requiere pues una reduccin de las
rica [118]. Esta propiedad se emplea para justificar una dosis de morfina.
administracin intraarticular en el postoperatorio, con Presentacin y uso clnico. La morfina es el opioide de
la posibilidad de obtener una analgesia moderada de referencia. En Francia, la morfina es el primer morfnico
24 horas con una dosis de 1 mg de morfina [119]. La empleado para el dolor postoperatorio en el adulto (62%
eficacia analgsica puede completarse con la combina- en las primeras 24 horas postoperatorias [122]). En la
cin con anestsicos locales. actualidad en Francia, ms del 20% de los pacientes
Va oral. La absorcin por va oral es errtica. Existe emplea la analgesia controlada por el paciente [122].
un efecto de primer paso heptico que explica la baja Recientemente, la Socit Franaise dAnesthsie et de
biodisponibilidad, estimada en un 30% [120]. La relacin Ranimation ha reactualizado las recomendaciones para
dosis por va oral/intravenosa est pues estimada en un el uso de la morfina intravenosa [96].
sexto en el caso agudo, en la mitad y en un tercio en la
toma crnica, probablemente a causa de la acumulacin Codena
de metabolitos activos. La biodisponibilidad oral de la Farmacocintica
morfina es todava menor en el postoperatorio, sin duda
alguna a causa de las modificaciones del trnsito [121]. La codena o 3-metil-morfina es un alcaloide del opio
Va subcutnea e intramuscular. Estas dos vas que presenta una dbil afinidad para los receptores
presentan cinticas similares. El pico de efecto se sita opioides. Se trata de una prodroga, ya que alrededor del
a los 60 minutos tras la inyeccin y su eficacia es de 10% de la codena se metaboliza en morfina, la cual
4-6 horas. En Francia se emplea la va subcutnea y en tiene una actividad analgsica. El polimorfismo gentico
Norteamrica, la va intramuscular. El uso de morfina que afecta al CYP2D6 inactiva la codena en el 15% de
subcutnea representa pues ms de un tercio de las los caucsicos. Tras el metabolismo, su eliminacin es
prescripciones de morfina en el postoperatorio [122]. Se renal.
contina prescribiendo de forma deficitaria (dosis Farmacodinmica
insuficiente e intervalo demasiado largo) y su prescrip-
cin se respeta poco por parte del personal de La farmacodinmica se puede superponer a la de la
enfermera [122]. morfina. La codena es ms eficaz que la morfina por
va oral, dado que el efecto del primer paso por el
Va intravenosa. La va intravenosa se emplea en
hgado es menor.
dosis de ataque para tratar un dolor intenso en el
postoperatorio [123, 124] o en el marco de las urgen- Presentacin y uso clnico
cias [125] . Para la dosis de ataque, la cintica de la
En Francia, la codena es el quinto morfnico que se
morfina ha sido estudiada recientemente [126].
utiliza con ms frecuencia para el dolor postoperatorio
Vas peridural e intratecal. La morfina es hidrfila y,
en el adulto (3,3% en las 24 horas postoperatorio [122]).
tras administrarse en el espacio peridural, atraviesa la
La codena existe en forma oral con liberacin inme-
duramadre, difunde poco hacia la circulacin o el
diata asociada siempre al paracetamol (en comprimidos
sistema nervioso central y permanece en el LCR con
de 30 mg codena y 500 mg de paracetamol o en com-
posibilidad de difundirse rostralmente y originar depre-
primidos efervescentes de 30 mg de codena y 500 mg
sin respiratoria retardada. Se recomienda utilizar la
de paracetamol) forma de liberacin sostenida (compri-
analgesia morfnica peridural en asociacin con anest-
midos de 60 mg) y la forma peditrica (nio con ms
sicos locales para el control del dolor postoperatorio en
de 1 ao, solucin a 1 mg/ml). Son necesarias entre tres
ciruga mayor del tronco [127].
y cuatro tomas diarias.
Se puede emplear por va intratecal mediante admi-
nistracin continua gracias a dispositivos implantables, Petidina
casi siempre en caso de dolor crnico oncolgico [128].
Su uso mediante inyeccin nica en el postoperatorio, Farmacocintica
se realiza en dosis bajas (100-200 g). Esta tcnica es La petidina se metaboliza en el hgado originando un
eficaz, pero el riesgo respiratorio requiere una vigilancia metabolito activo tras dimetilacin, la normeperidina.
en cuidados intensivos, excepto si la dosis inyectada es Este metabolito puede acumularse en caso de insufi-
inferior o igual a 100 g en un paciente ASA I o II [96]. ciencia renal y provocar alucinaciones y convulsiones.
Existe una formulacin de morfina, no disponible en Presenta una semivida corta.
Francia, de liberacin sostenida. Esta formulacin, que
contiene liposomas, presenta una accin analgsica de Farmacodinmica
48 horas de duracin tras un nico bolo peridural de La petidina presenta, adems de sus propiedades
5-15 mg. Comparada con la morfina intravenosa y la analgsicas y anticolinrgicas, una actividad anestsica
morfina peridural clsica, una dosis de 15 mg o ms de local.
morfina de liberacin sostenida origina:
una incidencia mayor de depresin respiratoria; Presentacin y uso clnico
un incremento de la incidencia de prurito respecto a La petidina slo est disponible para administracin
la morfina peridural; parenteral (nicamente por va intramuscular, ampolla
un incremento de la incidencia de vmitos respecto de 100 mg, dosis mxima de 600 mg/d). En la actuali-
al placebo. dad, su uso es raro a causa de su limitada eficacia, su

