Você está na página 1de 625

Manual

sobre
sida
Editor:
Francisco Antunes

4 edio
2011
687PT11NP006

PERMANYER PORTUGAL
www.permanyer.com
Manual
sobre

sida
Editor:
Francisco Antunes

4 edio
2011

PERMANYER PORTUGAL
www.permanyer.com
2011 Permanyer Portugal
Av. Duque dvila, 92, 7. E - 1050-084 Lisboa
Tel.: 21 315 60 81 Fax: 21 330 42 96
www.permanyer.com

ISBN: 978-973-733-253-3
Dep. Legal: 331099/11
Ref.: 537AP101

Impresso em papel totalmente livre de cloro


Impresso: Sociedade Industrial Grfica Telles da Silva, Lda.

Este papel cumpre os requisitos de ANSI/NISO


Z39-48-1992 (R 1997) (Papel Estvel)

Reservados todos os direitos.


Sem prvio consentimento da editora, no poder reproduzir-se, nem armazenar-se num suporte
recupervel ou transmissvel, nenhuma parte desta publicao, seja de forma electrnica, mecnica,
fotocopiada, gravada ou por qualquer outro mtodo. Todos os comentrios e opinies publicados so
da responsabilidade exclusiva dos seus autores.
ndice de autores III

Prefcio

A quarta edio do Manual sobre sida comemora os 10 anos, aps a


sua primeira edio (2001), tendo contribudo para a formao de centenas
de alunos, da Faculdade de Medicina de Lisboa, de tcnicos de sade, um
pouco por todo o Pas, sendo, ainda, o livro de texto de referncia nos
cursos de formao que, desde ento, tm decorrido nos pases africanos de
lngua oficial portuguesa (PALOPs). Por solicitao do Alto Comissariado
da Sade, no mbito da cooperao com a Organizao Mundial da Sade
(OMS), a terceira edio do Manual sobre sida foi cedida para distribuio
pelos PALOPs.
Esta quarta edio do Manual sobre sida tem, pela primeira vez, o con-
tributo de autores de Moambique, numa rea cuja experincia, naquele
Pas, no poderia deixar de ser aproveitada, enriquecendo o seu contedo.
Continuam a registar-se progressos no mbito da teraputica anti-retro-
vrica, no s com o licenciamento de novos frmacos, como, tambm,
estudos recentes apontam para a eficcia dos anti-retrovricos na preveno
da infeco VIH/sida em pr-exposio, quer por via oral, quer por via
vaginal (ou rectal).
Com o acesso universal teraputica anti-retrovrica, cada vez mais alargado,
com boa tolerabilidade a curto e longo prazo, com combinaes coformuladas,
o horizonte da teraputica anti-retrovrica alarga-se, cada vez mais, para um
papel crucial na preveno, com impacto em sade pblica.
Recentes resultados no estudo das vacinas podero ter importncia, na
investigao futura de uma vacina anti-VIH, cuja meta se pretende alcanar
nos prximos 5-10 anos.
Esta edio do Manual sobre sida s foi possvel pelo contributo dado
por diversos especialistas e investigadores. A todos eles o mais profundo
reconhecimento, em particular dos doentes, que possam vir a beneficiar com
a leitura desta obra.

Francisco Antunes
ndice de autores V

ndice de autores

lvaro Ayres Pereira


Servio de Doenas Infecciosas, Hospital de Santa Maria,
Centro Hospitalar Lisboa Norte, EPE

Alexandra Zagalo
Servio de Doenas Infecciosas, Hospital de Santa Maria,
Centro Hospitalar de Lisboa Norte, EPE. Clnica Universitria de Doenas
Infecciosas, Faculdade de Medicina de Lisboa

Amlcar Soares
Associao Positivo

Ana Espada de Sousa


Unidade de Imunologia Clnica, Instituto de Medicina Molecular,
Faculdade de Medicina, Universidade de Lisboa

Antnio Mota Miranda


Especialista em Infecciologia

Cludia Afonso
Servio de Doenas Infecciosas, Hospital de Santa Maria,
Centro Hospitalar de Lisboa Norte, EPE.

Elizabeth Pdua
Departamento de Doenas Infecciosas, Laboratrio de Referncia
da SIDA, Instituto Nacional de Sade Dr. Ricardo Jorge, IP

Emlia Valadas
Clnica Universitria de Doenas Infecciosas, Faculdade de Medicina,
Universidade de Lisboa. Servio de Doenas Infecciosas,
Hospital de Santa Maria, Centro Hospitalar Lisboa Norte, EPE

Eugnia Macassa
Servio de Infectocontagiosas, Hospital Central de Maputo,
Faculdade de Medicina da Universidade Eduardo Mondlane
VI Manual sobre sida

Francisco Antunes
Clnica Universitria de Doenas Infecciosas, Faculdade de Medicina,
Universidade de Lisboa. Servio de Doenas Infecciosas,
Hospital de Santa Maria, Centro Hospitalar Lisboa Norte, EPE

Graa Gonalves
Servio de Doenas Infecciosas, Hospital de Santa Maria,
Centro Hospitalar Lisboa Norte, EPE

Helena ngelo
Departamento de Doenas Infecciosas, Laboratrio de Parasitologia,
Instituto Nacional de Sade Dr. Ricardo Jorge, IP

Helena Cortes Martins


Departamento de Doenas Infecciosas, Laboratrio de Referncia
da SIDA, Instituto Nacional de Sade Dr. Ricardo Jorge, IP

Ins Brtolo
Instituto Superior de Cincias da Sade Egas Moniz
(Monte de Caparica), Unidade dos Retrovrus e Infeces Associadas,
Centro de Patognese Molecular, Faculdade de Farmcia,
Universidade de Lisboa

Isabel Aldir
Servio de Infecciologia e Medicina Tropical, Hospital de Egas Moniz,
Centro Hospitalar de Lisboa Ocidental, EPE

Isabel Nabais
Servio de Doenas Infecciosas, Hospital de Santa Maria,
Centro Hospitalar Lisboa Norte, EPE

Joo Borges da Costa


Clnica Universitria Dermatolgica de Lisboa, Hospital de Santa Maria,
Centro Hospitalar Lisboa Norte, EPE, Departamento de Microbiologia
Mdica, Instituto de Higiene e Medicina Tropical

Joo Paulo Cruz


Servios Farmacuticos, Hospital de Santa Maria, Centro Hospitalar
Lisboa Norte, EPE

Jos Antnio Lopes


Servio de Nefrologia e Transplantao Renal, Hospital de Santa Maria,
Centro Hospitalar Lisboa Norte, EPE. Clnica Universitria
de Nefrologia, Faculdade de Medicina, Universidade de Lisboa

Jos Lus Boaventura


Especialista em Infecciologia
ndice de autores VII

Jos Miguel Azevedo-Pereira


Unidade dos Retrovrus e Infeces Associadas, Faculdade de Farmcia,
Universidade de Lisboa

Kamal Mansinho
Servio de Infecciologia e Medicina Tropical, Hospital de Egas Moniz, Centro
Hospitalar de Lisboa Ocidental, EPE. Instituto de Higiene e Medicina Tropical

Lus Caldeira
Servio de Doenas Infecciosas, Hospital de Santa Maria,
Centro Hospitalar Lisboa Norte, EPE

Lus Frana
Servios Farmacuticos, Hospital de Santo Antnio dos Capuchos,
Centro Hospitalar de Lisboa Central, EPE

Manuela Doroana
Servio de Doenas Infecciosas, Hospital de Santa Maria,
Centro Hospitalar Lisboa Norte, EPE

Maria Odette Ferreira


Associao para o Desenvolvimento do Ensino e Investigao
da Microbiologia (ADEIM), Faculdade de Farmcia,
Universidade de Lisboa

Maria Teresa Paixo


Departamento de Doenas Infecciosas, Instituto Nacional de Sade
Dr. Ricardo Jorge, IP

Marlia Pedro
Especialista em Imunohemoterapia

Nafissa Bique Osman


Departamento de Ginecologia e Obstetrcia, Hospital Central de Maputo,
Faculdade de Medicina da Universidade Eduardo Mondlane

Nuno Flix da Costa


Instituto de Psicologia Mdica, Faculdade de Medicina, Universidade de Lisboa

Nuno Taveira
Instituto Superior de Cincias da Sade Egas Moniz (Monte de Caparica),
Unidade dos Retrovrus e Infeces Associadas, Centro de Patognese
Molecular, Faculdade de Farmcia, Universidade de Lisboa

Olga Matos
Instituto de Higiene e Medicina Tropical, Universidade Nova de Lisboa
VIII Manual sobre sida

Patrcia Pacheco
Servio de Doenas Infecciosas, Hospital de Santa Maria,
Centro Hospitalar Lisboa Norte, EPE. Clnica Universitria de Doenas
Infecciosas, Faculdade de Medicina, Universidade de Lisboa

Pedro Borrego
Instituto Superior de Cincias da Sade Egas Moniz (Monte de Caparica),
Unidade dos Retrovrus e Infeces Associadas, Centro de Patognese
Molecular, Faculdade de Farmcia, Universidade de Lisboa

Ricardo Camacho
Laboratrio de Biologia Molecular, Hospital de Egas Moniz,
Centro Hospitalar de Lisboa Ocidental, EPE

Rui Victorino
Clnica Universitria de Medicina II e Unidade de Imunologia Clnica,
Instituto de Medicina Molecular, Faculdade de Medicina,
Universidade de Lisboa. Servio de Medicina II, Hospital de Santa Maria,
Centro Hospitalar Lisboa Norte, EPE

Slvia Ouakinin
Instituto de Psicologia Mdica, Faculdade de Medicina,
Universidade de Lisboa
ndice

I SECO Etiologia
1. Diversidade gentica de VIH
Nuno Taveira, Maria Odette Ferreira.............................................. 3
2. Ciclo biolgico de VIH
Jos Miguel Azevedo-Pereira............................................................ 13
3. Biologia molecular de VIH
Nuno Taveira, Pedro Borrego, Ins Brtolo..................................... 31

II SECO Imunopatognese e resposta imunitria


1. Imunopatognese e resposta imunitria
Ana Espada de Sousa, Rui Victorino................................................ 55

III SECO Epidemiologia


1. Epidemiologia da infeco por VIH e da sida impacto mundial
Maria Teresa Paixo......................................................................... 79
2. Distribuio mundial dos gentipos (epidemiologia molecular de VIH)
Helena Cortes Martins..................................................................... 87
3. Epidemiologia da infeco por VIH-2
Elizabeth Pdua................................................................................ 93
4. Epidemiologia da infeco por VIH e da sida em Portugal
Maria Teresa Paixo......................................................................... 101
5. Transmisso da infeco por VIH
Maria Teresa Paixo, Elizabeth Pdua............................................ 105

IV SECO Diagnstico da infeco por VIH


1. Testes serolgicos e vricos*
Marlia Pedro.................................................................................... 117
X Manual sobre sida

V SECO Infeces oportunistas e tumores


1. Espectro clnico da infeco por VIH
Emlia Valadas.................................................................................. 131
2. Protozorios oportunistas e Pneumocystis jirovecii*
Olga Matos, Helena ngelo, Francisco Antunes............................. 139
3. Infeces fngicas*
Patrcia Pacheco............................................................................... 155
4. Tuberculose
Emlia Valadas.................................................................................. 163
5. Outras infeces bacterianas*
Kamal Mansinho............................................................................... 173
6. Infeces por vrus herpes*
Isabel Aldir....................................................................................... 181
7. Neoplasias associadas sida*
Lus Caldeira.................................................................................... 193

VI SECO Doenas associadas infeco por VIH


1. Manifestaes orais*
Patrcia Pacheco............................................................................... 213
2. Manifestaes gastrintestinais*
Patrcia Pacheco............................................................................... 219
3. Complicaes dermatolgicas
Joo Borges da Costa....................................................................... 227
4. Complicaes do sistema nervoso na infeco por VIH
Antnio Mota Miranda..................................................................... 239
5. Complicaes renais
Jos Antnio Lopes, lvaro Ayres Pereira........................................ 251
6. Complicaes hematolgicas*
lvaro Ayres Pereira......................................................................... 257
7. Interaces clnicas entre VIH e os vrus das hepatites
Francisco Antunes............................................................................. 269

VII SECO Tratamento da infeco por VIH


1. Estratgias e progressos na teraputica antiretrovrica
Francisco Antunes............................................................................. 287
2. Farmacologia dos antiretrovricos e interaces medicamentosas
Joo Paulo Cruz............................................................................... 297
3. Anlogos nuclesidos inibidores da transcriptase reversa
Manuela Doroana............................................................................. 323
ndice XI

4. Anlogos nonuclesidos inibidores da transcriptase reversa


Manuela Doroana............................................................................. 337
5. Anlogos nucletidos inibidores da transcriptase reversa
Manuela Doroana............................................................................. 347
6. Inibidores da protease
Manuela Doroana............................................................................. 351
7. Inibidores de entrada
Manuela Doroana............................................................................. 381
8. Inibidores da integrase
Manuela Doroana............................................................................. 393
9. Teraputica da infeco por vrus da imunodeficincia
humana tipo 2
Lus Frana....................................................................................... 397
10. Resistncia aos antiretrovricos. Patognese, monitorizao
laboratorial e impacto na clnica do infectado por VIH*
Ricardo Camacho............................................................................. 411
11. Toxicidade aos antiretrovricos*
Kamal Mansinho............................................................................... 425

VIII SECO Infeco por VIH na grvida e transmisso


me-filho
1. Teraputica antiretrovrica na mulher grvida e preveno
da transmisso mefilho, em pases em vias de
desenvolvimento
Nafissa Bique Osman........................................................................ 441
2. Transmisso da infeco por VIH/sida da me para o filho, em pases
em vias de desenvolvimento
Eugnia Macassa.............................................................................. 453
3. Teraputica antiretrovrica na mulher grvida e preveno
da transmisso mefilho
Francisco Antunes, Alexandra Zagalo, Cludia Afonso................... 467

IX SECO Aspectos psicolgicos


1. Aconselhamento/interveno psicolgica
Isabel Nabais, Graa Gonalves...................................................... 481
2. Consideraes psiquitricas*
Slvia Ouakinin................................................................................. 497
3. Interveno na comunidade*
Amilcar Soares.................................................................................. 509
XII Manual sobre sida

X SECO Preveno e sade pblica


1. Factores de risco de transmisso sexual e interveno na preveno*
Slvia Ouakinin................................................................................. 527
2. Toxicodependncia e sida
Nuno Felix da Costa......................................................................... 537

XI SECO Profilaxia psexposio infeco por VIH


1. Introduo e consideraes gerais*
Jos Lus Boaventura, lvaro Ayres Pereira.................................... 551
2. Avaliao de exposio, da fonte de exposio e da pessoa exposta*
Jos Lus Boaventura, lvaro Ayres Pereira.................................... 559
3. Tratamento e seguimento psexposio a vih*
Jos Lus Boaventura, lvaro Ayres Pereira.................................... 563
4. Recomendaes para a quimioprofilaxia psexposio ocupacional
e noocupacional*
Jos Lus Boaventura, lvaro Ayres Pereira.................................... 571
5. Preveno da exposio ocupacional e nosocomial*
Jos Lus Boaventura, lvaro Ayres Pereira.................................... 581

XII SECO Vacinas


1. Vacinao contra VIH
Francisco Antunes............................................................................. 595

Atlas de imagens.................................................................................. 603


I SECO

Etiologia
I Seco
Captulo 1

Diversidade gentica de VIH


Nuno Taveira, Maria Odette Ferreira

Introduo
VIH caracterizado por elevada diversidade gentica, tanto a nvel intra
como interindividual, que resulta da progressiva acumulao de mutaes,
durante o processo de transcrio reversa e da recombinao entre vrus que
infectam uma mesma clula. No caso de VIH-1, a frequncia das mutaes
, em mdia, de 2,4 105 por nucletido por ciclo de replicao1 e 6,4
103 por nucletido por ano2, e a frequncia de recombinao de cerca de
8,3 104 recombinaes por ciclo de replicao3. A marcada heterogenei-
dade gentica de VIH , ainda, ampliada pelo elevado nmero de clulas
infectadas presentes nos indivduos no tratados ( 10 7-108), pela elevada
taxa reprodutiva destes vrus in vivo (cada clula infectada produz entre 102
e 104 viries, dos quais entre seis a oito vrus, pelo menos, so capazes de
infectar outras clulas)4,5 e pelo enorme nmero de vrus que se podem
produzir diariamente nestes indivduos (cerca de 10 9). A populao de va-
riantes vricas heterogneas e geneticamente relacionadas existentes num
nico indivduo designa-se de quasiespcies.

Origem, classificao e diversidade molecular


VIH-1 e VIH-2 partilham apenas cerca de 40-50% de homologia gentica
e tm a sua origem nos vrus da imunodeficincia dos smios (VIS), um
grupo de vrus distribudos por vrias espcies de macacos, gorilas e chim-
panzs. VIH-1 aparentado com VIS isolados de chimpanzs (VIScpz) e
do gorila (VISgor)6, enquanto VIH-2 faz parte da linhagem de VISmac/sm,
que infectam os macacos do gnero Macaca spp e da espcie Cercocebus
4 Nuno Taveira, Maria Odette Ferreira

cpzTAN
cpzANT
MVP5180
ANT70 VIH-1 1994,
98CMU5337 grupo O Camares
100 VAU
1,00 96CMABB009
RBF168 VIH-1 2009
100 grupo P Camares
gorBQ664
1,00 48,4 gorCP684
0,48 100
0,95 gorCP2135
gorCP2139
cpzCAM13
cpzGAB1
cpzUS
cpzMT145
cpzEK505
YBF30
YBF106 VIH-1 1998,
DJO0131 grupo N Camares
04CM_1015
04CM_1131
cpzMB66
cpzLB7
C_ETH2220
A_92UG037 VIH-1
F_MP411 1957
B_HXB2 grupo M Repblica
0,05 D_ELI Democrtica
do Congo

Figura 1. Relacionamento evolutivo do nico isolado de VIH-1 grupo P (RBF168, apresen-


tado a negrito na rvore filogentica) com outros grupos do VIH-1 e com VIScpz e VISgor.
So ainda indicados os anos de identificao dos primeiros isolados dos grupos M, N e O.
A filogenia foi determinada por mxima verosimilhana e confirmada por anlise Bayesia-
na. O suporte estatstico dos diferentes agrupamentos de sequncias indicado em cima
(anlise de repetio, 1.000 bootstrap, mxima verosimilhana) e em baixo (probabilidades
posteriores em proporo, anlise Bayesiana) dos ramos que do origem aos agrupamentos
(modificado de Plantier, et al.6).

atys7. As epidemias de infeco por VIH-1 e VIH-2 so o resultado de


transmisses vricas cruzadas do macaco para o homem, representando
assim infeces zoonticas. Estas transmisses do macaco para o homem
so relativamente recentes e ocorreram em diferentes ocasies e locais ge-
ogrficos. Tal poder explicar o facto dos dois tipos de VIH desenvolverem
quadros epidmicos muito diversos. Enquanto VIH-1 provoca uma verda-
deira pandemia, espalhada por todos os continentes, a infeco por VIH-2
tem distribuio quase restrita Guin-Bissau, pases circundantes da fri-
ca Ocidental e alguns pases europeus onde se inclui Portugal, Frana e
Espanha.
Com base na anlise filogentica de sequncias de vrus isolados em
todo o Mundo, VIH-1 foi classificado nos grupos M, O, N e P (Fig. 1) 6.
Os grupos N e P s existem nos Camares, onde foram descobertos em
1998 e 2009, respectivamente6,8. Os membros destes grupos divergem entre
si, em mdia, 30% ao nvel das sequncias de aminocidos do gag e 47%
Diversidade gentica de VIH 5

Quadro 1. Caractersticas de uma CRF


Ter sido detectada em pelo menos trs indivduos no relacionados epidemiologicamente.
Ter o genoma sequenciado inteiramente.
Ter uma estrutura molecular e composio homognea.

no Env. O grupo M, o mais prevalente a nvel mundial, composto por


nove subtipos distintos classificados de A-D, F-H, J e K, que divergem, em
mdia, 15% no gag e 25% no env, e seis subsubtipos (A1-A4 e F1-F2), que
divergem, cerca de, 17% no env (Fig. 2). Em relao a VIH-2, existem oito
grupos designados de A a H, mas o A e o B so os nicos que geraram
epidemias9-11.
A infeco da mesma clula por dois ou mais vrus diferentes (subtipos,
recombinantes ou grupos) leva produo de vrus recombinantes de pri-
meira ou segunda gerao, durante o processo de transcrio reversa. Os
recombinantes que do origem a novos focos epidmicos so designados de
formas recombinantes circulantes (CRF, de circulating recombinant forms)
(Quadro 1). Os recombinantes nicos so designados unique recombinant
forms (URF). As CRF e URF so designadas por nmeros, que identificam
a ordem de descoberta, e pelas letras correspondentes aos subtipos, recom-
binantes ou grupos que as constituem (Fig. 2). As CRF, constitudas por
trs ou mais subtipos, so designadas de CRF complexas ou CRF_cpx. A
co-circulao de mltiplos subtipos, na mesma regio geogrfica, frequen-
te na actual pandemia de VIH/sida, o que favorece a formao e dissemi-
nao de vrus VIH-1 recombinantes. Actualmente esto descritas, 47 CRF
que apresentam diferenas nas estruturas moleculares, na composio dos
subtipos e nas prevalncias e distribuies geogrficas (Figs. 3 A e B) 12. A
CRF01_AE, constituda pelos subtipos A e E, a forma recombinante mais
prevalente, a nvel mundial, logo seguida da CRF02_AG.

Distribuio geogrfica
A maior parte das infeces, a nvel mundial, so causadas pelos subtipos
A, B e C, com este ltimo subtipo a ser responsvel por cerca de 50% das
infeces, a nvel global13,14. Com excepo da frica sub-sariana e, em
particular, da frica Central em que esto presentes todos os subtipos, CRF
e algumas URF, h um padro especfico de distribuio geogrfica das
diferentes formas genticas do VIH-114,15. Este padro de transmisso pare-
ce ser consequncia da introduo ocasional de um tipo de vrus num de-
terminado local, fruto de migraes populacionais (efeito fundador) ou do
predomnio de uma forma de transmisso, que favorece a maior prevalncia
de um ou mais tipo de vrus nessa populao14,16. O subtipo B, embora s
cause cerca de 12% das infeces, a nvel global, o mais prevalente no
Mundo ocidental (Europa Ocidental, Amricas, Japo e Austrlia) e , ain-
da, comum nalguns pases do Sudeste Asitico, Norte de frica e Mdio
6 Nuno Taveira, Maria Odette Ferreira

Figura 2. Relacionamento evolutivo dos diferentes subtipos, subsubtipos e CRF de VIH-1,


grupo M. As sequncias analisadas (genomas inteiros ou quase inteiros de vrus prottipos)
foram recolhidas da base de dados HIV Sequence Database12. As distncias evolutivas (nmero
de substituies por nucletido), entre as diferentes sequncias, foram calculadas usando o
mtodo Maximum Composite Likelihood. A rvore filogentica foi obtida por neighbour-
joining. Cada uma das ramificaes internas, definindo um subtipo ou subsubtipo, suportada
por > 90% bootstrap. A anlise filogentica foi efectuada no programa MEGA4.

Oriente14,17,18. Os subtipos no-B predominam no resto do mundo. O subtipo


C prevalece nos pases responsveis por > 80% das infeces por VIH-1,
como a frica do Sul, Moambique e ndia19, sendo, ainda, comum no
Diversidade gentica de VIH 7

A
CRF01_AE LTR gag vpr env LTR
vif A
pol
rev rev E
iai vpx iai nef U

CRF02_AG LTR gag vpr env LTR


vif A
pol
rev rev G
iai vpx iai nef U
vpr

CRF03_AB LTR gag vpr env LTR


vif A
pol
rev rev B
iai vpx iai nef
vpr

CRF04_CPX LTR gag vpr env LTR


vif A K
pol
rev rev G H
iai vpx iai nef U

Subtipo A CRF01_AE
SU
TM
A E

A
TR CA
PR NC

IN
MA

Figura 3. Organizao molecular e estrutural de algumas CRF. A representao esquemtica


da organizao molecular e composio em subtipos das CRF01_AE, CRF02_AG, CRF03_AB
e CRF04_cpx. B representao esquemtica da composio do invlucro da CRF01_AE
e do subtipo A que lhe deu origem.

Brasil. O subtipo A predominante na Europa de Leste, Centro e Oeste de


frica e no Norte da sia. As CRF e URF causam > 20% das infeces por
VIH-1 a nvel global e representam as formas genticas predominantes no
Sudeste Asitico (CRF01_AE) e na frica Ocidental (CRF02_AG), incluindo
Angola, onde se detectam mltiplas CRF e URF14,15. Em Portugal, os gen-
tipos mais prevalentes so os subtipos B e G, o CRF14_BG, que resulta da
recombinao entre estes dois subtipos, e o CRF02_AG20-25. Como referido,
os vrus dos grupos N e P s foram ainda encontrados nos Camares6,8.
8 Nuno Taveira, Maria Odette Ferreira

Quanto ao grupo O, originalmente isolado nos Camares, em 1994, end-


mico neste Pas e nos pases vizinhos da frica Central, onde representa,
apenas, 1-5% das infeces por VIH-126. Estes vrus foram j detectados nos
Estados Unidos, Canad, Espanha, Noruega, Alemanha e Frana.
No caso de VIH-2, o grupo A o mais difundido, e foi detectado em
Cabo Verde, Guin-Bissau, Gmbia e Senegal, onde endmico, e em Por-
tugal, Espanha, Frana, Holanda e ndia, entre outros pases 25. O grupo B
endmico na Costa do Marfim, Gana e Mali. Fora da frica Ocidental,
foi, apenas, encontrado, em nmeros significativos, em Espanha e Frana,
em indivduos provenientes da Costa do Marfim e do Mali. Os raros isola-
dos dos grupos C, D, E, F, G e H foram encontrados na Libria, Serra Leoa
e Costa do Marfim9,11.

Implicaes da diversidade gentica de VIH-1


Um estudo recente, demonstrando que o subtipo A se transmite a uma taxa
significativamente superior do que o D, no Uganda, sugere que o subtipo pode
ser um factor importante para a especificidade das epidemias de VIH/sida na
frica sub-sariana27. Contudo, a maior parte dos estudos semelhantes, efec-
tuados em frica e noutros locais, no confirmam esta associao directa
entre subtipo e taxa de transmisso14. A diversidade gentica de VIH-1 tem,
sobretudo, impacto ao nvel do diagnstico e da preveno da infeco, bem
como ao nvel da resistncia aos anti-retrovricos (ARVs).

Impacto no diagnstico e na preveno da infeco


Actualmente, os testes de serodiagnstico da infeco por VIH-1, presentes
no mercado, detectam, eficientemente, todas as amostras contendo anticorpos
contra VIH-1, do grupo M, independentemente do gentipo vrico e da ori-
gem geogrfica. Isto ocorre, apesar de haver alguma variabilidade ao nvel
da sequncia de aminocidos dos eptopos imunodominantes de VIH-1.
No entanto, h alguma variabilidade no desempenho dos testes serolgicos
para detectar infeces por isolados do grupo O. Um estudo recente indi-
ca que pequenas modificaes na estrutura antignica de alguns variantes
do grupo O so suficientes para diminuir a sensibilidade de alguns testes
Enzyme-Linked Immunosorbent Assay (ELISA), para detectar estes vrus28.
Pequenas variaes antignicas podem, tambm, comprometer a sensibili-
dade e especificidade dos testes, que detectam o antignio p24, no sangue
dos indivduos infectados.
A determinao continuada da carga vrica, nos indivduos infectados
por VIH-1, por quantificao do nmero de cpias de ARN no plasma,
um processo de rotina no controlo da progresso da infeco e na avaliao
da eficcia da teraputica anti-retrovrica (TARV). O elevado grau de diver-
sidade gentica de VIH-1 torna difcil o desenho de testes para detectar
todos os seus variantes. De facto, vrios estudos mostram que alguns testes
de carga vrica apresentam desempenhos variveis, em funo do gentipo
Diversidade gentica de VIH 9

vrico sobretudo no que respeita aos subtipos no-B mais divergentes (G,
H, K e J), recombinantes complexos e isolados dos grupos O e N 21,29-31. Os
problemas de no deteco ou subquantificao de alguns subtipos afectam
tambm os testes para a deteco qualitativa de ADN provrico de VIH-1,
testes utilizados no diagnstico de infeces em crianas nascidas de mes
seropositivas32. , portanto, necessrio continuar a melhorar o desempenho
dos testes moleculares para VIH, identificando regies de maior conservao
gentica e desenhando primers e/ou sondas que permitam a deteco de
todos os variantes de VIH-1. Idealmente, estes testes devero detectar os
vrus recombinantes, que esto a emergir como as variantes dominantes da
epidemia em vrias regies do globo. Em qualquer das circunstncias,
fundamental manter uma contnua vigilncia do desempenho destes testes,
uma vez que a contnua variabilidade do VIH-1 ir, mais tarde ou mais
cedo, afectar a sua sensibilidade. Um exemplo recente deste tipo de situao
diz respeito a VIH-1, do grupo P, descoberto em 2009 e que no foi detec-
tado por um teste de carga vrica em comercializao 6.
Em relao preveno da infeco VIH/sida, a marcada variao es-
trutural e antignica do invlucro de VIH-1 considerada um potencial
entrave ao desenvolvimento de vacinas33,34. De facto, h eptopos neutrali-
zantes (contra os quais se produzem anticorpos neutralizantes), que variam
em funo do subtipo vrico e, por isso, a escolha dos imunognios, a usar
numa vacina, dever ter em conta esta diversidade35,36. A recombinao in
silico poder ser uma boa estratgia para obter novos imunognios vacinais
que contemplem toda a diversidade antignica de VIH-1 37,38.

Impacto na resistncia aos anti-retrovricos


VIH-1, do grupo O, naturalmente resistente aos no-nuclesidos inibido-
res da transcriptase reversa (NNITRs), devido existncia de polimorfismos
naturais nas suas transcriptases reversas (TRs), que conferem resistncia
contra esta classe de frmacos39,40.
A mutao V106M, que confere resistncia ao efavirenz (EFV) e nevi-
rapina (NVP) , preferencialmente, seleccionada em infectados por isolados
dos subtipos C e CRF01_AE, em detrimento da V106A que mais vezes
seleccionada no subtipo B (revisto em Wainberg, et al.17). Esta alterao
est associada com um polimorfismo natural existente no cdo 106 da TR.
Alguns polimorfismos na posio 98 da TR, que so comuns no CRF02_AG,
por exemplo A98G, esto associados a resistncia etravirina (ETV) no
subtipo B41. Este e outros polimorfismos podem diminuir a barreira gen-
tica de resistncia do subtipo G para os NNITRs.
H poucos estudos sobre o papel dos subtipos no desenvolvimento de
resistncia aos nuclesidos inibidores da TR (NITRs). Alguns estudos su-
gerem que a mutao K65R, que confere resistncia ao tenofovir (TDF)
mais vezes e rapidamente seleccionada no subtipo C, em comparao com
o subtipo B e que esta mutao menos vezes seleccionada em infectados
com o subtipo A (revisto em Wainberg, et al.17).
10 Nuno Taveira, Maria Odette Ferreira

Quadro 2. Exemplos de polimorfismos naturais na protease de subtipos no-B em posies


que esto associados a resistncia, no subtipo B
Gentipos Mutaes que conferem resistncia a, pelo menos, um IP, no subtipo B
L10I V11I I13V K20I/R M36I V82A/ I93L
T/F/I/
L/S
A1/A2 I V I
C I/V L
D V V I
F1/F2 V/I R I/V
G I I V I I I
H V R I
J V R I
K I R I
CRF01_AE V R I
CRF02_AG V/I I V I I
CRF37_cpx I

A protease varia cerca de 10% entre cada subtipo, ao nvel das sequncias
de aminocidos. Com excepo do subtipo G, em que h um aminocido de
diferena no stio activo da enzima em relao ao subtipo B, todas as diver-
gncias entre subtipos ocorrem fora do centro activo da protease42. Por esta
razo, embora a diversidade observada fora do centro activo possa modificar
a afinidade da enzima para os inibidores da protease (IPs), alterar a sua
actividade proteoltica e influenciar a capacidade replicativa de VIH-1, os
IPs existentes so activos sobre todas as formas genticas de VIH-1 17,42-44.
Os infectados com vrus do subtipo B, tratados com IPs, desenvolvem
padres clssicos de mutaes de resistncia na protease45. As primeiras mu-
taes seleccionadas pelos IPs, designadas de mutaes major, localizam-se
no centro activo da enzima. As mutaes minor so seleccionadas aps as
mutaes major e localizam-se fora do centro activo da protease. Algumas
mutaes minor podem existir como polimorfismos naturais de alguns sub-
tipos no-B e, eventualmente, contribuir para baixar a barreira gentica aos
IPs e determinarlhes novas vias de resistncia (Quadro 2)19,43,44. Alguns
destes polimorfismos, por exemplo K20I e M36I, podem ainda aumentar a
capacidade replicativa dos vrus na presena dos IPs46.
Os padres de emergncia de mutaes de resistncia aos IPs podem
variar em funo do subtipo vrico e isto pode estar associado menor
capacidade de ligao dos IPs protease dos vrus no-B42. Por exemplo,
a resistncia ao nelfinavir (NFV), no subtipo C, est associada com a mu-
tao L90M e no CRF01_AE com a N88S, enquanto no subtipo B est
associada com a D30N (no centro activo) e N88D (fora do centro activo)47,48.
Diversidade gentica de VIH 11

A mutao I54V/O foi seleccionada na presena do NFV em infectados


com o subtipo G, mas no em infectados com o subtipo B49. Da mesma
forma, no subtipo G, a L90M foi associada com menor diminuio da sus-
ceptibilidade ao NFV, quando comparado com o B e, em contraste com este
subtipo, esta mutao no foi associada a resistncia ao saquinavir (SQV),
devido mutao auxiliar M89I.
Os polimorfismos existentes nos locais de clivagem NC/SP2/p6, da po-
liprotena precursora gag, podem aumentar a capacidade replicativa de vrus
resistentes aos IPs50. Recentemente, foi demonstrado que alguns polimor-
fismos presentes no gag dos subtipos A e C podem diminuir a sensibilida-
de de VIH do subtipo B ao lopinavir (LPV), em 14 vezes, indicando que
poder haver diferenas na resistncia aos IPs, mediada pelo gag em funo
dos subtipos51.

Bibliografia
1. Sanjuan R, Nebot MR, Chirico N, Mansky LM, Belshaw R. Viral mutation rates. J Virol. 2010;84:9733-48.
2. Skar H, Borrego P, Wallstrom TC, et al. HIV-2 genetic evolution in patients with advanced disease is faster than
that in matched HIV-1 patients. J Virol. 2010;84:7412-5.
3. Suryavanshi GW, Dixit NM. Emergence of recombinant forms of HIV: dynamics and scaling. PLoS Comput
Biol. 2007;3:2003-18.
4. Ribeiro RM, Qin L, Chavez LL, Li D, Self SG, Perelson AS. Estimation of the initial viral growth rate and
basic reproductive number during acute HIV-1 infection. J Virol. 2010;84:6096-102.
5. Chen HY, Di Mascio M, Perelson AS, Ho DD, Zhang L. Determination of virus burst size in vivo using a
single-cycle SIV in rhesus macaques. Proc Natl Acad Sci USA. 2007;104:19079-84.
6. Plantier JC, Leoz M, Dickerson JE, et al. A new human immunodeficiency virus derived from gorillas. Nat Med.
2009;15:871-2.
7. Lemey P, Rambaut A, Pybus OG. HIV evolutionary dynamics within and among hosts. AIDS Rev. 2006;8:125-40.
8. Simon F, Mauclere P, Roques P, et al. Identification of a new human immunodeficiency virus type 1 distinct
from group M and group O. Nat Med. 1998;4:1032-7.
9. Damond F, Worobey M, Campa P, et al. Identification of a highly divergent HIV type 2 and proposal for a
change in HIV type 2 classification. AIDS Res Hum Retroviruses. 2004;20:666-72.
10. de Silva TI, Cotten M, Rowland-Jones SL. HIV-2: the forgotten AIDS virus. Trends Microbiol. 2008;16:588-95.
11. Gao F, Yue L, Robertson DL, et al. Genetic diversity of human immunodeficiency virus type 2: evidence for
distinct sequence subtypes with differences in virus biology. J Virol. 1994;68:7433-47.
12. HIV Sequence Database: Los Alamos National Laboratory. 2010.
13. Arien KK, Vanham G, Arts EJ. Is HIV-1 evolving to a less virulent form in humans? Nat Rev Microbiol.
2007;5:141-51.
14. Buonaguro L, Tornesello ML, Buonaguro FM. Human immunodeficiency virus type 1 subtype distribution in the
worldwide epidemic: pathogenetic and therapeutic implications. J Virol. 2007;81:10209-19.
15. Bartolo I, Rocha C, Bartolomeu J, et al. Highly divergent subtypes and new recombinant forms prevail in the
HIV/AIDS epidemic in Angola: New insights into the origins of the AIDS pandemic. Infect Genet Evol. 2009;
9:672-82.
16. Gilbert MT, Rambaut A, Wlasiuk G, Spira TJ, Pitchenik AE, Worobey M. The emergence of HIV/AIDS in the
Americas and beyond. Proc Natl Acad Sci USA. 2007;104:18566-70.
17. Wainberg MA, Brenner BG. Role of HIV Subtype diversity in the development of resistance to antiviral drugs.
Viruses. 2010;2:2493-508.
18. Hemelaar J, Gouws E, Ghys PD, Osmanov S. Global and regional distribution of HIV-1 genetic subtypes and
recombinants in 2004. Aids. 2006;20:W13-23.
19. Bartolo I, Casanovas J, Bastos R, et al. HIV-1 genetic diversity and transmitted drug resistance in health care
settings in Maputo, Mozambique. J Acquir Immune Defic Syndr. 2009;51:323-31.
20. Esteves A, Parreira R, Venenno T, et al. Molecular epidemiology of HIV type 1 infection in Portugal: high
prevalence of non-B subtypes. AIDS Res Hum Retroviruses. 2002;18:313-25.
21. Antunes R, Figueiredo S, Bartolo I, et al. Evaluation of the clinical sensitivities of three viral load assays with
plasma samples from a pediatric population predominantly infected with human immunodeficiency virus type 1
subtype G and BG recombinant forms. J Clin Microbiol. 2003;41:3361-7.
22. Esteves A, Parreira R, Piedade J, et al. Spreading of HIV-1 subtype G and envB/gagG recombinant strains among
injecting drug users in Lisbon, Portugal. AIDS Res Hum Retroviruses. 2003;19:511-7.
23. Palma AC, Araujo F, Duque V, Borges F, Paixao MT, Camacho R. Molecular epidemiology and prevalence of
drug resistance-associated mutations in newly diagnosed HIV-1 patients in Portugal. Infect Genet Evol. 2007;
7:391-8.
24. Duque V, Holguin A, Silvestre M, Gonzalez-Lahoz J, Soriano V. Human immunodeficiency virus type 1 recom-
binant B/G subtypes circulating in Coimbra, Portugal. Clin Microbiol Infect. 2003;9:422-5.
12 Nuno Taveira, Maria Odette Ferreira

25. Barroso H, Borrego P, Brtolo I, et al. Evolutionary and structural features of the C2, V3 and C3 envelope regions
underlying the differences in HIV-1 and HIV-2 biology and infection. PLoS ONE. Forthcoming 2010.
26. Gurtler LG, Hauser PH, Eberle J, et al. A new subtype of human immunodeficiency virus type 1 (MVP-5180)
from Cameroon. J Virol. 1994;68:1581-5.
27. Kiwanuka N, Laeyendecker O, Quinn TC, et al. HIV-1 subtypes and differences in heterosexual HIV transmis-
sion among HIV-discordant couples in Rakai, Uganda. Aids. 2009;23:2479-84.
28. Plantier JC, Djemai M, Lemee V, et al. Census and analysis of persistent false-negative results in serological
diagnosis of human immunodeficiency virus type 1 group O infections. J Clin Microbiol. 2009;47:2906-11.
29. Parekh B, Phillips S, Granade TC, Baggs J, Hu DJ, Respess R. Impact of HIV type 1 subtype variation on viral
RNA quantitation. AIDS Res Hum Retroviruses. 1999;15:133-42.
30. Drexler JF, de Souza Luna LK, Pedroso C, et al. Rates of and reasons for failure of commercial human im-
munodeficiency virus type 1 viral load assays in Brazil. J Clin Microbiol. 2007;45:2061-3.
31. Church D, Gregson D, Lloyd T, et al. HIV-1 viral load multi-assay comparison of the realtime HIV-1, COBAS
TaqMan 48 v 1.0, Easy Q v1.2 and Versant v3.0 assays in a cohort of canadian patients with diverse HIV sub-
type infections. J Clin Microbiol. 2010 Nov 17. [Epub ahead of print]
32. Bogh M, Machuca R, Gerstoft J, et al. Subtype-specific problems with qualitative Amplicor HIV-1 DNA PCR
test. J Clin Virol. 2001;20:149-53.
33. Gnanakaran S, Lang D, Daniels M, Bhattacharya T, Derdeyn CA, Korber B. Clade-specific differences between
human immunodeficiency virus type 1 clades B and C: diversity and correlations in C3-V4 regions of gp120. J
Virol. 2007;81:4886-91.
34. Gaschen B, Taylor J, Yusim K, et al. Diversity considerations in HIV-1 vaccine selection. Science. 2002;296:2354-60.
35. Gray ES, Moore PL, Pantophlet RA, Morris L. N-linked glycan modifications in gp120 of human immunodeficiency
virus type 1 subtype C render partial sensitivity to 2G12 antibody neutralization. J Virol. 2007;81:10769-76.
36. Mascola JR, Montefiori DC. The role of antibodies in HIV vaccines. Annu Rev Immunol. 2010;28:413-44.
37. Barouch DH, OBrien KL, Simmons NL, et al. Mosaic HIV-1 vaccines expand the breadth and depth of cellular
immune responses in rhesus monkeys. Nat Med. 2010;16:319-23.
38. Santra S, Liao HX, Zhang R, et al. Mosaic vaccines elicit CD8+ T lymphocyte responses that confer enhanced
immune coverage of diverse HIV strains in monkeys. Nat Med. 2010;16:324-8.
39. Descamps D, Collin G, Letourneur F, et al. Susceptibility of human immunodeficiency virus type 1 group O
isolates to antiretroviral agents: in vitro phenotypic and genotypic analyses. J Virol. 1997;71:8893-8.
40. Tuaillon E, Gueudin M, Lemee V, et al. Phenotypic susceptibility to nonnucleoside inhibitors of virion-associated
reverse transcriptase from different HIV types and groups. J Acquir Immune Defic Syndr. 2004;37:1543-9.
41. Sylla M, Chamberland A, Boileau C, et al. Characterization of drug resistance in antiretroviral-treated patients
infected with HIV-1 CRF02_AG and AGK subtypes in Mali and Burkina Faso. Antivir Ther. 2008;13:141-8.
42. Ali A, Bandaranayake R, Cai Y, et al. Molecular basis for drug resistance in HIV-1 protease. Viruses. 2010;2:
2509-35.
43. Camacho RJ, Vandamme AM. Antiretroviral resistance in different HIV-1 subtypes: impact on therapy outcomes
and resistance testing interpretation. Curr Opin HIV AIDS. 2007;2:123-9.
44. Santos AF, Soares MA. HIV genetic diversity and drug resistance. Viruses. 2010;2:503-31.
45. Johnson VA, Brun-Vezinet F, Clotet B, et al. Update of the drug resistance mutations in HIV-1: December 2009.
Top HIV Med. 2009;17:138-45.
46. Holguin A, Sune C, Hamy F, Soriano V, Klimkait T. Natural polymorphisms in the protease gene modulate the
replicative capacity of non-B HIV-1 variants in the absence of drug pressure. J Clin Virol. 2006;36:264-71.
47. Grossman Z, Paxinos EE, Averbuch D, et al. Mutation D30N is not preferentially selected by human immuno-
deficiency virus type 1 subtype C in the development of resistance to nelfinavir. Antimicrob Agents Chemother.
2004;48:2159-65.
48. Ariyoshi K, Matsuda M, Miura H, Tateishi S, Yamada K, Sugiura W. Patterns of point mutations associated with
antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. J Acquir
Immune Defic Syndr. 2003;33:336-42.
49. Santos AF, Abecasis AB, Vandamme AM, Camacho RJ, Soares MA. Discordant genotypic interpretation and
phenotypic role of protease mutations in HIV-1 subtypes B and G. J Antimicrob Chemother. 2009;63:593-9.
50. Clavel F, Mammano F. Role of Gag in HIV resistance to protease inhibitors viruses. 2010;2:1411-26.
51. Gupta RK, Kohli A, McCormick AL, Towers GJ, Pillay D, Parry CM. Full-length HIV-1 Gag determines protease
inhibitor susceptibility within in vitro assays. Aids. 2010;24:1651-5.
I Seco
Captulo 2

Ciclo biolgico de VIH


Jos Miguel Azevedo-Pereira

Introduo
Vrus da imunodeficincia humana (VIH), agente responsvel pela sndrome
da imunodeficincia adquirida (sida), pertence famlia Retroviridae, subfa-
mlia Orthoretrovirinae, gnero dos Lentivrus. Este retrovrus possui, como
todos os membros desta famlia, a enzima transcriptase reversa (TR), que
transcreve o ARN genmico para uma molcula de ADN que, posterior-
mente, ser integrada no genoma da clula hospedeira, sob a forma de ADN
proviral.
Existem dois tipos de VIH, o tipo 1 (VIH-1) e o tipo 2 (VIH-2), os
quais, apesar de possurem morfologia e estrutura semelhantes, apresentarem
uma identidade genmica de cerca de 50% e induzirem respostas imunit-
rias cruzadas, podem distinguir-se pelas respectivas caractersticas antig-
nicas, moleculares e biolgicas1.
As infeces por VIH-1 e por VIH-2 diferem quer pelo ciclo biolgico e,
consequentemente, pela evoluo da infeco, desde a fase aguda at fase
sintomtica ou sida, quer pela distribuio geogrfica do agente etiolgico.
A evoluo das duas infeces distingue-se, especialmente, pelo pero-
do de latncia clnica, que muito mais longo nas infeces por VIH-2 do
que nas infeces por VIH-1. No primeiro caso, este perodo pode ultrapas-
sar os 20 anos, enquanto que no segundo varia, geralmente, entre os 10 e os
12 anos2.
Em termos epidemiolgicos, apesar de VIH-1 e VIH-2 partilharem as
mesmas vias de transmisso, VIH-2 manteve uma distribuio geogrfica
muito mais restrita, comparada com a pandemia, que caracteriza a infeco
por VIH-1. No presente, a maioria das infeces por VIH-2 verificam-se,
14 Jos Miguel Azevedo-Pereira

predominantemente, na frica Ocidental. Fora desta regio, os casos de


infeco por VIH-2 so detectados nos pases que mantm ou mantiveram
relaes culturais, socioeconmicas ou histricas com esses pases africanos;
Portugal, Frana e as respectivas ex-colnias so exemplos elucidativos,
sendo que, em Portugal, 3,3% dos casos de sida notificados so devidos
infeco por VIH-23. As razes para esta menor disseminao de VIH-2
est, directamente, relacionada com as caractersticas vricas intrnsecas
deste tipo de VIH, nomeadamente as menores cargas vricas e a menor taxa
de transmisso verificadas para VIH-24.
Ao longo dos ltimos anos tem-se verificado o aparecimento de novas
estirpes, resultantes no s da acumulao de mutaes, que ocorrem em
cada ciclo de replicao vrica, mas, tambm, das possveis trocas genticas
entre as estirpes de VIH circulantes nas diferentes comunidades.
A construo de rvores filogenticas, a partir do conhecimento das
sequncias de isolados vricos obtidos de indivduos oriundos dos diferentes
continentes, mostra a grande diversidade de estirpes de VIH. Esta grande
variabilidade condiciona, no s a preparao de vacinas, mas, tambm, a
composio dos dispositivos para diagnstico in vitro e a obteno de novos
medicamentos, para uma teraputica anti-retrovrica eficaz.
A aplicao de novas tecnologias ao estudo de VIH-1 e VIH-2, e os
dados resultantes da experincia adquirida pelas equipas pluridisciplinares,
que acompanham os indivduos infectados por estes dois vrus, tm contri-
budo para um melhor conhecimento da histria natural da infeco.

Estrutura genmica de VIH


Duma forma muito sucinta, o genoma de VIH (Fig. 1) constitudo por duas
molculas de ARN, cada uma com cerca de 9.500 pares de bases, e contm
trs genes estruturais, env, gag e pol, e seis genes reguladores/acessrios, tat,
rev, nef, vif, vpr, e vpx (s em VIH-2) ou vpu (s em VIH-1). Nas extremi-
dades 5 e 3 do ADN provrico localizam-se sequncias repetitivas terminais
longas (long terminal repeats [LTR]), que controlam a transcrio do ge-
noma vrico, regulando a produo dos viries 5,1,6.
Os genes gag, pol e env codificam para a maior parte dos componen-
tes estruturais da partcula vrica. Considerando o genoma de VIH-1, o
gene gag codifica para uma protena precursora (p55), que, aps clivagem,
origina a protena da cpside (CA) (p24), as protenas bsicas associadas
ao genoma (p9 e p6) e a protena da matriz (MA) (p17); o gene pol co-
difica para uma protena precursora (p68), que, cindida, leva formao
das enzimas: TR (p53), protease (p11) e integrase (p34) e o gene env, que
codifica para um polipptido, precursor das glicoprotenas do invlucro,
a gp160, que, cindida por enzimas celulares, possivelmente no aparelho
de Golgi, d lugar glicoprotena externa, gp120, e glicoprotena trans-
membranar (TM), gp41. No caso do genoma de VIH-2, os pesos molecu-
lares das protenas, codificadas pelos diferentes genes, so um pouco di-
ferentes5,1.
Ciclo biolgico de VIH 15

VIH-1 tat

vif rev
LTR gag vpu LTR

vpr
pol env nef

VIH-2 tat
vif
rev
nef
LTR gag vpr

pol env
vpx LTR

Figura 1. Esquema da estrutura genmica de VIH-1 e VIH-2.

Tat e rev so genes essenciais, que codificam para protenas reguladoras,


que actuam na activao da transcrio e na regulao da expresso do
ARN de polaridade positiva (ARNm) vrico. O gene nef intervm na re-
plicao vrica. Estes trs genes participam no controlo precoce da expres-
so gnica7.
Vif, vpu (em VIH-1) ou vpx (em VIH-2) e vpr so genes, que codificam
para a sntese de protenas acessrias, com funes de regulao tardia,
sendo importantes na infecciosidade vrica e na eficincia da replicao de
VIH7.

Estrutura da partcula vrica de VIH


As partculas vricas produzidas pelas clulas infectadas in vitro com VIH1
ou VIH-2 so muito semelhantes, na sua morfologia e composio. Os vi-
ries tm uma morfologia esfrica, com cerca de 100-110 nm de dimetro
(Figs. 2 e 3), que consiste num invlucro constitudo por uma bicamada de
natureza lipdica, que rodeia uma nucleocpside (NC) de formato cnico,
mais interna. Esta NC envolve e protege o ARN genmico vrico, promo-
vendo a sua insero dentro da nova partcula vrica, durante o processo de
morfognese; ela participa, igualmente, no processo de descapsidao, du-
rante os primeiros passos do ciclo de replicao vrica 8.
A NC constituda pelas protenas codificadas pelo gene gag, atravs
dum polipptido precursor, que, aps clivagem, d origem s principais
protenas constituintes da NC:
Protena da MA, que se encontra localizada entre a NC e o invlucro
vrico.
Protena da CA que forma o core vrico.
16 Jos Miguel Azevedo-Pereira

Figura 2. Fotografia obtida por microscopia electrnica de uma partcula vrica de VIH-2
(VIH-2ALI), onde possvel observar as principais caractersticas estruturais vricas. Barra
= 100 nm (adaptado de Azevedo-Pereira JM e Alves de Matos AP, resultados no publicados).

Protena da NC, que se encontra, intimamente, ligada ao ARN genmico.


Enquanto que a protena MA, no virio maduro se mantm estreitamente
ligada ao folheto interno da bicamada lipdica, constituinte do invlucro, as
restantes protenas do gene gag condensam-se para formar o core vrico de
forma cnica, tpica dos lentivrus9.
Dentro da NC encontram-se duas molculas de ARN genmico de po-
laridade positiva. Associada extremidade 5, de cada uma destas molcu-
las, encontra-se uma molcula de ARN de transferncia (tARN Lys), que vai
servir de primer para o incio da sntese da cadeia do ADN complementar
(cADN), por intermdio da enzima TR. Esta enzima, juntamente com a
protease e a integrase (ambas codificadas pelo gene pol), encontram-se,
igualmente, localizadas no interior da CA.
Cada virio contm cerca de 1.200 molculas de protena CA e 80 de
TR10. Adicionalmente, est descrita a presena das protenas acessrias Vif,
Vpr e Vpx nas partculas vricas11, bem como de vrias protenas da clula
hospedeira, nomeadamente a actina, a ubiquitina e a ciclofilina A. Curiosa-
mente, esta ltima liga-se, especificamente, protena CA de VIH-1, de-
monstrando ser necessria no processo infeccioso das estirpes de VIH-1,
pertencentes ao grupo M12,13.
O invlucro vrico constitudo por uma bicamada lipdica, onde se
inserem espculas constitudas por heterodmeros, compostos, cada um deles,
por uma molcula da protena de superfcie (SU) e outra da protena TM.
Ciclo biolgico de VIH 17

gp120 (SU) Q
T
p6, 9 (NC)
T
gp41 (TM) T
T
p24 (CA)
T
T
T
p17 (MA)
p55 (RT), p63 T
T
T

p11 (IN)

Figura 3. Esquema de uma partcula vrica de VIH-1, onde se assinalam as principais prote-
nas estruturais.

Os lpidos presentes no invlucro vrico so oriundos da membrana ci-


toplasmtica da clula produtora das partculas vricas, em consequncia do
processo de gemulao14. Para alm das protenas vricas SU e TM, prote-
oliticamente processadas ao nvel do aparelho de Golgi, a partir da protena
precursora15 Pr160Env (codificadas pelo gene env), existem ainda protenas
de origem celular. Por exemplo, as protenas histocompatibilidade (HLA)
classe I e HLA DR (classe II) so inseridas no invlucro vrico, durante o
processo de gemulao, e excedem, em nmero, as protenas SU e TM, de
origem vrica. Para alm de servirem de disfarce imunitrio e, por isso,
serem importantes na interaco vrus-sistema imunitrio, estas protenas
podem, ainda, exercer outras funes biolgicas16. Foram, igualmente, descri-
tas como fazendo parte do invlucro vrico outras protenas (LFA-1, ICAM-1,
ICAM-2, etc.), que parecem intervir nos processos de fuso vrus-clula e
clula-clula, influenciando desta forma a infecciosidade do VIH 17,18. A
presena e quantidade relativa destas protenas, na partcula vrica, dependem
do tipo de clula produtora.

Ciclo de replicao de VIH


O ciclo de replicao de VIH (Fig. 4), tal como de todos os lentivrus, pode
ser dividido em duas fases, a fase inicial e a fase tardia. Cada uma delas
constituda por uma srie sequencial de passos, nos quais esto envolvidas
macromolculas de origem vrica e de origem celular.
18 Jos Miguel Azevedo-Pereira

vDNA Transcription
V
vRNA IV Protein synthesis

VI
III vRNA VII

I mRNA

X
Budding
VIII
II

IX

Figura 4. Esquema do ciclo replicativo de VIH. As fases referidas no texto esto assinaladas
com numerao romana (adaptado de um diapositivo gentilmente cedido pela Upjohn).

1 Fase inicial
As interaces iniciais de VIH, com a clula, so determinantes do respec-
tivo tropismo celular. De facto, a interaco especfica entre as protenas de
origem vrica, presentes no invlucro de VIH, e as molculas receptoras,
presentes na membrana citoplasmtica da clula-alvo, condiciona que tipo
de clulas uma determinada variante de VIH capaz de infectar. As impli-
caes deste tropismo, na patognese da infeco, so bvias, bastando
pensar que, em consequncia dele existiro variantes vricas com a capaci-
dade de infectar clulas diferenciadas ou clulas precursoras, clulas acti-
vadas ou no-activadas, clulas linfocitrias ou clulas de outros comparti-
mentos (do sistema nervoso central, por exemplo). O perfil de utilizao das
molculas receptoras tem, ainda, implicaes directas na teraputica que faa
uso da nova classe de anti-retrovricos, cujo alvo a interaco de VIH
com a molcula do co-receptor (ver 1.2) os antagonistas dos co-recepto-
res. Estes frmacos tero a sua eficcia condicionada pelo tipo de co-recep-
tor, que a populao, maioritariamente, presente no indivduo infectado ser
capaz de usar19.
Esta fase inicial, que culmina com a integrao do ADN provrico no
genoma celular, tem como primeiros passos a ligao molcula CD4 e
molcula do co-receptor, que levam fuso do invlucro vrico com a
membrana citoplasmtica da clula-alvo.
Ciclo biolgico de VIH 19

1.1 Interaco com a molcula CD4


O primeiro passo do ciclo de replicao vrica a adsoro do vrus
clula-alvo (Fig. 4, passo I). A ligao de VIH (quer de VIH-1, de VIH-2,
quer, ainda, de vrus da imunodeficincia dos smios [VIS]) s clulas,
mediada por uma interaco entre a glicoprotena externa ou de SU (glico-
protena SU), presente no invlucro vrico, e a protena CD4, presente na
membrana citoplasmtica dos linfcitos T-auxiliadores e nos moncitos/
macrfagos20. A protena CD421 uma glicoprotena de 55 kDa, pertencen-
te superfamlia das imunoglobulinas, e, funcionalmente, intervm nas
interaces, que do incio activao das clulas T.
A presena da molcula CD4, identificada logo aps o isolamento de
VIH-1 como sendo o seu principal receptor22,23, apesar de necessria na
maioria do casos (as excepes sero focadas mais adiante), no , por si
s, suficiente para que a entrada do vrus e, consequentemente, para que a
infeco da clula ocorra24-27. A observao de que clulas no-humanas e,
mesmo, algumas linhas celulares humanas25, transfectadas com o gene CD4,
permitem a adsoro, mas no a infeco por VIH-1, apesar da expresso e
processamento normais da molcula CD424,26,27, levantou a hiptese de exis-
tirem outras protenas necessrias entrada do vrus na clula, que estariam
presentes em algumas clulas e ausentes noutras. Estes co-receptores foram
identificados como pertencentes famlia dos receptores das quimiocinas 28-30
e, actualmente, so 23 os que, in vitro, demonstraram ter actividade de co-
receptor, para a entrada de VIH-1 e de VIH-2 na clula4,31-33.

1.2 Interaco com os receptores das quimiocinas

De acordo com o modelo actualmente aceite34,35, VIH entra na clula atra-


vs da ligao inicial da glicoprotena SU, molcula CD4. Esta ligao
induz alteraes conformacionais na estrutura da SU, que permitem expor
ou formar o local de ligao molcula do co-receptor, que, por sua vez,
induz alteraes adicionais na estrutura da glicoprotena TM, conduzindo,
posteriormente, fuso com a membrana celular e entrada de VIH na
clula. Apesar da grande variedade de receptores das quimiocinas, que in
vitro parecem contribuir para a entrada de VIH na clula, in vivo somente
os receptores das quimiocinas CCR5 e CXCR4 parecem ser relevantes na
patognese da infeco por VIH33,36.
Vrios estudos, usando VIH-1, demonstraram, que a utilizao do co-recep-
tor CCR5 uma caracterstica comum das variantes vricas, presentes na fase
inicial e durante a fase assintomtica da infeco. As variantes com a capaci-
dade de utilizarem o co-receptor CXCR4, em alternativa ou adicionalmente ao
uso do CCR5, emergem nas fases mais avanadas da infeco e so predomi-
nantes em cerca de 40% dos indivduos infectados apresentando sintomatolo-
gia evidente37,38. Estas estirpes, utilizadoras do co-receptor CXCR4 (X4), esto,
normalmente, associadas a uma depleo mais acentuada dos linfcitos TCD4+
e a uma evoluo mais acelerada para a imunodeficincia39-43.
20 Jos Miguel Azevedo-Pereira

A capacidade de utilizao do co-receptor CCR5 uma caracterstica,


aparentemente, fundamental para a transmisso e para o estabelecimento da
infeco no novo hospedeiro por parte de VIH-1. Vrios estudos revelaram,
que as variantes utilizadoras do co-receptor CCR5 (estirpes R5) so encon-
tradas em circulao pouco tempo aps o contgio, o que sugere que estas
sero as estirpes, preferencialmente, transmitidas, mesmo quando no incu-
lo original predominem estirpes X444-46. De igual forma, sugestiva da im-
portncia das estirpes R5, na transmisso do VIH-1, o facto de indivdu-
os homozigticos, para uma forma delecionada do gene ccr5 (32ccr5),
apresentarem uma extraordinria resistncia infeco 47-50. As raras infec-
es, descritas nestes indivduos, parecem estar associadas transmisso de
estirpes X4, envolvendo a via de transmisso parentrica 51-55. Este conjunto
de dados realam o envolvimento directo e, aparentemente, crucial das es-
tirpes R5 na transmisso de VIH-1, pelo menos nas vias, que envolvem a
passagem de mucosas.
A importncia das estirpes R5, na patognese da infeco por VIH,
reforada pelo facto de que durante a fase assintomtica predomina este tipo
de variantes, na populao vrica, do indivduo infectado37,38. Este facto su-
gere, que sero estas estirpes as mais aptas a escapar ao controlo imunitrio
do hospedeiro e as que, por mecanismos directos ou indirectos, sero as
responsveis pela gradual depleo de linfcitos TCD4+ e pelo aparecimento
da imunodeficincia. Neste cenrio, as estirpes X4 emergem e, em alguns
casos, tornam-se predominantes, provavelmente como consequncia da j
debilitada capacidade de resposta imunitria do hospedeiro.

1.3 Entrada do vrus na clula

A entrada de VIH nas clulas um processo independente do pH e, con-


sensualmente, aceite que a via principal pela qual o vrus entra na clula
por fuso directa com a membrana celular (Fig. 4, passo II). Recentemen-
te, foi descrito um processo alternativo de entrada de VIH, envolvendo um
processo de endocitose56. Neste modelo, a fuso do invlucro vrico ocorre
no ao nvel da membrana citoplasmtica, mas sim num compartimento
endossomal, duma forma dependente da actividade de exciso vesicular, por
parte da dinamina. Esta forma de entrada vrica j tinha sido descrita para
outros vrus, bem como para VIH, em clulas da linhagem macrofgica 57.
Da interaco entre a glicoprotena externa do invlucro e o CD4 resul-
ta no s a fixao ou adsoro da partcula vrica clula, como possibi-
lita a induo de alteraes conformacionais na glicoprotena SU, que
contribuem para a formao ou exposio do stio de ligao ao receptor
das quimiocinas58 (Fig. 5).
As alteraes conformacionais na SU e na TM, induzidas pelas ligaes
aos receptores, conduzem dissociao da subunidade SU da subunidade TM,
e exposio do pptido de fuso (regio localizada na extremidade N-termi-
nal da glicoprotena TM), que vai mediar o processo de fuso do invlucro
vrico com a membrana da clula, permitindo a entrada do vrus na clula59.
Ciclo biolgico de VIH 21

SU

TM

Ligao Ligao ao Fuso com


ao CD4 co-receptor a clula

Figura 5. Esquema do processo de fuso de VIH com a clula-alvo (adaptado de Reeves


JD, et al.35).

1.3.1 Consequncias da interaco entre as glicoprotenas do


invlucro vrico e os receptores celulares
Como foi referido, a interaco entre as glicoprotenas do invlucro vrico e
os receptores celulares (CD4 e receptor das quimiocinas), permite a VIH
entrar na clula-alvo e, assim, dar incio ao respectivo ciclo replicativo. No
entanto e paralelamente, estas interaces desencadeiam um conjunto de
mecanismos de activao, que no seu conjunto alteram o meio intracelular,
favorecendo ou inibindo processos bioqumicos, necessrios aos passos in-
tracelulares do ciclo replicativo vrico.
A capacidade de usar o receptor das quimiocinas CCR5 parece ser fun-
damental para o sucesso de VIH, como agente patognico, protagonista
duma infeco crnica/persistente, capaz de conduzir imunodeficincia e
sida. Como j foi referido, em VIH-1, as estirpes R5 predominam duran-
te a fase assintomtica e em cerca de 60% dos indivduos nas fases termi-
nais da infeco40,42. Tambm, no estabelecimento de novas infeces por
VIH-1, as estirpes R5 parecem ser fundamentais. Qual a razo da impor-
tncia dessa utilizao? Uma das explicaes provveis a que se relacio-
na com o padro de expresso do CCR5 nas clulas sanguneas, em parti-
cular nos linfcitos. A expresso do CCR5 , particularmente, notria nos
linfcitos TCD4+ de memria (CD45RO) e muito baixa nos linfcitos TCD4+
nave (CD45RA)60, tendo os primeiros mostrado serem, altamente, suscep-
tveis infeco por VIH-161,62. Paralelamente, vrios estudos in vitro su-
gerem que o estado de activao das clulas parece ser um factor funda-
mental na infeco produtiva, por parte de VIH-163,64. significativo o
facto de a entrada de VIH-1 em linfcitos CD45RA necessitar duma acti-
vao celular posterior, sem a qual a infeco produtiva no ocorre 65. Ou
seja, a capacidade de utilizar o CCR5 permitir a VIH-1 infectar clulas
activadas, totalmente permissveis replicao vrica, e pode ser vista como
uma importante e mesmo crucial vantagem evolutiva.
Por outro lado, vrios trabalhos sugerem que a ligao da glicoprotena SU
de VIH-1, aos receptores das quimiocinas, desencadeia um conjunto de acti-
vaes intracelulares66-74, que so responsveis pela quimioatraco de linf-
citos CD4+ activados, para os locais de replicao vrica, ou pelo incremento
22 Jos Miguel Azevedo-Pereira

VIH-1

CD4 CXCR4/CCR5

Membrana
citoplasmtica

Transcrio Citoesqueleto
Migrao Apoptose
celular

Figura 6. Esquema dos processos de transduo de sinal, aps interaco das glicoprotenas
do invlucro vrico com os receptores das quimiocinas presentes na membrana da clula-
alvo (adaptado de Wu Y, et al.88).

da replicao vrica in vivo, atravs da modificao do estado de activao


das clulas-alvo. Embora esta sinalizao, atravs dos receptores das qui-
miocinas, no seja necessria para a sua funo como co-receptores 75-77,
parece contribuir, in vivo, para tornar as clulas permissveis concluso
do ciclo replicativo vrico e, eventualmente, podero ser responsveis por
algumas das respostas celulares aps infeco vrica (Fig. 6). Por exemplo,
sequncias especficas da glicoprotena SU parecem influenciar no s a
capacidade de fuso do invlucro vrico, mas, tambm, alguns eventos intra-
celulares do ciclo replicativo vrico, aps a entrada do vrus na clula 78.
A ligao da glicoprotena SU, aos receptores das quimiocinas, pode,
tambm, estar, potencialmente, ligada a vrios processos de sinalizao, que
induzam a activao de vias biossintticas intracelulares, que regulam a di-
viso celular, a sobrevivncia e a diferenciao celulares79-84. Alm disso, a
interaco das quimiocinas, com os respectivos receptores (e considerando
a glicoprotena SU de VIH como um ligando no-natural desses receptores),
demonstrou ser capaz de induzir alteraes na estrutura do cito-esqueleto 85.
Este facto, no caso de uma infeco por VIH, poder facilitar a transmisso
vrica entre clulas infectadas e no-infectadas, atravs das denominadas
sinapses vricas79,82, ou facilitando o transporte do complexo de pr-integra-
o da membrana at ao ncleo86,87.
Apesar da entrada de VIH em linfcitos e macrfagos primrios, atravs do
co-receptor CCR5, no depender de qualquer tipo de sinalizao membra-
nar89, e as mutaes no CCR5, que reduzem ou eliminam essas sinalizaes
no afectarem a actividade deste como co-receptor de VIH90,75-77, algumas
evidncias sugerem que a sinalizao intracelular, desencadeada aps ligao
da glicoprotena SU ao co-receptor CCR5, poder influenciar a eficincia
da infeco por VIH, em clulas primrias. Por um lado, a dessensibilizao
do CCR5 impede a entrada de isolados primrios R5 de VIH-1, apesar de
Ciclo biolgico de VIH 23

no perturbar a expresso deste co-receptor ou da molcula CD4 91,92. Por


outro lado, a capacidade de infeco dos macrfagos, por parte deste tipo de
isolados, correlaciona-se com a capacidade destes vrus induzirem a trans-
duo de sinal, em consequncia da interaco com o CCR5, sugerindo que
a activao via co-receptor essencial, para que a segunda fase do ciclo
replicativo seja levada a cabo, neste tipo de clulas 66.
Em concluso, embora em alguns casos controversos e, provavelmente,
especficos, de uma determinada variante vrico ou de um tipo de clula,
estes resultados indicam que a mera existncia dos receptores adequados,
ao nvel da membrana citoplasmtica, no suficiente, em algumas circuns-
tncias, para garantir uma infeco produtiva. Dito de outro modo, os dados
disponveis sugerem que a interaco das glicoprotenas do invlucro vrico
com os receptores celulares tm que permitir o processo de fuso e a en-
trada de VIH na clula-alvo e, simultaneamente, desencadear os vrios
processos bioqumicos intracelulares, que permitiro a persecuo e conclu-
so do ciclo replicativo vrico. Neste contexto, ser expectvel, que em al-
gumas circunstncias, dessas interaces iniciais vrus-clula, resulte a en-
trada de VIH, mas que, apesar disso, devido a uma sinalizao subptima,
o ciclo replicativo vrico aborte algures nalgum dos passos intracelulares, em
consequncia do estado fisiolgico da clula no permitir a sua concluso.

1.3.2 VIH-2 e o uso dos receptores celulares


Tal como j anteriormente apontado, relativamente a outras caractersticas,
tambm na forma como utilizam os receptores celulares, VIH-1 e VIH-2
diferem, substancialmente4. Assim, enquanto que em VIH-1 so raras as
descries de estirpes capazes de utilizarem com eficcia outros co-recep-
tores, para alm do CCR5 e CXCR4, em VIH-2 frequente a identificao
de estirpes com a capacidade de usarem outros co-receptores (CCR1, CCR2,
CCR3 ou CCR8, por exemplo), de uma forma to ou mais eficiente com
que utilizam o CCR5 ou o CXCR493-95. Esta maior promiscuidade, no uso
dos co-receptores, uma caracterstica, consistentemente, observada, princi-
palmente nas variantes vricas obtidas de doentes nas fases sintomticas da
infeco. Por outro lado, a entrada de VIH na clula, na ausncia do recep-
tor celular CD4, foi, exclusivamente, observada em estirpes primrias (estir-
pes obtidas, directamente, do indivduo infectado e somente propagadas em
linfcitos primrios humanos) de VIH-296. No caso de VIH-1, esta caracte-
rstica s foi descrita em estirpes extensivamente adaptadas replicao in
vitro em linhas celulares CD4-negativas97,98. Em ambos os casos, estas carac-
tersticas fenotpicas esto relacionadas com a estrutura conformacional das
glicoprotenas, constituintes do invlucro vrico, codificadas pelo gene env de
VIH99, sugerindo que essa estrutura diferente em VIH-1 e emVIH-2.
Para alm da maior promiscuidade, na utilizao dos receptores das
quimiocinas, e da possibilidade de entrada na clula-alvo duma forma in-
dependente da interaco com a molcula CD4, mais recentemente, em
consequncia de um estudo sobre as caractersticas das variantes de VIH-2,
24 Jos Miguel Azevedo-Pereira

obtidas de indivduos assintomticos, identificaram-se estirpes que, ao con-


trrio do descrito at ento, eram incapazes de infectar qualquer linha ce-
lular co-expressando a molcula CD4 e os vrios receptores das quimioci-
nas100, embora o fizessem em clulas mononucleadas do sangue perifrico
(CMSP) humanas. Alm disso, foi possvel demonstrar que estas estirpes
so resistentes a ligandos naturais e anticorpos monoclonais, dirigidos para
o CCR5 e CXCR4, sugerindo que so capazes de utilizar outras molculas
co-receptoras para entrarem nas CMSP, em alternativa aos j referidos CCR5
e CXCR4100. A partir dos resultados obtidos, colocou-se a hiptese de uma
infeco natural por VIH-2, na espcie humana, poder ocorrer com estirpes
que no usam, como co-receptores, as molculas CCR5 e CXCR4.
A forma como VIH-2 utiliza os receptores celulares, para infectar as
clulas, nomeadamente a entrada CD4-independente e o uso anormal dos
receptores das quimiocinas, como co-receptores, tm implicaes, potencial-
mente, importantes na patognese da infeco por VIH-2, podendo contribuir,
de uma forma relevante, para a menor virulncia in vivo, observada na
generalidade das infeces por VIH-24. Neste contexto, de realar breve-
mente dois aspectos relevantes. O primeiro tem a ver com a infeco CD4-
independente99,96, cujo mecanismo impe que o local de ligao ao
co-receptor j esteja, previamente, formado ou exposto antes da interaco
com o CD4. Este facto para alm de poder permitir a infeco de clulas
CD4-negativas, implica a exposio de eptopos, eventualmente, presentes
nesse local de interaco com o co-receptor, de importncia fulcral para a
infeco da clula; estes eptopos podero induzir a formao de anticorpos
neutralizantes, cuja presena poder explicar o longo perodo assintomtico,
observado nos indivduos infectados por VIH-2. O segundo aspecto prende-se
com o uso de diferentes co-receptores, em paralelo ou em alternativa ao
CCR5 e CXCR4. Este uso anormal dos co-receptores poder propiciar a
fuso do invlucro vrico com a membrana da clula, mas no ser suficien-
te para induzir a sinalizao necessria para desencadear os processos de
activao intracelulares, imprescindveis para a persecuo do ciclo replica-
tivo de VIH, com a produo de um menor nmero de partculas vricas 4.
Este facto poder contribuir para explicar, nomeadamente, as baixas cargas
vricas observadas nos indivduos infectados por VIH-2.
De igual forma, a identificao de estirpes com perfis pouco comuns de
utilizao dos receptores das quimiocinas , particularmente, importante no
actual contexto, em que novas molculas inibidoras da interaco de VIH
com os co-receptores os antagonistas do CCR5 constituem alternativas
teraputicas no tratamento da infeco por VIH.

1.4 Sntese do ADN vrico

As partculas vricas, imediatamente aps a entrada na clula, so, parcialmen-


te, descapsidadas (Fig. 4, passo III), formando um complexo nucleoprotei-
co101,102. A TR , ento, activada, iniciando a sntese do cADN (Fig. 4, passo
IV), a partir do primer tARNlys, que se encontra ligado ao ARN genmico
Ciclo biolgico de VIH 25

vrico, no local denominado primer binding site (PBS), localizado logo aps
o final do LTR 5.

1.5 Integrao do ADN vrico

O processo de integrao no ADN da clula hospedeira (Fig. 4, passo V)


tem por base o complexo nucleoproteico integrativo. Este complexo, situa-
do, inicialmente, no citoplasma, constitudo, presumivelmente, pelo ADN
vrico de dupla cadeia recm-sintetizado, a enzima integrase, a protena da
NC, algumas cpias da protena da MA e da protena Vpr. Este complexo
transportado at ao ncleo atravs das fibras de actina 87, cuja dinmica
de polimerizao activada, em consequncia da interaco das glicopro-
tenas do invlucro vrico com os receptores das quimiocinas (ver 1.3.1).
J no ncleo, o processo de integrao do ADN vrico, no ADN celular,
mediado pela enzima integrase e conduz formao do denominado ADN
provrico.

2 Fases tardias
Este conjunto de etapas do ciclo de replicao vrica, culminam com a
produo e libertao de vrus produzidos de novo. Estas etapas esto de-
pendentes do estado de activao da clula hospedeira, necessitando que a
clula esteja activada, para poderem ser desencadeadas. Este facto remete,
de novo, para as interaces iniciais entre VIH e os co-receptores celulares
(ver 1.3.1 e 1.3.2).

2.1 Expresso das protenas vricas

A expresso dos genes vricos requer a colaborao activa de elementos


activadores da clula hospedeira e das protenas reguladoras vricas Tat e
Rev. Da transcrio do ADN provrico (Fig. 4, passo VI) resulta a formao
de trs tipos de ARNm vricos:
1 O ARNm, totalmente, processado, que d origem s protenas Tat,
Rev e Nef. Este conjunto de ARN tem um tamanho que ronda as dois kb.
2 O ARNm, parcialmente processado, que origina a protena precur-
sora gp160, que, aps protelise, d origem s protenas do invlucro vri-
co. Estes ARN tm um peso de cerca de quatro kb.
3 O ARNm no processado, que origina a poliprotena precursora
p160Gag-Pol, a protena precursora p55Gag e do ARN genmico, que ser
integrado nas novas partculas vricas. Estes ARNs tm cerca de nove kb.
A transcrio vrica mediada pela regio promotora, existente no LTR
5, onde se ligam vrios factores de transcrio celulares, activadores desta
transcrio. Estes factores, de origem celular, so os responsveis pela ac-
tivao inicial do LTR de VIH, originando alguns transcritos completos, que
permitem a sntese da protena Tat. Esta interage com o elemento de res-
posta transativao (TAR), presente no LTR, aumentando, substancialmente,
26 Jos Miguel Azevedo-Pereira

os nveis e a eficincia de transcrio dos ARNm vricos. Para que estes


ARNm, em particular os no totalmente processados, possam sair do ncleo,
necessria a interveno da protena Rev. Esta liga-se s molculas de
ARN vrico, contendo sequncias intrnicas e transporta-as para fora do
ncleo, permitindo que estes ARNm possam ser traduzidos. A traduo das
protenas (Fig. 4, passo VII), codificadas por estes ARNm no, totalmente,
processados, est, assim, dependente dos nveis da protena Rev, sendo por
isso s, tardiamente, traduzidas. Neste grupo de protenas tardias incluem-se
as protenas estruturais, codificadas pelos genes gag e pol e pelas protenas
no estruturais Vif, Vpr, Vpx (s em VIH-2) e Vpu (s em VIH-1).

2.2 Morfognese, sada e maturao da partcula vrica

A morfognese e maturao da partcula vrica passa por vrias fases:


A partcula vrica formada ao nvel da membrana plasmtica, por
um processo de automontagem ordenada das poliprotenas precursoras das
protenas estruturais (Pr55Gag e Pr160Gag-Pol) juntamente com o ARN gen-
mico (Fig. 4, passo VIII).
Esta cpsula esfrica, de natureza ribonucleoproteica, rodeada por
uma bicamada lipdica, originada a partir da membrana celular, onde se
inserem, projectando-se, para o exterior, as espculas constitudas pelas
protenas do invlucro vrico103.
Sada por gemulao (Fig. 4, passo IX) do virio imaturo para o
espao extracelular.
A maturao da partcula vrica (Fig. 4, passo X) envolve a clivagem
proteoltica sequencial dos polipptidos precursores 104 Pr55Gag e Pr160Gag-Pol,
da qual resultam as quatro protenas principais, constituintes da NC vrica
p17 MA ou protena da MA, p24 CA ou protena da CA, p9 NC ou
protena da NC e p6 LI ou protena da ligao CA-invlucro 105.
Conclui-se, assim, o ciclo de replicao de VIH, com a produo de
partculas vricas capazes de infectarem novas clulas. Dados recentes in-
dicam que VIH, tal como o vrus do sarampo e o vrus influenza, sai da
clula infectada, em zonas especializadas da membrana citoplasmtica,
particularmente ricas em colesterol e glicolpidos (lipid rafts). Presumivel-
mente, a composio lipdica destas regies facilitar a morfognese e a
gemulao das novas partculas vrica106.

Bibliografia
1. Farnet CM, Haseltine WA. Determination of viral proteins present in the human immunodeficiency virus type
1 preintegration complex. J Virol. 1991;65:1910-5.
2. Sasaki H, Ozaki H, Karaki H, Nonomura Y. Actin filaments play an essential role for transport of nascent HIV-
1 proteins in host cells. Biochem Biophys Res Commun. 2004;316:588-93.
3. Chiu IM, Yaniv A, Dahlberg JE, et al. Nucleotide sequence evidence for relationship of AIDS retrovirus to
lentiviruses. Nature. 1985;317:366-8.
4. Samson M, Libert F, Doranz BJ, et al. Resistance to HIV-1 infection in caucasian individuals bearing mutant
alleles of the CCR-5 chemokine receptor gene. Nature. 1996;382:722-5.
5. Balotta C, Bagnarelli P, Violin M, et al. Homozygous delta 32 deletion of the CCR-5 chemokine receptor gene
in an HIV-1-infected patient. Aids. 1997;11:F67-71.
Ciclo biolgico de VIH 27

6. Roederer M, Raju PA, Mitra DK, Herzenberg LA. HIV does not replicate in naive CD4 T cells stimulated with
CD3/CD28. J Clin Invest. 1997;99:1555-64.
7. Michael NL, Nelson JA, Kewalramani VN, et al. Exclusive and persistent use of the entry coreceptor CXCR4 by
human immunodeficiency virus type 1 from a subject homozygous for CCR5 delta32. J Virol. 1998;72:6040-7.
8. Liska V, Spehner D, Mehtali M, Schmitt D, Kirn A, Aubertin AM. Localization of viral protein X in simian
immunodeficiency virus macaque strain and analysis of its packaging requirements. J Gen Virol. 1994;75(Pt
11):2955-62.
9. Berger EA, Murphy PM, Farber JM. Chemokine receptors as HIV-1 coreceptors: roles in viral entry, tropism,
and disease. Annu Rev Immunol. 1999;17:657-700.
10. Bukrinskaya A, Brichacek B, Mann A, Stevenson M. Establishment of a functional human immunodeficiency
virus type 1 (HIV- 1) reverse transcription complex involves the cytoskeleton. J Exp Med. 1998;188:2113-25.
11. Weiss R. Cellular receptors and viral glycoproteins involved in retrovirus entry. Em: Levy JA, ed. The Retro-
viridae. Nova Iorque: Plenum Press; 1993. p. 1-108.
12. Alkhatib G, Locati M, Kennedy PE, Murphy PM, Berger EA. HIV-1 coreceptor activity of CCR5 and its inhibition
by chemokines: independence from G protein signaling and importance of coreceptor downmodulation. Virology.
1997;234:340-8.
13. Tsibris AM, Kuritzkes DR. Chemokine antagonists as therapeutics: focus on HIV-1. Annu Rev Med. 2007;58:445-59.
14. Erblom HR. Assembly and morphology of HIV: potential effect of structure on viral function. Aids. 1991;5:617-37.
15. Del Corno M, Liu QH, Schols D, et al. HIV-1 gp120 and chemokine activation of Pyk2 and mitogen-activat-
ed protein kinases in primary macrophages mediated by calcium-dependent, pertussis toxin-insensitive
chemokine receptor signaling. Blood. 2001;98:2909-16.
16. Davis CB, Dikic I, Unutmaz D, et al. Signal transduction due to HIV-1 envelope interactions with chemokine
receptors CXCR4 or CCR5. J Exp Med. 1997;186:1793-8.
17. Erblom HR, Hausmann EH, Ozel M, Pauli G, Koch MA. Fine structure of human immunodeficiency virus (HIV)
and immunolocalization of structural proteins. Virology. 1987;156:171-6.
18. Deng H, Liu R, Ellmeier W, et al. Identification of a major co-receptor for primary isolates of HIV-1. Nature.
1996;381:661-6.
19. Iyengar S, Hildreth JE, Schwartz DH. Actin-dependent receptor colocalization required for human immunodefi-
ciency virus entry into host cells. J Virol. 1998;72:5251-5.
20. Weissman D, Rabin RL, Arthos J, et al. Macrophage-tropic HIV and SIV envelope proteins induce a signal
through the CCR5 chemokine receptor. Nature. 1997; 389:981-5.
21. Hunter E. Macromolecular interactions in the assembly of HIV and other retroviruses. Seminars in Virology.
1994;5:71-83.
22. Clapham PR, McKnight A. Cell surface receptors, virus entry and tropism of primate lentiviruses. J Gen Virol.
2002;83:1809-29.
23. Simmons G, Reeves JD, Hibbitts S, et al. Co-receptor use by HIV and inhibition of HIV infection by chemokine
receptor ligands. Immunol Rev. 2000;177:112-26.
24. Mummidi S, Ahuja SS, Gonzalez E, et al. Genealogy of the CCR5 locus and chemokine system gene variants
associated with altered rates of HIV-1 disease progression. Nat Med. 1998;4:786-93.
25. Brasseur R, Cornet B, Burny A, Vandenbranden M, Ruysschaert JM. Mode of insertion into a lipid membrane
of the N-terminal HIV gp41 peptide segment. AIDS Res Hum Retroviruses. 1988;4:83-90.
26. Liu QH, Williams DA, McManus C, et al. HIV-1 gp120 and chemokines activate ion channels in primary mac-
rophages through CCR5 and CXCR4 stimulation. Proc Natl Acad Sci USA. 2000;97:4832-7.
27. Capon DJ, Ward RH. The CD4-gp120 interaction and AIDS pathogenesis. Annu Rev Immunol. 1991;9:649-78.
28. Aloia RC, Tian H, Jensen FC. Lipid composition and fluidity of the human immunodeficiency virus envelope
and host cell plasma membranes. Proc Natl Acad Sci USA. 1993;90:5181-5.
29. Liu R, Paxton WA, Choe S, et al. Homozygous defect in HIV-1 coreceptor accounts for resistance of some mul-
tiply-exposed individuals to HIV-1 infection. Cell. 1996;86:367-77.
30. Chackerian B, Long EM, Luciw PA, Overbaugh J. Human immunodeficiency virus type 1 coreceptors participate
in postentry stages in the virus replication cycle and function in simian immunodeficiency virus infection. J
Virol. 1997;71:3932-9.
31. Cornelissen M, Mulder-Kampinga G, Veenstra J, et al. Syncytium-inducing (SI) phenotype suppression at sero-
conversion after intramuscular inoculation of a non-syncytium-inducing/SI phenotypically mixed human immu-
nodeficiency virus population. J Virol. 1995;69:1810-8.
32. Dikic I, Tokiwa G, Lev S, Courtneidge SA, Schlessinger J. A role for Pyk2 and Src in linking G-protein-coupled
receptors with MAP kinase activation. Nature. 1996; 383:547-50.
33. Doms RW, Moore JP. HIV-1 membrane fusion: targets of opportunity. J Cell Biol. 2000;151:F9-14.
34. Farzan M, Choe H, Martin KA, et al. HIV-1 entry and macrophage inflammatory protein-1beta-mediated signal-
ing are independent functions of the chemokine receptor CCR5. J Biol Chem. 1997;272:6854-7.
35. Alkhatib G, Combadiere C, Broder CC, et al. CC CKR5: a RANTES, MIP-1alpha, MIP-1beta receptor as a
fusion cofactor for macrophage-tropic HIV-1. Science. 1996; 272:1955-8.
36. Broder CC, Jones-Trower A. Coreceptor use by primate Lentiviruses. Theoretical Biology and Biophysics Group.
Los Alamos, NM: Los Alamos National Laboratory; 1999.
37. Maddon PJ, Dalgleish AG, McDougal JS, Clapham PR, Weiss RA, Axel R. The T4 gene encodes the AIDS
virus receptor and is expressed in the immune system and the brain. Cell. 1986;47:333-48.
38. Fortin JF, Cantin R, Lamontagne G, Tremblay M. Host-derived ICAM-1 glycoproteins incorporated on human
immunodeficiency virus type 1 are biologically active and enhance viral infectivity. J Virol. 1997;71:3588-96.
39. Murphy PM. Chemokine receptors: structure, function and role in microbial pathogenesis. Cytokine Growth Factor
Rev. 1996;7:47-64.
40. Cicala C, Arthos J, Ruiz M, et al. Induction of phosphorylation and intracellular association of CC chemokine
receptor 5 and focal adhesion kinase in primary human CD4+ T cells by macrophage-tropic HIV envelope. J
Immunol. 1999;163:420-6.
28 Jos Miguel Azevedo-Pereira

41. Nguyen DH, Hildreth JE. Evidence for budding of human immunodeficiency virus type 1 selectively from glycolip-
id-enriched membrane lipid rafts. J Virol. 2000;74:3264-72.
42. Hoglund S, Ofverstedt LG, Nilsson A, et al. Spatial visualization of the maturing HIV-1 core and its linkage to
the envelope. AIDS Res Hum Retroviruses. 1992;8:1-7.
43. Thali M, Bukovsky A, Kondo E, et al. Functional association of cyclophilin A with HIV-1 virions. Nature.
1994;372:363-5.
44. Woods TC, Roberts BD, Butera ST, Folks TM. Loss of inducible virus in CD45RA naive cells after human
immunodeficiency virus-1 entry accounts for preferential viral replication in CD45RO memory cells. Blood.
1997;89:1635-41.
45. Misse D, Cerutti M, Noraz N, et al. A CD4-independent interaction of human immunodeficiency virus-1 gp120
with CXCR4 induces their cointernalization, cell signaling, and T-cell chemotaxis. Blood. 1999;93:2454-62.
46. Clapham PR, Blanc D, Weiss RA. Specific cell surface requirements for the infection of CD4-positive cells by hu-
man immunodeficiency virus types 1 and 2 and by Simian immunodeficiency virus. Virology. 1991;181:703-15.
47. Biti R, French R, Young J, Bennetts B, Stewart G, Liang T. HIV-1 infection in an individual homozygous for
the CCR5 deletion allele. Nat Med. 1997;3:252-3.
48. Bjorndal A, Deng H, Jansson M, et al. Coreceptor usage of primary human immunodeficiency virus type 1
isolates varies according to biological phenotype. J Virol. 1997;71:7478-87.
49. Azevedo-Pereira JM, Santos-Costa Q, Moniz-Pereira J. HIV-2 infection and chemokine receptors usage - clues
to reduced virulence of HIV-2. Curr HIV Res. 2005;3:3-16.
50. Aramori I, Ferguson SS, Bieniasz PD, Zhang J, Cullen B, Cullen MG. Molecular mechanism of desensitization
of the chemokine receptor CCR-5: receptor signaling and internalization are dissociable from its role as an HIV-
1 co-receptor. EMBO J. 1997;16:4606-16.
51. Wu Y, Yoder A. Chemokine coreceptor signaling in HIV-1 infection and pathogenesis. PLoS Pathog. 2009;5:e1000520.
52. Arthur LO, Bess JW Jr., Sowder RC, et al. Cellular proteins bound to immunodeficiency viruses: implications
for pathogenesis and vaccines. Science. 1992;258:1935-8.
53. Miyauchi K, Kim Y, Latinovic O, Morozov V, Melikyan GB. HIV enters cells via endocytosis and dynamin-
dependent fusion with endosomes. Cell. 2009;137:433-44.
54. Simmons G, Wilkinson D, Reeves JD, et al. Primary, syncytium-inducing human immunodeficiency virus type
1 isolates are dual-tropic and most can use either Lestr or CCR5 as coreceptors for virus entry. J Virol. 1996;
70:8355-60.
55. Shimizu N, Tanaka A, Oue A, et al. Broad usage spectrum of G protein-coupled receptors as coreceptors by
primary isolates of HIV. AIDS. 2009;27:761-9.
56. Berger EA, Doms RW, Fenyo EM, et al. A new classification for HIV-1. Nature. 1998;391:240.
57. Tokiwa G, Dikic I, Lev S, Schlessinger J. Activation of Pyk2 by stress signals and coupling with JNK signaling
pathway. Science. 1996;273:792-4.
58. Zhang YJ, Dragic T, Cao Y, et al. Use of coreceptors other than CCR5 by non-syncytium-inducing adult and
pediatric isolates of human immunodeficiency virus type 1 is rare in vitro. J Virol. 1998;72:9337-44.
59. Arthos J, Rubbert A, Rabin RL, et al. CCR5 signal transduction in macrophages by human immunodeficiency
virus and simian immunodeficiency virus envelopes. J Virol. 2000;74:6418-24.
60. OBrien TR, Winkler C, Dean M, et al. HIV-1 infection in a man homozygous for CCR5 delta 32. Lancet.
1997;349:1219.
61. Bron R, Klasse PJ, Wilkinson D, et al. Promiscuous use of CC and CXC chemokine receptors in cell-to-cell
fusion mediated by a human immunodeficiency virus type 2 envelope protein. J Virol. 1997;71:8405-15.
62. Ashorn PA, Berger EA, Moss B. Human immunodeficiency virus envelope glycoprotein/CD4-mediated fusion
of nonprimate cells with human cells. J Virol. 1990;64:2149-56.
63. Markovitz DM, Smith MJ, Hilfinger J, Hannibal MC, Petryniak B, Nabel GJ. Activation of the human immu-
nodeficiency virus type 2 enhancer is dependent on purine box and kappa B regulatory elements. J Virol.
1992;66:5479-84.
64. Ostrowski MA, Krakauer DC, Li Y, et al. Effect of immune activation on the dynamics of human immunodefi-
ciency virus replication and on the distribution of viral quasispecies. J Virol. 1998;72:7772-84.
65. Albert J, Fiore J, Fenyo EM, et al. Biological phenotype of HIV-1 and transmission. AIDS. 1995;9:822-3.
66. Azevedo-Pereira JM, Santos-Costa Q, Mansinho K, Moniz-Pereira J. Identification and characterization of HIV-
2 strains obtained from asymptomatic patients that do not use CCR5 or CXCR4 coreceptors. Virology.
2003;313:136-46.
67. Marlink R, Kanki P, Thior I, et al. Reduced rate of disease development after HIV-2 infection as compared to
HIV-1. Science. 1994;265:1587-90.
68. Fortin JF, Cantin R, Tremblay MJ. T cells expressing activated LFA-1 are more susceptible to infection with
human immunodeficiency virus type 1 particles bearing host-encoded ICAM-1. J Virol. 1998;72:2105-12.
69. Chesebro B, Buller R, Portis J, Wehrly K. Failure of human immunodeficiency virus entry and infection in CD4-
positive human brain and skin cells. J Virol. 1990;64:215-21.
70. Amara A, Vidy A, Boulla G, et al. G protein-dependent CCR5 signaling is not required for efficient infection
of primary T lymphocytes and macrophages by R5 human immunodeficiency virus type 1 isolates. J Virol.
2003;77:2550-8.
71. Alfano M, Schmidtmayerova H, Amella CA, Pushkarsky T, Bukrinsky M. The B-oligomer of pertussis
toxin deactivates CC chemokine receptor 5 and blocks entry of M-tropic HIV-1 strains. J Exp Med. 1999;
190:597-605.
72. Hoffman TL, LaBranche CC, Zhang W, et al. Stable exposure of the coreceptor-binding site in a CD4-indepen-
dent HIV-1 envelope protein. Proc Natl Acad Sci USA. 1999;96:6359-64.
73. Spina CA, Prince HE, Richman DD. Preferential replication of HIV-1 in the CD45RO memory cell subset of
primary CD4 lymphocytes in vitro. J Clin Invest. 1997;99:1774-85.
74. Gosling J, Monteclaro FS, Atchison RE, et al. Molecular uncoupling of C-C chemokine receptor 5-induced
chemotaxis and signal transduction from HIV-1 coreceptor activity. Proc Natl Acad Sci USA. 1997;94:5061-6.
Ciclo biolgico de VIH 29

75. Guillon C, van der Ende ME, Boers PH, Gruters RA, Schutten M, Osterhaus AD. Coreceptor usage of human
immunodeficiency virus type 2 primary isolates and biological clones is broad and does not correlate with their
syncytium-inducing capacities. J Virol. 1998;72:6260-3.
76. Marsh M, Pelchen-Matthews A. Endocytosis in viral replication. Traffic. 2000;1:525-32.
77. Hallenberger S, Bosch V, Angliker H, Shaw E, Klenk HD, Garten W. Inhibition of furin-mediated cleavage activa-
tion of HIV-1 glycoprotein gp160. Nature. 1992;360:358-61.
78. Mori K, Ringler DJ, Desrosiers RC. Restricted replication of simian immunodeficiency virus strain 239 in mac-
rophages is determined by env but is not due to restricted entry. J Virol. 1993;67:2807-14.
79. Franke EK, Yuan HE, Luban J. Specific incorporation of cyclophilin A into HIV-1 virions. Nature. 1994;372:359-62.
80. Popik W, Pitha PM. Exploitation of cellular signaling by HIV-1: unwelcome guests with master keys that signal
their entry. Virology. 2000;276:1-6.
81. Zhu T, Mo H, Wang N, et al. Genotypic and phenotypic characterization of HIV-1 patients with primary infec-
tion. Science. 1993;261:1179-81.
82. Guntermann C, Murphy BJ, Zheng R, Qureshi A, Eagles PA, Nye KE. Human immunodeficiency virus-1 infection
requires pertussis toxin sensitive G-protein-coupled signalling and mediates cAMP downregulation. Biochem Bio-
phys Res Commun. 1999;256:429-35.
83. Lee C, Liu QH, Tomkowicz B, Yi Y, Freedman BD, Collman RG. Macrophage activation through CCR5- and
CXCR4-mediated gp120-elicited signaling pathways. J Leukoc Biol. 2003;74:676-82.
84. Yoder A, Yu D, Dong L, et al. HIV envelope-CXCR4 signaling activates cofilin to overcome cortical actin re-
striction in resting CD4 T cells. Cell. 2008;134:782-92.
85. McKnight A, Dittmar MT, Moniz-Pereira J, et al. A broad range of chemokine receptors are used by primary
isolates of human immunodeficiency virus type 2 as coreceptors with CD4. J Virol. 1998;72:4065-71.
86. CVEDT. Infeco VIH/SIDA - A situao em Portugal. Doc. 137. Instituto Nacional de Sade Dr. Ricardo Jorge.
31 de Dezembro de 2006.
87. Stevenson M, Stanwick TL, Dempsey MP, Lamonica CA. HIV-1 replication is controlled at the level of T cell
activation and proviral integration. EMBO J. 1990;9:1551-60.
88. Dumonceaux J, Nisole S, Chanel C, et al. Spontaneous mutations in the env gene of the human immunodefi-
ciency virus type 1 NDK isolate are associated with a CD4-independent entry phenotype. J Virol. 1998;72:512-9.
89. Klatzmann D, Champagne E, Chamaret S, et al. T-lymphocyte T4 molecule behaves as the receptor for human
retrovirus LAV. Nature. 1984;312:767-8.
90. Frankel AD, Young JA. HIV-1: fifteen proteins and an RNA. Annu Rev Biochem. 1998;67:1-25.
91. Reeves JD, Doms RW. Human immunodeficiency virus type 2. J Gen Virol. 2002;83:1253-65.
92. Connor RI, Ho DD. Human immunodeficiency virus type 1 variants with increased replicative capacity develop
during the asymptomatic stage before disease progression. J Virol. 1994;68:4400-8.
93. Connor RI, Sheridan KE, Ceradini D, Choe S, Landau NR. Change in coreceptor use coreceptor use correlates
with disease progression in HIV-1-infected individuals. J Exp Med. 1997;185:621-8.
94. Dean M, Carrington M, Winkler C, et al. Genetic restriction of HIV-1 infection and progression to AIDS by a dele-
tion allele of the CKR5 structural gene. Hemophilia Growth and Development Study, Multicenter AIDS Cohort Study,
Multicenter Hemophilia Cohort Study, San Francisco City Cohort, ALIVE Study. Science. 1996;273:1856-62.
95. Layne SP, Merges MJ, Dembo M, et al. Factors underlying spontaneous inactivation and susceptibility to neu-
tralization of human immunodeficiency virus. Virology. 1992; 189:695-714.
96. Lev S, Moreno H, Martinez R, et al. Protein tyrosine kinase PYK2 involved in Ca(2+)-induced regulation of ion
channel and MAP kinase functions. Nature. 1995;376:737-45.
97. Azevedo-Pereira JM, Santos-Costa Q, Taveira N, Verissimo F, Moniz-Pereira J. Construction and characterization
of CD4-independent infectious recombinant HIV-2 molecular clones. Virus Res. 2003;97:159-63.
98. Pettit SC, Moody MD, Wehbie RS, et al. The p2 domain of human immunodeficiency virus type 1 Gag regulates
sequential proteolytic processing and is required to produce fully infectious virions. J Virol. 1994;68:8017-27.
99. Bleul CC, Wu L, Hoxie JA, Springer TA, Mackay CR. The HIV coreceptors CXCR4 and CCR5 are differen-
tially expressed and regulated on human T lymphocytes. Proc Natl Acad Sci USA. 1997;94:1925-30.
100. Bowerman B, Brown PO, Bishop JM, Varmus HE. A nucleoprotein complex mediates the integration of retrovi-
ral DNA. Genes Dev. 1989;3:469-78.
101. M ichael NL, Louie LG, Sheppard HW. CCR5-delta 32 gene deletion in HIV-1 infected patients. Lancet.
1997;350:741-2.
102. Levy JA. HIV and the Pathogenesis of AIDS. Washington: ASM Press; 1998.
103. Richman DD, Bozzette SA. The impact of the syncytium-inducing phenotype of human immunodeficiency virus
on disease progression. J Infect Dis. 1994;169:968-74.
104. Reeves JD, Hibbitts S, Simmons G, et al. Primary human immunodeficiency virus type 2 (HIV-2) isolates infect
CD4-negative cells via CCR5 and CXCR4: comparison with HIV-1 and simian immunodeficiency virus and
relevance to cell tropism in vivo. J Virol. 1999;73:7795-804.
105. Dalgleish AG, Beverley PC, Clapham PR, Crawford DH, Greaves MF, Weiss RA. The CD4 (T4) antigen is an
essential component of the receptor for the AIDS retrovirus. Nature. 1984;312:763-7.
106. Feng Y, Broder CC, Kennedy PE, Berger EA. HIV-1 entry cofactor: functional cDNA cloning of a seven-trans-
membrane, G protein-coupled receptor. Science. 1996;272:872-7.
I Seco
Captulo 3

Biologia molecular de VIH


Nuno Taveira, Pedro Borrego, Ins Brtolo

Introduo

VIH-1 e VIH-2 so lentivrus humanos, com cerca de 40-50% de homolo-


gia gentica. Possuem um invlucro de natureza glucdico-lipdico-proteica
e um dimetro de cerca de 110 nm1. Os seus viries albergam duas cpias
idnticas de genoma ARN de polaridade positiva (ARNm), com cerca de
10 kb de comprimento, localizadas no interior de uma cpside (CA), com
morfologia cnica. No genoma de VIH-1 h trs genes, que codificam para
as protenas estruturais Gag, Pol e Env, dois genes que codificam para as
protenas regulatrias Tat e Rev, e quatro genes que codificam para as pro-
tenas acessrias Nef, Vif, Vpr e Vpu (Fig. 1). Em VIH-2 o gene vpx subs-
titui o vpu de VIH-1. O gene gag codifica para uma poliprotena precurso-
ra, Pr55Gag, que processada pela protease vrica (PR), gerando-se as
protenas da matriz (MA), CA, nucleocpside (NC) e p6. So ainda gerados
dois pptidos espaadores p1 e p2. O gene pol codifica para uma polipro-
tena precursora, Pr160gagpol, cuja sntese resulta de uma mudana de fase
de leitura durante a traduo da Pr55gag. A PR, a transcriptase reversa (TR),
a ARNase H e a integrase (IN) so obtidas por processamento proteoltico
da Pr160gagpol pela PR vrica. O gene env codifica para uma poliprotena
precursora glicosilada, com cerca de 160 kDa de peso molecular, que
cortada por uma protease celular e d origem glicoprotena de superfcie
(SU) com cerca de 120 kDa, gp120, e glicoprotena transmembranar (TM),
com cerca de 41 kDa, gp41. Estas duas glicoprotenas assumem uma con-
formao estrutural complexa e associam-se entre si de forma no covalen-
te formando o invlucro vrico (Figs. 1 A e B). No virio maduro as gli-
coprotenas do invlucro formam trmeros. Dados recentes indicam que o
32 Nuno Taveira, Pedro Borrego, Ins Brtolo

A
0 1.000 2.000 3.000 4.000 5.000 6.000 7.000 8.000 9.000 10.000

VIH-1
5LTR p15 vpu, p16 env 3 LTR
gag p23 vpr SU, gp120 TM, gp41
MA CA NC p6 vif rev p19 rev
pol
p17 p24 p7
U3 RU S PR RT IN tat p14 tat nef
p2 p1
p15 p51/66 p31 p27

VIH-2
5LTR vpr env 3LTR
gag vpx SU TM
MA CA NC vif rev rev
pol
U3 RU S tat tat nef
PR RT IN

SU, gp120

TM, gp41

CA, p24
RT, p66/p51
Genoma vrico ARN

PR, p15 NC, p7

IN, p31

MA, p17

Figura 1. A organizao dos genomas provricos de VIH-1 e VIH-2. Localizaes relativas dos
genes gag, pol, env, vif, vpr, vpu (VIH-1), vpx (VIH-2), nef, tat e rev e indicao dos LTR em 5
e 3 e das suas regies U3, R e U5. No gene gag so indicadas as protenas por ele codificadas,
a MA, CA e NC. No gene pol esto indicadas as regies que codificam para a PR, a TR (com
os subdomnios p66 e p51) e a IN. Apresenta-se ainda a localizao do sinal de encapsidao
() do genoma ARN vrico. B composio proteica dos viries de VIH-1.
Biologia molecular de VIH 33

gp120 V4 V5 PF HR1 HR2 TM gp41


Regio intra-
C1 V1/V2 C2 V3 C3 C4 C5 citoplasmtica
1 862
508
C

320(25)

330(35)
306(11)
296(1)

CONS. VIH-1 : CTRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHC N


VIH-1A1 : ................................ .
VIH-1B : . . . . . . . . . . . .H. . . . R . . . . T. . .E. . . . . . . . . .
VIH-1C : . . . . . . . . . . . . . . . . . T. . . . . . . . . . . . . . . .
VIH-1D : ....Y . . . . . QRTP
. . . . . . . . . L. . T. . R
. . . K. . . . . . . .
VIH-1F1 : . . . . . . . . . . . .H. . . . . . . . . . . E. . . . . . K. . . .
VIH-1G : . . . . .S . . . . T. . .T. . . . . V. . . R. . . . . . . . . K. . Y. .
CBF01_AE : . . . . . . . . . . . . . . . . . T. . . . . . . . . . . . . . . .
CBF02_AG : . . . . . . . . . .R. .T. . . . RVL
. . . . T. . .Q. . . . . . K. . . .
CBF14_BG : ................................ .

306
320

V3

Figura 2. Representao esquemtica das diferentes regies estruturais das glicoprotenas


gp120 e gp41 do invlucro de VIH-1. Na gp120 so indicadas a localizao das regies
conservadas (C1-C5) e variveis (V1-V5). Na gp41 so indicadas a localizao do pptido de
fuso (PF), das hlices HR1 e HR2, da regio TM e da regio intracitoplasmtica. A regio
V3 de vrios subtipos e recombinantes apresentada em alinhamento de aminocidos de
forma a salientar a sua variabilidade. Os aminocidos 306 (resduo 11, a contar da cistena
inicial) e 320 (25), envolvidos na ligao aos co-receptores CCR5 e CXCR4, esto indicados
a cinzento no alinhamento. Estes dois aminocidos esto localizados em lados opostos da ansa
inter-cistenico formado pela V3, tal como est indicado no diagrama da estrutura molecular
da gp120. Este diagrama foi produzido a partir da gp120 do isolado VIH-1JR-FL 8.

invlucro das partculas vricas infecciosas pode ser formado por um n-


mero muito varivel (entre 10-100) destes complexos trimricos 1.

Mecanismos moleculares de entrada de VIH nas clulas


Organizao e estrutura molecular do invlucro
A gp120 composta por cinco regies hipervariveis, V1 a V5, separadas
por cinco regies conservadas, C1 a C5 (Fig. 2). Na protena nativa, estas
regies formam trs domnios moleculares e estruturais, isto um domnio
externo muito glicosilado (aminocidos 252-482, em VIH-1 HXB2), um
domnio interno e um minidomnio de unio, que liga os domnios externo
e interno (Fig. 3)2-4. Em termos funcionais, o domnio externo da gp120
participa na ligao ao receptor CD4 e aos co-receptores CCR5 e/ou CXCR4.
34 Nuno Taveira, Pedro Borrego, Ins Brtolo

Domnio Domnio
interno externo
Regio de ligao
gp41

V5

V4

V1/V2 Base da V3

Domnio
de ligao

Figura 3. Diagrama da estrutura molecular da gp120. Esta estrutura foi obtida por crista-
lizao da gp120 do isolado VIH-1HXB2, em associao com o CD4 e com um anticorpo
neutralizante. Esto indicados os domnios internos, externo e de ligao (tracejado), as
regies variveis V1-V5, o local de ligao gp41 e as regies descontnuas de ligao ao
CD4 e ao CCR5 (adaptado de Wyatt, et al.5).

Este domnio contm, ainda, a maior parte dos determinantes antignicos


da gp120, incluindo os eptopos neutralizantes5,6. O domnio interno fun-
damental para a associao da gp120 gp41.
A glicoprotena gp41 tem cerca de 350 aminocidos (Fig. 2), sendo
constituda por uma regio extracelular com 165-172 aminocidos, uma
regio de insero na membrana citoplasmtica (regio TM) de 21-23 ami-
nocidos e uma regio intracitoplasmtica com 152-158 aminocidos. Na
regio extracelular existe uma regio hidrofbica N-terminal, o pptido de
fuso, e duas hlices heptad repeat 1 (HR1) e heptad repeat 2 (HR2),
contendo motivos fecho de leucina (leucine zipper), que so essenciais para
a fuso do vrus com a membrana citoplasmtica celular. A regio extrace-
lular da gp41 contm um eptopo antignico imunodominante (posio 601
a 609, em VIH-1 estirpe HXB2), localizado logo aps a HR1, que induz
forte produo de anticorpos, por parte do hospedeiro 6. Estes anticorpos so
importantes para o diagnstico laboratorial da infeco por VIH. A regio
intracitoplasmtica da gp41 tem um papel determinante na ligao do inv-
lucro protena de MA, necessria para a formao de novos viries.
Biologia molecular de VIH 35

Mecanismos moleculares de interaco de VIH com a clula hospedeira

A entrada de VIH nas clulas requer trs passos, que ocorrem superfcie
das clulas e que so mediados pelas glicoprotenas do invlucro, isto ,
ligao da gp120 ao receptor CD4, ligao da gp120 aos co-receptores
celulares CCR5 e CXCR4 e fuso do invlucro vrico com a membrana
citoplasmtica.
A protena CD4 uma glicoprotena TN de 58 kDa. A sua regio ex-
tracelular, com 370 aminocidos, composta por quatro domnios, desig-
nados D1 a D4. O domnio D1 pode ser dividido nas sub-regies CDR1,
CDR2 e CDR3. A sub-regio CDR2 est envolvida na ligao gp120.
In vivo, os dois co-receptores fundamentais para a entrada de VIH nas
clulas so o CCR5 e o CXCR4, protenas com sete regies TM, que so
receptores naturais das quimiocinas e 7. O CCR5 uma protena ex-
pressa em clulas T de memria, clulas T activadas e macrfagos e tem
20-50 vezes maior afinidade para a gp120 do que o CXCR4. As regies do
CCR5, envolvidas na interaco com a regio V3 da gp120, so, primeiro,
as tirosinas sulfatadas da regio NH2-terminal (resduos 3, 10, 14 e 15) e,
segundo, a ansa (loop) extracelular 2 (ECL2)8. Esta segunda interaco
essencial para que se d a subsequente entrada de VIH nas clulas. O ma-
raviroc uma molcula que se liga ao CCR5 e inibe, de forma no com-
petitiva, a ligao da gp120 ao CCR59.
O domnio externo da gp120 responsvel pela interaco inicial de
VIH com vrias molculas de CD4 celular. Esta interaco meta-estvel
desencadeia alteraes conformacionais no domnio interno da gp120, a
mais importante das quais envolve a formao do domnio de ligao e o
reforo da ligao da gp120 ao CD4 (Fig. 3)10. A ligao da gp120 ao CD4
desencadeia, tambm, a exposio da regio V3 e a sua projeco em di-
reco membrana citoplasmtica celular8. A regio hipervarivel V3
formada por 31-39 aminocidos, delimitados por duas cistenas, envolvidas
em pontes dissulfureto (Fig. 2). Nos indivduos infectados por VIH-1, a
regio V3 imunodominante e induz a formao de anticorpos neutralizan-
tes e no neutralizantes11. A carga global da V3, bem como o tipo de ami-
nocidos existentes nas posies 11 e 25, esto, directamente, envolvidos
na interaco da gp120 com o CCR5 e CXCR4 e determinam, por essa via,
o tropismo de VIH (Fig. 2). Quando estes dois aminocidos possuem carga
positiva (R ou K), os vrus usam, em geral, o CXCR4 para entrar nas c-
lulas. Em caso contrrio usam o CCR512-14. As regies C3, C4, V4-V5
possuem os determinantes moleculares para a utilizao do co-receptor
CCR315,16.
Para que VIH entre, finalmente, nas clulas necessrio que ocorra
a fuso entre o invlucro e a membrana citoplasmtica. O desencadear
da fuso requer a exposio e insero do pptido de fuso da gp41 na
membrana citoplasmtica, seguido do emparelhamento antiparalelo das
hlices HR1 e HR2. Estes dois fenmenos ocorrem, somente, aps a
ligao da gp120 ao CD4 e co-receptores. Gera-se uma conformao
36 Nuno Taveira, Pedro Borrego, Ins Brtolo

retrctil e muito estvel da gp41, que essencial para a formao do


poro de fuso e a entrada do vrus na clula. possvel bloquear a fu-
so vrica, atravs de pptidos, que se ligam ao pptido de fuso ou s
hlices HR1 e HR2 17. O VIRIP um exemplo recente de um pptido
antivrico que se liga ao pptido de fuso 18. O T20 um exemplo de
pptido antivrico, que se liga HR1 e que est em uso clnico sob a
designao de enfuvirtida 19,20.

Transcrio reversa e produo do ADN provrico


Aps a fuso entre o invlucro da partcula vrico e a membrana cito-
plasmtica, a CA vrica entra no citoplasma da clula hospedeira. No
citoplasma ocorre o processo de descapsidao, o qual pode ser impedi-
do pela protena TRIM5-, e forma-se, primeiro, o complexo de trans-
crio reversa, onde ocorre a reaco com o mesmo nome, e, depois, o
complexo de pr-integrao (PIC). O PIC um complexo ribonucleoprotei-
co, que possui o genoma ADN e as protenas MA, NC, IN, TR, Vpr e Vpx,
em VIH-221,22.
A transcrio reversa ou converso de ARN vrico em ADN provrico,
em dupla cadeia, efectuada pela enzima TR, um heterodmero, com uma
subunidade com 66 kDa (p66) e outra com 51 kDa (p51). Estas duas subu-
nidades derivam da mesma regio da protena precursora Pr160 gagpol e a p51
formada quando a extremidade C-terminal da p66 (ARNase H, 15kDa)
removida pela PR23. A transcrio reversa ocorre numa srie de passos, que
utilizam vrios elementos, que actuam em cis no genoma vrico (Fig. 4)
(http://pathmicro.med.sc.edu/flash/hiv-ltr-fn.html) 21. Este processo iniciado
por uma molcula de tARNlys, que actua como iniciador (primer), e que
se liga ao local de unio deste (primer binding site [PBS]). A sntese de
ADN inicia-se na extremidade 5` da molcula de ARN gerando-se um h-
brido de ADN/ARN. A poro de ARN deste hbrido degradada pela
ARNase H, gerando-se um fragmento de ADN conhecido por strong stop
DNA (SSD). Devido homologia das regies R, este ADN salta da extre-
midade 5` do genoma para a extremidade 3`. A sntese da cadeia negativa
de ADN ocorre utilizando a extremidade 3` do SSD, como o iniciador e o
ARN genmico (ARNg) como molde. Em seguida a ARNase H elimina
todo o ARNg, excepto um pequeno fragmento de ARN, existente junto
regio U3. Este fragmento de ARN designado de regio polipurnica
(polypurine tract [PPT]), devido ao seu grande contedo em purinas (Fig.
4). A sntese da cadeia de ADN positiva inicia-se, utilizando o PPT como
iniciador. Em seguida a ARNase H elimina o PPT e o tARNlys. A comple-
mentaridade entre os PBS das duas sequncias de ADN leva circularizao
das duas molculas de ADN e sntese do resto da cadeia de ADN positiva.
Finalmente, a TR produz a cadeia negativa do long terminal repeat (LTR)
em 5. Nesta fase final da transcrio reversa, a TR actua como uma ADN
polimerase ADN-dependente e tem de saltar entre as duas cadeias de
ADN.
Biologia molecular de VIH 37

R U5 PBS gag pol env U3 R


5 3
3 RU5
tARNlys

PBS gag pol env U3 R


5
3
RU5
tARNlys
PBS gag pol env PPT
5 5 3
3 U3 RU5
env
PPT tARNlys
5 3
3
PBS gag pol env U3 RU5
tARNlys
U3 R U5 PBS
5 3
3
PBS gag pol env U3 RU5
tARNlys

U3 R U5 PBS
5
PBS
U3 R U5

U3 R U5 gag pol env U3 R U5


5 3
3 5
LTR LTR

Figura 4. Representao esquemtica do processo de transcrio reversa em VIH.

Importao nuclear do complexo de pr-integrao


e integrao de VIH no genoma da clula hospedeira
Por processos ainda mal conhecidos, o PIC transportado atravs da rede
de microtbulos citoplasmticos at ao ncleo. A transposio da membra-
na nuclear mediada pelas importinas (IP) e 1 (Fig. 5 A)24. A IN, Vpr
e Vpx ligam-se s IP e, portanto, provvel que participem na importao
nuclear do PIC25. A protena acessria Vpr liga-se a nucleopurinas do com-
plexo do poro nuclear e pode, por essa via, promover a ancoragem do PIC
membrana nuclear24. No ncleo, aps a desagregao do PIC, o ADN
vrico vai integrar-se no genoma da clula hospedeira, por aco da IN. O
ADN vrico integrado passa a designar-se por provrus. O ADN provrico
, imediatamente, transformado em cromatina, por associao com histonas.
Os trs nucleossomas posicionados no promotor LTR, nuc-0, nuc-1 e nuc-2,
tm um papel importante na expresso e na latncia de VIH, uma vez que
condicionam o acesso de factores de transcrio ao LTR 25.
38 Nuno Taveira, Pedro Borrego, Ins Brtolo

Estrutura e organizao molecular da integrase


A IN sintetizada como parte da poliprotena Pr160gagpol e catalisa a inte-
grao do ADN vrico no genoma da clula hospedeira26. uma enzima
que pertence famlia das nucleotidiltransferases. Estas enzimas actuam na
ligao fosfodister e quebram ou ligam cidos nucleicos. A sua actividade
cataltica requer a presena de ies Mg2+.
A IN existe nas partculas vricas e transportada para a clula-alvo,
onde permanece como parte dos PIC. A IN de VIH-1 possui 288 amino-
cidos e trs domnios funcionais, isto o domnio aminoterminal (NTD)
(aminocidos 1-49), seguido do domnio cataltico (CCD) (aminocidos
50-212), que possui o centro activo responsvel por todas as actividades
catalticas da IN e, ainda, do domnio carboxiterminal (CTD) (aminocidos
213-288)26,27. Os aminocidos do centro activo Asp64, Asp116 e Glu152
so muito conservados entre todas as IN retrovricas 26. Estes aminocidos
so considerados componentes essenciais da IN, uma vez que a sua mutao
leva perca de toda as actividades catalticas. A IN exerce as suas funes
na forma multimrica.

Mecanismo molecular da integrao e da inibio


da integrao
A integrao do ADN vrico ocorre em trs passos sucessivos (Fig. 5 B)25,27,28.
No primeiro passo, no citoplasma celular, a enzima remove dois nucletidos
de cada extremidade 3` dos dois LTR, originando duas extremidades reces-
sivas, que terminam em citosina e adenina (CA). No ncleo, a IN corta,
tambm, o ADN cromossomal humano, cinco bases a montante do local de
integrao. No segundo passo, que ocorre no ncleo, a IN liga as extremi-
dades 3 do ADN vrico s extremidades 5 do ADN cromossomal. No
terceiro e ltimo passo da integrao, enzimas celulares adicionam as bases
em falta nas extremidades 5 e promovem a sua ligao.
O raltegravir um inibidor da aco da IN, que pertence classe dos
cidos diceto (DKA)27. O raltegravir compete com os resduos Asp64, Asp116
e Glu152, do centro activo da IN, para a ligao aos ies metlicos (Mg 2+).
A remoo destes ies metlicos inibe a actividade cataltica da IN, sobre-
tudo o segundo passo da integrao.

Locais de integrao e relao com expresso gentica


A integrao de VIH-1 no genoma humano ocorre, preferencialmente, nas
regies intrnicas de genes activamente transcritos in vivo29,30. A integra-
o preferencial, nas regies transcritas, pode ser promovida pela maior
acessibilidade da cromatina, nestas regies do cromossoma. Alternativa-
mente, a integrao nos genes activos pode ser promovida devido a inte-
races favorveis entre o PIC e factores de transcrio, existentes local-
mente31.
Biologia molecular de VIH 39

A
Microtbulos
Vpr/
RTMA Vpx NC PIC
ADN vrico IN

Ligao s importinas
MA Vpr/
RT
IP-Vpx IN NC
IP- Citoplasma
Complexo do Importao nuclear
poro nuclear
Membrana nuclear

IP- IP-
RT Vpr/ Dissociao do PIC
NC Vpx
MA
Ncleo
ADN vrico IN

Integrao
Pr-virus
vpx vpr env
gag vif rev
tat nef
pol

B
ADN vrico
5 ACTG CAGT 3
3 TGAC GTCA 5
Integrase
1. 5 ACTG CAOH 3 Citoplasma
OHAC GTCA 5

ADN humano Integrase Ncleo

2. Integrase
AC
TG CA
AC GT
CA

3. Enzimas celulares

TG CA
AC GT

Figura 5. A movimentao intracelular do ADN de VIH. Diagrama do mecanismo de


importao nuclear do ADN de VIH no PIC. IP-, importina ; IP-, importina . B re-
aco de integrao do ADN de VIH no genoma da clula hospedeira. 1 remoo de dois
nucletidos de cada extremidade 3` dos dois LTR, com produo de extremidades recessivas
CA-OH e corte do ADN cromossomal humano cinco bases a montante do local de integrao.
2 ligao das extremidades 3 do ADN vrico s extremidades 5 do ADN cromossomal.
3 adio das bases em falta nas extremidades 5 e ligao.
40 Nuno Taveira, Pedro Borrego, Ins Brtolo

5LTR env 3LTR


vpr
gag vpx SU TM
MA CA NC vi rev rev
pol
U RU PR RT IN tat tat nef

TAR
ansa

bulg

Estimulador stem
Modulador core
-454 -1 + +59 +98 +181
U TATAA R U5
NF B
NFI, S/HR, HTF-4, ATF/CREB,
NRT-2, Sp1, GATA2/3 AP-1, Sp1, TBP
C/EBP, NFI, ILF, NFAT, NRT-1,

Figura 6. Representao esquemtica das regies estruturais do promotor LTR de VIH e da regio
TAR. Esto indicadas algumas das protenas que se ligam s trs regies do LTR e que actuam
como factores gerais de transcrio. A transcrio inicia-se na posio +1 do LTR.

Expresso dos genes vricos


Estrutura do promotor long terminal repeat
A partir dos provrus sintetizam-se os ARN vricos, que daro origem s
protenas do vrus. No provrus, o LTR da extremidade 5 funciona como pro-
motor de transcrio de todo o genoma de VIH, enquanto o LTR em 3
fornece o sinal de poliadenilao do ARN vrico nascente e codifica, tam-
bm, para a protena nef (Fig. 6).
O LTR de VIH tem, aproximadamente, 640 nucletidos e composto
pelas regies U3, R e U5 (Fig. 6). A transcrio inicia-se na regio de
juno entre U3 e R (+1). A regio U3 foi subdividida em trs regies
modulador, estimulador (enhancer) e core de acordo com os motivos de
ligao de factores de transcrio e o seu impacto na actividade do LTR e
na expresso de genes vricos32. O modulador contm locais de ligao para
numerosas protenas que participam na activao e represso da actividade
do LTR. O estimulador possui como, factor distintivo, duas cpias de uma
sequncia de 10 nucletidos qual se liga o factor de transcrio nuclear
factor kappa B (NF-B). A deleo destas sequncias elimina a replicao
vrica. O core possui, como motivos essenciais, trs sequncias ricas em
Biologia molecular de VIH 41

GC, s quais se ligam os factores proteicos de transcrio da famlia Sp1,


e a caixa TATAA, onde se liga a protena TBP e outras protenas, que
compem o complexo de transcrio da ARN polimerase II.
A ARN polimerase II recrutada para o promotor LTR, atravs das
interaces com o factor de transcrio TFIID e outros componentes do
complexo basal de transcrio 33. Posteriormente, o seu CTD fosforilado
parcialmente, pela cinase ciclina-dependente 7 (CDK-7), existente no
factor de transcrio TFIIH. A ARN polimerase II sai do promotor e ini-
cia a transcrio. Contudo, imobilizada pouco depois pela aco con-
certada dos factores negativos da elongao NELF e DSIF 34. Consequen-
temente, a transcrio interrompida pouco depois do seu incio. A regio
+1 a +59 do ARN nascente sofre uma alterao conformacional significa-
tiva e forma-se uma estrutura de ARN em dupla cadeia designada TAR,
constituda por um stem e uma ansa (Fig. 6). A protena Tat de VIH liga-se,
especificamente, ao stem de TAR. Simultaneamente, a ciclina T1, presente
no complexo P-TEFb, liga-se, tambm, a TAR (na ansa) e a Tat. As inte-
races entre TAR, Tat e P-TEFb permitem a formao de um complexo
ternrio estvel, que, atravs de P-TEFb, interage com a ARN polimerase
II imobilizada. A CDK-9, cinase que integra o complexo P-TEFb, promove
a hiperfosforilao do CTD da ARN polimerase II e a fosforilao de NELF
e DSIF34. A fosforilao promove a dissociao de NELF e converte DSIF
num factor positivo de transcrio, o que permite ARN polimerase II
efectuar a elongao da transcrio para produzir ARNm genmicos. Na
ausncia de Tat s se produzem transcritos de pequena dimenso.
A expresso dos genes vricos ocorre, sobretudo, em clulas T activadas.
Nas clulas no activadas a baixa concentrao de factores de transcrio
incluindo, por exemplo, o NF-B, e a presena dos nucleossomas nuc-1 e
nuc-2 na regio de iniciao da transcrio impedem a transcrio.
Estudos recentes indicam, por um lado, que o LTR em 5' de VIH-1
hipermetilado nos resduos CpG e, por outro, que esta metilao suprime a
actividade basal do promotor e a resposta a molculas activadoras da ex-
presso gnica, como as protenas Tat e factor de necrose tumoral
(TNF-)35. Estes resultados sugerem que a metilao do LTR de VIH pode
ser um mecanismo epignico, utilizado pela clula para silenciar a expres-
so dos genes vricos e manter o vrus em latncia.

Estrutura e funo da protena transactivadora Tat


A transcrio dos genes de VIH, a partir do LTR, requer a protena Tat,
como se viu anteriormente. Tat codificada por dois exes e tem 101 ami-
nocidos (Fig. 1 A)36. Tat liga-se regio TAR, que est localizada na ex-
tremidade 5 de todos os ARNm do VIH (Fig. 6). A regio de ligao de
Tat TAR rica em argininas. As argininas, nas posies 52 e 53, so sus-
ceptveis de metilao por metiltransferases da clula (por exemplo, PRMT6),
o que pode impedir a ligao de Tat ciclina T1 e ao TAR e reprimir a sua
actividade transactivadora37,38. Tat interage, tambm, com complexos histona
42 Nuno Taveira, Pedro Borrego, Ins Brtolo

acetiltransferase (por exemplo, p300/CBP), que acetilam as caudas N-ter-


minais das histonas, existentes nos nucleossomas localizados no LTR de
VIH39. A acetilao induz a desestabilizao dos contactos entre as histonas
e o ADN e facilita a transcrio dos genes de VIH. Os complexos histona
acetiltransferase causam tambm a acetilao da prpria Tat nos resduos
Lys50 e Lys51. Uma vez acetilada, a Tat recruta para o LTR o complexo
celular SWI/SNF, cuja funo alterar a localizao ou conformao dos
nucleossomas. Ao modificar o nucleossoma 1 (nuc 1) do LTR, o complexo
SWI/SNF facilita o acesso da ARN polimerase II ao ADN 40,41.

Transcrio, transporte intracelular e traduo dos ARNm de VIH


Os nove genes de VIH so expressos por processamento alternativo de um
nico transcrito inicial do ADN provrico, transcrito esse que tambm cons-
titui o genoma ARN do vrus42. Mais especificamente, a transcrio do
genoma provrico de VIH-1 e o processamento dos ARN gerados leva
produo de trs classes de ARN:
1 Os ARNm completos no processados, que, por um lado, so ARNm
para as poliprotenas precursoras do Gag e GagPol e, por outro,
so incorporados como ARNg nas novas partculas vricas.
2 Os ARNm parcialmente processados, que tm cerca de 5 kb e
codificam para o Env, Vif, Vpu e Vpr.
3 Os ARNm processados mltiplas vezes, que tm cerca de 1,7-2,0 kb
e que so traduzidos nas protenas Rev, Tat e Nef (Fig. 7).
A replicao de VIH requer a exportao nuclear e traduo de todos estes
tipos de ARNm. Os ARNm poliprocessados so transportados para o citoplas-
ma como qualquer ARNm celular. A exportao nuclear dos ARNm no pro-
cessados e, parcialmente, processados assegurada pela protena Rev21.
A Rev uma fosfoprotena com 116 aminocidos e 19 kDa. Esta pro-
tena possui um domnio N-terminal rico em argininas, responsvel pela li-
gao ao ARNm vrico e pela multimerizao do Rev, e um domnio C-ter-
minal com cerca de 10 aminocidos, hidrofbico e rico em leucinas, que
funciona como o sinal de exportao nuclear (NES)42. A Rev liga-se, na
forma multimrica, ao ARNm vrico no motivo Rev responsive element
(RRE). O motivo RRE est localizado no meio do gene env, possui cerca
de 250 nucletidos e forma uma complexa estrutura secundria no ARNm
vrico (Fig. 7). No ncleo celular, Rev liga-se, atravs do sinal de exporta-
o nuclear, protena Crm1, um factor de exportao nuclear da famlia
das carioferinas (Fig. 8)42. A ligao de Crm1 ao Rev, associado ao ARNm
vrico, ocorre na presena de Ran GTPase ligada ao guanosina trifosfato
(GTP). Posteriormente, DDX3 e DDX1, duas helicases do ARN, ligam-se
ao domnio N-terminal de Rev no complexo Crm1/Rev/ARNm43. A trans-
locao, atravs do complexo do poro nuclear, para o citoplasma parece ser
mediada pelas helicases, que, tal como Crm1, se ligam s nucleoporinas.
No citoplasma, a hidrlise do GTP associado Ran GTPase causa uma
alterao conformacional do complexo de transporte, que induz a libertao
Biologia molecular de VIH 43

Ncleo vpx
gag vif vpr env
rev
tat
pol nef

Transcrio e
processamento

Rev
Gag, Pol
gag, pol
e ARNg (10 Kb) CAP RRE A(n)
Rev
env, vif, vpx CAP
e vpr (5 Kb) RRE A(n)
Env, Vif, Vpx
Vpr
rev, tat, nef (2 Kb) CAP A(n)

Rev, Tat, Nef

Figura 7. Diagrama da transcrio, processamento e transporte nucleocitoplasmtico do


ARNm de VIH. Como todos os ARNm eucariticos, os ARNm vricos so modificados em
5 por adio de 7-metilguanosina (CAP) e em 3 por poliadenilao (A[n]).

CAP A(n)

Ribossomas
ARNm VIH
Crm1
Rev Citoplasma
Ran
DDX3

Membrana nuclear

DDX3
Ncleo
Crm1
Ran
Rev CTP ARNm VIH

CAP RRE
A(n)

Figura 8. Diagrama do papel das protenas celulares Crm1 e DDX3, no mecanismo de


exportao nuclear do ARNm de VIH, mediado pela protena Rev.
44 Nuno Taveira, Pedro Borrego, Ins Brtolo

do Rev e do ARNm vrico. O ARNm vrico reconhecido pela maquinaria


de traduo proteica. Rev liga-se IP- e regressa ao ncleo.
O processo de traduo do ARNm vrico determinado pelo internal
ribosome entry site (IRES), uma regio lder, no traduzida, presente no
incio do ARNm vrico e que composta por vrios outros elementos ge-
nticos (por exemplo, regies TAR e sequncia de iniciao de dimerizao
[DIS]), que controlam a replicao vrica44. O IRES liga-se a subunidades
40S ribossomais e a diversos factores de iniciao da traduo, mas o seu
papel exacto na regulao da traduo ainda no conhecido.

Formao das partculas vricas


A formao dos viries VIH um processo complexo, que envolve a ex-
presso de novo das protenas estruturais Gag, Pol e Env, a interaco
destas protenas entre si e com o ARNg, o seu transporte intracelular at
aos locais de formao vrica e, finalmente, a libertao das partculas v-
ricas da clula45. Neste processo ocorrem, tambm, mltiplas interaces
com protenas celulares. Algumas destas protenas celulares estaro presen-
tes nas partculas vricas maduras. Os lentivrus dos primatas formam-se,
em geral, na membrana citoplasmtica e so libertados por gemulao na
superfcie celular. No caso de VIH-1, os vrus produzidos em macrfagos
podem, tambm, formar-se no interior da clula nos corpos multivesiculares
(MVB), compartimentos endossomais tardios46.

Expresso e transporte intracelular do invlucro de VIH


As glicoprotenas do invlucro de VIH so sintetizadas, inicialmente, numa
poliprotena precursora com cerca de 862 aminocidos e 98 kDa de peso
molecular, pela traduo de ARNm, processado uma nica vez em polirri-
bossomas, no retculo endoplasmtico. No aparelho de Golgi so adiciona-
dos oligossacridos protena precursora, que adquire, ento, um peso
molecular de 140 kDa em VIH-2 e 160 kDa em VIH-1 (gp140/gp160). A
gp140/160 sofre, em seguida, um processo de folding e de oligomerizao,
formando trmeros. No compartimento cis do complexo de Golgi, a gp140/160
clivada, por aco da furina, em duas glicoprotenas com 120/125 kDa
(gp120/125) e 32/41 kDa (gp32/41), que se associam entre si de forma no
covalente e formam heterotrmeros (3 [gp120/gp41]). Estes oligmeros
so transportados para a membrana citoplasmtica, onde se inserem por
intermdio da gp32/41. A migrao do invlucro para a membrana regu-
lada por interaces entre motivos de dileucina e tirosina do invlucro com
os complexos proteicos AP-1 e AP-247. Na membrana, a regio intracito-
plasmtica da gp32/41 vai interagir com as protenas MA dos precursores
Gag e GagPol, durante a formao dos novos viries. A incorporao do
invlucro nos viries VIH-1 depende do co-factor celular TIP47, uma pro-
tena que interage simultaneamente com o domnio MA do precursor Pr55 Gag
e a cauda citoplasmtica da gp4148.
Biologia molecular de VIH 45

Expresso e transporte intracelular das protenas Gag e Pol de VIH


A protena estrutural Gag sintetizada na forma de um precursor com 55 kDa,
Pr55Gag, nos ribossomas citoslicos por traduo de um ARNm genmico.
Durante a traduo do Gag ocorre, com alguma frequncia (5-10%), uma
alterao de grelha de leitura ribossomal 1 que resulta na traduo do Pol
na forma de uma poliprotena GagPol com 160 kDa (Pr160GagPol)21. Esta
alterao de grelha de leitura ribossomal induzida por dois sinais activa-
dos em cis no ARNg. Os precursores Pr55Gag e Pr160GagPol so meristilados
na extremidade amina da protena MA, o que lhes confere afinidade para as
membranas45. As molculas de precursor meristilado Pr55Gag acumulam-se
em dmeros, na face interna da membrana citoplasmtica, eventualmente
ligadas glicoprotena gp41 do invlucro vrico. Este ser o primeiro pas-
so do processo de formao de novas partculas vricas. Os precursores
Pr55Gag e Pr160GagPol so transportados at membrana citoplasmtica em
MVB. Este percurso envolve a associao da protena MA com o comple-
xo AP-349. Sem esta interaco, estes precursores no so transportados para
os MVB e a formao das partculas vricas reduzida.
A poliprotena precursora do Gag, Pr55Gag contm trs domnios funcio-
nais, M, I e L, que tm papis importantes no processo de formao das
partculas virais45. O domnio M est localizado na protena MA e meris-
tilado na sua glicina N-terminal. A meristilao um sinal fundamental para
levar o Gag para a membrana citoplasmtica e para a sua insero na mem-
brana. Estudos recentes indicam que o lpido fosfatidilinositol (PI) 4,5-bis-
fosfato (PI [4,5] P2) se liga de forma especfica ao domnio MA meristilado
do precursor Pr55Gag e serve de ncora para a sua insero na membrana
citoplasmtica50. A ligao ao PI (4,5) P2 promove, ainda, a exposio do
miristato, o que essencial para a estabilidade da associao da MA com
a membrana citoplasmtica.
O domnio I, localizado na protena NC, responsvel pela dimerizao
do Gag. A dimerizao aumenta a eficincia de ligao do Gag membra-
na, o que essencial para a formao da partcula vrica51. A dimerizao
do Gag depende ainda de um motivo de dimerizao localizado na extre-
midade carboxilo da protena da CA e da ligao da NC ao ARNg vrico.

Encapsidao do ARNg
A encapsidao das duas cpias de ARNg em cada partcula vrica requer
a sua dimerizao e a interaco com a protena da NC. A protena NC
possui dois motivos dedo de zinco do tipo CCHC, cada um dos quais co-
ordena um io de zinco44. Atravs destes motivos da NC, o precursor Pr55Gag
liga-se ao ARNg no sinal de encapsidao (). O sinal de encapsidao
existe na extremidade 5 no traduzida do ARN vrico, imediatamente antes
do codo de iniciao do gene gag (Fig. 1 A)44. Esta regio forma uma
estrutura secundria complexa composta por quatro ansas, designadas de
SL1 a SL4. A ansa SL1 contm a DIS, uma regio rica em citosinas e
46 Nuno Taveira, Pedro Borrego, Ins Brtolo

guaninas, que promove a dimerizao do ARNg numa estrutura meta-estvel


designada por kissing complex52. A protena NC, do vrus, interage com a
DIS e promove a converso do kissing complex numa estrutura distendida
mais estvel e que pode ser encapsidada nos viries nascentes53. A ansa
SL4, que existe exclusivamente no ARNg, parece ser importante para a
encapsidao prioritria do ARNg nos viries, em detrimento dos outros
ARNm vricos.

Libertao das partculas vricas


A libertao vrica da clula , ainda, objecto de debate intenso. H dois
modelos alternativos ou complementares para a libertao de VIH-1 das
clulas infectadas54. O primeiro modelo postula que os vrus se formam e
libertam nos lipid rafts, regies da membrana citoplasmtica enriquecidas
em esfingolpidos, colesterol e protenas ligadas a glicosilfosfatidilinositol
(GPI). Este modelo parece aplicar-se replicao de VIH nos linfcitos T,
uma vez que na membrana citoplasmtica destas clulas as protenas pre-
cursoras Pr55Gag e Pr160GagPol e o invlucro se localizam preferencialmente
nos lipid rafts e a destruio destas regies reduz a produo de vrus51.
Neste modelo, o vrus liberta-se da clula por gemulao a partir da mem-
brana citoplasmtica. Resultados recentes indicam que a teterina, uma pro-
tena integral da membrana citoplasmtica celular cuja expresso induzi-
da pelo interfero , pode impedir a libertao das novas partculas vricas
(VIH e VIS) das clulas infectadas55. A actividade antivrico da teterina ,
contudo, neutralizada pela protena Vpu no VIH-1, pelo Env no VIH-2 e
pelo Nef no VIS56.
No modelo do exossoma de Tria, que se aplica sobretudo replicao
de VIH nos macrfagos, as partculas vricas formam-se e libertam-se di-
rectamente para os MVB, dentro da clula46. Os MVB, carregados de par-
tculas vricas, so direccionados para a membrana citoplasmtica e a sua
membrana funde-se com a membrana citoplasmtica, libertando os vrus na
forma de exossomas. Neste modelo, o transporte dos MVB para a membra-
na citoplasmtica, a fisso membranar e a libertao de VIH das clulas so
mediados pelos complexos celulares ESCRT I-III54. Os complexos ESCRT
so recrutados para os precursores Pr55Gag e Pr160GagPol atravs das prote-
nas celulares TSG101 e AIP que interagem com o motivo aminoacdico
PTAP localizado no domnio L destes precursores45.

Maturao das protenas vricas


A maturao de VIH-1 conseguida pelo processamento proteoltico das
poliprotenas Pr55Gag e Pr160GagPol pela PR. Na ausncia desta protelise
so produzidos viries no infecciosos. Durante e aps a libertao vrico
a partir da membrana celular, a poliprotena Gag clivada nos seus com-
ponentes estruturais vricos, MA, CA, NC, p6, p2 e p157,58. O processo de
activao da PR no est, ainda, totalmente esclarecido. Pensa-se que a PR
Biologia molecular de VIH 47

activada via dimerizao, que promovida por interaces entre as poli-


protenas Pr55Gag e Pr160GagPol. A PR, activada na forma dimrica, primeiro
autocliva-se da poliprotena Pr160GagPol e depois cliva os precursores Pr55Gag
e Pr160GagPol. O processamento proteoltico da poliprotena Pr160GagPol d
origem TR e IN. O processamento proteoltico do precursor Pr55 Gag
essencial para a infecciosidade do vrus, mas no necessrio para a for-
mao e libertao da partcula vrica59. O processamento de Pr55Gag de-
pende da dimerizao do ARNg, o que sugere que a maturao das prote-
nas vricas e do ARNg esto interligados53.
Finalmente, ocorrem uma srie de rearranjos estruturais e relocalizao
dos componentes estruturais na partcula vrica. A MA passa a ser a nica
protena ligada ao invlucro, enquanto a CA e NC se condensam volta
do genoma vrico, originando a CA cnica caracterstica do virio maduro
e infeccioso21,23.

Funo das protenas acessrias


Vpu
Vpu uma fosfoprotena integral de membrana do tipo I com 81 amino-
cidos e 16 kDa que codificada em VIH-1 e VIScpz mas no em VIH-2
(Fig. 1 A). Vpu no se encontra no virio. As suas duas principais funes
biolgicas so aumentar a libertao dos viries da membrana citoplasm-
tica de clulas infectadas por VIH-1 e promover a degradao do receptor
CD4 no retculo endoplasmtico, o que tem, como consequncia, o aumen-
to da expresso das glicoprotenas do invlucro na membrana celular. Estas
duas funes biolgicas parecem envolver mecanismos distintos e domnios
estruturais diferentes de Vpu60,61. A degradao do CD4 depende da inte-
raco simultnea de Vpu, na sua forma fosforilada, com o CD4 e com a
protena TrCP, recrutando a maquinaria proteossomal, que inclui a ubiqui-
tina Cdc34 E2. Vpu favorece a permanncia do precursor Pr55Gag na mem-
brana citoplasmtica e impede o redireccionamento da Pr55 Gag para as
membranas internas por endocitose62,63. Este efeito pode contribuir para
aumentar a formao e libertao das partculas vricas. Contudo, o princi-
pal papel de Vpu, na libertao vrica, parece ser neutralizar, por mecanis-
mos, ainda, desconhecidos, a funo da teterina, uma protena que fixa os
viries recm-formados na superfcie das clulas infectadas 55.

Vpx
Vpx uma protena vrica com cerca de 12 kDa que est presente apenas
em VIH-2 e em VISmac/sm (Fig. 1 A). Curiosamente, uma protena com
alta homologia com a protena Vpr de VIH-1. incorporada no virio, tal
como Vpr, atravs de interaces com a protena p6 do Gag. uma pro-
tena necessria para a replicao eficiente de VIH-2/VISsm nos linfcitos
do sangue perifrico. Nestes vrus, Vpx integra o PIC e participa na sua
48 Nuno Taveira, Pedro Borrego, Ins Brtolo

importao nuclear22. A protena Vpx retorna depois ao citoplasma para


integrar os viries. Vpx possui, portanto, sinais de importao e exportao
nuclear22.

Vpr
A protena Vpr uma protena homloga de Vpx, presente tanto em VIH1
como em VIH-2. Possui 96 aminocidos e 14 kDa e incorporada nos
viries, atravs de interaces com a protena p6 do Gag (Fig. 1 A) 24. A
sua principal funo biolgica a interrupo de clulas infectadas por VIH,
na fase G2 do ciclo celular, o que parece aumentar a expresso do LTR.
Vpr interrompe o ciclo celular na fase G2, pela inibio da cinase Cdc2,
que controla a entrada da clula em mitose. A ligao protena DCAF1,
uma protena, que interage com as ubiquitina ligases celulares E3 Cul4,
um pr-requisito da actividade citosttica de Vpr. Assim, a paragem do
ciclo celular, em fase G2, parece resultar da formao de um complexo
ternrio entre Vpr, DCAF1 e a ubiquitina ligase DDB1-Cul4, que activa a
degradao de protenas celulares, que participam no ciclo celular. Tambm
a protena Vpx tem a capacidade de se ligar DCAF1, mas no consegue
interromper o ciclo celular, o que sugere que Vpr e Vpx evoluram no sen-
tido de manter conservada a capacidade de recrutar a ubiquitina ligase Cul4,
mas divergiram no reconhecimento das protenas celulares, a sinalizar para
degradao proteossomal64,65.
Outras funes atribudas a Vpr so a induo da diferenciao celular e
o transporte do PIC, para o ncleo das clulas infectadas (Fig. 5 A). Nos
macrfagos, o transporte de Vpr para o ncleo promovido pela IP e esta
associao fundamental para a replicao de VIH-1 nestas clulas 66.
Vpr influencia, tambm, a fidelidade do processo de transcrio rever-
sa, possivelmente pela associao com a ADN glicosilase (UNG2) 24. Esta
interaco permite que a UNG2 seja incorporada nas partculas vricas,
onde ir modular a taxa de mutao de VIH, uma vez que a presena da
UNG2 minimiza a incorporao de resduos de uracilo no ADN provrico
recm-sintetizado.

Vif
Vif uma protena bsica com 23 kDa, que pode ser encontrada nos viries 67.
Mutaes no gene vif podem tornar VIH pouco ou nada infeccioso. A funo
de Vif exerce-se atravs de factores celulares antivricos. Neste contexto, Vif
liga-se a factores celulares antivricos, entre os quais a citidina desaminase
humana APOBEC3G e inibe a incorporao desta nas partculas vricas, por
mecanismos ainda mal esclarecidos68. Na ausncia de Vif, APOBEC3G
incorporada nas partculas vricas e exerce a sua actividade antivrica. A
presena de APOBEC3G, no vrus, pode causar hipermutao da cadeia
negativa de cADN, durante a transcrio reversa, inibir a transcrio reversa
ou inactivar o vrus de uma forma independente da desaminao 61.
Biologia molecular de VIH 49

5LTR vpr env 3LTR


gag vpx SU TM
MA CA NC vif rev rev
pol
U3 RU5 PR RT IN tat tat nef

)
IV e 3
s)

d (A P )
(H , 2
P
ti ana

di cina CO
ico -1

)

as
S)
r

iza
an emb

ivo u (-
in
AC
ca

ol

er

M o d dico
pr
e (M

om
(P
tip

en
lic ido

lig
o


ot iac

ac
ot ile

ica

eo
c
ila

d
er

ld
ivo

ivo
ist

iv
lic

ca
er

ot

ot
H

Lo
M

M
M
1 58 150 180 206 aa
Domnio ncora Domnio globular central Hlice Domnio
N-terminal flexvel C-terminal

Figura 9. Diagrama dos domnios estruturais e funcionais da protena Nef.

Nef
Nef uma fosfoprotena, com 27 kDa, predominantemente citoplasmtica
e associada com a membrana citoplasmtica via um resduo de cido me-
ristlico, adicionado segunda glicina (Fig. 9). Nef contribui, directamente,
para prolongar o tempo de vida das clulas infectadas por VIH e para di-
minuir a eficincia das defesas imunitrias do hospedeiro69. Nef impede a
morte prematura das clulas infectadas, inibindo a apoptose, mediada pela
protena p53, e a actividade da cinase ASK-1, que envia sinais pr-apopt-
ticos para o receptor do TNF-. A nvel imunitrio, Nef promove a remoo
do CD4 da superfcie da clula, o que impede a infeco desta por outros
vrus e compromete a resposta T auxiliadora. O transporte do CD4, para o
interior da clula, parece envolver a ligao de Nef cauda citoplasmtica
do CD4 e o recrutamento de co-factores celulares (por exemplo, AP-2,
ARF-1, -COP, V1H), que direccionam o CD4 para a degradao lisossomial
(Fig. 9). Em VISsm e VIH-2, Nef induz, tambm, a remoo selectiva do
receptor das clulas T (TCR/CD3), o que leva a menor grau de activao das
clulas T, nas infeces por estes vrus70. Nef , tambm, responsvel pela
remoo para o aparelho de Golgi (TGN), das molculas de MHC-I existen-
te na superfcie da clula, o que permite s clulas infectadas no serem
detectadas e destrudas pelos linfcitos T citotxicos, um mecanismo, poten-
cialmente, importante de escape ao sistema imunitrio 69.
50 Nuno Taveira, Pedro Borrego, Ins Brtolo

Agradecimentos
Ins Brtolo e Pedro Borrego so bolseiros de doutoramento da Fundao
para a Cincia e Tecnologia. Agradecemos a Alexandre Quintas o diagrama
da estrutura molecular da V3 apresentado na figura 2.