16 Anestesia-Reanimacin
Farmacologa de los opioides E 36-371-A-10

Cuadro IX. En los pacientes con alteraciones de la deglucin, se


Proporcin de equianalgesia entre los morfnicos. pueden abrir las cpsulas y mezclar los microgrnulos
DCI Ratio Equivalencia de la dosis
en un lquido, ya que la biodisponibilidad de la hidro-
de morfina oral morfona no cambia.
Dextropropoxifeno 1/6 60 mg de D = 10 mg de morfina Oxicodona [131, 132]
(D)
Codena (C) 1/6 60 mg de C = 10 mg de morfina Farmacocintica
Tramadol (T) 1/5 50 mg de T = 10 mg de morfina El clorhidrato de oxicodona es un agonista opioide
Petidina (P) 1/5 50 mg de P = 10 mg de morfina puro de los receptores y j. El comprimido de oxico-
Dihidrocodena (DC) 1/3 30 mg de DC = 10 mg de morfina dona est fabricado mediante un procedimiento gal-
Morfina oral 1 nico original de liberacin bifsica. El 38% de la dosis
situado en la capa externa se absorbe con una semivida
Morfina i.v. 3 1 mg de morfina i.v. = 3 mg de
morfina oral
de absorcin de 37 minutos. El 62% restante de la dosis
se absorbe, gracias a un sistema de matriz hidrfoba,
Morfina s.c. o i.m. 2 1 mg de morfina s.c. = 2 mg de
mucho ms lentamente, con una semivida de absorcin
morfina oral
de 6,2 horas. En total, la biodisponibilidad oral es de un
Nalbufina s.c. 2 5 mg de nalbufina s.c. = 10 mg
60% de media (entre un 60 y un 87% segn los estu-
de morfina oral
dios). La oxicodona es metabolizada por el hgado en
Oxicodona oral 2 1 mg de oxicodona = 2 mg de noroxicodona, principal metabolito sin actividad anal-
morfina oral gsica notable, y en oximorfona, molcula cuya activi-
Hidromorfona oral 8 1 mg de hidromorfona = 8 mg de dad analgsica es diez veces ms fuerte que la de la
morfina oral morfina y est comercializada en Estados Unidos. Sin
Buprenorfina (B) s.l. 30 0,2 mg de B = 6 mg de morfina embargo, la implicacin clnica de este metabolito es
oral insignificante, ya que se produce en cantidades muy
DCI: denominacin comn internacional; s.l.: sublingual; i.v.: pequeas. La oxicodona y sus metabolitos son elimina-
intravenoso; s.c.: subcutneo; i.m.: intramuscular. dos fundamentalmente por el rin. El inicio de accin
de la forma de liberacin sostenida presenta un plazo de
7,99 2,96 horas. La semivida de eliminacin de la
corta semivida, que requiere una administracin cada
oxicodona es de 2-8 horas para la forma de liberacin
3 horas, y de la toxicidad neurolgica del metabolito
sostenida. La insuficiencia heptica o renal requieren
normeperidina.
una adaptacin de las dosis o alargar el tiempo entre
Hidromorfona tomas, ya que las concentraciones plasmticas de
oxicodona aumentan alrededor de un 50%, lo que se
Farmacocintica traduce clnicamente en una mayor sedacin.
La hidromorfona es un derivado semisinttico (cetona Farmacodinmica
hidrogenada de la morfina) entre seis y ocho veces ms
potente que la morfina. Su biodisponibilidad oral vara La oxicodona es un agonista semisinttico y j, con
del 35 al 60% segn los estudios. Su accin se inicia a propiedades similares a las de la morfina. La proporcin
partir de los 30 minutos. Se observa un 8% de unin a de equianalgesia es de 2:1 entre la morfina oral y la
protenas plasmticas y una semivida de eliminacin oxicodona oral (2 mg de morfina = 1 mg de oxicodona)
plasmtica de alrededor de 2 horas. El metabolismo y de 4:1 entre oxicodona oral e hidromorfona (4 mg de
heptico conduce a la formacin de la hidromorfona oxicodona = 1 mg de hidromorfona) (Cuadro IX). La
3 glucurnido (H3G) y, en menor cantidad, de dihidro- forma parenteral (no disponible en Francia) posee el
isomorfina y de dihidromorfina. La H3G, al contrario 75% de la potencia de la morfina parenteral. Los efectos
que la M6G, no parece presentar actividad farmacol- secundarios son cualitativamente los mismos que los de
gica. La eliminacin de la hidromorfona (5,6%) y de sus la morfina.
metabolitos (38%) se realiza por va urinaria. Todava se
Presentacin y uso clnico
desconoce gran parte de la accin de sus metabolitos,
por lo que se debe tener precaucin a la hora de pres- En Francia existe una forma oral de liberacin inme-
cribirla por primera vez en pacientes con disminucin diata (cpsulas de 5, 10 y 20 mg) y una forma de
de la funcin renal y en ancianos. liberacin sostenida (comprimidos de 10, 20, 40 y
80 mg; 1 toma cada 12 horas). Est indicada en los
Farmacodinmica dolores crnicos de origen oncolgico, intensos o
Los efectos son superponibles a los de la morfina. La rebeldes a los analgsicos de nivel inferior, en el adulto.
proporcin de equianalgesia es de 7,5:1 entre morfina Al principio se emplean dosis de 10-20 mg por toma en
oral e hidromorfona oral (7,5 mg de morfina = 1 mg de los pacientes que nunca han tomado opiceos. Cada
hidromorfona) (Cuadro IX). Los efectos secundarios de 24 horas pueden adaptarse las dosis en funcin del
la hidromorfona son similares a los de la morfina pero, dolor. Es posible, incluso recomendado, asociar morfina
en el caso de rotacin de opioides, puede esperarse una de liberacin inmediata con oxicodona de liberacin
reduccin de los problemas de tolerancia. La hidromor- sostenida en caso de picos dolorosos transitorios. En el
fona est contraindicada en caso de insuficiencia hepa- dolor agudo en el postoperatorio, se ha demostrado que
tocelular grave, epilepsia no controlada e insuficiencia la asociacin de la oxicodona con la morfina puede
respiratoria descompensada. resultar til [133].
Presentacin y uso clnico Tramadol
Est indicada en el tratamiento de los dolores inten-
Farmacocintica
sos de origen oncolgico en caso de resistencia o de
intolerabilidad a la morfina (a partir de los 7 aos de Es un opioide sinttico, anlogo a la codena. Tras su
edad). En la actualidad, en Francia, slo existe una administracin oral, la biodisponibilidad es del 70-90%.
presentacin (cpsulas de 4, 8 16 y 24 mg). En otros La semivida de eliminacin se sita entre 5-7 horas en
pases (Estados Unidos, Canad, pases europeos) existen el voluntario sano. El metabolismo se realiza en un 90%
formas de liberacin inmediata, oral, bebible, parenteral en el hgado, formando como metabolito el O-dimetil-
o en supositorios, muy empleadas en el postoperatorio. tramadol o compuesto M1, que es casi el triple de

Anestesia-Reanimacin 17
E 36-371-A-10 Farmacologa de los opioides

potente que el tramadol con una semivida similar. El Dextropropoxifeno


tramadol y sus metabolitos son a continuacin comple-
Farmacocintica
tamente excretados por el rin.
El dextropropoxifeno (DXP) es un opioide sinttico
Farmacodinmica con una estructura similar a la de la metadona. La
Presenta un doble mecanismo de accin con una biodisponibilidad es del 30-70%. Su eficacia comienza a
accin agonista parcial del receptor y una inhibicin los 30-60 minutos. La Tmax es de 2-2,5 horas. La
de la recaptacin de la noradrenalina y de la serotonina duracin de la accin es de 4-6 horas. La eliminacin es
sobre las vas descendentes, lo que permite una interac- sobre todo renal tras un metabolismo heptico por el
cin con los receptores a2-adrenrgicos. citocromo 2D6. Slo el 10% se elimina sin metabolizar.
La semivida de eliminacin es de 6-12 horas para el
Presentacin y uso clnico propoxifeno y de 30-36 horas para el norpropoxifeno.
En Francia, el tramadol es el segundo opioide Farmacodinmica
empleado tras la morfina para el dolor postoperatorio
El DXP interacta con los receptores , j y probable-
en el adulto (15,2% en las primeras 24 horas postope-
mente con los RNMDA. Su potencia analgsica es un
ratorias [122]). El tramadol dispone de una amplia gama
33-50% superior a la de la codena. En el postoperatorio,
de forma oral de liberacin inmediata (en comprimidos
la dosis de 65 mg requiere un nmero de pacientes que
de 50 y 100 mg o en comprimido efervescente de
tratar (NPT) de 7,7 [134]. La asociacin con 600 mg de
50 mg) y liberacin sostenida, de formas parenterales de
paracetamol reduce el NPT a 4,4, lo que lo sita a nivel
accin inmediata (va intravenosa e intramuscular,
del tramadol 100 mg, pero es menos eficaz que la
ampolla de 100 mg), de formas peditricas (nio mayor asociacin codena 60 mg-paracetamol 600 mg o ibu-
de 3 aos; solucin bebible de 100 mg por ml). Se profeno 400 mg [134].
puede pues emplear tanto para el dolor agudo como Los efectos secundarios menores son los vrtigos. Se
crnico. La dosis recomendada es de 50-100 mg cada pueden observar los efectos secundarios habituales de
4-6 horas sin sobrepasar los 400 mg/d. Existen igual- los morfnicos. De forma ms rara, se han detectado
mente formas orales que asocian tramadol con parace- hipoglucemias, en ocasiones graves. Existen riesgos de
tamol (en comprimido de 37,5 mg de tramadol y toxicidad con el norpropoxifeno, que tiene una accin
325 mg de paracetamol; dosis mxima de ocho compri- de tipo anestsico local y que puede provocar problemas
midos al da). cardacos (bradicardia, insuficiencia cardaca, alteracio-
nes de la conduccin con alargamiento del intervalo
Tapentadol QT). En las sobredosis se observan tambin edemas
Farmacocintica pulmonares y convulsiones [135].