Bibliografia
1. Gelderblom H. Fine Structure of HIV and SIV. Em: Korber B, Haynes B, Koup R, Moore J, Walker B, eds. HIV
Molecular Immunology Database 1997. Los Alamos, NM: Theoretical Biology and Biophysics Group, Los
Alamos National Laboratory; 1997. p. 37-50.
2. Kwong PD, Wyatt R, Robinson J, Sweet RW, Sodroski J, Hendrickson WA. Structure of an HIV gp120 envelope
glycoprotein in complex with the CD4 receptor and a neutralizing human antibody. Nature. 1998;393:648-59.
3. Rizzuto CD, Wyatt R, Hernandez-Ramos N, et al. A conserved HIV gp120 glycoprotein structure involved in
chemokine receptor binding. Science. 1998;280:1949-53.
4. Wyatt R, Hendrickson WA, Sodroski JG. Structure of the core of the HIV-1 gp120 exterior envelope glycoprotein.
Em: Korber B, Foley B, Hahn B, McCutchan F, Mellors JW, Sodroski J, eds. Human Retroviruses and AIDS 1998.
Los Alamos, NM: Theoretical Biology and Biophysics Group, Los Alamos National Laboratory; 1998. p. 3-9.
5. Wyatt R, Sodroski J. The HIV-1 envelope glycoproteins: fusogens, antigens, and immunogens. Science. 1998;280:
1884-8.
6. Zolla-Pazner S. Identifying epitopes of HIV-1 that induce protective antibodies. Nat Rev Immunol. 2004;4:199-210.
7. Mascolini M. Coreceptor tropism, entry inhibitors, and the pathogenesis of entry: report from the 2nd Interna-
tional Workshop on targeting HIV entry. Reviews in Antiviral Therapy. 2007;1:4-22.
8. Huang CC, Tang M, Zhang MY, et al. Structure of a V3-containing HIV-1 gp120 core. Science. 2005;310:1025-8.
9. Tsibris AM, Kuritzkes DR. Chemokine antagonists as therapeutics: focus on HIV-1. Annu Rev Med. 2007;58:445-59.
10. Zhou T, Xu L, Dey B, et al. Structural definition of a conserved neutralization epitope on HIV-1 gp120. Nature.
2007;445:732-7.
11. Zolla-Pazner S. Improving on nature: focusing the immune response on the V3 loop. Hum Antibodies.
2005;14:69-72.
12. De Jong JJ, De Ronde A, Keulen W, Tersmette M, Goudsmit J. Minimal requirements for the human immuno-
deficiency virus type 1 V3 domain to support the syncytium-inducing phenotype: analysis by single amino acid
substitution. J Virol. 1992;66:6777-80.
13. Delobel P, Nugeyre MT, Cazabat M, et al. Population-based sequencing of the V3 region of env for predicting
the coreceptor usage of human immunodeficiency virus type 1 quasispecies. J Clin Microbiol. 2007;45:1572-80.
14. Resch W, Hoffman N, Swanstrom R. Improved success of phenotype prediction of the human immunodefi-
ciency virus type 1 from envelope variable loop 3 sequence using neural networks. Virology. 2001;288:51-62.
15. Aasa-Chapman MM, Seymour CR, Williams I, McKnight A. Novel envelope determinants for CCR3 use by
human immunodeficiency virus. J Virol. 2006;80:10884-9.
16. Hu QX, Barry AP, Wang ZX, Connolly SM, Peiper SC, Greenberg ML. Evolution of the human immunodefi-
ciency virus type 1 envelope during infection reveals molecular corollaries of specificity for coreceptor utilization
and AIDS pathogenesis. J Virol. 2000;74:11858-72.
17. Poveda E, Briz V, Soriano V. Enfuvirtide, the first fusion inhibitor to treat HIV infection. AIDS Rev. 2005;7:139-47.
18. Munch J, Standker L, Adermann K, et al. Discovery and optimization of a natural HIV-1 entry inhibitor target-
ing the gp41 fusion peptide. Cell. 2007;129:263-75.
19. Oldfield V, Keating GM, Plosker G. Enfuvirtide: a review of its use in the management of HIV infection. Drugs.
2005;65:1139-60.
20. Wild CT, Shugars DC, Greenwell TK, McDanal CB, Matthews TJ. Peptides corresponding to a predictive alpha-
helical domain of human immunodeficiency virus type 1 gp41 are potent inhibitors of virus infection. Proc Natl
Acad Sci USA. 1994;91:9770-4.
21. Freed EO. HIV-1 replication. Somat Cell Mol Genet. 2001;26:13-33.
22. Singhal PK, Rajendra Kumar P, Subba Rao MR, Mahalingam S. Nuclear export of simian immunodeficiency
virus Vpx protein. J Virol. 2006;80:12271-82.
23. Wang WK, Chen MY, Chuang CY, Jeang KT, Huang LM. Molecular biology of human immunodeficiency virus
type 1. J Microbiol Immunol Infect. 2000;33:131-40.
24. Le Rouzic E, Benichou S. The Vpr protein from HIV-1: distinct roles along the viral life cycle. Retrovirology.
2005;2:11.
25. Vandegraaff N, Engelman A. Molecular mechanisms of HIV integration and therapeutic intervention. Expert Rev
Mol Med. 2007;9:1-19.
26. Lataillade M, Kozal MJ. The hunt for HIV-1 integrase inhibitors. AIDS Patient Care STDS. 2006;20:489-501.
27. Nair V, Chi G. HIV integrase inhibitors as therapeutic agents in AIDS. Rev Med Virol. 2007;17:277-95.
28. Hayouka Z, Rosenbluh J, Levin A, et al. Inhibiting HIV-1 integrase by shifting its oligomerization equilibrium.
Proc Natl Acad Sci USA. 2007;104:8316-21.
29. Mitchell RS, Beitzel BF, Schroder AR, et al. Retroviral DNA integration: ASLV, HIV, and MLV show distinct
target site preferences. PLoS Biol. 2004;2:E234.
30. Schroder AR, Shinn P, Chen H, Berry C, Ecker JR, Bushman F. HIV-1 integration in the human genome favors
active genes and local hotspots. Cell. 2002;110:521-9.
31. Ikeda T, Shibata J, Yoshimura K, Koito A, Matsushita S. Recurrent HIV-1 integration at the BACH2 locus in rest-
ing CD4+ T cell populations during effective highly active antiretroviral therapy. J Infect Dis. 2007;195:716-25.
Biologia molecular de VIH 51

32. Krebs FC HT, Quiterio S, Gartner S, Wigdahl B. Lentiviral LTR-directed expression, sequence variation, and
disease pathogenesis. Em: Kuiken C, Hahn B, Marx P, et al., eds. HIV Sequence Compendium 2001. Los Ala-
mos, NM: Theoretical biology and biophysics group, Los Alamos National Laboratory; 2001. p. 29-70.
33. Karn J. Tackling Tat. J Mol Biol. 1999;293:235-54.
34. Zhou Q, Yik JH. The Yin and Yang of P-TEFb regulation: implications for human immunodeficiency virus gene
expression and global control of cell growth and differentiation. Microbiol Mol Biol Rev. 2006;70:646-59.
35. Ishida T, Hamano A, Koiwa T, Watanabe T. 5 long terminal repeat (LTR)-selective methylation of latently in-
fected HIV-1 provirus that is demethylated by reactivation signals. Retrovirology. 2006;3:69.
36. Liang C, Wainberg MA. The role of Tat in HIV-1 replication: an activator and/or a suppressor? AIDS Rev. 2002;
4:41-9.
37. Boulanger MC, Liang C, Russell RS, et al. Methylation of Tat by PRMT6 regulates human immunodeficiency
virus type 1 gene expression. J Virol. 2005;79:124-31.
38. Xie B, Invernizzi CF, Richard S, Wainberg MA. Arginine methylation of the human immunodeficiency virus type
1 Tat protein by PRMT6 negatively affects Tat Interactions with both cyclin T1 and the Tat transactivation region.
J Virol. 2007;81:4226-34.
39. Quivy V, De Walque S, Van Lint C. Chromatin-associated regulation of HIV-1 transcription: implications for the
development of therapeutic strategies. Subcell Biochem. 2007;41:371-96.
40. Agbottah E, Deng L, Dannenberg LO, Pumfery A, Kashanchi F. Effect of SWI/SNF chromatin remodeling
complex on HIV-1 Tat activated transcription. Retrovirology. 2006;3:48.
41. Mahmoudi T, Parra M, Vries RG, et al. The SWI/SNF chromatin-remodeling complex is a cofactor for Tat
transactivation of the HIV promoter. J Biol Chem. 2006;281:19960-8.
42. Cullen BR. Nuclear mRNA export: insights from virology. Trends Biochem Sci. 2003;28:419-24.
43. Jeang KT, Yedavalli V. Role of RNA helicases in HIV-1 replication. Nucleic Acids Res. 2006;34:4198-205.
44. Darlix J-L, Mely Y, Roques B. Nucleocapsid protein chaperoning of nucleic acids at the heart of hiv structure,
assembly and cDNA synthesis. IEm Kuiken C, Freed E, Hahn B, et al., eds. HIV Sequence compendium 2002.
Los Alamos, NW: Theoretical biology and biophysics group, Los Alamos National Laboratory; 2002. p. 69-88.
45. Gottlinger H. HIV-1 Gag: a molecular machine driving viral particle assembly and release. Em: Kuiken C, Hahn
B, Marx P, et al., eds. HIV Sequence compendium 2001. Los Alamos, NM: Theoretical biology and biophysics
group, Los Alamos National Laboratory; 2001. p. 2-28.
46. Ono A, Freed EO. Cell-type-dependent targeting of human immunodeficiency virus type 1 assembly to the
plasma membrane and the multivesicular body. J Virol. 2004;78:1552-63.
47. Wyss S, Berlioz-Torrent C, Boge M, et al. The highly conserved C-terminal dileucine motif in the cytosolic
domain of the human immunodeficiency virus type 1 envelope glycoprotein is critical for its association with
the AP-1 clathrin adaptor [correction of adapter]. J Virol. 2001;75:2982-92.
48. Lopez-Verges S, Camus G, Blot G, Beauvoir R, Benarous R, Berlioz-Torrent C. Tail-interacting protein TIP47
is a connector between Gag and Env and is required for Env incorporation into HIV-1 virions. Proc Natl Acad
Sci USA. 2006;103:14947-52.
49. Dong X, Li H, Derdowski A, et al. AP-3 directs the intracellular trafficking of HIV-1 Gag and plays a key role
in particle assembly. Cell. 2005;120:663-74.
50. Saad JS, Miller J, Tai J, Kim A, Ghanam RH, Summers MF. Structural basis for targeting HIV-1 Gag proteins
to the plasma membrane for virus assembly. Proc Natl Acad Sci USA. 2006;103:11364-9.
51. Resh MD. Intracellular trafficking of HIV-1 Gag: how Gag interacts with cell membranes and makes viral par-
ticles. AIDS Rev. 2005;7:84-91.
52. Houzet L, Paillart JC, Smagulova F, et al. HIV controls the selective packaging of genomic, spliced viral and
cellular RNAs into virions through different mechanisms. Nucleic Acids Res. 2007;35:2695-704.
53. Sun X, Zhang Q, Al-Hashimi HM. Resolving fast and slow motions in the internal loop containing stem-loop 1
of HIV-1 that are modulated by Mg2+ binding: role in the kissing-duplex structural transition. Nucleic Acids
Res. 2007;35:1698-713.
54. Gomez C, Hope TJ. The ins and outs of HIV replication. Cell Microbiol. 2005;7:621-6.
55. Neil SJ, Zang T, Bieniasz PD. Tetherin inhibits retrovirus release and is antagonized by HIV-1 Vpu. Nature.
2008;451:425-30.
56. Jia B, Serra-Moreno R, Neidermyer W, et al. Species-specific activity of SIV Nef and HIV-1 Vpu in overcoming
restriction by tetherin/BST2. PLoS Pathog. 2009;5:e1000429.
57. Paulus C, Ludwig C, Wagner R. Contribution of the Gag-Pol transframe domain p6* and its coding sequence to
morphogenesis and replication of human immunodeficiency virus type 1. Virology. 2004;330:271-83.
58. Sluis-Cremer N, Arion D, Abram ME, Parniak MA. Proteolytic processing of an HIV-1 pol polyprotein precur-
sor: insights into the mechanism of reverse transcriptase p66/p51 heterodimer formation. Int J Biochem Cell
Biol. 2004;36:1836-47.
59. Chen SW, Chiu HC, Liao WH, Wang FD, Chen SS, Wang CT. The virus-associated human immunodeficiency
virus type 1 Gag-Pol carrying an active protease domain in the matrix region is severely defective both in au-
toprocessing and in trans processing of gag particles. Virology. 2004;318:534-41.
60. Bour S, Strebel K. The HIV-1 Vpu protein: a multifunctional enhancer of viral particle release. Microbes Infect.
2003;5:1029-39.
61. Freed EO, Mouland AJ. The cell biology of HIV-1 and other retroviruses. Retrovirology. 2006;3:77.
62. Harila K, Prior I, Sjoberg M, Salminen A, Hinkula J, Suomalainen M. Vpu and Tsg101 regulate intracellular target-
ing of the human immunodeficiency virus type 1 core protein precursor Pr55gag. J Virol. 2006;80:3765-72.
63. Neil SJ, Eastman SW, Jouvenet N, Bieniasz PD. HIV-1 Vpu promotes release and prevents endocytosis of nascent
retrovirus particles from the plasma membrane. PLoS Pathog. 2006;2:e39.
64. Le Rouzic E, Belaidouni N, Estrabaud E, et al. HIV1 Vpr arrests the cell cycle by recruiting DCAF1/VprBP, a
receptor of the Cul4-DDB1 ubiquitin ligase. Cell Cycle. 2007;6:182-8.
65. Schrofelbauer B, Hakata Y, Landau NR. HIV-1 Vpr function is mediated by interaction with the damage-specif-
ic DNA-binding protein DDB1. Proc Natl Acad Sci USA. 2007;104:4130-5.
52 Nuno Taveira, Pedro Borrego, Ins Brtolo

66. Nitahara-Kasahara Y, Kamata M, Yamamoto T, et al. Novel nuclear import of Vpr promoted by importin alpha
is crucial for human immunodeficiency virus type 1 replication in macrophages. J Virol. 2007;81:5284-93.
67. Yu Q, Knig R. Vif and the role of antiviral cytidine deaminases in HIV-1 replication. Em: Leitner T, Hahn B,
Marx P, et al, eds. HIV Sequence compendium 2003. Los Alamos, NM: Theoretical biology and biophysics
group, Los Alamos National Laboratory; 2003. p. 2-13.
68. Opi S, Kao S, Goila-Gaur R, et al. Human immunodeficiency virus type 1 Vif inhibits packaging and antiviral
activity of a degradation-resistant APOBEC3G variant. J Virol. 2007;81:8236-46.
69. Roeth JF, Collins KL. Human immunodeficiency virus type 1 Nef: adapting to intracellular trafficking pathways.
Microbiol Mol Biol Rev. 2006;70:548-63.
70. Schindler M, Munch J, Kutsch O, et al. Nef-mediated suppression of T cell activation was lost in a lentiviral
lineage that gave rise to HIV-1. Cell. 2006;125:1055-67.
II SECO

Imunopatognese
e resposta imunitria
II Seco
Captulo 1

Imunopatognese e resposta imunitria


Ana Espada de Sousa, Rui Victorino

So sucessivamente tratados, neste captulo, o desenvolvimento da imuno-


deficincia e as diferentes fases clnicas da doena, as respostas especficas
do hospedeiro para controlar o vrus, as perturbaes induzidas no sistema
imunitrio e, por ltimo, os modelos clnicos que tm sido explorados para
a compreenso da imunopatognese de VIH.

Estabelecimento da infeco por VIH e desenvolvimento


da imunodeficincia
Infeco primria e sndrome de infeco aguda
A infeco por VIH pode ser contrada por entrada do vrus no sangue circu-
lante, directamente atravs de transfuso, injeco com seringas contaminadas
em consumidores de drogas endovenosas ou transmisso materno-fetal. Nestes
casos, o vrus , provavelmente, removido da circulao pelo sistema reticu-
loendotelial do bao, fgado e pulmes, ocorrendo infeco do tecido linfide,
nestes rgos, replicao de VIH e, consequentemente, viremia com dissemi-
nao da infeco. Alternativamente, a infeco pode ser contrada atravs da
mucosa rectal e genital, por contactos homossexuais ou heterossexuais.
Neste caso, parece ter papel determinante a clula dendrtica, no local da
exposio, captando os viries e transportando-os para a regio paracortical dos
gnglios linfticos de drenagem, onde o vrus contacta com as clulas TCD4 +
activadas, atravs da interaco destas com as clulas dendrticas, permitin-
do, assim, a replicao vrica e a posterior disseminao da infeco.
Embora os mecanismos envolvidos na infeco inicial possam diferir, no
existem diferenas bvias nas manifestaes da doena, entre os indivduos
56 Ana Espada de Sousa, Rui Victorino

Infeco Latncia clnica Infeces


primria oportunistas

1.200 107
Morte
1.100

Cpias ARN vrico/ml no plasma


1.000
106
900
Linfcitos TCD4+ (clulas/l)

800
700 105

600
500
104
400
300
103
200
100
0 102
0 3 6 9 12 1 2 3 4 5 6 7 8 9 10 11
Semanas Anos

Figura 1. Histria natural da infeco por VIH. Aps a infeco primria com subida mar-
cada da viremia e descida transitria da contagem de linfcitos TCD4 +, verifica-se o controle
imunitrio parcial da replicao vrica e a entrada num perodo longo de latncia clnica. O
declnio progressivo de linfcitos TCD4+, durante esta fase, culmina com o aparecimento de
infeces oportunistas e tumores que caracterizam a fase avanada (sida).

infectados, atravs das mucosas ou atravs do sangue. Aproximadamente


trs a seis semanas aps a exposio e a infeco primria por VIH, cerca de
metade dos infectados apresentam sndrome clnica aguda, com manifesta-
es semelhantes mononucleose infecciosa, autolimitada, que dura, geral-
mente, uma a trs semanas. Estas manifestaes associam-se subida da
viremia e so acompanhadas por queda transitria dos nveis de clulas
TCD4+, no sangue perifrico, que, ocasionalmente, pode ser to marcada
que se associe ao aparecimento de infeces oportunistas (Fig. 1). Alm da
descida do nmero absoluto de linfcitos TCD4+, observa-se diminuio das
contagens de linfcitos TCD8+ e B. No entanto, cerca de trs semanas de-
pois do incio do quadro, ocorre expanso da populao TCD8 +, para nveis
iguais ou superiores aos existentes, antes da infeco. Dado que a recupe-
rao das contagens de linfcitos TCD4+ , geralmente, parcial, documenta-
se, no final da sndrome aguda, diminuio do quociente TCD4+/TCD8+, no
sangue perifrico, que se mantm durante toda a doena.
O diagnstico da infeco, na fase aguda, s possvel atravs de estu-
dos vricos (antigenemia gag ou quantificao do nmero de cpias de
ARN), uma vez que os anticorpos anti-VIH, que permitem o diagnstico
serolgico da infeco, s so, em regra, detectados algumas semanas aps
o incio da sintomatologia. As respostas especficas do sistema imunitrio
Imunopatognese e resposta imunitria 57

Respostas imunitrias VIH-especficas


Factores supressores produzidos por clulas TCD8+
RANTES, MIP-1, MIP-1
(estirpes VIH com tropismo para macrfagos)
SDF-1
(estirpes VIH com tropismo para linfcitos T)
Citocinas inibitrias (IL-10, FCT-)

Replicao
de VIH
Activao celular
Citocinas pr-inflamatrias
(TNF-, IL-1, IL-6, etc.)

Figura 2. O equilbrio estabelecido entre os factores que induzem replicao vrica e os que
a inibem determinante do nvel de replicao vrica nas vrias fases da doena (adaptado
de Fauci AS. Nature. 1996;384:529-34).

contra VIH surgem, no entanto, precocemente, aps a infeco primria e,


embora sejam incapazes de impedir o estabelecimento da infeco crnica
persistente, desempenham um papel fundamental no controle da replicao
vrica e na reduo da viremia.
Da interaco das respostas especficas imunitrias com o vrus e o
background gentico do hospedeiro resulta um estado de equilbrio, que se
traduz em diferentes nveis de replicao vrica e de estabilizao da viremia,
nos diferentes indivduos (Figs. 1 e 2). Os nveis de viremia, obtidos cerca
de seis a 12 meses aps a seroconverso, tm valor prognstico importante,
sugerindo que a viremia, alcanada nesta fase, determinante da forma de
evoluo da doena.
Vrios estudos tm tentado caracterizar as alteraes observadas nos
gnglios linfticos, durante esta fase de transio1. Aps a infeco aguda,
VIH encontra-se, sobretudo, em clulas T da regio paracortical, que se
encontram, produtivamente, infectadas. A emergncia das respostas imuni-
trias especficas associa-se, temporalmente, diminuio destas clulas e
hiperplasia folicular, em paralelo com a diminuio da viremia. O vrus
retido pelas clulas foliculares dendrticas, maioritariamente ligado a
imunocomplexos de anticorpos e complemento, nos centros germinativos
em desenvolvimento.
Tem sido demonstrada uma depleo marcada das clulas TCD4 + de
memria, durante a infeco aguda, em particular das que expressam o
coreceptor CCR5, nos tecidos linfides secundrios, nomeadamente no tubo
digestivo2. Estas alteraes, induzidas na fase de disseminao do vrus, s
so, parcialmente, recuperadas aps a emergncia das respostas imunitrias
ou o incio da teraputica anti-retrovrica combinada (TARVc), tendo-lhes
sido atribudo um papel importante na patognese, por exemplo, atravs do
favorecimento de translocao bacteriana intestinal, podendo os produtos
bacterianos contribuir para a activao persistente do sistema imunitrio,
que caracteriza a infeco por VIH2.
58 Ana Espada de Sousa, Rui Victorino

Apesar da resposta do sistema imunitrio ser capaz de eliminar, com


eficcia, clulas, produtivamente, infectadas, persistem no organismo reser-
vatrios vricos, de que so exemplos os viries retidos pelas clulas foli-
culares dendrticas nos centros germinativos, as clulas T e macrfagos
latentemente infectados, que possuem o ADN provrico, mas que no ex-
pressam protenas vricas e, por isso, escapam ao sistema imunitrio 3. A
instituio de TARVc precoce, antes da seroconverso, no parece evitar o
estabelecimento de reservatrios vricos, embora diminua o nmero de c-
lulas TCD4+, com infeco latente, e se associe normalizao de alguns
parmetros imunitrios3.

Infeco crnica: Perodo de latncia clnica


Aps a infeco aguda, inicia-se um perodo, em mdia de oito a 10 anos,
de infeco crnica assintomtica, que se sabe hoje corresponder, apenas,
a latncia clnica, uma vez que a replicao vrica persiste e se observa agra-
vamento progressivo das alteraes imunitrias. A durao deste perodo ,
no entanto, muito heterognea, havendo indivduos infectados, que podem
desenvolver, rapidamente, em cerca de um ano, denominados rapid progres-
sors, linfopenias TCD4+ extremas, com infeces oportunistas graves e, por
outro lado, outros que permanecem assintomticos e com linfcitos TCD4 +
prximos dos nveis normais ao fim de 15 anos, sendo designados por long-
term nonprogressors4.
Mltiplos estudos tm procurado marcadores clnicos definidores do
prognstico de evoluo da doena5. A imunodeficincia, associada a VIH,
caracteriza-se por diminuio progressiva do nmero de linfcitos TCD4 +
circulantes e, na realidade, os nmeros absolutos de clulas TCD4+ emergi-
ram como o marcador central da doena. A percentagem e o ritmo de perda
de linfcitos TCD4+, no sangue perifrico, revelaram-se, igualmente, marca-
dores laboratoriais vlidos de progresso. Outros marcadores, que foram
propostos, traduzem o estado de activao do sistema imunitrio, como, por
exemplo, a -2 microglobulina, a neopterina e os receptores solveis do
factor de necrose tumoral (TNF-) ou a expresso de CD38 nos linfcitos
TCD8+, bem como as alteraes funcionais, que caracterizam a imunodefi-
cincia, de que so exemplos os testes cutneos de sensibilidade a antignios
ou as respostas proliferativas linfocitrias in vitro, ao anticorpo anti-CD3. O
desenvolvimento de metodologias mais sensveis, de quantificao da carga
vrica, veio mostrar que, em paralelo com a queda progressiva do nmero
de linfcitos TCD4+, se observa aumento do nmero de cpias de ARN
vrico, no sangue perifrico. Embora estes parmetros se correlacionem, os
trabalhos de Mellors, et al. revelaram que o nmero de cpias de ARN v-
rico constitui um marcador de prognstico independente das contagens de
linfcitos TCD4+ e que, alm disso, para um mesmo nmero de linfcitos
TCD4+, a quantificao da viremia define diferentes prognsticos de pro-
gresso da doena6. No entanto, recentemente, um estudo s permitiu impu-
tar viremia cerca de 10% do risco de progresso, sendo as diferenas na
Imunopatognese e resposta imunitria 59

histria natural da infeco entre os diferentes indivduos, maioritariamente,


atribudas a outros factores7. Actualmente, as recomendaes para incio da
TARVc, em indivduos assintomticos, baseiam-se, essencialmente, na conta-
gem de linfcitos TCD4+, complementada pela viremia, sendo, tambm, estes
os principais marcadores, utilizados na avaliao da resposta teraputica.
Os indivduos, nesta fase, apresentam, com frequncia, adenopatias gene-
ralizadas. Na verdade, observam-se importantes alteraes histopatolgicas
nos gnglios linfticos1, que tendem a evoluir, durante este perodo, de um
padro de hiperplasia folicular para uma involuo folicular, com alterao
progressiva da arquitectura linfide e dos microambientes, necessrios para a
resposta imunitria e, possivelmente, para a manuteno da homeostasia de
clulas T. Estas alteraes associam-se a progressivo aumento do nmero de
clulas, produtivamente, infectadas por VIH e a diminuio do vrus extrace-
lular, retido pelas clulas foliculares dendrticas, em paralelo com a involuo
dos folculos, o que pode contribuir para a redistribuio da carga vrica
entre os gnglios linfticos e a periferia, com aumento da viremia. Os meca-
nismos implicados nestas alteraes histopatolgicas constituem uma rea
importante de investigao e podero envolver quer a aco directa do vrus
atravs da infeco das clulas foliculares dendrticas e dos efeitos de prote-
nas vricas, quer perturbaes imunorregulatrias provocadas pela activao
imunitria persistente e a progressiva depleo de linfcitos T auxiliares1.

Doena avanada: Sndrome de imunodeficincia adquirida


A progresso da doena leva ao risco crescente de aparecimento ou reacti-
vao de infeces oportunistas (Fig. 1). A depleo e as alteraes funcio-
nais dos linfcitos TCD4+ comprometem a resposta adequada do sistema
imunitrio e, assim, mesmo os microrganismos ubquos de virulncia limi-
tada, como Mycobacterium avium ou Pneumocystis jirovecii, podem gerar
patologia que determina a morte. A listagem das situaes clnicas, defini-
doras da fase avanada de imunodeficincia, vulgarmente rotulada como sida
, periodicamente, revista pelos Centers for Disease Control and Prevention
(CDC), nos Estados Unidos da Amrica (EUA), e inclui numerosas infeces,
bem como neoplasias, na sua maioria relacionadas com a reactivao de
microrganismos oportunistas, como certos linfomas (vrus de Epstein-Barr),
carcinoma do colo do tero (papilomavrus) e sarcoma de Kaposi (herpes-
vrus 8). Por outro lado, inclui, tambm, como critrio definidor de sida,
contagem de linfcitos TCD4+ igual ou inferior a 200 cls/l, que se sabe
traduzir risco acrescido de infeces oportunistas, e a sndrome consumpti-
va crnica, que se pensa estar relacionado com os mltiplos distrbios
imunoendcrinos, que se associam doena avanada.

Respostas imunitrias especficas para VIH


As respostas especficas desenvolvidas contra VIH parecem ser determinan-
tes, para o controle da replicao vrica e para a evoluo da doena. Vrios
60 Ana Espada de Sousa, Rui Victorino

factores intrnsecos, das clulas, tm sido identificados como determinantes


na restrio da infeco vrica, bloqueando a infeco por VIH ou limitan-
do a replicao vrica, como por exemplo tripartite motif-containing protein
5 (TRIM5-), as molculas da famlia apolipoprotein B mRNA editing
enzyme, catalytic polypeptide-like (APOBEC) ou bone marrow stromal cell
antigen 2 (BST-2), tambm conhecida por tetherin/CD317/HM1.24. Embo-
ra os estudos, em indivduos expostos a VIH, que permanecem no-infec-
tados, sejam a favor da existncia de respostas imunitrias protectoras
contra o vrus8, no foram, ainda, identificados os corolrios da resposta
protectora eficaz, o que tem constitudo o principal obstculo ao desenvol-
vimento de uma vacina9. Para uma melhor sistematizao, as respostas
especficas anti-VIH podem ser agrupadas em humorais e celulares.

Respostas humorais
Os anticorpos anti-p24 parecem contribuir para o declnio da viremia, aps
a infeco aguda, e a perda destes anticorpos est associada progresso
da infeco.
Os anticorpos neutralizantes, assim chamados porque se ligam a compo-
nentes do vrus e impedem a sua ligao s clulas-alvo, teriam, segundo alguns
autores, um papel importante no controle da viremia, na transio da fase
aguda para a fase crnica de latncia clnica e estariam associados a progns-
tico favorvel, embora esta seja uma rea de resultados controversos10.
Alguns anticorpos contra VIH tipo 1 (VIH-1), particularmente contra as
protenas do invlucro gp120 e gp41, tm a capacidade de se ligar ao re-
ceptor Fc de clulas capazes de mediarem reaces citotxicas, dependentes
de anticorpos (ADCC), contra clulas infectadas por VIH ou que apresentem
sua superfcie a gp120. Estes anticorpos so detectados logo aps a in-
feco aguda e parecem diminuir nas fases avanadas da doena.

Respostas de imunidade celular


Linfcitos T citotxicos

As respostas celulares contra o vrus so, maioritariamente, mediadas por


clulas TCD8+ citotxicas clssicas (linfcitos T citotxicos [CTL]), isto ,
que reconhecem os determinantes vricos, nas clulas infectadas, atravs da
apresentao antignica, no contexto do complexo major de histocompati-
bilidade (HLA) classe I e tm a capacidade de induzir a lise directa destas
clulas11. A expanso de CTL detectada na altura da sndrome vrica
aguda e do pico da viremia, podendo atingir frequncias muito elevadas no
sangue perifrico (at 1% das clulas mononucleadas) e parece ser crucial,
para o declnio posterior da viremia plasmtica. Por outro lado, tem sido
sugerido que as caractersticas desta resposta citotxica inicial, em termos
da capacidade de expandir maior diversidade de famlias V, constitui um
marcador de progresso da doena, independente da viremia. Os linfcitos
Imunopatognese e resposta imunitria 61

T podem ser classificados de acordo com a expresso de diferentes genes


V do receptor de clulas T em 24 famlias V e, de acordo com os estu-
dos de Pantaleo G, et al., publicados em 1997, quanto maior o nmero de
famlias envolvidas nesta expanso inicial dos CTL, mais eficaz parece ser o
controlo do vrus.
O desenvolvimento de metodologias, que permitem a quantificao de
frequncia de clulas TCD8+ especficas, por citometria de fluxo, atravs do
uso de tetrmeros de molculas de HLA, conjugados com fluorocromos em
associao com pptidos de VIH, vieram revelar frequncias, ainda, mais
elevadas de CTL, do que as, previamente, descritas, usando mtodos de di-
luio limitante e demonstraram correlao inversa entre a frequncia destas
clulas e a carga vrica. Na infeco crnica, de acordo com os estudos do
grupo de McMichael A, cerca de 0,11,0% de todas as clulas TCD8 +
do sangue perifrico so, habitualmente, especficas para eptopos vricos
imunodominantes. Estas frequncias, so, ainda, mais elevadas na infeco
aguda, podendo ser detectadas, claramente, antes da seroconverso, em
estreita correlao temporal com a viremia. Estas metodologias permitiram
documentar diminuio da frequncia de CTL especficos, aps reduo da
viremia com TARVc.
Outro dado a favor do papel protector dos CTL deriva da evidncia
crescente da presena de respostas citotxicas vigorosas contra VIH, em
indivduos expostos e no-infectados8.
Apesar destes dados apontarem para papel benfico das respostas cito-
txicas especficas para VIH, alguns autores tm salientado o papel delet-
rio da citlise das clulas infectadas e algumas observaes sugerem, tam-
bm, papel patognico dos CTL, em quadros de patologia neurolgica e
pulmonar associadas a VIH.
Apesar deste debate continuar, o consenso dominante , por agora, a
favor da aco benfica destas clulas. A evoluo da infeco tem sido
interpretada como o resultado de um equilbrio complexo entre, por um
lado, a capacidade do vrus de escapar aco dos CTL, atravs de muta-
o de eptopos determinantes dessa resposta, sem que estas mutaes
acarretem diminuio da sua competncia replicativa e, por outro, a ca-
pacidade dos alelos HLA de classe I do hospedeiro se ligarem a mltiplos
eptopos vricos. Vrios estudos tm evidenciado a presso selectiva sobre o
vrus, exercida pelos CTL, e, por outro lado, a importncia da plasticidade
da resposta citotxica, para controlar a emergncia de estirpes mutantes.
Ao longo da evoluo da infeco so vrios os mecanismos que pode-
ro contribuir para a perda da actividade citotxica (Quadro 1). As protenas
acessrias Tat, Nef e Vpu de VIH-1 tm a capacidade de promover a dimi-
nuio da expresso de molculas HLA classe I, da superfcie da clula
impedindo, assim, o reconhecimento antignico pelos linfcitos TCD8 +. A
protena Nef , ainda, capaz de induzir a expresso de ligandos da molcu-
la Fas nas clulas infectadas, o que promove a apoptose dos CTL, envolvi-
dos na lise daquelas clulas. Tem sido, tambm, sugerido que a activao
e expanso marcadas dos CTL, especficas para VIH, possa levar exausto
62 Ana Espada de Sousa, Rui Victorino

Quadro 1. Mecanismos de escape de VIH s respostas citotxicas especficas


Provrus latente Ausncia de expresso de antignio
Sequestrao celular Invisibilidade do antignio
Uso do receptor CXCR4 Insensibilidade s CC quimiocinas
Diminuio da expresso de HLA classe I Invisibilidade para as clulas TCD8+
Diminuio da expresso de HLA classe II Invisibilidade para as clulas TCD4+
Induo de Fas ligando Apoptose das clulas especficas
Mutao dos eptopos No reconhecimento
Adaptado de McMichael AJ, et al. Nature. 2001;410:980-7.

das respostas antivricas. Pantaleo G, et al. documentaram a perda de res-


postas citotxicas especficas, na fase aguda da doena, na ausncia de
mutaes de escape vrico, que as pudessem explicar. Uma evidncia a
favor da senescncia replicativa desta populao a acumulao na perife-
ria de clulas TCD8+, terminalmente diferenciadas, com baixo potencial
clonognico e com diminuio da dimenso dos telmeros. Para alm disso,
a activao crnica e a perda de funo T auxiliar, com a progressiva de-
pleo de linfcitos TCD4+, podem levar ao estado de anergia funcional dos
CTL, bem como de susceptibilidade aumentada apoptose, contribuindo
para a perda de actividade citoltica, com a progresso da doena.

Factores supressores solveis

Levy J, et al. descreveram, em 1986, a capacidade das clulas TCD8+ ini-


birem a replicao vrica, por uma actividade no-citoltica, mediada por
factores solveis. Esse factor, a que foi chamado CD8 Antiviric Factor
(CAF), actua por mecanismo no restrito pelo HLA, ao nvel da transcrio
vrica e no parece identificar-se com nenhuma das citocinas conhecidas ou
com os factores solveis posteriormente identificados. Esta actividade su-
pressora diminui com a progresso da doena, mas est preservada nos
indivduos long-term nonprogressors.
Por outro lado, as ligaes naturais do receptor CCR5, o principal
coreceptor das estirpes M-trpicas, constituem importantes factores solveis
supressores do VIH. Estas quimiocinas (Regulated upon Activation, Nor-
mal T-cell Expressed, and Secreted [RANTES], Macrophage inflammatory
protein type 1 alpha [MIP1]- e Macrophage inflammatory protein type 1
beta [MIP1-]) competem com o vrus para o uso do receptor CCR5 e
bloqueiam, desta forma, a entrada do vrus na clula. Estas quimiocinas
so libertadas, rapidamente e em grande quantidade, aps a estimulao
especfica das clulas TCD8+ pelos antignios de VIH, evidenciando cone-
xo desta resposta com a resposta efectora citoltica. Embora sejam maio-
ritariamente produzidas pelos linfcitos TCD8 +, podem tambm ser produ-
zidas por outros tipos celulares. A investigao da relao entre os nveis
de quimiocinas e a progresso da doena tem gerado resultados contra-
ditrios. Contudo, foi sugerido papel protector destas quimiocinas, em
Imunopatognese e resposta imunitria 63

indivduos, frequentemente, expostos a VIH-1, mas no infectados. Outros


factores secretados por linfcitos TCD8+ activados e outras clulas tm
demonstrado propriedades supressoras da replicao vrica, mas no est
ainda claro o seu papel na imunopatognese da doena.

Respostas das clulas TCD4+


As clulas TCD4+ ou auxiliares (helper) reconhecem os eptopos, no con-
texto da apresentao dependente do HLA classe II, e respondem atravs
da sua proliferao e produo de citocinas, de que se destaca a interleuci-
na 2 (IL-2), que so determinantes para a orquestrao e ampliao da
resposta dos diferentes componentes do sistema imunitrio, de forma a
obter resposta efectora eficaz. Embora tenham sido identificados vrios
eptopos vricos para as clulas T auxiliares, os estudos in vitro de respos-
tas proliferativas de clulas mononucleadas, do sangue perifrico, mostraram
que aquelas desaparecem, precocemente, aps a infeco aguda e so, fra-
camente, recuperadas pela TARVc. Alguns autores documentaram a preser-
vao destas respostas em indivduos sem progresso da doena e com
controle da viremia, em paralelo com a presena de vigorosas respostas
citotxicas especficas, bem como em indivduos tratados, logo aps a in-
feco aguda, antes de ocorrer a seroconverso.
Os estudos das respostas especficas dos linfcitos TCD4+, ao nvel da
clula individualizada, vieram demonstrar a presena de clulas TCD4+ espe-
cficas para VIH, no sangue perifrico da maioria dos infectados, e sugerem
tendncia para a sua diminuio em indivduos com progresso da doena,
sendo estas clulas um alvo preferencial da infeco por VIH12. Estes estudos
so baseados na induo especfica de produo de citocinas, pelos linfcitos
TCD4+, em resposta a eptopos de VIH e na quantificao da sua frequncia,
por citometria de fluxo, aps marcao intracelular, das citocinas com fluoro-
cromos. Estes estudos revelaram, tambm, que a frequncia destas clulas
tende a diminuir com a reduo da viremia sob TARVc, o que representaria o
argumento a favor da necessidade de vacinaes teraputicas complementares.

Disfuno do sistema imunitrio


A infeco por VIH associa-se a alteraes funcionais de, praticamente,
todos os componentes do sistema imunitrio. Algumas destas alteraes so
devidas aco directa do vrus, outras relacionam-se com o estado de
activao crnica generalizada observado, nestes doentes, ou, ainda, so
inerentes depleo de linfcitos T auxiliares, dado o papel central destas
clulas na orquestrao do sistema imunitrio. De facto, alm de alteraes
quantitativas e qualitativas das clulas T, observam-se alteraes em todas
as populaes celulares, envolvidas na resposta imunitria. Logo aps a
infeco primria documenta-se hiperactivao dos linfcitos B, com hiper-
-globulinemia marcada. Esta activao B , em parte, especfica, gerando
quantidade elevada de anticorpos para VIH e, em parte, no dependente de
64 Ana Espada de Sousa, Rui Victorino

antignios, para a qual contribui a activao directa dos linfcitos B, pelas


protenas gp120 e gp41 vricas. A imunodeficincia associa-se a dfices
precoces da imunidade inata, como a perda de actividade ltica das clulas
natural killer (NK). Estudos envolvendo clulas dendrticas demonstraram
a sua infeco por VIH e a sua progressiva depleo e disfuno, no de-
curso da infeco, embora estas observaes no tenham sido corroboradas
por alguns autores, o que pode ser devido a diferenas, no isolamento e na
caracterizao daquelas clulas. Apesar de no se observar, em regra, dimi-
nuio do nmero de moncitos e ser rara a documentao de infeco, nos
moncitos em circulao, VIH infecta com facilidade e replica, extensiva-
mente, nas clulas desta linhagem, sem aparente efeito citoptico directo,
constituindo os macrfagos, dos tecidos, importantes reservatrios de VIH.
Por outro lado, so reconhecidas, desde h longa data, alteraes da fago-
citose e da capacidade oxidativa, bem como da quimiotaxia e da produo
de citocinas, pelos moncitos, em indivduos infectados por VIH-1. Tambm,
existe evidncia a favor de activao dos leuccitos polimorfonucleares, com
aumento da sua susceptibilidade apoptose e a alteraes funcionais.
Estas mltiplas alteraes, descritas nos diferentes componentes do
sistema imunitrio, contribuem para a imunodeficincia e podem ser de-
terminantes para o aparecimento e evoluo de infeces oportunistas. No
entanto, a gnese da imunodeficincia centra-se nas alteraes numricas
e funcionais das clulas TCD4+ e TCD8+ e, portanto, o foco principal
neste captulo sero os potenciais mecanismos envolvidos nas perturbaes
dos linfcitos T. O papel da activao crnica generalizada do sistema
imunitrio e dos distrbios na produo de citocinas sero destacados,
pela sua importncia na imunopatognese, por constiturem dois alvos
importantes de teraputicas de base imunitria, na imunodeficincia asso-
ciada a VIH.

Perturbaes das clulas T


A identificao, logo no incio da epidemia, da molcula CD4, como o
principal receptor de VIH e dos linfcitos T auxiliares, como a principal
populao alvo da infeco, focalizou a investigao da imunopatognese
da doena nos mecanismos envolvidos na depleo das clulas TCD4+
(Quadros 2 e 3). Vrios mecanismos foram documentados in vitro, potencial-
mente implicados na citopatogenicidade directa do vrus, nomeadamente:
a)Acumulao de ADN vrico no integrado no citoplasma da clula.
b)Interferncia com o processamento celular do ARN, devido presen-
a de ARN vrico e de molculas aberrantes de ARN, em grande
quantidade.
c)Interaco a nvel intracelular da gp120 vrica com a molcula CD4,
com induo de morte celular.
d)Perda de integridade da membrana celular, devida morfognese e
libertao dos viries, bem como ao aumento da concentrao intra-
celular de caties monovalentes induzidas por VIH.
Imunopatognese e resposta imunitria 65

Quadro 2. Causas da depleo de clulas T destruio de clulas TCD4 + maduras


Destruio directa de clulas infectadas:
Apoptose mediada pelas glicoprotenas do envelope vrico.
Paragem na fase G2, induzida por Viral Protein R (Vpr) e apoptose.
Alterao da integridade da membrana celular/formao de sinccios.
Acumulao de ADN vrico no-integrado.
Induo indirecta da morte de clulas no-infectadas:
Citlise por clulas T citolticas especficas para VIH ou por clulas NK.
Reaces auto-imunes de natureza humoral ou celular.
Incorporao para os sinccios de clulas infectadas vizinhas.
Induo de apoptose, aps activao celular ou cross-linking de gp120 TCD4+.
Aumento da transmisso VIH e/ou apoptose, aps interaco com clulas apresentadoras
de antignios infectadas.
Adaptado de McCune JM. Nature. 2001;410:974-9.

Quadro 3. Causas da depleo de clulas T diminuio da produo de clulas T


Infeco pelo vrus das clulas progenitoras, levando sua morte ou disfuno.
Destruio da rede estromal, de suporte necessria para a hematopoiese directa ou
indirectamente pelo vrus.
Infeco dos timcitos e induo de alteraes no micro-ambiente do timo, que impedem
a timopoiese.
Infeces oportunistas localizadas na medula ssea (p. ex. por vrus citomeglico ou
Mycobacterium avium intracellulare).
Disfuno de citocinas.
Apoptose induzida por VIH.
Efeitos mielotxicos dos frmacos.
Deficincias em vitaminas ou outros factores essenciais.
Alteraes dos rgos linfides secundrios, que diminuem a sobrevivncia das clulas T,
recentemente, produzidas e a sua incorporao no compartimento de clulas T circulantes.

No entanto, o papel destes mecanismos in vivo no est clarificado. A


lise das clulas, infectadas por VIH, pode, tambm, ser consequncia das
respostas do hospedeiro contra o vrus mediadas por CTL, clulas NK ou
envolvendo respostas do tipo ADCC, conforme referido anteriormente. Dada
a evidncia de efeitos citopticos do vrus in vitro, nestas clulas, era plau-
svel pensar que a depleo de clulas TCD4+ podia ser uma consequncia
directa da infeco celular in vivo. Contudo, a frequncia de linfcitos TCD4+
do sangue perifrico infectados por VIH, durante a fase assintomtica varia
de um em 1.000 a um em 10.000 e embora aumente com a progresso da
infeco, raramente excede um em 100. Alm disso, a percentagem de c-
lulas, que expressa o ARN de polaridade positiva (ARNm) vrico ou que
possui o ADN provrico , geralmente, inferior a 1% no tecido linfide, o
que sugere que a morte celular resultante, directamente, da infeco da
clula por VIH, no seja o mecanismo predominante da depleo de linf-
citos TCD4+. Alguns autores, como Ho D, defenderam a possibilidade de
66 Ana Espada de Sousa, Rui Victorino

a depleo de TCD4+ poder ser, largamente, explicada pela morte, por aco
citoptica directa do vrus, de uma populao celular que, embora pequena
em nmero, tivesse um turnover muito aumentado, ou seja, estas clulas,
recentemente, infectadas produziriam vrus, que infectariam outras clulas
e morreriam de imediato, no sendo detectadas pelos mtodos, actualmente,
disponveis. No entanto, a maioria dos autores e os dados actuais apontam
para o envolvimento de outros mecanismos, como principais determinantes
da imunopatognese, conforme a seguir se detalha 5.
As glicoprotenas do envelope vrico podem, tambm, por si s, mediar
vrios processos, que conduzem morte celular. Estas glicoprotenas podem
promover a fuso com clulas no infectadas, levando formao de clu-
las multinucleadas gigantes ou sinccios, que so, no entanto, raramente
observados nos tecidos dos indivduos infectados. Por outro lado, existe
homologia significativa entre algumas regies das glicoprotenas vricas e
certos alelos HLA, HLA-DR, HLA-DQ de classe 2, cadeias pesadas HLA
de classe I, regies do receptor das clulas T, a molcula Fas, domnios
funcionais da imunoglobulina G (IgG) e da IgA, colagnio desnaturado,
componentes do complemento e vrios antignios nucleares, que podem
gerar respostas patognicas auto-imunes. A gp120 liberta-se, com facilidade,
dos viries e pode ligar-se a clulas no infectadas, levando ao seu reco-
nhecimento e destruio indevidos pelo sistema imunitrio. Alm disso, a
ligao da gp120 s clulas pode veicular sinais inapropriados, que levem
anergia e apoptose, por mltiplas vias. Estas propriedades imunossupres-
soras e indutoras de apoptose da gp 120, in vitro, tm sido consideradas
relevantes para o estabelecimento da imunodeficincia.
De facto, os indivduos infectados por VIH apresentam susceptibilidade
aumentada dos linfcitos apoptose quer espontnea, quer em resposta a
estmulos proliferativos e a frequncia de clulas apoptticas nos gnglios
linfticos , significativamente, mais elevada nestes indivduos, do que nos
saudveis. A apoptose envolve, predominantemente, clulas no infectadas
e os trabalhos de Muro-Cacho, et al. sugerem que a intensidade da apop-
tose se relaciona com o grau de activao imunitria e independente dos
nveis de TCD4+ perifricos e da viremia. Embora esta ausncia de corre-
lao entre a fase da infeco e o grau de susceptibilidade apoptose tenha
sido corroborada por outros autores, existem estudos que documentam au-
mento da susceptibilidade apoptose, com a progresso da infeco, atribuin-
do-lhe papel importante na disfuno progressiva e na depleo linfocitria.
A favor desta hiptese so, tambm, os estudos que mostram que os nveis
aumentados de apoptose diminuem, rapidamente, em paralelo, com a redu-
o da viremia, aps o incio de TARVc e os estudos em modelos animais,
documentando aumento de apoptose nas clulas TCD4+ de primatas infec-
tados por estirpes patognicas de vrus da imunodeficincia smia (VIS),
que no observado na infeco por estirpes de VIS no-patognicas 13.
O organismo tende a manter, relativamente, constante o nmero total de
linfcitos TCD3+, atravs de mecanismos reguladores, que permanecem
pouco claros e que envolvem um balano estreito entre as taxas de produo
Imunopatognese e resposta imunitria 67

e de morte celular. O nmero total de linfcitos T, no sangue perifrico,


tende a manter-se constante nas fases iniciais e intermdias da infeco por
VIH e diminui nos estdios avanados. Assim, o declnio progressivo dos
linfcitos TCD4+, que se observa no sangue perifrico, acompanhado pela
expanso de linfcitos TCD8+, mantendo, assim, os nveis de linfcitos T
at s fases avanadas, em que h depleo das duas subpopulaes 5.
A expanso da subpopulao TCD8+ observa-se logo aps a infeco
primria e leva inverso do quociente TCD4+/TCD8+, no sangue perifri-
co. A opinio dominante de que esta expanso surge em resposta repli-
cao vrica e que inclui uma proporo importante de CTL especficos para
VIH. Parte significativa desta populao constituda por linfcitos TCD8 +,
que tiveram contacto com o antignio e sofreram diferenciao terminal em
clulas efectoras, conforme sugerido pela perda de molculas de co-estimu-
lao CD28 e CD27 e pela reduo de dimenso dos telmeros. Estas c-
lulas tm, portanto, reduzida capacidade replicativa e baixa sobrevivncia
in vitro, embora exista evidncia a favor de terem uma sobrevida longa em
circulao. Os factores que determinam a persistncia destas clulas e a sua
contribuio para a desregulao da homeostasia das subpopulaes T per-
manecem sob intenso debate.
A depleo de linfcitos TCD4+, no sangue circulante, mais precoce
do que a perda de clulas TCD4+ do tecido linfide, onde a inverso do
quociente TCD4+/TCD8+ s se observa nas fases avanadas, quando a ar-
quitectura dos gnglios linfticos est profundamente alterada, sugerindo
que alteraes de trfego celular poderiam estar envolvidas nesta perda
precoce de clulas TCD4+, no sangue perifrico5. Estas poderiam ser de-
vidas reteno de linfcitos TCD4+, nos gnglios linfticos, pelo vrus a
localizado, levando expanso compensatria na periferia dos linfcitos
TCD8+. Alternativamente, a populao de TCD8+, expandida logo aps a
infeco primria, adquiriria um fentipo, em termos de molculas de
coestimulao e de adeso, que levaria sua permanncia em circulao,
condicionando o nmero de linfcitos TCD4+. Embora existam dados que
suportam estas hipteses, outros mecanismos tero que estar envolvidos,
para explicar a progresso da doena5.
Margolick JB, et al. propuseram, em 1995, uma explicao alternativa,
baseados na hiptese de que a homeostasia das clulas T seria cega, ou
seja, o organismo responderia sempre perda de clulas T com produo
quer de clulas TCD4+, quer de TCD8+. Assim, a perda de linfcitos TCD4+
seria reposta, equitativamente, com linfcitos TCD4+ e TCD8+, o que leva-
ria depleo efectiva dos linfcitos TCD4+. Esta resposta homeosttica
perder-se-ia nas fases avanadas, determinando a progresso para a sida.
Esta hiptese tem sido questionada, dada a dificuldade em explicar outras
situaes fisiolgicas e patolgicas, com base na homeostasia cega, de
recuperao das flutuaes das populaes linfocitrias.
Apesar da expanso dos linfcitos TCD8+, a caracterizao mais deta-
lhada de subpopulaes nave (clulas que ainda no foram expostas ao
antignio para que so especficas) e memria/efectoras (clulas que aps
68 Ana Espada de Sousa, Rui Victorino

a exposio ao antignio se diferenciaram no sentido de reconhecerem e


responderem, rapidamente, segunda exposio ao antignio ou no sentido
de clulas capazes de mediarem a resposta efectora ao antignio em causa)
mostrou que a infeco, por VIH, se associa perda progressiva de clulas
TCD8+ nave, ao longo da doena.
A anlise destas subpopulaes nave e memria/efectora, nos linfcitos
TCD4+, revelou que a perda inicial , sobretudo, de clulas nave, levando
ao aumento relativo da percentagem de clulas memria/efectoras nos lin-
fcitos TCD4+ totais apesar de VIH infectar, preferencialmente, clulas de
memria/efectoras.
Estes achados reforaram a hiptese do compromisso dos mecanismos
de produo de novas clulas pelo organismo, no decurso da infeco por
VIH. No indivduo adulto saudvel, a produo de linfcitos resulta da ti-
mopoiese residual e da expanso perifrica dos linfcitos existentes. O
turnover destes no se encontra, claramente, quantificado, havendo, no en-
tanto, a evidncia de que o turnover das clulas de memria muito maior
do que o das clulas nave e que os linfcitos nave tero uma sobrevida
mais prolongada.
VIH infecta os progenitores tmicos e hematopoiticos, bem como pro-
move a alterao dos micro-ambientes necessrios, para a eficaz diferencia-
o e produo celular nestes rgos, atravs de efeitos directos das prote-
nas vricas ou de alteraes induzidas na rede de citocinas (Quadro 3). Por
outro lado, se o timo tivesse capacidade de efectuar a repopulao celular
efectiva, esperar-se-ia manuteno do repertrio linfocitrio, ou seja, da re-
presentao perifrica de linfcitos, com especificidade para os diferentes
possveis antignios, o que no o caso, uma vez que foram documentadas
deplees importantes, no repertrio de receptores de clulas T, no decurso
da imunodeficincia. No entanto, em alguns indivduos infectados por VIH1
aps a teraputica anti-retrovrica (TARV), parece observar-se aumento da
produo tmica, medida por quantificao de produtos resultantes do re-
arranjo do receptor das clulas T durante o seu desenvolvimento no timo
(T cell receptor excision cycles [TREC]), que poder contribuir para a pro-
gresso mais lenta da imunodeficincia e para a melhor capacidade de re-
constituio imunitria aps a TARVc14. O timo configura-se, assim, como
o rgoalvo de intervenes teraputicas de base imunitria. Por outro lado,
as estimativas do turnover linfocitrio em infectados por VIH, bem como a
avaliao dos mecanismos envolvidos na regulao da expanso dos linf-
citos na periferia, constituem uma das principais reas actuais de investiga-
o da imunopatognese da infeco VIH/sida.
Tende hoje a ser consensual que mltiplos factores esto envolvidos nas
perturbaes da homeostasia linfocitria, na imunodeficincia associada ao
VIH (Quadros 2 e 3). No entanto, a relativa contribuio da possvel aco
citoltica directa da infeco vrica in vivo, da redistribuio celular asso-
ciada s alteraes do trfego linfocitrio, da diminuio de produo de
novo de linfcitos, a partir dos progenitores hematopoiticos multipotenciais
da medula ssea ou das clulas progenitoras de linhagem T do timo, bem
Imunopatognese e resposta imunitria 69

como do compromisso da expanso adequada de linfcitos, nos rgos


linfides perifricos, permanecem por clarificar.
A infeco por VIH associa-se, para alm de alteraes quantitativas, a
alteraes qualitativas dos linfcitos, que esto presentes mesmo antes de
haver perda significativa do nmero de linfcitos TCD4 + circulantes e que
se traduzem em diminuio da capacidade proliferativa linfocitria, alterao
da produo de citocinas e compromisso das respostas de imunidade celular,
avaliada por testes de hipersensibilidade cutnea retardada. Shearer, et al.
propuseram, em 1989, o estadiamento das alteraes funcionais T auxiliares,
em que a progresso da doena estaria associada a perda sequencial de
respostas proliferativas in vitro aos antignios, aloantignios e, por fim, aos
mitognios. Os mecanismos subjacentes, a estas alteraes funcionais, no
se encontram, ainda, completamente clarificados. Um dos factores que con-
tribui para esta perda de funo a activao generalizada do sistema
imunitrio, expressa nas mltiplas alteraes fenotpicas dos linfcitos, que
a seguir se descrevem.

Papel da activao crnica


Os indivduos infectados por VIH apresentam frequncia elevada de linf-
citos T activados, no sangue perifrico, associando-se alguns dos marcado-
res de activao linfocitria a um prognstico adverso, como, por exemplo,
o aumento da expresso de CD38, particularmente em simultneo com HLA
DR nos linfcitos TCD8+ circulantes5.
A activao/proliferao celular fundamental, para que o vrus seja
integrado no genoma da clula hospedeira e replique eficazmente (Fig. 2).
Alm da activao do sistema imunitrio, resultante das respostas especficas
a VIH, certas protenas vricas, como a Nef, so capazes por si s de indu-
zir a activao celular. O vrus induz, assim, activao persistente do sistema
imunitrio, que reverte em seu benefcio, permitindo a manuteno da infec-
o de novas clulas e da replicao vrica. Um nmero crescente de dados
sugere que a replicao vrica, in vivo, est dependente da activao dos
linfcitos TCD4+. Os infectados por VIH apresentam aumentos transitrios
da viremia, na sequncia de infeces intercorrentes ou de imunizaes com
vrias vacinas, como a do ttano ou da gripe. Este aumento da carga vrica
correlaciona-se inversamente com a fase da infeco, sugerindo que a indu-
o da replicao vrica tanto maior, quanto maior for a capacidade do
sistema imunitrio de desenvolver a resposta imunitria.
A activao celular leva expanso clonal dos linfcitos e induz anergia
e aumento da susceptibilidade apoptose, que actuam como mecanismos
reguladores dessa proliferao. Assim, a activao imunitria crnica um
dos factores determinantes da anergia linfocitria e dos nveis elevados de
apoptose, documentados nos indivduos infectados por VIH.
Por outro lado, os perfis de activao das populaes linfocitrias, nos te-
cidos, contribuem de forma decisiva para os padres de migrao das clulas
e para os ritmos de turnover linfocitrio. Assim, o estado de panactivao,
70 Ana Espada de Sousa, Rui Victorino

que se observa na infeco por VIH, tem papel importante nas alteraes
descritas de trfego celular e na perturbao dos micro-ambientes necess-
rias para a expanso e renovao celulares1,2,5.
A interveno, ao nvel do estado de activao e proliferao celulares,
constitui uma das vias em explorao, para intervenes teraputicas de base
imunitria. O uso de imunossupressores tem sido proposto na infeco
aguda, de forma a limitar o estabelecimento de reservatrios vricos e, por
outro lado, a aco da hidroxiureia, em associao com anti-retrovricos
(ARVs) , em parte, mediada pelo seu efeito limitante da proliferao ce-
lular. Uma estratgia alternativa prope a induo da activao celular e
disseminao vrica sob TARVc, com o objectivo de activar as clulas, la-
tentemente, infectadas e erradicar estes reservatrios vricos3. Esta interven-
o tem sido tentada atravs do uso de citocinas como a IL-2 ou a inter-
leucina 7 (IL-7).

Citocinas e VIH
As citocinas so mediadores solveis das respostas imunitrias, determinan-
do a activao e diferenciao celulares, bem como a quimiotaxia e a in-
flamao.
VIH tem a capacidade de induzir, directamente, a produo de algumas
citocinas, como o TNF- e a interleucina 6 (IL-6), que de uma forma
autcrina e parcrina aumentam a replicao vrica. Os estudos in vitro
revelaram nmero elevado de citocinas, com efeitos indutores da replica-
o vrica, mediados quer por activao da ligao de nuclear factor B
(NF-B) s long terminal repeats (LTR) do vrus, como o TNF-, quer
atravs da modulao do estado de activao e diferenciao celular ou da
induo de proliferao linfocitria, como a IL-2. Algumas citocinas apre-
sentam efeitos variveis sobre a replicao vrica, conforme o modelo de
estudo in vitro, enquanto outras tm, claramente, efeitos supressores da
replicao vrica, como os interferes (IFN- e IFN-). Dada a complexi-
dade da rede de citocinas in vivo e o seu pleotropismo, difcil extrapolar
a partir dos efeitos in vitro. No entanto, o balano entre citocinas indutoras
e supressoras da replicao vrica contribui, certamente, para o estabeleci-
mento, em cada indivduo, de um ponto de equilbrio de replicao vrica,
que determinante para o prognstico da doena (Fig. 2).
Por outro lado, a desregulao produzida pela infeco por VIH, de
forma directa ou indirecta, na rede de citocinas, tem importantes consequn-
cias do ponto de vista imunitrio. O aumento dos nveis sricos de citocinas
pr-inflamatrias, como o TNF-, IL-1- e IL-6 contribui para muitas das
manifestaes da imunodeficincia. Apesar da IL-2 ser um estmulo poten-
te para a replicao vrica, pensa-se que a diminuio da produo de IL-2,
documentada na infeco por VIH, determinante para a incapacidade do
hospedeiro responder, adequadamente, s infeces e manter a produo
de linfcitos. Esta foi uma das bases racionais para os ensaios teraputicos
com IL-2 e, na realidade, documentou-se aumento sustentado dos nveis de
Imunopatognese e resposta imunitria 71

TCD4+ perifricos, que parece resultar da expanso extratmica das clu-


las TCD4+, previamente existentes, uma vez que no se observou recons-
tituio significativa do repertrio de receptores de clulas T. Dados recen-
tes sugerem que o impacto clnico, a longo prazo, da teraputica com IL-2
em associao com ARVs , no entanto, limitado, em comparao com a
TARV, apenas.
A IL-2, alm de estimular autocrinamente a proliferao linfocitria,
uma importante citocina Th1. Mosmann TR e Coffman RL propuseram
um modelo em que as respostas T auxiliares se polarizavam em dois tipos,
de acordo com as citocinas produzidas. Assim, as clulas TCD4 + Th1
produziriam IL-2 e IFN- e seriam responsveis pela induo de respostas
de imunidade celular e as Th2 produziriam interleucina 4 e 5 (IL-4 e IL-5),
induzindo respostas humorais e diferenciao de eosinfilos e mastcitos.
Um estado intermdio de polarizao, com produo de ambos os tipos
de citocinas, foi denominado Th0. Existe evidncia de que este modelo,
inicialmente proposto no ratinho, se aplica em imunitria humana e
relevante para a interpretao das respostas imunitrias, em vrias situaes
infecciosas e auto-imunes, embora se acumulem dados a favor destes fe-
ntipos celulares representarem polarizaes extremas, dificilmente encon-
tradas, in vivo, de um espectro contnuo de diferenciao celular. Por
outro lado, emerge, tambm, a possibilidade de existirem outras subpopu-
laes auxiliares e destes perfis funcionais de produo de citocinas se
estenderem a outras clulas, alm das TCD4 +, com possibilidade de se
regularem mutuamente. Com base em estudos das respostas de produo
de citocinas, pelas clulas mononucleadas do sangue perifrico de indiv-
duos em diferentes fases da infeco por VIH, Shearer G e Clerici M
propuseram, em 1993, que a progresso da doena se associaria perda
de respostas tipo 1 e a um aumento das respostas tipo 2. Esta desregula-
o, no sentido da produo de citocinas tipo 2, teria tambm implicaes
no aumento da susceptibilidade linfocitria apoptose e na diminuio da
produo de factores solveis pelas clulas TCD8 +. Por outro lado, as
citocinas tipo 1 estariam associadas proteco contra a infeco e cons-
tituiriam o objectivo em estratgias de vacinao. Curiosamente, de acor-
do com os trabalhos de Maggi E, et al., VIH replica, preferencialmente,
em clulas TCD4+ do tipo Th2 e Th0. Esta hiptese imunopatognica
gerou intensa controvrsia, em torno da dominncia de uma resposta tipo
2, nas fases avanadas da infeco, dada a existncia de achados experi-
mentais contraditrios, em relao produo de IL-4 e IFN-. Actual-
mente, , no entanto, relativamente consensual que a progresso da doen-
a se associa perda das respostas de imunidade celular Th1 e que esta
uma rea de importante interveno teraputica, com imunomoduladores.
Por outro lado, existe evidncia de que a progresso da doena poder
estar relacionada, tambm, com a perda de clulas produtoras de interleu-
cina 17 (IL-17), particularmente, nas mucosas, uma citocina importante,
principalmente, para a proteco contra infeces fngicas e determinadas
infeces bacterianas15.
72 Ana Espada de Sousa, Rui Victorino

Quadro 4. Sumrio dos principais obstculos ao desenvolvimento de uma vacina


Identificao de eptopos que induzam resposta CTL duradoura.
Definio de estruturas e de estratgias de imunizao que induzam anticorpos neutralizantes.
Definio de indicadores de proteco imunitria em humanos ou em modelos animais.
Estratgias para ultrapassar o problema da diversidade entre estirpes.
Expanso dos ensaios clnicos humanos:
Produo de vacinas escala clnica.
Garantir a diversidade e durao da resposta imunitria.
Priorizao e anlise dos candidatos.
Adaptado de Nabel GJ. Nature. 2001;410:1002-7.

Modelos clnicos de estudo da imunopatognese da infeco VIH


Alm dos modelos animais de infeco por VIH ou por retrovrus, que se
associam imunodeficincia smia ou felina, vrios modelos clnicos tm
sido explorados, com vista compreenso dos mecanismos envolvidos no
estabelecimento e progresso da imunodeficincia, e, ainda, na definio da
possvel resposta imunitria protectora contra a infeco, fundamental para
o desenvolvimento de uma vacina (Quadro 4).
Neste sentido, as respostas do sistema imunitrio, especficas para anti-
gnios de VIH, tm sido investigadas em indivduos expostos ao vrus, mas
sem evidncia vrica de infeco, tendo sido, consistentemente, documen-
tadas respostas T auxiliares e citotxicas8.
Um grupo de indivduos infectados por VIH, que tem sido intensamen-
te, estudado do ponto de vista vrico e imunitrio, so os chamados long
term nonprogressors, ou seja, indivduos sem evidncia de progresso cl-
nica, apesar de infeco documentada h vrios anos4. Os critrios de de-
finio, geralmente usados, incluem infeco h mais de sete anos, com
nmero de linfcitos TCD4+ circulantes superior a 600 cls/l, na ausncia
de sintomatologia e de TARVc. um grupo heterogneo de infectados, que
corresponde a menos de 5% dos seropositivos, permanecendo, actualmente,
incerto se existe uma verdadeira no-progresso da infeco ou se so in-
divduos com progresso lenta, que se situariam na cauda de um espectro
de possveis ritmos de progresso da imunodeficincia. Os dados existentes,
embora com alguma heterogeneidade, sugerem:
1 A existncia de carga vrica mais baixa nestes indivduos, apesar
da evidncia de manuteno de replicao vrica.
2 A possibilidade da no-progresso se associar a estirpes atenuadas
do vrus, como aquelas com deleo do gene nef, embora a infec-
o por estirpes menos patognicas seja documentada, apenas, numa
percentagem mnima de indivduos.
3 A possibilidade de factores genticos, como polimorfismos nos
receptores das quimiocinas ou certos hapltipos HLA terem papel
protector, embora no estejam documentados numa percentagem
elevada de casos.
Imunopatognese e resposta imunitria 73

Aumento da capacidade Produo de novo timopoiese


proliferativa linfocitria
Redistribuio
Nmero de linfcitos TCD4+

e da apoptose

8/12 semanas 24/32 semanas


Tempo aps incio de TARVc

Figura 3. Mecanismos envolvidos no aumento do nmero de linfcitos TCD4+, durante a TARVc.

4 A presena de expanso dos linfcitos CD8 circulantes, com fre-


quncias elevadas de CTL especficos para VIH e manuteno da
capacidade de produo de factores supressores solveis, bem como
a existncia de vigorosas respostas humorais e T auxiliares espe-
cficas para VIH.
Outra populao de indivduos infectados por VIH-1, que tem suscitado
muito interesse o grupo dos chamados elite controlers, indivduos que
mantm viremias abaixo dos limites de deteco dos testes disponveis, na
ausncia de TARVc e que se estima que representem menos de 0,01% dos
indivduos infectados por VIH-116. Estudos recentes sugerem que factores
genticos, bem como factores resultantes da interaco vrus-hospedeiro
contribuem para o controlo da replicao vrica. Embora nalguns indivdu-
os se documente a manuteno do nmero de linfcitos TCD4+ circulantes,
preenchendo os critrios de long term nonprogressors, num nmero signi-
ficativo observa-se perda lenta dos linfcitos TCD4 +.
A TARVc, actualmente disponvel, reduz a viremia, para nveis abaixo
dos limites de deteco, e induz subida significativa do nmero de clulas
TCD4+ circulantes, na maioria dos indivduos tratados. A caracterizao da
reconstituio imunitria putativa, sob esta teraputica, constitui um enor-
me desafio, no s pelas suas implicaes na definio das estratgias de
seguimento clnico destes indivduos (altura ideal de incio da teraputica,
descontinuao da profilaxia das infeces oportunistas, etc.), mas, tambm,
para a caracterizao do papel relativo dos possveis mecanismos de imu-
nopatognese e validao de muitas das hipteses anteriormente enunciadas.
O estudo do efeito da TARVc nos diferentes componentes do sistema imu-
nitrio, nas vrias fases da infeco, configurou-se, assim, como uma das
vias para a compreenso da imunopatognese da infeco por VIH, confor-
me referido ao longo deste captulo (Fig. 3). Em resumo, diferentes estudos
74 Ana Espada de Sousa, Rui Victorino

evidenciaram papel relevante da redistribuio celular, no aumento inicial


das contagens linfocitrias do sangue perifrico, evidenciando a importncia
das alteraes do trfico celular na gnese da linfopenia TCD4+ perifrica5.
Por outro lado, a teraputica associa-se diminuio marcada do estado de
hiperactivao celular, com melhoria da capacidade proliferativa linfocitria
e diminuio da susceptibilidade apoptose5. Embora haja evidncia de
produo de novo de linfcitos e do restabelecimento da linfopoiese, a re-
cuperao das alteraes do reportrio T , geralmente, incompleta. Por
outro lado, a TARVc no parece reconstituir, eficazmente, os linfcitos T
intra-epiteliais do tubo digestivo, mantendo-se uma depleo significativa
das clulas TCD4+ de memria nas mucosas2.
Em 1986, foi identificado um segundo vrus, capaz de se associar
imunodeficincia humana, com espectro clnico semelhante a VIH-1,
que foi designado por VIH tipo 2 (VIH-2). Os estudos clnico-epide-
miolgicos subsequentes demonstraram que a progresso da infeco
quer em termos de ocorrncia de infeces oportunistas, quer em termos
de ritmo de perda de linfcitos TCD4+, era, claramente, mais lenta na
infeco por VIH-2 do que na por VIH-1. Os indivduos infectados por
VIH-2 apresentam viremia reduzida ou, frequentemente, indetectvel, o que
poder contribuir para a sua reduzida transmisso. Embora as vias de
transmisso sejam as mesmas, a transmissibilidade de VIH-2, quer vertical
quer horizontal, muito menor, sendo muito raros os casos de transmisso
maternofetal. Estes factores determinaram que a infeco se mantivesse
largamente confinada frica Ocidental, particularmente Guin-Bissau,
onde foi descrita, e que a sua prevalncia no tenha crescido nos ltimos
anos, apesar do aumento da prevalncia de VIH-1, nesta regio. Portugal
o nico Pas fora de frica com expresso significativa da infeco por
aquele vrus, devido aos contactos com a ex-colnia da frica Ocidental,
associando-se VIH-2, actualmente, a cerca de 4% dos casos notificados de
sida.
Do ponto de vista biolgico, VIH-2, apesar de ser menos patognico do
que VIH-1, parece usar um leque mais alargado de co-receptores, em con-
junto com a molcula TCD4+ e associar-se a nveis semelhantes de ADN
provrico17. Contudo, o nmero de cpias plasmticas de ARN vrico ,
claramente, menor na infeco por VIH-2, sendo, com frequncia, inferior
aos limites de deteco, pelas metodologias correntes 18. Vrios autores tm
sugerido que este controle da viremia seria devido resposta especfica
contra o vrus, mais vigorosa por parte do sistema imunitrio. A investiga-
o imunitria, em infectados por VIH-2, tem sido muito limitada, mas os
estudos disponveis sugerem a presena de anticorpos neutralizantes, respos-
tas citotxicas e respostas T auxiliares, contra um painel alargado de antig-
nios de VIH-2, bem como a existncia de reactividade cruzada contra anti-
gnios de VIH-1 e de VIS, sem que, no entanto, a frequncia de clulas
especficas seja, aparentemente, superior ao observado na infeco por
VIH119,20. Curiosamente, estudos epidemiolgicos, conduzidos no Senegal,
revelaram que prostitutas infectadas por VIH-2 estavam, aparentemente,
Imunopatognese e resposta imunitria 75

parcialmente protegidas da infeco subsequente por VIH-1. Embora con-


troversos, estes estudos trouxeram para primeiro plano a investigao dos
mecanismos imunitrios e/ou vricos, que medeiam esta eventual proteco,
dada a sua importncia para o desenvolvimento de uma vacina. Investigaes
recentes sobre as propriedades imunolgicas da protena do invlucro de
VIH-2 (gp105) identificam diferenas em relao gp120 de VIH-1, cuja
relevncia in vivo se desconhece. Foi descrita a ligao da gp105 mol-
cula CD8, com transduo de sinal por esse receptor, que no se observa
com a gp120, bem como uma maior capacidade, por parte da gp105, de
induzir a produo de quimiocinas. Curiosamente, trabalhos do nosso
grupo documentaram maiores propriedades imunossupressoras da gp105 do
que da gp120 de VIH-1 e de VIS, ao contrrio do que seria de esperar,
dado o curso mais benigno da infeco por VIH-2 e do papel que tem sido
atribudo, para estes efeitos, na progresso da imunodeficincia 21. Estes
resultados levaram-nos a colocar a hiptese alternativa de que estes efeitos
imunossupressores possam ser benficos para o hospedeiro, tendo presente
a possibilidade de reduzirem os efeitos deletrios da activao crnica do
sistema imunitrio, descritos anteriormente.
Por outro lado, embora escassa, a investigao dos possveis mecanismos,
que determinam as diferenas no ritmo de declnio do nmero de TCD4 +,
entre as duas infeces, aponta para uma preservao da actividade do timo
nos indivduos infectados pelo VIH-222, uma melhor preservao da capa-
cidade de produo de IL-2, na imunodeficincia associada a VIH-2 23, e
uma aparente melhor capacidade de utilizar a IL-724, duas citocinas com
importantes papis na homeostasia linfocitria. Contudo, para o mesmo
nvel de depleo de TCD4+, os infectados por VIH-2 apresentavam nveis
semelhantes de activao dos linfcitos circulantes e frequncias semelhan-
tes de clulas TCD4+ em ciclo, em comparao com os infectados por
VIH-1, apesar de terem viremia muito mais baixa, o que sugere que o au-
mento do turnover linfocitrio est directamente relacionado com os nveis
de activao imunitria e que esta parece ser determinante para a perda de
clulas TCD4+25. Estes dados corroboram o papel crucial da activao per-
sistente do sistema imunitrio, na imunopatognese da imunodeficincia
associada a VIH-1, e salientam a importncia de VIH-2, como um modelo
nico de doena atenuada, com um potencial, ainda, pouco explorado de
contribuir para a compreenso dos mecanismos bsicos envolvidos na imu-
nopatognese de VIH.

Concluso
Apesar dos importantes progressos na compreenso da imunopatognese da
infeco por VIH, existem questes centrais que permanecem por clarificar
e que so fundamentais para a definio de estratgias de interveno tera-
putica e vacinal, como o esclarecimento dos mecanismos que determinam
a depleo linfocitria e a definio dos correlatos de uma resposta imuni-
tria protectora eficaz.
76 Ana Espada de Sousa, Rui Victorino

Bibliografia
1. Lederman ML, Margolis L. The lymph node in HIV pathogenesis. Semin Immunol. 2008;20:187-95.
2. Brenchley JM, Price DA, Douek DC. HIV disease: fallout from a mucosal catastrophe? Nat Immunol. 2006;7:235-9.
3. Trono D, Van Lint C, Rouzioux C, et al. HIV persistence and the prospect of long-term drug-free remissions
for HIV-infected individuals. Science. 2010;329:174-80.
4. Brenchley JM, Silvestri G, Douek DC. Nonprogressive and progressive primate immunodeficiency lentivirus
infections. Immunity. 2010;32:737-42.
5. Grossman Z, Meier-Schellersheim M, Sousa AE, et al. CD4 T-cell depletion in HIV infection: are we closer to
understanding the cause? Nature Med. 2002;8:319-23.
6. Mellors JW, Rinaldo CR Jr, Gupta P, et al. Prognosis in HIV-1 infection predicted by the quantity of virus in
plasma. Science. 1996;272:1167-70.
7. Rodrguez B, Sethi AK, Cheruvu VK, et al. Predictive value of plasma HIV RNA level on rate of CD4 T-cell
decline in untreated HIV infection. JAMA. 2006;296:1498-506.
8. Lederman MX, Alter G, Daskalakis DX, et al. Determinants of protection among HIV-exposed seronegative
persons: an overview. J Infect Dis. 2010;202(S3):S333-8.
9. Haase AT.Targeting early infection to prevent HIV-1 mucosal transmission. Nature. 2010 Mar 11;464:217-23.
10. Alter G, Moody MA. The humoral response to HIV-1: new insights, renewed focus. J Infect Dis. 2010;202
Suppl 2:S315-22.
11. Davenport MP, Petravic J. CD8+ T cell control of HIV--a known unknown. PLoS Pathog. 2010 Jan 29;6:e1000728.
12. Douek DC, Brenchley JM, Betts MR, et al. HIV preferentially infects HIV-specific CD4 T cells. Nature. 2002;
417:95-8.
13. Silvestri G, Paiardini M, Pandrea I, Lederman MM, Sodora DL. Understanding the benign nature of SIV infec-
tion in natural hosts. J Clin Invest. 2007;117:3148-54.
14. Douek DC, McFarland RD, Keiser PH, et al. Changes in thymic function with age and during the treatment of
HIV infection. Nature. 1998;396:690-5.
15. Dandekar S, George MD, Bumler AJ. Th17 cells, HIV and the gut mucosal barrier. Curr Opin HIV AIDS. 2010;
5:173-8.
16. Walker BD. Elite control of HIV Infection: implications for vaccines and treatment. Top HIV Med. 2007;15:134-6.
17. Soares R, Foxall R, Albuquerque A, et al. Increased frequency of circulating CCR5+ CD4+ T cells in Human
Immunodeficiency Virus Type 2 infection. J Virol. 2006;80:12425-9.
18. Soriano V, Gomes P, Heneine W, et al. Human immunodeficiency virus type 2 (HIV-2) in Portugal: clinical
spectrum, circulating subtypes, virus isolation, and plasma viral load. J Med Virol. 2000;61:111-6.
19. Borrego P, Marcelino JM, Rocha C, et al. The role of the humoral immune response in the molecular evolution
of the envelope C2, V3 and C3 regions in chronically HIV-2 infected patients. Retrovirology. 2008;5:78.
20. Rowland-Jones SL, Whittle HC. Out of Africa: what can we learn from HIV-2 about protective immunity to
HIV-1? Nat Immunol. 2007;8:329-31.
21. Cavaleiro R, Brunn GJ, Albuquerque AS, Victorino RM, Platt JL, Sousa AE. Monocyte-mediated T cell suppres-
sion by HIV-2 envelope proteins. Eur J Immunol. 2007;37:3435-44.
22. Gautier D, Beq S, Corteso CS, Sousa AE, Cheynier R. Efficient thymopoiesis contributes to the maintenance of
peripheral CD4 T cells during chronic human immunodeficiency virus type 2 infection. J Virol. 2007;81:12685-8.
23. Sousa AE, Chaves AF, Loureiro A, Victorino RMM. Comparison of the frequency of IL2, IFN gamma and IL4
producing T cells in two diseases with distinct clinical outcomes: the HIV1 and HIV2 infections. J Infec Dis.
2001;184:552-9.
24. Albuquerque AS, Corteso CS, Foxall RB, et al. Rate of increase in circulating IL-7 and loss of IL-7R expres-
sion differ in HIV-1 and HIV-2 infections: two lymphopenic diseases with similar hyper immune-activation but
distinct outcomes. J Immunol. 2007;178:3252-9.
25. Sousa AE, Carneiro J, Meier-Schellersheim M, et al. CD4 T cell depletion is linked directly to immune activation
in the pathogenesis of HIV-1 and HIV-2 but only indirectly to the viral load. J Immunol. 2002;169:3400-6.
III SECO

Epidemiologia
III Seco
Captulo 1

Epidemiologia da infeco por VIH


e da sida impacto mundial
Maria Teresa Paixo

Trs dcadas aps a referncia aos primeiros casos de sida, cujo reconheci-
mento se atribui aos Centers for Disease Control and Prevention (CDC), em
Atlanta, as pandemias de VIH e de sida constituem, mundialmente, um dos
problemas dominantes em sade pblica1-4. De incio, a evoluo epidemio-
lgica desta doena era imprevisvel e desconhecia-se se os mecanismos
clssicos de controlo das doenas infecciosas modificariam os padres epi-
demiolgicos observados. Hoje, com a informao obtida atravs dos sistemas
de vigilncia epidemiolgica, considera-se que a pandemia VIH/sida afecta
todas as regies do Mundo, constituindo o maior problema de sade pblica
para o continente africano e sia e, em vastas regies, limita o desenvolvi-
mento demogrfico e econmico4-7. A rpida expanso desta infeco tra-
duzse na necessidade permanente de actualizao das estatsticas globais, a
cargo da Organizao Mundial da Sade (OMS) e das Naes Unidas (UNAI-
DS). Nos 30 anos desta pandemia, ocorreram mais de 65 milhes de casos
de infeco por VIH e morreram cerca de 25 milhes de pessoas com sida 4.
A nvel mundial, mais de 40% dos casos de infeco ocorrem em adultos
e jovens entre os 15 e 24 anos4. Em 2001, as Naes Unidas adoptaram a
Declaration of Commitment on HIV/AIDS, pela qual os Estados Membros
se obrigavam a reportar Assembleia Geral, periodicamente, os progressos
registados de acordo com um conjunto de indicadores de actuao. Estes
indicadores agrupam-se, genericamente, em indicadores globais e nacionais.
Estes ltimos agrupam-se em trs grupos principais, designadamente indi-
cadores de empenhamento/motivao e aces especficas, indicadores
referentes a comportamentos e indicadores de impacto dos programas na-
cionais, na reduo da proporo de novos casos. Entretanto, enquanto
entidade supranacional, as Naes Unidas organizaram uma sesso especial,
80 Maria Teresa Paixo

designada por United Nations General Assembly Special Session (UNGASS)


on HIV/AIDS, com o intuito de avaliar os progressos realizados na preveno
de novos casos de infeco VIH, mediante a avaliao de programas nacionais.
Em 2004, somente 54% dos Estados Membros tinham submetido relatrios
de progresso, mas esta proporo aumentou para 77% em 20088,9.
Considerando os elevados recursos financeiros e humanos disponibiliza-
dos, para a preveno da infeco VIH/sida, o ltimo relatrio das Naes
Unidas revela progressos limitados, para se atingirem os objectivos propos-
tos (UNGASS 2010)9,10:
1 Nos pases participantes, dos jovens entre os 15-24 anos, somente 38%
das mulheres e 40% dos homens possuem conhecimentos suficientes
e adequados sobre formas de preveno da transmisso da infeco,
tendo em considerao que a meta da UNGASS de 90% em 2010.
2 Os programas de preveno da transmisso VIH da me para o filho,
atingem unicamente 33% daqueles que deveriam ser beneficiados, en-
quanto a meta da UNGASS de 80% em 2010.
3 Os bons resultados obtidos, especialmente num conjunto de pases com
maior desenvolvimento econmico, com a aplicao directa de recursos
financeiros, superiores a 10 bilies de dlares, disponibilizados pelos
pases contribuidores e aplicados nas actividades de preveno e respos-
ta epidemia da infeco VIH/sida, podero ser afectados pelo impacto
da recesso, iniciada com a crise global em 2007, colocando em causa a
sustentabilidade dos programas locais.
A pandemia da infeco VIH/sida continuar a ser monitorizada pelas
entidades internacionais e nacionais, no s com base nos indicadores j
mencionados, mas requerendo, tambm, uma forte componente comporta-
mental e social.

Padres epidemiolgicos mundiais


VIH caracterizado por extrema variabilidade gentica, diferente patogeni-
cidade e capacidade de expanso epidmica, apresentando os dois tipos
principais (VIH-1, VIH-2) e os vrios subtipos distribuio geogrfica di-
versificada. A heterogeneidade de VIH e as formas de transmisso vrica
constituem os principais factores responsveis pelos padres epidemiolgi-
cos mundiais. A identificao e o conhecimento dos factores locais, promo-
tores da diversidade epidemiolgica, devem-se criao de novos sistemas
de vigilncia epidemiolgica (sistemas de vigilncia epidemiolgica de
segunda gerao), segundo a proposta da OMS e da UNAIDS, de forma a
obter melhor caracterizao das epidemias de mbito regional, mediante o
conhecimento de factores sociais e comportamentais, permitindo a aplicao
de medidas adequadas aos grupos populacionais mais afectados 7,11.
Na classificao das epidemias por VIH/sida consideram-se trs padres:
1 Epidemia em incio, caracterizada pelos primeiros casos assinto-
mticos e sintomticos terem sido diagnosticados h menos de
cinco anos; a prevalncia inferior a 5% em diversos subgrupos
Epidemiologia da infeco por VIH e da sida impacto mundial 81

populacionais e os casos ocorrem, predominantemente, em subgru-


pos com comportamentos de risco elevado. Este padro encontra-se
limitado a zonas da Austrlia e de pases da sia Central.
2 Epidemia concentrada, caracterizada pela transmisso de VIH pre-
dominantemente associada a grupos social e economicamente mais
desfavorecidos; a prevalncia da infeco superior a 5% em, pelo
menos, um subgrupo populacional; utilizando como indicador a
prevalncia da infeco em mulheres grvidas, residentes em zonas
urbanas, esta inferior a 1%. Nos Estados Unidos da Amrica
(EUA), Unio Europeia (UE), Austrlia e Amrica do Sul, so as
populaes urbanas as mais afectadas.
3 Epidemia generalizada, em que na maioria da populao ocorrem
casos de infeco por VIH, atribuindo-se a transmisso a contactos
heterossexuais; regista-se prevalncia em mulheres grvidas superior
a 1%. Considera-se que a frica sub-sariana e o Sudoeste Asitico
correspondem a este padro.