La biodisponibilidad oral (paciente en ayunas) es de Presentacin y uso clnico


media del 32%. En caso de alimentacin concomitante En Francia, el DXP es el cuarto opioide empleado en
(desayuno copioso), la concentracin plasmtica el dolor postoperatorio en el adulto (6,3% en las
mxima (Cmax) y el rea bajo la curva aumentan 24 horas postoperatorias [122]). El DXP se suele emplear
respectivamente un 16 y un 25%, y el tiempo necesario casi siempre asociado con paracetamol (65 mg de DXP,
para alcanzar la Cmax (Tmax) pasa de 90 a 180 minu- 400 mg de paracetamol). La Socit Franaise
tos. El volumen de distribucin es de 540 l con una dAnesthsie et de Ranimation ha insistido en des-
difusin rpida en el SNC. La fijacin a protenas es baja aconsejar el uso de DXP en 2008 [96]. La Agence
(20%). La eliminacin se realiza por la orina tras glucu- Franaise de Scurit Sanitaire des Produits de Sant
roconjugacin mediante una pequea accin del cito- (AFSSAPS) previ en 2009 una retirada progresiva del
cromo P450 y una semivida de eliminacin de DXP en 1 ao. Esta retirada fue la consecuencia de una
4,3 horas. Se observa un efecto menor de la edad decisin de la Agencia Europea de Medicamentos del
(>65 aos), el sexo, el peso y la raza sobre la farmaco- 25 de junio de 2009 que examin los datos de eficacia
cintica del tapentadol, que est contraindicado en caso y de seguridad transmitidos por los laboratorios impli-
de insuficiencia heptica grave. En caso de insuficiencia cados as como los datos de intoxicaciones obtenidos en
renal, existe acumulacin (sin riesgo aparente) de los los diferentes Estados miembros de la Unin Europea.
metabolitos. Al contrario que con el tramadol, no se ha Esta decisin fue motivada por el importante nmero de
detectado interaccin con el paracetamol. fallecimientos declarados en el contexto de intoxicacio-
nes voluntarias o accidentales, una eficacia limitada y
Farmacodinmica
un estrecho margen teraputico.
El tapentadol es similar al tramadol y se caracteriza
como ste por una doble accin que asocia una accin Fentanilo por va transmucosa
sobre el receptor y un efecto de inhibicin de la Tres productos que contienen fentanilo permiten una
recaptacin de la noradrenalina. El tapentadol es un administracin transmucosa. Para los tres, la indicacin
enantimero puro que acta directamente sobre el es el tratamiento de los episodios dolorosos en el paciente
sistema nervioso central y sus metabolitos no poseen oncolgico tratado previamente con un morfnico en
una accin analgsica. dosis de al menos 60 mg/d de morfina, 25 g/h de
Presentacin y uso clnico fentanilo transcutneo o 30 mg/d de oxicodona. Estos
episodios de dolor afectan a dos tercios de los pacientes
El tapentadol es un opioide que prximamente estar oncolgicos durante el desarrollo de su enfermedad.
disponible en Francia para el tratamiento del dolor El fentanilo est disponible desde la dcada de 1990 y
postoperatorio. Se ha demostrado la eficacia del tapen- se presenta en forma de comprimidos con aplicador bucal
tadol en el dolor postoperatorio de moderado a intenso de 200, 400, 600, 800, 1.200 y 1.600 g. El comprimido
con una accin analgsica comparable a la de la oxico- debe colocarse en la boca, entre el carrillo y la enca; se
dona y la de la morfina oral. Los principales efectos consume en 15 minutos, hay que frotarlo vigorosamente
secundarios son los habituales de los morfnicos como contra el carrillo y no debe morderse. La farmacocintica
nuseas, vmitos, somnolencia y depresin respiratoria. de la absorcin del fentanilo transmucoso incluye una
No se ha estudiado su inocuidad en la mujer embara- absorcin rpida inicial a partir de la mucosa bucal (25%
zada o en perodo de lactancia. No existen estudios en de la dosis), un inicio de accin a los 5-10 minutos y una
el nio. absorcin prolongada del fentanilo ingerido, a partir del

18 Anestesia-Reanimacin
Farmacologa de los opioides E 36-371-A-10

tracto gastrointestinal (un tercio de la dosis total) con 2-5 minutos tras la administracin intravenosa y a los
una biodisponibilidad total del 50%. La concentracin 15-20 minutos por va intramuscular o subcutnea. La
plasmtica mxima se alcanza a los 20-40 minutos y la duracin de la analgesia es de 4 horas. Los efectos
duracin de accin es de 1-3,5 horas, aunque puede secundarios son los de los opioides. En caso de intoxi-
aumentar con dosificaciones elevadas. cacin pueden aparecer signos neurolgicos con disforia
El fentanilo en spray intranasal posee la autorizacin y signos sicodislpticos.
europea de comercializacin desde julio del 2009. Se Presentacin y uso clnico. En Francia, la nalbufina
destina al tratamiento de los episodios dolorosos sigue siendo el tercer opioide empleado tras la morfina
paroxsticos. Se observa un alivio clnicamente notable para el dolor postoperatorio en el adulto (11,5% a las
del dolor al cabo de 10 minutos en el 58% de los 24 horas postoperatorias [122]). La dosis habitual es de
episodios dolorosos tratados y una buena tolerabilidad 10 mg cada 3-6 horas.
de todas las dosis de fentanilo en spray durante la fase
de seguimiento de 10 meses. Buprenorfina
El fentanilo tambinse presenta en forma de compri- Farmacocintica. La buprenorfina es un opioide
mido (100-800 g de fentanilo) que debe colocarse en sinttico derivado de la tebana, entre 25-50 veces ms
posicin sublingual, con una dilucin rpida en potente que la morfina. La biodisponibilidad es de
1 minuto y un Tmax variable de 15-47 minutos. alrededor del 75%. Tras la administracin sublingual de
Para los tres productos es posible realizar una titula- 0,4 mg, el producto es detectado desde el minuto
cin con la administracin repetida con el fin de 30 con un pico plasmtico 1-2 horas despus y una
obtener un alivio del dolor. El intervalo de tiempo entre analgesia que persiste entre 6-8 horas. La unin proteica
dos dosis es al menos de 15 minutos. En el siguiente es del 96%, no con la albmina, sino nicamente con
episodio doloroso paroxstico, el paciente debe aumen- la a y la b-globulina. Es muy improbable cualquier
tar la posologa a la dosis inmediatamente superior. interaccin en los lugares de fijacin de las globulinas.
El metabolismo heptico origina la norbuprenorfina
Fentanilo por va transdrmica (N-dialquil-buprenorfina). Dos tercios de los metabolitos
Por difusin pasiva se excretan por las heces y slo un tercio por el rin.
Farmacodinmica. La farmacodinmica est caracte-
Farmacocintica. El fentanilo se absorbe de forma rizada por una accin agonista sobre el receptor y
continua a travs de la piel en un perodo de 72 horas. antagonista sobre el receptor j. La unin al receptor
Tras la primera aplicacin, las concentraciones sricas de morfnico se disocia muy lentamente. Por eso, la
fentanilo aumentan progresivamente y por lo general depresin respiratoria de la buprenorfina se antagoniza
alcanzan un techo al cabo de 12-24 horas, tras lo cual muy mal con la naloxona.
permanecen relativamente estables durante el resto del Presentacin y uso clnico. En Francia, en la actua-
intervalo de 72 horas entre la aplicacin de dos parches lidad, la buprenorfina se emplea sobre todo como
sucesivos. Las concentraciones sricas de fentanilo opioide de sustitucin en el toxicmano (comprimido
alcanzadas dependen del tamao del dispositivo trans- de 0,4, 2 y 8 mg). El comprimido sublingual de 0,2 mg
drmico. Cuando se interrumpe el tratamiento, las o la ampolla inyectable de 0,3 mg es la formulacin
concentraciones sricas de fentanilo disminuyen pro- para la analgesia. En la actualidad su empleo es raro
gresivamente y descienden alrededor de un 50% en el (1,2% de los pacientes en ciruga [122]), a pesar de que
espacio de 13-22 horas en el adulto. La continuacin de algunas recomendaciones lo proponen como opioide de
la absorcin del fentanilo a partir de la piel explica la primera eleccin, sobre todo en el anciano a causa de la
lentitud de la reduccin de las concentraciones sricas. poca influencia de la insuficiencia renal [100].
Presentacin y uso clnico. Este fentaniloexiste en
parches que liberan 12, 25, 50 y 100 g/h. El uso est Nalorfina
reservado para el dolor crnico que requiere un trata- La nalorfina es un agonista-antagonista que puede
miento opioide con una dosis eficaz definida y estable. emplearse como antagonista de los opioides. En el
Esta forma de opioide puede asociarse a complementos marco de este uso, es preferible la naloxona.
de morfina oral de liberacin inmediata.
Por iontoforesis Antagonistas
No est detallado este modo de administracin, que Naloxona
ha sido desarrollado para un uso autocontrolado de Farmacocintica. La naloxona se absorbe por va
fentanilo en el perioperatorio. El dispositivo Ionsysse oral, pero se metaboliza completamente por el hgado
retir del mercado a finales de 2008 a causa de funcio- antes de alcanzar la circulacin general. La naloxona es
namientos intempestivos sin accidente en los pacientes. muy liposoluble y se metaboliza a nivel del hgado por
glucuroconjugacin. Tras una administracin intrave-
Antiopioides nosa de 0,4 mg, la semivida de la fase inicial de distri-
bucin es de 4 minutos y la de la fase de eliminacin
Agonistas-antagonistas es de 64 minutos. Esta semivida de eliminacin es
inferior a la de los opioides, lo que expone a la reapari-
Nalbufina
cin de una depresin respiratoria.
Farmacocintica. Los picos de concentracin por va Farmacodinmica. La naloxona bloquea todos los
intramuscular y subcutnea se obtienen en 30 minutos. receptores opioides salvo el ORL1. No presenta ninguna
La depuracin plasmtica es alta, cercano al gasto accin en ausencia de opioide. La accin antagonista es
sanguneo heptico y, en consecuencia, presenta una mxima en 2 minutos por va intravenosa, pero su
biodisponibilidad por va oral muy baja. El metabolismo efecto es corto: 45 minutos por va intravenosa, 2 horas
por va heptica se realiza mediante glucuroconjugacin por va intramuscular de una dosis de 0,4 mg para
y despus eliminacin urinaria. La semivida de elimina- 70 kg. Existe un riesgo de sndrome de retiro brutal de
cin es de 3-6 horas. los morfnicos con despertar brusco, agitacin, dolor,
Farmacodinmica. La nalbufina presenta una estruc- taquipnea, taquicardia e hipertensin arterial. Este
tura qumica similar a la oximorfona y a la naloxona. Es efecto se acompaa de un aumento del gasto cardaco y
un antagonista de los receptores y agonista de los del consumo de oxgeno del miocardio. Debe evitarse la
receptores j. El efecto analgsico es mximo con una naloxona en el paciente con insuficiencia coronaria, con
dosis de 0,3-0,5 mg/kg. El efecto analgsico aparece a los insuficiencia cardaca o hipertenso.

Anestesia-Reanimacin 19
E 36-371-A-10 Farmacologa de los opioides

Presentacin y uso clnico. La naloxona requiere dolor agudo y el dolor crnico, pero sigue siendo ms
que se administre por va intravenosa (ampolla de limitado que en los pases anglosajones. Sigue estando
0,4 mg). Es necesaria una dosis inicial para antagonizar dominado por la morfina. Tras aos de esfuerzo para
el opioide (0,05-0,3 mg) asociada a una administracin luchar contra la fobia de los opioides y ampliar su
de la misma dosis intramuscular o a una perfusin prescripcin, ha llegado la hora de reflexionar sobre los
continua (3,3 g/min). medios para emplearlos de la mejor manera posible. La
Metilnaltrexona accin hiperalgsica de los opioides es un nuevo ele-
mento que se asocia a aquel ms conocido de la tole-
Farmacocintica. La metilnaltrexona es el derivado rancia. Estos dos elementos sugieren un control
cuaternario N-metilado de la naltrexona. Es particular- razonable de los opioides para el dolor crnico, que
mente resistente a la desmetilacin en el ser humano, al
favorezca las dosis mnimas eficaces y las asociaciones
contrario que otros derivados metilados como la metil-
con otros analgsicos. El uso de todos los opioides
naltrexona o la metilnalomorfina. Como cualquier
disponibles y la nocin de rotacin de los opioides son
amonio cuaternario, la metilnaltrexona, muy poco
reforzados por las nociones de tolerancia y de hiperal-
liposoluble, no se difunde a travs de la barrera
gesia. El incremento de la frecuencia de uso inadecuado
hematoenceflica [136].
Farmacodinmica. Los resultados positivos de los de los morfnicos prescritos en el dolor crnico debe
estudios clnicos han permitido otorgar una autoriza- reforzar el control de los prescriptores y la calidad del
cin de uso para el estreimiento en el paciente tratado seguimiento de los pacientes tratados a largo plazo.
de forma prolongada con morfnicos [136]. La aceleracin
media del trnsito es de 52 minutos respecto al place-
bo [137]. Tambin se est estudiando el uso de metilnal-
trexona para la prevencin del leo postoperatorio.
Presentacin y uso clnico. La metilnaltrexona
(8-12 mg cada 2 das segn el peso) est disponible para
Puntos esenciales
una administracin subcutnea. Este producto estar Los opioides constituyen la base del
tambin, en un futuro, disponible por va intravenosa y tratamiento del dolor y su utilidad es innegable
oral.
tanto en el dolor agudo y en el dolor crnico
Alvimopn como durante la anestesia.
Farmacocintica. El alvimopn es un antagonista de La biologa molecular, la fisiologa de la
los receptores morfnicos con un peso molecular de nocicepcin y la gentica han permitido mejorar
461 Da. Este peso molecular, asociado a su estructura la compresin de la interaccin opioides-sistema
qumica y a su polaridad, permite evitar la absorcin nervioso central y perifrico y precisar el impacto
intestinal y la difusin en el sistema nervioso central. El del polimorfismo gentico.
alvimopn presenta una fuerte afinidad por los recepto- La comprensin de la gentica permite
res morfnicos , cinco veces superior a la de la identificar mejor algunas diferencias en la eficacia
naloxona, y afinidades menores por los receptores j y d, de los opioides segn las molculas y el entorno.
que se calcula en 10-100 veces menos que para los
Estas nociones de farmacogentica explican de
receptores . La biodisponibilidad de la va oral es muy
baja, se ha estimado en un 0,03% [136]. Existe un meta- diferente forma el uso de los opioides disponibles
bolito ADL-08-0011 equipotente al alvimopn, pero del y permiten esperar un uso ms racional en un
cual se desconoce su papel en el efecto clnico [136]. futuro.
Farmacodinmica. El antagonismo de los efectos Aparte de su accin analgsica, la accin
gastrointestinales de la morfina para el alvimopn, comn a todos los opioides sobre el sistema
exceptuada la analgesia, se ha confirmado en una serie nervioso central expone a los pacientes a un
de estudios clnicos en voluntarios y en pacientes efecto sedativo, un efecto depresor respiratorio y
(2.225 pacientes en cinco estudios) [136, 137]. El alvimo- una accin psicoafectiva.
pn es capaz de acortar la duracin del leo postopera- Los otros efectos secundarios incluyen las
torio en pacientes intervenidos de colectoma
nuseas y vmitos, el estreimiento, la retencin
segmentaria o de histerectoma por va abdominal y
cuyo dolor postoperatorio era tratado mediante ACP i.v urinaria, la broncoconstriccin y la depresin de la
de morfnicos [136]. El otro efecto positivo del alvimopn tos.
es la disminucin de las nuseas y de los vmitos. La accin hiperalgsica de los opioides es un
Presentacin y uso clnico. El alvimopn (cpsula de nuevo elemento que se asocia a aquel ms
12 mg; una cpsula antes de la intervencin y despus conocido de la tolerancia.
en el postoperatorio dos cpsulas al da durante 7 das; Un control razonable de los opioides para el
dosis mxima de 15 cpsulas) estar tambin disponible dolor crnico debe favorecer las dosis mnimas
para los pacientes tratados con morfnicos y en el eficaces y las asociaciones con otros analgsicos.
postoperatorio. El uso de todos los opioides disponibles y la
nocin de rotacin de los opioides son reforzados
Conclusin por las nociones de tolerancia y de hiperalgesia.
El incremento de la frecuencia de uso
Los opioides constituyen la base del tratamiento del inadecuado de los morfnicos prescritos en el
dolor y su utilidad es innegable tanto en el dolor agudo
dolor crnico debe hacer que se refuerce el
y en el dolor crnico como durante la anestesia. La
comprensin de la gentica permite identificar mejor control de los prescriptores y la calidad del
algunas diferencias en la eficacia de los opioides segn seguimiento de los pacientes tratados a largo
las molculas y el entorno. Estas nociones de farmaco- plazo.
gentica explican de diferente forma el uso de los Tras aos de esfuerzo para luchar contra la fobia
opioides disponibles y permiten esperar un uso ms de los opioides y ampliar su prescripcin, ha
racional en un futuro. llegado la hora de reflexionar sobre los medios
El arsenal teraputico de los opioides se ha enrique- para emplearlos de la mejor manera posible.
cido en Francia mediante nuevos productos para el