Diferenas na pandemia da infeco por VIH e da sida


Cada Pas, cada regio ou continente apresenta vrios padres epidemiol-
gicos, caracterizados pela forma de transmisso predominante de VIH e por
subgrupos populacionais, com taxas de incidncia diferentes. Estas diferen-
as devem-se, fundamentalmente, a:
1 Data em que ocorreu a introduo de VIH na comunidade.
2 Tipo e subtipos de VIH, predominantes na populao e formas
recombinantes circulantes.
3 Principais formas de transmisso; diferenas na proporo de in-
divduos infectados, em vrios grupos populacionais.
4 Alteraes nos critrios de incluso ou de classificao epidemio-
lgica.
5 Profilaxia das infeces oportunistas e administrao de teraputi-
ca anti-retrovrica (TARV).
6 Aspectos comportamentais e sociais.
7 A eficcia das intervenes de sade pblica.
A situao a nvel mundial preocupante, uma vez que desde o reconhe-
cimento dos primeiros casos de sida nos EUA e em frica, mais de 65 milhes
de pessoas foram infectadas por VIH, das quais 25 milhes j faleceram 4.
A sida , actualmente, a principal causa de morte prematura nos indivduos
entre os 15 e 59 anos4. Em 2008, com base em novos dados epidemiolgi-
cos, considerava-se que o nmero total de casos de infeco VIH e sida
totalizavam 33,4 milhes, estimando-se em 2,7 milhes de casos de novas
infeces e 2,0 milhes de bitos, no ano em causa 10.
Os factores de maior importncia que, nos ltimos 10 anos, influen-
ciaram a morbilidade e mortalidade associada a VIH, correspondem ao
acesso profilaxia das infeces oportunistas e utilizao de anti-retro-
vricos (ARVs) em pases com recursos adequados e influncia de alguns
82 Maria Teresa Paixo

aspectos sociais, estes ltimos nem sempre tidos em considerao, duran-


te a primeira dcada da pandemia. Contudo, nos cinco anos mais recentes,
assistimos, de novo, a um envolvimento da sociedade civil que, confron-
tada com a incapacidade dos servios de sade controlarem a expanso
epidmica de VIH, procura medidas alternativas, designadamente a modi-
ficao dos comportamentos que favorecem a transmisso da infec-
o8-10.

Tendncias temporais da pandemia


Os padres da infeco por VIH e doenas associadas encontram-se em
grande modificao. Analisando as tendncias temporais da pandemia de VIH
entre 1984 e 2009, em vrias regies do Mundo, verifica-se que em todos
os pases ocorreram casos de infeco por VIH. No entanto, a principal
caracterstica, que caracteriza a diversidade dos padres epidemiolgicos
refere-se prevalncia varivel de VIH ou seja, a percentagem de indivdu-
os infectados e a expanso epidmica reflecte a ocorrncia de novos casos.
Considera-se que as diferenas observadas quer na incidncia, quer na
prevalncia da infeco, resultantes de mltiplos factores, permitem associar
os estilos de vida e comportamentos, o desenvolvimento econmico e social,
assim como a acessibilidade aos cuidados de sade, ao padro epidemio-
lgico local.

Pases em desenvolvimento
1 Diversas epidemias, em subgrupos populacionais, resultantes de
distintas formas de transmisso de VIH.
2 Diversidade vrica elevada.
3 Elevada incidncia de doenas infecciosas, nomeadamente tuber-
culose e infeces de transmisso sexual; co-infeco por um ou
mais vrus hepatotrpicos.
4 Inexistncia ou recursos limitados para profilaxia das infeces
oportunistas; recursos limitados para administrao de ARVs.
5 Grandes desigualdades no acesso a servios de sade e programas
de preveno, incluindo a disponibilidade de TARV.

Pases industrializados
Os pases com maior desenvolvimento econmico, independentemente do
continente em que se localizam, conseguiram um sucesso parcial no con-
trolo da transmisso do VIH, com consequncias, praticamente, imediatas
em vrios aspectos da epidemia:
1 Diminuio da incidncia dos casos de sida, pela disponibilidade
universal da TARV combinada (TARVc).
2 Profilaxia das infeces oportunistas associadas infeco por VIH,
com reduo da incidncia das mesmas.
Epidemiologia da infeco por VIH e da sida impacto mundial 83

3 Aumento da sobrevida dos casos de infeco por VIH, o que se


traduz numa prevalncia mais elevada de casos assintomticos e
de sida.
4 Rastreio da co-infeco por um ou mais vrus hepatotrpicos, de-
signadamente por vrus da hepatite C (VHC).
5 Diminuio do impacto negativo da crise econmica e financeira
mundial, com incio em 2007, na continuao e desenvolvimento
de programas nacionais de preveno de transmisso da infeco
por VIH e apoio a pessoas infectadas por VIH.
A nvel mundial, constata-se que a maior incidncia da infeco por VIH
abrange pases to diversos, do ponto de vista demogrfico (ndia e Qunia),
quer com baixa ou elevada densidades populacionais (Zimbabwe e ndia)
ou com estruturas etrias, maioritariamente, jovens (pases da frica central
e ocidental), mas sempre e, inevitavelmente, associados a factores econ-
micos e sociais. Estes ltimos, contribuindo, cada vez mais, para a diferen-
a entre o sucesso ou insucesso das intervenes 12-15.
A transmisso sexual de VIH a forma predominante de propagao da
infeco a nvel mundial. Contudo, em determinadas regies, por exemplo,
na sia e, especialmente, no Sudoeste Asitico, a transmisso de VIH as-
sociada utilizao de drogas injectveis generalizou-se, em algumas co-
munidades urbanas, constituindo a toxicodependncia um importante pro-
blema de sade pblica.
A China, um dos pases com maior populao a nvel mundial, tem de-
senvolvido esforos para documentar melhor a situao epidemiolgica na-
cional, dada a elevada subnotificao existente. Neste Pas, o primeiro caso
de infeco VIH (sida) data de 1985 e nos cinco anos subsequentes a epide-
mia desenvolveu-se lentamente. Em determinadas regies da China, a trans-
misso da infeco por VIH foi atribuda a prticas de colheita e a produtos
derivados do sangue pouco seguros, estimando-se em 2009 que existissem
740.000 pessoas infectadas por VIH, se bem que valores exactos sejam di-
fceis de obter, pois as autoridades locais tm relutncia em notificar os casos,
assim como pela discriminao sofrida pelos indivduos infectados16. As
condies sociais e a tolerncia zero das autoridades locais, quanto uti-
lizao de drogas por via endovenosa e comportamentos sexuais reprovados
pela sociedade, levam a um ocultar dos casos de infeco por VIH16.
Nos pases em que a prevalncia de VIH baixa, mas em que se regis-
ta uma prevalncia elevada de outras doenas de transmisso sexual, estas
sero, certamente, o factor contributivo para o aumento de incidncia de
VIH10,11,16.
A nvel mundial, a infeco por VIH e as patologias associadas consti-
tuem a segunda causa de morbilidade, nas populaes mais carenciadas, e
em frica so a primeira causa. A infeco por VIH, em breve constituir
uma das cinco principais causas de morte no Mundo (a quarta causa da
morte em 1999), assumindo-se, mesmo, que poder causar mortalidade
superior malria, sobretudo em pases da Commonwealth em que, no seu
conjunto, possuem cerca de 60% dos casos prevalentes de infeco, por este
84 Maria Teresa Paixo

tipo de vrus7. O relatrio das Naes Unidas, referente situao mundial,


em 2006, descreve a complexidade desta epidemia e as provveis tendncias
temporais7, confirmando-se em 2010 as tendncias previstas 9,10.

A situao na Unio Europeia


Em 1985, a UE deu incio vigilncia epidemiolgica da infeco por VIH
e a sida, ficando a cargo do European Centre for the Epidemiological Mo-
nitoring of AIDS, designado por EuroHiv, em Paris.
Em 2005, com a criao do European Centre for Diseases Prevention
and Control (ECDC), a monitorizao dos casos de infeco VIH e de sida
passou a ser da responsabilidade do mesmo e o sistema de vigilncia eu-
ropeu The European Surveillance System (TESSy) baseia-se no registo, em
cada Pas, dos casos de infeco, em qualquer estdio, de acordo com a
classificao epidemiolgica em vigor e enviados regularmente ao ECDC,
que procede, posteriormente, divulgao desta informao 17-19.
Actualmente, e como consequncia da acessibilidade TARVc, no
suficiente para estabelecer a evoluo da epidemia, determinar a incidncia
com base nos casos de sida diagnosticados e utiliza-se, como medida do
impacto, a taxa de incidncia, com base na notificao dos casos assinto-
mticos de infeco por VIH, o que permite comparar as taxas de incidn-
cia na Regio Europeia da OMS, constituda por 54 pases. Para uma melhor
caracterizao considera-se a Europa dividida em trs grandes reas: Euro-
pa Ocidental, Central e Oriental, correspondendo, esta diviso geogrfica,
a diferenas epidemiolgicas importantes20.
A UE, constituda por 27 pases, apresenta um padro epidemiolgico
global, com epidemias concentradas em subgrupos populacionais distintos.
Assim, as trs reas geogrficas (Europa Oriental, Central e Ocidental) so
caracterizadas, individualmente, por um padro epidemiolgico especfico
da infeco por VIH. Contudo, observam-se algumas semelhanas, associa-
das a comportamentos e estilos de vida, evidenciadas pela incidncia ele-
vada de casos de infeco por VIH estreitamente associadas a factores de
risco bem determinados, por exemplo o uso de drogas ilcitas por via in-
jectvel, com partilha de material infectado.
Na UE existem importantes diferenas inter e intrapases, por exemplo
no que se refere aos principais factores de risco e formas de transmisso e
a factores sociais j mencionados. De referir, tambm, factores de natureza
poltica, que induziram maior mobilidade das populaes quer por motivos
scio-econmicos, quer por motivos de conflitos locais ou regionais. Estas
populaes migrantes podero contribuir para a disseminao da infeco
por VIH, assim como de outras patologias de elevada incidncia local, de-
signadamente a tuberculose.
Na Europa Ocidental, Portugal e Espanha apresentavam, no ano 2007,
taxas de incidncia de infeco por VIH elevadas (146,2 e 88,8 por milho
de habitantes), com base nas notificaes nacionais efectuadas ao ECDC e
em 2008 (105,9 e 81,9 por milho de habitantes, respectivamente), valores
Epidemiologia da infeco por VIH e da sida impacto mundial 85

que se encontram associados transmisso por uso de drogas injectveis e


transmisso sexual (heterossexual), enquanto nos pases do Norte predomi-
na a transmisso sexual (homossexual), com valores das taxas de incidncia
global muito inferiores, designadamente, 29,1/106 na Finlndia e 39,1/106
na Sucia21.
Na Europa Oriental, a epidemia de VIH recente, mas, em 2008, a
Ucrnia, com uma taxa de incidncia de 340,7 por milho de habitantes e
a Letnia (157,6 106) apresentam epidemias em grande expanso21.
Na UE verifica-se, actualmente, alterao epidemiolgica importante,
uma vez que a infeco por VIH j se encontra disseminada na populao,
sem factores de risco acrescidos, considerando-se a transmisso sexual (he-
terossexual), como a principal forma de transmisso, especialmente nos
pases do sul da Europa. A crescente epidemia da infeco VIH/sida na
Europa do leste, atribui-se, principalmente, a prticas de utilizao de dro-
gas injectveis pouco seguras e de acordo com um artigo publicado na
Lancet, os consumidores possuem escassos conhecimentos e acesso limita-
do a centros de atendimento e preveno de toxicodependncias 22,23.
Actualmente, no possvel estabelecer projeces da pandemia a longo
prazo. Assim, conhecem-se os seus aspectos principais nos primeiros 10 anos,
desenvolveram-se frmacos etiotrpicos nos cinco anos seguintes e admi-
nistram-se estes a indivduos residentes em pases que os disponibilizem.
Hoje, observamos os efeitos desses frmacos na modificao do padro
epidemiolgico da pandemia de VIH/sida, sobretudo nos pases de maiores
recursos, mas, apesar do conhecimento de numerosos factores, que deter-
minam os aspectos epidemiolgicos de maior importncia, incerta a evo-
luo da pandemia.
Segundo Levin, et al.24, ao analisarem, em vrios pases, os padres
epidemiolgicos, consideraram como factores principais e determinantes da
evoluo da epidemia os seguintes aspectos:
1 Aps a introduo de VIH numa populao, a epidemia impul-
sionada durante muitos anos pelas formas de transmisso iniciais.
2 Os casos de infeco por VIH, que ocorrem num subgrupo popu-
lacional, podem diminuir ou apresentar valores constantes, devido
ao fenmeno de saturao do nmero de indivduos susceptveis
e no tanto devido a mutaes vricas ou eficcia das medidas
de preveno.
3 Nas prximas dcadas, no esperada a ocorrncia na populao
humana de resistncia natural a VIH ou menor morbilidade asso-
ciada a este vrus.
4 A TARVc, que reduz a transmissibilidade do vrus, poder diminuir
a frequncia de novas infeces e o nmero de bitos por sida na
populao, mas verificar-se-o, sempre, assimetrias entre os pases
de maiores e menores recursos.
Trinta anos aps o incio da pandemia, a resposta mundial encontra-se
muito aqum do que seria desejvel. Assim, em 2010 verificou-se no s
um maior nmero de novas infeces, como de bitos, apesar dos sucessos
86 Maria Teresa Paixo

da TARVc, pois nos pases de menores recursos, somente um em cada


cinco indivduos, que necessita de tratamento, tem acesso ao mesmo 6,24.
Os modelos matemticos desenvolvidos, que incluem novas variveis j
identificadas como de elevada importncia para as projeces epidemiol-
gicas (polticas teraputicas, mecanismos de preveno, modificaes com-
portamentais, aspectos vricos e imunitrios e factores intrnsecos ao hos-
pedeiro) no podero substituir os sistemas de vigilncia epidemiolgica
locais, como instrumentos para avaliar a progresso da pandemia 21,24.

Bibliografia
1. Centres for Disease Control. Pneumocystis pneumonia Los Angeles. Morb Mort Weekly Rep. 1981;30:250-2.
2. Gottlieb MS, Schroff R, Schanker HM, et al. Pneumocystis carinii pneumonia and mucosal candidiasis in previously
healthy homosexual men: evidence a new acquired cellular immunodeficiency. N Engl J Med. 1981;305:1425-31.
3. Quinn TC. Global burden of the HIV pandemic. Lancet. 1996;348:99-106.
4. Merson, MH. The HIV-AIDS pandemic at 25 - The global response. N Engl J Med. 2006:354:2414-7.
5. World Health Organization. Global AIDS Surveillance. Wkly Epidemiol Rec. 2000;75(47):379-83.
6. World Health Organization. Global AIDS Surveillance. Wkly Epidemiol Rec. 2000;75(48):386-92.
7. UNAIDS. AIDS epidemic update: special report on HIV/AIDS. December 2006.
8. International Community of Women Living with HIV. A critical look at the UNGASS indicators [acedido em
26/10/2010]. Disponvel em: http://www.icw.org/node/128
9. UNAIDS. Monitoring country progress. 2010 UNGASS CountryReporting. [acedido em 26/10/2010]. Disponv-
el em: http://www.unaids.org/en/KnowledgeCentre/HivData/CountryProgress
10. UNAIDS Joint action for results. UNAIDS Outcome Framework 2009-2011. Geneva. Joint United Nations Pro-
gramme on HIV/AIDS (UNAIDS), 2010 [acedido a 26/10/2010]. Disponvel em: http://data.unaids.org/pub/Re-
port/2010
11. UNAIDS/WHO. Guidelines for second generation HIV surveillance. WHO/CSR/EDC/2000.5. UNAIDS/WHO;
2000.
12. Nicoll A, Gill ON. The global impact of HIV infection and disease. Commun Dis Public Health. 1999;2(2):85-95.
13. Timaeus IM. Impact of HIV epidemic on mortality on sub-Saharan Africa: evidence from national surveys and
census. AIDS. 1998;12 Suppl 1:15-27.
14. UNAIDS. Trends in HIV incidence and prevalence: natural course of the epidemic or results of behavioural
change. UNAIDS. Best Practice Collection; 1999.
15. Cohen MS. Sexually transmitted diseases enhance HIV transmission: no longer a hypothesis. Lancet. 1998;351
Suppl III:5-7.
16. Annimo. HIV/AIDS in China [acedido em 12/10/2010]. Disponvel em: http://www.avert.org/aidschina.htm
17. Centres for Disease Control. Revision of the case definition of acquired immunodeficiency syndrome for na-
tional reporting United States. Morb Mort Weekly Rep. 1985;34:373-5.
18. European Centre for the Epidemiological Monitoring of AIDS. 1993 Revision of the European AIDS Surveillance
case definition. AIDS Surveillance in Europe. Quarterly Report. 1993;37:23-8.
19. Coordenao Nacional para a Infeco VIH/SIDA. Infeco VIH/SIDA. A situao em Portugal a 31 de Dezem-
bro de 2006. CVEDT. Doc. SIDA n. o 137, Fevereiro 2007.
20. EuroHiv. HIV/AIDS surveillance in Europe. End-year report 2005. Saint-Maurice: Institut de veille sanitaire;
2006. p. 73.
21. European Centre for Disease Prevention and Control /WHO Regional Office for Europe. HIV/AIDS surveillance
in Europe 2008. Estocolmo: European Centre for Disease Prevention and Control; 2009.
22. Mathers B, Degenhardt L, Ali H, et al. Hiv prevention, treatment and care services for people who inject drugs:
a systematic review of global, regional, and national coverage. Lancet. 2010;375(9719):1014-28.
23. Benyamina A, Blecha L, Lebeau B, Reynaud M. Prevention of HIV transmission among intravenous drug users.
Lancet. 2010;375(9728):1782.
24. Levin BR, Bull JJ, Stewart FM. Epidemiology, evolution and future of the HIV/AIDS pandemic. Emerg Infect
Dis. 2001;7(3):505-11.
III Seco
Captulo 2

Distribuio mundial dos gentipos


(epidemiologia molecular de VIH)
Helena Cortes Martins

Nomenclatura

VIH-1
As estirpes de VIH tipo 1 (VIH1), em circulao, exibem grau elevado de
diversidade gentica, a qual pode influenciar aspectos da sua biologia, tais
como infecciosidade, transmissibilidade e imunogenicidade. As sequncias
derivadas destas estirpes de VIH1 so, actualmente, classificadas, com base
nas suas relaes filogenticas, em grupos, subtipos e subsubtipos. Assim,
da anlise dos genes env, gag e pol, a partir de isolados vricos com dife-
rentes origens geogrficas, constatase existirem quatro grupos diferentes,
correspondendo a linhagens distintas de VIH1:
1 Um grupo principal, denominado M (major), que inclui os vrus
dominantes na pandemia da infeco VIH/sida.
2 Um grupo divergente denominado O (outlier).
3 Um grupo denominado N (noM e noO ou new).
4 Um grupo, recentemente identificado, para o qual foi proposta a
denominao de P.
A anlise filogentica das sequncias das diferentes estirpes mostra que o
grupo M pode ser subdividido em subtipos, geneticamente equidistantes, com-
preendendo, luz dos conhecimentos actuais, nove subtipos: A, B, C, D, F,
G, H, J e K. A classificao em subsubtipos ocorre quando, perante uma linha-
gem distinta, estreitamente relacionada com um subtipo, previamente reconhe-
cido, se verifica que, geneticamente, ela no , suficientemente, distante
para ser considerada como um novo subtipo. Como exemplo, referemse as
linhagens distintas, que formam quatro agrupamentos, dentro do subtipo A
88 Helena Cortes Martins

(subsubtipos A1, A2, A3 e A4), e dois agrupamentos dentro do subtipo F (sub-


subtipos F1 e F2). O acesso a amostras biolgicas de indivduos infecta-
dos por VIH, de todas as regies do Mundo, bem como os avanos regis-
tados nas tecnologias de amplificao e sequenciao de cidos nucleicos,
permitiram identificar um nmero crescente de sequncias, que no se en-
quadram na nomenclatura padro. Destas, assumem maior relevo as formas
resultantes de fenmenos de recombinao gentica, que recebem a desig-
nao de circulating recombinant forms (CRF), quando representam estirpes,
que contribuem para a pandemia em causa, ou unique recombinant forms
(URF), quando tenham sido isoladas de um nico indivduo. O primeiro
destes fenmenos de recombinao, a ser identificado, foi o do subtipo em
tempos designado por E, que, posteriormente, aps sequenciao do genoma
completo, se verificou tratarse de um recombinante, em que a regio env
do genoma permanece como uma linhagem distinta E (que levou sua an-
terior classificao como um subtipo) e as regies gag e pol se identificam
com o subtipo A. As CRF so identificadas por nmeros, que representam
a ordem pela qual foram descobertas, seguidos da identificao das estirpes
parentais que feita pelas letras correspondentes aos respectivos subtipos ou
por nmeros quando estas estirpes sejam CRF, ou ainda de cpx (de com-
plex), nos casos em que derivam de trs ou mais subtipos parentais. Actual-
mente, na base de dados, referente a sequncias do VIH (HIV Sequence
Database) do Los Alamos National Laboratory (URL: http://www.hiv.lanl.
gov), encontramse descritas 48 formas recombinantes. Estas contribuem, de
forma reconhecidamente crescente, para a pandemia VIH1, distinguindose,
pela sua elevada prevalncia, as CRF01_AE e CRF02_AG 113.

VIH2
A sequenciao dos genes pol, env e gag de VIH tipo 2 (VIH2) revelou a
existncia de oito grupos diferentes (A a H), anteriormente designados como
subtipos. Esta alterao da nomenclatura teve por base o facto de, tal como
para VIH1, cada grupo representar uma transmisso independente ao ho-
mem, a partir dos primatas nohumanos. Recentemente, foi identificada
nos Camares a primeira CRF resultante da recombinao entre os subtipos
A e B, denominada por VIH2 CRF01_AB.
Os dados referentes prevalncia dos diferentes subtipos so escassos,
no entanto, os vrus isolados tm, maioritariamente, sido classificados como
grupo A, verificandose que o grupo B apresenta maior restrio, na sua
distribuio geogrfica, sendo, contudo, comum no Mali e na Costa do
Marfim. Os grupos C a H foram identificados em isolados nicos 1418.

Distribuio geogrfica
Numa escala global, e de acordo com estudos recentes, os gentipos VIH1
mais prevalentes so os correspondentes ao subtipo C (responsvel, a nvel
mundial, por mais de 50% das infeces), subtipo A (subsubtipo A1),
Distribuio mundial dos gentipos (epidemiologia molecular de VIH) 89

Europa Leste
Europa Ocidental
A, CRF03_AB
B China
Amrica do Norte
A, C, G B, CRF07_BC, CRF08_BC
e Central
B
frica Ocidental sia (Sul) Sudoeste Asitico
CRF02_AG, A, G C CRF01_AE, B
frica Oriental
A, D, C
frica Central
Amrica do Sul Maioria das CRF
B, F1, CRF12_BF A, C, D, G, H, J, K
Austrlia
frica (Sul) B
C

Figura 1. Distribuio mundial dos gentipos VIH-1 predominantes (grupo M e formas


recombinantes) (adaptado de Perrin L, et al. Lancet Infect Dis. 2003;3:22-7).

subtipo B e CRF02_AG. Embora a maioria dos subtipos seja comum na


frica Central, a sua distribuio mundial bastante diferente, verificandose,
em cada Pas, a predominncia de uma ou duas formas genticas, o que
pode indiciar o papel que essas estirpes tiveram na introduo da infeco
VIH, no Pas ou regio em causa (Fig. 1).

frica
Os resultados de mltiplos estudos epidemiolgicos, de base molecular, efec-
tuados neste continente, indicam a presena de todos os grupos e subtipos de
VIH1, bem como a presena de VIH2 na regio ocidental. A elevada hete-
rogeneidade das estirpes africanas de VIH1 reflecte a maior durao da
epidemia, por comparao com outras regies do globo. Alguns subtipos so,
com maior frequncia, encontrados em reas geogrficas especficas e esto
associados a epidemias, com taxas de prevalncia e incidncia diferentes.
Como exemplo, refirase a elevada prevalncia dos subtipos A e D, numa
faixa que atravessa o continente de leste a oeste, ao nvel da regio subsa-
riana, do subtipo C no flanco leste e no sul do continente e da CRF02_AG,
na regio ocidental. As infeces por vrus pertencentes ao grupo O concen-
tramse nos Camares e pases vizinhos, nomeadamente na Guin Equatorial
e no Gabo. As infeces por vrus dos grupos N e P tm o seu epicentro
na mesma regio africana, mais especificamente nos Camares911,13,1923.

Amrica
Na maioria dos casos, as estirpes de VIH1 do continente americano per-
tencem ao subtipo B. No entanto, existem j alguns estudos revelando a
90 Helena Cortes Martins

presena de outras variantes genticas na Amrica do Norte, incluindo do


grupo O e de VIH2. A presena de diferentes subtipos e formas recombi-
nantes foi, tambm, descrita na Amrica do Sul, com especial relevo para
o subsubtipo F1 no Brasil e CRF12_BF na Argentina2426.

Europa
Na Europa, e em particular na Unio Europeia, VIH1 o tipo de vrus
predominante, embora em Portugal e Frana se verifique tambm a presen-
a de VIH215,27. Tal como no continente americano, a maioria dos isolados
europeus de VIH1 pertencem ao subtipo B. No entanto, vrios pases, in-
cluindo Frana, Reino Unido, Espanha e Portugal, reportam nmeros apre-
civeis de infeces por subtipos noB, com particular relevncia para o
subtipo G, C e CRF02_AG, em Portugal2836.
Estudos de epidemiologia molecular, que acompanham o recente aumen-
to da incidncia da infeco VIH nos pases do leste europeu, revelam
elevada incidncia de infeces por subtipos noB de VIH1, nomeadamente
o subtipo A e a CRF03_AB3739.

sia e Pacfico
Os aspectos epidemiolgicos de VIH na sia so, extremamente, diversos,
tanto nos pases em que a prevalncia baixa (por exemplo, a Monglia),
como nos pases em que a prevalncia elevada (Tailndia, Camboja,
Myanmar). Estudos de epidemiologia molecular, na Tailndia, ajudaram a
caracterizar os padres de distribuio e segregao de certos subtipos,
segundo a forma de transmisso. Assim, verificase elevada prevalncia de
infeces por subtipo B, em toxicodependentes (transmisso por via endo-
venosa), e uma elevada prevalncia de infeces por CRF01_AE (anterior-
mente designado por subtipo E), adquiridas por transmisso sexual (hete-
rossexual)40,41. A disseminao da infeco VIH a outras regies asiticas,
associada ao trfico de estupefacientes, tem sido documentada atravs de
estudos de epidemiologia molecular, que tm permitido a identificao dos
diferentes subtipos e formas recombinantes42. No Iro e no Afeganisto,
onde a epidemia VIH-1 est, maioritariamente, associada ao consumo de
drogas por via endovenosa, a identificao, em ambos os pases, de uma nova
estirpe recombinante, a CRF35_AD, permitiu demonstrar a ligao entre as
duas epidemias43. A China e a ndia, os pases mais populosos do Mundo,
representam dois focos importantes para a futura epidemia global. Na Chi-
na, o nmero de infeces continua a aumentar quer nos toxicodependentes
por via endovenosa, em que predomina a infeco por subtipo B e, recen-
temente, se assiste introduo do subtipo C, quer nas infeces adquiridas
por via heterossexual, em que prevalece a infeco pelo CRF01_AE 44. Na
ndia, dados da epidemiologia molecular da infeco VIH, indicam a pre-
sena de VIH1 e VIH2. O subtipo C de VIH1 tem dominado a epidemia
heterossexual, embora tenham sido j identificados os subtipos A, B, D e
Distribuio mundial dos gentipos (epidemiologia molecular de VIH) 91

CRF01_AE45,46. Na Austrlia, o padro semelhante Europa Ocidental e


Amrica do Norte, com maior prevalncia do subtipo B 47.

Bibliografia
1. Robertson DL, Anderson JP, Bradac JA, et al. HIV-1 nomenclature proposal: A reference guide to HIV-1 clas-
sification. Em: Human Retroviruses and AIDS 1999: A Compilation and Analysis of Nucleic Acid and Amino
Acid Sequences. Los Alamos, New Mxico: Los Alamos National Laboratory; 1999.
2. Robertson DL, Anderson JP, Bradac JA, et al. HIV-1 nomenclature proposal. Science. 2000;288:55-6.
3. Rodenburg CM, Li Y, Trask SA, et al. Near full-length clones and reference sequences for subtype C isolates
of HIV type 1 from three different continents. AIDS Res Hum Retroviruses. 2001;17:161-8.
4. Grtler L, Hauser PH, Eberle J, et al. A new subtype of human immunodeficiency virus type 1 (MPV 5180)
from Cameroon. J Virol. 1994;68:1581-5.
5. Simon F, Mauclere P, Roques P, et al. Identification of a new human immunodeficiency virus type 1 distinct
from group M and group O. Nat Med. 1998;4:1032-7.
6. Triques K, Bourgeois A, Vidal N, et al. Near full-length genome sequencing of divergent African HIV-1 subtype F
viruses leads to the identification of a new subtype designated K. AIDS Res Hum Retroviruses. 2000;16:139-51.
7. Thomson MM, Prez-lvarez L, Njera R. Molecular Epidemiology of HIV-1 genetic forms and its significance
for vaccine development and therapy. Lancet Infect Dis. 2002;2:461-71.
8. Perin L, Kaiser L, Yerly S. Travel and spread of HIV-1 genetic variants. Lancet Infect Dis. 2003;3:22-7.
9. Osmanov S, Pattou C, Walker N, Schwardlnder B, Esparza J, and the WHO-UNAIDS Network for HIV Isolation
and Characterization. Estimated global distribution and regional Spread of HIV-1 genetic subtypes In the year
2000. JAIDS. 2002;29:184-90.
10. McCutchan FE. Global epidemiology of HIV. J Med Virol. 2006;78:S7-12.
11. Geretti AM. HIV-1 subtypes: epidemiology and significance for HIV management. Curr Opin Infect Dis. 2006;19:1-7.
12. Vidal N, Mulanga C, Bazepeo SE, et al. Identification and molecular characterization of subsubtype A4 in central
Africa. AIDS Res Hum Retroviruses. 2006;22(2):182-7.
13. Plantier JC, Leoz M, Dickerson JE, et al. A new human immunodeficiency virus derived from gorillas. Nat Med.
2009;15(8):871-2.
14. Schim van der Loeff M, Aaby P. Towards a better understanding of the epidemiology of HIV-2. AIDS. 1999;13
Suppl A:69-84.
15. Plantier JC, Damond F, Souquire S, et al. V3 Serological subtyping of human Immunodeficiency virus type 2
infection is not relevant. J Clin Virol. 2001;39(10):3803-7.
16. Damond F, Worobey M, Campa P, et al. Identification of a highly divergent HIV type 2 and proposal for a
change in HIV type 2 classification. AIDS Res Hum Retroviruses. 2004;20(6):666-72.
17. Ibe S, Yokomaku Y, Shiino T, et al. HIV-2 CRF01_AB: first circulating recombinant form of HIV-2. J Acquir
Immune Defic Syndr. 2010;54(3):241-7.
18. de Silva TI, Cotten M, Rowland-Jones SL. HIV-2: the forgotten AIDS virus.Trends Microbiol. 2008 Dec;16
(12):588-95.
19. Expert Group of the Joint United Nations Programme on HIV/AIDS: Implications of HIV variability for trans-
mission: scientific and policy issues. AIDS. 1997;11:UNAIDS1-15.
20. European Commission and the Joint United Nations Programme on HIV/AIDS: HIV-1 subtypes: implications for
epidemiology, pathogenicity, vaccines and diagnostics. AIDS. 1997;11:UNAIDS17-36.
21. Yang C, Pieniazek D, Owen SM, et al. Detection of phylogenetically diverse human immunodeficiency virus
type 1 groups M and O from plasma using highly sensitive and specific generic primers. J Clin Microbiol.
1999;37:2581-6.
22. Toure-Kane C, Montavon C, Faye MA, et al. Identification of all HIV1 group M subtypes in Senegal a country
with low and stable prevalence. AIDS Res Hum Retroviruses. 2000;16:211-21.
23. Van Harmelen JH, Van der Ryst E, Loubser AS, et al. A predominantly HIV type 1 subtype C restricted epidemic
in South African urban populations. AIDS Res Hum Retroviruses. 1999;15:395-8.
24. Bongertz V, Bou-Habib DC, Brgido LFM, et al. HIV-1 Diversity in Brazil: Genetic, Biologic, and Immunologic
Characterization of HIV-1 Strains in Three Potential HIV Vaccine Evaluation Sites. JAIDS. 2000;23:184-93.
25. Eyer-Silva WA, Couto-Fernandez JC, Morgado MG. Molecular epidemiology of HIV type 1 in inner Rio De
Janeiro State, Brazil. AIDS Res Hum Retroviruses. 2007;23(2):303-8.
26. Thomson MM, Villahermosa ML, Vzquez-de Parga E, et al. Widespread circulation of a B/F intersubtype
recombinant form among HIV-1 infected individuals in Buenos Aires, Argentina. AIDS. 2000;14:897-9.
27. Soriano V, Gomes P, Heneine W, et al. Human immunodeficiency virus type 2 (HIV-2) in Portugal: clinical
spectrum, circulating subtypes, virus isolation, and plasma viral load. J Med Virol. 2000;61:111-6.
28. Couturier E, Damond F, Roques P, et al. HIV-1 diversity in France, 1996-1998. AIDS. 2000;14:289-96.
29. Parry JV, Murphy G, Barlow KL, et al. National surveillance of HIV-1 subtypes for England and Wales: design,
methods, and initial findings. JAIDS. 2001;26:381-8.
30. Tatt ID, Barlow KL, Clewley JP, et al. Surveillance of HIV-1 subtypes among heterosexuals in England and
Wales, 1997-2000. J Acquir Immune Defic Syndr. 2004;36(5):1092-9.
31. Garca-Albert L, Ortiz M, Garca-Saiz A; the Group for the Study of Subtype Prevalence In Spain. HIV type 1
non-B subtype prevalence In Spain, 1997-1998. AIDS Res Hum Retroviruses. 2001;17(14):1317-20.
32. Holgun A, lvarez A, Soriano V. High prevalence of HIV-1 subtype G and natural polymorphisms at the protease
gene among HIV-Infected Immigrants In Madrid. AIDS. 2002;16(8):1163-70.
33. Lospitao E, Alvarez A, Soriano V, Holgun A. HIV-1 subtypes in Spain: a retrospective analysis from 1995 to
2003. HIV Med. 2005;6(5):313-20.
92 Helena Cortes Martins

34. Esteves A, Parreira R, Venenno T, et al. Molecular epidemiology of HIV type 1 Infection In Portugal: high
prevalence of non-B subtypes. AIDS Res Hum Retroviruses. 2002;18(5):313-25.
35. Esteves A, Parreira R, Piedade J, et al. Spreading of HIV-1 subtype G and envB/gagG recombinant strains among
Injecting drug users In Lisbon, Portugal. AIDS Res Hum Retroviruses. 2003;19(6):511-7.
36. Palma AC, Arajo F, Duque V, et al. Molecular epidemiology and prevalence of drug resistance-associated muta-
tions in newly diagnosed HIV-1 patients in Portugal. Infect Genet Evol. 2007;7(3):391-8.
37. Bobkov A, Kazennova E, Khanina T, et al. An HIV type 1 subtype A strain of low genetic diversity continues
to spread among injecting drug users in Russia: study of the new local outbreaks in Moscow and Irkutsk. AIDS
Res Hum Retroviruses. 2001;17(3):257-61.
38. Liitsola K, Holm K, Bobkov A, et al. An AB recombinant and its parental HIV type 1 strains in the area of the
former Soviet Union: low requirements for sequence identity in recombination. UNAIDS Virus Isolation Network.
AIDS Res Hum Retroviruses. 2000;16(11):1047-53.
39. Womack C, Roth W, Newman C, et al. Identification of non-B human immunodeficiency virus type 1 subtypes
in rural Georgia. J Infect Dis. 2001;183(1):138-42.
40. Tovanabutra S, Beyrer C, Sakkhachornphop S, et al. The changing molecular epidemiology of HIV type 1 among
northern Thai drug users, 1999 to 2002. AIDS ResHum Retroviruses. 2004;20(5):465-75.
41. Xiridou M, van Griensven F, Tappero JW, et al. The spread of HIV-1 subtypes B and CRF01_AE among Inject-
ing drug users in Bangkok, Thailand. J Acquir Immune Defic Syndr. 2007;45(4):468-75.
42. Beyrer C, Razak MH, Lisam K, et al. Overland heroin trafficking routes and HIV-1 spread in south and south-
east Asia. AIDS. 2000;14(1):75-83.
43. Taylor BS, Sobieszczyk ME, McCutchan FE, et al. The challenge of HIV-1 subtype diversity. N Engl J Med.
2008;358:1590-602.
44. Zhang Y, Lu L, Ba L, et al. Dominance of HIV-1 subtype CRF01_AE in sexually acquired cases leads to a new
epidemic in Yunnan province of China. PLoS Med. 2006;3(11):e443.
45. Halani N, Wang B, Ge YC, et al. Changing epidemiology of HIV type 1 infections in India: evidence of subtype
B introduction in Bombay from a common source. AIDS Res Hum Retroviruses. 2001;17(7):637-42.
46. Kandathil AJ, Ramalingam S, Kannangai R, et al. Molecular epidemiology of HIV. Indian J Med Res.
2005;121(4):333-44.
47. Oelrichs R. The subtypes of human immunodeficiency virus in Australia and Asia. Sex Health. 2004;1(1):1-11.
III Seco
Captulo 3

Epidemiologia da infeco por VIH-2


Elizabeth Pdua

A caracterizao molecular das primeiras estirpes VIH2, isoladas em indi-


vduos originrios da frica Ocidental, com diagnstico clnico de sida,
revelou que este vrus est gentica e filogeneticamente mais prximo de
estirpes de vrus da imunodeficincia do smio (VIS), do que, propriamen-
te, de VIH11. Desde a descoberta de VIH2, j foram identificados sete
grupos genticos (A a G), tambm designados de subtipos. Contudo, recen-
temente foi identificada em Frana uma estirpe divergente, representando a
proposta de classificao de um novo grupo/subtipo H2. Os vrus do subti-
po A e do subtipo B so, maioritariamente, as variantes vricas responsveis
pela epidemia da infeco VIH2 no Mundo3,4. Os primeiros estudos, con-
duzidos em prostitutas do Senegal, infectadas por VIH2, indicaram que este
vrus estava associado infeco com longo perodo de incubao e sem
sintomatologia5. Por isso, foi admitido que a infeco por VIH2 era, clini-
camente, distinta da infeco por VIH1 e que os seus efeitos patognicos
eram menores, relativamente a VIH16. Embora as diferenas na histria
natural entre VIH1 e VIH2, j documentadas, sugerissem propriedades
patognicas reduzidas de VIH2, estudos clnicos e imunitrios posteriores
demonstraram o potencial deste tipo de vrus causar imunodeficincia grave,
cujo curso clnico final da infeco, em doentes hospitalizados, indistin-
guvel da infeco por VIH17.
Numerosos estudos confirmam a frica Ocidental, como foco inicial
(epicentro) da infeco por VIH2. Esta infeco considerada endmica,
em particular, na GuinBissau, Senegal, Gmbia, Gana e Costa do Marfim.
Na GuinBissau encontrouse a maior prevalncia de infeco por VIH2,
onde os estudos seroepidemiolgicos indicaram que 10% da populao
94 Elizabeth Pdua

geral deste Pas estava infectada, comparativamente a percentagens obtidas


de 1-2% nos restantes pases, desta regio africana 8,9.
A prevalncia da infeco por VIH2 , tambm, mais elevada em indi-
vduos com mais de 25 anos, e a idade para a aquisio da infeco pare-
ce ser superior, em relao da idade dos casos de infeco por VIH1,
correspondente aos anos de maior actividade sexual, atingindo um pico nos
5055 anos. Estes dados apoiam a associao da infeco por VIH2
transmisso heterossexual menos eficiente, a um perodo assintomtico
prolongado e a taxa baixa de mortalidade3,4.
A actividade sexual est, fortemente, associada com a disseminao do
vrus na frica Ocidental. A migrao de prostitutas de ou para regies de
elevada endemicidade desempenhou o papel mais importante na sua trans-
misso. Um estudo realizado na Gmbia revelou que cerca de 25% das
prostitutas estavam infectadas por VIH21012. No Senegal, a comparao de
taxas de transmisso entre VIH1 e VIH2 indicou que a taxa de transmisso
da infeco por VIH2, do homem para a mulher, pode ser menor, compa-
rativamente com a da taxa de infeco por VIH113. A transmisso vertical
da infeco por VIH2 foi demonstrada, embora os dados sejam escassos,
neste tpico, e sugiram que um acontecimento possvel, mas raro 14. Em
Portugal, desde o incio da epidemia VIH/sida e at ao final de Agosto do
ano de 2010, um total de 313 casos de transmisso mefilho de VIH foram
notificados ao ncleo da Unidade de Referncia e Vigilncia Epidemiolgi-
ca do Departamento de Doenas Infecciosas (URVEDDI) do Instituto
Nacional de Sade Dr. Ricardo Jorge (INSA), estando 6,1% (n = 19) dos
casos associados transmisso de vrus tipo 2. A baixa frequncia de trans-
misso vertical da infeco por VIH2 poder, tambm, ser observada,
analisando resultados de um protocolo laboratorial, implementado pelo labo-
ratrio de referncia da sida, em que participaram 25 instituies (maternidades
e hospitais) de sade do Pas, tendo sido diagnosticados, num perodo de
sete anos, apenas dois casos de transmisso mefilho de vrus tipo 2, com-
parativamente a 46 casos de transmisso mefilho de vrus tipo 115.

Disseminao de VIH2, a partir da frica Ocidental


Durante os anos 80, a epidemia de VIH2 parecia ser exclusiva da frica Oci-
dental, surgindo, no entanto, casos espordicos desta infeco na frica
Central. Porm, a infeco por VIH2 pode estar associada a pases que
mantiveram colnias na regio ocidental do continente africano, particular-
mente a GuinBissau. Em pases de outras regies de frica, apenas An-
gola e Moambique tm prevalncia de VIH2 relativamente elevada, mas
que pode ser explicada como resultado de ligaes militares com a frica
Ocidental. Nos Camares, Guin Equatorial, Gabo e Repblica Democr-
tica do Congo, estudos epidemiolgicos confirmaram que a infeco por
VIH2 no foi disseminada a outras regies do continente africano e pare-
ce estar confinada a pases da frica Ocidental3,4,16. No entanto, existem
razes que tornam difcil o conhecimento da prevalncia da infeco por
Epidemiologia da infeco por VIH-2 95

VIH2, neste continente. Os grupos populacionais estudados so heterogneos


e, por vezes, migratrios, diferentes metodologias so utilizadas na recolha e
na anlise de dados epidemiolgicos, dificultando a comparao de resultados
obtidos, entre as diversas reas e populaes do continente africano4,16,17.
Os primeiros casos de infeco por VIH2, na Europa, foram identifica-
dos em alguns pases, como Sucia, Alemanha, Portugal e Frana. Ligaes
coloniais do passado, entre a Europa e a frica Ocidental, conduziram a cami-
nhos geogrficos, que facilitaram a disseminao da infeco por VIH2, entre
os dois continentes. Tendo por base uma diviso historicogeogrfica, da
frica Ocidental, SmallmanRaynor e Cliff18 explicaram a disseminao de
VIH2, a partir da frica Ocidental, com base em trs regies consideradas
como a fonte do agente. A frica Ocidental portuguesa, uma regio impor-
tante, com a ligao entre a GuinBissau e Portugal e uma ligao adicio-
nal, na Europa, entre Portugal e a Sua. A segunda regio, considerada,
identifica pases da frica Ocidental francesa, nomeadamente o Senegal, o
Mali e a Costa do Marfim, sendo a Frana o principal Pas importador dos
casos de infeco. A terceira regio descrita, a frica Ocidental inglesa,
foca, especialmente, os pases como a Gmbia e o Gana. Alm destas liga-
es principais, identificaramse outras, entre a Alemanha e a Serra Leoa,
a Holanda e a GuinBissau e, ainda, a Sua e a Costa do Marfim 18.
Com excepo de Portugal, nos restantes pases da Europa, em que a
infeco por VIH2 est presente, o nmero cumulativo de casos conheci-
dos, at meados da dcada de 90, inferior a uma centena. Em Frana
foram identificados 98 casos, no Reino Unido 33 e em Espanha 72 casos
de infeco por VIH23. At ao final de Agosto, do ano de 2010, foram
notificados em Portugal URVEDDI 1.295 casos de infeco por VIH2,
que correspondem a 3,3% de infeco por VIH registada no Pas, dos quais
509 casos esto classificados como sida. A maior proporo dos casos de
infeco por VIH2 notificada refere residncia no distrito de Lisboa (46,9%),
seguindose propores, quase idnticas, observadas nos distritos do Porto
(11,4%) e de Setbal (10,9%). Embora a maioria dos casos notificados de
infeco por VIH2, em Portugal, seja em indivduos oriundos da frica
subsariana (48,1%), em 44,6% dos casos citada naturalidade portugue-
sa. Dados fornecidos pela URVEDDI indicam que a distribuio dos
casos de infeco por VIH2, por gnero, apresenta um rcio homem/mulher
de 1,1/1,0, estando 75,6% dos casos associados transmisso heterossexu-
al. Analisando a sua distribuio por perodos de tempo de seis anos,
concretamente entre 1990 a 1995, entre 1996 a 2001, e entre 2002 a 2007,
verificase uma estabilidade do nmero de casos notificados, ao longo do
tempo. De facto, a proporo dos casos, no primeiro perodo, foi de 28,0%
(n = 363), no segundo perodo de 27,7% (n = 359) e no ltimo perodo de
28% (n = 363). Os resultados obtidos no corroboram a tendncia de de-
clnio da infeco por VIH2, observada em outros pases9,17.
Nos Estados Unidos da Amrica (EUA), e at final de 1996, foram
identificados 67 casos de infeco por VIH23. Esta infeco est descrita,
tambm, no continente asitico. Na ndia, identificaramse ambos os vrus
96 Elizabeth Pdua

VIH1 e VIH2, em grupos com comportamento sexual de risco19. A pre-


valncia da infeco por VIH2 foi considerada estvel no Pas e descrita
como sendo 2,5% do total dos casos de infeco VIH20.

Consequncias possveis da cocirculao de vrus VIH1 e VIH2


A dupla infeco VIH1 e VIH2 coloca questes sobre a sinergia entre os
dois vrus no hospedeiro, com eventual consequncia na mais rpida progres-
so para doena e, simultaneamente, maiores desafios teraputicos. A frica
Ocidental tem uma prevalncia de infeco por VIH1 e casos associados a
sida mais baixa, comparativamente frica Central e Oriental, resultante da
elevada prevalncia de VIH2. Excepcionalmente, na Costa do Marfim est
descrita prevalncia de casos de sida mais alta, mas que pode ser explicada
pelo nmero existente de duplas infeces por VIH1 e por VIH2, resultan-
te do facto de ambos os vrus existirem em circulao na populao17,21. Na
Gmbia, em 1987, existiam poucos casos de infeco por VIH1. Anos mais
tarde, foram encontrados valores de prevalncia de 1,2 e 0,8%, respectiva-
mente, para a infeco por VIH1 e por VIH210,22. Embora a infeco por
VIH1 esteja a aumentar, nesta ltima dcada, os autores concluram que a
prevalncia da infeco por VIH2 parecia manterse estvel no Pas22. Con-
tudo, entre 1985 a 1996, nove de 10 pases da frica Ocidental revelaram
decrscimo na prevalncia de VIH2 na populao de dadores de sangue23 e
entre 1987 a 2002, na Costa do Marfim, foi descrito declnio de 2,0 para
0,5% desta infeco, na populao de mulheres grvidas24,25. Os estudos re-
alizados na GuinBissau, entre 1987 a 2007, mostraram, tambm, decrscimo
significativo na prevalncia da infeco por VIH226,27 e aumento significati-
vo da prevalncia da infeco por VIH1 (Quadro 1). Neste Pas, e j no
final da dcada de 90, a incidncia da infeco por VIH1 encontrada foi de
1,10%, ou seja, duas vezes superior ao valor de incidncia obtido para a
infeco por VIH2 (0,54%)28,29. Assim, o fenmeno de ambos os vrus coe-
xistirem em circulao, na mesma populao, e o crescente nmero de novos
casos de infeco por VIH1, em reas endmicas para VIH2, est a ser
observado em pases da frica Ocidental e a colocar em debate hipteses do
seu eventual desaparecimento, a longo prazo30. O declnio, observado na
prevalncia e na incidncia da infeco por VIH2, surgindo a infeco por
VIH1, em pases onde esta era quase inexistente, pode confirmar a eficincia
mais baixa, na sua transmisso31. Assim, a controvrsia gerada na dcada de
90, de que a infeco por VIH2 poderia ser um factor de proteco contra
a infeco por VIH1, podendo esta epidemia abrandar em regies afectadas
pela primeira, parece, actualmente, ter terminado. Os ltimos resultados de
estudos de campo, indicam que, na realidade, tal no se verifica32.

Decrscimo da prevalncia da infeco por VIH2


Nos ltimos anos, surgiram resultados de estudos, revelando a diminuio
da prevalncia da infeco por VIH2, indicando que a epidemia est em
Epidemiologia da infeco por VIH-2 97

Quadro 1. Prevalncia da infeco por VIH-2 e por VIH-1, obtida em grupos populacionais
de pases da frica Ocidental entre 1983 e 2007
Pas Populao Ano de Indivduos VIH-2 VIH-1 Referncia
estudo (n) (%) (%)
Guin- Grvidas 1987-1997 11.371 5,5 0,9 Norrgren, et al.29
Bissau
1997 1.491 4,6 2,0 Mansson, et al.26
1999-2001 4.505 3,5 3,9
2002-2004 4.503 1,9 4,5
Polcias 1990-1996 2.637 9,7 0,9 Norrgren, et al.29
1996-1998 552 6,3 2,2 Mansson, et al.27
2003-2004 1.238 4,9 8,3
2005-2007 548 4,7 5,8
Adultos 1989-1991 2.770 7,9 0,1 van Tienen, et al.9
(rea rural) 1996-1998 3.110 6,8 1,6
2006-2007 2.895 4,0 2,9
Adultos 1987 603 8,9 0,0 Poulsen, et al.8
(rea urbana)
1995-1996 1.505 5,9 1,3 Larsen, et al.28
2004-2007 2.548 3,9 4,2 da Silva, et al.30
Gmbia Grvidas 1993-1995 29.549 1,1 0,5 ODonovan, et al.14
2000-2001 8.054 0,8 1,2 Schim van der Loeff,
et al.22
Prostitutas 1988 355 24,5 0,6 Pepin, et al.11
1989 241 26,1 2,1
1990-1991 104 13,5 5,8 Wilkins, et al.10
1992-1993 207 21,7 8,2 Hawkes, et al.12
Doentes IST* 1983-1984 117 0,0 0,0 Mabey, et al.34
1986 185 5,4 0,0
1988-1990 443 4,7 0,1 Pepin, et al.35
Utentes de 1988-1991 3.775 7,0 4,2 Schim van der Loeff,
clnicas de 1992-1994 3.807 7,4 8,0 et al.32
Ginecologia/ 1995-1997 4.609 6,3 10,6
Urologia 1998-2000 5.669 5,3 14,5
2001-2003 5.503 4,0 17,5
Costa Grvidas 1987 200 2,0 7,0 Djomang, et al.36
do 1988 537 1,0 5,0
Marfim 1990 3.153 2,0 9,0
1991 10.134 1,0 10,0
1992 5.363 2,0 9,0
2001-2002 1.039 0,5 10,6 Rouet, et al.37
(Continua)
98 Elizabeth Pdua

Quadro 1. Prevalncia da infeco por VIH-2 e por VIH-1, obtida em grupos populacionais
de pases da frica Ocidental entre 1983 e 2007 (continuao)
Pas Populao Ano de Indivduos VIH-2 VIH-1 Referncia
estudo (n) (%) (%)
Costa Adultos com 1987 200 4,0 16,0 Djomang, et al.36
do tuberculose 1989 1.994 5,0 28,0
Marfim 1990 3.843 4,0 32,0
1991 3.495 4,0 35,0
1992 3.736 3,0 35,0
1993 3.380 3,0 35,0
Internados em 1987 114 7,0 27,0
Enfermarias de 1988 752 5,0 30,0
Doenas 1990 3.123 4,0 43,0
Infecciosas 1991 2.225 4,0 45,0
1992 720 2,5 53,0
Internados em 1986 1.987 2,0 15,0
Enfermarias de 1988 179 3,0 33,0
Pneumologia 1989 473 4,0 38,0
1990 426 3,0 44,0
1991 686 4,0 49,0
1992 291 3,0 54,0
Internados em 1988 316 5,0 14,0
Enfermarias de 1991 1.872 3,0 21,0
Medicina
Interna
Doentes de 1988 86 3,5 27,0
Dermatologia 1992 57 3,0 28,0
Prostitutas 1996-1997 343 1,0 44,0 Nkengasong, et al.38
1992 356 3,0 49,0 Ghys, et al.39
1993 778 2,0 47,0
1994 607 2,0 43,0
1995 832 2,0 37,0
1996 916 1,0 39,0
1997 876 2,0 40,0
1988 853 1,0 29,0
Adaptado de de Silva TI, et al. 2010; disponvel em: www.medscape.com/viewarticle/723256
*IST: Infeces sexualmente transmissveis.

declnio17,27,32,33. Nos pases conhecidos, como sendo os mais afectados, a


prevalncia da infeco por VIH2 est, agora, a decrescer, observandose
a existncia de um aumento da infeco por VIH1 (Quadro 1). Na Gmbia,
os mais recentes resultados de um estudo desenvolvido durante um perodo
de 16 anos mostraram que a prevalncia da infeco por VIH2 decresceu
de 7% para 4%, enquanto que, a prevalncia da infeco por VIH1 aumen-
tou de 4,2% para 17,5%32. Os comentrios, situao observada, de acordo
Epidemiologia da infeco por VIH-2 99

com investigadores na rea, parecem incluir dois pontos de vista. Por um


lado, a situao descrita como desvantajosa, pois os elementos coligidos
sugerem que ser o vrus considerado menos patognico e menos transmis-
svel, que, eventualmente, poder desaparecer da populao, mas, por outro
lado, a situao descrita parece ser benfica, por simplificar os algoritmos
para o diagnstico diferencial da infeco (VIH1 e/ou VIH2) e os respec-
tivos programas de tratamento com antiretrovricos (ARVs), implementados
de acordo com a eficcia conhecida para cada tipo de vrus 32,33.

Bibliografia
1. Clavel F, Guetard D, Brun-Vezinet F, et al. Isolation of a new human retrovirus from West African patients with
AIDS. Science. 1986;223:343-6.
2. Damond F, Worobey M, Campa P, et al. Identification of a highly divergent HIV type 2 and proposal for a
change in HIV type 2 classification. AIDS Res Hum Retroviruses. 2004;20(6):666-72.
3. Schim van der Loeff M, Aaby P. Towards a better understanding of the epidemiology of HIV-2. AIDS. 1999;13
Suppl A:69-84.
4. Bock PJ, Markovitz DM. Infection with HIV-2. AIDS. 2001;15 Suppl 5:35-45.
5. Ancelle R, Bletry O, Baglin AC, et al. Long incubation period for HIV-2 infection. Lancet. 1987;i:688-9.
6. Marlink R, Kanki P, Thior I, et al. Reduced rate disease development after HIV-2 infection as compared to
HIV-1. Science. 1994;265:1587-90.
7. Romieu I, Marlink R, Kanki P, et al. HIV-2 link to AIDS in West Africa. J Acquired Immune Deficiency Syn-
dromes. 1990;3:220-30.
8. Poulsen AG, Kanki P, MBoup S, et al. HIV-2 infection in Bissau, West Africa, 1987-1989: incidence, prevalence,
routes of transmission. J Acquired Immune Deficiency. 1993;6:941-8.
9. van Tienen C, Schim van der Loeff MF, Zaman SM, et al. Two distinct epidemics: the rise of HIV-1 and decline of
HIV-2 infection between 1990 and 2007 in rural Guinea-Bissau. J Acquir Immune Defic Syndr. 2009;35(5):640-7.
10. Wilkins A, Oelman B, Pepin J, et al. Trends in HIV-1 and HIV-2 infection in the Gambia. AIDS. 1991;5:1529-30.
11. Pepin J, Morgan G, Dunn D, et al. HIV-2-induced immunosuppression among asymptomatic West African pros-
titutes: evidence that HIV-2 is pathogenic, but less so than HIV-1. AIDS. 1991;5:1165-72.
12. Hawkes S, West B, Wilson S, Whittle H, Mabey D. Asymptomatic carriage of Haemophilus ducreyi confirmed
by the polymerase chain reaction. Genitourin Med. 1995;71(4):224-7.
13. Kanki PJ, Travers KU, MBoup S, et al. Slower heterosexual spread of HIV-2 than HIV-1. Lancet. 1994;343:
943-6.
14. ODonovan D, Ariyoshi K, Milligan P, et al. Maternal plasma viral RNA levels determine marked differences in
mother-to-child transmission rates of HIV-1 and HIV-2 in The Gambia. MRC/Gambia Government/University
College London Medical School working group on motherchild transmission of HIV. AIDS. 2000;14(4):441-8.
15. Pdua E, Almeida C, Nunes B, et al. Assessment of mother-to-child HIV-1 and HIV-2 transmission: an AIDS
reference laboratory collaborative study. HIV Med. 2009;10:182-90.
16. Cazein F, Hamers F, Alix J, Brunet JB. Prevalence of HIV-2 infection in Europe. European Communicable
Disease Bulletin. 1996;3.
17. de Silva TI, van Tienen C, Rowland-Jones SL, Cotten M. Dual Infection with HIV-1 and HIV-2: Double Trouble
or Destructive Interference? HIV Ther. 2010;4(3):305-23.
18. Smallman-Raynor M, Cliff A. The spread of human immunodeficiency virus type 2 into Europe: a geographical
analysis. Int J Epidemiol. 1991;20:480-9.
19. Crez M, Dietrich U, Balfe P, et al. Genetic analysis of human immunodeficiecy virus type 1 and type 2 (HIV-1
and HIV-2) mixed infections in India reveals a recent spread of HIV-1 and HIV-2 from a single ancestor for
each of these virus. J Virol. 1994;68:2161-8.
20. Kannangai R, Ramalingam S, Vijayakumar TS, Prabu K, Jesudason MV, Sridharan G. HIV-2 sub-epidemic not
gathering speed: experience from a tertiary care center in south India. J Acquir Immune Defic Syndr.
2003;32(5):573-5.
21. George JR, Ou CY, Parekh B, et al. Prevalence of HIV-1 and HIV-2 mixed infections in Cote dIvoire. Lancet.
1992;340:337-9.
22. Schim van der Loeff MF, Sarge-Njie R, Ceesay S, et al. Regional differences in HIV trends in the Gambia:
results from sentinel surveillance among pregnant women. AIDS. 2003;17:1441-6.
23. Bouckenooghe A, Shandera W. HIV trends in African blood donors. J Infect. 1999;39:122-8.
24. Djomand G, Greenberg AE, Sassan-Morokro M, et al. The epidemic of HIV/AIDS in Abidjan, Cte dIvoire: a
review of data collected by Projet RETRO-CI from 1987 to 1993. J Acquir Immune Defic Syndr Hum Retrovi-
rol. 1995;10(3):358-65.
25. Rouet F, Ekouevi DK, Inwoley A, et al. Field evaluation of a rapid human immunodeficiency virus (HIV) se-
rial serologic testing algorithm for diagnosis and differentiation of HIV type 1 (HIV-1), HIV-2, and dual HIV-
1-HIV-2 infections in West African pregnant women. J Clin Microbiol. 2004;42(9):4147-53.
26. Mansson F, Alves A, Silva ZJ, et al. Trends of HIV-1 and HIV-2 prevalence among pregnant women in Guinea-
Bissau, West Africa: possible effect of the civil war 19981999. Sex Transm Infect. 2007;83(6):463-7.
27. Mansson F, Biague A, da Silva ZJ, et al. Prevalence and incidence of HIV-1 and HIV-2 before, during and after
a civil war in an occupational cohort in Guinea-Bissau, West Africa. AIDS. 2009;23(12):1575-82.
100 Elizabeth Pdua

28. Larsen O, Da Silva Z, Sandstrom A, et al. Declining HIV-2 prevalence and incidence among men in a com-
munity study from Guinea Bissau. AIDS. 1998;12(13):1707-14.
29. Norrgren H, Andersson S, Biague AJ, et al. Trends and interaction of HIV-1 and HIV-2 in Guinea Bissau West
Africa: no protection of HIV-2 against HIV-1 infection. AIDS. 1999;13(6):701-7.
30. da Silva ZJ, Oliveira I, Andersen A, et al. Changes in prevalence and incidence of HIV-1, HIV-2 and dual infec-
tions in urban areas of Bissau, Guinea-Bissau: is HIV-2 disappearing? AIDS. 2008;22(10):1195-202.
31. Anderson RM, May RM. The population biology of the interaction between HIV-1 and HIV-2: coexistence or
competitive exclusion? AIDS. 1996;10:1663-73.
32. Schim van der Loeff MF, Awasana AA, Sarge-Njie R, et al. Sixteen years of HIV surveillance in a West African
research clinic reveals divergent epidemic trends of HIV-1 and HIV-2. Int. J. Epidemiol. 2006;35(5):1322-8.
33. Eholi S, Anglaret X. Commentary: Decline of HIV-2 prevalence in West Africa: good news or bad news? Int
J Epidemiol. 2006;35(5):1329-30.
34. Mabey DC, Tedder RS, Hughes AS, et al. Human retroviral infections in The Gambia: prevalence and clinical
features. Br Med J (Clin Res Ed). 1988;296(6615):83-6.
35. Pepin J, Quigley M, Todd J, et al. Association between HIV-2 infection and genital ulcer diseases among male
sexually transmitted disease patients in The Gambia. AIDS. 1992;6(5):489-93.
36. Djomand G, Greenberg AE, Sassan-Morokro M, et al. The epidemic of HIV/AIDS in Abidjan, Cte dIvoire: a
review of data collected by Projet RETRO-CI from 1987 to 1993. J Acquir Immune Defic Syndr Hum Retrovi-
rol. 1995;10(3):358-65.
37. Rouet F, Ekouevi DK, Inwoley A, et al. Field evaluation of a rapid human immunodeficiency virus (HIV) se-
rial serologic testing algorithm for diagnosis and differentiation of HIV type 1 (HIV-1), HIV-2, and dual HIV-1-
HIV-2 infections in West African pregnant women. J Clin Microbiol. 2004;42(9):4147-53.
38. Nkengasong JN, Kestens L, Ghys PD, et al. Dual infection with human immunodeficiency virus type 1 and type 2:
impact on HIV type 1 viral load and immune activation markers in HIV-seropositive female sex workers in
Abidjan, Ivory Coast. AIDS Res Hum Retroviruses. 2000;16(14):1371-8.
39. Ghys PD, Diallo MO, Ettiegne-Traore V, et al. Increase in condom use and decline in HIV and sexually trans-
mitted diseases among female sex workers in Abidjan, Cte dIvoire, 19911998. AIDS. 2002;16(2):251-8.
III Seco
Captulo 4

Epidemiologia da infeco por VIH


e da sida em Portugal
Maria Teresa Paixo

Em Portugal, a vigilncia epidemiolgica da infeco VIH e sida baseada


na notificao, obrigatria, dos casos diagnosticados nas diversas fases de
evoluo da doena. A classificao epidemiolgica utilizada na Unio Euro-
peia (UE) e, em consequncia, em Portugal, foi revista em 1993 e baseiase na
classificao do Centers for Disease Control and Prevention (CDC), refe-
rindo as principais patologias (infeces oportunistas e doenas oncolgicas)
e formas de transmisso de VIH (categorias de transmisso)13. No nosso Pas,
as caractersticas da epidemia so idnticas s registadas em Espanha e no sul
da Frana, pases limtrofes, cujas populaes tm factores de risco semelhan-
tes para a transmisso do vrus. No entanto, Portugal apresenta taxas de inci-
dncia das mais elevadas da zona ocidental da Regio Europeia (Organizao
Mundial da Sade [OMS]), quer para os casos de sida, como para os novos
casos de infeco VIH, respectivamente 36,4 106 em 2008 e 105,9 106
no mesmo perodo, de acordo com as estatsticas europeias publicadas pelo
European Centre for Disease Prevention and Control (ECDC) 3.
O primeiro caso de sida diagnosticado no Pas ocorreu em 1983. Desde
ento, e at 31 de Dezembro de 2009, foram notificados ao Ncleo de Vigi-
lncia Laboratorial de Doenas Infecciosas, da Unidade de Referncia e Vi-
gilncia Epidemiolgica do Instituto Nacional de Sade (INSA) 15.685 casos
de sida, dos quais 494 referiam infeco por VIH tipo 2 (VIH2) e 197
indicam infeco associada a VIH tipo 1 (VIH1) e VIH2 ou tipificao,
ainda, em curso. Para melhor caracterizar a epidemia, necessrio proceder
anlise dos casos assintomticos (portadores assintomticos [PA]), que a
31 de Dezembro de 2009 totalizavam 17.839 notificaes 2.
Constatase que a maioria dos casos de sida notificados referese a in-
divduos toxicodependentes, utilizadores de drogas por via endovenosa,
102 Maria Teresa Paixo

constituindo, em valores acumulados, a principal categoria de transmisso, por


estes casos se reportarem aos primeiros anos da epidemia. Contudo, as activi-
dades desenvolvidas pelas entidades responsveis pela preveno da toxicode-
pendncia podero justificar o decrscimo do nmero de casos de infeco VIH,
associados a este tipo de transmisso. Ao analisarmos a informao, nesta ca-
tegoria de transmisso, por ano de diagnstico, verificase um decrscimo
percentual acentuado, do total de casos notificados entre 2005 e 2009, dimi-
nuindo de 44% para 23,6%. Contudo, a transmisso sexual, designadamente
heterossexual, regista, anualmente, aumento proporcional do nmero de casos,
em relao s outras categorias de transmisso, 50,6% em 2005 e 59,9% em
2009, enquanto que as notificaes, referindo a transmisso sexual (homosse-
xual) tm aumentado nos anos referidos, 7,9% em 2005 e 13,1% em 20092. A
informao epidemiolgica, referente situao em Portugal, encontrase actu-
alizada e divulgada na pgina electrnica do INSA (www.insarj.pt).
Em Portugal, a epidemia atribuise, predominantemente, disseminao
de VIH1, associada utilizao de drogas injectveis, enquanto a transmis-
so heterossexual assume maior importncia nos ltimos anos, especialmen-
te em mulheres. A informao estatstica nacional referente aos casos de
infeco por VIH/sida incompleta, para profunda caracterizao epidemio-
lgica. As tendncias temporais so influenciadas por vrios factores, de
que destacamos os aspectos associados aos gentipos de VIH. A variabili-
dade gentica destes vrus reconhecida como factor determinante, na
evoluo das epidemias locais e, certamente, os padres epidemiolgicos,
caractersticos do Pas sero determinados pelos subtipos de VIH e formas
circulantes predominantes.
No Pas, verificase a coexistncia dos dois tipos de VIH, com caracters-
ticas vricas, clnicas e macroepidemiolgicas muito distintas, cujas formas
de transmisso predominante so, presentemente, a via sexual. A infeco
por VIH tem grande impacto na sade das comunidades, especialmente por
apresentar associaes com outras infeces/doenas, por exemplo a tuber-
culose, que, por si s, apresenta uma taxa elevada de incidncia 2. As ten-
dncias temporais da epidemia da infeco por VIH/sida e o seu padro
epidemiolgico so cada vez mais influenciados pelas alteraes de aspec-
tos comportamentais e sociais, designadamente a reduo do risco de trans-
misso da infeco, em utilizadores de drogas injectveis, originando um
menor nmero de novos casos diagnosticados anualmente ou o aumento do
nmero de novos casos de infeco por VIH, atribudo transmisso hete-
rossexual, entre as mulheres com idade superior a 55 anos e homens com
mais de 65 anos2. As populaes migrantes, oriundas de zonas endmicas
para VIH, no esto suficientemente estudadas, de forma a permitir avaliar
os factores, que possam contribuir para a disseminao da infeco por VIH
no Pas, mas em 2009, considerase importante verificar o impacto que
outras patologias, nomeadamente a tuberculose, diversas infeces de trans-
misso sexual e hepatites, possam ter nestes grupos populacionais.
Nas figuras 1, 2 e 3 esto representadas as tendncias temporais das
principais categorias de transmisso, omitindose aquelas em que os valores
Epidemiologia da infeco por VIH e da sida em Portugal 103

%
70,0
59,7 56,9 59,6
60,0 55,9 Hetero
54,0 50,6
48,7 43,7 50,7 Homo/Bi
50,0 45,9
Toxico
40,0 38,3
42,1 45,2 44,0
43.2 30,1 27,4
30,0 36,5 23,6
34,0
20,0
9,2
7,6 6,3 7,0 8,4 7,6 7,9 8,7
10,0
12,0 13,1
0,0
2000 2001 2002 2003 2004 2005 2006 2007 2008 2009
Ano de diagnstico

Figura 1. Casos de sida tendncias temporais nas trs principais categorias de transmisso.

%
80,0
70,0 64,7 64,1 Hetero
57,8 61,0
56,9 57,8 56,6 Homo/Bi
60,0 53,4
46,6 Toxico
50,0 40,8
40,0
44,1 40,6 29,7 28,3
30,0 25,0 26,2
21,5 24,3
15,0 18,9
20,0
20,9
10,0 6,4
14,1 14,6 16,0 12,9
10,1 8,7 10,5 11,6
0,0
2000 2001 2002 2003 2004 2005 2006 2007 2008 2009
Ano de diagnstico

Figura 2. Casos de infeco no-sida (CRS) tendncias temporais nas trs principais cate-
gorias de transmisso.

%
90,0
Hetero
75,0
63,3 61,9 Homo/Bi
59,7 58,6 58,2 56,2
60,0 56,1
50,2 50,1 53,0 Toxico

45,0 38,7
33,1
39,3 28,7 25,1
30,0 23,4 19,5 23,2
17,2 21,2
15,0 7,5 7,6 10,2
19,4 16,8 17,4
11,0 12,5 14,2 12,7
0,0
2000 2001 2002 2003 2004 2005 2006 2007 2008 2009
Ano de diagnstico

Figura 3. Casos de PA tendncias temporais nas trs principais categorias de transmisso.


104 Maria Teresa Paixo

das tendncias so inferiores2. Verificase que, desde 2002, a transmisso da


infeco por VIH por via endovenosa, associada ao consumo de drogas ilci-
tas, apresenta uma menor proporo de casos notificados (PA, sintomticos
nosida e de sida), enquanto a transmisso por via sexual assume valores
elevados. Perante as tendncias temporais descritas, e tendo em considerao
o atraso da notificao de casos em que se baseia a anlise efectuada, no
previsvel um decrscimo da incidncia da infeco por VIH no Pas.

Bibliografia
1. Ministrio da Sade. Portaria n.o 258/2005, de 16 de Maro, DR n.o 53, Srie I-B. Integra a infeco pelo VIH
na lista das doenas de declarao obrigatria.
2. Coordenao Nacional para a Infeco VIH/SIDA. Infeco VIH/SIDA. A situao em Portugal a 31 de Dezem-
bro de 2009. Ncleo de Vigilncia Laboratorial de Doenas Infecciosas, Departamento de Doenas Infecciosas.
Doc. SIDA n.o 141, Fevereiro 2010.
3. European Centre for Disease Prevention and Control/WHO Regional Office for Europe. HIV/Surveillance in
Europe 2008. Estocolmo; European Centre for Disease Prevention and Control; 2009.
III Seco
Captulo 5

Transmisso da infeco por VIH


Maria Teresa Paixo, Elizabeth Pdua

A transmisso em adolescentes e adultos

A actual pandemia da sida o resultado directo da eficcia da transmisso


de VIH. O vrus foi isolado em diferentes lquidos orgnicos, como o sangue,
o esperma, as secrees vaginais, o leite materno, a urina e lquidos cefa-
lorraquidiano, amnitico e bronco-alveolar. Sabese que a infeco por VIH
transmitido, principalmente, atravs do contacto com lquidos orgnicos
(sangue, esperma e secrees vaginais) de indivduos infectados, sendo as
principais formas de transmisso as seguintes: Sexual, sangunea e mefi-
lho (transmisso vertical). O nmero de partculas vricas, necessrias para
iniciar a infeco, superior ao de outros vrus, igualmente transmitidos pelo
sangue (vrus da hepatite C do [VHC]), e existem cofactores que facilitam
ou promovem o processo infeccioso. A presena de outras infeces ou
doenas, de incidncia elevada, especialmente doenas de transmisso sexu-
al, constituem factores que favorecem a transmisso de VIH.
A capacidade de transmisso de VIH responsvel por dois indicadores
epidemiolgicos importantes: A incidncia e a prevalncia de casos de in-
feco por VIH e de sida, os quais retratam as principais formas de trans-
misso local. A nvel mundial, predomina a transmisso sexual de VIH1,
sendo VIH2 transmitido, quase exclusivamente, por via sexual. A transmisso
dizse generalizada em pases de frica e Sudoeste Asitico, ou regies des-
ses pases, quando na populao adulta se atribui a disseminao de VIH
transmisso sexual (heterossexual), a infeco endmica h mais de 25 anos
e a prevalncia na populao adulta superior a 1%. No entanto, a trans-
misso, por via parentrica conhece acrscimo e generalizouse em alguns
pases destas regies, em populaes com elevada utilizao de drogas
106 Maria Teresa Paixo, Elizabeth Pdua

injectveis. Na maioria dos pases, coexistem todas as formas de transmis-


so, quando se analisam reas geogrficas mais restritas.
Na Europa, a Organizao Mundial da Sade (OMS), agrupou os 54 pases,
que constituem a regio europeia (regio que abrange desde Portugal s
vrias Repblicas da exUnio Sovitica), para efeitos da vigilncia epide-
miolgica da infeco por VIH e de sida, subdividindo em trs reas geo-
grficas: A zona Oriental, Central e Ocidental. No conjunto, destas reas
geogrficas, verificase que os padres epidemiolgicos so muito diversos,
correspondendo s vias predominantes da transmisso da infeco por
VIH1.
O European Centre for Disease Prevention and Control (ECDC), que
desde 2005 a entidade responsvel pela compilao e produo da infor-
mao epidemiolgica referente epidemia, regista as caractersticas dos
novos casos e recomenda intervenes apropriadas 1.
Na zona Ocidental, correspondendo aos pases de maior desenvolvimen-
to econmico da Unio Europeia (UE), o declnio acentuado do nmero de
casos de novos diagnsticos de VIH, em subgrupos populacionais, est,
estreitamente, associado s medidas de preveno existentes, designadamen-
te aos programas de preveno da toxicodependncia e alterao dos padres
de consumo. Contudo, a transmisso sexual, nomeadamente, em homosse-
xuais masculinos, o factor a que se atribui o elevado nmero de casos
registados anualmente.
Na zona Centro, agrupando pases que estiveram politicamente associados
exUnio Sovitica, registase um padro epidemiolgico estvel, com baixo
nmero de casos totais e anuais, mas com sinais evidentes de que a transmis-
so sexual est a aumentar, predominando, em alguns pases desta regio, a
transmisso associada a comportamentos homossexuais masculinos.
Na zona do Leste europeu, englobando a exUnio Sovitica e pases de
independncia recente, o relatrio do ECDC, para 2008, afirma que a trans-
misso de VIH, nesta regio, incontrolvel e a meta de acesso universal
preveno, tratamento e cuidados de sade no poder ser atingida, in-
cluindo o acesso a programas de substituio da utilizao de drogas duras,
assim como a programas de troca de seringas, se estes no forem imple-
mentados1.
O ECDC, de acordo com os dados da vigilncia epidemiolgica, consi-
dera que a transmisso de VIH constitui, ainda, um importante problema
de sade pblica, dado que em muitos pases se verifica um aumento da
notificao de novos casos2. Dos 20 pases da UE, que reportam, regular-
mente, desde 1999, os dados referentes aos novos casos de infeco, a taxa
de novos casos diagnosticados quase duplicaram, de 2,9 por 100.000 em
1999 (8.295 casos) para 5,6 105, em 2006. Em quatro pases (Bulgria,
Eslovquia, Eslovnia e Reino Unido), verificouse que duplicou o nmero
de casos, em que a via de infeco est associada transmisso sexual, a
transmisso sexual, em homossexuais masculinos, duplicou no perodo em
causa. Na UE, o padro epidemiolgico da transmisso da infeco VIH
complexo, uma vez que as tendncias locais so diferentes:
Transmisso da infeco por VIH 107

1 A transmisso heterossexual prevalece, sendo responsvel por mais


de 50% dos casos de infeco. Contudo, muitos destes casos, so
indivduos naturais e residentes de pases africanos e de outras
regies no europeias, que, actualmente, residem ou permanecem
na UE, para usufrurem de servios de sade.
2 Na maioria dos pases, verificase que os homossexuais masculinos
continuam a registar um elevado nmero de casos, estando em
maior risco de aquisio de infeco.
3 Nos pases blticos, a epidemia encontrase, predominantemente,
associada ao uso de drogas por via injectvel e o declnio do n-
mero de casos neste grupo, poder indiciar um efeito de saturao
populacional.
4 Na UE, o acesso generalizado teraputica antiretrovrica (TARV),
o factor responsvel pelo decrscimo do nmero de casos de sida,
notificados anualmente2.
A nvel da UE, necessrio melhorar o sistema de vigilncia epide-
miolgica, integrando outras componentes, sociais (populaes migrantes)
e comportamentais (toxicodependncia), de forma a monitorizar a epidemia
e avaliar a resposta da sade pblica, designadamente os aspectos asso-
ciados preveno da infeco e o acesso universal aos cuidados de
sade1,2.

Mefilho
Um ano aps a notificao dos primeiros casos de sida, em adultos, foram
notificados aos Centers for Disease Control and Prevention (CDC) os pri-
meiros casos de sida em mulheres e crianas3,4. Em menos de uma dcada,
a sida tornouse a maior causa de morte em mulheres com menos de 45 anos
de idade e em crianas, entre o primeiro e o quinto ano de vida5. O rela-
trio da AIDS Epidemic Update, publicado em Dezembro de 2009, indica
existirem 33,4 milhes de pessoas infectadas por VIH no Mundo, em que
6,3% dos casos so registados em crianas com menos de 15 anos de ida-
de. Foi tambm estimado, que cerca de 22,4 milhes das infeces ocorre-
ram na frica subsariana6.
A transmisso vertical da me para o feto (mefilho) a principal
fonte de infeco por VIH, em crianas e jovens com menos de 15 anos de
idade. Estimase que, diariamente, 1.700 crianas nascem infectadas por
VIH e que outras 300 adquirem a infeco atravs da amamentao 7,8. Do
total de crianas infectadas por VIH, desde o incio da pandemia, cerca de
90% nasceram no continente africano9,10.
Na ausncia de qualquer interveno preventiva, o risco de transmisso
da infeco por VIH a uma criana, nascida de me infectada, pode variar
entre 1525%, nos pases industrializados, e de 2535% nos pases em vias
de desenvolvimento. Estas diferenas so, geralmente, explicadas pela fre-
quncia e durao do perodo de amamentao8,10. Considerase, ainda, que
a aquisio recente da infeco ou o estdio de doena avanada da me e
108 Maria Teresa Paixo, Elizabeth Pdua

a elevada exposio do feto a fluidos corporais maternos infectados so


factores conhecidos de risco de transmisso vertical de VIH 11.
A transmisso de VIH, da me ao filho, pode ocorrer no tero, princi-
palmente no ltimo trimestre de gestao, durante o desenvolvimento do
trabalho de parto e na fase de expulso ou, inclusivamente, aps o nasci-
mento, atravs do aleitamento materno. No entanto, os estudos efectuados
indicam que a transmisso vertical da infeco por VIH2 um aconteci-
mento possvel, mas de ocorrncia mais rara, em relao transmisso de
VIH112. Estudos realizados em pases da frica Ocidental, onde ambos os
vrus coexistem na populao, mostraram que na Gmbia (19931997) foram
detectadas percentagens de transmisso vertical de 21% e 4%, e na Costa do
Marfim (19901992) de 24,7% e 1,2%, respectivamente para VIH1 e VIH213.
Na Europa Ocidental, apenas alguns pases notificam casos de infeco por
VIH2. Independente do tipo de vrus, os valores das taxas de transmisso
mefilho tm vindo a decrescer, acentuadamente, nos ltimos anos, e valores
inferiores a 2% tm sido obtidos, especificamente, para VIH17.
Em Portugal, e at ao final de Agosto do ano de 2010, foram notificados
Unidade de Referncia e Vigilncia Epidemiolgica do Departamento de
Doenas Infecciosas (URVEDDI), 313 casos de transmisso mefilho,
correspondendo a 0,8% dos casos de infeco por VIH/sida, notificados no
Pas. A grande maioria dos casos observados, nesta categoria de transmisso,
corresponde a infeco por VIH1, embora, tambm, tenham sido notifica-
dos 19 casos de transmisso por VIH2. Um estudo referente a crianas
seguidas, entre 1989 e 1997, num hospital peditrico de Lisboa, descreve
uma percentagem de 5,4% (dois em 37 crianas) de transmisso por VIH214.
Estudos conduzidos no Laboratrio de Referncia da sida, entre 1999 a
2005, que incluram o seguimento laboratorial de 1.452 crianas nascidas
de mes infectadas por VIH, provenientes de 25 instituies de sade do
Pas (maternidades e hospitais) revelaram taxas globais de transmisso
mefilho de 3,4% e 1,5%, respectivamente, para VIH-1 e VIH-2 15,16. Um
decrscimo significativo da proporo de transmisso me-filho, da infeco
por VIH, foi observado no perodo de estudo, alcanando um valor mnimo
de 0,5% no ano de 2005, ao qual foi associado uma percentagem mxima
de cumprimento de estratgias de preveno16. Estes valores contrastam com
taxas transmisso oito vezes superiores, registadas no laboratrio, antes de
1996, quando ainda no tinha sido instituda uma interveno preventiva
com regimes teraputicos de provada eficcia17,18. A maioria das crianas
infectadas nasceu de mes que no cumpriram as medidas de preveno da
transmisso do vrus ao filho, nomeadamente durante a gravidez. A trans-
misso de VIH-1 ocorreu em 11,0% dos casos, em que no foram seguidas
as estratgias de preveno, e em, apenas, 0,9% dos casos, em que essas
medidas foram cumpridas, observandose uma associao, estatisticamente,
significativa entre a transmisso do vrus e a ausncia de preveno (teste
exacto de Fisher, p < 0,0001)16. Num estudo mais recente do Laboratrio
de Referncia da sida (dados no publicados), que incluiu 939 crianas, que
nasceram de mes infectadas, entre 2006 e 2009, em mais de 30 hospitais
Transmisso da infeco por VIH 109

Quadro 1. Distribuio dos casos positivos por grupos de mes que cumpriram a teraputi-
ca anti-retrovrica combinada (TARVc) ou no (sem TARVc), na preveno da transmisso
me-filho de VIH entre 2006 e 2009
Estudo da transmisso me-filho de VIH*
Ano Positivo n (%) Total com TARVc Positivo n (%) Total sem TARVc
2006 1 (0,5) 182 3 (8,1) 37
2007 1 (0,6) 181 3 (6,9) 43
2008 1 (0,5) 186 4 (9,1) 44
2009 2 (1,0) 192 3 (7,3) 41
Total 5 (0,7) 741 13 (7,9) 165
*Casos com informao TARVc desconhecida foram excludos dos clculos (n = 33).

e maternidades do Pas (continente e ilhas) foram identificados 18 casos


(1,9%) de transmisso vertical de VIH; analisando os casos, cuja informao
era conhecida (n = 906), cinco crianas correspondiam ao grupo de mes
com teraputica antiretrovrica combinada (TARVc) de preveno (n = 741)
e 13 crianas, ao grupo de mes sem cumprimento de TARVc de preveno
(n = 165) (Quadro 1).
Nos ltimos anos, o espectro das doenas peditricas, associadas in-
feco por VIH, foi, visivelmente, modificado, particularmente nos pases
com acesso teraputica. A razo desta alterao devese no s ao desen-
volvimento da TARVc, mas, tambm, evoluo de metodologia, que tem
possibilitado o diagnstico precoce da infeco por VIH e ao uso de mar-
cadores de monitorizao da infeco e de progresso da doena, que per-
mitem o tratamento das grvidas e das crianas infectadas, na altura mais
adequada. O rastreio de anticorpos antiVIH, em mulheres grvidas, condu-
ziu ao acentuado declnio da transmisso e incidncia da infeco por VIH,
possibilitando o tratamento precoce e cuidados especiais de sade, neces-
srios durante o decurso da gestao5,1921.
Nos Estados Unidos da Amrica (EUA), os ltimos dados apresentados,
referentes avaliao de 4.419 crianas, expostas ou infectadas por VIH,
indicaram, tambm, um declnio significativo do nmero total de casos de
sida (257 em 1992 a 79 em 1997)22. Em 1997, foi estimada, para aquele
Pas, a existncia entre 500 a 700 novos casos de crianas infectadas por
transmisso vertical de VIH, comparativamente a valores estimados de 1.000
a 2.000, para o ano de 199423. Contudo, nos pases em desenvolvimento,
esta infeco continua a ser um problema de sade pblica, de magnitude
considervel, no deixando de se observar um significativo aumento global
do nmero de crianas infectadas, particularmente na frica subsariana24.
Um estudo realizado no Ruanda, compara taxas de morbilidade e mor-
talidade, num grupo de 218 crianas nascidas de mes infectadas, com um
grupo controlo. O risco estimado de desenvolvimento de sida e de morte
110 Maria Teresa Paixo, Elizabeth Pdua

foi, respectivamente, de 28% e 35%, calculado para a idade de dois anos,


e 45% e 62% para a idade de cinco anos. A taxa de mortalidade, do grupo
em estudo, foi 21 vezes mais elevada, do que a observada no grupo con-
trolo. Aps o desenvolvimento dos primeiros sintomas, a mdia de sobrevi-
vncia das crianas infectadas foi de 12,4 meses. Estes resultados so seme-
lhantes aos de estudos conduzidos na frica do Sul, em que a maioria (83%)
das mortes em crianas, causadas por sida, ocorrem antes dos 10 meses de
idade25,26. Em frica, a infeco e a doena associada a VIH, em crianas,
conduzem morte em idade peditrica, em geral, tambm associada a causas
comuns, igualmente observadas em crianas nos pases desenvolvidos22,27.
O impacto da infeco por VIH peditrica, em frica, especialmente em
pases em desenvolvimento, devido no apenas impossibilidade de aces-
so TARVc e preveno das infeces oportunistas, como, tambm,
inexistncia de estratgias efectivas na preveno da transmisso da infeco
mefilho. O aleitamento materno, que em casos de infeco materna no
aconselhado em pases desenvolvidos, desempenha o maior papel na
aquisio da infeco por VIH, em crianas do Terceiro Mundo, particular-
mente se o perodo de amamentao for alargado at aos 1824 meses de
vida das crianas10,25. Existe um conceito, quase que generalizado, para
pases de elevada escassez de recursos, de que a amamentao de crianas
nascidas de mes infectadas por VIH pode colocar menores riscos imunit-
rios, do que a alimentao dessas crianas por leite artificial. Em Nairobi
(Qunia), um estudo realizado em crianas nascidas de mes infectadas, e
que incluiu a avaliao de 109 crianas, amamentadas a leite materno, e de
204 por leite artificial, contribuiu para a reviso e ponderao desse con-
ceito. Aps a anlise dos resultados, o nmero de crianas infectadas por
VIH, aos 24 meses de idade, foi duas vezes superior no grupo das crianas
amamentadas com leite materno22. Contrariamente ao descrito, previamente,
para os pases em desenvolvimento, de que o aleitamento artificial conduzia
a uma maior taxa de mortalidade, neste estudo as taxas cumulativas de
mortalidade so semelhantes em ambos os grupos, 24,4% (n = 45) nas
amamentadas e 20% (n = 39) nas alimentadas com leite artificial. impor-
tante salientar que, em crianas nascidas de mulheres africanas noinfec-
tadas por VIH, as taxas de mortalidade para as crianas alimentadas com
leite artificial, so trs a quatro vezes mais altas do que em crianas ama-
mentadas com leite materno22. No estudo realizado em Nairobi, a mortali-
dade associada alimentao artificial foi, significativamente, menor do que
a morte devida aquisio da infeco por VIH. Estes resultados no dei-
xam de ter importantes implicaes para os gestores em sade pblica de
pases do continente africano. No entanto, neste campo, a controvrsia ain-
da persiste pois, segundo alguns investigadores, o risco em casos de ama-
mentao exclusiva por leite materno, comparativamente a casos de alimen-
tao por leite artificial ou amamentao mista (leite materno e artificial),
incluindo a ingesto de slidos, ainda no foi, devidamente, avaliado 28. Um
estudo recente, no Botswana, mostrou que a taxa de mortalidade (incluindo
todas as causas de morte), aos sete meses de idade, foi, significativamente,
Transmisso da infeco por VIH 111

superior nas crianas alimentadas por leite artificial, comparativamente s


amamentadas por leite materno e, simultaneamente, a cumprir profilaxia
com zidovudina (AZT)29.
Neste Pas, foram registados, nos primeiros quatro meses do ano de
2006, 22.500 casos de crianas com diarreia (comparando com 9.166 casos
em igual perodo do ano de 2005), o que contribuiu para um aumento de
20 vezes do nmero de mortes em crianas, com menos de cinco anos. A
maioria destas crianas no beneficiou da alimentao por leite materno.
Em pases de escassos recursos, as decises requerem uma avaliao dos
benefcios reais do decrscimo da transmisso vertical de VIH, com o no
aconselhamento da amamentao.
Vrios regimes teraputicos provaram ser eficientes para a reduo da
transmisso perinatal por VIH21,30. Nestas condies, para alm da reduo
efectiva do risco da transmisso de VIH ao filho, pode ser, ainda, preser-
vada a opo de escolha, por parte das mes, relativamente amamentao
dos filhos com o leite materno31. Porm, em muitos pases, os recursos
teraputicos para preveno da infeco so ainda insuficientes. Enquanto
no se desenvolver e disponibilizar uma vacina para a preveno da trans-
misso de VIH, a infeco peditrica por VIH e a sida continuaro a ser
uma importante causa de morbilidade e mortalidade, particularmente nos
pases em desenvolvimento32.
Os resultados encorajadores, obtidos em mulheres grvidas, que cumpri-
ram o protocolo teraputico de preveno da transmisso da infeco por
VIH1, e os consequentes benefcios, observados nos recmnascidos, devem
ser, tambm, estudados numa outra perspectiva. Desde 1994, nos pases com
recursos, a administrao de AZT efectuada por rotina a mulheres grvi-
das infectadas por VIH. Contudo, a partir de 1996, devido ao aumento na
prevalncia de resistncias, foram iniciados regimes mais complexos, com
administrao de mltiplos antiretrovricos (ARVs)30. Actualmente, ainda
no conhecido o efeito da administrao de ARVs em mulheres que foram
infectadas com vrus resistentes, assim como quais as consequncias de
mutaes vricas, que conferem resistncia a frmacos, na transmisso pe-
rinatal de VIH. Esta uma rea de investigao emergente, para a qual
existe informao limitada e contraditria33.
Mutaes genotpicas da transcriptase reversa, associadas resistncia ao
AZT e nevirapina, foram detectadas em grvidas infectadas por VIH134,35.
Mas, enquanto que em alguns estudos no foi encontrado um efeito estatis-
ticamente significativo, na transmisso vertical do vrus, em outros estudos
foi mostrada associao com a transmisso da infeco, ou observada a trans-
misso vertical de vrus resistentes, da me infectada ao recmnascido34,3639.
Por outro lado, o efeito da transmisso de vrus resistentes, na progresso
clnica da infeco peditrica, tambm, ainda, no conhecido. Alguns
estudos sugerem que a progresso mais rpida em crianas expostas, pe-
rinatalmente, ao AZT, comparativamente s noexpostas40,41.
A presena de estirpes de VIH1, resistentes a ARVs, nas mes infecta-
das, pode estar relacionada com o insucesso do esquema teraputico de
112 Maria Teresa Paixo, Elizabeth Pdua

preveno da transmisso do vrus criana. A transmisso vertical de va-


riantes de VIH1 multirresistentes pode ocorrer devido incapacidade de
reduo, na grvida, dos nveis de carga vrica plasmtica. A identificao
das variantes vricas, possuindo mutaes consideradas relevantes, e que,
possivelmente, conduzem maior virulncia, poder fornecer, ao clnico,
informao para a aplicao de medidas alternativas, na preveno da trans-
misso vertical de VIH.

Bibliografia
1. Europen Centre for Disease Prevention and Control/WHO Regional Office for Europe. HIV/AIDS surveillance
in Europe 2008. Estocolmo: European Centre for Diseases Prevention and Control; 2009.
2. European Centre for Disease Prevention and Control. Annual Epidemiological Report on Communicable Dis-
eases in Europe 2008. Report on the State of Communicable Diseases in EU and EEA/EFTA countries. ECDC;
2009.
3. Centers for Disease Control (CDC). Pneumocystis pneumonia Los Angeles. Morbid Mortal Weekly Rep.
1981;30:250-2.
4. CDC. Unexplained immunodeficiency and opportunistic infections in infants New York, New Jersey, California.
Morbid Mortal Weekly Rep. 1982;31:665-7.
5. Sison AV, Campos JM. Laboratory methods for early detection of Human Immunodeficiency Virus Type 1 in
Newborns and Infants. Clinical Microbiology Reviews. 1992;5(3):238-47.
6. UNAIDS/WHO AIDS Epidemic Update: December 2009. Disponvel em: http://data.unaids.org/pub/Report/2009/
JC1700_Epi_Update_2009_en.pdf
7. Kourtis AP, Duerr A. Prevention of perinatal HIV transmission: a review of novel strategies. Expert Opin Inves-
tig Drugs. 2003;12(9):1535-44.
8. UNAIDS Technical Update mother-to-child transmission of HIV; September 2000.
9. UNAIDS. 2008 Report on the global AIDS epidemic. 2008 Disponvel em: http://www.unaids.org/en/Knowledge-
Centre/HIVData/GlobalReport/2008/2008_Global_report.asp
10. WHO. Breastfeeding and replacement feeding practices in the context of mother-to-child transmission of HIV.
Maio 2002.
11. Newell ML, Rogers M. Pregnancy and HIV infection: a European consensus on management. AIDS. 2002;16
Suppl 2:1-18.
12. Burgard M, Jasseron C, Matheron S, et al.; ANRS French Perinatal Cohort EPF-CO1. Mother-to-child transmis-
sion of HIV-2 infection from 1986 to 2007 in the ANRS French Perinatal Cohort EPF-CO1. Clin Infect Dis.
2010;51(7):833-43.
13. Schim van der Loeff M, Aaby P. Towards a better understanding of the epidemiology of HIV-2. AIDS. 1999;13
Suppl A:69-84.
14. Cavaco-Silva P, Taveira NC, Loureno MH, et al. Vertical transmission of HIV-2. Lancet. 1997;349:177-8.
15. Pdua E, Miguel R, Almeida C, et al. Evoluo da transmisso vertical do VIH (1999-2002): protocolo de
estudo do Laboratrio de Referncia da SIDA. Rev Port Doen Inf. 2003;2(2):22.
16. Pdua E, Almeida C, Nunes B, et al. Assessment of mother-to-child HIV-1 and HIV-2 transmission: an AIDS
reference laboratory collaborative study. HIV Med. 2009;10:182-90.
17. Faria A, Pdua E, Avillez F, et al. PCR: Experincia laboratorial no diagnstico da infeco por VIH-1 [abstract
70]. VII Congresso de Patologia Clnica. Estoril; 1994.
18. Faria A, Pdua E, Valle H, et al. Diagnstico laboratorial da infeco pelo VIH em crianas nascidas de mes
seropositivas [abstract B3]. III Congresso Nacional sobre SIDA. Maia; 1997.
19. Taylor GP, Hermione-Lyall EG, Mercey D, et al. British HIV association guidelines for perscribing antiretrovi-
ral therapy in pregnancy (1998). Sex Transm Inf. 1999;75(2):90-7.
20. European Collaborative Study. HIV-infected pregnant women and vertical transmission in Europe since 1986.
AIDS. 2001;15:761-70.
21. Panel on Treatment of HIV-Infected Pregnant Women and Prevention of Perinatal Transmission. Recommendations
for Use of Antiretroviral Drugs in Pregnant HIV-1-Infected Women for Maternal Health and Interventions to
Reduce Perinatal HIV Transmission in the United States. 24 Maio 2010. p. 1-117. Disponvel em: http://aid-
sinfo.nih.gov/ContentFiles/PerinatalGL.pdf
22. Nielson K. Recent advances in the clinical management of HIV-infected Infants and children. Medscape HIV/
AIDS: Annual Update. 2000.
23. CDC. Perinatally acquired HIV/AIDS. Morbid Mortal Weekly Rep. 1997;46:1086-92.
24. Nolan ML, Greenberg AE, Fowler MG. A review of clinical trials to prevent mother-to-child HIV-1 transmission
in Africa and inform rational intervention strategies. AIDS. 2002;16(15):1991-9.
25. Cock KM, Fowler MG, Mercier E, et al. Prevention of mother-to-child HIV transmission in resource-poor
countries Translation research into policy and practice. JAMA. 2000;283(9):1175-82.
26. Coutsoudis A, Pillay K, Spooner E, et al. Morbility in children born to women infected with human immuno-
deficiency virus in South Africa: does mode of feeding matter? Acta Paediatr. 2003;92(8):890-5.
27. Sartorius BK, Kahn K, Vounatsou P, Collinson MA, Tollman SM.Young and vulnerable: Spatial-temporal trends
and risk factors for infant mortality in rural South Africa (Agincourt), 1992-2007. BMC Public Health.
2010;10(1):645.
Transmisso da infeco por VIH 113

28. Coovadia HM, Rollins NC, Bland RM, et al. Mother-to-child transmission of HIV-1 infection during exclusive
breastfeeding in the first 6 months of live: an intervention cohort study. Lancet. 2007;369:1107-16.
29. Thior I, Lockman S, Smeaton LM, et al. Breastfeeding plus infant zidovudine prophylaxis for 6 months vs
formula feeding plus infant zidovudine for 1 month to reduce mother-to-child HIV transmission in Botswana: a
randomized trial: the Mashi Study. JAMA. 2006;296:794-805.
30. Mofenson LM. U.S. Public Health Service task force recommendations for use of antiretroviral drugs in pregnant
HIV-1 infected women for maternal health and interventions to reduce perinatal HIV-1 transmission in United
States. Morbid Mortal Weekly Rep. 2002;22:1-38.
31. Kouanda S, Tougri H, Cisse M, et al. Impact of maternal HAART on the prevention of mother-to-child transmission
of HIV: results of an 18-month follow-up study in Ouagadougou, Burkina Faso. AIDS Care. 2010;22(7):843-50.
32. Biberfeld G, Buonaguro F, Lindberg A, et al. Prospects of vaccination as a means of preventing mother-to-child
transmission of HIV-1. Acta Paediatr. 2002;91(2):241-2.
33. Nolan M, Glenn M, Mofenson LM. Antiretroviral prophylaxis of perinatal HIV-1 transmission and the potential
impact of antiretroviral resistence. J AIDS. 2002;30:216-29.
34. Palumbo P, Holland B, Dobbs T, et al. Antiretroviral resistance mutations among pregnant human immunodefi-
ciency virus type 1-infected women and their newborns in the United States: vertical transmission and clades. J
Inf Dis. 2001;184:1120-6.
35. Lockman S, Shapiro RL, Smeaton LM, et al. Response to Antiretroviral Therapy after a Single, Peripartum Dose
of Nevirapine. N Engl J Med. 2007;356:135-47.
36. Welles SL, Pitt J, Colgrove R, et al. HIV-1 genotypic zidovudine drug resistance and the risk of maternal-infant
transmission in the women and infants transmission study. AIDS. 2000;14:263-71.
37. Johnson VA, Petropoulos CJ, Woods CR, et al. Vertical transmission of multidrug-resistant HIV-1 and continued
evolution of drug resistance in an HIV-1 infected infant. J Infect Dis. 2001;183:1688-93.
38. Masquelier B, Chaix ML, Burgard M, et al. Zidovudine genotypic resistance in HIV-1-infected newborns the
French perinatal cohort. J Acquir Immune Defic Syndr. 2001;27(2):99-104.
39. Eshleman SH, Mracna M, Guay LA, Deseyve M, et al. Selection and fading of resistance mutations in women and
infants receiving nevirapine to prevent HIV-1 vertical transmission (HIVNET 012). AIDS. 2001;15(15):1951-7.
40. Kuhn L, Abrams EJ, Weedon J, et al. Disease progression and early viral dynamics in human immunodefi-
ciency virus infected children exposed to zidovudine during prenatal and perinatal periods. J Infect Dis. 2000;
182:104-11.
41. De Souza RS, Gmez-Marn O, Scott GB, et al. Effect of prenatal zidovudine on disease progression in perina-
tally HIV-1infected infants. J Acquir Immune Defic Syndr. 2000;24:154-61.
IV SECO

Diagnstico da infeco
por VIH
IV Seco
Captulo 1

Testes serolgicos e vricos*


Marlia Pedro

Generalidades
Na actualidade, existem dois pontos fundamentais que se devem ponderar
no diagnstico da infeco por vrus da imunodeficincia humana (VIH):
O primeiro consiste em verificar se o indivduo se encontra infectado e o
segundo colocase depois da confirmao da infeco e tem por objectivo
a deteco da actividade de replicao do vrus.
A infeco causada por VIH determinase por diversos testes. Os vrus
pesquisamse, utilizando mtodos directos para os vrios componentes v
ricos. Estes incluem a protena p24/25, que se efectua por testes imunoen
zimticos. O ADN e o ARN dos vrus identificamse por testes, que se
baseiam em tcnicas de biologia molecular. Na grande maioria das infeces,
o diagnstico laboratorial efectuase com o recurso a testes de pesquisa de
anticorpos especficos contra VIH e que resultam da resposta imunitria do
indivduo infectado, perante os diferentes antignios do vrus. No mercado,
esto disponveis testes de elevada sensibilidade e especificidade, que per-
mitem o diagnstico laboratorial da infeco, preciso e de qualidade.
As descries dos procedimentos tcnicos sero tratadas de uma forma
genrica, pela grande diversidade de testes existentes e, em simultneo,
considerarseo as indicaes, vantagens e desvantagens que oferecem no
diagnstico da infeco por VIH.

Diagnstico serolgico
Os testes de pesquisa de anticorpos tambm se denominam testes de ras-
treio. Os anticorpos produzemse algumas semanas depois da infeco.

*Nota do editor: Este captulo no foi actualizado em relao 3.a edio do Manual sobre sida (2008)
118 Marlia Pedro

Designase por seroconverso a presena de anticorpos antiVIH no indiv-


duo infectado. O tempo que decorre desde o contgio at seroconverso
varivel de uma para a outra pessoa, depende da estirpe do vrus, que
infecta, do inculo, da via de transmisso e das caractersticas do teste
utilizado para a pesquisa do anticorpo, sendo a sensibilidade do ensaio um
parmetro importante a ter em considerao.

Testes imunoenzimticos para o rastreio de anticorpos


Nos primeiros testes de rastreio de anticorpos, baseados em lizado vrico pu
rificado testes de primeira gerao a seroconverso era detectada, em mdia
4556 dias depois da infeco e o perodo de janela era inferior a 20 semanas1.
Actualmente, os testes de rastreio de terceira gerao baseiamse em pp-
tidos sintticos e antignios recombinantes para VIH1, VIH2, grupo O e
tm a possibilidade de detectar anticorpos IgM2. Com a utilizao destes,
cerca de metade dos indivduos infectados tm o anticorpo positivo 21 dias
depois da infeco. Dos restantes, a maioria detectase ao fim de 60 dias,
embora 5% seroconverta depois dos seis meses. A aplicao, nestes casos,
de testes de Ag p24/25, ADN ou de ARN reduz, apenas, o perodo de ja-
nela em uma ou duas semanas3.
Os principais formatos, usados para o rastreio do anticorpo antiVIH,
so o ensaio de ligao indirecta, o ensaio por captura de anticorpo e o
ensaio em sandwich, com duplo antignio. Os ensaios de ligao indirecta
correspondem a testes designados de primeira gerao (EnzymeLinked Im-
munosorbent Assay ELISA) e a testes de segunda gerao, baseados em
antignios recombinantes, que representavam protenas das regies gag e
env do vrus. Os testes de ligao indirecta, de primeira gerao, no eram
exclusivos de testes ELISA, mas tambm englobavam testes de imunofluo-
rescncia e Western Blotting. Os ensaios imunoenzimticos em linha (LIA),
que utilizam protenas recombinantes podem ser considerados ensaios de
ligao indirecta de segunda gerao. Os ensaios de captura de anticorpos
utilizam protenas recombinantes; o princpio do teste o ensaio de ligao
indirecta inverso. Os ensaios em sandwich, com duplo antignio, tambm
chamados testes de terceira gerao, baseiamse em antignios recombinan-
tes e pptidos sintticos.
A variao antignica de VIH pode demonstrarse pela modificao das
protenas de um vrus, que infecta o indivduo, e para as quais os antignios
do teste exibem diferenas, o que resulta na impossibilidade de deteco e,
ainda, na produo de um resultado negativo falso; este facto constatouse
depois da descoberta de VIH2. O problema conduziu introduo de pro-
tenas do invlucro de VIH2, nos testes de rastreio. A descoberta do grupo
O fundamentou, tambm, a necessidade de melhoria dos antignios utiliza-
dos nos mesmos testes4,5.
No ano de 1997, produziramse ensaios com caractersticas diferen-
tes dos anteriores, designados de quarta gerao. Nestes, a pesquisa de
anticorpos e de antignio p24/25 efectuase em simultneo. A principal
Testes serolgicos e vricos 119

vantagem consiste na reduo do perodo de janela de diagnstico, em


quatro a cinco dias6.

Interpretao dos resultados


Os resultados reactivos ou na zona cinzenta, obtidos em testes de rastreio
na primeira determinao, devero sempre ser repetidos e se continuar a
obteremse resultados diferentes de negativo, essas amostras submeterseo,
na fase seguinte do procedimento diagnstico, a testes de confirmao ou
testes suplementares. Na actualidade, a sensibilidade e a especificidade dos
testes ELISA so superiores a 99%. Os resultados negativos falsos podem
surgir nas duas primeiras semanas da infeco ou na fase avanada, quando
a produo dos anticorpos est reduzida. Os resultados positivos falsos tm
sido associados a vrias situaes, que incluem doenas autoimunes, insu-
ficincia renal, fibrose qustica, gravidez mltipla, politransfuso, doena
heptica, hemodilise, vacinao para a hepatite B, para a raiva e para a
gripe7,8.

Testes rpidos
Os testes rpidos so ensaios que necessitam de equipamento muito redu-
zido e efectuamse em menos de 30 min. Estes testes tm vrias combi-
naes de antignios para VIH1 e VIH2, que se fixam a materiais trans-
portadores diversos (imunoensaios de captura em fase slida, ensaios
immunoblot dot e ensaios de aglutinao em ltex). A sua utilidade reves-
tese de uma importncia considervel em diversos pases africanos dotados
de meios escassos, no que respeita a equipamento, energia elctrica e re-
cursos humanos e, tambm, nas situaes em que um resultado obtido no
laboratrio no esteja disponvel de imediato. Os testes rpidos, submetidos
a painis de seroconverso, apresentam sensibilidades inferiores maioria
dos testes baseados em ELISA das geraes recentes 9. Por esta razo, os
testes rpidos aplicamse, em regra, a situaes de emergncia. Tambm,
podem testarse outros lquidos, como por exemplo transudados da muco-
sa oral, secrees vaginais e urina, embora as sensibilidades dos testes,
destinados aos produtos biolgicos referidos, no se possam avaliar por
painis de seroconverso.

Testes combinados para anticorpos e antignio p24


A nvel mundial, h a preocupao de obter um diagnstico precoce
da inf eco por VIH e de reduzir a janela serolgica. Desde o ano de
1997 que vrias companhias produzem testes combinados para a de-
teco, simultnea, de anticorpos e antignio p24, designados por
testes de quarta gerao 10. Como foi referido, os testes combinados,
quando comparados com os testes de terceira gerao, pela anlise de
painis de seroconverso, reduzem o perodo de janela em, cerca de,
120 Marlia Pedro

quatro a cinco dias. No entanto, em virtude de uma menor sensibilidade do


antignio p24, os testes de quarta gerao no devem ser utilizados como
substitutos do teste de deteco do antignio p24, no diagnstico da infec-
o precoce por VIH.

Testes de confirmao
A confirmao de resultados reactivos, obtidos em testes de rastreio, foi
cedo considerada como muito necessria. No ano de 1984 introduziuse a
tcnica de Western Blot, para testar VIH11. No ano seguinte, esta foi pro-
posta para a confirmao de testes ELISA reactivos e, actualmente, perma-
nece, ainda, como o teste de confirmao mais utilizado no mundo. A
Western Blot, baseada em lizado vrico, apresenta uma sensibilidade que
anloga dos testes ELISA de primeira gerao e, ainda, detecta anticorpos
com reactividades cruzadas, produzidos por agentes diferentes de VIH, o
que conduz obteno de uma taxa elevada de resultados indeterminados.
A Western Blot detecta anticorpos contra protenas especficas e desna-
turadas de VIH, que incluem protenas do core (p18, p24/25, p55), da po-
limerase (p34, p68) e do invlucro (gp160, gp120 e gp41), para a identifi-
cao de anticorpos antiVIH1.
A utilizao de protenas recombinantes, na produo de testes de Wes-
tern Blot, constituiu uma melhoria introduzida por alguns fabricantes. Os
antignios purificados aplicamse sob a forma de bandas separadas em
membranas ou tiras de nylon, sendo estas ltimas colocadas sobre suportes
plsticos. Alguns destes testes apresentam sensibilidade e especificidade
mais elevadas do que a Western Blot convencional e permitem, ainda, a
diferenciao da infeco produzida por VIH1 da por VIH212. De referir,
tambm, que surgem reaces indeterminadas, neste tipo de Western Blot.
Durante a execuo tcnica deve haver o mximo cuidado, para evitar os
problemas ocasionados por contaminaes, quer em virtude da proximidade
dos canais de incubao, quer os motivados pela contaminao de luvas,
quando se efectua a remoo das rolhas dos tubos das amostras. A conta-
minao, originada por uma amostra de elevada reactividade, para diluies
at um milho de vezes, conduz ao aparecimento de bandas de fraca reac-
tividade na Western Blot.
Quanto interpretao, a ausncia de todas as bandas ou a presena de
anticorpos p18 ou p16, consoante seja VIH1 ou VIH2, significa que o
teste negativo. Uma Western Blot positiva se duas bandas do env gp160,
gp120 ou gp41 esto presentes e associadas a bandas do gag ou pol. A
presena de quaisquer bandas, que no apresentem os critrios para a ob-
teno de um resultado positivo, significa um resultado indeterminado 13.
Cerca de 4-20% de soros, que so reactivos repetidos pelo ELISA
VIH1, so interpretados como indeterminados, pela tcnica da Western
Blot.
Os resultados indeterminados podem surgir em doentes com perturba-
es de natureza autoimune, tais como por exemplo o lpus eritematoso
Testes serolgicos e vricos 121

sistmico, em indivduos infectados por alguns vrus, entre os quais se po-


dem citar o vrus herpes simplex tipo 1, o vrus citomeglico ou, ainda,
depois da vacinao contra os vrus influenza ou da raiva. As reaces
produzidas por anticorpos noespecficos podem observarse, tambm, em
doentes com linfoma, esclerose mltipla e doena heptica 14.
As bandas de intensidade fraca e escassas no devem constituir a base
para o diagnstico de infeco por VIH. Nestas circunstncias, o recurso
deteco do antignio p24/25, a pesquisa de ARN vrico e a cultura do
vrus podem fornecer informaes esclarecedoras da situao de infeco
versus noinfeco, num determinado indivduo. Outras causas para Western
Blot indeterminada incluem os testes efectuados no perodo de janela, du-
rante o qual os anticorpos para VIH esto, ainda, em desenvolvimento,
reactividade cruzada com VIH2 e perda de anticorpos do core na infeco
por VIH tardia.
O diagnstico de infeco por VIH revestese de grande importncia,
pois devese fazer o aconselhamento adequado, tendo por objectivo reduzir
a transmisso. Assim, em indivduos que tm risco elevado de infeco e
que apresentam anlises com resultados indeterminados devese efectuar
uma nova determinao, nos 30 dias imediatos, e se os resultados persis-
tirem indeterminados, o teste repetirse, de novo, dois a cinco meses mais
tarde.

Exame directo de amostras para vrus e antignios vricos


Isolamento de VIH
O isolamento de VIH um instrumento de diagnstico moroso e de custo
elevado.
A tcnica de isolamento do vrus consiste na separao de leuccitos, a
partir de amostras de sangue anticoagulado, ao qual se adiciona Ficoll, o
que permite a separao daqueles, depois de centrifugar a mistura referida.
Em seguida, procedese cocultura, utilizando leuccitos de indivduos
saudveis e estimulados pela fitohemaglutinina. As culturas so positivas
cerca de 15 dias depois, mas podem demorar at 60 dias a positivar15. As
culturas de VIH apresentam especificidade elevada, mas a sensibilidade
de 90%. No presente, a rapidez de novos mtodos de diagnstico, como a
deteco do ARN ou do ADN vrico, por mtodos de reaco em cadeia da
polimerase (PCR), ou outros, relegam o isolamento de VIH para fins de
investigao e no se utiliza para fins de diagnstico quer em adultos, quer
em crianas.

Testes de antignio
Os testes de pesquisa de antignio p24 tm aplicao em situaes de in-
feco primria por VIH ou quando se obtm resultados indeterminados,
em Western Blot, e o indivduo refere epidemiologia sugestiva de infeco
recente.
122 Marlia Pedro

Os testes de antignio p24 tm indicao na fase inicial da infeco por


VIH, quando o antignio se pode apresentar com ttulos elevados, na circu
lao, e os anticorpos, ainda, no foram produzidos ou circulam em con-
centraes baixas, o que, ainda, no permite atribuir critrios de positivida-
de em Western Blot.
Os primeiros testes de pesquisa de antignio foram aprovados em 1989,
pela FDA, e eram testes de captura do antignio, baseados em anticorpos
policlonais. O teste consiste na ligao do antignio p24, presente no soro,
ao anticorpo especfico p24, no momento actual, de origem monoclonal. O
antignio ligado reage, por sua vez, com outro anticorpo p24, marcado com
uma enzima, capaz de produzir um sinal, quando combinado com o subs-
trato compatvel, na fase seguinte do teste. Tambm, podemse efectuar
imunoensaios por electroquimioluminiscncia (electrochemiluminescence
immunoassay ou ECLIA), baseados em tcnica de sandwich. As amostras,
que apresentam resultados reactivos, devemse analisar por um teste de neu
tralizao. Os testes de produo mais recente detectam o antignio dos
grupos M (sensibilidade de cinco pg/ml), O e tambm VIH2, embora com
menor sensibilidade (0,5 ng/ml). As amostras, confirmadas por neutralizao,
nas quais se utilizam anticorpos humanos antiVIH, consideramse positivas
para o antignio VIH.
Os laboratrios, que efectuam testes de pesquisa de antignio, devem ter
em ateno que a presena de anticorpos especficos p24, numa determina-
da amostra, pode conduzir formao de imunocomplexos com o antignio
p24, o que produz um resultado negativo falso. Uma soluo, que per-
mite contornar este problema, consiste na utilizao de testes de dissociao
de imunocomplexos, alguns dos quais actuam em meio cido associado a
calor, outros em meio bsico. Estes mtodos melhoram a sensibilidade do
teste de deteco de antignio, de 12-23%16. A presena de anticorpos es
pecficos de imunoglobulinas, como por exemplo o factor reumatide, que
podem ligarse ao anticorpo de captura e ao anticorpo marcado com a en-
zima, na ausncia de antignio p24, conduz a um resultado positivo falso.
Nesta situao, a reduo do sinal, obtido pelo teste de neutralizao,
anloga quer se adicionem anticorpos especficos de VIH, quer anticorpos
de controle. O teste de dissociao de imunocomplexos liberta, tambm, o
factor reumatide dos complexos imunoglobulinaantiimunoglobulina, pelo
que pode conduzir a um maior nmero de resultados positivos falsos. A
sensibilidade do teste de antignio p24 apresenta limitaes, perante os
testes de biologia molecular, razo pela qual tm surgido modificaes
tcnicas nas diferentes fases, com o intuito de melhorar o procedimento de
deteco do antignio. A principal alterao consiste na amplificao do
sinal produzido pelo antignio, que leva obteno de um teste, cuja sen-
sibilidade aproximase da quantificao do ARN vrico por PCR e cujo
limiar de 200 cpias/ml. O interesse deste teste reside no custo menor e
na facilidade de execuo tcnica, pelo que poder vir a constituir um ins-
trumento de diagnstico muito sensvel, especfico e talvez de monitorizao
da teraputica antiretrovrica17.
Testes serolgicos e vricos 123

Virologia molecular: Aplicaes no diagnstico


A biologia molecular constitui um campo fundamental nas cincias bsicas
e na medicina clnica. As anlises de hibridizao, a amplificao por PCR,
a tcnica do ADN ramificado (branched DNA) e as anlises das sequncias
de cidos nucleicos, permitem a deteco especfica e sensvel de genomas
vricos, a sua caracterizao molecular e, ainda, a localizao celular dos
mesmos. As tcnicas moleculares possibilitam a deteco de mutantes vri-
cas ou de infeces, para as quais no existem ensaios serolgicos. As
tcnicas moleculares fornecem uma informao nova, que resulta em melhor
compreenso da epidemiologia e da patognese da infeco por VIH e abrem
novas perspectivas para o diagnstico e para a teraputica.

Tcnicas para a deteco do ARN ou ADN vrico


A deteco directa de VIH, baseada na pesquisa de ADN ou ARN, efectuase
por trs tcnicas com princpios diferentes. A primeira, designada por
PCR, consiste na desnaturao de uma cadeia dupla de ADN, por aque-
cimento, na presena de duas sondas genmicas, designadas por inicia-
dores (primers) especficos de VIH. Estes iniciadores so sequncias sin-
tticas de ADN, de cadeia simples, com cerca de 20-30 bases de
comprimento e produzem-se de modo a serem complementares da sequn-
cia de ADN, que se pretende detectar. A fixao dos iniciadores, designada
por moldagem ou annealing, constitui a fase seguinte do mtodo e deve-se
efectuar a uma temperatura inferior utilizada para a desnaturao. Os
iniciadores so submetidos a um procedimento de extenso na presena de
uma enzima, a Thermus aquaticus (Taq polimerase), que uma ADN po-
limerase, dependente do ADN e resistente ao calor. Um nucletido adi-
cionado, ento, depois de outro e as cadeias simples convertemse em duas
cadeias complementares de ADN duplas. Este procedimento repetese du-
rante 30 ou 40 ciclos. As cadeias de ADN, recmformadas, servem como
moldes para a formao de novas cadeias no ciclo seguinte, que compre-
ende uma desnaturao, uma moldagem e uma extenso 18. Na teoria, 20
ciclos originam um milho de cpias, mas na prtica o nmero obtido
inferior. Quando o material vrico inicial para a PCR constitudo por
ARN, deve produzirse ADNc, gerado por trancrio reversa e, em segui-
da, amplificase este ADNc, pelo procedimento referido. O teste comercial
da firma Roche Diagnostics baseiase neste princpio tcnico e designase
por Amplicor HIV1 Monitor verso 1.5, o qual pesquisa e quantifica o
ARN genmico do grupo M e o produto de ADN, obtido na tcnica, de-
tectase por ELISA.
A segunda tcnica, NASBA (Nucleic Acid SequenceBased Amplification),
comercializada com a designao NucliSens, pela firma Organon Teknika,
amplifica o ARN, por um procedimento multi-enzimtico isotrmico. As
trs enzimas utilizadas so a transcriptase reversa do vrus da mieloblasto-
se aviria (AVMRT), a ARNse H e a T7 ARN polimerase (T7 ARN pol).
124 Marlia Pedro

O produto obtido ARN e amplificase uma sequncia do gene gag, an-


loga da primeira tcnica descrita19. Ambos os ensaios tm padres de
quantificao internos, que permitem o controlo da extraco do ARN e da
amplificao.
Na terceira tcnica, denominada de ADN ramificado (Quantiplex, Chiron
Diagnostics), o ARN de VIH capturado por sondas de captura especficas,
imobilizadas numa superfcie slida da microplaca. O ARN capturado rea-
ge com sondas, que hibridizam, por uma das terminaes, com mltiplas
sondas de sequncias curtas da regio pol de VIH1 e pela outra terminao
fixam as sondas de ADN ramificado. Este ADN ramificado (amplificador)
reage com outro ADN ramificado, que hibridiza com o primeiro. Na fase
seguinte, adicionamse sondas marcadas com enzima, que hibridizam com
o amplificador e a anlise efectuase por quimioluminiscncia20. Quando se
comparam as trs tcnicas, verificase que, nas duas primeiras, existe uma
amplificao das sequncias vricas, mas no que respeita terceira esta
amplificao no se verifica, o que acontece uma potenciao designada
por amplificao do sinal, devida interaco de sondas moleculares
adicionadas ao meio, em que o ARN foi capturado e com o qual se faz a
hibridizao. A principal vantagem deste mtodo a ampla especificidade,
devida utilizao de 40 sondas diferentes do gene pol, o gene de VIH
mais conservado. A principal desvantagem da tcnica do ADN ramificado,
consiste na utilizao de volumes grandes (dois ml) de plasma, que com-
pensam a sua menor sensibilidade.
O diagnstico da infeco por VIH1 devese efectuar pela pesquisa do
seu ADN. Os testes de quantificao do ARN no tm, como objectivo, o
diagnstico, mas a monitorizao da progresso da infeco e a eficcia do
tratamento antiretrovrico.
Os testes moleculares so muito sensveis a variaes das sequncias do
vrus, o que pode produzir resultados negativos falsos, se forem utilizadas
sequncias no conservadas. Este risco aumenta quando os testes no so
de origem comercial. A contaminao, por ADN amplificado ou a partir de
amostras diferentes da que se pretende analisar, constitui outro problema,
em particular com a PCR, razo pela qual os laboratrios, que efectuam
estas tcnicas, devem implementar todas as medidas, que permitam a exe-
cuo tcnica com a qualidade mxima. Consideramse factores relevantes
para os testes moleculares a colheita e a preparao das amostras. O ARN
plasmtico, na presena de clulas, instvel e deve ser colhido em tubos
com EDTA, por sistema de vcuo e processado de preferncia at duas
horas depois da colheita ter sido efectuada. O plasma pode ser congelado
e descongelado trs vezes, pois o nvel de ARN no sofre reduo signifi-
cativa. Actualmente, existe equipamento automatizado, para as fases de
amplificao e deteco, que reduzem os resultados positivos falsos, ob-
tidos por contaminao de amostras, devido a produtos amplificados. Ex-
tractores de cidos nucleicos esto disponveis, os quais utilizam filtros
descartveis e sistema fechado, o que facilita a extraco de numerosas
amostras21.
Testes serolgicos e vricos 125

Quadro 1. Descrio dos testes de diagnstico para VIH


Teste Utilidade clnica Comentrios
Teste baseado em Teste de rastreio primrio Sensibilidade e especificidade >
anticorpos ELISA 99%.
Depende da resposta imunitria do
organismo. Os indivduos com
infeco aguda tm um perodo
de janela, durante o qual o teste
negativo.
Western Blot Teste utilizado para Especificidade 97,8%. Resultados
confirmar a presena de indeterminados, por vezes no
anticorpos anti-VIH especficos.
Deteco de antignio Complemento do Utiliza-se para avaliar a infeco
p24 diagnstico aguda por VIH e como teste de
rastreio em dadores de sangue,
para reduzir o perodo de janela.
Deteco de cidos Monitorizao da Sensvel e especfico. til no
nucleicos vricos progresso VIH e eficcia diagnstico de infeco aguda, em
PCR, ADN ramificado da teraputica anti- indivduos de risco elevado com
e NASBA retrovrica testes de WB negativos ou
indeterminados. Uma carga vrica
positiva fraca pode ser um positivo
falso.
Deteco de cidos Teste diagnstico de VIH Sensvel e especfico. Confirmao
nucleicos vricos do diagnstico em recm-nascidos.
ADN VIH-1 por PCR til no diagnstico de infeco
aguda, em indivduos de risco
elevado, com testes de WB
negativos ou indeterminados.
Isolamento de VIH Auxlio em diagnstico Mtodo lento e trabalhoso.
em cultura Especificidade elevada, mas pouco
sensvel, devido a dificuldades
tcnicas, em funo do grau de
viremia.
Testes rpidos para Alternativa para a Boa especificidade e sensibilidade.
VIH pesquisa de anticorpos Utilizao em situaes muito
urgentes.
Testes orais para VIH Alternativa puno venosa Boa especificidade e sensibilidade.

A carga vrica representa o nmero de cpias de ARN de VIH1, que


circula no plasma e obtmse por quantificao do ARN. A sensibilidade
da tcnica de 50 cpias/ml, para procedimentos ultrasensveis. A aplica-
o principal da determinao da carga vrica plasmtica a avaliao da
resposta teraputica antiretrovrica, a progresso da doena e o declnio
126 Marlia Pedro

do sistema imunitrio. O nvel de ARN vrico, durante a fase aguda, antes


e durante o perodo de seroconverso, constitui um indicador de prognsti-
co a longo prazo22.
A determinao do ADN til, quando a serologia se mostra insuficien-
te para o diagnstico da infeco por VIH. Em infectados com Western Blot
indeterminada, indivduos com suspeita de infeco em fase aguda e com
teste de antignio negativo ou, ainda, em crianas, filhas de mes infectadas
por VIH deve ser utilizada.
Em concluso, os clnicos devem ter conhecimento dos diferentes testes
que existem para o diagnstico da infeco por VIH e optimizar a sua uti-
lizao (Quadro 1). Quando se pretende seleccionar um teste de diagnsti-
co, a sensibilidade, a especificidade e o custo do teste, associados ao risco
do doente, que vai ser testado, e ao tempo de obteno do resultado, devem
ser tidos em considerao.
Os protocolos de testes diagnsticos devem incluir ensaios, que se com-
plementem. A pesquisa serolgica por ELISA um teste de rastreio sens-
vel, pouco dispendioso e de grande importncia. A pesquisa pela tcnica de
Western Blot um teste de confirmao fidedigno, que deve ser efectuado,
aps a obteno de um resultado reactivo por ELISA. Indivduos com risco
baixo para a infeco por VIH, que apresentem testes ELISA reactivos e
Western Blot indeterminadas ou positivas, necessitam de avaliao, numa
fase posterior. Os indivduos com risco elevado de infeco por VIH devem
efectuar uma carga vrica ou a pesquisa de ADN. Os seropositivos sinto-
mticos, em fase aguda, com testes serolgicos negativos devem efectuar,
para fins de diagnstico, um teste de antignio p24 e se negativo, a pesqui-
sa de ADN. O ensaio PERT (productenhanced RT) pertence a um grupo
novo de testes e mede a actividade da transcriptase reversa, associada a
partculas. Este ensaio 106 vezes mais sensvel do que o teste de trans-
criptase reversa convencional, o que pode levar a considerlo, no futuro,
um teste de rastreio poderoso, no diagnstico da infeco por VIH. O ensaio
PERT til, tambm, na quantificao de VIH1, particularmente no grupo
O e para VIH2, os quais no so detectveis pelos testes de ARN ou de
ADN disponveis no mercado23.

Bibliografia
1. Petersen LR, Satten GA, Dodd R, et al. Duration of time from onset of human immunodeficiency virus type 1
infectiousness to development of detectable antibody. The HIV Seroconversion Study Group. Transfusion.
1994;34:283-9.
2. Zaaijer HL, Exel-Oehlers PV, Kraaijeveld T, et al. Early detection of antibodies to HIV-1 by third-generation
assays. Lancet. 1992;340:770-2.
3. Busch MP, Satten GA. Time course of viremia and antibody seroconversion following human immunodeficiency
virus exposure. Am J Med. 1997;102:117-24.
4. De Leys R, Vanderborght B, Vanden HM, et al. Isolation and partial characterization of un unusual human im-
munodeficiency retrovirus from two persons of west-central African origin. J Virol. 1990;64:1207-16.
5. Simon F, Ly TD, Baillou-Beaufils A, et al. Sensitivity of screening kits for anti-HIV-1 O antibodies. AIDS.
1994;8:1628-9.
6. Weber B, Fall EHM, Berger A, et al. Reduction of diagnostic window period by new fourth-generation human
immunodeficiency virus screening assays. J Clin Microbiol. 1998;36:2235-9.
7. Proffitt MR, Yen-Lieberman B. Laboratory diagnosis of human immunodeficiency virus infection. Infect Dis Clin
North Am. 1993;7:203-19.
Testes serolgicos e vricos 127

8. Kvinesdal B, Pederson NS. False-positive HIV antibody tests in RPR-reactive patients. JAMA. 1988;260:923-4.
9. Kuun E, Brashow M, Heyns ADP. Sensitivity and specificity of standard and rapid HIV-antibody tests evaluated
by seroconversion and non-seroconversion low-titer panels. Vox Sang. 1997;72:11-5.
10. Gurtler L, Mhlbacher A, Michl U, et al. Reduction of the diagnostic window with a new combined p24 antigen
and human immunodeficiency virus antibody screening assay. J Virol Methods. 1998;75:27-38.
11. Schupbach J, Popovic M, Gilden VR, et al. Serological analysis of a subgroup of human Tlymphotropic retro-
viruses (HTLV-III) associated with AIDS. Science. 1984;224:503-5.
12. Zaaijer HL, Van Rixel T, Van Exel-Oehlers P, et al. New anti-human immunodeficiency virus immunoblot assays
resolve non-specific western blot results. Transfusion. 1997;37:193-8.
13. Update: serologic testing for HIV-1 antibody- United States, 198 and 1989. MMWR. 1990;39:380-3.
14. Sayre KR, Dodd RY, Tegtmeier G, et al. False-positive human immunodeficiency virus type 1 western blot tests
in noninfected blood donors. Transfusion. 1996;36:45-52.
15. Burgard M, Mayaux MJ, Blanche S, et al. The use of viral culture and p24 antigen testing to diagnose human
immunodeficiency virus infection in neonates. The HIV Infection in Newborns French Collaborative Study Group.
N Engl J Med. 1992;327:1192-7.
16. Schpbach J, Flepp M, Pontelli D, et al. Heat-mediated immune complex dissociation and enzyme-linked im-
munosorbent assay signal amplification render p24 antigen detection in plasma as sensitive as HIV-1 RNA detec-
tion by polymerase chain reaction. AIDS. 1996;10:1085-90.
17. Nadal D, Bni J, Kind C, et al. Prospective evaluation of amplification-boosted ELISA for heatdenatured p24
antigen for diagnosis and monitoring of pediatric HIV-1 infection. J Infect Dis. 1999;180:1089-95.
18. Kwok S, Mack DH, Mullis KB, et al. Identification of human immunodeficiency virus sequences by using in
vitro enzymatic amplification and oligomer cleavage detection. J Virol. 1987;61:1690-4.
19. Kievits T, Van Gemen B, Van Strijp D, et al. NASBA isothermal enzymatic in vitro nucleic acid amplification
optimized for the diagnosis of HIV-1 infection. J Virol Methods. 1991;35:273-86.
20. Urdea MS, Wilber JC, Yeghiazarian T, et al. Direct and quantitative detection of HIV-1 RNA in human plasma
with a branched DNA signal amplification assay. AIDS. 1993;7: S11-4.
21. Van Buul C, Cuypers HTM, Lelie PN, et al. The NucliSense Extractor for Automated Nucleic Acid Isolation.
Infusion Therapy and Transfusion Medicine. 1998;25:147-51.
22. Katzenstein TL, Pederson C, Neilson C, et al. Longitudinal serum HIV ARN quantification: Correlation to viral
phenotype at seroconversion and clinical outcome. AIDS. 1996;10:167-73.
23. Boni J, Pyra H, Schupbach J. Sensitive detection and quantification of particle-associated reverse transcriptase
in plasma of HIV-1-infected individuals by the product-enhanced reverse transcriptase (PERT) assay. J Med
Virol. 1996;49:23-8.
V SECO

Infeces oportunistas
e tumores
V Seco
Captulo 1

Espectro clnico da infeco por VIH


Emlia Valadas

Histria natural da infeco por VIH

A histria natural da infeco por VIH tem uma progresso lenta, ao longo
de cerca de 10 anos. Evolui desde uma fase, clinicamente, silenciosa at
sndrome de imunodeficincia adquirida (sida). De acordo com alguns es-
tudos, baseados na avaliao de indivduos com seroconverses identificadas
no tempo, 5060% dos infectados por VIH desenvolvem sintomas, em m-
dia, nos 10 anos que se seguem infeco1. A maioria dos casos de trans-
misso da infeco ocorre, provavelmente, nesta fase, durante a qual nem
o que foi infectado, nem o seu contacto tm conscincia da existncia da
infeco. Esse valor mdio de 10 anos aumentou devido, principalmente,
ao uso da teraputica antiretrovrica (TARV) e da profilaxia das infeces
oportunistas. Embora a taxa de progresso da infeco, para a fase sinto-
mtica, varie de indivduo para indivduo, alguns estudos tm sugerido,
tambm, correlao entre a progresso mais rpida e a idade avanada ao
tempo de infeco, a existncia de alguns hapltipos e a presena de infec-
es, cujo exemplo melhor estudado a tuberculose 2.
A histria natural da infeco por VIH pode resumirse aos seguintes
estdios:
1 Transmisso de VIH.
2 Infeco aguda por VIH.
3 Seroconverso.
4 Fase assintomtica acompanhada, ou no, de linfadenopatias gene-
ralizadas persistentes (LGP).
5 Infeco sintomtica (anteriormente conhecida como AIDSrelated
complex, e mais recentemente como estdio B, de acordo com a
132 Emlia Valadas

classificao de 1993, do Centers for Disease Control and Preven-


tion [CDC]).
6 Sida (doenas indicadoras de sida, segundo a classificao de 1993,
do CDC ou menos de 200 linfcitos TCD4+/mm3).
7 Infeco VIH avanada, caracterizada por contagem de linfcitos
TCD4+ inferiores a 50/mm3.
Assim, o espectro clnico das manifestaes, associadas infeco por
VIH, muito amplo, variando desde um estdio assintomtico, at uma fase
sintomtica, caracterizada pelo aparecimento de infeces oportunistas ou
de neoplasias. A replicao contnua de VIH resulta na diminuio progres-
siva do nmero das clulas, preferencialmente infectadas, os linfcitos
TCD4+, tendo como consequncia, tambm, depresso progressiva da imu-
nidade celular. Como a imunidade celular eficaz fundamental para o
controle da maioria das infeces (e neoplasias), a sida est, naturalmente,
associada a infeces provocadas por organismos, que, em regra, no causam
doena nos indivduos imunocompetentes. Por outro lado, o facto de, tam-
bm, haver alteraes nos linfcitos B e na imunidade humoral, faz com
que haja maior incidncia de infeces bacterianas recorrentes nos infecta-
dos por VIH, mas, tambm, que possa haver limitaes no que diz respeito
interpretao dos resultados das serologias no diagnstico de algumas
infeces, como sejam a sfilis, a infeco por vrus citomeglico (VCM)
ou a toxoplasmose.
Inicialmente, foram usadas mltiplas designaes para descrever as mani-
festaes precoces e tardias da infeco por VIH, com base em sintomas,
sinais e exames laboratoriais. Numa tentativa de uniformizar os critrios de
classificao e atendendo ao amplo espectro clnico da infeco por VIH, em
1986, o CDC props um sistema de classificao para a infeco por VIH e
sida, revisto em 19933. De acordo com esta classificao, os infectados so
agrupados segundo caractersticas clnicas e contagem de linfcitos TCD4+
(em nmeros absolutos ou percentuais). Assim, os indivduos com infeco
por VIH podem ser divididos em trs categorias clnicas (Fig. 1):
1 Grupo A, se forem assintomticos ou tiverem infeco aguda por
VIH ou, ainda, LGP.
2 Grupo B, se tiverem sintomas (no includos no grupo A, nem no
grupo C).
3 Grupo C, se houver doenas definidoras de sida (Quadro 1).
Em relao contagem de linfcitos TCD4 +, os infectados so clas-
sificados como tendo 500/mm 3 ou mais, entre 200 e 499/mm 3 ou menos
de 200/mm3. De acordo com esta classificao, os doentes com critrios de
sida apresentam uma doena definidora de sida (categorias C1, C2 e C3)
e/ou tm menos de 200 linfcitos TCD4 +/mm3 (categorias A3, B3 e C3)
(Fig. 1).

Espectro clnico da infeco por VIH


O espectro clnico da infeco por VIH inclui:
Espectro clnico da infeco por VIH 133

Categorias clnicas

Contagem de linfcitos A B C
TCD4+ Assintomtica Sintomtica Doena definidora
ou infeco VIH aguda (nem A nem B) de sida
ou linfadenopatias
generalizadas
persistentes

500/mm3 ( 29%) A1 B1 C1

200-499/mm3 (14-28%) A2 B2 C2

< 200/mm3 (< 14%) A2 B2 C2

Figura 1. Classificao da infeco por VIH, segundo o CDC, 1993. Os indivduos nas
categorias A3, B3 e C1-3 (rea sombreada) tm critrios de sida, com base na existncia de
uma doena definidora de sida e/ou contagem de linfcitos TCD4+ < 200/mm3. As percentagens
de linfcitos TCD4+ podem substituir o seu nmero absoluto.

Quadro 1. Doenas definidoras de sida em adultos (1987)*

Candidose esofgica ou broncopulmonar


Carcinoma do colo do tero invasivo
Coccidioidomicose extrapulmonar
Criptococose extrapulmonar
Criptosporidiose com diarreia > um ms durao
Demncia associada a VIH
Estrongiloidose extra-intestinal
Herpes simplex, com lcera mucocutnea > um ms, bronquite, pneumonite e esofagite
Histoplasmose extrapulmonar
Isosporose com diarreia > um ms de durao
Infeco disseminada por Mycobacterium avium
Infeco por VCM de qualquer rgo, excepto fgado, bao ou gnglio
Leucoencefalopatia multifocal progressiva
Linfoma de Burkitt, imunoblstico ou primrio do sistema nervoso central (SNC)
Nocardiose
Pneumonia por Pneumocystis jirovecii
Pneumonia bacteriana recorrente ( dois episdios em 12 meses)
Sarcoma de Kaposi
Septicemia recorrente a Salmonella spp (no-tifide)
Sndrome de emaciao associada a VIH: Perda involuntria de > 10% do peso corporal e
diarreia crnica ( duas dejeces por dia, 30 dias) ou astenia crnica e febre 30 dias
Toxoplasmose cerebral
Tuberculose pulmonar ou extrapulmonar
*O quadro enumera as doenas definidoras de sida, em adultos, segundo o CDC, em 1987 (MMWR.
1987;36:15). As definies de 1993 incluem todas as definies de 1987 e tambm as marcadas com.
134 Emlia Valadas

1 Doena vrica aguda, presente nas semanas imediatamente a seguir


infeco e associada a viremia muito elevada.
2 Alteraes imunitrias, em resposta infeco crnica por VIH
(por exemplo, LGP ou trombocitopenia).
3 Doenas oportunistas, consequncia da progressiva depresso da
imunidade celular.
Nos ltimos anos, o uso da TARV combinada (TARVc) fez com que
duas novas categorias de manifestaes clnicas fossem includas ao espec-
tro da doena:
1 Sndromes de reconstituio imune, caracterizadas por exacerbaes
de determinadas infeces.
2 Sndrome de lipodistrofia.

Infeco aguda por VIH


As manifestaes clnicas da infeco aguda por VIH (ou sndrome retro-
vrica aguda) podem ser inespecficas, o que leva, muitas vezes, a que o
diagnstico no seja suspeitado4. Embora se aponte para taxas de 10-40%,
a real incidncia desta sndrome no conhecida. No entanto, sabese que
a maioria dos trabalhadores da sade, que adquiriram a infeco por VIH,
aps picada acidental, desenvolveram a sndrome retrovrica aguda 5, pelo
que, esta sndrome pode estar relacionada com o volume do inculo. Este
quadro ocorre at cerca de uma a seis semanas, aps a transmisso do vrus,
sendo o perodo de incubao, em mdia, de trs semanas. Clinicamente,
pode manifestarse como sndrome mononuclesica, autolimitada e com a
durao de 10 a 15 dias, sendo a febre, faringite, linfadenopatias perifricas
e exantema, os sintomas e sinais mais encontrados6. Outros quadros, a
acompanhar a infeco aguda por VIH, tm sido descritos, tais como ence-
falite, meningite linfocitria benigna, neuropatia perifrica ou sndrome de
GuillainBarr.
A infeco aguda acompanhada pelo desenvolvimento de anticorpos
s protenas do vrus, geralmente em duas a seis semanas, apesar de sero-
converses, at trs meses ou mais, terem j sido descritas.
Esta sndrome retrovrica aguda acompanhada por diminuio marca-
da do nmero de linfcitos TCD4+ e viremia plasmtica elevada, alteraes
que revertem, parcialmente, aps a recuperao clnica desta fase inicial.
Devido depresso marcada dos linfcitos TCD4+ encontrada, esta sndro-
me pode, tambm, ser acompanhada de infeces oportunistas, tais como
pneumonia a Pneumocystis jirovecii (anteriormente P. carinii)7, candidose
esofgica ou meningite criptoccica. Laboratorialmente, acompanhase de
leucopenia, aumento da velocidade de sedimentao, das transaminases e
da fosfatase alcalina.
Cerca de duas semanas aps a exposio ao vrus e coincidente com o
incio dos sintomas em, aproximadamente, 80% dos infectados possvel
detectar a antigenemia p24, no sangue e no lquido cefalorraquidiano (LCR) 8.
O antignio p24 persiste durante semanas ou meses, altura em que se inicia
Espectro clnico da infeco por VIH 135

a formao de anticorpos antip24. No entanto, o marcador mais sensvel


de infeco a deteco de ARN vrico no plasma9, que, em regra, en-
contrado em nveis muito elevados (100.000 a 1.000.000 de cpias por mm3).
Apesar de poder haver resultados positivos falsos, em relao deteco
de ARN de VIH, com o risco potencial de resultar em diagnsticos falsos de
infeco por VIH, a existncia de viremia elevada, na ausncia de anticor-
pos antiVIH, diagnstico de infeco aguda por VIH.
A importncia da deteco precoce da sndrome retrovrica aguda ba-
seiase no facto de que o incio imediato da TARVc pode melhorar as
respostas especficas dos linfcitos TCD4+ e TCD8+, bem como diminuir a
carga vrica inicial10. Este , no entanto, um assunto controverso11.

Linfadenopatia generalizada persistente


Aps a infeco aguda seguese a fase crnica, que assintomtica na sua
fase inicial. A maioria dos infectados por VIH (5070%) desenvolvem LGP.
Tratase de uma sndrome definida pela presena de adenopatias em duas
ou mais cadeias ganglionares perifricas e extrainguinais, durante um pe-
rodo mnimo de trs a seis meses, para as quais no possvel encontrar
qualquer outra etiologia. Os gnglios so simtricos, mveis, de consistn-
cia normal e as cadeias ganglionares, mais envolvidas no processo, so as
cervicais anteriores e posteriores, as submaxilares, as occipitais e as axila-
res. O restante exame objectivo, em regra, no apresenta outras alteraes,
com excepo de poder haver candidose oral ou tricoleucoplasia da lngua.
A taxa de progresso para sida idntica, quer os doentes apresentem LGP
ou no12. O exame histopatolgico das adenopatias revela hiperplasia foli-
cular, que acompanhada de destruio da arquitectura normal do gnglio,
devido presena de centros germinativos constitudos por linfcitos B,
sendo nestas clulas foliculares que a replicao activa do vrus acontece 13.
A biopsia ganglionar no est indicada, com excepo das situaes nas
quais necessrio excluir outras patologias, tais como tuberculose, linfoma
ou sarcoma de Kaposi, isto , naqueles casos em que esto presentes sin-
tomas associados (emagrecimento ou febre) ou gnglios, marcadamente,
assimtricos, dolorosos ou, ainda, com aumento rpido de volume.
No decurso da infeco por VIH, as adenopatias associadas LGP vo
diminuindo de volume, havendo desaparecimento da hiperplasia folicular,
encontrada no incio.

Fase sintomtica
Aps a fase assintomtica, que tem a durao, em mdia, de cerca de 10 anos
(sem instituio de TARV), seguese a fase sintomtica, que corresponde
depresso mais marcada da imunidade celular. Durante a fase de latncia
clnica, embora apenas uma pequena fraco dos linfcitos TCD4 +, no san-
gue perifrico, esteja infectada, a replicao de VIH continua e acompa-
nhada por uma destruio progressiva do sistema imune; a progresso para
136 Emlia Valadas

sida precedida por diminuio dos linfcitos TCD4+. Nesta fase, os doentes
(no tratados) tm, tipicamente, contagem de linfcitos TCD4+ < 200/mm3,
aumento dos nveis plasmticos do ARN de VIH e manifestaes clnicas,
que indicam haver compromisso do sistema imune.
As situaes patolgicas includas no subgrupo B da classificao do
CDC, que corresponde fase sintomtica da infeco por VIH, mas sem a
presena de doenas definidoras de sida (Fig. 1), so as seguintes: Angio-
matose bacilar, candidose oral, candidose vaginal recorrente e com m
resposta teraputica, displasia cervical (moderada ou grave), carcinoma
do colo uterino in situ, sintomas constitucionais, tais como febre (38,5 oC)
ou diarreia, com mais de um ms de evoluo, tricoleucoplasia da lngua,
herpeszster (mais que dois episdios ou mais que um dermtomo), doen-
a inflamatria plvica e neuropatia perifrica.
O subgrupo C inclui, como doenas indicadoras de sida, vrias infeces
e doenas malignas, bem como outras entidades, tais como a sndrome de
emaciao (Fig. 1).
medida que a incidncia de infeces oportunistas, associadas sida, vai
diminuindo, devido ao uso da TARVc e profilaxia das infeces oportunistas,
o espectro clnico da infeco por VIH vai sendo alterado. Mesmo que parcial,
a recuperao da imunidade celular, verificada sob TARV, suficiente para
proteger o indivduo contra a maioria das infeces oportunistas. A incidn-
cia de sarcoma de Kaposi e de linfoma noHodgkin, tambm, tem vindo
a diminuir14. At que ponto que a recuperao do sistema imune ir alterar
o espectro clnico da infeco por VIH , ainda, uma questo em aberto.
Apesar de se considerar que o intervalo, em mdia, de progresso de
infeco por VIH para sida seja de 10 anos, em indivduos no tratados,
reconhecese que h grande variao individual. Embora pouco frequente,
pode acontecer que haja progresso para sida em poucos meses15. Por outro
lado, alguns indivduos, no tratados, continuam sem apresentar sinais cl-
nicos ou laboratoriais de progresso da doena mais de 15 anos aps a in-
feco por VIH (longterm non progressors)16,17. Alguns dos factores que
determinam a taxa de progresso da doena tm sido identificados nos lti-
mos anos e incluem no s caractersticas genticas e qualidade da respos-
ta imune do hospedeiro (receptores celulares, imunidade celular, produo
de citocinas), mas, tambm, caractersticas do prprio vrus (diversidade
gentica, virulncia, fitness). Muito recentemente, foi demonstrado que a
interaco entre os pptidos vricos e hapltipos fundamental para o con-
trolo da infeco por VIH18. No entanto, claro que apesar dos avanos da
investigao nos ltimos anos, muito acerca dos mecanismos que influenciam
a progresso da doena continua por esclarecer.

Bibliografia
1. Biggar RJ. AIDS incubation in 1891 HIV seroconverters from different exposure groups. International Registry
of Seroconverters. AIDS. 1990;4(11):1059-66.
2. Perneger TV, Sudre P, Lundgren JD, Hirschel B. Does the onset of tuberculosis in AIDS predict a shorter sur-
vival? Results of a cohort study in 17 European studies over 13 years. AIDS in Europe study group. BMJ.
1995;311:1468-71.
Espectro clnico da infeco por VIH 137

3. Centers for Disease Control and Prevention. 1993 revised classification system for HIV infection and expanded
surveillance case definition for AIDS among adolescents and adults. MMWR. 1992;41:1-19.
4. Clark SJ, Kelen GD, Henrard DR, et al. Unsuspected primary human immunodeficiency virus type 1 infection
in seronegative emergency department patients. J Infect Dis. 1994;170:194-7.
5. Tokars JI, Marcus R, Culver DH, et al. Surveillance of HIV infection and zidovudine use among health care
workers after occupational exposure to HIV-infected blood. The CDC Cooperative Needlestick Surveillance Group.
Ann Intern Med. 1993;118:913-9.
6. Clark SJ, Saag MS, Decker WD, et al. High titters of cytopathic virus in plasma of patients with symptomatic
primary HIV-1 infection. N Engl J Med. 1991;324:954-60.
7. Stringer JR, Beard CB, Miller RF, Wakefield AE. A new name (Pneumocystis jiroveci) for pneumocystis from
humans. Emerg Infect Dis. 2002;8:891-6.
8. Kessler HA, Blaauw B, Spear J, Paul DA, Falk LA, Landay A. Diagnosis of human immunodeficiency virus
infection in seronegative homosexuals presenting with an acute viral syndrome. JAMA. 1987;258:1196-9.
9. Henrard DR, Philips J, Windsor I, et al. Detection of human immunodeficiency virus type 1 p24 antigen and
plasma RNA: relevance to indeterminant serologic tests. Transfusion. 1994;34:376-80.
10. Rosenberg ES, Billingsley JM, Caliendo AM, et al. Vigorous HIV-1-specific CD4+ T cell responses associated
with control of viremia. Science. 1997;278:1447-50.
11. Vlassi C, Corpolongo A, DOffizi G, et al. Tolerability of HAART in patients treated during acute HIV infection.
J Acquir Immune Defic Syndr. 2010;54(5):11-2.
12. Murray HW, Godbold JH, Jurica KB, Roberts RB. Progression to AIDS in patients with lymphadenopathy or
AIDS-related complex: reappraisal of risk and predictive factors. Am J Med. 1989;86:533-8.
13. Pantaleo G, Graziosi C, Demarest JF, et al. HIV infection is active and progressive in lymphoid tissue during
the clinically latent stage of disease. Nature. 1993;362:355-8.
14. Gingues S, Gill MJ. The impact of highly active antiretroviral therapy on the incidence and outcomes of AIDS-
defining cancers in Southern Alberta. HIV Med. 2006;7(6):369-77.
15. Mellors JW, Margolick JB, Phair JP, et al. Prognostic value of HIV-1 RNA, CD4 cell count, and CD4 Cell count
slope for progression to AIDS and death in untreated HIV-1 infection. JAMA. 2007;297(21):2349-50.
16. Lambotte O, Boufassa F, Madec Y, et al. HIV controllers: a homogeneous group of HIV-1-infected patients with
spontaneous control of viral replication. Clin Infect Dis. 2005;41(7):1053-6.
17. Walker BD. Elite control of HIV Infection: implications for vaccines and treatment. Top HIV Med. 2007;15(4):134-6.
18. The International HIV Controllers Study. The major genetic determinants of HIV-1 control affect HLA class I
peptide presentation. Science. 2010;330(6010):1551-7.
V Seco
Captulo 2

Protozorios oportunistas
e Pneumocystis jirovecii*
Olga Matos, Helena ngelo, Francisco Antunes

Introduo
Desde o incio da epidemia de sndrome de imunodeficincia adquirida (sida)
que vrios parasitas tm surgido como importantes agentes patognicos,
afectando, particularmente, os doentes com sida, mas, tambm, doentes com
outras imunodeficincias.

Criptosporidiose
O gnero Cryptosporidium composto por protozorios parasitas, ubquos, as
sociados, principalmente, a infeco entrica em todas as classes de mamferos.
Actualmente, so conhecidas 16 espcies, sendo Cryptosporidium parvum (an-
teriormente designado C. parvum gentipo bovino) e Cryptosporidium hominis
(anteriormente designado C. parvum gentipo humano) as espcies mais vezes
identificadas em infeces no homem. No entanto, Cryptosporidium meleagri-
dis, Cryptosporidium felis, Cryptosporidium canis, Cryptosporidium muris,
Cryptosporidium andersoni, Cryptosporidium suis e C. parvum gentipo cer-
vino j foram encontrados em infeces espordicas em doentes com sida
e, tambm, em imunocompetentes1,2.
A transmisso da criptosporidiose humana ocorre quando um indivduo
susceptvel ingere oocistos, excretados nas fezes de um hospedeiro infecta-
do (homem ou animal), seja por contacto directo ou indirecto, atravs da
gua ou de alimentos contaminados. O parasita altamente infeccioso, bas
tando a inoculao de uma pequena quantidade de oocistos, que pode variar
entre nove e 1.042, dependendo dos isolados, para provocar doena em
adultos imunocompetentes3. C. hominis, que infecta, quase exclusivamente,

*Nota do editor: Este captulo no foi actualizado em relao 3.a edio do Manual sobre sida (2008)
140 Olga Matos, Helena ngelo, Francisco Antunes

o homem, transmitido por via antropontica, enquanto que C. parvum, que


infecta o homem e ruminantes, especialmente o gado bovino, tem uma epi-
demiologia mais complexa. Em associao com a via zoontica, C. parvum
pode infectar o homem atravs da via antropontica. A importncia relativa
de cada uma das vias no est, completamente, esclarecida46. Numerosos
surtos epidmicos, associados ingesto de gua contaminada, em grandes
zonas metropolitanas e a piscinas pblicas, tm sido reportados, estando des-
critos, tambm, casos de surtos epidmicos por ingesto de alimentos conta-
minados7.
A infeco ocorre quando os oocistos ingeridos libertam os esporozotos,
contidos no seu interior, os quais se vo ligar e invadir as clulas do epi-
tlio intestinal. Se bem que o jejuno seja, em regra, o local do tubo diges-
tivo mais parasitado, Cryptosporidium encontrado, com frequncia, em
toda a extenso do clon, assim como no duodeno, incluindo a ampola de
Vater, leo, vias biliares e pancreticas. Nalguns doentes, a criptosporidiose
pode estar associada a alteraes histolgicas, correspondentes a enterite e
colite agudas, aumento das clulas inflamatrias na lamina propria ou atro
fia das vilosidades do intestino delgado, que levam a diarreia persistente e
a malabsoro8.
Os dados disponveis indicam que so identificados 250 a 500 milhes de
casos de criptosporidiose, por ano, na sia, frica e Amrica Latina. A pre
valncia de oocistos, em doentes com diarreia, varia entre 1 e 10%, enquan-
to que estudos serolgicos demonstram que 25-64% da populao j teve
contacto com o parasita, dependendo estes valores da localizao geogrfica.
Em doentes com sida e diarreia, as prevalncias variam entre 4 e 50%9.
Num estudo efectuado em doentes com sida e diarreia, dum grande hospi-
tal de Lisboa, observouse uma prevalncia de criptosporidiose de 8%10.
Os sintomas da criptosporidiose comeam, geralmente, entre os trs e
os 12 dias (cinco a sete dias em mdia), aps a ingesto dos oocistos. No
indivduo imunocompetente, a criptosporidiose causa diarreia aguda, que
dura de cinco a 10 dias, a qual se acompanha de nuseas, vmitos, clicas
abdominais e febre, em geral pouco elevada. Em doentes com sida, a diar-
reia pode ser prolongada, volumosa, debilitante, levando, nalguns casos,
morte. A durao e a intensidade da diarreia dependem do estado imunit-
rio do doente e da maior ou menor capacidade de reverter a imunodefici-
ncia. Nestes doentes, a infeco por C. parvum no se confina ao aparelho
gastrintestinal, podendo surgir sintomas adicionais (respiratrios, das vias
biliares, do fgado e do pncreas), associados a localizaes extraintestinais
do parasita. A reactivao de uma infeco antiga pode ocorrer, medida
que o nmero de clulas TCD4+ diminui8.