20 Anestesia-Reanimacin
Farmacologa de los opioides E 36-371-A-10

[9] Cahill CM, Holdridge SV, Morinville A. Trafficking of delta-

Glosario
opioid receptors and other G-protein-coupled receptors:
implications for pain and analgesia. Trends Pharmacol Sci
2007;28:23-31.
CB1: receptor cannabinoide 1 [10] Mogil JS, Grisel JE, Reinscheid RK, Civelli O, Belknap JK,
Grandy DK. Orphanin FQ is a functional anti-opioid peptide.
DOP: receptor opioide d, d para canal deferente Neuroscience 1996;75:333-7.
DOR: receptor opioide delta, receptor opioide d [11] Lutfy K, Eitan S, Bryant CD, Yang YC, Saliminejad N,
KOP: receptor opioide j, k para quetociclazocina Walwyn W, et al. Buprenorphine-induced antinociception is
KOR: receptor opioide kappa, receptor opioide j mediated by mu-opioid receptors and compromised by
M3G: morfina-3-glucurnido concomitant activation of opioid receptor-like receptors.
M6G: morfina-6-glucurnido J Neurosci 2003;23:10331-7.
Mc1R: receptor 1 de la melanocortina [12] Wollemann M, Benyhe S. Non-opioid actions of opioid
peptides. Life Sci 2004;75:257-70.
MOP: receptor opioide , m para morfina [13] Zagon IS, Verderame MF, McLaughlin PJ. The biology of the
MOR: receptor opioide mu, receptor opioide opioid growth factor receptor (OGFr). Brain Res Brain Res
N/OFQ: nociceptina u orfanina FQ ligando del Rev 2002;38:351-76.
receptor ORL1 [14] Gomes I, Filipovska J, Jordan BA, Devi LA. Oligomerization
NNH: number needed to harm; describe los efectos of opioid receptors. Methods 2002;27:358-65.
secundarios de un analgsico dando el nmero de [15] Kobilka B, Schertler GF. New G-protein-coupled receptor
crystal structures: insights and limitations. Trends Pharmacol
pacientes a los cuales debe administrarse el
Sci 2008;29:79-83.
producto para obtener una vez el efecto [16] Dietis N, Guerrini R, Calo G, Salvadori S, Rowbotham DJ,
secundario esperado. Cuanto ms cercano al Lambert DG. Simultaneous targeting of multiple opioid
1 est el nmero, ms frecuente ser el efecto receptors: a strategy to improve side-effect profile. Br
secundario. J Anaesth 2009;103:38-49.
NPT: nmero de pacientes que hay que tratar (o [17] Weber E, Evans CJ, Barchas JD. Multiple endogenous ligands
for opioid receptors. Trends Neurosci 1983;6:333-6.
NNT, number needed to treat); describe la eficacia
[18] Gustein HB, Akil H. Opioid analgsics. In: Brunton L, editor.
de un analgsico precisando el nmero de Goodman and Gilmans, the Pharmacological Basis of
pacientes a los cuales se debe administrar el Therapeutics, 11th d. New York: McGraw-Hill; 2006.
producto para conseguir la eficacia esperada. [19] Zadina JE, Hackler L, Ge LJ, KastinAJ.Apotent and selective
Cuanto ms cercano al 1 est el nmero, mayor endogenous agonist for the mu-opiate receptor. Nature 1997;
ser la eficacia del producto. 386:499-502.
OP1: receptor opioide d [20] Stefano GB, Cadet P, Kream RM, Zhu W. The presence of
endogenous morphine signaling in animals. Neurochem Res
OP2: receptor opioide j 2008;33:1933-9.
OP3: receptor opioide [21] Fichna J, Janecka A, Costentin J, Do Rego JC. The
OP4: receptor opioide ORL1 endomorphin system and its evolving neurophysiological
OR: receptor opioide role. Pharmacol Rev 2007;59:88-123.
ORL1: receptor de tipo opioide 1 [22] Rollason V, Samer C, Piguet V, Dayer P, Desmeules J.
RNMDA: receptor N-metil-D-aspartato Pharmacogenetics of analgesics: toward the individualization
of prescription. Pharmacogenomics 2008;9:905-33.
[23] Meineke I, Freudenthaler S, Hofmann U, Schaeffeler E,
Mikus G, Schwab M, et al. Pharmacokinetic modelling of
morphine, morphine-3-glucuronide and morphine-6-
Bibliografa
glucuronide in plasma and cerebrospinal fluid of
neurosurgical patients after short-term infusion of morphine.
Br J Clin Pharmacol 2002;54:592-603.
[1] Chauvin M, Baulieu P. Pharmacologie des opiodes. In:
[24] Klepstad P, Dale O, Skorpen F, Borchgrevink PC, Kaasa S.
Beaulieu P, editor. Pharmacologie de la douleur. Montral:
Genetic variability and clinical efficacy of morphine. Acta
Presses universitaires de Montral; 2005. p. 39. Anaesthesiol Scand 2005;49:902-8.
[2] Evans CJ, Keith Jr. DE, Morrison H, Magendzo K, [25] Park HJ, Shinn HK, Ryu SH, Lee HS, Park CS, Kang JH.
Edwards RH. Cloning of a delta opioid receptor by functional Genetic polymorphisms in the ABCB1 gene and the effects of
expression. Science 1992;258:1952-5. fentanyl in Koreans. Clin Pharmacol Ther 2007;81:539-46.
[3] Yasuda K, Raynor K, Kong H, Breder CD, Takeda J, [26] Slanar O, Nobilis M, Kvetina J, Matouskova O, Idle JR,
Reisine T, et al. Cloning and functional comparison of kappa Perlik F. Pharmacokinetics of tramadol is affected by MDR1
and delta opioid receptors from mouse brain. Proc Natl Acad polymorphism C3435T. Eur J Clin Pharmacol 2007;63:
Sci USA 1993;90:6736-40. 419-21.
[4] Chen Y, Mestek A, Liu J, Hurley JA, Yu L. Molecular cloning [27] Landau R. Polymorphisme gntique et traitement opiode.
and functional expression of a mu-opioid receptor from rat Presse Med 2008;37:1415-22.
brain. Mol Pharmacol 1993;44:8-12. [28] Stamer UM, Lehnen K, Hothker F, Bayerer B, Wolf S,
[5] Pasternak GW. Multiple opiate receptors: deja vu all over Hoeft A, et al. Impact of CYP2D6 genotype on postoperative
again. Neuropharmacology 2004;47(suppl1):312-23. tramadol analgesia. Pain 2003;105:231-8.
[6] Trescot AM, Helm S, Hansen H, Benyamin R, Glaser SE, [29] Reyes-Gibby CC, Shete S, Rakvag T, Bhat SV, Skorpen F,
Adlaka R, et al. Opioids in the management of chronic non- Bruera E, et al. Exploring joint effects of genes and the clinical
efficacy of morphine for cancer pain: OPRM1 and COMT
cancer pain: an update of American Society of the
gene. Pain 2007;130:25-30.
Interventional Pain Physicians (ASIPP) Guidelines. Pain
[30] Diatchenko L, Slade GD, Nackley AG, Bhalang K,
Physician 2008;11(suppl2):S5-S62. Sigurdsson A, Belfer I, et al. Genetic basis for individual
[7] Loh HH, Liu HC, Cavalli A, Yang W, Chen YF, Wei LN. mu variations in pain perception and the development of a chronic
Opioid receptor knockout in mice: effects on ligand-induced pain condition. Hum Mol Genet 2005;14:135-43.
analgesia and morphine lethality. Brain Res Mol Brain Res [31] Wolozin BL, Pasternak GW. Classification of multiple
1998;54:321-6. morphine and enkephalin binding sites in the central nervous
[8] Schuller AG, King MA, Zhang J, Bolan E, Pan YX, system. Proc Natl Acad Sci USA 1981;78:6181-5.
Morgan DJ, et al. Retention of heroin and morphine-6 beta- [32] Wang JB, Imai Y, Eppler CM, Gregor P, Spivak CE, Uhl GR.
glucuronide analgesia in a new line of mice lacking exon 1 of mu opiate receptor: cDNA cloning and expression. Proc Natl
MOR-1. Nat Neurosci 1999;2:151-6. Acad Sci USA 1993;90:10230-4.