Diagnstico
O diagnstico baseiase na identificao do parasita em amostras de fezes,
por microscopia ptica, aps concentrao e colorao pelas tcnicas de Ziehl-
Neelsen modificada ou auraminafucsina, ou, ainda, na pesquisa de antignios,
Protozorios oportunistas e Pneumocystis jirovecii 141

utilizando anticorpos mono ou policlonais, associados a tcnicas de imuno-


fluorescncia indirecta ou de ELISA, respectivamente (Foto 1)11. Os oocis-
tos de Cryptosporidium, excretados nas fezes, so, em geral, redondos, com
quatro a seis m, esporulados (infectantes), podendose manter viveis na
gua durante seis meses, uma vez que so altamente resistentes maioria
dos desinfectantes, como o cloro. Recentemente, as tcnicas baseadas na
amplificao dos cidos nucleicos (PCR) tm sido aplicadas, na anlise de
amostras de gua e de alimentos e na identificao de portadores assintom-
ticos. Quando combinadas com a anlise dos polimorfismos, no comprimen-
to de fragmentos de restrio (PCRRFLP) e/ou com a sequenciao dos
fragmentos obtidos, funcionam como ferramentas epidemiolgicas, permitin-
do a identificao da espcie e a anlise da variao intraespecfica de C.
hominis e de C. parvum, isolados de hospedeiros humanos e animais4,1214.

Tratamento
Enquanto que a maioria dos doentes imunocompetentes no necessitam de
tratamento, a criptosporidiose, nos doentes com sida, pela gravidade e evo-
luo para a cronicidade, necessita de teraputica. Apesar de terem sido
feitos numerosos ensaios com mais de 100 agentes antimicrobianos, estes
no se tm revelado, totalmente, eficazes na eliminao dos oocistos de
Cryptosporidium. A associao da paramomicina (1 g), administrada duas
vezes ao dia, por via oral, com a azitromicina (600 mg dirios) durante
quatro semanas, seguida da administrao da paramomicina em monoterapia
durante oito semanas, pode conseguir razovel resposta clnica e diminuio
da eliminao de oocistos, mas sem cura parasitolgica. Por esta razo,
se o tratamento interrompido, surgem, com frequncia, recidivas, sendo,
por isso, recomendada teraputica de manuteno. Tambm a nitazoxani-
da (1 g), administrada duas vezes ao dia, por via oral, durante 14 dias, tem
demonstrado alguma eficcia na reduo da diarreia e da excreo de oo-
cistos de Cryptosporidium15.

Preveno
As medidas de preveno centramse na melhoria das condies de higiene
pessoal e sanitrias, para obstar transmisso fecaloral, atravs do contac-
to sexual e a partir de alimentos, da gua ou de outras possveis fontes
contaminadas do ambiente.

Isosporose
Isospora belli um protozorio intracelular obrigatrio, ubquo na natureza.
A infeco por este parasita era considerada rara, e ocorria, essencialmente,
nos trpicos, mas, com o advento da sida, tem aumentado o nmero de
casos descritos em doentes seropositivos para VIH, mesmo em regies
temperadas16,17. Estes microrganismos podem infectar adultos e crianas. O
142 Olga Matos, Helena ngelo, Francisco Antunes

envolvimento intestinal e os sintomas so, de um modo geral, transitrios,


a no ser que o doente seja imunocomprometido. Este coccdeo , tambm,
uma das causas de diarreia do viajante. A transmisso ao homem parece
processarse atravs da gua e dos alimentos contaminados, no se conhe-
cendo outros reservatrios animais. A possibilidade de transmisso ho-
memahomem, talvez por contacto sexual, foi sugerida por alguns autores 17.
Nos doentes com sida, as taxas de prevalncia variam desde 2,9-15%, de-
pendendo das regies estudadas18.
Histologicamente, a infeco por I. belli pode induzir atrofia das vilo-
sidades, hiperplasia das criptas e alteraes inflamatrias intestinais. Se bem
que esta infeco se restrinja, na grande maioria dos casos, ao intestino, j
foram descritos casos de disseminao em doentes com sida. Nestes doen-
tes, as recidivas so frequentes, mesmo aps um tratamento, aparentemente,
eficaz.
Os sintomas incluem diarreia, que pode persistir por longos perodos
(meses a anos), perda de peso, clicas abdominais e febre. A diarreia, in-
termitente e do tipo secretrio, podese tornar crnica, levando a desidrata-
o e necessitando de teraputica de suporte.

Diagnstico
O diagnstico baseiase na identificao do parasita por microscopia ptica,
em amostras de fezes. As preparaes de fezes a fresco ou aps concentrao
so recomendadas (Foto 2). Os oocistos so muito plidos e transparentes,
tm uma forma alongada, elptica com 2033 1019 m e apresentam au-
tofluorescncia azul, quando iluminados pela luz ultravioleta de 330380 nm,
microscopia de fluorescncia. Os oocistos so excretados nas fezes
noesporulados (noinfectantes) ou, parcialmente, esporulados, podendo,
ento, desenvolverse no meio exterior, em menos de 24 h, resultando na
formao de dois esporocistos, cada um dos quais com quatro esporozotos9.

Tratamento
O frmaco de primeira escolha o trimetoprim (160 mg)sulfametoxazol
(800 mg) administrado em quatro tomas dirias, por via oral, durante 10 dias,
seguido de duas tomas dirias durante trs semanas. Em doentes alrgicos
s sulfamidas, aconselhase a pirimetamina (50 a 75 mg dirios). Outros
frmacos tm sido utilizados, tambm, na erradicao destes coccdeos, com
algum sucesso, como o caso da pirimetaminasulfadiazina, da tetraciclina
ou do metronidazol. Nos imunocomprometidos, com infeco recorrente ou
persistente, a teraputica deve ser mantida indefinidamente 9.

Preveno
Uma vez que a infeco se processa atravs da ingesto de oocistos infec-
tantes, as medidas de preveno centramse na melhoria das condies de
Protozorios oportunistas e Pneumocystis jirovecii 143

higiene pessoal e sanitrias, para obstar transmisso fecaloral, a partir dos


alimentos, da gua ou de outras possveis fontes contaminadas do ambiente.

Ciclosporose
Cyclospora cayetanensis um protozorio intracelular, com caractersticas
semelhantes a Isospora e a Cryptosporidium, sendo o responsvel da mais
recente infeco oportunista no homem, a ciclosporose. Os seus oocistos foram
encontrados, pela primeira vez, em fezes de doentes da Papua Nova Guin,
em 197919. Esta infeco pode surgir em indivduos imunodeficientes e imu-
nocompetentes. C. cayetanensis foi identificado quer em viajantes, quer em
residentes de vrias regies do globo. Os vrios casos descritos sugerem que
a transmisso se processa atravs da gua e dos alimentos contaminados e que
a infeco sazonal, surgindo, geralmente, na estao das chuvas e com tem-
peraturas amenas. Os oocistos so resistentes ao tratamento com cloro, usado
na gua, e s so destrudos pela fervura. A transmisso homemahomem
parece ser possvel, se bem que ainda no tenha sido descrita.
Estudos de prevalncia em reas endmicas, como o Nepal e o Peru, re
velaram taxas de 5 e 18%, respectivamente, em crianas destas regies e de
10% em turistas. No Haiti, em seropositivos para VIH, com diarreia crnica,
verificouse que 11% apresentavam oocistos de C. cayetanensis nas suas fezes.
No entanto, desconhecese a sua prevalncia em pases desenvolvidos20.
C. cayetanensis um parasita do intestino delgado, podendo provocar
atrofia das vilosidades, hiperplasia das criptas e alteraes inflamatrias 21.
Os sintomas tm incio sbito e incluem diarreia lquida, com dejeces
em jacto, clicas abdominais, nuseas, vmitos, fadiga, anorexia e perda de
peso21. No hospedeiro imunocompetente, a diarreia pode ser prolongada,
mas autolimitada, mantendose durante uma a seis semanas (mdia trs
semanas). No doente imunodeficiente, este quadro diarreico pode ser mais
intenso.

Diagnstico
O diagnstico baseiase na identificao do parasita, por microscopia pti-
ca em amostras de fezes, biopsias ou no aspirado duodenal 20. Preparaes
de fezes, a fresco e aps colorao pelo mtodo de ZiehlNeelsen modifi-
cado, revelam oocistos esfricos (810 m) noesporulados, apresentando
autofluorescncia azul, quando observados com recurso microscopia de
fluorescncia. Os oocistos, excretados nas fezes, esporulam no meio exterior,
no espao de duas semanas, resultando em dois esporocistos, os quais, por
sua vez, contm dois esporozotos cada.

Tratamento
Embora a infeco possa regredir espontaneamente, os casos de evoluo mais
arrastada tm sido tratados com sucesso com trimetoprimsulfametoxazol, por
144 Olga Matos, Helena ngelo, Francisco Antunes

via oral, o qual induz resoluo dos sintomas, em comparao com doen-
tescontrolo, no tratados22.

Preveno
Os viajantes para reas endmicas de ciclosporose (Amrica Latina, leste
da Europa, sul da sia e Austrlia) devem ser alertados para o risco de
infeco, de forma a evitarem a exposio aos oocistos, veiculados pela
gua e pelos alimentos. Nestas reas recomendamse bebidas fervidas como
o caf e o ch. A fruta e os vegetais frescos devem ser muito bem lavados
e/ou descascados antes de serem ingeridos.

Microsporidiose
Os agentes causadores de microsporidiose, genericamente designados por
microsporidia, so parasitas unicelulares, intracelulares obrigatrios, ub-
quos na natureza. At ao momento foram descritos cerca de 50 gneros e
1.200 espcies. No entanto, s as espcies pertencentes a sete gneros
(Enterocytozoon, Encephalitozoon, Nosema, Trachipleistophora, Pleisto-
phora, Vittaforma e Anncaliia), em conjuno com um grupo de micros-
pordeos, ainda no suficientemente caracterizado, denominado generica-
mente Microsporidium, foram descritas como causadoras de infeco no
homem. As fontes de infeco no esto, totalmente, esclarecidas 23. A
infeco primria parece ocorrer pela inalao ou pela ingesto de esporos,
provenientes de fontes do ambiente ou por transmisso zoontica, j se
tendo encontrado esporos de microsporidia em gua superficial e profun-
da23,24.
A infeco pela espcie Enterocytozoon bieneusi localizase, primaria-
mente, no intestino delgado, podendo atingir a rvore biliar e o fgado e
est associada com diarreia crnica e sndrome de emaciao. As trs es-
pcies do gnero Encephalitozoon (E. intestinalis, E. hellem e E. cuniculi)
so causa de patologia diversa, localizada ou disseminada, incluindo gas
trintestinal (diarreia crnica grave, que progride para malabsoro e sndro-
me de emaciao), pulmonar, urinria e cerebral. As espcies do gnero
Nosema provocam infeco ocular, podendo, tambm, disseminar. A infec-
o por espcies do gnero Trachipleistophora pode localizarse no mscu-
lo esqueltico, seios nasais e disseminar, e o gnero Pleistophora encontrase,
apenas, no msculo esqueltico. O gnero Anncaliia pode infectar clulas
musculares, provocar queratite, ou at disseminar, dependendo da espcie
envolvida. A infeco provocada pela espcie Vittaforma corneae localizase
na crnea e pelo grupo designado Microsporidium dissemina.
A microsporidiose humana est, muitas vezes, associada a imunode-
presso geralmente nos doentes com sida , reflectindo a natureza opor-
tunista da infeco, no entanto, tm sido descritos casos em imunocompe-
tentes, principalmente em crianas, idosos e viajantes 23,25,26. A prevalncia
da microsporidiose no , ainda, bem conhecida e, muito provavelmente,
Protozorios oportunistas e Pneumocystis jirovecii 145

encontrase subdiagnosticada, devido a dificuldades na identificao dos


esporos de tamanho muito reduzido (14 m) e de difcil colorao. Num
estudo parasitolgico, em doentes com sida, efectuado na regio de Lisboa,
foi encontrada uma percentagem global de infeco de 30% (51% em fezes
de doentes com diarreia e/ou outra sintomatologia gastrintestinal, e de 14%
na urina e nas secrees pulmonares)27. Atravs de mtodos moleculares,
desenvolvidos recentemente, possvel identificar os gneros ou as espcies
envolvidas nas infeces. At ao momento, em Portugal, foi possvel iden-
tificar E. bieneusi e uma nova espcie, Vittaformalike, em fezes de doen-
tes seropositivos para VIH e em imunocompetentes, com sintomatologia
gastrintestinal, sugerindo que estas espcies possam ser mais comuns na
nossa populao, do que anteriormente se suspeitava 28,29.

Diagnstico
O diagnstico est dependente da visualizao do parasita, nos tecidos ou
nos fluidos biolgicos do hospedeiro (fezes, urina ou secrees pulmonares),
por microscopia ptica, recorrendo a mtodos de colorao histoqumica (por
exemplo, tricrmio modificado, gramchromotrope), mtodos fluorescentes
no especficos (por exemplo, uvitex 2B ou calcoflor branco) ou, ainda, a
mtodos de colorao imunoespecfica (por exemplo, imunofluorescncia
com anticorpos monoclonais ou policlonais) (Foto 3)27. Outros mtodos in-
cluem a microscopia electrnica, a cultura de tecidos e, ainda, a deteco
molecular (por exemplo, PCR). A metodologia do diagnstico ideal deveria
iniciarse com o rastreio por microscopia ptica, aps colorao, seguida de
confirmao e determinao da espcie implicada na infeco, por PCR 9.

Tratamento
No se encontra disponvel teraputica etiolgica totalmente eficaz, sendo
o albendazol (400 mg), administrado duas vezes ao dia, por via oral, du-
rante seis semanas, o frmaco mais promissor na teraputica antiEncepha-
litozoon spp, mas menos eficaz contra E. bieneusi. O itraconazol (200 mg
dirios), administrado durante oito semanas, recomendado no tratamento
da microsporidiose ocular, nasal ou dos seios paranasais causada por E.
cuniculi, nos casos em que o albendazol ineficaz25. A fumagilina (60 mg
por dia), administrada por via oral, durante duas semanas, tem sido utiliza-
da, com algum sucesso, contra espcies de Encephalitozoon e em infeces
crnicas provocadas por E. bieneusi23,30.

Preveno
No homem, a presena de esporos sugere que devem ser tomadas precaues,
aquando do manuseamento dos seus produtos biolgicos e adoptadas medi-
das de higiene pessoal, como a lavagem das mos, importantes para evitar
a transmisso.
146 Olga Matos, Helena ngelo, Francisco Antunes

Toxoplasmose

Toxoplasma gondii um protozorio do filo Apicomplexa descoberto em 1908.


O primeiro caso humano de infeco toxoplsmica foi descrito em 1923, mas
s a partir de 1937 foi reconhecida a importncia do parasita em patologia
humana. At dcada de 80, os casos de toxoplasmose foram, esporadica-
mente, assinalados na literatura, quase sempre relacionados com infeces
congnitas, linfomas ou transplantes de rgos, mas a expanso das tcnicas
de transplante e, sobretudo, a pandemia de sida transformaram a toxoplasmo-
se numa importante causa de morbilidade e mortalidade nos imunodeficientes
e, ainda, numa das principais causas de morte nos doentes com sida31,32.
T. gondii, sendo um Coccidia dos felinos, apresenta um grande nmero
de hospedeiros acidentais. O parasita ubiquitrio na natureza e tem sido
identificado em, praticamente, todos os mamferos, aves e, mesmo, em alguns
rpteis. No homem, a prevalncia da infeco latente aumenta com a idade
e, na maior parte das regies, idntica para ambos os sexos. As taxas de
contaminao esto, directamente, relacionadas com as condies climticas,
com os hbitos alimentares e condies de higiene das populaes, varian-
do, consideravelmente, com as regies geogrficas e com os grupos popu-
lacionais. As diferenas na epidemiologia da toxoplasmose podem ser ex-
plicadas pelo grau de exposio das populaes s duas principais fontes
de contaminao, os quistos contidos nos tecidos dos animais de abate e os
oocistos provenientes do ciclo sexuado do parasita, no gato 33.
A prevalncia global da toxoplasmose na populao infectada por VIH
igual da comunidade em que est inserida. Entre os doentes com sida,
as formas sintomticas da infeco toxoplsmica so, quase em exclusivo,
cerebrais e mais de 95% so resultantes da reactivao duma infeco la-
tente, quando a contagem de linfcitos TCD4+ inferior a 100 cls/mm3.
Nas reas em que a prevalncia da infeco elevada, os factores epidemio
lgicos parecem favorecer o desenvolvimento de encefalite toxoplsmica,
provavelmente devido concentrao maior de quistos provenientes de su-
cessivas reinfeces da populao. Na Europa, a prevalncia aumenta de
norte para o sul, oscilando entre os 12% na Noruega e os 80% nalgumas
regies da Europa Ocidental, estimandose que 30-40% dos doentes com
sida, seropositivos para Toxoplasma, desenvolvem encefalite toxoplsmica,
na ausncia de profilaxia. Em Portugal, entre 50 e 64% da populao adul-
ta apresenta anticorpos antitoxoplasma e a prevalncia da infeco mais
elevada no Norte do Pas, do que no Sul34.
A descrio clnica da toxoplasmose cerebral pode variar de sinais focais
a encefalopatia. As manifestaes focais incluem hemiparesia, hemiplegia,
perdas sensoriais, tremor, paralisia de pares cranianos, afasia, cefaleia loca-
lizada e convulses. Os sintomas e sinais de disfuno neurolgica podem
predominar, incluindo debilidade, desorientao, psicose, letargia, confuso
ou coma. A maior parte dos casos de encefalite toxoplsmica apresenta le
ses focais ou multifocais que podem ser evidenciadas pela tomografia axial
computadorizada (TAC) ou pela ressonncia magntica nuclear (RMN). As
Protozorios oportunistas e Pneumocystis jirovecii 147

leses podem ser simples ou mltiplas, bilaterais, isodensas ou hipodensas,


difusas ou em anel (Fotos 4 e 5). Ainda que, nos doentes com sida, a en-
cefalite toxoplsmica seja a manifestao clnica mais usual, a infeco
toxoplsmica pode envolver outros sistemas e rgos. O compromisso do
pulmo, corao, olho e fgado pode ocorrer, isoladamente ou associado ao
envolvimento cerebral. As formas extracerebrais so, em regra, disseminadas,
atingindo vrios rgos. A retinocoroidite toxoplsmica pode ocorrer asso-
ciada encefalite. Quando isolada, , por vezes, precursora da sintomato-
logia cerebral32,35,36.
A marcada diferena de gravidade do quadro clnico, verificada na re-
activao da toxoplasmose no doente imunodeprimido, sugere que a sus-
ceptibilidade infeco pode ser controlada por factores genticos do hos
pedeiro ou do parasita37,38.
O estatuto imunitrio para T. gondii deve ser determinado, logo aps o
diagnstico da infeco por VIH, j que uma serologia positiva, indepen-
dentemente do ttulo, um marcador de risco de encefalite, especialmente
em doentes com imunodepresso profunda.

Diagnstico
O diagnstico presuntivo de toxoplasmose cerebral , normalmente, estabe-
lecido com base na sintomatologia sugestiva, na presena de anticorpos
antitoxoplasma e no exame imagiolgico compatvel. No entanto, aproxi-
madamente 3% dos doentes com sida e toxoplasmose activa no apresentam
anticorpos antitoxoplasma, provavelmente devido ausncia de sntese de
mediadores da resposta imunitria humoral. O diagnstico definitivo de um
episdio de etiologia toxoplsmica implica a confirmao laboratorial da
infeco activa por T. gondii seja por serologia, seja pela evidncia das
formas de multiplicao rpida do parasita (taquizotos). Um dos mtodos
mais utilizados para identificao do toxoplasma tem sido a amplificao
gnica por PCR efectuada no sangue, no LCR ou por biopsia. O mtodo
apresenta elevada especificidade, mas a sensibilidade influenciada no s
pela carga parasitria, mas, tambm, pela complexidade dos constituintes
das amostras biolgicas, o que dificulta, por vezes, a interpretao dos re-
sultados34,35.

Tratamento
A teraputica da toxoplasmose activa, no imunodeprimido, inclui a pres-
crio conjunta da pirimetamina, um inibidor da dihidrofolato redutase,
e da sulfadiazina, um inibidor competitivo da dihidrofolato sintetase. Esta
combinao condiciona o bloqueio do metabolismo do cido flico e ac-
tua, sinergicamente, contra a replicao dos taquizotos, mas os quistos
de T. gondii permanecem viveis, com capacidade de reiniciar o processo
infeccioso activo, se a teraputica descontinuada. A interrupo da tera-
putica , frequentemente, imposta pela toxicidade que lhe est associada.
148 Olga Matos, Helena ngelo, Francisco Antunes

A clindamicina, o interfero e os antibiticos do grupo dos macrlidos so


opes teraputicas alternativas32,39.

Preveno
A instituio sistemtica da profilaxia para Pneumocystis jirovecii, em in-
fectados por VIH com contagem de linfcitos TCD4+ < 200/mm3, veio
diminuir, em cerca de 50%, o nmero de episdios de toxoplasmose cerebral,
calculandose que, em Portugal, 7,3% dos notificados com sida apresentem
um ou mais episdios de encefalite toxoplsmica34,36.

Leishmaniose visceral (calazar)


A leishmaniose visceral (LV) uma doena causada por um protozorio do
gnero Leishmania, que ocorre no hospedeiro imunocompetente, principal-
mente, na Amrica Latina, na bacia mediterrnica, na sia e em frica,
causando, aproximadamente, 500 mil novos casos/ano40. A infeco por VIH
e outras condies de imunodepresso aumentam o risco dos infectados por
Leishmania desenvolverem LV, considerando que para cada caso de LV
existem 30 a 100 infeces subclnicas41. Dos 62 pases endmicos de LV,
33 reportaram casos de coinfeco Leishmania/VIH42. A coinfeco Leish-
mania/VIH, no sul da Europa, tem como principal grupo de risco os toxi-
codependentes de drogas por via endovenosa. O nmero cumulativo de
casos na Europa Ocidental foi de 1440 at Junho de 1998 e de 1627 at
Dezembro de 199943.
Em Portugal, at 1994, foram identificados 26 casos de coinfeco
Leishmania/VIH e 93 novos casos em 77 doentes, de 1995 a 2000 (F. An-
tunes, dados no publicados).
Devido presena de numerosos parasitas fora do sistema reticuloendo-
telial, incluindo o sangue perifrico, estes doentes tornamse verdadeiros
reservatrios e fontes de infeco para o vector. A transmisso atravs de
agulhas e seringas contaminadas, em toxicodependentes, foi, recentemente,
demonstrada44. A LV, em infectados por VIH, diagnosticada em indivdu-
os em estado avanado da imunossupresso, sendo a contagem mdia de
linfcitos TCD4+ de 25204/mm3 e em 62100% dos casos os linfcitos
TCD4+ esto abaixo de 200/mm3,44,45.
A imunossupresso pode dar origem LV, por reactivao de infeco
latente, como acontece com a maioria dos casos de infeces oportunistas
associadas sida ou evoluo para doena no decurso de primoinfeco
por Leishmania.
Leishmania infantum a espcie mais vezes identificada na coinfeco
Leishmania/VIH no sul da Europa, estando descritos casos de LV por es-
pcies dermotrpicas. Para alm disto registase enorme variabilidade dos
isolados de Leishmania, novos zimodemas do parasita e infeces causadas
por flagelados, aparentemente nopatognicos44,46,47.
Protozorios oportunistas e Pneumocystis jirovecii 149

O quadro clnico da LV, na maioria destes doentes, idntico ao des-


crito na doena clssica, no hospedeiro imunocompetente, com febre, hepa
toesplenomegalia e pancitopenia. Porm, dada a imunossupresso grave, o
parasita pode disseminar para localizaes, onde, em regra, no imunocompe
tente, no observado, tais como mucocutnea, gastrintestinal, larngea,
renal, peritoneal, sinovial e cerebral, sendo identificado na pele em 818%
dos casos de coinfeco Leishmania/VIH46,48. A hipergamaglobulinemia,
secundria activao policlonal dos linfcitos B, ocorre tanto na LV, como
na prpria infeco por VIH, pelo que a suspeio de diagnstico, fun
damentada neste achado imunitrio, perde o seu valor na coinfeco Leish-
mania/VIH.

Diagnstico
No que se refere ao diagnstico etiolgico, a tcnica mais sensvel (98%
de positividade) consiste na identificao de Leishmania no material de as
pirado esplnico, surgindo as complicaes em < 1% dos casos. Apesar
daquela ser, praticamente, isenta de riscos, pouco usada, sendo a aspirao
da medula ssea a tcnica mais utilizada, podendo, no entanto, Leishmania
ser observada, tambm, em aspirados do gnglio linftico ou do fgado. Nos
doentes com coinfeco Leishmania/VIH est recomendado, como mtodo
electivo de diagnstico, o aspirado da medula ssea com cultura em meio
de NNN, principalmente nas recadas (Foto 6). O xenodiagnstico, a concen
trao dos leuccitos do sangue perifrico e a PCR tmse revelado pro-
missoras, esta ltima, particularmente, nas recadas. Porm, estas tcnicas
no esto acessveis na maioria dos centros. No que se refere serologia,
a sua sensibilidade, de 8795%, diminui, nos doentes imunocomprometi-
dos com LV, para 4378% nos infectados por VIH. Porm, a combinao
de duas ou mais das tcnicas serolgicas (ELISA, Western blotting e
imunofluorescncia) pode aumentar, significativamente, a sensibilidade da
serologia no diagnstico da coinfeco Leishmania/VIH, pelo que tal me-
todologia est recomendada.

Tratamento
Apesar do nmero elevado de casos de Leishmania/VIH referenciados, o tra-
tamento de escolha, a melhor dosagem e a durao do tratamento no esto,
ainda, estabelecidos. Os antimoniais pentavalentes constituem a teraputica de
primeira escolha da LV na regio mediterrnica (20 mg de Sb/kg/dia, na dose
mxima de 850 mg nos adultos). Na coinfeco Leishmania/VIH recomen-
damse doses mais elevadas, isto de 20 mg de Sb/kg/dia, sem limite mxi-
mo. A anfotericina B considerada como o frmaco de segunda linha. Dado
o insucesso relativo destes frmacos, no tratamento da LV, no infectado por
VIH, tm sido utilizadas alternativas, como a anfotericina B lipossmica, a
pentamidina (abandonada na ndia, por toxicidade e resistncia, mas com
utilidade na teraputica de manuteno dos coinfectados Leishmania/VIH),
150 Olga Matos, Helena ngelo, Francisco Antunes

os antimoniais pentavalentes associados a alopurinol, cetoconazol e muitos


outros. Os custos elevados da anfotericina B lipossmica tm limitado a
utilizao deste composto, como teraputica de primeira opo no tratamen-
to da coinfeco Leishmania/VIH.
Uma das caractersticas mais relevantes na LV, nos infectados por VIH,
a sua tendncia para as recadas (2561% dos doentes, no primeiro ano),
apesar da utilizao de vrios esquemas de teraputica, como profilaxia
secundria.
Recentemente, foi demonstrado que Leishmania pode persistir nos gnglios
linfticos, aps cura clnica, mesmo no hospedeiro imunocompetente49.
A miltefosina foi licenciada, na ndia, para utilizao por via oral, ten-
do demonstrado, em ensaios clnicos no hospedeiro imunocompetente com
kalazar indiano, taxas de cura de 97%, na dose de 50 mg, duas vezes por
dia, durante 28 dias50. Nos doentes com sida poder ser uma opo vlida
quer na teraputica de induo, quer na de manuteno, para obstar s re-
cadas51.

Preveno
Com a utilizao da teraputica antiretrovrica combinada (TARVc)
temse registado diminuio da LV nos infectados por VIH 5254. Por ou-
tro lado, a reconstituio imunitria, induzida pela TARVc, poder per-
mitir a interrupo da profilaxia secundria da LV, em doentes com
contagem de linfcitos TCD4 + > 200 cls/mm 3, o que no est, ainda,
comprovado 55.

Pneumocistose
O agente de pneumocistose Pneumocystis jirovecii (designado, anterior-
mente, P. carinii f. sp hominis) um organismo eucaritico, parasita, com
caractersticas genticas de fungo e fenotpicas de protozorio.
A epidemiologia da pneumonia por P. jirovecii (PPc) no est, ainda,
bem esclarecida. As fontes de infeco no so conhecidas, nem as formas
do ciclo de vida implicadas na transmisso, reconhecendose que algumas
destas, altamente infectantes, se encontram presentes no ambiente, mas no
se sabendo, ainda, onde, nem como o hospedeiro as adquire. A transmisso
animalaanimal, por via area, j foi demonstrada em estudos experimentais
in vivo. Como tal, pensase que a transmisso deste microrganismo, entre
os humanos, se processe da mesma forma. A corroborar esta hiptese so
exemplo alguns casos de transmisso nosocomial56.
No passado recente, julgavase que o nico modo de aquisio da in-
feco resultava da reactivao de uma infeco latente P. jirovecii colo-
nizaria, como saprfita, o pulmo de indivduos saudveis, proliferando e
provocando pneumonia grave, no pulmo de indivduos imunocomprometi-
dos. No entanto, vrios estudos tm vindo a apresentar resultados refutando
esta teoria, pelo menos como nico mecanismo de infeco. Estudos de
Protozorios oportunistas e Pneumocystis jirovecii 151

genotipagem de P. jirovecii sugerem que a infeco seja, na maioria dos


casos, adquirida de novo, em vez de ser consequncia da reactivao de
infeco adquirida anteriormente57,58.
O compromisso profundo da imunidade celular, provavelmente associa-
do a alteraes do surfactante, condio favorvel proliferao de P.
jirovecii no pulmo de indivduos imunocomprometidos59.
As manifestaes pulmonares so as mais frequentes na histria natural
da PPc, caracterizandose por febre, tosse seca, fadiga e dispneia de agra-
vamento progressivo. A gasimetria arterial revela, em regra, hipoxemia
arterial, com alcalose respiratria. O radiograma do trax mostra um padro
de pneumonia intersticial difusa, mas pode ser normal ou apresentar outros
padres radiolgicos, como cavitao, micronodular ou derrame pleural
(Foto 7). Numa fase tardia, a insuficincia respiratria pode traduzirse,
radiologicamente, por um pulmo branco bilateral. As localizaes extra-
pulmonares, embora raras, tm sido demonstradas em vrios rgos e te-
cidos, incluindo o globo ocular, o aparelho auditivo, fgado, rim, medula
ssea, etc.

Diagnstico
O diagnstico definitivo assenta na pesquisa directa de P. jirovecii por tc-
nicas de colorao histoqumica, tais como a metenamina prata, Giemsa,
azul de toluidina, por tcnicas de colorao imunoespecficas, como a imu-
nofluorescncia directa ou indirecta com anticorpos monoclonais e, ainda,
por tecnologia biomolecular (PCR), aplicada em diferente material de origem
pulmonar (Foto 8). Os mtodos moleculares tm sido, tambm, utilizados
para tipagem das estirpes isoladas com o objectivo de clarificar a epidemio-
logia desta doena60.

Tratamento
Alguns frmacos antiparasitrios so capazes de inibir a aco de enzimas
cruciais no metabolismo de P. jirovecii. O trimetoprimsulfametoxazol e a
pentamidina (as molculas de referncia no tratamento e profilaxia da PPc),
a dapsona, a clindamicina, a primaquina, a atovaquona, o trimetrexato e a
eflornitina revelaramse todas elas teis no tratamento e na profilaxia da
PPc. Estes frmacos so eficazes, isoladamente, ou em combinao. O tri-
metoprim (15 a 20 mg/kg/dia)sulfametoxazol (75 a 100 mg/kg/dia) ad-
ministrado fraccionado em trs a quatro tomas dirias, por via oral ou en-
dovenosa, durante 21 dias, enquanto que a pentamidina pode ser utilizada
por via intramuscular ou, de preferncia, por via endovenosa (administrada
por um perodo de uma a duas horas), na dose de trs a quatro mg/kg/dia,
durante 21 dias. Nas formas graves, o tratamento etiotrpico pode ser po-
tenciado pela administrao de corticides, com o intuito de inibir a infla-
mao e a evoluo para a fibrose, limitando o bloqueio alveolocapilar e,
consequentemente, a hipoxemia60,61.
152 Olga Matos, Helena ngelo, Francisco Antunes

Preveno
Em indivduos seropositivos para VIH, a profilaxia recomendada para
adultos e adolescentes com um nmero de clulas TCD4+ < 200 cls/mm3;
em crianas nascidas de mes seropositivas para VIH, a profilaxia deve
comear entre as quatro e as seis semanas de vida; a carga vrica inicial de
ARNVIH e a sua reduo, durante a TARVc, influenciam o risco de infec-
es oportunistas e podem ser independentes da contagem de clulas
TCD4+60,62. O frmaco de escolha para a profilaxia primria e secundria
o trimetoprimsulfametoxazol. Vrias posologias so possveis, tais como
um comprimido de cotrimoxazol forte diariamente ou trs comprimidos de
cotrimoxazol forte/semana. Pelo facto de, no contexto da infeco VIH,
haver incidncia elevada de efeitos secundrios, necessrio, com frequn-
cia, recorrer a outros frmacos. A pentamidina em aerossol alternativa
eficaz ao trimetoprimsulfametoxazol e, relativamente, bem tolerada. A dose
de 300 mg/ms, nebulizada, ou de 60 mg todos os 15 dias aps duas
doses de 300 mg/ms59,60.

Agradecimento
O autor agradece a Ana Sequeira a preparao do manuscrito referente a
leishmaniose visceral (kalazar).

Bibliografia
1. Matos O, Alves M, Xiao L, Cama V, Antunes F. Cryptosporidium felis and C. meleagridis in persons with HIV,
Portugal. Emerg Infect Dis. 2004;10:2255-6.
2. Xiao L, Fayer R, Ryan U, Upton SJ. Cryptosporidium taxonomy: recent advances and implications for public
health. Clin Microbiol Rev. 2004;17:72-97.
3. Okhuysen PC, Chappell CL, Crabb JH, Sterling CR, DuPont HL.Virulence of three distinct Cryptosporidium
parvum isolates for healthy adults. J Infect Dis. 1999;180:1275-81.
4. Alves M, Xiao L, Sulaiman I, Lal AA, Matos O, Antunes F. Subgenotype analysis of Cryptosporidium isolates
from humans, cattle, and zoo ruminants in Portugal. J Clin Microbiol. 2003;41:2744-7.
5. Xiao L, Ryan UM. Cryptosporidiosis: an update in molecular epidemiology. Curr Opin Infect Dis. 2004;17:483-90.
6. Hunter PR, Thompson RCA. The zoonotic transmission of Giardia and Cryptosporidium. Int J Parasitol. 2005;
35:1181-90.
7. Fayer R. Cryptosporidium: a water-borne zoonotic parasite. Vet Parasitol. 2004;126:37-56.
8. Addiss DG, Juranek DD, Schwartz DA. Criptosporidiosis. Em: Horsburgh RC, Nelson AM, eds. Pathology of
Emerging Infections. Washington DC: ASM Press; 1997. p. 242-56.
9. Garca LS. Intestinal protozoa (coccidia and microsporidia) and algae. Em: Diagnostic Medical Parasitology. 4. a
ed. Washington DC: ASM Press; 2001. p. 60-105.
10. Matos O, Toms A, Antunes F, et al. Prevalence of cryptosporidiosis in AIDS patients with diarrhoea in Santa
Maria Hospital, Lisbon. Folia Parasitol. 1998;45:162-5.
11. Casemore DP. Laboratory methods for diagnosing cryptosporidiosis. J Clin Path. 1991;44:445-51.
12. Alves M, Matos O, Antunes F, et al. PCR-RFLP analysis of Cryptosporidium parvum isolates from HIV-infect-
ed patients in Lisbon, Portugal. Ann Trop Med Parasitol. 2000;94:291-7.
13. Alves M, Matos O, Antunes F. Multilocus PCRRFLP analysis of Cryptosporidium isolates from HIV-infected
patients from Portugal. Ann Trop Med Parasitol. 2001;95:627-32.
14. Alves M, Xiao L, Antunes F, Matos O. Distribution of Cryptosporidium subtypes in humans and domestic and
wild ruminants in Portugal. Parasitol Res. 2006;99:287-92.
15. Mofenson LM, Oleske J, Serchuck L, Van Dyke R, Wilfert C; CDC; National Institutes of Health, Infectious
Diseases Society of America. Treating opportunistic infections among HIV-exposed and infected children: recom-
mendations from CDC, the National Institutes of Health, and the Infectious Diseases Society of America. MMWR
Recomm Rep. 2004;53(RR-14):1-92.
16. Curry A, Turner AJ, Lucas S. Opportunistic protozoan infections in human immunodeficiency virus disease:
review highlighting diagnostic and therapeutic aspects. J Clin Path. 1991;44:182-93.
17. Hamour A, Curry A, Ridge A, et al. Isospora belli in a patient with AIDS. J Infect. 1997;35:94-5.
18. Curry A, Smith HV. Emerging pathogens: Isospora, Cyclospora and microsporidia. Parasitology. 1998;117:143-59.
Protozorios oportunistas e Pneumocystis jirovecii 153

19. Ashford RW. Occurrence of an undescribed coccidian in man in Papua New Guinea. Ann Trop Med Parasitol.
1979;73:497-500.
20. Ortega YR, Sterling CR. Cyclospora cayetanensis: epidemiology and diagnosis. Clin Microbiol Newsl.
1996;18:169-72.
21. Ortega YR, Nagle R, Gilman RH, et al. Pathological and clinical findings in patients with ciclosporiasis and a
description of intracellular parasite life-cycle stages. J Inf Dis. 1997;176:1584-9.
22. Madico G, Gilman RH, Miranda E, et al. Treatment of Cyclospora infections with co-trimoxazole (letter). Lan-
cet. 1993;342:1222-3.
23. Didier ES, Weiss LM. Microsporidiosis: current status. Current Opinion in Infectious Diseases. 2006;19:485-92.
24. Bryan RT, Schwartz DA. Epidemiology of microsporidiosis. Em: The Microsporidia and Microsporidiosis. Wash-
ington, DC: ASM Press; 1999. p. 502-16.
25. Kotler DP, Orenstein JM. Clinical syndromes associated with microsporidiosis. Em: The Microsporidia and
Microsporidiosis. Washington, DC: ASM Press; 1999. p. 258-92.
26. Franzen C, Mller A. Microsporidiosis: human diseases and diagnosis. Microbes and Infection. 2001;3:389-400.
27. Matos O, Lobo ML, Gonalves L, Antunes F. Diagnostic use of 3 techniques for identification of microsporid-
ian spores among AIDS patients in Portugal. Scand J Infect Dis. 2002;34:591-3.
28. Sulaiman IM, Matos O, Lobo ML, Xiao L. Identification of a new microsporidian parasite related to Vittaforma
corneae in humans in Portugal. J Euk Microbiol. 2003;50:586-90.
29. Lobo ML, Xiao L, Cama V, Antunes F, Matos O. Frequency of microsporidian spores among HIV-positive and
HIV-negative patients [resumo 62.044]. Int J Infect Dis. 2006;10 Suppl 1:S298.
30. Molina J-M, Tourneur M, Sarfati C, et al. Fumagillin Treatment of Intestinal Microsporidiosis. N Engl J Med.
2002;346:1963-9.
31. Antunes F. Toxoplasmose Estudo da epidemiologia e da infeco congnita na regio de Lisboa [dissertao
de doutoramento]. Lisboa: Faculdade de Medicina da Universidade de Lisboa; 1984.
32. Luft BJ, Remington JS. Toxoplasmic encephalitis in AIDS. Clin Infect Dis. 1992;15:211-20.
33. Remington JS, Klein JO. Toxoplasmosis. Em: WB Saunders Company (ed). Infectious Diseases of the fetus and
newborn infant. Harcourt Brace Jovanovich, Inc 1990:90-179.
34. ngelo HF. Metodologia de identificao da infeco por Toxoplasma gondii no hospedeiro imunocompro-
metido [dissertao de doutoramento]. Lisboa: Faculdade de Farmcia da Universidade de Lisboa; 2000.
35. Raffi F, Aboulker JP, Michelet C, et al. A prospective study of criteria for the diagnosis of toxoplasmic en-
cephalitis in 186 AIDS patients. AIDS. 1997;11(2):177-84.
36. Belanger F, Derouin F, Grangeot-Keros L, et al. Incidence and risk factor of toxoplasmosis in a cohort of human
immunodeficiency virus infected patients: 1988-1995. HEMOCO and SEROCO study groups. Clin Infect Dis.
1999;28(3):575-81.
37. Suzuki Y, Wong SY, Grumet, et al. Evidence for genetic regulation of susceptibility to toxoplasmic encephalitis
in AIDS patients. J Infect Dis. 1996;173:265-8.
38. Howe DK, Sibley LD. Toxoplasma gondii comprises three clonal lineages: correlation of parasite genotype with
human disease. J Infect Dis. 1995;172:1561-6.
39. Luft BJ, Chua A. Central nervous system toxoplasmosis in HIV pathogenesis, diagnosis, and therapy. Curr Infect
Dis Rep. 2000;2:358-62.
40. Desjeux P. Leishmaniasis. Public health aspects and control. Clin Dermatol. 1996;14:417-23.
41. Ho M, Siongok TK, Lyerly WH, Smith DH. Prevalence and disease spectrum in a new form of visceral leish-
maniasis in Kenya. Trans R Soc Trop Med Hyg. 1982;76:741-6.
42. Desjeux P. The increase in risk factors for Leishmaniasis worldwide. Trans R Soc Trop Med Hyg. 2001;95:239-43.
43. Desjeux P, Meert JP, Piot B, et al. Leishmania/HIV co-infection, South Western Europe, 1990-1998, Geneva,
Switzerland: World Health Organization, CDS/CSR/EDC. WHO/LEISH/2000:42.
44. Alvar J, Canavate C, Gutirrez-Solar B, et al. Leishmania and human immunodeficiency virus coinfection: the
first 10 years. Clin Microbiol Rev. 1997;10:298-319.
45. Pintado V, Lpez-Vlez R. HIV-associated visceral leishmaniasis. Clin Microbiol Infect. 2001;7(6):291-300.
46. Rosenthal E, Marty P, Poizot MI, et al. Visceral Leishmaniasis and HIV-1 co-infection in Southern France. Trans
R Soc Trop Med Hyg. 1995;89:159-62.
47. Pratlong F, Dedet JP, Marty P, et al. Leishmania human immunodeficiency virus coinfection in the Mediter-
ranean basin: isoenzymatic characterization of 100 isolates of the Leishmania infantum complex. J Infect Dis.
1995;20:872-5.
48. Montalbn C, Calleja JL, Erice A, et al. Visceral Leishmaniasis in patients infected with human immunodefi-
ciency virus. Co-operative Group for the Study of Leishmaniasis in AIDS. J Infect. 1990;21:261-70.
49. Dereure J, Dvongh-Thanh H, Lavabre-Bertrand T, et al. Visceral leishmaniasis. Persistence of parasites in lymph
nodes after clinical cure. J Infection. 2003;47:77-81.
50. Murray HW. Treatment of visceral leishmaniasis (Kala-azar): a decade of progress and future approaches. Int J
Infect Dis. 2000;4:158-77.
51. Murray HW. Suppression of post-treatment recurrence of experimental visceral leishmaniasis in T cell-deficient
myce by oral milfefosine. Antimicrob Agents Chemother. 2000;44:3235-6.
52. Lpez-Vlez R, Casado JL, Pintado V. Decline of a visceral leishmaniasis epidemic in HIV-infected patients
after the introduction of highly active antiretroviral therapy (HAART). Clin Microbiol Infect. 2001;7:270-1.
53. Tacconelli E, Tumbarello M, Bertagnolio S, Cauda R. Highly active antiretroviral therapy (HAART) decreases
the incidence of visceral leishmaniasis in HIV-infected subjects. Em: Program and Abstracts of the 13 th Interna-
tional AIDS Conference. Durban, South Africa 2000 [abstract WePeA 4030].
54. Pintado V, Moreno S, Miralles PO, et al. Prolonged survival after highly active antiretroviral therapy (HAART)
in AIDS-associated visceral leishmaniasis. Em: Program and Abstracts of the 13 th International AIDS Conference.
Durban, South Africa 2000 [abstract WePeA 4025].
55. Berenguer J, Cosin J, Miralles P, et al. Discontinuation of anti-leishmania prophylaxis in HIV-infected patients
who have responded to highly active antiretroviral therapy. AIDS. 2000;14:2946-8.
154 Olga Matos, Helena ngelo, Francisco Antunes

56. Cushion MT. Transmission and epidemiology. Em: Walzer PD, ed. Pneumocystis carinii Pneumonia. 2.a ed. Nova
Iorque: Marcel Dekker; 1994. p. 123-40.
57. Walzer PD. Pathogenic mechanisms. Em: Walzer PD, ed. Pneumocystis carinii Pneumonia. 2.a ed. Nova Iorque:
Marcel Dekker; 1994. p. 251-65.
58. Keely SP, Stringer JR. Multilocus genotype switching in Pneumocystis carinii sp. f. hominis: evidence for rein-
fection. J Eukaryotic Microbiology. 1996;43:50S.
59. Matos O, Lee CH, Jin S, Li B, et al. Pneumocystis jiroveci in Portuguese immunocompromised patients: asso-
ciation of specific ITS genotype with treatment failure, bad clinical outcome and childhood. Infection, Genetics
and Evolution. 2003;3:281-5.
60. Matos O. Epidemiologia e diagnstico da pneumonia por Pneumocystis carinii. Contribuio para a avaliao
de tcnicas de biologia molecular aplicadas ao diagnstico da pneumocistose. Teste de Doutoramento, Instituto
de Higiene e Medicina Tropical, Universidade Nova de Lisboa; 1999. p. 81-93.
61. Walker RE, Masur H. Current regimens of therapy and prophylaxis. Em: Walzer PD, ed. Pneumocystis carinii
Pneumonia. 2.a ed. Nova Iorque: Marcel Dekker; 1994. p. 439-66.
62. Garca LS. Tissue protozoa. Em: Diagnostic medical parasitology. 4. a ed. Washington DC: ASM Press; 2001. p.
132-58.
V Seco
Captulo 3

Infeces fngicas*
Patrcia Pacheco

Introduo

As infeces fngicas constituem uma causa significativa de morbimorta-


lidade na infeco por VIH/sida. A gravidade clnica das infeces vari-
vel, desde um desconforto ligeiro associado candidose oral at situaes
potencialmente mortais, como a meningite criptoccica.
O conhecimento da estrutura e caractersticas de crescimento dos fungos,
bem como dos mecanismos de resposta imunitria do ser humano infeco,
permitem compreender o motivo pelo qual algumas infeces fngicas so
mais frequentes no decurso da infeco por VIH/sida. Assim, sabendo que
a linha moncitomacrfago o elemento primordial de defesa contra as
infeces causadas por fungos leveduriformes e dimrficos, facilmente se
compreende que o decrscimo dos linfcitos TCD4+ permite o desenvolvi-
mento de infeces, como a criptococose ou a histoplasmose. Por outro
lado, os neutrfilos encontramse preservados, em nmero e/ou funo, at
estdios muito avanados da infeco por VIH, pelo que infeces causadas
por fungos filamentosos, como a aspergilose, so raras no doente com
sida.
A introduo da teraputica antiretrovrica combinada (TARVc), nos
ltimos anos, alterou a histria natural da infeco por VIH. Assim, se por
um lado ocorreu diminuio global da incidncia de infeces fngicas,
semelhana do que tem ocorrido com outras infeces oportunistas 1, por
outro condicionou o aparecimento de nova sndrome, denominada sndrome
de reconstituio imunitria, na qual ocorrem manifestaes de doena,
aps a introduo da TARVc. Estas reaces inflamatrias paradoxais, que
no correspondem a infeco activa, mas reaco imunitria contra uma

*Nota do editor: Este captulo no foi actualizado em relao 3.a edio do Manual sobre sida (2008)
156 Patrcia Pacheco

infeco quiescente (tratveis com corticoterapia), tambm j foram descri-


tas nas infeces fngicas, nomeadamente na criptococose 2,3.

Candidose
As infeces por Candida spp so as infeces fngicas mais frequentes na
infeco por VIH/sida e atingem, quase que exclusivamente, as superfcies
mucosas (orofarngea, esofgica e vulvovaginal). As espcies de Candida
fazem parte da flora habitual das mucosas e a progresso da colonizao
para a infeco depende de factores imunitrios locais e/ou sistmicos do
hospedeiro.
A candidose orofarngea constitui, frequentemente, o primeiro sinal de
depresso imunitria, devendo alertar o mdico para a possibilidade de existir
infeco por VIH subjacente. A gravidade da candidose aumenta medida que
a deteriorao imunitria progride, podendo envolver o esfago, quando a
contagem de linfcitos TCD4+ inferior a 200 cls/mm3. A candidose orofa-
rngea ocorre em, aproximadamente, 60% dos indivduos com infeco por
VIH/sida4 e manifestase, com maior frequncia, na forma pseudomembrano-
sa, podendo tambm ser visualizadas outras formas, como sejam a eritemato-
sa, a hipertrfica ou a queilite angular (Fotos 9 a 12). No causa sintomas,
excepto, por vezes, alterao do paladar. O diagnstico clnico, no sendo
necessrios, habitualmente, exames microbiolgicos para confirmao.
A candidose vulvovaginal no parece ser mais frequente nas mulheres
seropositivas5, embora tenda a apresentar formas mais exuberantes e recor-
rentes. Manifestase por ardor e prurido vulvovaginal, acompanhados de
leucorreia branca e grumosa.
A candidose esofgica expressase por disfagia e/ou dor retrosternal. A
combinao de sintomatologia esofgica associada a candidose oral sufi-
ciente para o diagnstico de candidose esofgica e para o incio de terapu-
tica emprica6, reservandose a endoscopia digestiva alta para os casos de
falncia teraputica (diagnstico diferencial com outras patologias oportu-
nistas, nomeadamente esofagite por herpes, vrus citomeglico ou lcera
idioptica do esfago).
O tratamento da candidose esofgica sempre sistmico, sendo o fr-
maco de primeira escolha o fluconazol. Para a candidose orofarngea e
vaginal pode optarse pelo tratamento tpico ou sistmico. O uso de imi-
dazis sistmicos est associado ao desaparecimento mais rpido das leses
e a maior percentagem de cura micolgica, na candidose orofarngea 7,8.
No caso de candidose refractria teraputica (independentemente da
superfcie mucosa atingida), pode ser necessrio identificar a espcie em
causa e proceder ao teste de susceptibilidade antifngica. O conhecimento
da espcie permite, presuntivamente, equacionar a hiptese de resistncias.
Assim, por exemplo, C. krusei e C. glabrata podem apresentar resistncia
intrnseca (resistncia primria) ao fluconazol. C. albicans, a espcie mais
habitual, pode adquirir resistncia ao fluconazol (resistncia secundria),
razo pela qual a candidose refractria acontece, sobretudo, em doentes com
Infeces fngicas 157

histria extensa de exposio prvia ao fluconazol9. A teraputica antifn-


gica, em casos de candidose refractria, poder ser guiada pelos resultados
dos testes de susceptibilidade. De referir que a resistncia ao fluconazol
dosedependente, pelo que em casos de susceptibilidade intermediria se
pode aumentar a dose diria (at 800 mg/dia), com eficcia clnica e sem
efeitos secundrios graves10. At recentemente, a teraputica alternativa para
doentes com candidose esofgica, refractria aos azis, limitavase anfo-
tericina B. Actualmente, est, tambm, disponvel a caspofungina, que
apresenta actividade sobre a maioria das espcies de Candida, incluindo
isolados resistentes ao fluconazol, e que revelou idntica eficcia clnica
com melhor tolerabilidade que a anfotericina B, no tratamento da candido-
se esofgica11. Os novos azis (voriconazol e posaconazol), tambm, podem
ser teis no tratamento de formas refractrias, uma vez que nem sempre
existem resistncias cruzadas com o fluconazol12,13.

Criptococose
A criptococose constitui a infeco fngica sistmica mais frequente na
infeco VIH/sida, sendo, geograficamente, prevalente em frica e no Su-
doeste Asitico.
Anteriormente consideravamse duas variedades, Cryptococcus neofor-
mans var. neoformans e Cryptococcus neoformans var. gatti, e cinco sero-
tipos (baseados nos antignios polissacridos). Actualmente, considerase
existirem duas espcies no gnero Cryptococcus, C. neoformans (serotipos
A, D e AD) e C. gatti (serotipos B e C). C. neoformans uma levedura
encapsulada, com distribuio mundial, habitualmente isolada do solo, so-
bretudo em terra contendo excrementos de aves, nomeadamente pombos ou
galinhas e a principal responsvel pela criptococose humana. C. gatti
encontrase, sobretudo, nas regies tropicais e subtropicais, nomeadamente
em eucaliptos.
Atravs da inalao, estas leveduras atingem os pulmes, desencadeando
infeco respiratria subclnica. Nos doentes com depresso imunitria celu-
lar T (devido infeco por VIH/sida ou a outra patologia, nomeadamente
doenas linfoproliferativas, transplantados ou sob corticoterapia), a resposta
celular insuficiente para limitar a infeco, podendo ocorrer disseminao
do agente infeccioso por todo o organismo. O aparecimento de doena, no
decurso da infeco por VIH (habitualmente com contagem de linfcitos
TCD4+ < 50 cls/mm3), pode resultar quer de infeco primria recente,
quer da reactivao de foco quiescente.
A forma mais comum de apresentao da criptococose a meningoen
cefalite. Outras formas de apresentao, menos frequentes, so a criptococo-
se pulmonar, cutnea e sistmica. O quadro clnico da meningoencefalite
criptoccica , frequentemente, insidioso. Ocorrem cefaleias de moderada
intensidade, associadas a febrcula nos dias, ou mesmo semanas, anteriores
ao diagnstico. Os sinais clssicos de meningite, como a rigidez da nuca,
vmitos ou fotofobia esto, muitas vezes, ausentes. Alguns doentes apresentam
158 Patrcia Pacheco

alteraes do estado de conscincia, como sejam letargia ou perturbaes


psicticas, traduzindo o componente enceflico desta infeco. O exame
citoqumico do lquor pode revelar quer alteraes compatveis com menin-
gite linfocitria pleocitose linfoctica (< 500 cls/ml), aumento das pro-
tenas e glicorraquia normal ou diminuda , quer parmetros dentro da
normalidade14,15. O diagnstico , definitivamente, estabelecido pela presen-
a de antignio criptoccico no lquor e/ou pela identificao de Crypto-
coccus spp no exame directo e cultural (Foto 13). A meningoencefalite
criptoccica apresenta mortalidade elevada (10-30%) e os factores de mau
prognstico so a alterao do estado de conscincia, a presso de abertura
elevada (> 200 mm H2O), o antignio criptoccico no lquor > 1:1.024 e
celularidade < 20 cls/ml.
A deteriorao clnica, durante o curso teraputico, quase nunca pode
ser atribuda emergncia de resistncias. Um factor importante, e muitas
vezes esquecido, o aumento de presso intracraniana (PIC) 16. O aumento
da PIC pode ser devido a edema cerebral, efeito de massa ou obstruo na
absoro de lquor e manifestase por cefaleias persistentes, alteraes do
estado de conscincia (desorientao, coma) e dfices visuais. O diagnsti-
co confirmado por puno lombar, verificandose aumento da presso de
abertura. Na ausncia de hidrocefalia obstrutiva ou de abcessos focais, a
drenagem de lquor, por meio de punes lombares repetidas, diariamente,
permite reduzir a PIC.
A teraputica da meningoencefalite criptoccica compreende uma fase de
induo, uma fase de consolidao e, posteriormente, a profilaxia secundria.
O regime teraputico de induo recomendado consiste em anfotericina B
(0,71 mg/kg/dia), endovenosa, associada a flucitosina (100 mg/kg/dia), oral
ou endovenosa, durante duas semanas. A teraputica de induo combinada,
com a associao de flucitosina e anfotericina B, est associada esteriliza-
o mais rpida do lquor e a menor taxa de recidivas17,18. Contudo, a flu-
citosina tem um risco elevado, dosedependente, de mielossupresso, pelo
que h necessidade de monitorizar as suas concentraes sricas e do seu
metabolito txico (fluoroacilo ou 5FC). A indisponibilidade desta facilidade
tcnica tem sido um factor limitativo da utilizao generalizada de flucito-
sina. Mais recentemente, alguns estudos sugerem que as doses, actualmente,
preconizadas (100 mg/kg/d) so relativamente baixas e podem ser usadas de
forma segura, sem necessidade de monitorizar a concentrao srica19. Como
alternativa teraputica, no perodo de induo, podese utilizar a anfotericina
B isoladamente (0,71 mg/kg/dia). A anfotericina B lipossmica est, tambm,
aprovada, como alternativa para o tratamento de induo (quatro mg/kg/d),
uma vez que apresenta idntica eficcia clnica, comparativamente conven-
cional, com maior eficcia micolgica e menor toxicidade renal 20. Esta
aprovao no se estende a outras formulaes lipdicas da anfotericina B.
Atendendo ao elevado custo da formulao lipossmica, habitual reservla
para doentes com doena renal prvia. Em doentes com estado de conscin-
cia preservado e sem critrios de gravidade, pode ser efectuada teraputica
de induo com fluconazol (400800 mg/d).
Infeces fngicas 159

A teraputica de consolidao efectuada com fluconazol (400 mg, via


oral) durante oito a 10 semanas ou at as culturas de lquor serem estreis.
Quando a evoluo clnica, sob tratamento, favorvel, no h necessidade
de repetir a puno lombar. O doseamento regular do antignio criptocci-
co srico no til na monitorizao do tratamento, uma vez que as mu-
danas na titulao no se correlacionam com a resposta clnica 21.
Devido ao elevado risco de recidiva da criptococose, o fluconazol deve
ser mantido na dose de 200 mg/dia, como profilaxia secundria. Contudo,
no caso de ocorrer uma recuperao imunitria sustentada, sob TARVc,
discutvel a sua manuteno ad vitae. A maioria dos autores recomenda a
suspenso da profilaxia secundria, quando o doente permanece assintom-
tico e com contagens de linfcitos TCD4+ > 100200 cls/mm3, durante
mais de seis meses22.
Como j foi referido anteriormente, a infeco por C. neoformans pode
ter apresentaes extramenngeas. A pesquisa de antignio criptoccico, no
sangue, pode ser usada como teste de rastreio de infeco criptoccica, em
doentes febris com infeco por VIH23. Um teste positivo deve ser encara-
do como evidncia presuntiva de criptococose.
No caso de se tratar de uma mulher grvida, antifngicos com risco
potencial de teratogenecidade devero ser evitados, como sejam o flucona-
zol (durante o primeiro trimestre) e a flucitosina.

Micoses endmicas
As micoses endmicas so infeces fngicas causadas por fungos dimr-
ficos, que ocorrem em regies geogrficas definidas. Assim, por exemplo,
na Amrica do Norte (sudoeste dos EUA e Mxico) pode encontrarse a
coccidioidomicose (Coccidioides immitis), tambm na Amrica do Norte
(Indiana, Ohio e Mississipi), bem como nas Carabas e Amrica Central e
do Sul, a histoplasmose americana (Histoplasma capsulatum var. capsula-
tum), na frica subsariana, a histoplasmose africana (Histoplasma capsu-
latum var. duboisii), e na sia (norte da Tailndia e China) a peniciliose
(Penicillium marneffei) (Foto 14).
Os fungos dimrficos caracterizamse pelo seu potencial patognico.
Estes fungos so capazes de causar doena em pessoas saudveis, no en-
tanto, nos doentes imunocomprometidos por VIH, existe incapacidade para
limitar a infeco, a qual se pode disseminar. O contgio processase pela
inalao de esporos e a clnica pouco especfica (febre, perda ponderal,
sintomas respiratrios)2426. O quadro clnico de algumas micoses endmicas
(por exemplo a histoplasmose e a peniciliose) mimetiza a tuberculose, pelo
que uma histria epidemiolgica detalhada (incluindo viagens, com trajectos
e datas) fundamental para o diagnstico. Embora existam tcnicas imuni-
trias (deteco de antignios e anticorpos), para algumas destas micoses
endmicas, elas no esto disponveis em Portugal, pelo que o diagnstico
confirmado por exame microbiolgico directo/cultural de espcimes bio-
lgicos e/ou por exame histolgico. A teraputica compreende, regra geral,
160 Patrcia Pacheco

um perodo inicial de anfotericina B seguido de tratamento ad vitae com um


imidazol.

Aspergilose
As infeces por fungos filamentosos so muito raras no decurso da infec-
o por VIH/sida. Aspergillus spp (A. fumigatus, A. flavus, A. terreus, entre
outros) um fungo ubiquitrio no ambiente, que apresenta uma clara natu-
reza oportunista. A aspergilose ocorre, habitualmente, em estdios terminais
da infeco por VIH, quando, tambm, esto presentes outros factores de
risco, como sejam a neutropenia, a corticoterapia e, ainda, a antibioterapia
de largo espectro.
Na aspergilose, do doente com sida, esto descritas duas grandes sn-
dromes27,28, uma traduzindo infeco respiratria (tosse, dispneia, hemopti-
ses, febre e infiltrados nodulares localizados ou difusos), e outra traduzindo
infeco do sistema nervoso central, manifestada por dfices neurolgicos
com leses cerebrais, nicas ou mltiplas, e presena de edema perilesional.
A invaso do crebro pode processarse por via hematognea ou por con-
tiguidade, atravs dos seios perinasais. O diagnstico definitivo de aspergi-
lose difcil, uma vez que este fungo um colonizador habitual das super-
fcies mucosas, podendo, assim, ser cultivado, por exemplo, a partir de
secrees brnquicas, sem ter significado patolgico. A presena de hifas
septadas num tecido de biopsia , contudo, um claro indicador de infeco,
devendo a identificao da espcie ser realizada por exame cultural.
Classicamente, a teraputica da aspergilose invasiva consistia em anfo-
tericina B, como tratamento de induo, e itraconazol como tratamento de
manuteno. Mais recentemente, demonstrouse a superioridade do vorico-
nazol, comparativamente anfotericina B, no tratamento da aspergilose
invasiva, apresentando maior resposta clnica (53 vs 32%), maior sobrevi-
vncia (71 vs 58%) e melhor perfil de segurana, pelo que deve ser usado
como frmaco de primeira opo29. A caspofungina constitui alternativa te
raputica, no caso de aspergilose refractria aos tratamentos de primeira
linha (anfotericina B e azis).
Como curiosidade, de referir que a espcie A. terreus apresenta resis-
tncia intrnseca anfotericina B30, pelo que este frmaco nunca deve ser
utilizado no seu tratamento.
Globalmente, o prognstico reservado, devido quer prpria natureza
agressiva da infeco, quer ao dfice imunitrio severo subjacente.

Bibliografia
1. Palella FJ Jr, Delaney KM, Moorman AC, et al. Declining morbidity and mortality among patients with advanced
human immunodeficiency virus infection. HIV Outpatient Study Investigators. N Engl J Med. 1998;338:853-60.
2. Blanche P, Gombert B, Ginsburg C, et al. HIV combination therapy: immune reconstitution causing cryptococ-
cal lymphadenitis dramatically improved by anti-inflammatory therapy. Scand J Infect Dis. 1998;30:615-6.
3. Lanzafame M, Trevenzoli M, Carretta G, et al. Mediastinal lymphadenitis due to cryptococcal infection in HIV-
positive patients on highly active antiretroviral therapy. Chest. 1999;116:848-9.
4. Sangeorzan JA, Bradley SF, He X, et al. Epidemiology of oral candidiasis in HIV-infected patients: colonization,
infection, treatment, and emergence of fluconazole resistance. Am J Med. 1994;97:339-46.
Infeces fngicas 161

5. Schuman P, Sobel JD, Ohmit SE, et al. Mucosal candidal colonization and candidiasis in women with or at risk
for human immunodeficiency virus infection. HIV Epidemiology Research Study (HERS) Group. Clin Infect Dis.
1998;27(5):1161-7.
6. Rabeneck L, Laine L. Esophageal candidiasis in patients infected with the human immunodeficiency virus. A decision
analysis to assess cost-effectiveness of alternative management strategies. Arch Intern Med. 1994;154:2705-10.
7. Pons V, Greenspan D, Lorada-Nur F, et al. Oropharyngeal candidiasis in patients with AIDS: randomized com-
parison of fluconazole versus nystatin oral suspensions. Clin Infect Dis. 1997;24:1204-7.
8. Pons V, Greenspan D, Debruin M, and the Multicenter Study Group. Therapy for oropharyngeal candidiasis in
HIV-infected patients: A randomized, prospective, multicenter study of oral fluconazole vs clotrimazole troches.
J Acquir Immune Defic Syndr Hum Retrovirol. 1993;6:1311-6.
9. Rex JH, Rinaldi MG, Pfaller MA. Resistance of Candida species to fluconazole. Antimicrob Agents Chemother.
1995;39(1):1-8.
10. Revankar SG, Dib OP, Kirkpatrick WR, et al. Clinical evaluation and microbiology of oropharyngeal infection
due to fluconazole-resistant Candida in human immunodeficiency virus-infected patients. Clin Infect Dis. 1998;
26:960-3.
11. Arathoon EG, Gotuzzo E, Noriega LM, et al. Randomized, double-blind, multicenter study of caspofungin versus
amphotericin B for treatment of oropharyngeal and esophageal candidiasis. Antimicrob Agents Chemother.
2002;46:451-7.
12. Skiest DJ, Vazquez JA, Anstead GM, et al. Posaconazole for the treatment of azole-refractory oropharyngeal and
esophageal candidiasis in subjects with HIV infection. Clin Infect Dis. 2007;44(4):607-14.
13. Gothard P, Rogers TR. Voriconazole for serious fungal infections. Int J Clin Pract. 2004;58(1):74-80.
14. Shaunak S, Schell WA, Perfect JR. Cryptococcal meningitis with normal cerebrospinal fluid. J Infect Dis.
1989;160:912.
15. Kovacs JA, Kovacs AA, Polis M, et al. Cryptococcosis in the acquired immunodeficiency syndrome. Ann Intern
Med. 1985;103:533-8.
16. Graybill JR, Sobel J, Saag M, et al. Diagnosis and management of increased intracranial pressure in patients
with AIDS and Cryptococcal Meningitis. The NIAD Mycosis Study Group and AIDS Cooperative Treatment
Groups. Clin Infect Dis. 2000;30:47-54.
17. Van der Horst CM, Saag MS, Cloud GA, et al. Treatment of Cryptococcal meningitis associated with the acquired
immunodeficiency syndrome. N Eng J Med. 1997; 337:15-21.
18. Brouwer AE, Rajanuwong A, Chierakul W, et al. Combination antifungal therapies for HIV-associated cryptococ-
cal meningitis: a randomised trial. Lancet. 2004;363:1764-7.
19. Brouwer AE, van Kan HJ, Johnson E, et al. Oral versus intravenous flucytosine in patients with human immu-
nodeficiency virus-associated cryptococcal meningitis. Antimicrob Agents Chemother. 2007;51(3):1038-42.
20. Leenders AC, Reiss P, Portegies P, et al. Liposomal amphotericin B (Ambisome) compared with amphotericin
B both followed by oral fluconazole in the treatment of AIDS-associated cryptococcal meningitis. AIDS.
1997;11(12):1463-71.
21. Powderly WG, Cloud GA, Dismukes WE, Saag MS. Measurement of cryptococcal antigen in serum and cerebro-
spinal fluid: value in management of AIDS associated cryptococcal meningitis. Clin Infect Dis. 1994;18:789-92.
22. Kaplan, JE, Masur H, Holmes KK, USPHS/IDSA. Guidelines for Preventing Opportunistic Infections Among
HIV-Infected Persons. MMWR Recomm Rep. 2002;51:1-46.
23. Feldmeser M, Harris C, Reichberg S, et al. Serum cryptococcal antigen in patients with AIDS. Clin Infect Dis.
1996;23:827-30.
24. Wheat LJ, Connolly-Stringfield P, Baker RL, et al. Disseminated histoplasmosis in the acquired immune deficiency
syndrome: Clinical findings, diagnosis and treatment, and review of the literature. Medicine. 1990;69:361-74.
25. Fish DG, Ampel NM, Galgiani JN, et al. Coccidioidomycosis during human immunodeficiency virus infection.
A review of 77 patients. Medicine. 1990;69:384-91.
26. Supparatpinyo K, Khamwan C, Baosoung V, et al. Disseminated Penicillium marneffei infection in southeast
Asia. Lancet. 1994;344:110-3.
27. Lortholary O, Meyohas MC, Dupont B, et al. Invasive aspergillosis in patients with acquired immunodeficiency syn-
drome: report of 33 cases. French Cooperative Study Group on Aspergillosis in AIDS. Am J Med. 1993;95:177-87.
28. Khoo SH, Denning DW. Invasive aspergillosis in patients with AIDS. Clin Infect Dis. 1994;19 Suppl 1:41-8.
29. Herbrecht R, Denning D, Patterson T, et al. Voriconazole versus amphotericin B for primary therapy of invasive
aspergillosis. NEJM. 2002;347(6):408-15.
30. Sutton DA, Sanche SE, Revankar SG, et al. In vitro amphotericin B resistance in clinical isolates of Aspergillus
terreus, with a head-to-head comparison to voriconazole. J Clin Microbiol. 1999;37(7):2343-5.
V Seco
Captulo 4

Tuberculose
Emlia Valadas

The growing tuberculosis epidemic is no longer an emergency only for


those who care about health, but for those who care about justice. (World
Health Organisation. TB a global emergency. WHO report on the TB epi-
demic. Genebra: WHO; 1994).

Incidncia e mortalidade por tuberculose


A tuberculose (TB) considerada, mais do que nunca, um grave problema
de sade pblica a nvel mundial. Apesar de se conhecer a causa da doena,
h mais de um sculo, e de se dispor de uma vacina e de um tratamento
eficaz e barato, a TB continua a ser a primeira causa de morte em adultos
(Fig. 1).
Uma em cada trs pessoas no mundo est infectada por Mycobacterium
tuberculosis. H oito milhes de novos casos de TB por ano e trs milhes
de mortes, o que faz com que a TB seja a primeira causa de morte em
adultos, a nvel mundial1. Estes nmeros ilustram o terrvel impacto que
uma nica doena tem a nvel global.
O aumento da prevalncia da TB no pode ser considerado, apenas, como
consequncia da pandemia por VIH/sida, embora esta seja o factor mais
importante. Fenmenos demogrficos, tais como o aumento global da po-
pulao, o aumento da sua longevidade, factores socio-econmicos e a de-
teriorao das infraestruturas de sade pblica contribuem para a elevada
prevalncia da doena. A emergncia de estirpes de M. tuberculosis multir-
resistentes veio agravar, ainda mais, o problema da TB, a nvel mundial.
Apesar de se ter assistido diminuio gradual do nmero de casos de
TB, Portugal detm, ainda, a mais elevada incidncia de TB da Europa
164 Emlia Valadas

3
Populao (milhes)

0
Infeco Sida* Diarreia TB Malria Sarampo
respiratria
aguda

Figura 1. As seis doenas que causam 90% das mortes a nvel mundial. Os dados referem-se
ao nmero de mortes (milhes) em crianas e adultos (adaptado de: OMS, 1999).
*As mortes por TB, em infectados por VIH, foram includas no grupo de mortes por sida, o que faz
com que a TB seja a primeira causa de morte em adultos.

Ocidental (http://www.dgs.pt/upload/membro.id/ficheiros/i012626.pdf, ace-


dido em Dezembro de 2010). Considerando a regio europeia, a incidncia
de TB em Portugal s ultrapassada por alguns pases do Leste europeu 2,
e semelhante de alguns pases em desenvolvimento.
Nos pases industrializados, a recente diminuio dos casos de TB asso-
ciados a VIH tem sido acompanhada pela reduo dos casos de TB em geral.
provvel que esta diminuio seja consequncia do uso generalizado da
teraputica antiretrovrica (TARV) eficaz que leva reconstituio imune.

Interaces entre M. tuberculosis e VIH


Os indivduos infectados por VIH tm risco aumentado de desenvolver TB.
Vrios estudos tm vindo a demonstrar os efeitos negativos recprocos entre
a TB e a infeco por VIH. Se, por um lado, a infeco por VIH aumenta
o risco de TB3, a TB agrava o prognstico da infeco por VIH4,5. A maioria
dos indivduos imunocompetentes, apesar de infectados por M. tuberculosis,
nunca ir desenvolver TB, j que a micobactria mantida num estado dor-
mente. Como a manuteno da micobactria, nesse estado quiescente, de-
pende, fundamentalmente, da imunidade celular eficaz, a taxa de progresso
de infeco latente para doena activa muito mais elevada nos indivduos
infectados por VIH6. A taxa de reactivao da TB , assim, de 10% por ano
ou 10% ao longo da vida, conforme se trate de um indivduo imunodeprimido
Tuberculose 165

ou de um imunocompetente3. Os infectados por VIH tm, no s elevada


taxa de reactivao da TB, mas, tambm, mais rpida evoluo de infeco
por M. tuberculosis para TB3,7. Em regies com elevada prevalncia de TB,
como o caso de Portugal e, como tal, com elevado nmero de doentes
bacilferos, a reinfeco exgena pode ser mais frequente do que anterior-
mente se pensava e ser responsvel por elevada percentagem dos casos de
TB810. O aumento do nmero de casos de TB, na populao infectada por
VIH, condiciona o aumento da probabilidade de transmisso, sendo, afinal,
a TB a nica infeco oportunista, que tambm se transmite aos imunocom-
petentes. Alguns estudos tm sugerido que a TB acelera o curso da infeco
por VIH. A produo de uma cascata de citocinas (factor de necrose tumo-
ral [FNT] interleucina 1 [IL1] e 6 [IL6]), pelos macrfagos infec-
tados por M. tuberculosis, activa os linfcitos TCD4+, o que origina aumen-
to da replicao de VIH11,12. De facto, foi demonstrado que a TB agrava o
prognstico dos doentes com sida4,5.

Manifestaes clnicas da TB
A variabilidade do quadro clnico na TB (a grande imitadora) bem conhe-
cida, o que explicado pela patogenia da doena. A TB pode atingir qualquer
rgo e a sua expresso clnica varia conforme a localizao das leses. Quan-
do associada infeco por VIH, as manifestaes clnicas da TB podem ser
semelhantes s dos imunocompetentes. No entanto, as formas disseminadas e
de localizao extrapulmonar so mais frequentes. Embora a TB possa ocorrer
em qualquer estdio da infeco por VIH, as suas manifestaes clnicas variam
com o grau de imunodepresso associada. De facto, existe correlao bem
conhecida entre a contagem de linfcitos TCD4+ e as manifestaes clnicas
da TB13, um nmero de linfcitos TCD4+ < 200 cls/mm3 correlaciona com
a existncia de localizaes extrapulmonares ou formas disseminadas de TB14.
Num estudo, realizado entre ns, verificouse que a contagem de linfcitos
TCD4+, data do diagnstico de TB, foi de 73 cls/mm3. Esta grave imuno-
depresso poder ter estado relacionada a determinadas caractersticas da po-
pulao estudada, tal como a elevada taxa de toxicodependncia, o que pode-
r ter contribudo para o recurso tardio aos servios de sade15. Quando a
contagem de linfcitos TCD4+ baixa h, com maior frequncia, TB extra-
pulmonar, deteco de micobactrias em hemocultura e radiografias de trax
com imagens atpicas, o que reflecte a incapacidade do sistema imune con-
ter a infeco (Foto 15)13. Assim, medida que a infeco por VIH progride,
no tempo, mais atpica a apresentao clnica da TB pode ser. A forma de
apresentao pode ter caractersticas de sndrome febril prolongada, que obri-
ga ao diagnstico diferencial com mltiplas situaes patolgicas.

Diagnstico
O diagnstico de TB deve ser, sempre que possvel, bacteriolgico, recor-
rendo s tcnicas habituais (exame directo com a auramina/ZiehlNeelsen e
166 Emlia Valadas

exame cultural em meio de Lwenstein ou em meios lquidos). Os meios


lquidos podem, em regra, confirmar o diagnstico mais rapidamente, mas
o meio de LwensteinJesen , ainda, considerado fundamental para o
diagnstico de TB16. O diagnstico deve ser comprovado a partir de qual-
quer material suspeito, tal como expectorao ou secrees brnquicas,
sangue, medula ssea, urina, lquido cefalorraquidiano (LCR) ou fragmen-
tos de tecidos, obtidos por biopsia (fgado, gnglios, pleura, bao, osso).
As novas tcnicas de biologia molecular, embora permitam a identificao
da micobactria em poucos dias, no so usadas por rotina, atendendo no
s aos custos elevados, mas, tambm, devido possibilidade de resultados
positivos falsos. O exame histolgico do material obtido por biopsia, com
a identificao de granulomas caractersticos de TB, pode, tambm, ajudar
ao diagnstico. Como a formao de granulomas est, directamente, de-
pendente da manuteno da imunidade celular eficaz, esses achados histo-
lgicos so, tambm, menos tpicos medida que a imunodepresso vai
progredindo. Da mesma forma, as alteraes encontradas na radiografia de
trax vo sendo menos especficas, medida que a imunodepresso se
acentua. Em regra, as cavitaes so encontradas nos doentes com contagens
de linfcitos TCD4+ 200 cls/mm3, enquanto que as adenopatias intrato-
rcicas so observadas em doentes com linfcitos TCD4 + < 200 cls/mm3.
A presena de leses hipoecognicas no bao, que, com frequncia, se
associam a discreta esplenomegalia, so, tambm, a favor do diagnstico
de TB17.
A reaco de Mantoux cada vez menos usada na prtica clnica, em
especial desde que a infeco por VIH conhecida. Nestes casos, a reaco
de Mantoux , muitas vezes, negativa, mesmo em doentes com TB, j que
para a sua positividade necessria a presena de imunidade eficaz. Alter-
nativas a este mtodo comeam agora a surgir. Os dois testes mais usados,
Quantiferon Gold e TSPOT.TB, baseiamse na deteco de interfero
(IFN) pelos linfcitos TCD4+, quando em presena de pequenas protenas
produzidas pela prpria micobactria (ESAT6 e CFP10). Embora os dois
testes tenham algumas caractersticas idnticas, TSPOT.TB tem melhor
especificidade e sensibilidade, quando se trata de doentes coinfectados por
VIH. De facto, um trabalho recente mostra as vantagens deste mtodo,
mesmo em doentes vacinados com BCG, infectados por VIH e com imu-
nodepresso grave18. Outra das aplicaes deste mtodo ser, seguramente,
a identificao de indivduos com infeco latente por M. tuberculosis e em
risco de desenvolver a doena18,19.

Tratamento da TB
Os frmacos de que dispomos para tratar a TB foram descobertos h mais
de 40 anos. Idealmente, os novos frmacos deveriam permitir reduzir a du-
rao do tratamento, melhorar o perfil de toxicidade, serem activos nos casos
de M. tuberculosis resistente, poderem ser usados nos doentes com infeco
por VIH e, ainda, serem activos na infeco latente por M. tuberculosis. No
Tuberculose 167

entanto, por vrias razes, o desenvolvimento de novos frmacos para


tratar a TB tem sido dificultado. Em primeiro lugar, o mercado para estes
frmacos est associado a baixos lucros para as companhias farmacuticas.
O custo do desenvolvimento de um novo frmaco estimado em 115 a
240 milhes de dlares e, para ser rentvel, o preo no mercado de novos
frmacos teria que ser relativamente alto. Um outro desafio a dificulda-
de em identificar novos compostos, que sejam activos contra M. tubercu-
losis. Estes devem destruir micobactrias, que crescem rapidamente (acti-
vidade bactericida), e, tambm, as micobactrias persistentes nas leses
(actividade esterilizante). Os mecanismos moleculares responsveis pela
dormncia da micobactria (micobactria num estado de baixa actividade
metablica), ou pela sua persistncia (micobactrias sensveis aos antitu-
berculosos mas que sobrevivem, apesar da continua exposio aos mesmos)
e resistncia aos frmacos, no so, ainda, completamente conhecidos. Um
outro desafio tem sido a avaliao dos novos antibacilares, j que no h
modelos animais, que permitam predizer a durao correcta do tratamen-
to com novos frmacos. Ainda, um outro problema, o facto de se ne-
cessitar, nos ensaios de fase III, de longo tempo de seguimento (dois anos
aps a concluso do tratamento) e de amostras com grande nmero de
indivduos. Para alm disso, os locais onde estes estudos poderiam ser
realizados (pases com elevada taxa de incidncia de TB) no permitem,
em geral, realizlos, por deficientes infraestruturas. No entanto, desde
1998, ano em que se decifrou o genoma de M. tuberculosis, temse vindo
a compreender alguns dos mecanismos do seu metabolismo e, assim, tm
sido encontrados novos alvos teraputicos e novos frmacos. Alguns apre-
sentam resultados muito promissores (TMC207, PA824, OPC67683,
SQ1092022), mas o uso de regimes de menor durao, baseados no uso
dos novos frmacos, devero levar, ainda, uma dcada at estarem imple-
mentados na prtica clnica. Como a TB um problema importante, nos
doentes com infeco por VIH, estes deveriam ser includos nos ensaios
clnicos, o mais precocemente possvel. De igual modo, o tratamento da
TB em crianas e de TB multirresistente (TBMR) deveria ter maior prio-
ridade.
Recomendase que o tratamento da TB, em doentes infectados por VIH
e sem indicao para TARV e, ainda, no contexto epidemiolgico actual, seja
feito com quatro antibacilares, durante os dois primeiros meses de terapu-
tica isoniazida 300 mg/dia, rifampicina 600 mg/dia (ou 450 mg/dia se
menos de 45 kg de peso), pirazinamida 20 a 30 mg/kg/dia e etambutol
15 mg/kg/dia. O uso do quarto frmaco, o etambutol, justificado sempre
que a taxa de resistncia isoniazida seja superior a 4%. Em Portugal,
calculase que a resistncia primria isoniazida seja de 7% e a adquirida
de 14,3%. Tal como nos doentes imunocompetentes, a isoniazida e a ri-
fampicina devem ser continuadas, pelo menos, por mais quatro meses. Nos
doentes com TB menngea, nos que apresentam respostas tardias ao trata-
mento antibacilar ou com TBMR, devem ser considerados, pelo menos,
12 meses de tratamento antibacilar.
168 Emlia Valadas

No entanto, em relao aos doentes j medicados com antiretrovricos (ARVs)


ou com indicao para iniciar essa teraputica, h algumas particularidades que
condicionam alteraes a este esquema teraputico. O problema em proceder
aos dois tratamentos em simultneo devese, principalmente, ao facto de poder
ser difcil conciliar a TARV mais eficaz com os antibacilares mais potentes, ao
risco de se poder desenvolver a sndrome de reconstituio imunitria e ine-
vitvel dificuldade na adeso a uma teraputica, que inclui, pelo menos, sete
frmacos diferentes.
Em 1998, o CDC publicou as recomendaes para a teraputica da TB,
em doentes coinfectados por VIH23. Nestas recomendaes era sugerida a
utilizao de esquemas teraputicos que inclussem rifabutina, em vez da
rifampicina, nos doentes medicados com inibidores da protease (IPs) ou com
nonuclesidos inibidores da transcriptase reversa (NNITRs). Os nuclesidos
inibidores da transcriptase reversa (NITRs) no so metabolizados pelo ci-
tocrmio P450 (CYP450), pelo que o uso da rifampicina no est contrain-
dicado e no so necessrios fazer ajustes posolgicos. No entanto, as reco-
mendaes mais recentes24,25 sofreram algumas alteraes, havendo lugar
para o uso de rifampicina em conjunto com alguns ARVs, para alm dos
NITRs. Por exemplo, dentro da classe dos NNITRs, o efavirenz (EFV) pode
ser usado em conjunto com rifampicina, mantendose a dose de 600 mg/dia
se o doente tiver peso inferior a 50 kg e aumentandose para 800 mg/kg se
tiver peso superior25. Em relao ao uso, concomitante, de nevirapina (NVP)
e de rifampicina, dados de farmacocintica mostram grande reduo nas
concentraes da NVP. No entanto, h estudos clnicos que mostram haver
respostas clnica e vrica favorveis, quando os dois frmacos so usados em
simultneo26,27. Assim, considerase que, at haver mais dados disponveis,
a NVP s deve ser usada com rifampicina se no houver mais opes dis-
ponveis. A rifabutina, na dose de 450 mg/dia, pode ser usada com EFV 25.
Em relao ao uso de IPs e de rifamicinas, tambm houve alteraes
recentes nas recomendaes para o seu uso. Enquanto a rifabutina, com
ajuste de dose, pode ser usada com IPs nopotenciados (excepto saquinavir
[SQV]), a rifampicina j no o deve ser25. Em relao ao uso de qualquer
IPs potenciado e rifampicina, no aconselhada a sua coadministrao por
haver um claro aumento do risco de hepatoxicidade25. Nos casos em que
no h alternativas teraputicas, aconselhase a monitorizao clnica e la-
boratorial frequentes, incluindo doseamento srico dos IPs. A excepo o
SQV, que no deve ser coadministrado com rifampicina, por haver uma
taxa muito elevada de hepatotoxicidade grave25. H poucos dados disponveis
sobre coadministrao de rifabutina e de IPs potenciados, mas se usada a
rifabutina deve ser na dose de 150 mg, trs vezes por semana. No entanto,
necessrio chamar a ateno para o facto de haver poucos dados sobre o
uso de rifabutina, no tratamento da TB, em doentes com infeco por VIH.
Dois estudos, em doentes com TB e infeco por VIH, mostram eficcia
semelhante entre rifampicina e rifabutina; no entanto, o nmero de doentes
includo foi muito reduzido 50 no Uganda e 25 nos Estados Unidos da
Amrica (EUA)28,29.
Tuberculose 169

Assim, e apesar de todas as restries na prescrio, as recomendaes con-


tinuam a sugerir que a rifampicina seja, sempre que possvel, o frmaco de es-
colha no tratamento da TB, quer esteja associada, ou no, infeco por
VIH24,25.
A outra questo diz respeito altura ideal para iniciar a TARV, nos
doentes com TB. Tambm aqui as recomendaes so semelhantes, isto ,
sempre que possvel devemse evitar os dois tratamentos em simultneo, de
forma a prevenir os mltiplos efeitos sinergsticos e acessrios dos vrios
frmacos usados. Quando o doente tem indicao para iniciar TARV, ento
este devese afastar o mais possvel do incio do tratamento com antibaci-
lares. Esta deciso devese apoiar na contagem de linfcitos TCD4+, isto ,
se a contagem for inferior a 100 cls/mm3, este incio deve ser o mais
precoce possvel, dependendo da avaliao clnica; se estiver entre 100 e
200 linfcitos TCD4+/mm3, os ARVs devem ser iniciados aos dois meses,
altura em que tambm se diminui o nmero de antibacilares e, finalmente,
se forem > 200 cls/mm3, ento deverse decidir no final dos seis meses
de tratamento da TB25.
Atendendo a que este um assunto em rpida evoluo, com desenvol-
vimento de novos ARVs e de novos dados sobre farmacocintica, desej-
vel que a TARV, em simultneo com a teraputica antibacilar, seja, sempre,
prescrita por um mdico com ampla experincia neste assunto, de forma a
no comprometer a eficcia de nenhuma das teraputicas. Informaes re-
centes sobre ARVs e suas interaces podem ser consultadas em http://www.
hivdruginteractions.org.

Tuberculose multirresistente
A TBMR definida como a resistncia simultnea isoniazida e rifam-
picina, os dois antibacilares mais eficazes no tratamento da TB. Apesar da
resistncia de M. tuberculosis ser um fenmeno conhecido, desde a desco-
berta dos antibacilares, s a partir dos finais da dcada de 80, e coincidente
com a ecloso de surtos de TBMR nos EUA, este problema passou a inte-
ressar a comunidade internacional. Em Portugal, s a partir de meados da
dcada de 90, se passou a realizar a vigilncia da TBMR, de uma forma
sistemtica. Em 2005 e a nvel nacional, 14,4% dos casos de TB notificados
foram de TBMR e alguns hospitais mostraram resultados preocupantes30,
apontando para taxas de TBMR, que rondavam os 16%. O agrupamento dos
padres de resistncia encontrados e o estudo molecular destas estirpes pa-
recia sugerir que a transmisso nosocomial da TB possa ter ocorrido31. O
prognstico da TBMR correlacionase, fundamentalmente, com a rapidez
com que o tratamento correcto institudo, o que est dependente da sus-
peita clnica e da prontido com que os testes de sensibilidade aos antibaci-
lares so fornecidos. Embora o esquema teraputico tenha que ser sempre
individualizado , no entanto, consensual que deve combinar trs ou quatro
frmacos no usados previamente, incluindo uma fluoroquinolona e um
aminoglicosdeo ou capreomicina, devendo ser mantido por 1824 meses32.
170 Emlia Valadas

Vacinao e quimioprofilaxia
A vacina BCG, usada desde 1921, tem eficcia bastante contraditria. En-
quanto alguns estudos demonstraram que se associa a proteco contra a
TB de cerca de 80%, outros mostraram eficcia nula33. No entanto, con-
sensual que a BCG protege contra as formas graves da doena (TB menn-
gea e TB miliar nas crianas). A necessidade de uma vacina mais eficaz
indiscutvel, no s pelas razes j apontadas, mas, tambm, porque a BCG,
por ser uma vacina viva atenuada, no deve ser administrada a infectados por
VIH.
A medida considerada mais importante para a preveno da TB a
rpida identificao e tratamento dos casos de TB. Os defensores da
quimioprofilaxia, um dos assuntos mais controversos no que diz respei-
to ao controlo da TB, especialmente em pases desenvolvidos, como
uma das medidas para o controlo da TB, argumentam que iniciar qui-
mioprofilaxia, nos infectados por M. tuberculosis, pode prevenir a pro-
gresso de infeco latente para doena activa, diminuindo, assim, a
transmisso da TB. A eliminao dos reservatrios humanos de M. tu-
berculosis, atravs da quimioprofilaxia, poderia diminuir, a mdio pra-
zo, o nmero de casos da doena. Por outro lado, nos coinfectados por
VIH, a preveno da reactivao da TB pode evitar a activao dos
linfcitos TCD4 + e, assim, diminuir a progresso para sida. De facto,
a diminuio da incidncia de TB e da progresso para sida, atravs da
quimioprofilaxia, tem sido documentada em mltiplas publicaes. Os
resultados continuam a ser alvo de intensa discusso e os argumentos
contra a quimioprofilaxia generalizada apoiamse, principalmente, em
razes de sade pblica. Em primeiro lugar, h que identificar os indi-
vduos infectados por M. tuberculosis. Em regies com elevada preva-
lncia de vacinao por BCG e de TB, como o caso de Portugal, os
testes cutneos disponveis reaco de Mantoux no permitem esta
distino. Este assunto tem sido mais debatido, nos ltimos anos, de-
vido ao aparecimento de novas tcnicas (deteco da produo de IFN
por linfcitos especficos, atravs de Elispot ou de enzymelinked im-
munosorbent assay [ELISA], em resposta estimulao com protenas
especficas de M. tuberculosis ESAT6 e CFP10) que permitem o
diagnstico de infeco latente por M. tuberculosis de uma forma mui-
to mais acurada que anteriormente.

Concluso
O controlo da TB deve ser uma prioridade em sade pblica. Os tratamen-
tos inadequados ou parciais iro aumentar a incidncia de TB e de TBMR
e, ainda, diminuir a capacidade em controlar a doena. E , sempre, bom
relembrar que o primeiro ponto da estratgia directly observed treatment
shortcourse (DOTS) um slido empenhamento poltico, sem o qual difi-
cilmente os outros quatro pontos funcionaro.
Tuberculose 171

Bibliografia
1. World Health Organisation. Fact sheet n.o 104. Geneve: WHO; 2007.
2. EuroTB. Surveillance of tuberculosis in Europe. Report on tuberculosis. 1996.
3. Daley CL, Small PM, Schecter GF, et al. An outbreak of tuberculosis with accelerated progression among persons
infected with immunodeficiency virus. An analysis using restriction-fragment-length polymorphisms. N Engl J
Med. 1992;326:231-5.
4. Whalen C, Okwera A, Johnson J, et al. Predictors of survival in human immunodeficiency virus-infected patients
with pulmonary tuberculosis. The Makerere University-Case Western Reserve University Research Collaboration.
Am J Resp Crit Care Med. 1996;153:1977-81.
5. Perneger TV, Sudre P, Lundgren JD, Hirschel B. Does the onset of tuberculosis in AIDS predict a shorter sur-
vival? Results of a cohort study in 17 European studies over 13 years. AIDS in Europe study group. BMJ.
1995;311:1468-71.
6. Selwyn PA, Hartel D, Lewis VA, et al. A prospective study of the risk of tuberculosis among intravenous drug
users with human immunodeficiency virus infection. N Engl J Med. 1989;320(9):545-50.
7. DiPierri G, Cruciani M, Danzi MC, et al. Nosocomial epidemic of active tuberculosis among HIV-infected pa-
tients. Lancet. 1989;2:1502-4.
8. Alland D, Kalkut GE, Moss RA, et al. Transmission of tuberculosis in New York City. An analysis by DNA
fingerprinting and conventional epidemiologic methods. N Engl J Med. 1994;330:1710-6.
9. Small PM, Hopewell PC, Singh SP, et al. The epidemiology of tuberculosis in San Francisco. A population-based
study using conventional and molecular methods. N Engl J Med. 1994;330:1703-9.
10. Marchal G. Recently transmitted tuberculosis is more frequent than reactivation of latent infections. Int J Tuberc
Lung Dis. 1997;1:192-8.
11. Nakata K, Rom WN, Honda Y, et al. Mycobacterium tuberculosis enhances human immunodeficiency virus-1
replication in the lung. Am J Respir Crit Care Med. 1997;155:996-1003.
12. Garrait V, Cadranel J, Esvant H, et al. Tuberculosis generates a microenvironment enhancing the productive
infection of local lymphocytes by HIV. J Immunol. 1997;159:2824-30.
13. Jones BE, Young SM, Antoniskis D, et al. Relationship of the manifestations of tuberculosis to CD4 + cell counts
in patients with human immunodeficiency virus infection. Am Rev Respir Dis. 1993;148(5):1292-7.
14. Martin DJ, Sim JG, Sole GJ, et al. CD4+ lymphocyte count in African patients co-infected with HIV and tuber-
culosis. J Acquir Immune Defic Syndr Hum Retrovirol. 1995;8(4):386-91.
15. Valadas E, Hnscheid T, Fernandes ML, Antunes F. Smear microsocopy to diagnose tuberculosis early and
prevent further transmission in a population with a high prevelance of HIV infection. Clin Microbiol Infect.
2003;9(10):1045-7.
16. Hnscheid T, Salgado MJ, Lito L, Valadas E. Lwenstein-Jensen media, no longer necessary; too strong a state-
ment? Am J Clin Path. 2001;115:615-7.
17. Valadas E, Badura R, Gonalves A, Quaresma MJ. Usefulness of spleen biopsy in the diagnosis of tuberculosis in
HIV patients. 5th International Congress on Drug Therapy in HIV Infection. Glasgow, Reino Unido; 2000. Poster.
18. Santos J, Valadas E, Antunes F. Diagnstico de tuberculose e de infeco latente por Mycobacterium tuberculo-
sis em indivduos infectados por VIH baseado na enumerao de linfcitos T especficos. Revista Portuguesa de
Doenas Infecciosas. 2009;5(2):59-67.
19. Lalvani A, Pathan AA, Durkan H, et al. Enhanced contact tracing and spatial tracking of Mycobacterium tuber-
culosis infection by enumeration of antigen-specific T cells. Lancet. 2001;357(9273):2017-21.
20. Diacon AH, Pym A, Grobusch M, et al. The diarylquinoline TMC207 for multidrug-resistant tuberculosis. N
Engl J Med. 2009;360(23):2397-405.
21. Chen P, Gearhart J, Protopopova M, Einck L, Nacy CA. Synergistic interactions of SQ109, a new ethylene di-
amine, with front-line antitubercular drugs in vitro. J Antimicrob Chemother. 2006;58(2):332-7.
22. Matsumoto M, Hashizume H, Tomishige T, et al. OPC-67683, a nitro-dihydro-imidazooxazole derivative with
promising action against tuberculosis in vitro and in mice. PLoS Med. 2006;3(11):e466.
23. CDC. Prevention and treatment of tuberculosis among patients infected with human immunodeficiency virus:
principles of therapy and revised recommenda-tions. MMWR. 1998;47(RR-20).
24. CDC. Treatment of Tuberculosis. MMWR. 2003;52(RR-11).
25. BHIVA guidelines for TB/HIV infection [2005]. Disponvel em: http://www.bhiva.org/files/file1001577.pdf
26. Ribera E, Pou L, Lopez RM, et al. Pharmacokinetic interaction between nevirapine and rifampicin in HIV-in-
fected patients with tuberculosis. J Acquir Immune Defic Syndr. 2001;28:450-3.
27. Olivia J, Moreno S, Sanz J, et al. Co-administration of rifampin and nevirapine in HIV-infected patients with
tuberculosis. AIDS. 2003;17:637-42.
28. Schwander S, Rusch-Gerdes S, Mateega A, et al. A pilot study of antituberculosis combinations comparing ri-
fabutin with rifampicin in the treatment of HIV-1 associated tuberculosis: a single-blind randomized evaluation
in Ugandan patients with HIV-1 infection and pulmonary tuberculosis. Tubercle Lung Dis. 1995;76:210-8.
29. Narita M, Stambaugh JJ, Hollender ES, Jones D, Pitchenik AE, Ashkin D. Use of rifabutin with protease inhibi-
tors for human immunodeficiency virus infected patients with tuberculosis. Clin Infect Dis. 2000;30:779-83.
30. Valadas E, Constant C, Bravo-Ferreira P, et al. Multidrug-resistant tuberculosis in a Department of Infectious
Diseases. Infection, Genetics and Evolution. 2003;85:82.
31. Portugal I, Brum L. Multidrug-resistant tuberculosis in Portugal: molecular characterization. 12th European
Congress of Clinical Microbiology and Infectious Diseases. Milo, Itlia; 2002. Poster.
32. Caminero JA, Sotgiu G, Zumla A, Migliori GB. Best drug treatment for multidrug-resistant and extensively
drug-resistant tuberculosis. Lancet Infect Dis. 2010;10(9):621-9.
33. Colditz GA, Brewer TF, Berkey CS, et al. Efficacy of BCG vaccine in the prevention of tuberculosis. Meta-
analysis of the published literature. JAMA. 1994;271:698-702.
V Seco
Captulo 5

Outras infeces bacterianas*


Kamal Mansinho

As infeces bacterianas, nos doentes com infeco por vrus da imunode-


ficincia humana (VIH), na era da teraputica antiretrovrica combinada
(TARVc) e dos avanos no diagnstico molecular das infeces, readquiri-
ram nova importncia, como resultado da sua frequncia crescente, da
emergncia/reemergncia de novos agentes, da maior facilidade de diagns-
tico e da sua gravidade potencial.
Dependendo do estdio evolutivo da infeco por VIH, da existncia
de doenas concomitantes (metablicas, tumorais), dos comportamentos
de risco [consumo de drogas ilcitas por via parentrica, multiplicidade de
parceiro(a)s sexuais], da idade (menores de 13 anos apresentam risco ele-
vado de infeces piognicas recorrentes), dos regimes teraputicos (neu-
tropenia induzida por antiretrovricos ou por quimioterapia antineoplsica)
e da existncia de prteses percutneas, para acesso intravascular, estes
doentes apresentam um elevado risco de desenvolver infeces bacterianas,
potencialmente mortais (Quadro 1)1.
Algumas destas infeces bacterianas so responsveis por doenas de-
finidoras de sida, tais como a septicemia recorrente a Salmonella notyphi
e a pneumonia bacteriana recorrente ( 2 episdios/ano) 2.
As perturbaes da imunidade celular, que se verificam nas fases avan-
adas da doena associada a VIH, predispem os doentes, sobretudo, ao
risco de desenvolvimento de infeces por bactrias intracelulares, tais como
Mycobacterium, Salmonella, Legionella, Listeria e Nocardia. As alteraes
da imunidade humoral, nomeadamente dos processos de cooperao entre
as clulas T e B, so responsveis pelo maior risco de infeces piognicas
por bactrias capsuladas, mesmo nas fases mais iniciais da infeco por
VIH.

*Nota do editor: Este captulo no foi actualizado em relao 3.a edio do Manual sobre sida (2008)
174
140 Kamal Mansinho
Kamal Mansinho
Olga Matos, Helena ngelo, Francisco Antunes
138 Kamal Mansinho

Quadro 1. Principais bactrias piognicas isoladas nos doentes com infeco por VIH

Bactrias Local de infeco

Gram positivo
Streptococcus pneumoniae Pulmo, seios perinasais, sangue
Staphylococcus spp Sangue, pulmo, pele, meninges,
Nocardia asteroides Pulmo, crebro
Rhodococcus equi Pulmo, sangue
Listeria monocytogenes Meninges, sangue
Gram negativo
Haemophilus influenzae Pulmo
Moraxella catarrhalis Pulmo
Legionella pneumophila Pulmo
Pseudomonas aeruginosa Pulmo, seios perinasais, urina, meninges
Escherichia coli e outras enterobactericeas Sangue, pulmo, urina
Salmonella spp Tubo digestivo, sangue
Shigella spp Tubo digestivo, sangue
Campylobacter spp Tubo digestivo, sangue
Clostridium difficile Tubo digestivo
Bordatella bronchoseptica Pulmo
Rochalimea spp Pele, sangue, rgos hematopoiticos
Espiroquetas
Treponema pallidum Pele, meninges, crebro
Outras
Mycoplasma pneumoniae Pulmo
Chlamydiae spp Pulmo

Em consequncia do alto risco de desenvolvimento das infeces bacte-


rianas nos doentes imunodeprimidos, o diagnstico precoce e a instituio de
Em consequncia
Em consequncia
tratamento doalto
do
antimicrobiano alto riscodededesempenham
risco
adequado desenvolvimento
desenvolvimento umdasdasinfeces
papel infeces nabacte-
crucial bacteria-
redu-
rianas
nas, nos
nos doentes
doentes imunodeprimidos,
imunodeprimidos, o o diagnstico
diagnstico precoce
precoce
o das elevadas taxas de mortalidade e das complicaes ps-infecciosas. ee aa instituio
instituio de
tratamento
tratamento
Contudo, antimicrobiano
antimicrobiano
vrios factores adequado
adequado
dificultam desempenham
desempenham
o diagnstico um
umdestas papel
papel infeces crucial
crucial nanestes na
redu-
reduo
o
doentes, das elevadas
das elevadas
factores nos taxas
taxas de
semortalidade
de mortalidade
quais incluem ea das e das complicaes
complicaes
natureza ps-infecciosas.
psinfecciosas.
inespecfica ou atpica das
Contudo, vrios
Contudo,
manifestaes vrios factores
clnicas, dificultam
a relativa oo diagnstico
diagnstico
insensibilidade destas
destas
e a baixa infeces
infeces,nestes
especificidade nes-
dos
doentes,
tes factores
doentes, nos
factores quais
nos se
quais incluem
se a
incluem natureza
a inespecfica
natureza ou
inespecfica
mtodos microbiolgicos convencionais e a emergncia de infeces causa- atpica
ou das
atpi-
manifestaes
ca
das das agentesclnicas,
pormanifestaes a relativa
clnicas,
patognicos no insensibilidade
a relativa at eento,
a baixa
insensibilidade
reconhecidos, e como especificidade
a baixa especifi-
causadores
dos mtodos
cidade dos microbiolgicos
mtodos
de patologia humana. convencionais
microbiolgicos e a
convencionaisemergncia
e a de infeces
emergncia de
infeces
causadas por causadas
agentespor agentes patognicos
patognicos no reconhecidos,
no reconhecidos, at ento, como at causa-
ento,
como causadores
dores de
Infeco patologia de patologia
humana.
do aparelho humana.
respiratrio
As infeces bacterianas do tracto respiratrio superior e inferior so fre-
Infeconosdodoentes
quentes aparelho respiratrio
infeco por VIH3, sendo responsveis por vrias
comrespiratrio
Infeco do aparelho
sndromes
As clnicas:
infeces bacterianas do tracto respiratrio superior e inferior so fre-
As a)infeces
quentes,Sndrome de condensao
nos doentes com infeco
bacterianas acompanhada, ou superior
VIH3, sendo
porrespiratrio
do tracto no, de bacteriemia.
responsveis por vrias
e inferior so
b) Opacidades
sndromes
frequentes clnicas:
nos intersticiais
doentes e/ou nodulares
com infeco por VIH3, difusas pouco evocadoras
sendo responsveis de
por vrias
infeco
1 por agentes
Sndrome
sndromas clnicas: depiognicos.
condensao acompanhada, ou no, de bacteriemia.
2 Opacidades intersticiais e/ou nodulares difusas pouco evocadoras
de infeco por agentes piognicos.
3 Bronquite ou sinusite recorrentes e prolongadas 4.
Outras
Outras infeces
infeces
Protozorios bacterianas
bacterianas
oportunistas e Pneumocystis 175
141
Outras infeces bacterianas 139

Quadro 2. Condensao pulmonar no Rx do trax. Diagnstico diferencial

Frequente Raro

Bactrias piognicas Nocardia asteroides


Cryptococcus neoformans M. tuberculosis
Sarcoma de Kaposi M. kansasii
B. bronchoseptica

c) Bronquite ou sinusite recorrentes e prolongadas4.


Nestes doentes, para alm dos agentes infecciosos responsveis pelas
Nestes doentes, para alm dos agentes infecciosos responsveis pelas
infeces oportunistas,
a) Sndroma tais comoacompanhada,
de condensao M. tuberculosis ou ouno,P.dejiroveci, as bactrias
bacteriemia.
infeces oportunistas, tais como M. tuberculosis ou P. jirovecii, as
piognicas, nomeadamente
b) Opacidades intersticiais S. pneumoniae,
e/ou nodulares H. difusas
influenzae
pouco e M. catarrhalis,
evocadoras de
bactrias piognicas, nomeadamente S. pneumoniae, H. influenzae e M.
representam as causas
infeco por agentes mais frequentes de pneumonia bacteriana adquirida
piognicos.
catarrhalis, representam as causas mais frequentes de pneumonia bac-
na comunidade,
c) Bronquite havendo
ou sinusite maior probabilidade
recorrentes e prolongadasde se4.estar perante infeco
teriana adquirida na comunidade, havendo maior5 probabilidade de se
por Nestes
S. aureus, nos doentes
doentes, parapor consumidores
alm dos agentes deinfecciosos
drogas ou responsveis
por P. aeruginosa,
estar perante infeco S. aureus, nos doentes consumidores
3 6 depelas
dro-
nos 5 doentes
infeces gravemente
oportunistas, imunodeprimidos
tais como M. (CD4
tuberculosis <ou100/mm
P. ) . as bactrias
carinii,
gas ou por P. aeruginosa, nos doentes gravemente imunodeprimidos
Menos + < frequentemente,
piognicas, nomeadamente microrganismos como R. equi, Nocardia spp e
(TCD4 100 cls/mm 3) 6.S. pneumoniae, H. influenzae e M. catarrhalis,
B. bronchoseptica
representam so, igualmente,
as causas mais frequentes responsveis
de pneumonia pelo desenvolvimento de
Menos frequentemente, microrganismos como R.bacteriana
equi, Nocardiaadquiridasppnae
leses atpicashavendo
comunidade, nodulares e/ouprobabilidade
cavitadas nosdepulmes.
B. bronchoseptica so,maiorigualmente, responsveis se estar
pelo perante infeco por
desenvolvimento de
S. Aproximadamente
aureus, nos doentes um tero dos doentes
consumidores de drogascom pneumocistose
5 ou por P. pulmonar
aeruginosa, nos
leses atpicas nodulares e/ou cavitadas nos pulmes.3 6
apresenta
doentes infeces simultneas
gravemente imunodeprimidos por bactrias
(CD4 < (micobactrias,
100/mm ). Legionella spp,
Aproximadamente, um tero dos doentes 7 com pneumocistose pulmonar
S. pneumoniae),
Menosinfeces vrus
frequentemente, (VCM) e fungos
microrganismos .
apresenta simultneas por bactriascomo R. equi, Nocardia
(micobactrias, Legionellaspp spp,
e B.
Nos doentes so,
bronchoseptica hospitalizados,
igualmente, S. aureus
responsveis7 resistentes
pelo meticilina, Staphylo-
desenvolvimento de leses
S. pneumoniae), vrus (VCM) e fungos .
coccus
atpicas coagulase negativo
nodulareshospitalizados,
e/ou e P. nos
cavitadas aeruginosa
pulmes. so os agentes, com mais fre-
Nos doentes S. aureus resistentes meticilina, Staphylo-
quncia, envolvidos
Aproximadamente nas pneumonias
um tero nosocomiais.
dos doentesso comospneumocistose
coccus coagulase negativo e P. aeruginosa agentes, com pulmonar
mais fre-
apresentaenvolvidos
quncia, infeces simultneas
nas pneumonias por bactrias
nosocomiais. (micobactrias, Legionella spp,
Diagnstico
S. pneumoniae), vrus (CMV) e fungos7.
Clinicamente,
Nos doentes oshospitalizados,
doentes apresentam S. aureus, febre, tosse com emisso
Staphylococcus coagulasedenegativo
expec-
Diagnstico
torao mucopurulenta,
e P. aeruginosa toracalgia
so os agentes, e, nafrequncia,
com mais auscultao pulmonar,
envolvidos nassinais
pneumo- de
consolidao
nias nosocomiais. (fervores crepitantes ou subcrepitantes).
Clinicamente, os doentes apresentam febre, tosse com emisso de expecto-
raoAsmucopurulenta,
alteraes pulmonares toracalgia radiolgicas so, com pulmonar,
e, na auscultao frequncia,sinais
atpicas, par-
de con-
ticularmante, nos doentes em estdio
solidao (fervores crepitantes ou subcrepitantes). avanado de imunodepresso, podendo
8:
Diagnstico
observar-se
As alteraesquatro pulmonares
diferentes padres radiolgicas so, com frequncia, atpicas,
a) Condensao
particularmante, nospulmonar
doentes em (diagnstico
estdio avanado diferencialde imunodepresso,
Quadro 2). po-
dendob) Derrame
Clinicamente,
observarse pleural
os doentes
quatro (diagnstico
apresentamdiferencial
diferentes : Quadro
febre, 8tosse
padres com emisso3). de expecto-
c)
rao
1 Leses cavitadas
mucopurulenta,
Condensao (diagnstico
toracalgia
pulmonar diferencialdiferencial
e,(diagnstico
na auscultao pulmonar,
Quadro4) sinais
Quadro de consoli-
2).
d)
dao Radiograma
(fervores do trax
crepitantes ou normal (pneumocistose,
subcrepitantes).
2 Derrame pleural (diagnstico diferencial Quadro 3). tuberculose, criptoco-
cose,3 Asinfeco
Lesespor
alteraes MAC). (diagnstico
pulmonares
cavitadas radiolgicas so, com frequncia,
diferencial Quadro 4) atpicas, parti-
Tal
cularmante,como nos
4 Radiograma doentes
nos doentes do em imunocompetentes,
traxestdio
normal avanado o diagnstico
de imunodepresso,
(pneumocistose, de
tuberculose, pneumonia
podendo
cripto-
bacteriana
observar-se baseia-se em
quatroinfeco
cocose, diferentescritrios
porpadresclnicos,
8 :
Mycobacterium microbiolgicos e radiolgicos.
avium complex [MAC]).
Ainda
Tal como que nos
a) Condensao o exame
doentes mais
pulmonar sensvel
imunocompetentes,
(diagnstico e mais especfico
o diagnstico
diferencial para ade
- Quadro identificao
2). pneumonia
do agente
bacteriana
b) Derrame etiolgico
baseiase
pleural seja
em a colheita
critrios
(diagnstico de secrees
clnicos,
diferencial brnquicas
microbiolgicos
- Quadro distais ou o
3). e radiolgicos.
microlavado
Ainda
c) Leses quebroncoalveolar, maiso sensvel
o exame(diagnstico
cavitadas examediferencial
directo
e maise especfico,
-a Quadro
cultura 4).
dapara
expectorao,
a identifica- as
o do agente etiolgico, seja a colheita de secrees brnquicas distais
ou o microlavado broncoalveolar, o exame directo e a cultura da expec-
torao, as hemoculturas e a cultura do lquido pleural, antes do incio da
176 Kamal Mansinho
140
142 KamalMansinho
Olga Matos, Helena ngelo, Francisco
Kamal Mansinho
Antunes

Quadro 3. Derrame pleural no Rx do trax. Diagnstico diferencial

Frequente Raro

Bactrias piognicas (S. aureus, S. pneumoniae, P. aeruginosa) Rhodococcus equi


M. tuberculosis Histoplasma spp
Sarcoma de Kaposi Linfoma
Cryptococcus neoformans Leishmaniose
Hipoalbuminemia MAC
Embolia sptica Nocardia
Insuficincia cardaca P. jirovecii
Aspergillus spp Coccidioidomicose

Quadro 4. Leso cavitada no Rx do trax. Diagnstico diferencial

Frequente Raro

M. tuberculosis Legionella pneumophila


P. aeruginosa P. jirovecii
Klebsiella spp Linfoma
S. pneumoniae MAC
S. aureus
Bactrias anaerbias
M. kansasii
Cryptococcus neoformans
Histoplasma
Aspergillus spp
Rhodococcus equi
Nocardia asteroides
Aspergilose
Coccidioidomicose

hemoculturas e a cultura do lquido pleural, antes do incio da antibioterapia,


d) Radiograma
antibioterapia,
permitem do trax
permitem
a caracterizao normal de
aetiolgica (pneumocistose,
caracterizao uma etiolgica detuberculose,
uma das
parte importante criptoco-
partepneumonias
importan-
cose, infeco
te das pneumonias
adquiridas por MAC).
adquiridas na comunidade.
na comunidade.
Tal como
Perante nos doentes
a suspeita imunocompetentes,
de pneumonia causada por o diagnstico
bactrias dode pneumonia
gnero Chla-
bacteriana
mydiae, baseia-se emLegionella
Mycoplasma, critrios clnicos, microbiolgicos
e Coxiella, e radiolgicos.e de
as tcnicas inmunolgicas
Ainda quemolecular,
amplificao o exame mais sensvel
efectuadas a epartir
maisdo especfico para a identificao
soro, expectorao, urina e
do agente
sangue etiolgico
perifrico, seja a colheita
permitem de secrees
diagnosticar brnquicas distais ou o mi-
estes agentes.
cro-lavado broncoalveolar, o exame directo e a cultura da expectorao, as
hemoculturas e a cultura do lquido pleural, antes do incio da antibioterapia,
Tratamento
permitem a caracterizao etiolgica de uma parte importante das pneumonias
adquiridas
Uma vez na comunidade.
vezexcludos
excludos osos critrios
critrios de gravidade
de gravidade (paO2(paO < 60 mmHg,
< 602 mmHg, mau geral,
mau estado esta-
Perante
do geral,
imunodepresso a suspeita
imunodepresso de pneumonia
grave, idade,grave, causada
idade,
comorbilidades por bactrias
comorbilidades
associadas, do gnero
associadas,
infeco infeco
Chlamy-
nosocomial) o
nosocomial)
poderoserdoente
diae, Mycoplasma,
doente poder
Legionella
tratado em regimeser tratado
e Coxiella, em
ambulatrio. regime ambulatrio.
a seroimunologia
A antibioterapia A antibio-
eemprica
as tcnicas de
dever
terapia emprica
amplificao
privilegiar dever
molecular,
a cobertura privilegiar
de S.efectuadas
pneumoniae aa cobertura
partir
e de H. de S. expectorao,
pneumoniae
do influenzae,
soro, eurina
de H.e
estando indicados,
influenzae,
sangue
em estando
perifrico,
primeira indicados,
permitem
linha, os em primeira
diagnosticar
antibiticos linha, os
estes agentes.
betalactmicos antibiticos
ou os macrlidos. betalact-
micos ou os macrlidos.
O doente dever ser observado s 4872 h, aps a instituio da tera-
putica antibitica, para, em caso de evoluo desfavorvel, se ponderar o
Outras infeces bacterianas 177

internamento hospitalar para reavaliao clnica, laboratorial e microbiol-


gica e para reviso, eventual, do tratamento antibitico (quinolona ou cefa-
losporina de 3 gerao).
A durao do tratamento antibitico est mal definida, preconizandose,
em mdia, 10 dias de teraputica, podendo ser mais longo, nos casos de
recidiva ou quando associados a focos de infeco ORL persistentes.
Bacteriemia e septicemia
Nos doentes com infeco por VIH, o risco de bacteriemia e de septicemia
mais elevado do que na populao no infectada por este vrus 9, atingin-
do valores mximos nos doentes consumidores de drogas por via parent-
rica, nos doentes com neutropenia grave (<500 neutrfilos/mm 3), hospitali-
zados e nos portadores de dispositivos para acesso intravascular.
Os agentes envolvidos, com mais frequncia, incluem S. pneumoniae,
H. influenzae, S. aureus, S. epidermidis, Salmonella notyphi e P. aerugi-
nosa.
Entre os agentes acima referidos, tendo em ateno a elevada frequncia
de doentes consumidores de drogas por via parentrica e de portadores de
dispositivos para acesso vascular central, deve prestarse particular ateno
bacteriemia estafiloccica, bem como s suas localizaes metastticas
em outros rgos, provocando, nomeadamente, endocardite, sobretudo da
vlvula tricspida, espondilodiscite, artrite e manifestaes neurolgicas.
Por sua vez, verificase aumento da incidncia das infeces a P. aeru-
ginosa, nos doentes com sida, no se observando nestes os habituais facto-
res de risco associados infeco por este agente10. As recidivas frequentes
e a elevada taxa de mortalidade exigem elevado ndice de suspeio clnica e
a instituio precoce de antibioterapia.
Diagnstico e tratamento
A marcha do diagnstico e os critrios de instituio de antibioterapia em-
prica, aps colheita dos produtos biolgicos para culturas em meios ade-
quados, no diferente da adoptada para os doentes imunocompetentes,
com diagnstico de septicemia.
O tratamento preconizado para a endocardite aguda da vlvula trics-
pida, no complicada, nos consumidores de drogas por via parentrica
inclui a associao de dicloxacilina com um aminoglicosdeo, durante, pelo
menos, duas semanas. Num estudo j publicado, a associao de um ami-
noglicosdeo com a cloxacilina no mostrou benefcios adicionais, quando
comparada com a administrao isolada de cloxacilina11.
Infeces entricas
Na era da TARVc, a incidncia dos protozorios, como causa mais frequen-
te de diarreia nos doentes com sida, diminuiu significativamente 12.
As infeces bacterianas entricas mais frequentes so causadas por
Salmonella spp, Shigella spp, Campylobacter spp, C. difficile, complexo
Mycobacterium avium e E. coli enteropatognica13.
178 Kamal Mansinho

Nos imunodeprimidos, estas bactrias so responsveis por quadros de


diarreia prolongada ou recidivante, por vezes grave e, em algumas circuns-
tncias, associada a bacteriemia14.

Diagnstico e tratamento
A coprocultura efectuada em, pelo menos, trs amostras de fezes, a pesquisa
de citotoxina de C. difficile, quando se suspeita de colite pseudomembranosa,
as hemoculturas, inclusive para micobactrias, o exame parasitolgico das
fezes, quando se suspeita de etiologia parasitria e a rectosigmoidoscopia
permitem identificar o agente etiolgico da diarreia em, aproximadamente,
5080% dos doentes15.
Nos doentes em que foi possvel identificar a bactria responsvel, o tra-
tamento dever ser orientado em funo da sensibilidade do agente isolado.
De acordo com as bactrias entricas envolvidas, os principais antibi-
ticos recomendados para o tratamento so16:
1 Salmonella spp: Ciprofloxacina 500750 mg p.o. 2/dia, durante
14 dias. Os frmacos alternativos incluem cotrimoxazol, ampicili-
na, cefalosporinas de 3 gerao e cloranfenicol.
2 Shigella spp: Ciprofloxacina 500 mg p.o. 2/dia, durante trs dias
ou cotrimoxazol ou, ainda, ampicilina. Os agentes antiperistlticos,
como a loperamida e o difenoxilato, esto contraindicados.
3 Campylobacter spp: Eritromicina 500 mg p.o. 4/dia, durante cinco
dias ou ciprofloxacina 500 mg p.o. 2/dia, durante trs a cinco dias.
4 C. difficile: Metronidazol 250500 mg p.o. 4/dia, durante 10 a 14 dias,
ou vancomicina por via oral.

Outras localizaes e outros agentes


Sinusite recidivante: As sinusites bacterianas crnicas, ou recidivantes, so
muito frequentes nos doentes em estdio avanado de imunodepresso 17,
representando uma causa importante das infeces broncopulmonares.
A antibioterapia emprica prolongada (trs semanas) e dirigida para os
agentes mais frequentes, entre os quais S. pneumoniae e H. influenzae,
contribui para a resoluo clnica da maior parte dos casos. Nas situaes
em que o tratamento antibitico no suficiente para a resoluo das quei-
xas deve ser ponderada a drenagem sinusal ou a meatotomia.
Angiomatose bacilar18: Infeco causada por bacilos do gnero Barto-
nella (B. quintana, agente da febre das trincheiras, e B. henselae, agente da
febre da arranhadela do gato) caracterizase, clinicamente, pela presena de
ndulos cutneos angiomatosos, em nmero varivel com, aproximadamen-
te, um a cinco cm de dimetro, podendo envolver as mucosas oral, anal ou
o tracto gastrintestinal, com manifestaes sistmicas, nomeadamente febre,
peliose heptica, hepatite, leses sseas e sndrome pleuropulmonar.
O diagnstico diferencial das leses cutneas inclui, fundamentalmente,
sarcoma de Kaposi, granuloma piognico e carcinoma espinocelular.
Outras infeces bacterianas 179

O diagnstico assenta na suspeio clnica, na demonstrao dos bacilos


intracelulares na biopsia das leses (pele e fgado) e nos resultados da se-
rologia e das tcnicas de amplificao molecular.
A eritromicina, na dose de 500 mg p.o. 4/dia ou a doxiciclina 100 mg
p.o. 2/dia so os frmacos de eleio. Ainda que a durao do tratamento
no esteja, claramente, definida, recomendase que o mesmo seja prolonga-
do, abrangendo um perodo no inferior a oito semanas.
Rhodococcus equi19: Bactria intracelular, pleomrfica, Grampositivo,
responsvel por quadros de pneumopatia nodular, muitas vezes com cavita-
o, simulando tuberculose, podendo, tambm, causar abcesso cerebral,
osteomielite e bacteriemia.
Embora o tratamento no esteja estabelecido em definitivo, a associao
de um macrlido com a rifampicina ou com a vancomicina, cido fusdico
e imipenem, durante vrios meses, so alguns frmacos preconizados.
Nocardia e Actinomiceta20: Sendo responsveis por infeces nos do-
entes com deficincias da imunidade celular, so agentes raros causadores
de pneumonia, abcessos cerebrais, infeces localizadas na pele e, mais
raramente, osteomielite, pericardite e endoftalmite.
O diagnstico assenta na identificao do agente, atravs da colorao
de ZiehlNeelsen modificada e da cultura da expectorao ou das secrees
brnquicas.
O frmaco aconselhado para tratamento a sulfadiazina, na dose de seis
a oito g p.o./dia ou cotrimoxazol, em doses elevadas. As cefalosporinas
de 3 gerao e o imipenem inibem o crescimento bacteriano in vitro e, em
alguns modelos experimentais, verificouse sinergismo de aco com a as-
sociao cotrimoxazol e imipenem.

Nota final
As infeces bacterianas continuam a ser uma importante causa de morbili-
dade e de mortalidade nos doentes com infeco por VIH, apesar do impac-
to verificado com as actuais estratgias de tratamento antiretrovrico.
O risco de desenvolvimento de infeces bacterianas, potencialmente
mortais, depende de vrios factores, entre os quais o estdio imunitrio do
hospedeiro e a virulncia do agente envolvido.
O diagnstico precoce e a rpida instituio da teraputica antiinfeccio-
sa so determinantes para a reduo da mortalidade e das complicaes
psinfecciosas.
As principais limitaes no diagnstico inicial destas infeces resultam
da inespecificidade da maior parte dos quadros clnicos e da relativa baixa
sensibilidade e especificidade dos mtodos convencionais de diagnstico
microbiolgico.
Tendo em ateno as limitaes referidas, a teraputica antiinfecciosa
emprica precoce, aps a colheita dos produtos orgnicos para a investigao
microbiolgica, dever ser considerada, apesar dos riscos cumulativos de
toxicidade e das interaces medicamentosas.
180 Kamal Mansinho

Bibliografia
1. Astagneau P, Maslo C. Em: Girard PM, Katlama C, Pialoux G. SIDA. Ed. 1998. Ed. DOIN 1998:241-51.
2. Annimo. 1993. Revised classification system for HIV infection and expanded surveillance case definition for
AIDS among adolescents and adults. MMWR 1992;41(RR-17).
3. Hirschtick R, Glassroth J, Jordan M, et al. Bacterial pneumonia in persons infected with the human immunode-
ficiency virus. N Engl J Med 1995;333:845-51.
4. Wallace J, Hansen N, Lavange L, et al. Respiratory disease trends in the pulmonary complications of HIV infec-
tion study cohort. Am J Respir Critic Care Med 1997;155:72-80.
5. Pina J. Complicaes pulmonares infecciosas no tuberculosas da infeco HIV. Em: Infeco pelo HIV e pulmo.
1992:55-80.
6. Shuster MG, Norris AH. Community acquired Pseudomonas aeruginosa pneumonia in patients with HIV infec-
tion. AIDS 1994;8:1437-41.
7. Hanan M. Bacterial infections. Em: Gazzard B. Chelsea & Westminster Hospital AIDS Care handbook. Edited
by B. Gazzard 1999;2.1:45-56.
8. Bartlet JG, Gallant JE. Differential diagnosis of pulmonary complications based on X-ray findings. Em: Medi-
cal management of HIV infection. Baltimore, Maryland: Johns Hopkins University School of Medicine 2000-
2001:305.
9. Moore RD, Keruly JC, Chaisson RE. Neutropenia and bacterial infection in acquired immunodeficiency syndrome.
Arch Intern Med 1995;155:1965-70.
10. Dropulick LK, Leslie JM, Eldred LJ, et al. Clinical manifestations and risk factors of Pseudomonas aeruginosa
in patients with AIDS. J Infect Dis 1995;171:930-7.
11. Ribera E, Gmez-Jimnez J, Corts E, et al. Effectiveness of cloxacilin with and without gentamicin in short-
term therapy for right-sided Staphylococcus aureus endocarditis. A randomized, controlled trial. Ann Intern Med
1996;125:969-74.
12. Derouin F, Gangeux J-P. Changing patterns of disease and treatment of opportunistic parasitic infections in
patients with AIDS. Curr Opin Infect Dis 1998;11:711-6.
13. Dupont HL, Marshall GD. HIV associated diarrhoea and wasting. Lancet 1995;346:352-6.
14. Sharpstone D, Gazzard B. Gastrointestinal manifestations of HIV infection. 1996;348:379-83.
15. Mayer HB, Wanke CA. Diagnostic strategies in HIV-infected patients with diarrhoea. AIDS 1994;8:1639-48.
16. Bartlet JG, Gallant JE. Acute infectious diarrhea in patients with AIDS. Em: Medical management of HIV infec-
tion. Baltimore, Maryland: Johns Hopkins University School of Medicine 2000-2001:324.
17. Small CB, Kaufman A, Armenaka M, et al. Sinusitis and atopy in human immunodeficiency virus infection. J
Infec Dis 1993;167:283-90.
18. Mohle-Botani JC, Koehler JE, Berger TG, et al. Bacillari angiomatosis and bacillary peliosis in patients infected with
human immunodeficiency vires: clinical characteristics in a case-control study. Clin Infect Dis 1996;22:794-800.
19. Messias A, Arajo C, Lino S, et al. Condensao pulmonar cavitada por Rhodococcus equi, num indivduo
seropositivo para VIH. Acta Mdica Portuguesa 2000;13:329-35.
20. Podzamczer D, Santn M, Martnez-Lacasa R, et al. Tratamiento de las infecciones ms frequentes en pacientes
con SIDA. Em: Gatell JM, Clotet B, Podzamczer D, et al. Gua prctica del SIDA. 5 ed. Publicaciones Masson
1998:326.
V Seco
Captulo 6

Infeces por vrus herpes*


Isabel Aldir

Desde o incio da epidemia da infeco por vrus da imunodeficincia hu


mana (VIH), nos anos 801, que as infeces vricas tm sido entidades
importantes de morbilidade e mortalidade, particularmente as causadas por
vrus ADN, na maioria pertencendo famlia Herpesviridae.
Um aspecto partilhado por todos os vrus herpes a capacidade de, aps
a infeco primria, permanecerem latentes para, eventualmente, se reactivarem
a posteriori2. Esta caracterstica explica o seu sucesso ecolgico, o qual se
traduz na sua presena na maioria dos animais desde tempos longnquos.
Apesar destes aspectos comuns, cada uma das subfamlias e espcies tm
caractersticas que lhe so prprias; por exemplo, a subfamlia Gammaherpes-
virin parece ter papel oncognico no hospedeiro, desconhecido at ao mo-
mento nas duas outras subfamlias (Alphaherpesvirin e Betaherpesvirin).
Os estudos seroepidemiolgicos mostram que os vrus herpes so, prati
camente, universais na populao, especialmente na populao em risco para
a infeco por VIH, ocorrendo a primoinfeco na infncia ou no incio
da adolescncia, excepto nos casos dos vrus herpes simplex tipo 2 e vrus
herpes humano tipo 835.
Daqui a sua importncia como patognicos, a considerar no doente com
infeco por VIH, reconhecendose, actualmente, quadros clnicos associados
a, pelo menos, seis dos oito vrus herpes humanos conhecidos.
O quadro 1 lista os oito vrus herpes humanos e o espectro de doenas
a eles associadas.

Herpes simplex 1 e 2
As infeces por vrus herpes simplex tipo 1 (VHS1) e vrus herpes sim-
plex tipo 2 (VHS2) so frequentes, apresentam distribuio mundial e

*Nota do editor: Este captulo no foi actualizado em relao 3.a edio do Manual sobre sida (2008)
182 Isabel Aldir

Quadro 1. Sndromes clnicas das infeces herpticas, no doente com infeco por VIH
Subfamlia Gnero e espcie Sndromes clnicas
Alphaherpesvirinae Herpes simplex 1 Ulceraes orolabiais
Herpes simplex 2 Ulceraes anogenitais, encefalite,
esofagite, hepatite
Vrus da varicela-zster Varicela, zona, infeco disseminada,
pneumonia, encefalite, hepatite, necrose
da retina
Betaherpesvirinae Vrus citomeglico Retinite, esofagite, colite, colangite,
HERPESVIRIDAE

hepatite, pneumonia, encefalite,


polirradiculopatia, adrenalite
Vrus herpes humano 6 Retinite (?), pneumonia intersticial (?),
aumento da replicao de VIH (?)
Vrus herpes humano 7 ?
Gammaherpesvirinae Vrus Epstein-Barr Tricoleucoplasia, linfoma de Hodgkin e
no-Hodgkin, pneumonia intersticial
linfide (criana)
Vrus herpes humano 8 Sarcoma de Kaposi, linfoma primrio
das serosas, doena de Castleman
multicntrica

caracterizamse pela primoinfeco ser assintomtica ou subclnica. VHS1,


com transmisso predominante na infncia e atravs do contacto com secre
es salivares e membranas mucosas, causa, fundamentalmente, leses orais
mucocutneas. VHS2, com transmisso sexual e com prevalncia estimada
em 20% nos pases desenvolvidos e 60% nos em vias de desenvolvimento,
manifestase com leses anogenitais6.
Dadas as elevadas prevalncias, as primoinfeces por VHS ocorrem,
em regra, antes da infeco por VIH e, tal como se verifica com as outras
doenas de transmisso sexual, a presena de infeco activa por VHS2
aumenta, em cerca de trs vezes, a probabilidade de contgio por VIH, sen
do, mesmo, um factor de risco independente79. H, pelo menos, trs impor
tantes mecanismos para o aumento da transmisso da infeco por VIH:
1 As lceras genitais herpticas causam inflamao local e disrupo
da mucosa, o que facilita a entrada de VIH durante a exposio a
fluidos genitais infectados10.
2 As lceras genitais por VHS2 levam a um aumento selectivo do
recrutamento local de clulas CD4+, que podem servir de alvo para
VIH11.
3 possvel a replicao de vrus competentes em leses causadas
por VHS212.
Tal como se verifica na populao em geral, a frequncia e gravidade
das reactivaes de VHS apresentam grande variabilidade, estando, no entan-
to, relacionadas com o grau de imunodepresso13,14. Consoante se assiste ao
agravamento da imunidade, as leses herpticas tornamse mais frequentes,
Infeces por vrus herpes 183

mais extensas e dolorosas, surgem em outras localizaes e melhoram mais


lentamente. Tal levou, em 1987, o Centers for Disease Control a considerar
a existncia de leses herpticas, com mais de um ms de durao, um dos
critrios definidores de sida.
Se certo que as alteraes da imunidade, desencadeadas por VIH,
modificam a expresso de VHS, o mesmo no se pode dizer de VHS en-
quanto cofactor na infeco por VIH, havendo estudos que apontam nas
duas direces1519.
Embora as leses mucocutneas sejam as mais frequentes, pode haver
disseminao para diversos rgos, incluindo esfago, retina, pulmo, en-
cfalo e espinal medula, entre outros.
Em regra, com a colheita dos dados anamnsicos e com a observao
das leses, conseguese o diagnstico, o qual pode ser confirmado com o
recurso ao teste de Tzanck, polimerase chain reaction (PCR) ou cultu-
ra vrica. Nas leses cutneas atpicas ou no envolvimento visceral deverse
proceder ao exame histolgico e cultural dum fragmento de biopsia.
A teraputica das leses mucocutneas fundamentase no aciclovir 200 mg
cinco vezes ao dia, ou no valaciclovir 500 a 1.000 mg duas vezes ao dia,
por um perodo de sete a 10 dias.
Embora certos autores defendam o uso de aciclovir profilctico, na
dose de 600 a 1.000 mg/dia, quando se verificam mais de seis recorrn-
cias herpticas por ano, em indivduos com profunda imunodepresso
(TCD4+ < 100 cls/mm3), o seu uso controverso, uma vez que suspensa
esta profilaxia a incidncia das recorrncias mantmse inalterada e po-
derse estar a contribuir para o aparecimento de resistncias. Se iniciada
a profilaxia, deve ser continuada, indefinidamente, ou at melhoria do es-
tdio imunitrio (TCD4+ > 350 cls/mm3)20. Em geral, uma dose nica
diria no eficaz, dado que os nveis sricos adequados no so mantidos;
o valaciclovir , igualmente, eficaz na supresso de infeco genital recor-
rente, na dose de 500 mg de 12/12 horas.
No caso de envolvimento cutneo disseminado ou visceral, a terapu-
tica indicada com aciclovir cinco mg/kg de 8/8 h, por via e.v., durante
sete a 21 dias. No envolvimento neurolgico, a dose de 10 mg/kg de 8/8 h,
e.v., por 1421 dias.
A resistncia ao aciclovir, habitualmente causada por deficincia em
timidinoquinase, uma complicao importante nos doentes com infeco
por VIH, parecendo o seu risco aumentar, consoante a durao das leses
herpticas e o valor dos linfcitos TCD4+ (aumento do risco para valores
inferiores a 50 cls/mm3)21,22. Aps a cura duma leso resistente, as recorrn
cias subsequentes podem ser sensveis ao aciclovir, uma vez que a popu-
lao vrica original, ganglionar, no deficitria em timidinoquinase. As
leses de VHS, resistentes ao aciclovir, so mais frequentes na regio
perianal e, raramente, disseminam, devendose suspeitar, quando no se
assiste a uma boa resposta sob a teraputica indicada. Por vezes, com doses
mais elevadas de aciclovir, por via oral ou endovenosa, conseguese obter
resposta favorvel. O valaciclovir, ao necessitar de ser, igualmente, fosforila-
184 Isabel Aldir

do intracelularmente, no uma alternativa vlida, a qual representada pelo


foscarnet. O foscarnet inibe a ADNpolimerase especfica de VHS, no ne-
cessitando de fosforilao. A dose de 40 mg/kg 8/8 h, ev., por 1024 dias,
obrigando higiene dos rgos genitais cuidada e vigilncia da funo
renal, nveis de magnsio e clcio e, ainda, do aparecimento de convulses
(principais toxicidades). O cidofovir, tambm, mostrou ser eficaz para as
situaes de resistncia ao aciclovir23.

Vrus citomeglico
As infeces por vrus citomeglico (VCM) so endmicas, ocorrendo ao
longo de todo o ano, podendo a sua transmisso processarse por via oral,
respiratria, sexual, transfuso de sangue nodesleucocitado, transplantao
de rgos e por via vertical, isto , da me para o filho. A percentagem de
adultos com anticorpos antiVCM alta, estando estimada em 90% na
populao homossexual e 80% nos dependentes de drogas por via endove-
nosa24.
De forma semelhante ao que sucede com os outros vrus herpes, aps a
infeco primria, VCM permanece latente, particularmente, nos precursores
da medula ssea e nos leuccitos do sangue perifrico 25,26.
Nos indivduos com infeco por VIH, a perda progressiva da imunida-
de em particular da imunidade celular permite que a replicao de VCM
se inicie, sendo as manifestaes clnicas mais frequentes em localizao
ocular, no aparelho gastrintestinal e no sistema nervoso central.
A retinite por VCM a apresentao clnica mais frequente desta infec-
o nos doentes com sida, no obstante a sua incidncia ter diminudo em
80%, desde a introduo da teraputica antiretrovrica combinada (TARVc).
Apresentase por diminuio da acuidade ou do campo visual, escotomas,
viso turva ou sensao de dor, e ocorre, quase exclusivamente, quando a
contagem de TCD4+ inferior a 50 cls/mm3. No entanto, o diagnstico
no deve ser excludo, tendo por base, apenas, a contagem de TCD4+, po-
dendo surgir com contagens mais elevadas, no contexto de recuperao
imunitria27. A fundoscopia revela exsudados perivasculares algodonosos e
hemorrgicos focais (Foto 16). No tratada, evolui, num espao de semanas
a meses, para a cegueira. Embora a doena se possa apresentar unilateral
mente, a retinite , com frequncia, manifestao de doena sistmica e o
envolvimento do outro olho ocorre com frequncia. As leses iniciais, ao
serem perifricas, no condicionam sintomas, e da a importncia de se fa
zerem fundoscopias de rotina aos doentes em risco, pese embora tal prtica
no ser unnime. Sendo um exame incuo para o doente e de fcil execu-
o tcnica, a sua realizao deveria fazer parte do exame de rotina, pois
para alm de se excluir retinite por VCM, poderseo excluir, de igual for
ma, outras doenas com expresso ocular, com as quais se faz o diagns-
tico diferencial, nomeadamente com a toxoplasmose ocular, tuberculose,
sfilis e infeces por VHS ou por vrus da varicela zster. A presena de
anticorpos para VCM no til em termos de diagnstico, e a serologia
Infeces por vrus herpes 185

negativa no permite excluir o diagnstico, uma vez que em fases avanadas


de imunodepresso podese assistir a uma serorreverso (de anticorpo po
sitivo para anticorpo negativo)28. A antigenemia para VCM permite a de
teco rpida de protenas do vrus nos leuccitos do sangue perifrico,
sendo o valor expresso em nmero de clulas infectadas, por nmero total
de clulas. Nos doentes imunodeprimidos, a antigenemia correlacionase
com a viremia, passvel de ser determinada, atravs de tcnicas de biologia
molecular. A presena de VCM, no sangue, um factor de risco para o
desenvolvimento de retinite, nos doentes com sida29.
Embora a retinite represente 80% das manifestaes por VCM no doen-
te com infeco por VIH, at 1/5 dos doentes, em fase avanada da sida,
apresentam manifestaes gastrintestinais. De entre elas, as mais frequentes
so a colite com diarreia aquosa profusa, hematoquesias, dores abdominais,
anorexia, febre e emagrecimento e a esofagite, com dor retrosternal, dis-
fagia, febre e emagrecimento. O diagnstico destas situaes passa pela
realizao de exames endoscpicos, com biopsia. No caso da colite, a co-
lonoscopia pode ser normal em 25% dos casos, apresentar lceras da mu-
cosa com hemorragias limitadas ao cego e ao clon esquerdo ou, ainda, ser
difusa30. Na endoscopia digestiva alta, o esfago pode mostrar lceras gran-
des, terminais, com sobreinfeco a Candida spp. Para se estabelecer o
diagnstico, devemse documentar as incluses intracelulares caractersticas
de VCM e excluir a presena de outros agentes patognicos. O exame cul-
tural da biopsia no til para diagnstico, pois, na maioria das vezes,
negativo e, se positivo, pode ser por contaminao sangunea no acto da
biopsia.
As manifestaes neurolgicas mais frequentes so a encefalite, a po-
lirradiculopatia e a mielite. A encefalite manifestase por alteraes do
comportamento e da personalidade, demncia, cefaleias e convulses,
entrando em diagnstico diferencial com a encefalopatia por VIH. O diag-
nstico confirmado por biopsia ou por PCR de VCM no lquido cefa-
lorraquidiano (LCR), com boa sensibilidade e especificidade para a infec-
o do sistema nervoso central 31. A radiculomielite apresentase com
diminuio da fora muscular nos membros inferiores, hipostesia, arrefle-
xia, espasticidade e incontinncia/reteno urinria. O exame citoqumico
do LCR no conclusivo, mostrando discreta pleocitose de predomnio
polimorfonuclear e hipoglicorraquia, sendo o diagnstico feito por PCR
de VCM, no LCR. A teraputica essencial, embora com eficcia desco-
nhecida.
Muito embora a identificao de VCM seja frequente, em produtos bio-
lgicos colhidos por broncoscopia de doentes com pneumocistoses, a melho
ria clnica e radiolgica s com teraputica para Pneumocystis jirovecii
indica que VCM no tem papel patognico nestas situaes 32,33. No entan-
to, este diagnstico deve ser admitido quando, aps excluso de outras
causas, se assiste ao agravamento dum quadro de pneumonia intersticial,
com hipoxemia, febre, polipneia, tosse irritativa, sem grande traduo aus-
cultatria.
186 Isabel Aldir

As opes teraputicas para tratamento de induo e de manuteno so


o ganciclovir, o valganciclovir (o ster valina do ganciclovir)34, o foscarnet
e o cidofovir, inibidores da ADNpolimerase de VCM. Os frmacos de pri
meira escolha so o valganciclovir (900 mg de 12/12 h, durante duas a trs
semanas) e o ganciclovir (dose de induo de cinco mg/kg 12/12 h, duran-
te duas a trs semanas ou at estabilizao; dose de manuteno de uma
administrao/dia), uma vez que so de fcil administrao e as suas maio-
res toxicidades, a anemia e a neutropenia, so facilmente monitorizadas e
controladas. O foscarnet (dose de induo de 90 mg/kg 12/12 h, durante
duas a trs semanas ou at estabilizao; dose de manuteno de uma
administrao/dia) uma boa alternativa, nos casos de neutropenia refrac-
tria, sendo activo contra as estirpes resistentes ao ganciclovir e tendo a
vantagem de ter aco antiretrovrica sobre a transcriptase reversa de VIH,
podendo actuar de forma sinrgica, com a teraputica antiretrovrica35. A
maisvalia do cidofovir (dose de induo de cinco mg/kg por semana, du-
rante duas semanas; dose de manuteno de administraes quinzenais)
sobre os outros frmacos a comodidade posolgica, com uma nica ad-
ministrao semanal na fase da induo; tal como o foscarnet, a nefrotoxi-
cidade a ele associada, embora menos frequente se, concomitantemente, for
administrado probenecid, limita por vezes o seu uso. O uso de teraputica
combinada de ganciclovir e foscarnet (cinco mg/kg/dia e 90 mg/kg/dia,
respectivamente) til nos casos graves e evolutivos, atrasando a progresso
da retinite, quando comparado com a monoterapia36. A teraputica intravtrea
permite concentraes locais mais elevadas e mantidas, sem efeitos acess-
rios sistmicos, sendo bem tolerada; no entanto, est associada com aumen-
to do risco de descolamento da retina e de endoftalmite e no protege
contra a retinite contralateral, nem contra a doena sistmica. Assim, a sua
utilizao no dispensa a prescrio de teraputica sistmica (por exemplo
com ganciclovir oral), estando esta estratgia mais indicada para os doentes
com leses de maior risco (leses a uma distncia < 1.500 micra da fvea
ou adjacente ao nervo ptico).
A profilaxia secundria processase, actualmente, com valganciclovir
(900 mg/dia) ou com ganciclovir oral (trs g/dia), podendo a sua suspenso
ser considerada se os linfcitos TCD4+ se mantiverem em valores estveis,
acima das 150 cls/mm3 e dependendo da supresso do VIH, da localizao
das leses iniciais e do grau de perda de viso37.
No tratamento das infeces extraoculares, os frmacos e doses so os
mesmos, devendo considerarse a teraputica de manuteno, particularmen-
te quando existe leso do sistema nervoso central.

Vrus da varicelazster
Vrus da varicelazster (VVZ) ubiquitrio, com prevalncia de 90% na
populao em idade escolar, causando duas situaes clnicas comuns, a
varicela e a zona. Dada a elevada prevalncia, a infeco primria por VVZ
rara no doente com infeco por VIH. A sua traduo clnica habitual
Infeces por vrus herpes 187

a varicela que, se na criana imunocompetente representa uma situao


benigna, no imunocomprometido pode ter evoluo fatal em 714% dos
casos, devendo ser tratada com teraputica antivrica, com aciclovir endo-
venoso, mesmo que j tenham passado mais de 24 horas, desde o incio
dos sintomas38. Esta potencial evoluo devese provvel disseminao,
com risco de pneumonite, hepatite, encefalite e vasculite hemorrgica
cutnea. Na ausncia de antecedentes de varicela, os infectados por VIH
devem, por isso, evitar possveis exposies e, caso ocorram, iniciar tera-
putica de imediato39. VVZ , intrinsecamente, menos susceptvel ao
aciclovir, comparativamente a VHS; para se obter uma percentagem ini-
bitria de 50% da replicao de VVZ, necessria uma dose de aciclovir
10 vezes maior que a necessria para conseguir o mesmo efeito sobre
VHS40.
A imunoglobulina especfica para VVZ deve ser administrada dentro de
96 horas, aps, a exposio, no sendo conhecida a sua eficcia aps este
intervalo de tempo41,42. A dose recomendada de 125 UI/10 kg peso, at
um mximo de 625 UI e um mnimo de 125 UI. Os doentes devem ser
regularmente observados at 28 dias, aps a exposio, uma vez que a
imunoglobulina pode prolongar o perodo de incubao da doena. Na im-
possibilidade de se fazer imunoglobulina especfica, poderse substituir
por imun oglobulina hiperimune, na dose de 40 mg/kg administrao
nica). Qualquer doente que faa a imunoglobulina deve ser, posterior-
mente, (aps terem decorrido cinco meses) vacinado, desde que esta
no esteja contraind icada, Nos doentes no submetidos a imunoglobu-
lina, a vacina deve ser adm inistrada, idealmente, at ao terceiro dia aps
exposio, embora j tenham sido administradas at ao quinto dia
psexposio 43.
A vacina da varicela uma vacina viva atenuada, que, no entanto,
segura e imunognica em doentes com linfcitos TCD4+ superiores a 15%
e > 200 cls/mm3, devendo ser prescrita nestas situaes. Numa anlise
multivariada, a presena da carga vrica positiva para VIH, correlacionouse
com a diminuio da probabilidade de resposta imunizao 4446.
O uso de aciclovir, como agente profilctico de rotina, no pode ser
generalizado, por inexistncia de dados conclusivos.
A manifestao clnica mais frequente da reactivao de VVZ a zona,
atingindo cerca de 10% doentes com infeco por VIH, nos quais duas
vezes mais frequente do que na populao em geral, e no parece ser um
indicador prognstico da infeco por VIH47. A sua apresentao clnica
idntica do imunocompetente, com a erupo vesicular cutnea a seguir
o trajecto dum dermtomo, localizandose, essencialmente, no tronco e
sendo precedida por dois ou trs dias de prdromos como sensao de quei
madura e prurido local (Foto 17).
Com menor frequncia, as leses de zster podem atingir mais do que
um dermtomo ou envolverem mucosas, como so o caso do herpes oftlmi-
co, da sndrome de RamseyHunt ou de vesculas intraorais. A disseminao
visceral rara, mas pode acontecer, particularmente, com envolvimento do
188 Isabel Aldir

sistema nervoso central, entre a primeira e segunda semana aps o apare-


cimento das leses cutneas. Outra das complicaes, felizmente rara, a
necrose aguda da retina, habitualmente bilateral, a exigir tratamento imediato
(teraputica combinada com aciclovir endovenoso e foscarnet), pelo risco
de cegueira.
O diagnstico de zona clnico, embora nas situaes atpicas seja, por
vezes, necessrio recorrer pesquisa de antignioVVZ, por imunofluores-
cncia, ao teste de Tzanck, pesquisa dos cidos nucleicos, por mtodos
de amplificao molecular e cultura vrica.
O antivrico indicado o aciclovir, na dose de 800 mg, cinco vezes ao
dia, durante 1014 dias, ou valaciclovir 1 g trs vezes ao dia, por igual pe
rodo de tempo. O incio rpido da teraputica reduz o risco de nevralgia
psherptica. Nos casos de disseminao, a teraputica deve ser efectuada
por via endovenosa, com aciclovir 10 mg/kg, trs vezes ao dia. Se houver
suspeio de VVZ, resistente ao aciclovir, a teraputica alternativa o fos-
carnet 40 mg/kg 8/8 h, e.v., por 1428 dias, com monitorizao rigorosa
dos seus efeitos secundrios, j referidos anteriormente. A resistncia vrica
deve ser admitida, quando as leses no mostram sinais de resoluo, ao
fim de 10 dias de tratamento correcto, ou quando tomam um aspecto ver-
rugoso.

Vrus EpsteinBarr
A manifestao clnica mais frequente da infeco por vrus EpsteinBarr
(VEB), no contexto de infeco por VIH, atingindo cerca de 25% dos doen
tes, a tricoleucoplasia da mucosa oral, localizada em regra nos bordos
laterais da lngua e correspondendo a um espessamento epitelial (Foto 18).
Entra em diagnstico diferencial com a candidose oral, mas, ao contrrio
desta, aderente, no se destacando, facilmente, com a esptula. Esta situ-
ao, causada pela replicao de VEB nas clulas epiteliais, pode ocorrer
em qualquer estdio da doena e no est associada, como, inicialmente, se
pensou, progresso da infeco por VIH, tratandose de situao benigna,
sem indicao para teraputica.
A reactivao de VEB est, ainda, associada ao carcinoma nasofarngeo
e a neoplasias hematolgicas, nomeadamente a linfomas noHodgkin
(LNH), particularmente do sistema nervoso central (15 vezes mais frequen-
tes nos doentes infectados por VIH, do que na populao em geral) e a
linfomas B difusos de grandes clulas (variante imunoblstica) ou a linfomas
de Burkitt48. A incidncia do LNH aumenta com o agravamento da imuno-
depresso e, em dois teros dos casos de LNH sistmico, a apresentao
extraganglionar. Em 320% h envolvimento menngeo (meningite linfoma-
tosa), o qual pode ser assintomtico, em um quarto das situaes, obrigan-
do realizao de rotina de puno lombar, nestes doentes.
Em crianas com infeco por VIH, a primoinfeco por VEB tem sido
associada com o aparecimento de neoplasias musculares muito agressivas
(leiomiomas e leiomiossarcomas)49.
Infeces por vrus herpes 189

Vrus herpes humano tipo 6 e tipo 7


Vrus herpes humano tipo 6 e tipo 7 (VHH6 e VHH7) so vrus T linfotr
picos, ubiquitrios, com transmisso por via salivar.
VHH6 o agente etiolgico do exantema sbito, estando, ainda, impli-
cado em casos de sndromes mononuclesicas e de hepatite. Embora no
tenha sido demonstrado como agente oportunista, na infeco por VIH, foi
associado a casos de encefalites, de neuropatias perifricas, de retinites,
miocardites e de pneumonias50,51. Estudos recentes imunohistoqumicos e
por PCR in situ mostraram a presena de VHH6 em leses de leucoence-
falopatia multifocal progressiva (LEMP), sugerindo que este vrus pode ter
a capacidade de aumentar a replicao de vrus JC, o agente etiolgico da
LEMP52,53. VHH6 pode coinfectar, com VIH, a clula TCD4+ e transacti
var a expresso dos genes heterlogos como o R (long terminal repeat) de
VIH, tendo alguns autores sugerido que poder ser um copatognico na
progresso da prpria infeco por VIH54. No entanto, na larga maioria dos
adultos infectados por VIH, a reactivao de VHH6 tem um efeito mnimo
na progresso da doena55. Em contraposio, nas crianas infectadas por
via vertical, a infeco primria por VHH6 foi associada com progresso
mais rpida da doena, durante o primeiro ano de vida 56.
VHH7 um potente inibidor da infeco das clulas monocitrias por
VIH1, regula negativamente a expresso do coreceptor CXCR4 e tem
efeito supressor sobre a transcrio do linfcito TCD4+57,58. No foi, ainda,
identificada qualquer doena no infectado por VIH, causada pela reactivao
deste vrus.

Vrus herpes humano tipo 8


Desde o incio que os estudos epidemiolgicos sugeriam um agente infec-
cioso de transmisso sexual, na etiopatogenia da doena de Kaposi associa-
da sida. Em 1994, era descoberto o vrus herpes humano 8 (VHH8 OU
KSHV kaposi sarcoma herpesvirus), aps identificao de sequncias de
ADN em leses de Kaposi de doentes com sida59. Ao contrrio dos outros
vrus herpes, e com a excepo de VHS2, a sua distribuio no ubiqui-
tria e transmitido, fundamentalmente, por via sexual, embora a distribui-
o da sua prevalncia em frica sugira, igualmente, a transmisso vertical
(mefilho) e horizontal entre crianas.
A infeco primria por VHH8 pode cursar com febre, esplenomegalia,
hiperplasia linfide, pancitopenia e, ocasionalmente, com aparecimento r-
pido de leses de sarcoma de Kaposi60.
Actualmente, VHH8 est associado a trs entidades nosolgicas no in
fectado por VIH, isto , doena ou sarcoma de Kaposi, doena de Castleman
multicntrica e linfomas B das serosas.
Apesar de, por amplificao gentica por tcnica de PCR, se encontrar
sequncias do genoma de VHH8, em 100% dos casos da doena de Kapo-
si, em termos teraputicos a interveno no sofreu qualquer modificao61,62.
190 Isabel Aldir

No entanto, os doentes sob profilaxia secundria de retinite por VCM com


ganciclovir, parecem ter incidncia menor de doena de Kaposi 63. A viremia
de VHH8, detectada em 5070% dos casos, reflecte a massa tumoral exis-
tente e um bom indicador do desenvolvimento da doena 64,65.
Na grande maioria dos linfomas das serosas, existe coinfeco por VEB,
o que sugere uma cooperao no processo de transformao maligna.
Nos indivduos com infeco por VIH, o genoma de VHH8 detectado
em 100% dos casos de doena de Castleman multicntrica, ao contrrio do
que acontece com os noinfectados66. No h uma recomendao terapu-
tica estandardizada, sendo alternativas a quimioterapia simples ou combina
da, corticides, agentes antivricos e anticorpos especficos, entre outros.