Anestesia-Reanimacin 21
E 36-371-A-10 Farmacologa de los opioides

[33] Befort K, Filliol D, Decaillot FM, Gaveriaux-Ruff C, [53] Woolf CJ, Ma QP, Allchorne A, Poole S. Peripheral cell types
Hoehe MR, Kieffer BL. A single nucleotide polymorphic contributing to the hyperalgesic action of nerve growth factor
mutation in the human mu-opioid receptor severely impairs in inflammation. J Neurosci 1996;16:2716-23.
receptor signaling. J Biol Chem 2001;276:3130-7. [54] Ji RR, Zhang Q, Law PY, Low HH, Elde R, Hokfelt T.
[34] Bond C, LaForge KS, Tian M, Melia D, Zhang S, Borg L, et al. Expression of mu-, delta-, and kappa-opioid receptor-like
Single-nucleotide polymorphism in the human mu opioid immunoreactivities in rat dorsal root ganglia after
receptor gene alters beta-endorphin binding and activity: carrageenan-induced inflammation. J Neurosci 1995;15:
possible implications for opiate addiction. Proc Natl Acad Sci 8156-66.
USA 1998;95:9608-13. [55] Yaksh TL. Pharmacology and mechanisms of opioid
[35] Searle R, Hopkins PM. Pharmacogenomic variability and analgesic activity. Acta Anaesthesiol Scand 1997;41(1Pt2):
anaesthesia. Br J Anaesth 2009;103:14-25. 94-111.
[36] Lotsch J, Skarke C, Grosch S, Darimont J, Schmidt H, [56] Marvizon JC, Grady EF, Waszak-McGee J, Mayer EA.
Geisslinger G. The polymorphism A118G of the human Internalization of -opioid receptors in rat spinal cord slices.
mu-opioid receptor gene decreases the pupil constrictory Neuroreport 1999;10:2329-34.
effect of morphine-6-glucuronide but not that of morphine.
[57] Song B, Lao L, Marvizon JC. NK1 receptor internalization
Pharmacogenetics 2002;12:3-9.
produced by capsaicin acting on the central terminals and
[37] Romberg RR, Olofsen E, Bijl H, Taschner PE, Teppema LJ,
axons of primary afferents: effect of NMDA and GABA B
Sarton EY, et al. Polymorphism of mu-opioid receptor gene
(OPRM1:c.118A>G) does not protect against opioid-induced receptors. Soc Neurosci Abstracts 2003;29:174.10.
respiratory depression despite reduced analgesic response. [58] Kemp T, Spike RC, Watt C, Todd AJ. The mu-opioid receptor
Anesthesiology 2005;102:522-30. (MOR1) is mainly restricted to neurons that do not contain
[38] Lotsch J, Zimmermann M, Darimont J, Marx C, Dudziak R, GABAor glycine in the superficial dorsal horn of the rat spinal
Skarke C, et al. Does the A118G polymorphism at the cord. Neuroscience 1996;75:1231-8.
mu-opioid receptor gene protect against morphine-6- [59] Neal Jr. CR, Mansour A, Reinscheid R, Nothacker HP,
glucuronide toxicity? Anesthesiology 2002;97:814-9. Civelli O, Akil H, et al. Opioid receptor-like (ORL1) receptor
[39] Coulbault L, Beaussier M, Verstuyft C, Weickmans H, distribution in the rat central nervous system: comparison of
Dubert L, Tregouet D, et al. Environmental and genetic factors ORL1 receptor mRNAexpression with (125)I-[Tyr]-orphanin
associated with morphine response in the postoperative FQ binding. J Comp Neurol 1999;412:563-605.
period. Clin Pharmacol Ther 2006;79:316-24. [60] Sakurada T, Katsuyama S, Sakurada S, Inoue M, Tan-No K,
[40] Chou WY, Wang CH, Liu PH, Liu CC, Tseng CC, Jawan B. Kisara K, et al. Nociceptin-induced scratching, biting and
Human opioid receptor A118G polymorphism affects licking in mice: involvement of spinal NK1 receptors. Br
intravenous patient-controlled analgesia morphine J Pharmacol 1999;127:1712-8.
consumption after total abdominal hysterectomy. [61] Fields HL, Heinricher MM, Mason P. Neurotransmitters in
Anesthesiology 2006;105:334-7. nociceptive modulatory circuits. Annu Rev Neurosci 1991;14:
[41] Chou WY, Yang LC, Lu HF, Ko JY, Wang CH, Lin SH, et al. 219-45.
Association of mu-opioid receptor gene polymorphism [62] Mason P. Central mechanisms of pain modulation. Curr Opin
(A118G) with variations in morphine consumption for anal- Neurobiol 1999;9:436-41.
gesia after total knee arthroplasty. Acta Anaesthesiol Scand [63] Zorman G, Belcher G, Adams JE, Fields HL. Lumbar
2006;50:787-92. intrathecal naloxone blocks analgesia produced by
[42] Janicki PK, Schuler G, Francis D, Bohr A, Gordin V, microstimulation of the ventromedial medulla in the rat. Brain
Jarzembowski T, et al. A genetic association study of the
Res 1982;236:77-84.
functional A118G polymorphism of the human mu-opioid
[64] Budai D, Fields HL. Endogenous opioid peptides acting at
receptor gene in patients with acute and chronic pain. Anesth
Analg 2006;103:1011-7. mu-opioid receptors in the dorsal horn contribute to midbrain
[43] Walter C, Lotsch J. Meta-analysis of the relevance of the modulation of spinal nociceptive neurons. J Neurophysiol
OPRM1 118A>G genetic variant for pain treatment. Pain 1998;79:677-87.
2009;146:270-5. [65] Chu LF, Angst MS, Clark D. Opioid-induced hyperalgesia in
[44] Mogil JS. Are we getting anywhere in human pain genetics? humans: molecular mechanisms and clinical considerations.
Pain 2009;146:231-2. Clin J Pain 2008;24:479-96.
[45] Mogil JS, Wilson SG, Chesler EJ, Rankin AL, Nemmani KV, [66] Mitra S. Opioid-induced hyperalgesia: pathophysiology and
Lariviere WR, et al. The melanocortin-1 receptor gene clinical implications. J Opioid Manag 2008;4:123-30.
mediates female-specific mechanisms of analgesia in mice [67] Simonnet G, Rivat C. Opioid-induced hyperalgesia: abnormal
and humans. Proc Natl Acad Sci USA 2003;100:4867-72. or normal pain? Neuroreport 2003;14:1-7.
[46] Urban JD, Clarke WP, von Zastrow M, Nichols DE, [68] Wilder-Smith OH, Arendt-Nielsen L. Postoperative
Kobilka B, Weinstein H, et al. Functional selectivity and hyperalgesia: its clinical importance and relevance.
classical concepts of quantitative pharmacology. J Pharmacol Anesthesiology 2006;104:601-7.
Exp Ther 2007;320:1-3. [69] Aley KO, Levine JD. Multiple receptors involved in
[47] Adams JU, Paronis CA, Holtzman SG. Assessment of relative peripheral alpha 2, mu, andA1 antinociception, tolerance, and
intrinsic activity of mu-opioid analgesics in vivo by using withdrawal. J Neurosci 1997;17:735-44.
beta-funaltrexamine. J Pharmacol Exp Ther 1990;255:1027- [70] Hutchinson MR, Bland ST, Johnson KW, Rice KC, Maier SF,
32. Watkins LR. Opioid-induced glial activation: mechanisms of
[48] Law PY, Erickson LJ, El-Kouhen R, Dicker L, Solberg J, activation and implications for opioid analgesia, dependence,
Wang W, et al. Receptor density and recycling affect the rate and reward. Scientific World J 2007;7:98-111.
of agonist-induced desensitization of mu-opioid receptor. Mol [71] Liang DY, Liao G, Lighthall GK, Peltz G, Clark DJ. Genetic
Pharmacol 2000;58:388-98. variants of the P-glycoprotein gene Abcb1b modulate opioid-
[49] Machelska H, Stein C. Immune mechanisms in pain control.
induced hyperalgesia, tolerance and dependence.
Anesth Analg 2002;95:1002-8.
Pharmacogenet Genomics 2006;16:825-35.
[50] Vindrola O, Mayer AM, Citera G, Spitzer JA, Espinoza LR.
Prohormone convertases PC2 and PC3 in rat neutrophils and [72] Liang DY, Liao G, Wang J, Usuka J, Guo Y, Peltz G, et al. A
macrophages. Parallel changes with proenkephalin-derived genetic analysis of opioid-induced hyperalgesia in mice.
peptides induced by LPS in vivo. Neuropeptides 1994;27: Anesthesiology 2006;104:1054-62.
235-44. [73] Hahnenkamp K, Nollet J, Van Aken HK, Buerkle H, Halene T,
[51] Christie MJ. Cellular neuroadaptations to chronic opioids: Schauerte S, et al. Rmifentanil directly activates human
tolerance, withdrawal and addiction. Br J Pharmacol 2008; N-methyl-D-aspartate receptors expressed in Xenopus laevis
154:384-96. oocytes. Anesthesiology 2004;100:1531-7.
[52] Antonijevic I, Mousa SA, Schafer M, Stein C. Perineurial [74] Drdla R, Gassner M, Gingl E, Sandkuhler J. Induction of
defect and peripheral opioid analgesia in inflammation. synaptic long-term potentiation after opioid withdrawal.
J Neurosci 1995;15(1Pt1):165-72. Science 2009;325:207-10.

22 Anestesia-Reanimacin
Farmacologa de los opioides E 36-371-A-10

[75] Joly V, Richebe P, Guignard B, Fletcher D, Maurette P, [98] Gordon DB, Dahl JL, Miaskowski C, McCarberg B, Todd KH,
Sessler DI, et al. Rmifentanil-induced postoperative Paice JA, et al. American pain society recommendations for
hyperalgesia and its prevention with small-dose ketamine. improving the quality of acute and cancer pain management:
Anesthesiology 2005;103:147-55. American Pain Society Quality of Care Task Force. Arch
[76] Angst MS, Chu LF, Tingle MS, Shafer SL, Clark JD, Intern Med 2005;165:1574-80.
Drover DR. No evidence for the development of acute [99] Krakowski I, Theobald S, Balp L, Bonnefoi MP, Chvetzoff G,
tolerance to analgesic, respiratory depressant and sedative Collard O, et al. Standards, options and recommendations for
opioid effects in humans. Pain 2009;142:17-26. the use of medical analgesics for the treatment of pain arising
[77] Chen L, Malarick C, Seefeld L, Wang S, Houghton M, Mao J. from excess nociception in adults with cancer (update 2002).
Altered quantitative sensory testing outcome in subjects with Bull Cancer 2002;89:1067-74.
opioid therapy. Pain 2009;143:65-70. [100] Pergolizzi J, Boger RH, Budd K, Dahan A, Erdine S, Hans G,
[78] Smith MT. Differences between and combinations of opioids et al. Opioids and the management of chronic severe pain in
re-visited. Curr Opin Anaesthesiol 2008;21:596-601. the elderly: consensus statement of an International Expert
[79] Troster A, Sittl R, Singler B, Schmelz M, Schuttler J, Panel with focus on the six clinically most often used World
Koppert W. Modulation of rmifentanil-induced analgesia Health Organization Step III opioids (buprenorphine,
and postinfusion hyperalgesia by parecoxib in humans. fentanyl, hydromorphone, methadone, morphine,
Anesthesiology 2006;105:1016-23. oxycodone). Pain Pract 2008;8:287-313.
[80] Singler B, Troster A, Manering N, Schuttler J, Koppert W. [101] Meuldermans WE, Hurkmans RM, Heykants JJ. Plasma
Modulation of rmifentanil-induced postinfusion protein binding and distribution of fentanyl, sufentanil,
hyperalgesia by propofol. Anesth Analg 2007;104:1397-403. alfentanil and lofentanil in blood. Arch Int Pharmacodyn Ther
[81] Ciccone DS, Just N, Bandilla EB, Reimer E, Ilbeigi MS, 1982;257:4-19.
Wu W. Psychological correlates of opioid use in patients with [102] Rosow CE. An overview of remifentanil. Anesth Analg 1999;
89(suppl4):S1-S3.
chronic nonmalignant pain: a preliminary test of the downhill
[103] Hug Jr. CC. Lipid solubility, pharmacokinetics, and the EEG:
spiral hypothesis. J Pain Symptom Manage 2000;20:180-92.
are you better off today than you were four years ago?
[82] Portenoy RK, Lesage P. Management of cancer pain. Lancet
Anesthesiology 1985;62:221-6.
1999;353:1695-700.
[104] Hug Jr. CC, Murphy MR. Tissue redistribution of fentanyl and
[83] Chou R, Fanciullo GJ, Fine PG, Adler JA, Ballantyne JC,
termination of its effects in rats. Anesthesiology 1981;55:
Davies P, et al. Clinical guidelines for the use of chronic opioid
369-75.
therapy in chronic noncancer pain. J Pain 2009;10:113-30. [105] Hughes MA, Glass PS, Jacobs JR. Context-sensitive half-
[84] Colameco S, Coren JS, Ciervo CA. Continuous opioid time in multicompartment pharmacokinetic models for
treatment for chronic noncancer pain: a time for moderation in intravenous anesthetic drugs. Anesthesiology 1992;76:
prescribing. Postgrad Med 2009;121:61-6. 334-41.
[85] Bigal ME, Lipton RB. Excessive acute migraine medication [106] Bernards CM, Shen DD, Sterling ES, Adkins JE, Risler L,
use and migraine progression. Neurology 2008;71:1821-8. Phillips B, et al. Epidural, cerebrospinal fluid, and plasma
[86] Weisner CM, Campbell CI, Ray GT, Saunders K, Merrill JO, pharmacokinetics of epidural opioids (part 1): differences
Banta-Green C, et al. Trends in prescribed opioid therapy for among opioids. Anesthesiology 2003;99:455-65.
non-cancer pain for individuals with prior substance use [107] Menigaux C, Guignard B, Fletcher D, Sessler DI, Levron JC,
disorders. Pain 2009;145:287-93. Chauvin M. More epidural than intravenous sufentanil is
[87] Alford DP. Opioids for chronic pain in patients with substance required to provide comparable postoperative pain relief.
abuse: Too much, too little or just right? Pain 2009;145:267-8. Anesth Analg 2001;93:472-6.
[88] Denisco RA, Chandler RK, Compton WM. Addressing the [108] Stoeckel H, Hengstmann JH, Schuttler J. Pharmacokinetics of
intersecting problems of opioid misuse and chronic pain fentanyl as a possible explanation for recurrence of
treatment. Exp Clin Psychopharmacol 2008;16:417-28. respiratory depression. Br J Anaesth 1979;51:741-5.
[89] Hall AJ, Logan JE, Toblin RL, Kaplan JA, Kraner JC, [109] Stanski DR, Hug Jr. CC. Alfentanil--a kinetically predictable
Bixler D, et al. Patterns of abuse among unintentional narcotic analgesic. Anesthesiology 1982;57:435-8.
pharmaceutical overdose fatalities. JAMA 2008;300:2613-20. [110] Stanski DR. The clinical pharmacology of alfentanil. Eur
[90] Pattinson KT. Opioids and the control of respiration. Br J Anaesthesiol 1987;1:3-11 [suppl].
J Anaesth 2008;100:747-58. [111] Maitre PO, Vozeh S, Heykants J, Thomson DA, Stanski DR.
[91] Zhao SZ, Chung F, Hanna DB, Raymundo AL, Cheung RY, Population pharmacokinetics of alfentanil: the average dose-
Chen C. Dose-response relationship between opioid use and plasma concentration relationship and interindividual
adverse effects after ambulatory surgery. J Pain Symptom variability in patients. Anesthesiology 1987;66:3-12.
Manage 2004;28:35-46. [112] Shafer SL, Varvel JR. Pharmacokinetics, pharmacodynamics,
[92] Tramer MR. A rational approach to the control of and rational opioid selection. Anesthesiology 1991;74:53-63.
postoperative nausea and vomiting: evidence from systematic [113] Fletcher D, Pinaud M, Scherpereel P, Clyti N, Chauvin M. The
reviews. Part I. Efficacy and harm of antiemetic interventions, efficacy of intravenous 0.15 versus 0.25 mg/kg intraoperative
and methodological issues. Acta Anaesthesiol Scand 2001;45: morphine for immediate postoperative analgesia after
4-13. rmifentanil-based anesthesia for major surgery. Anesth
Analg 2000;90:666-71.
[93] Tramer MR. A rational approach to the control of
[114] Casati A, Albertin A, Fanelli G, Deni F, Berti M, Danelli G,
postoperative nausea and vomiting: evidence from systematic
et al.Acomparison of rmifentanil and sufentanil as adjuvants
reviews. Part II. Recommendations for prevention and
during sevoflurane anesthesia with epidural analgesia for
treatment, and research agenda. Acta Anaesthesiol Scand
upper abdominal surgery: effects on postoperative recovery
2001;45:14-9. and respiratory function. Anesth Analg 2000;91:1269-73.
[94] Holte K, Kehlet H. Postoperative ileus: progress towards [115] Coller JK, Christrup LL, Somogyi AA. Role of active
effective management. Drugs 2002;62:2603-15. metabolites in the use of opioids. Eur J Clin Pharmacol 2009;
[95] Vallejo R, de Leon-Casasola O, Benyamin R. Opioid therapy 65:121-39.
and immunosuppression: a review. Am J Ther 2004;11: [116] Mazoit JX, Butscher K, Samii K. Morphine in postoperative
354-65. patients: pharmacokinetics and pharmacodynamics of
[96] Recommandations formalises dexpert pour la prise en metabolites. Anesth Analg 2007;105:70-8.
charge de la douleur postopratoire chez lenfant et ladulte. [117] Joshi GP. Morphine-6-glucuronide, an active morphine
Ann Fr Anesth Reanim 2008;27:1035-41. metabolite for the potential treatment of post-operative pain.
[97] Davies AN, Dickman A, Reid C, Stevens AM, Zeppetella G. Curr Opin Investig Drugs 2008;9:786-99.
The management of cancer-related breakthrough pain: [118] Stein C, Hassan AH, Przewlocki R, Gramsch C, Peter K,
recommendations of a task group of the Science Committee of Herz A. Opioids from immunocytes interact with receptors on
the Association for Palliative Medicine of Great Britain and sensory nerves to inhibit nociception in inflammation. Proc
Ireland. Eur J Pain 2009;13:331-8. Natl Acad Sci USA 1990;87:5935-9.

Anestesia-Reanimacin 23
E 36-371-A-10 Farmacologa de los opioides

[119] Gupta A, Bodin L, Holmstrom B, Berggren L. A systematic [129] Aubrun F.Administration de morphine en postopratoire chez
review of the peripheral analgesic effects of intraarticular le sujet g. Ann Fr Anesth Reanim 2009;28:e39-e41.
morphine. Anesth Analg 2001;93:761-70. [130] Aubrun F, Bunge D, Langeron O, Saillant G, Coriat P, Riou B.
[120] Hasselstrom J, Sawe J. Morphine pharmacokinetics and Postoperative morphine consumption in the elderly patient.
metabolism in humans. Enterohepatic cycling and relative Anesthesiology 2003;99:160-5.
contribution of metabolites to active opioid concentrations. [131] Meissner W, Leyendecker P, Mueller-Lissner S, Nadstawek J,
Clin Pharmacokinet 1993;24:344-54. Hopp M, Ruckes C, et al. A randomised controlled trial with
[121] Manoir BD, Bourget P, Langlois M, Szekely B, Fischler M, prolonged-release oral oxycodone and naloxone to prevent
Chauvin M, et al. Evaluation of the pharmacokinetic profile and reverse opioid-induced constipation. Eur J Pain 2009;13:
and analgesic efficacy of oral morphine after total hip 56-64.
arthroplasty. Eur J Anaesthesiol 2006;23:748-54. [132] Webster LR. Oxytrex: an oxycodone and ultra-low-dose
[122] Fletcher D, Fermanian C, Mardaye A, Aegerter P. A patient- naltrexone formulation. Expert Opin Investig Drugs 2007;
based national survey on postoperative pain management in 16:1277-83.
France reveals significant achievements and persistent [133] Blumenthal S, Min K, Marquardt M, Borgeat A. Postope-
challenges. Pain 2008;137:441-51.
rative intravenous morphine consumption, pain scores, and
[123] Aubrun F. Titration intraveineuse de morphine. Ann Fr Anesth
side effects with perioperative oral controlled-release
Reanim 2009;28:e33-e37.
oxycodone after lumbar discectomy. Anesth Analg 2007;105:
[124] Aubrun F, Monsel S, Langeron O, Coriat P, Riou B.
233-7.
Postoperative titration of intravenous morphine. Eur
J Anaesthesiol 2001;18:159-65. [134] Collins SL, Edwards JE, Moore RA, McQuay HJ. Single dose
[125] Lvovschi V, Aubrun F, Bonnet P, Bouchara A, Bendahou M, dextropropoxyphene, alone and with paracetamol
Humbert B, et al. Intravenous morphine titration to treat (acetaminophen), for postoperative pain. Cochrane Database
severe pain in the ED. Am J Emerg Med 2008;26:676-82. Syst Rev 2000(2):CD001440.
[126] Abou Hammoud H, Simon N, Urien S, Riou B, Lechat P, [135] Barkin RL, Barkin SJ, Barkin DS. Propoxyphene
Aubrun F. Intravenous morphine titration in immediate (dextropropoxyphene): a critical review of a weak opioid
postoperative pain management: population kinetic- analgesic that should remain in antiquity. Am J Ther 2006;
pharmacodynamic and logistic regression analysis. Pain 13:534-42.
2009;144:139-46. [136] Becker G, Blum HE. Novel opioid antagonists for opioid-
[127] Fletcher D, Jayr C. Indications de lanalgsie pridurale induced bowel dysfunction and postoperative ileus. Lancet
postopratoire. Ann Fr Anesth Reanim 2009;28:e95-e124. 2009;373:1198-206.
[128] Newsome S, Frawley BK, Argoff CE. Intrathecal analgesia [137] McNicol ED, Boyce D, Schumann R, Carr DB. Mu-opioid
for refractory cancer pain. Curr Pain Headache Rep 2008; antagonists for opioid-induced bowel dysfunction. Cochrane
12:249-56. Database Syst Rev 2008(2):CD006332.

D. Fletcher, Professeur (dominique.fletcher@rpc.aphp.fr).


Service danesthsie, Hpital Raymond Poincar, 104, boulevard Raymond-Poincar, 92380 Garches, France.

Cualquier referencia a este artculo debe incluir la mencin del artculo original: Fletcher D. Pharmacologie des opiodes. EMC (Elsevier
Masson SAS, Paris), Anesthsie-Ranimation, 36-371-A-10, 2011.

Disponible en www.em-consulte.com/es
Algoritmos Ilustraciones Vdeos / Aspectos Informacin Informaciones Autoevaluacin Caso
complementarias Animaciones legales al paciente complementarias clnico

24 Anestesia-Reanimacin