Bibliografia
1. Centers for Disease Control: Pneumocystis pneumonia Los Angeles. MMWR. 1981;30(21):1-3.
2. Banks T, Rouse B. Herpesviruses immune escape artists? Clin Infect Dis. 1992;14:933-41.
3. Siegel D, Golden E, Washington AE, et al. Prevalence and correlates of herpes simplex infections: the population-
based AIDS in multiethnic neighbourhoods study. JAMA. 1992;268:1702-8.
4. Martin JN, Ganem DE, Osmond DH, et al. Sexual transmission and the natural history of human herpesvirus 8
infection. N Engl J Med. 1998;338:948-54.
5. Calvez V, Barete S, Dupin N. Herpesvirus humain 8 (HHV-8). Rev Prat. 1999;49:2232-6.
6. Raguin G, Malkin JE. Genital herpes: epidemiology and pathophysiology. Update and perspectives. Ann Med
Intern. 1997;148:530-3.
7. Hook EW, Cannon R, Nahmias A, et al. Herpes simplex virus infection as a risk factor for human immunode-
ficiency virus infection in heterosexuals. J Infect Dis. 1992;165:251-5.
8. Stamm WE, Handsfield H, Rompalo AM, et al. The association between genital ulcer disease and acquisition of
HIV infection in homosexual men. JAMA. 1988;260:1429-33.
9. Freeman EE, Weiss HA, Glynn JR, et al. Herpes simplex virus 2 infection increases HIV acquisition in men
and women: systematic review and meta-analysis of longitudinal studies. AIDS. 2006;20:73-83.
10. Wald A, Zeh J, Selke S, et al. Reactivation of genital herpes simplex virus type 2 infection in asymptomatic
seropositive persons. N Engl J Med. 2000;342(12):844-50.
11. Koelle DM, Abbo H, Peck A, et al. Direct recovery of herpes simplex virus (HSV)-specific T lymphocyte clones
from recurrent genital HSV-2 lesions. J Infect Dis. 1994;169:956-61.
12. Schacker T, Ryncarz AJ, Goddard J, et al. Frequent recovery of HIV-1 from genital herpes simplex virus lesions
in HIV-1 infected men. JAMA. 1998;280(1) :61-6.
13. Quinnan GV, Masur H, Rock AH, et al. Herpesvirus infections in the acquired immune deficiency syndrome.
JAMA. 1984;252:72-7.
14. Bagdades EK, Pillay D, Squire SB, et al. Relationship between herpes simplex virus ulceration and CD4+ cell
counts in patients with HIV infection. AIDS. 1992;6:1317-20.
15. Severson JL, Tyring SK. Relation between herpes simplex viruses and human immunodeficiency virus infections.
Arch Dermatol. 1999;135:1393-7.
16. Sulogoi B, Dorrucci M, Volpi A, et al. Absence of an effect of herpes simplex virus type 2 infection on HIV disease
progression: data from a cohort of HIV-positive individuals with known date of seroconversion. AIDS. 2001;15:133-5.
17. Calistri A, Parolin C, Palu G. Herpes simplex virus type 1 can either suppress or enhance human immunodefi-
ciency virus type 1 replication in CD4-positive T lymphocytes. J Med Virol. 2003;70(1):163-70.
18. Schacker T, Zeh J, Hu H, et al. Changes in plasma human immunodeficiency virus type 1 RNA associated with
herpes simplex virus reactivation and suppression. J Infect Dis. 2002;186(12):1718-25.
19. Nagot N, Oudraogo A, Foulongne V, et al. Reduction of HIV-1 RNA levels with therapy to suppress herpes
simplex virus. N Engl J Med. 2007;356(8):790-9.
20. Warren T, Harris J, Brennen CA. Efficacy and safety of valacyclovir for the supressio and supression and epi-
sodic treatment of herpes simplex virus in patients with HIV. Clin Infect Dis. 2004;39 Suppl 5:S258-66.
21. Erlich KS, Mills J, Chatis P. Acyclovir-resistant herpes simplex virus infections in patients with the acquired
immunodeficiency syndrome. N Engl J Med. 1989;320:293-6.
22. Safrin S, Elbaggari A, Elbeik T. Risk factors for the development of acyclovir-resistant herpes simplex virus (HSV)
infection. Presented at the VIII International Conference on AIDS/III STD World Conference. Amsterdam; 1992.
23. Lalezari J, Schacker T, Feinberg J, et al. A randomized, double-bind, placebo-controlled trial of cidofovir gel
for the treatment of acyclovir unresponsive mucocutaneous herpes simplex virus infection in patients with AIDS.
J Infect Dis. 1997;176(4):892-8.
24. Collier AC, Meyers JD, Corey L, et al. Cytomegalovirus infection in homosexual men. Relationship to sexual
practices, antibody to human immunodeficiency virus, and cell-mediated immunity. Am J Med. 1987;82:593-601.
25. Toorkey CB, Carrigan DR. Immunohistochemical detection of an immediate early antigen of human cytomega-
lovirus in normal tissues. J Infect Dis. 1989;160:741-51.
26. Taylor WJ, Sissons JG, Borysiewicz LK, et al. Monocytes are a major site of persistance of human cytomega-
lovirus in peripheral blood mononuclear cells. J Gen Virol. 1991;72:2059-64.
Infeces por vrus herpes 191

27. Jacobson MA, Zegans M, Pavan PR, et al. Cytomegalovirus retinitis after initiating highly active antiretroviral
therapy. Lancet. 1997;349:1443-5.
28. Benson C, Kaplan J, Masur H, et al. Treating opportunistic infections among HIV-infected adults and adolescents:
Recommendations from CDC, the National Institutes of Health, and the HIV Medicine Association/Infectious
Diseases Society of America. Clin Infect Dis. 2005;40 Suppl 3:S131-235.
29. Spector SA, Hsia K, Crager M, et al. Cytomegalovirus (CMV) DNA load is an independent predictor of CMV
disease and survival in advanced AIDS. J Virol. 1999;73:7027-30.
30. Dieterich DT, Rahmin M. Cytomegalovirus colitis in AIDS: presentation in 44 patients and a review of the lit-
erature. J Acquir Immune Defic Syndr. 1991;4 Suppl1:S29-35.
31. Achim CL, Nagra RM, Wang R, et al. Detection of cytomegalovirus in cerebrospinal fluid autopsy spcecimens
from AIDS patients. J Infect Dis. 1994;169:623-7.
32. Broaddus C, Dake MD, Stulbarg MS, et al. Bronchoalveolar lavage and transbronchial biopsy for the diagnosis
of pulmonary infection in acquired immunodeficiency syndrome. Ann Inter Med. 1985;102:747-52.
33. Emanuel D, Peppard J, Stover D, et al. Rapid immunodiagnosis of cytomegalovirus pneumonia by bronchoal-
veolar lavage using human and murine monoclonal antibodies. Ann Inter Med. 1986;104:476-81.
34. Martin DF, Sierra-Madero J, Walmsley S, et al. A controlled trial of valganciclovir as induction therapy for
cytomegalovirus retinitis. N Engl J Med. 2002;346:1119-26.
35. Chrisp P, Clissold SP. Foscarnet: a review of its antiviral activity, pharmacokinetic properties, and therapeutic
use in immunocompromised patients with cytomegalovirus retinitis. Drugs. 1991;41:104-9.
36. Combination foscarnet and ganciclovir therapy vs monotherapy for the treatment of relapsed cytomegalovirus re-
tinitis in patients with AIDS. The Cytomegalovirus Retreatment Trial. The Studies of Ocular Complications of AIDS
Research Group in Collaboration with the AIDS Clinical Trials Group. Arch Ophthalmol. 1996;114:23-33.
37. Tural C, Romeu J, Sirera G, et al. Long-lasting remission of cytomegalovirus retinitis without maintenance
therapy in humam immunodeficiency virus-infected patients. J Infect Dis. 1998;177:1080-3.
38. Perronne C, Gikas A, Truffot-Pernot C, et al. Varicella in patients with the human immunodeficiency virus. Arch
Dermatol. 1990;126:1033-6.
39. Schacker T, Corey L. Herpesvirus infections in human immunodeficiency virus-infected persons. Em: AIDS:
Biology, Diagnosis, Treatment and Prevention. 4. a ed. Lippincott-Raven Publishers; 1997. p. 267-80.
40. Biron KK, Elion GB. In vitro susceptibility of varicella-zoster virus to acyclovir. Antimicrob Agents Chemother.
1980;18:443-7.
41. A new product (VariZIG) for postexposure prophylaxis of varicella available under an investigational new drug
application expanded access protocol. MMWR Morb Mortal Wkly Rep. 2006;55:209-10.
42. Prevention of varicella: Recommendations of the Advisory Committee on Immunization Practices (ACIP). Cen-
ters for Disease Control and Prevention. MMWR Recomm Rep. 1996;45:1-25.
43. Global Disease Elimination and Eradication as Public Health Strategies. Proceedings of a conference. Atlanta,
Georgia, USA. 23-25 February 1998. Bull World Health Organ. 1998;76 Suppl 2:5-162.
44. Levin MJ, Gershon AA, Weinberg A, et al. Immunization of HIV-infected children with varicella vaccine. J
Pediatr. 2001;139:305-10.
45. Levin MJ, Gershon AA, Weinberg A, et al. Administration of live varicella vaccine to HIV-infected children with
current or past significant depression of CD4+ T cells. J Infect Dis. 2006;194:247-55.
46. American Academy of Pediatrics. Committee on Infectious Diseases. Varicella vaccine update. Pediatrics.
2000;105:136-41.
47. Buchbinder SP, Katz MH, Hessol NA, et al. Herpes zoster and human immunodeficiency virus infection. J Infect
Dis. 1992;166:1153-6.
48. Samoszuk M, Nguyen V, Shadan FF, et al. Incidence of Epstein-Barr virus in AIDS-related lymphoma specimens.
J Acquir Immune Defic Syndr. 1993;6:913-8.
49. Pathmanathan R, Prasad U, Sadler R, et al. Clonal proliferations of cells infected with Epstein-Barr virus in
preinvasive lesions related to nasopharyngeal carcinoma. N Engl J Med. 1995;333:693-8.
50. Knox KK, Carrigan DR. Disseminated active HHV-6 infections in patients with AIDS. Lancet. 1994;343:577-8.
51. Cone RW, Huang MW, Hackman RC. Human herpesvirus 6 and pneumonia. Leuk Lymphoma. 1994;15:235-41.
52. Mock DJ, Powers JM, Goodman AD, et al. Association of human herpesvirus 6 with the demyelinate lesions of
progressive multifocal leukoencephalopathy. J Neurovirol. 1999;5:363-73.
53. Caserta M, Mock D, Dewhurst S. Human Herpesvirus 6. Clin Infect Dis. 2001;33:829-33.
54. Lusso P, Gallo RC. Human herpesvirus 6 in AIDS. Immunol Today. 1995;16:67-71.
55. Fairfax MR, Schacker T, Cone RW, et al. Human Herpes-virus 6 DNA in blood cells of human immunodefi-
ciency virus-infected men: correlation of high levels with CD4 cell counts. J Infect Dis. 1994;169:1342-5.
56. Kositanont U, Wasi C, Wanpropor N, et al. Primary infection of human herpesvirus 6 in children with vertical
infection of human immunodeficiency virus type-1. J Infect Dis. 1999;180:50-5.
57. Secchiero P, Zella D, Barabitskaja O, et al. Progressive and persistent downregulation of surface CxCR4 in CD4 +
T cells infected with human herpesvirus-7. Blood. 1998;92:4521-8.
58. Secchiero P, Gibellini D, Flamand L, et al. Human herpesvirus-7 induces the downregulation of CD4 antigen in
lymphoid T cells without affecting p56lck levels. J Immunol. 1997;159:3412-23.
59. Chang Y, Cesarman E, Pessin MS, et al. Identification of herpesvirus-like DNA sequences in AIDS-associated
Kaposis sarcoma. Science. 1994;266:1865-9.
60. Oksenhendler, E, Cazals-Hatem, D, Schulz, TF, et al. Transient angiolymphoid hyperplasia and Kaposis sar-
coma after primary infection with human herpesvirus 8 in a patient with human immunodeficiency virus infec-
tion. N Engl J Med. 1998;338:1585-90.
61. Boshoff C, Weiss RA. Kaposis sarcoma-associated herpesvirus. Em: Van de Woulde G, Klein G, eds. Advances
in Cancer Research. Vol. 75. San Diego: Academic San Diego; 1998. p. 57-86.
62. Hengge UR, Ruzicka T, Tyring SK, et al. Update on Kaposis sarcoma and other HHV8 associated diseases.
Part 1: epidemiology, environmental predispositions, clinical manifestations, and therapy. Lancet Infect Dis.
2002;2(5):281-92.
192 Isabel Aldir

63. Martin DF, Kuppermann BD, Wolitz RA, et al. Oral ganciclovir for patients with cytomegalovirus retinitis
treated with ganciclovir implant. N Engl J Med. 1999;340:1063-70.
64. Whitby D, Howard M, Tenant-Flowers M, et al. Detection of Kaposis sarcoma-associated herpesvirus in periph-
eral blood of HIV-infected individuals and progression to Kaposis sarcoma. Lancet. 1995;346:799-802.
65. Lebb C, Agbalika F, De Crmoux P, et al. Detection of human herpesvirus and human T-cell lymphotropic
virus type l sequences in Kaposi sarcoma. Arch Dermatol. 1997;133:25-30.
66. Soulier J, Grollet L, Oksenhendler E, et al. Kaposis sarcoma-associated herpesvirus-like DNA sequences in
multicentric Castlemans disease. Blood. 1995;86:1276-80.
V Seco
Captulo 7

Neoplasias associadas sida*


Lus Caldeira

Introduo
O aumento da prevalncia de determinados tipos de neoplasias, no contexto
da infeco por vrus da imunodeficincia humana (VIH), foi observado
desde os primeiros tempos da pandemia, e temse revelado como uma causa
importante de mortalidade, de morbilidade e de reduo da qualidade de
vida dos indivduos infectados. O advento da teraputica antiretrovrica
combinada (TARVc) veio alterar, de forma significativa, o padro da ocor-
rncia do sarcoma de Kaposi (SK), mas no parece ter afectado, do mesmo
modo, o linfoma noHodgkin (LNH) e as neoplasias associadas a vrus
do papiloma humano (VPH). Neste trabalho, feita uma actualizao dos
aspectos da clnica, diagnstico, tratamento e prognstico das neoplasias
associadas infeco por VIH, no contexto das novas possibilidades do
tratamento deste vrus.

Imunossupresso e neoplasias
Data de 1908 a afirmao de Ehrlich de que o sistema imunitrio inibe a
formao de neoplasias1, retomada mais de 50 anos depois por Burnet, na sua
teoria da vigilncia imunitria2. No entanto, decorrido um sculo de investi-
gao em medicina, so, ainda, muitos os aspectos por esclarecer na relao
complexa entre as neoplasias e o sistema imunitrio do hospedeiro.
De facto, como faz notar Schwartz3, as neoplasias que predominam em si
tuaes de imunodepresso, tais como a infeco por VIH e a teraputica
imunossupressora, utilizada em transplantados, so, relativamente, pouco varia-
das. Na realidade, a incidncia das neoplasias mais frequentes, em patologia

*Nota do editor: Este captulo no foi actualizado em relao 3.a edio do Manual sobre sida (2008)
194 Lus Caldeira

humana, tais como as do pulmo, mama, clon e ovrio, no parece estar,


significativamente, aumentada neste grupo, enquanto que as neoplasias, que
ocorrem no contexto dos doentes transplantados, sujeitos a teraputica imunos-
supressora, constituem um grupo relativamente restrito de entidades nosolgicas,
que , em muitos aspectos, semelhante ao observado nos doentes com sndro-
me de imunodeficincia adquirida (sida)4. Por outro lado, as neoplasias mais
frequentes nestes doentes (LNH, SK e carcinoma invasivo do colo do tero
[CICU]), tm sido associadas presena de infeco por vrus, tais como vrus
de EpsteinBarr (VEB), herpes vrus humano 8 (VHH8) e algumas estirpes do
VPH, com base na evidncia cientfica de que as clulas neoplsicas destes
tumores exprimem, com elevada frequncia, antignios especficos ou partes do
genoma destes vrus. Assim, tornase possvel e tentador admitir a hiptese de
que o aumento da frequncia da ocorrncia destas neoplasias se relaciona, pelo
menos em parte, com a perda selectiva da imunidade do hospedeiro contra
estes agentes infecciosos.
Outras caractersticas particulares das neoplasias, em doentes infectados
por VIH, apoiam a considervel complexidade dos aspectos relacionados com
a sua etiopatogenia. Assim, o linfoma de Burkitt e o carcinoma da nasofa-
ringe, que esto associados infeco por VEB, em doentes que no apre-
sentam deficincias identificveis dos linfcitos T, no so, significativamen-
te, mais frequentes nos doentes com infeco por VIH, embora, no seu
conjunto, 50% dos linfomas de clulas B, geralmente associados sida,
exprimam antignios do VEB. Por outro lado, o linfoma de Burkitt, fora do
contexto da sida, , tipicamente, monoclonal, enquanto que os linfomas as-
sociados sida parecem ser, com frequncia e, porventura, predominante-
mente policlonais, embora esta questo seja, ainda, objecto de alguma
controvrsia5. De uma forma geral, a sua ocorrncia parece surgir no con-
texto da estimulao e proliferao crnicas e desreguladas dos linfcitos B,
a qual foi, anteriormente, associada aos linfomas de clulas B em ratinhos
imunocompetentes, na sequncia da resposta imunitria persistente 6.
Deste modo, parece ser hoje aceitvel admitir que a relao entre o
sistema imunitrio e o desenvolvimento de neoplasias no to linear como
pretendia Ehrlich. A pesquisa de outros factores, que possam participar na
patogenia das neoplasias associadas sida, para alm do potencial papel
oncognico destes vrus, dever ser, hoje em dia, um campo importante de
investigao, no sentido de vir a proporcionar armas mais eficazes para o
controlo clnico das neoplasias, que ocorrem no contexto da imunossupres-
so, particularmente em doentes com sida.

Neoplasias associadas sida


Sarcoma de Kaposi (SK)
Em 1981, Brennan e Durack7 descrevem os primeiros 26 casos do que
designaram, ento, por gay compromise syndrome, caracterizado pela
ocorrncia de SK disseminado e/ou pneumonia por Pneumocystis jirovecii
Neoplasias associadas sida 195

em indivduos com comportamento homossexual pormscuo, numa anteci-


pao do que viria ser designado, cerca de um ano depois por acquired
immunedeficiency syndrome. De facto, o SK era uma neoplasia rara antes
do advento da epidemia por VIH, aps a qual a sua incidncia aumentou
at cerca de 70 vezes8, particularmente no grupo dos doentes do sexo
masculino infectados por contacto homossexual, que apresentam um risco
de ocorrncia de SK, significativamente, mais elevado do que os doentes
infectados por contacto heterossexual ou por via parentrica 9. Este aumento
de incidncia, que culminou neste grupo no incio da dcada de 90 e que
tornou o SK na mais frequente neoplasia, no contexto da sida, tanto nos
pases ocidentais como em frica, tem vindo a decrescer de forma muito
significativa desde ento9, por motivos que no esto ainda esclarecidos10.
Esta diminuio de prevalncia tem sido relacionada quer com o advento
da teraputica antiretrovrica11,12, particularmente com os regimes que
combinam dois ou mais frmacos13,14, quer com factores relacionados com
a epidemiologia particular da infeco por VHH8. De facto, dados recentes
apontam para a existncia de uma epidemia de VHH8 a par com a de VIH,
uma vez que estudos seroepidemiolgicos retrospectivos em homossexuais
de Nova Iorque e Washington mostraram um pico da prevalncia de VHH8,
em 198283, decrescendo, desde ento, de forma significativa 15.
A relao etiolgica do SK com a infeco por VHH8 tem vindo a ser
reforada pela evidncia cientfica produzida desde que Chang, et al., em 1995,
identificaram sequncias de ADN com caractersticas semelhantes s dos vrus
herpes em clulas de SK16. O agente, posteriormente classificado como um
herpes vrus ( semelhana de VEB), foi isolado a partir das clulas fusifor-
mes caractersticas do SK, nos quatro tipos epidemiolgicos identificados
(clssico ou mediterrnico, endmico, iatrognico ou associado a transplantes
e epidmico ou associado sida)17, indiciando uma relao etiolgica entre a
infeco por este vrus e o desenvolvimento desta forma especfica de angios-
sarcoma. A sua relao com o sarcoma de kaposi associado sida (SKAS)
apoiada por estudos, como o de Gao, et al., que demonstraram prevalncia,
significativamente, mais elevada de infeco prvia por VHH8, em doentes que
apresentaram SK, como primeira manifestao de sida, quando comparada com
os doentes em que o evento definidor foi de outra etiologia (80 contra 18%,
respectivamente, p < 0,01)18. Neste grupo de doentes, o tempo mdio entre
a seroconverso para VHH8 e o aparecimento de SK foi de 33 meses.
No entanto, os mecanismos atravs dos quais VHH8 induz o desenvol-
vimento de SK, nos doentes coinfectados por VIH, necessitam, ainda, de
esclarecimento, em muitos aspectos, parecendo que a eventual participao
do VIH, no processo patognico, pode estar limitada ao efeito da respecti-
va protena Tat de VIH, como cofactor activador da angiognese 19.
A relao entre a infeco/estado de portador de VHH8 e a ocorrncia
de SK muito varivel. A seroprevalncia global da infeco por VHH8
est, actualmente, estimada em 210%20, embora com variaes significativas,
de acordo com as regies geogrficas, indo desde 0,5-1,0% no Norte da
Europa e Amrica do Norte21 e 35% na Siclia22, at 87% no Botswana23,
196 Lus Caldeira

regio onde a incidncia de SK , relativamente, elevada, passando por 57%


em diferentes tribos amerndias da regio amaznica, como os uaiamp e
os tiriy24, nos quais a ocorrncia de SK , distintamente, rara.
Se parece existir, por um lado, correlao do risco de desenvolver SK
com os estados de depleo quantitativa e qualitativa de linfcitos TCD4 +,
como indica a sua melhoria espontnea em doentes, nos quais suspensa
a teraputica imunossupressora com ciclosporina, ou em doentes que
apresentam resposta favorvel aos actuais esquemas de teraputica antire-
trovrica, , tambm, verdade que na maioria dos doentes, com formas
clssicas ou endmicas, no se detectam alteraes significativas das po-
pulaes linfocitrias25. Um estudo recente demonstrou que VHH8 pode
infectar tanto as clulas endoteliais da derme humana como os macrfagos,
estabelecendo nestas uma infeco latente 26, que pode vir a reactivar, em
situaes de imunodepresso. O gene da fase latente mais bem caracteri-
zado ORF73, que codifica o antignio nuclear associado a latncia
(latency associated nuclear antigen [LANA]), e que tem sido relacionado
com a latncia de VHH8 nas clulas infectadas, sob a forma de epissoma 27,
podendo, deste modo, impedir a sua apresentao ao complexo major de
histocompatibilidade28. Monini, et al. mostraram que, na presena de ci-
tocinas prinflamatrias (interfero, FNT, IL1 e IL6), a expresso de
VHH8 em culturas de moncitos e linfcitos B persiste e pode ser de-
monstrada pela presena de genes de fase ltica, correlacionados com
replicao vrica activa29. Portanto, possvel admitir, actualmente, um
modelo segundo o qual esta infeco latente pode induzir alteraes nas
clulas endoteliais dos vasos linfticos, tornandoas no apenas mais sus-
ceptveis aco de citocinas inflamatrias, como a IL6, a IL8, o factor
de crescimento bsico dos fibroblastos (bFGF), o factor de crescimento
derivado das plaquetas (PDGF) e o factor de crescimento do endotlio
vascular (VEGF), como tambm elas prprias produtoras destas citocinas.
De facto, a ORFK2 de VHH8 codifica uma protena que considerada
com um homlogo vrico da IL630 e a ORF74 codifica uma protena
(viralG proteincoupled receptor [vGPCR]) homloga do receptor celular
da IL831, cuja sinalizao induz a produo de factores de proliferao
endotelial e a neoangiognese32. A participao da infeco por VIH no
processo patognico seria, assim, indirecta, ao promover quer a depleo
de clones de linfcitos TCD4 +, com memria especfica para antignios
de VHH8, quer uma disfuno generalizada da vigilncia imunitria, pro-
porcionada por estes linfcitos, em doentes em estdios avanados de
imunodepresso33.
A via de transmisso deste vrus no est, ainda, determinada, sendo
provvel que o contacto sexual possa ter papel importante, tendo em conta
a sua elevada incidncia em populaes masculinas, com comportamento
sexual promscuo e em parceiras sexuais de homens com SK34. No entanto,
os estudos que tentaram detectar a presena de VHH8 no esperma de doen
tes com SK, por intermdio de uma reaco em cadeia da polimerase espe
cfica, apresentaram resultados contraditrios35.
Neoplasias associadas sida 197

Recentemente, VHH8 foi, tambm, associado doena de Castleman


multicntrica e a uma forma nova de linfoma, o linfoma originado em ca-
vidades corporais (body cavity based lymphoma)36.
Histologicamente, o SK caracterizase, sobretudo, pela neoproliferao
de clulas endoteliais linfticas, dando origem ao aparecimento de clulas
fusiformes, caractersticas da doena, associadas a achados compatveis com
angiognese activa e formao de lagos vasculares, com grau varivel de
atipia. Safai e Good37 definiram, essencialmente, trs tipos histolgicos: O
monomorfo, no qual predominam as clulas fusiformes; o misto, que asso-
cia a estas clulas a presena de lagos vasculares; o anaplsico, que apre
senta grande polimorfismo celular e numerosas mitoses. No SKAS, predo-
minam, geralmente, as formas monomorfa e mista.
Do ponto de vista clnico, o SKAS , por regra, uma doena multicn-
trica. Este carcter generalizado do SK foi, desde logo, assinalado pelo
dermatologista Moritz Kaposi, nas suas primeiras descries da doena, em
1822, pelo que se torna importante realar o carcter, essencialmente, sis-
tmico desta neoplasia. As leses seguem, com frequncia, o trajecto dos
vasos linfticos, acompanhandose, muitas vezes, de linfedema, cuja exten-
so parece desproporcionada em relao ao nmero de leses observveis.
As leses tpicas so pigmentadas, de colorao arroxeada ou vermelha,
nas pessoas de pele branca e castanhoescura, nas de pele negra, nodulares,
indolores ou discretamente dolorosas, observandose, raramente, leses ve-
getantes (Fotos 19 e 20). As leses subcutneas podem no evidenciar
pigmentao. As dimenses so muito variveis, indo desde alguns milme-
tros a vrios centmetros de dimetro, podendo ser confluentes e cobrir
reas extensas do corpo (por exemplo, nos membros inferiores). Quando
atingem grandes dimenses, as leses podem necrosar, ulcerar, sangrar e
ser sede de infeco secundria. O tumor , geralmente, multicntrico, e as
leses cutaneomucosas atingem, preferencialmente, os membros inferiores,
o tronco, os genitais, a face e a cavidade oral (1/3 dos casos), onde se
torna necessrio pesquislas cuidadosamente, sobretudo ao nvel da abba-
da palatina, das gengivas, da orofaringe e da mucosa jugal (Fotos 21 a 25).
Nesta localizao, as leses mais volumosas podem tornar difcil a masti-
gao e a deglutio e infectam com frequncia (Foto 26).
O tracto gastrintestinal a localizao visceral mais frequente do SK38,
sendo atingido, segundo alguns autores, em cerca de 50% dos casos,
muitas vezes precocemente. Qualquer zona do tubo digestivo pode ser
afectada, mas mais evidente ao nvel do estmago e duodeno, estando
descrito, tambm, o envolvimento heptico e esplnico. Raramente
sintomtico, mas pode manifestarse por dor abdominal, hemorragia di-
gestiva subaguda ou aguda e, excepcionalmente, por ocluso intestinal ou
sndrome de malabsoro. As leses do parnquima pulmonar so mais
raras do que as do tubo digestivo, mas so sintomticas, com maior fre-
quncia, manifestandose por tosse seca, dor torcica, dispneia, condicio-
nando, com frequncia, perturbaes localizadas da ventilao e infeces
respiratrias de repetio, sendo a localizao que se relaciona com o
198 Lus Caldeira

pior prognstico vital 39. Com frequncia so, ainda, descritas leses atin-
gindo os gnglios linfticos.
O diagnstico do SK baseiase na suspeita clnica, que deve ser elevada
no contexto epidemiolgico de doente do sexo masculino com infeco por
VIH e histria de contactos homossexuais, devendo ser confirmado pelo
exame anatomopatolgico atravs de biopsia excisional, a qual, desde que
seja radical, acarreta baixo risco de hemorragia. O diagnstico diferencial
fazse com o granuloma piognico e com outras formas de angioma cutneo.
As leses do tubo digestivo so, geralmente, acessveis biopsia endosc-
pica, embora o carcter submucoso das leses, a este nvel, possa dificultar
o procedimento. Os exames radiolgicos convencionais do tubo digestivo
so menos especficos, podendo observarse imagens de subtraco luminal
de dimenses variveis, por vezes em alvo, associadas a massas submu-
cosas. O meio de eleio para o diagnstico das leses pulmonares a
broncofibroscopia, permitindo visualizar as leses endobrnquicas, geral-
mente de aspecto mais vascularizado do que as cutneas ou mucosas, pelo
que a biopsia se pode complicar por hemorragia com maior frequncia. O
padro radiolgico do SK pulmonar costuma ser mais grosseiramente no-
dular do que o observado na tuberculose e menos intersticial do que na
pneumonia por P. jirovecii (PPc) ou por vrus citomeglico. O derrame pleu-
ral associase, com mais frequncia, com o SK do que com a PPc, mas
menos do que com a tuberculose, sendo, em geral, serohemtico e a sua
anlise pouco til para o diagnstico. A cintigrafia pulmonar, com glio, pode
auxiliar no diagnstico, uma vez que as leses no concentram este radioi-
stopo, ao contrrio do que sucede com as pneumopatias infecciosas.
O facto de o SKAS ser uma neoplasia com envolvimento sistmico frequen-
te cria dificuldades no estadiamento e, em consequncia, na deciso quanto
forma de tratamento mais adequada. Por outro lado, a evoluo clnica do SKAS
muito varivel, podendo permanecer quiescente em alguns doentes e pro-
gredir, rapidamente, noutros, por vezes associada a sintomatologia geral,
sem que estejam ainda bem identificados os factores que determinam o tipo
de evoluo, que nem sempre depende do estdio imunitrio do doente. De
facto, o SKAS uma neoplasia oportunista, que pode surgir, por vezes, em
doentes com contagens de linfcitos TCD4+ relativamente elevadas e apre-
sentar, mesmo nestes doentes, evoluo, rapidamente, progressiva.
O sistema de estadiamento mais utilizado tem sido o desenvolvido pelo
AIDS Clinical Trial Group (ACTG), tambm conhecido por sistema TIS
(Quadro 1) e que foi validado, quanto ao seu valor prognstico no SKAS 40,
embora a sua utilidade na orientao da teraputica seja mais reduzida.
A variabilidade das formas evolutivas do SKAS impe, muitas vezes,
uma atitude inicial expectante ou com interveno de carcter meramente
cosmtico, no sentido de avaliar a extenso e rapidez de evoluo das leses.
Em situaes que se apresentem j com complicaes (T1IxSx) e/ou em
fase, rapidamente, progressiva, tornase necessrio recorrer a quimioterapia
sistmica. No entanto, o advento da TARVc, veio modificar, de forma fa-
vorvel, o panorama do tratamento do SKAS, tendo em conta as inmeras
Neoplasias associadas sida 199

Quadro 1. Estadiamento do SKAS (ACTG)


Baixo risco (0) Alto risco (1)
Tumor Limitado pele ou aos gnglios Presena de edema ou ulcerao
linfticos ou leso Qualquer localizao visceral
oral confinada ao palato
Imunidade TCD4+ > 200/mm3 TCD4+ 200/mm3
Doena sistmica CDC A CDC B ou C
Karnofsky > 70% Karnofsky 70%
Sem sintomas B Sintomas B
Outras infeces oportunistas

Quadro 2. Tratamento do SKAS


Extenso da doena Tratamento
Leses raras, pequenas (T0IxSx), Iniciar antiretrovricos;
bem toleradas atitude expectante: Evoluo?
Leses raras, pequenas (T0IxSx), Iniciar antiretrovricos; mscara cosmtica;
mal toleradas do ponto de vista exrese cirrgica, criocoagulao;
psicolgico e/ou esttico alitretinona tpica; vincristina intralesional.
Qualquer T1IxSx Quimioterapia sistmica:
Doxorrubicina lipossmica.
Bleomicina + vincristina (BV).
BV + doxorrubicina.
Outros regimes: Paclitaxel.

observaes, publicadas e pessoais, de estabilizao/cura das leses aps o


incio mandatrio de TARVc, no doente com critrios de sida e sem qualquer
teraputica adicional41,42. Neste contexto, uma recomendao para a interven-
o teraputica actual do SKAS, baseada na proposta de Levine (1997) 43,
sistematizada no quadro 2. Em todas as situaes de SKAS, o doente de-
ver iniciar TARVc, com o que se obtm, com frequncia, estabilizao e
mesmo remisso parcial ou total das leses. Nos casos de leses pouco
numerosas, pequenas e estveis, sem evidncia ou suspeita forte de existn-
cia de compromisso visceral ou ganglionar, deve-se manter, apenas, vigi-
lncia clnica quanto sua progresso. Nos casos em que, por razes est-
ticas e/ou psicolgicas, as leses sejam mal toleradas, podese recorrer ao
uso de mscaras cosmticas ou, se estas no forem suficientes, teraputi-
ca local com alitretinona tpica, cirurgia ou quimioterapia intralesional com
vincristina ou vinblastina (0,1 a 0,2 g/cm2 de leso, injectada nos bordos
desta com agulha intradrmica). J nos casos em que as leses progridem,
rapidamente, em dimenso e/ou nmero, associandose ou no a edema, ul-
cerao ou envolvimento sistmico, recomendase iniciar quimioterapia sist-
mica. A nossa prtica tem sido a de utilizar, como frmaco de primeira linha,
a doxorrubicina lipossmica, em monoterapia, na dose de 20 mg/m 2, em
administrao quinzenal ou trissemanal, justificandose esta preferncia pela
200 Lus Caldeira

sua boa tolerabilidade, do ponto de vista hematolgico e local, associandose


a uma taxa considervel de respostas favorveis, a longo prazo, comparvel
descrita na literatura (5059%)44,45. Nos doentes em que exista contrain-
dicao para o uso de antraciclinas sistmicas, por existncia prvia de pa-
tologia cardaca, recorrese associao da bleomicina (15 unidades) e da
vincristina (dois mg), em administrao quinzenal, regime que, embora se
associe a taxa significativamente mais elevada de efeitos adversos (nuseas,
vmitos, mialgias, febre), poder apresentar taxa de respostas favorveis,
no muito diferente da descrita para a doxorrubicina. A daunorrubicina li-
possmica, tambm disponvel, associase a taxa de remisses inferior
(25%)46,47 e apresenta, tambm, pior tolerabilidade, complicandose com
frequncia de depresso medular e de alopecia. Nos casos associados a ede-
ma grave e incapacitante, a leses orais extensas ou com envolvimento
pulmonar, utilizase a associao da doxorrubicina com a bleomicina e vin-
cristina, em ciclos quinzenais. Em todos os casos mandatria a vigilncia
clnica e laboratorial, entre os ciclos, podendose recorrer ao uso de factores
de crescimento (GCSF), sempre que indicado. A quimioterapia deve ser
prolongada at se obter remisso parcial, o que ocorre, geralmente, ao fim
de trs a seis ciclos, suspendendose, ento, a teraputica e mantendose
vigilncia clnica. Nos casos raros em que no se obtenha remisso neste
perodo, poderse recorrer ao paclitaxel4850 na dose de 100 mg/m2, e.v.,
bissemanal ou semanal.
O prognstico vital do SKAS , em regra, bastante favorvel, com ex-
cepo dos casos com compromisso pulmonar, embora dependa, tambm,
do estado imunitrio do doente e da coexistncia de outras intercorrncias
oportunistas, que motivem medicao adicional e que possam, por si s,
afectar o prognstico vital.

Linfoma noHodgkin (LNH)


O aumento de incidncia de LNH, no contexto da infeco por VIH, foi
reconhecido desde cedo no decurso desta pandemia, tendo o linfoma pri-
mrio do sistema nervoso central (LPSNC) sido considerado como doena
definidora de sida desde 1981 e o LNH desde 1985.
O LNH o primeiro evento definidor de sida, em 3-4% dos infectados
por VIH, que apresentam aumento de risco relativamente populao
noinfectada, da ordem das 600 vezes para o linfoma imunoblstico e de
145 vezes para o linfoma difuso de grandes clulas51. Ao contrrio do que
se observa para o SK, no parece predominar em nenhuma das categorias
de transmisso e a sua incidncia no parece ter diminudo, de forma to
significativa, aps a introduo da TARVc. Na realidade, a reduo genera-
lizada da frequncia de intercorrncias oportunistas, ocorrida desde 1996, na
maioria dos pases industrializados, veio aumentar a importncia relativa
desta neoplasia, como evento definidor de sida, desde ento52. Um estudo
recente aponta para a relativa estabilidade epidemiolgica do linfoma no-
Hodgkin associado sida (LNHAS), entre 1982 e 1998, no que respeita
Neoplasias associadas sida 201

Quadro 3. Frequncia histolgica dos LNHAS39


Working formulation Real Frequncia
Pequenas clulas clivadas Burkitt 24-38%
Burkitt Clulas B de altograu
NoBurkitt Burkittlike
Imunoblstico de grandes clulas Clulas B grandes difuso 18-31%
Difuso de grandes clulas Clulas B grandes difuso 17-40%

idade de ocorrncia, distribuio por sexo, ausncia de predomnio em


qualquer categoria de transmisso e, mesmo, relativamente sobrevida
mdia53. A idade de ocorrncia bimodal, com picos aos 1019 e aos 5059
anos, reflectindo a ocorrncia de linfoma de Burkitt e de linfoma difuso de
grandes clulas/imunoblstico54.
O LNH, na sida, tem sido relacionado, do ponto de vista etiolgico, com
a infeco latente por VEB, embora os mecanismos exactos da oncognese
estejam ainda por esclarecer. No contexto da imunodepresso causada por
VIH, possvel que a infeco latente por VEB reactive e induza a proli-
ferao permanente e desregulada dos linfcitos B infectados. Van Baarle
et al. detectaram perda de resposta citotxica especfica para VEB, em in-
fectados por VIH, antes do desenvolvimento de LNH55. O genoma de VEB,
nestes linfcitos, exprime antignios latentes, incluindo o antignio nativo
(EBNA2) e antignios latentes de membrana (LMP1 e LMP2), condicio-
nando o rearranjo do gene cmyc. No entanto, apenas 50% dos LNHAS
apresentam vestgios de genoma de VEB, ao contrrio do que sucede com
o LPSNC e do LNH, que ocorre aps o transplante, sendo a etiologia do
LNHAS ainda obscura em muitos casos.
Histologicamente, os LNHAS so relativamente pouco variados. O qua-
dro 3 apresenta a frequncia relativa dos principais tipos histolgicos en-
contrados, de acordo com as classificaes mais utilizadas.
Do ponto de vista clnico, o LNHAS ocorre, em geral, em doentes com
contagens de linfcitos TCD4+ < 100 cls/mm3 e apresenta algumas carac-
tersticas, que o distinguem do encontrado em doentes no infectados por
VIH, apresentandose com mais frequncia de forma multicntrica, envol-
vendo, simultaneamente, vrias localizaes ganglionares e extraganglionares.
O envolvimento do SNC, particularmente das meninges, registase em cerca
de 30% dos doentes, na altura do diagnstico, e at cerca de 50% no decur-
so da doena, embora cerca de 20% no apresentem semiologia sugestiva
de meningite. Cerca de 25% dos doentes apresentam envolvimento da me-
dula ssea e 12% apresentam envolvimento heptico. Os doentes referem,
geralmente, sintomatologia do tipo B. Esto descritos LNHAS com loca-
lizao oral, parotdea, cardaca, anal e, virtualmente, em todos os rgos ou
sistemas56 (Foto 27). O LNHAS , em regra, um linfoma generalizado (es-
tdio III ou IV) e agressivo. Os factores associados com mau prognstico
incluem a elevao da desidrogenase lctica (DHL), idade superior a 35 anos,
202 Lus Caldeira

contagem de linfcitos TCD4+ inferior a 100 cls/mm3, ndice de perfor-


mance baixo e coexistncia de outras intercorrncias oportunistas 51,57.
O diagnstico processase com base na suspeita clnica (presena de
sintomatologia B, DHL elevada, presena de linfadenopatia e/ou de mas-
sas localizadas), que pode ser sobreponvel encontrada em muitas infeces
oportunistas ou, mesmo, no contexto da prpria infeco por VIH, pelo que
a biopsia de gnglios patolgicos, ou de massas suspeitas, fundamental e
deve ser considerada, precocemente, neste contexto. A puno lombar deve
ser, tambm, considerada em todos os casos de LNHAS. Os procedimentos
para estadiamento do linfoma, na sida, so semelhantes aos realizados nos
doentes noseropositivos, devendo contudo ser avaliada a possibilidade de
infiltrao do SNC, com TAC ou RMN e puno lombar de diagnstico,
que essencial para a orientao do tratamento.
Entre 1980 e 1989, observouse aumento considervel na incidncia de
LPSNC, em doentes com infeco por VIH, atingindo incidncia absoluta de
4,7/1.000 pessoasanos, correspondendo a incidncia cerca de 3.600 vezes
superior encontrada na generalidade da populao58, e equivalendo a cer-
ca de 15% dos linfomas ocorridos em doentes com sida. O LPSNC, asso-
ciado sida, , por regra, limitado ao SNC, ao contrrio do LPSNC no
relacionado com sida, que apresenta envolvimento sistmico em 10% dos
casos59. Deve, ainda, ser distinguido do envolvimento do SNC por parte
do LNHAS, o qual ocorre em cerca de 30% dos casos 60. O LPSNC, asso-
ciado sida, ocorre, em geral, no contexto de imunodepresso avanada 61
e parece ser, proporcionalmente, mais frequente medida que a sobrevida
dos doentes aumenta, facto que se pode correlacionar com a possibilidade
do envolvimento de VEB, como factor etiolgico frequente deste linfoma 62,
semelhana do que se descreve para outros tipos de LNH, associados
sida. No entanto, existem sinais de que a incidncia do LPSNC est a di-
minuir aps a introduo da TARVc63. A maioria dos LPSNC associados
sida so linfomas de clulas B activadas, geralmente imunoblsticos, com
diferenciao plasmoctica64,65, sendo o VEB encontrado em, praticamente,
todos os casos de LPSNC66. A idade mdia de apresentao clnica situase
entre os 30 e os 40 anos e manifestase pelo aparecimento de sinais focais
(paresias, convulses), em cerca de 50% dos doentes, e por cefaleias, letar-
gia, alteraes da personalidade e do estado de conscincia, nos restantes
50%67. O LPSNC apresentase, geralmente, com nmero reduzido de leses,
no associadas a edema significativo, com topografia, preferencialmente, na
regies do corpo caloso, periventricular ou periependimria, muitas vezes
com dimenses superiores a 4 cm, com edema associado e captando con-
traste de forma homognea na TAC e na RMN68,69, podendo, ocasionalmen-
te, ser difceis de distinguir de outras leses intracranianas, frequentes em
doentes com sida, tais como a toxoplasmose (que tende a apresentar leses
mais numerosas, localizadas nos ncleos basais, com edema significativo e
captao de contraste caracterstica em anel), os abcessos tuberculosos
ou fngicos e a leucoencefalopatia multifocal progressiva. Com o fim de
estabelecer o diagnstico diferencial entre o LPSNC e outras patologias
Neoplasias associadas sida 203

Quadro 4. Pautas para o tratamento do LNHAS


CHOP:
Ciclofosfamida: 750 mg/m2 ev. em 100 cc de dextrose a 5% dia um.
Vincristina: 1,4 mg/m2 mximo dois mg ev. em bolus dia um.
Doxorrubicina: 50 mg/m2 ev. em 100 cc de dextrose a 5% dia um.
Prednisolona: 100 mg/m2 per os dias um a cinco.
Ciclos repetidos de 21/21 dias.
CVP:
Ciclofosfamida: 650 mg/m2 ev. em 100 cc de dextrose a 5% dia um.
Vincristina: 1,4 mg/m2 mximo dois mg ev. em bolus dia um.
Prednisolona: 100 mg/m2 per os dias um a cinco.
Ciclos repetidos de 21/21 dias.
ESHAP:
Etoposido: 60 mg/m2 em 250 cc dextrose 5% em perfuso de uma hora dias um a quatro.
Cisplatina: 25 mg/m2 em 1.000 cc de soro fisiolgico, perfuso contnua de 24 horas,
dias um a quatro.
Metilprednisolona: 500 mg ev. em bolus dias um a quatro.
Citosina arabinosido: Dois g/m2 diludos em 500 cc dextrose 5% em perfuso de duas
horas, duas horas aps terminar a ltima perfuso de cisplatina.
Ciclos repetidos de 21/21 dias no mximo de seis.

intracranianas, habituais no contexto da infeco por VIH, deverse, na


presena de leses suspeitas detectadas nos exames imagiolgicos, proce-
derse serologia para T. gondii e iniciar teraputica convencional para a
toxoplasmose cerebral. A realizao de puno lombar pode ser til quer
para excluir a presena de meningite bacteriana, tuberculosa ou fngica,
quer para a pesquisa de VEB atravs de reaco em cadeia da polimerase
(PCR), frequentemente positiva nos casos de LPSNC, mas cuja negativida-
de no exclui o diagnstico. Nos doentes que no apresentarem melhorias
clnica e imagiolgica, ao fim de uma a duas semanas de teraputica contra
a toxoplasmose do SNC, correctamente instituda, est indicada a biopsia
cerebral, a qual, quando feita por um neurocirurgio experimentado e com
recurso s tcnicas de neuronavegao, pode conduzir ao diagnstico em
95% dos casos, com apenas 2% de complicaes70. A TAC, por emisso de
foto nico com tlio 201 (SPECT), pode ajudar na distino das leses
linfomatosas de outras de etiologia infecciosa71, mas est longe de ser es-
pecfica e no evita o recurso biopsia cerebral.
A teraputica do LNHAS coloca problemas particulares, relacionados
quer com a pouca expectativa de vida dos doentes, quer com a sua escassa
reserva medular, quer, ainda, com a necessidade frequente de associar outras
teraputicas, devido a patologias coexistentes. De forma geral, temse re-
corrido aos esquemas de quimioterapia convencional (CHOP) ou, nos casos
mais raros de linfomas de baixo grau de malignidade, nomeadamente lin-
fomas foliculares, o regime CVP (Quadro 4), com os quais se podem obter
taxas de remisso que atingem os 50%, com tolerncia aceitvel7276. A
teraputica intratecal, com metotrexato, , em geral, associada aos esquemas
204 Lus Caldeira

de teraputica sistmica, embora esta prtica acarrete riscos, s por si. A


associao do anticorpo monoclonal antiCD20 (rituximab) ao regime de
quimioterapia, que demonstrou contribuir para melhoria significativa das
taxas de remisso a longo prazo do LNH, nos doentes no infectados por
VIH, carece, ainda, de demonstrao cabal de benefcio no contexto da
infeco por VIH, uma vez que, nos estudos controlados, realizados at
hoje, os eventuais benefcios, em termos do aumento da taxa de resposta,
foram confrontados com um aumento significativo da incidncia de infeces
graves7779. O tratamento do linfoma associado sida, em segunda linha,
no tem sido objecto de estudos aleatrios. Na literatura divulgada, os maus
resultados so uniformes. O esquema, actualmente, em uso na Unidade de
Hematologia, ESHAP parece neste momento, ser o que melhores resultados
proporciona, embora com toxicidade inerente importante 80. Apesar da tera-
putica, a sobrevida associada ao LNHAS , ainda hoje, relativamente
baixa, rondando os 18 meses62.
Sem tratamento, a sobrevida mdia do LPSNC de cerca de trs meses59.
O tratamento do LPSNC baseiase na utilizao de corticoterapia associada
irradiao global do crebro, embora os benefcios da teraputica, em termos
de aumento de sobrevida, sejam reduzidos (sobrevida no superior a um ano60),
o que se relaciona, provavelmente, com a imunodepresso, geralmente avan-
ada destes doentes e os torna maus candidatos a quimioterapia.
A elevada efectividade da TARVc, na melhoria da situao imunitria,
demonstrada pelos regimes de combinao, actualmente, disponveis, asso-
ciadas comprovao da importncia da melhoria da situao imunitria do
doente com LNH com factor de resposta favorvel, levam recomendao
de que a TARVc deve ser administrada, em simultneo, com a quimioterapia
e assegurada depois da teraputica citosttica ter terminado. A incidncia de
complicaes infecciosas no superior, em estudos aleatrios, durante o
perodo de quimioterapia. A melhoria da imunidade do doente determinan-
te, para a obteno de remisses mantidas da doena linfoproliferativa 74.
Recentemente81, foi descrito um novo tipo de linfoma associado a cavi-
dades serosas, tambm chamado linfoma primrio de efuso ou linfoma
primrio das cavidades serosas, que se caracteriza pela presena de derrames
em cavidades virtuais, como a pleura e o pericrdio, na ausncia de massas
tumorais slidas82. Estes tumores dos linfcitos B, que constituem menos do
que 4% dos LNHAS83, esto, quase sempre, associados a infeco por VHH8
e, em muitos casos, por VEB84. Estes tumores, que ocorrem, em geral, em
doentes com contagem de linfcitos TCD4+ < 100 cls/mm3, associamse a
escassa taxa de resposta aos regimes de quimioterapia, habitualmente, uti
lizados para LNHAS e a uma sobrevida mdia de cinco meses85.

Carcinoma invasivo do colo do tero/neoplasia cervical intraepitelial


A associao do carcinoma invasivo do colo uterino (CICU) e da neoplasia
cervical intraepitelial (NCI) com VPH , hoje, amplamente reconhecida,
sendo aceite que a imunodeficincia associada a VIH um factor de risco
Neoplasias associadas sida 205

para o aumento da incidncia desta neoplasia, que foi integrada nos critrios
de sida do CDC de Atlanta desde 1993.
VPH um vrus icosadrico nocapsulado, com dupla cadeia de ADN,
cuja transmisso por contacto sexual est bem estabelecida. A zona do colo
uterino mais susceptvel infeco por VPH o epitlio de transio entre
os epitlios escamoso e colunar, que comea a desenvolverse desde a puber-
dade. A prevalncia de infeco por VPH, nos EUA, de cerca de 30% em
alunas universitrias, mas pode ser mais elevada noutras regies do globo.
Mais de 60 subtipos de VPH esto descritos, embora com diferentes potenciais
oncognicos, sendo os subtipos 16, 18, 31, 33 e 35 os que, com maior fre-
quncia, se associam ao desenvolvimento de NCI e de CICU.
Em mulheres infectadas por VIH, a prevalncia de infeco por VPH
pode atingir 58%, parecendo aumentar com o grau de depresso imunitria
e com o aumento da carga vrica de VIH, podendo ser detectada infeco
por mais do que um subtipo de VPH, em 42% das doentes contra 16% em
doentes seronegativas86. Um estudo, patrocinado pelo CDC87, aponta para a
possibilidade de uma em cada cinco mulheres seropositivas para VIH, sem
leses prvias do colo uterino, virem a desenvolver NCI, ao fim de trs
anos, o que atesta a importncia do rastreio citolgico regular nestas doen-
tes. De notar, ainda, que a infeco por VPH depende de outros factores,
tais como o nmero de parceiros sexuais e a idade de incio das relaes
sexuais, pelo que os aspectos epidemiolgicos especficos desta infeco e
das suas consequncias, no contexto da infeco por VIH, devem ser en-
quadrados num cenrio multifactorial.
O impacto da TARVc, na incidncia de NCI e de CICU, no parece ser
muito significativo, na medida em que no parece reduzir a prevalncia de
infeco cervical por VPH, embora possa contribuir para melhorar ou esta-
bilizar leses de NCI j estabelecidas88,89. Por outro lado, e apesar de ser
critrio de sida, a prevalncia de CICU no apresentou aumento significati-
vo de incidncia nas mulheres infectadas por VIH, de acordo com os ltimos
dados da vigilncia epidemiolgica do Institute of Human Virology de Be-
thesda, embora a incidncia de leses neoplsicas in situ seja, significativa-
mente, mais elevada neste grupo, do que na ausncia de infeco por VIH90.
Para este facto, poder, eventualmente, contribuir reduo da depurao local
de VPH, observada em mulheres seropositivas para VIH91.
O diagnstico da NCI e do CICU, em infectadas por VIH, assenta em
rastreios citolgicos (Papanicolau) regulares (seis meses a um ano), poden-
do a monitorizao da infeco por VPH vir a dar um contributo importan-
te, dado o aumento da sensibilidade para a deteco de NCI 92.
O tratamento da NCI, de grau II ou III, mandatrio, no sentido de pre
venir a progresso para CICU, e processase como recurso a crioterapia, vapo-
rizao com laser ou LEEP, nos casos em que toda a zona de transio vi-
sualizvel por colposcopia e na ausncia de evidncia de invaso cervical. Nos
casos restantes, recorrese conizao cervical. Nas mulheres seropositivas para
VIH, a vigilncia regular mandatria, aps o tratamento, tendo em conta a
elevada taxa de recidiva ao fim de um ano (entre 40 e 50%)93.
206 Lus Caldeira

O CICU, por outro lado, apresenta mau prognstico no contexto da


infeco por VIH, quer pelo carcter, particularmente, agressivo de que se
reveste, quer pela elevada taxa de recidivas aps tratamento. Este facto
torna, em particular, relevante a necessidade de proceder a rastreios regu-
lares e ao tratamento agressivo de leses precursoras (NCI II e III), em
mulheres portadoras de infeco por VIH.

Outras neoplasias
Para alm destas trs neoplasias, que se incluem nos critrios de definio
de sida, hoje evidente que outros tumores ocorrem com frequncia aumen-
tada nos doentes portadores de infeco por VIH94. De facto, a neoplasia
anal intraepitelial parece estar hoje, fortemente, associada infeco por
VIH, particularmente em homossexuais masculinos95, mas o seu aumento
relativo na categoria de transmisso com contactos homossexuais e a sua
eventual associao com VPH podem ser factores de enviesamento, que
merecem ainda melhor esclarecimento. A sua relao etiolgica com VPH
est, tambm, estabelecida. O tratamento depende das dimenses da leso
inicial e da existncia de metstases, baseandose na irradiao local, em
tumores solitrios com dimetro 5 cm (cura em 70-90% dos casos) e na
associao de radioterapia local com quimioterapia com 5fluorouracilo e
cisplatina, em tumores com metstases ganglionares regionais e/ou com mais
de cinco cm de dimetro (50-70% de cura). Nos tumores disseminados, o
prognstico consideravelmente mais reservado, dependendo sempre do
estado geral e imunitrio do doente.
Goedert, et al., num trabalho de vigilncia epidemiolgica das neoplasias
em doentes com sida, na Austrlia, encontraram aumentos estatisticamente
significativos nas taxas de incidncia, no apenas para o SK (310 vezes)
e o LNH (113 vezes), como para as leucemias mielides e nomielides
(11 vezes), o linfoma de Hodgkin (7,6 vezes), o mieloma mltiplo (4,5 ve-
zes), os tumores cerebrais (3,5 vezes) e o seminoma (2,9 vezes) 96, apoiando
a ocorrncia aumentada de outras neoplasias, no contexto da infeco por
VIH. O linfoma de Hodgkin, particularmente, tem vindo a ser citado como
uma potencial neoplasia oportunista associada a sida, sendo certo que as-
sume um carcter particularmente agressivo, quando conectada com esta,
com caractersticas histolgicas particulares relacionadas com uma maior
frequncia de doena extraganglionar, de sintomatologia B, menor sobrevi-
da ao fim de um e de dois anos aps o tratamento, e uma maior frequncia
de identificao de genoma de VEB, no tecido do linfoma, que pode atingir
90% dos casos nos doentes infectados por VIH97.

Bibliografia
1. Ehrlich P. The collected works of Paul Ehrlich. Vol. 2. Londres: Pergamon Press; 1956. p. 550.
2. Burnet FM. The concept of immunological surveillance. Prog Exp Tumor Res. 1970;13:127.
3. Schwartz RS. Immunosupression and Lymphomas, International Symposium on HIV, Leukemia and Opportunistic
Cancers; 1999.
Neoplasias associadas sida 207

4. Penn I. Cancers complicating orgam transplantation. N Engl J Med. 1990;323:1767.


5. McGrath MS, Shiramizu B, Herndier BG. Sequential pathogenesis: A model implicating role for clonal mac-
rophages in neoplastic and degenerative HIVassociated diseases [abstract 81]. 3rd National AIDS Malignancy
Conference. Bethesda, MD; 1999.
6. Schwartz RS, Beldotti L. Malignant lymphomas following allogenic disease: transition from an immunological
to a neoplastic disorder. Science. 1965;149(691):15114.
7. Brennan R, Durack D. Gay compromise syndrome. Lancet. 1981;2:13389.
8. Blattner WA. Institute of Human Virology, Baltimore. Immunosupression and Lymphomas, International Sympo-
sium on HIV, Leukemia and Opportunistic Cancers; 1999.
9. Beral V, Peterman TA, Berkelman RL, Jaffe HW. Kaposis sarcoma among persons with AIDS: a sexually trans-
mitted infection? Lancet. 1990;335:1238.
10. Gallo R. Kaposis sarcoma: Where do we go from here? 3rd National AIDS Malignancy Conference. Bethesda,
MD; 1999.
11. Brodt HR, Kamps BS, Gute P, et al. Changing incidence of AIDSdefining illnesses in the era of antiretroviral
combination therapy. AIDS. 1997;11:17318
12. Michaels SH, Clark R, Kissinger P. Declining morbidity and mortality among patients with advanced HIV infec-
tion. N Engl J Med. 1998;339:4056.
13. Mocroft A, Sabin CA, Youle M, et al. Changes in AIDSdefining illnesses in a London clinic, 19871998. J
Acquir Immune Defic Syndr. 1999;21:4017.
14. Mocroft A, Katlama C, Johnson AM, et al. AIDS across Europe, 19941998: The EuroSIDA study. Lancet.
2000;356:2916.
15. Brian TR, Kedes D, Ganem D, et al. Evidence for concurrent epidemics of human herpesvirus 8 and human
immunodeficiency virus type I in US homosexual men: rates, risk factors, and relationship to Kaposis sarcoma.
J Infect Dis. 1999;180:10107.
16. Chang Y, Cesarman E, Pessin MS, et al. Identification of herpesviruslike DNA sequences in AIDSassociated
Kaposis sarcoma. Science. 1994;266(5192):18659.
17. Moore PS, Chang Y. Detection of herpesviruslike DNA sequences in Kaposis sarcoma in patients with and
those without HIV infection. N Engl J Med. 1995;332:11813.
18. Gao SJ, Kingsley L, Hoover DR, et al. Seroconversion to antibodies against Kaposis sarcomaassociated
Herpesviruslike latent nuclear antigens before the development of Kaposis sarcoma. N Engl J Med. 1996;335:
23341.
19. Albini A, Soldi R, Giunciuglio D, et al. The angiogenesis induced by HIV1 Tat protein is mediated by the Flk1/
KDR receptor of vascular endothelial cells. Nat Med. 1996;2:13715.
20. Martin J. Diagnosis and epidemiology of HHV8 infection. Semin Hematol. 2003;40:13342.
21. Dukers N, Rezza G. Human herpesvirus 8 epidemiology: what we do and what we do not know. AIDS.
2003;17:171730.
22. Whitby D, Luppi M, Barozzi P, et al. Human herpesvirus seroprevalence in blood donors and lymphoma patients
from different regions of Italy. J Natl Cancer Inst. 1998;90:3957.
23. Engels E, Sinclair M, Biggar R, et al. Latent analysis of HHV8 assay performance and infection prevalence in
subsaharan Africa. Int J Cancer. 2002;88:10038.
24. Cunha AMG, Arajo AC, Costa SC, et al. Increasing seroprevalence of Human herpesvirus 8 (HHV8) with age
confirms HHV8 endemicity in Amazon Amerindians from Brazil. J General Virol. 2005;86:24337.
25. Cottoni F, De Marco R, Montesu M. Classical KS in northeast Sardinia: an overview from 1977 to 1991. Br J
Cancer. 1996;73:11323.
26. Moses AV, Fish K, Ruhl R, et al. HHV8/KSHV infects dermal endothelial cells and macrophages: implications
for Kaposis sarcoma [abstract 75]. 3rd National AIDS Malignancy Conference. Bethesda, MD; 1999.
27. Renne R, Barry C, Dittmer D, et al. Modulation of cellular and viral gene expression by the latencyasociated
nuclear antigen of Kaposis sarcomaassociated herpesvirus. J Virol. 2001;75:45868.
28. Zaldumbide A, Ossevoort M, Wiertz M, et al. In cis inhibition of antigen processing by the latencyassociated
nuclear antigen I of Kaposi sarcoma herpes virus. Mol Immunol. 2007;44:135260.
29. Monini P, Colombini S, Sturzl M, et al. Reactivation and persistence of human herpesvirus8 infection in B cells
and monocytes by Th1 cytokines increased in Kaposis sarcoma. Blood. 1999;93:404458.
30. Hideshima T, Chauhan D, Teoh G, et al. Characterization of signaling cascades triggered by human IL6 versus
KSassociated herpes virus encoded IL6. Clin Cancer Res. 2000;6:11809.
31. Guo H, Browning P, Nicholas J, et al. Characterization of a acemokine receptorrelated gene in HHV8 and its
expression in KS. Virology. 1997;228:3718.
32. Bais C, Santomaso B, Coso O. Gprotein coupled receptor of KSassociated herpesvirus is a viral oncogene and
angiogenesis activator. Nature. 1998;391:869.
33. Ganem D. KSHV/HHV8 infection and the pathogenesis of AIDSrelated neoplasms: An overview [abstract S7].
3rd National AIDS Malignancy Conference. Bethesda, MD; 1999.
34. Lassoued K, Clauvel JP, Fegueux S, et al. AIDS associated Kaposis sarcoma in female patients. AIDS.
1991;5:87780.
35. Monini P, De Lellis L, Fabris M, et al. Kaposis sarcomaassociated herpes virus DNA sequences in prostate
tissue and human semen. N Engl J Med. 1996;334:116872.
36. Cesarman E, Chang Y, Moore PS, et al. Kaposis sarcomaassociated herpesviruslike DNA sequences in
AIDSrelated bodycavitybased lymphomas. N Engl J Med. 1995;32:118691.
37. Safai B, Goog RA. Kaposis sarcoma: a review and recent developments. Cancer. 1981;31:39.
38. Scott LF, Wright TL, Altman DF. Gastrointestinal Kaposis sarcoma in patients with AIDS. Gastroenterology.
1988;89:10210.
39. Caray SM, Belenko M, Fazzini E, et al. Pulmonary manifestations of Kaposis sarcoma. Chest. 1987;91:
3948.
40. Mitsuyasu RT. Interferon alpha in the treatment of AIDSrelated KS. Br J Haematol. 1991;79:6973.
208 Lus Caldeira

41. Maserati R, Mongiovetti M, Vaccher E, et al. Effects of HAART regimen as exclusive treatment of slow prolif-
erating Kaposis sarcoma [abstract TuOrB302]. Program and abstracts of the XIII International AIDS Conference.
Durban, frica do Sul; 914 Julho 2000.
42. Cattelan AM, Aversa S, Calabro I, et al. Antiretroviral therapy with HIVprotease inhibitors in the treatment of
AIDSrelated Kaposis sarcoma: clinical and biological correlations [abstract TuPeB3163]. Program and abstracts
of the XIII International AIDS Conference. Durban, frica do Sul; 914 Jullho 2000.
43. Levine A. AIDSrelated malignancies. Disponvel em: http//www.medscape.com/medscape/cno/1997
44. Stewart S, Jablonowski H, Goebel FD, et al. Randomized comparative trial of pegylated liposomal doxorubicin
versus bleomycin and vincristine in the treatment of AIDSrelated Kaposis sarcoma. International Pegylated
Liposomal Doxorubicin Study Group. J Clin Oncol. 1998;16:68391.
45. Gill PS, Wernz J, Scadden DT, et al. Randomized phase III trial of liposomal daunorubicin versus doxorubicin,
bleomycin and vincristine in AIDSrelated Kaposis sarcoma. J Clin Oncol. 1996;14:235364.
46. Stewart S, Jablonowski H, Goebel FD, et al. Randomized comparative trial of pegylated liposomal doxorubicin
versus bleomycin and vincristine in the treatment of AIDSrelated Kaposis sarcoma. International Pegylated
Liposomal Doxorubicin Study Group. J Clin Oncol. 1998;16:68391.
47. Gill PS, Wernz J, Scadden DT, et al. Randomized phase III trial of liposomal claunorubicin versus doxorubicin,
bleomycin and vincristine in AIDSrelated Kaposis sarcoma. J Clin Oncol. 1996;14:235364.
48. Sgadari S, Toschi E, Palladino C, et al. Mechanism of paclitaxel activity in Kaposis sarcoma. J Immunol.
2000;165:50917.
49. Brambilla L, Romanelli A, Bellinvia M, et al. Weekly paclitaxel for advanced aggressive classic Kaposi sarcoma:
experience in 17 cases. Br J Dermatol. 2008;158(6):133944.
50. Tulpule A, Groopman J, Saville MW, et al. Multicenter trial of lowdose paclitaxel in patients with advanced
AIDSrelated Kaposi sarcoma. Cancer. 2002 Jul 1;95(1):14754.
51. Cote TR, Biggar RF, Rosenberg PS, et al. NonHodgkins lymphoma among people with AIDS: incidence,
presentation and public health burden. Int J Cancer. 1997;73:64550.
52. Ledergerber B, Telenti A, Egger M, for the Swiss HIV Cohort Study. Risk of HIV related Kaposis sarcoma and
nonHodgkins lymphoma with potent antiretroviral therapy: prospective cohort study. BMJ. 1999;319:234.
53. Seneviratne LC, Espina BM, Tulpule A, et al. Evolving characteristics of AIDSrelated lymphoma overtime: a
single institution study of 369 patients. J AIDS Hum Retrovirol. 1999;21:34.
54. Bower M, Fife K. HIVassociated malignancy. Em: Gazzard B, ed. Chelsea and Westminster Hospital AIDS
Care Handbook. 1999;2(6):93111.
55. Van Baarle D, Hovenkamp E, Kersten MJ, et al. Role of EpsteinBarr virus in the development of AIDSrelated
nonHodgkins lymphoma [abstract 83]. 3rd National AIDS Malignancy Conference. Bethesda, MD; 1999.
56. Levine AM. AIDSrelated lymphoma. Blood. 1992;80:820.
57. Straus D, Juang J, Testa M, Levine AM, Kaplan L. Prognostic factors in the treatment of HIVassociated nonHodgkins
lymphoma: Analysis of ACTG 142 (low dose vs standard dose mBACOD + GMCSF). Blood. 1995;86:604.
59. Herrlinger U. Primary CNS lymphoma: findings outside the brain. J Neurooncol. 1999;43:22730.
60. Kaplan LD, Abrams DI, Feigel F, et al. AIDSassociated nonHodgkins lymphoma in San Francisco. JAMA.
1989;261:71924.
61. Levine AM. Epidemiology, clinical characteristics, and management of AIDSrelated lymphoma. Hematol Oncol
Clin North Am. 1991;5:33142.
62. Pluda JM, Yarchoan R, Jaffe ES, et al. Development of nonHodgkins lymphoma in a cohort of patients with
severe human immunodeficiency virus on long term antiretroviral therapy. Ann Intern Med. 1990;113:27682.
63. Sparano JA, Anand K, Desai J, et al. Effects of highly active antiretroviral therapy on the incidence of HIVas-
sociated malignancies at an urban medical center. J Acquir Immune Defic Syndr. 1999;21 Suppl 1:1822.
64. Antinori A, Laroca LM, Fassone L, et al. HHV8/KSHV is not associated with AIDSrelated primary central
nervous system lymphoma. Brain Pathol. 1999;9:199208.
65. CamilleriBroet S, Criniere E, Broet P, et al. A uniform activated Bcelllike immunophenotype might explain the
poor prognosis of primary central nervous system lymphomas: analysis of 83 cases. Blood. 2006;107:1906.
66. MacMahon EM, Glass JD, Hayward SD, et al. EpsteinBarr virus in AIDSrelated primary central nervous system
lymphoma. Lancet. 1991;338:96973.
67. Rosenblum ML, Levy RM, Bredesen DE. Primary central nervous system lymphoma in patients with AIDS. Ann
Neurol. 1988;23:136.
68. Radin DR, Esplin JA, Levine AM, Ralls PW. AIDSrelated nonHodgkins lymphoma: abdominal CT findings
in 112 patients. Am J Roentgenol. 1993;160:11339. 1994;49:45660.
69. Goldstein JD, Zeifer B, Chao C, et al. CT appearance of primary CNS lymphoma in patients with acquired
immunodeficiency syndrome. J Comput Assist Tomogr. 1991;15:3944.
70. Levy RM, Russell E, Yungbluth M, et al. Efficacy of image guided stereotactic brain biopsy in neurologically
symptomatic acquired immune deficiency syndrome patients. Neurosurgery. 1992;30:18690.
71. Antinori A, De Rossi G, Ammassari A, et al. Value of combined approach with thallium201 single emission
computed tomography and EpsteinBarr virus DNA polymerase chain reaction in CSF for the diagnosis of
AIDSrelated primary CNS lymphoma. J Clin Oncol. 1999;17:55460.
72. Levine AM, Wernz JC, Kaplan L, et al. Low dose chemotherapy with CNS prophylaxis and zidovudine main-
tenance for AIDSrelated lymphoma: a prospective multiinstitutional trial. JAMA. 1991;266:848.
73. Kaplan L, Staus D, Testa M, Levine AM. Randomized trial of standard dose mBACOD with GMCSF vs reduced
dose mBACOD for systemic HIVassociated lymphoma. ACTG 142. Proc ASCO. 1995;14:288.
74. Navarro JT, Ribera JM, Oriol A, et al. Influence of highly active antiretroviral therapy on response to treatment
and survival in patients with acquired immunodeficiency syndromerelated nonHodgkins lymphoma treated with
cyclophosphamide, hydroxydoxorubicin, vincristine and prednisone. Br J Haematol. 2001;112(4):90915.
75. Vaccher E, Spina M, Gennaro G, et al. Concomitant cyclophosphamide, doxorubicin, vincristine, and prednisone
hemotherapy plus highly active antiretroviral therapy in patients with human immunodeficiency virusrelated,
nonHodgkin lymphoma. Cancer. 2001;91(1):15563.
Neoplasias associadas sida 209

76. Levine AM, Espina BM, Yuzon R, et al. Treatment of relapsed/refractory AIDS related lymphomas with high
dose cytarabine/cisplatin combination regimens. J Acq Immunodef Synd. 2000;23:A24.
77. Spina M, Sparano M, Jaeger U, et al. Rituximab and chemotherapy is highly effective in patients with CD20pos-
itive nonHodgkins lymphoma and HIV infection. AIDS. 2003;17:1378.
78. Bou F, Gabarre J, Gisselbrecht C, et al. CHOP chemotherapy plus rituximad in HIV patients with high grade
lymphoma Results of an ANRS trial [abstract 1824]. Proc Am Soc Hematol. 2002;470a.
79. Kaplan LD, Scadden DT, for the AIDS Malignancies Consortium. No benefit from rituximab isn a randomized
phase III trial of CHOP with or without rituximab for patients with HIVassociated mnonHodgkins lymphoma:
AIDS Malignancies Consortium study 010 [abstract 2268]. Proc Am Soc Clin Oncol. 2003;22:564.
80. Mota Fajardo J, Gomes dOliveira A, et al. Tratamento dos linfomas associados infeco VIH. Em: Teraputica
Mdica em Hematologia (Servio de Hematologia). Servio de Hematologia Clnica, Hospital de Santa Maria;
2006.
81. Nador RG, Cesarman E, Chadburn A, et al. Primary effusion lymphoma: a distinct clinicopathologic entity
associated with the Kaposis sarcomaassociated herpes virus. Blood. 1996;88(2):64556.
82. Boshoff C, Weiss R. AIDSrelated malignancies. Nat Rev Cancer. 2002;2(5):37382.
83. Chen Y, Rahemtullah A, Hochberg BE. Primary effusion lymphoma. The Oncologist. 2007;12:56976.
84. Cesarman E, Chang Y, Moore PS, et al. Kaposis sarcomaassociated herpesviruslike DNA sequences in
AIDSrelated bodycavitybased lymphomas. N Engl J Med. 1995;332(18):118691.
85. Waddington TW, Aboulafia DM. Failure to eradicate AIDSassociated effusion lymphoma with highdose che-
motherapy and autologous stem cell reinfusion: care report and literature review. AIDS patient care and STDS.
2004;18(2):6773.
86. Palefsky JM, Minkoff H, Kalish LA, et al. Cervicovaginal human papillomavirus infection in human immuno-
deficiency virus1 positive and high risk HIVnegative women. J Natl Cancer Inst. 1999;91:22636.
87. Ellerbrock TV, Chiasson MA, Bush TJ, et al. Incidence of cervical squamous intraepithelial lesions in HIVinfected
women. JAMA. 2000;283(8):10317.
88. Heard I, Schmitz V, Costagloila D, et al. Early regression of cervical lesions in HIV seropositive women receiv-
ing highly active antiretroviral treatment (HAART) [abstract 22.312]. Program and Abstracts of the 12th World
AIDS Conference. Genebra, Suia; 1998.
89. Sperandeo D, RobagliaSchlupp A, et al. Trying to know the role of viral load and ARBV therapies in the
progression of cervical disease [abstract 22.321]. Program and abstracts of the 12th World AIDS Conference.
Genebra, Suia; 1998.
90. Blattner WA. Institute of Human Virology. International Symposium on HIV, Leukemia and Opportunistic Cancers.
Baltimore; 1999.
91. Hankins C, Coutlee F, Lapointe N, Tran T, Hum L. Persistence of human papillomavirus (HPV) infection in
HIVpositive and HIVnegative women [abstract 22.303]. Program and Abstracts of the 12th World AIDS Confer-
ence. Genebra, Suia; 29 Junho3 Julho 1998.
92. Manos MM, Kinney WK, Hurley LB, et al. Identifying women with cervical neoplasia: Using human papil-
lomavirus DNA testing for equivocal Papanicolaou results. JAMA. 1999;281:160510.
93. Maiman M, Fruchter RG, Serur E, et al. Recurrent cervical intraepithelial neoplasia in HIV seropositive women.
Obstet Gynecol. 1993;82:1704.
94. Grulich AE. Cancer risk in persons with HIV/AIDS in the era of combination antiretroviral therapy. The AIDS
Reader. 2000;10(6):3416.
95. Biggar RJ, Melbye M. Marital status in relation to Kaposis sarcoma, nonHodgkins lymphoma, and anal cancer
in the preAIDS era. J Acquir Immune Defic Syndr. 1996;11:17882.
96. Goedert JJ. Spectrum of AIDSrelated malignancies [abstract 126]. International Symposium on HIV, Leukemia
and Opportunistic Cancers. Marrakech; 1999.
97. Glaser S, Clarke C, Gulley M, et al. Populationbased HIV associated Hodgkins disease in San Francisco Bay
Area, 19881998 [abstract 3]. Program and Abstracts of the 6th International Conference on Malignancies and
AIDS & Other Immunodeficiencies. Bethesda, EUA; Abril 2002.
VI SECO

Doenas associadas
infeco por VIH
VI Seco
Captulo 1

Manifestaes orais*
Patrcia Pacheco

As patologias orais so muito frequentes, no decurso da infeco por VIH,


pelo que a observao detalhada da cavidade oral deve fazer parte da obser
vao mdica de rotina destes doentes. As leses observadas so de etiolo-
gia variada, incluindo processos de natureza infecciosa (fngica, vrica e
bacteriana), neoplsica (linfoma e sarcoma de Kaposi [SK]) e idioptica
(lceras aftosas e doena das glndulas salivares).
A tricoleucoplasia oral e a candidose oral constituem marcadores clni-
cos de infeco por VIH sintomtica, enquanto as leses orais, como o SK,
as lceras por vrus citomeglico e as lceras por herpes simplex (quando
persistem mais de um ms) so marcadores clnicos de sida 1. Para alm de
constiturem um indicador de progresso da imunodepresso, a presena de
algumas leses orais poder indiciar uma infeco retrovrica previamente
desconhecida.

Leses fngicas
A candidose a leso oral mais frequente na infeco por VIH. As espcies
de Candida fazem parte da flora oral normal, estando a maioria dos doen-
tes colonizados por Candida albicans2 ou, ocasionalmente, por C. glabrata,
C. tropicalis, C. krusei e C. dubliniensis, entre outras. A progresso da co
lonizao para a infeco pode ocorrer no perodo de infeco retrovrica
aguda3, mas mais frequente em estdios avanados, quando a contagem
de linfcitos TCD4+ < 200 cls/mm3. Na ausncia de recuperao imunit-
ria, a candidose oral tem tendncia a tornarse patologia recidivante. O uso
prolongado e repetido de antifngicos conduz seleco de espcies mais
resistentes teraputica, motivo pelo qual as infeces causadas por espcies

*Nota do editor: Este captulo no foi actualizado em relao 3.a edio do Manual sobre sida (2008)
214 Patrcia Pacheco

noalbicans ocorrem, sobretudo, em doentes com imunodepresso grave e


com extensa exposio prvia ao fluconazol4,5.
As manifestaes clnicas da candidose oral so variadas, podendo coexis
tir diversas formas num mesmo doente. A doena , em regra, bem tolera-
da mas pode condicionar, ocasionalmente, alteraes do paladar ou dor.
Classicamente, distinguemse as seguintes apresentaes:
1 Pseudomembranosa: Constitui a forma mais frequente, manifestan-
dose por placas brancas, cremosas, que podem envolver qualquer
parte da boca ou da faringe. Ao serem removidas com uma esp-
tula, a mucosa subjacente apresentase frivel.
2 Eritematosa: Leses atrficas eritematosas, mais frequentes no
palato e na lngua.
3 Queilite angular: Leses fissuradas eritematosas, localizadas nos
cantos da boca, condicionando dor e dificuldade na abertura da
boca.
4 Hipertrfica ou hiperplsica: Situao menos frequente, muito si-
milar tricoleucoplasia oral, caracterizandose por placas nodes-
tacveis, que envolvem a superfcie ventral da lngua ou o palato
e a mucosa jugal.
O diagnstico de candidose , essencialmente, clnico. Contudo, quando
existem dvidas, nomeadamente na candidose hipertrfica, lcito a reali-
zao de um exame directo de um esfregao de mucosa, o qual poder
demonstrar a presena de hifas. A cultura importante para determinao
da espcie, mas no para o diagnstico.
O tratamento da candidose oral pode ser tpico ou sistmico, devendo
ser mantido durante uma a duas semanas. O tratamento tpico prefervel,
uma vez que, no sendo absorvido, limita o potencial de efeitos txicos e
de interaces medicamentosas, no entanto, depende da capacidade de
adeso do doente. Assim, por exemplo, a soluo de nistatina oral deve ser
bochechada durante alguns minutos, antes da sua deglutio, cinco vezes
por dia durante 10 dias. O uso de imidazis sistmicos (fluconazol e itraco
nazol), implicando uma toma nica diria, est associado ao mais rpido
desaparecimento das leses e a maior percentagem de cura micolgica. A
resposta ao tratamento boa, com melhoria clnica em dois a cinco dias.
No caso de no ocorrer recuperao imunitria, a possibilidade de recada
da infeco elevada. Quando a candidose oral refractria ao tratamen-
to pode ser feito um exame cultural, com identificao da espcie e um
teste de susceptibilidade antifngica. Atendendo possibilidade de resis-
tncia cruzada entre os imidazis 6, a teraputica de segunda linha poder
ser seleccionada com base nos resultados dos testes de susceptibilidade
antifngica.
Existem outras infeces fngicas oportunistas na infeco por VIH que,
embora raramente, se podem manifestar por leses da cavidade oral, nome-
adamente a histoplasmose e a criptococose7,8. A apresentao varivel
(lceras, massas e placas), sendo o diagnstico confirmado por biopsia da
leso.
Manifestaes orais 215

Leses vricas
As patologias orais de etiologia vrica, que se encontram mais vezes no
decurso da infeco por VIH, so as causadas por vrus herpes simplex
(VHS) e por vrus de EpsteinBarr (VEB). Atingindo, ocasionalmente, a
cavidade oral so de referir as infeces por vrus Varicellazster (VVZ),
vrus do papiloma humano (VPH) e vrus citomeglico (VCM).
VHS pode causar infeco primria ou secundria. A gengivoestomatite
herptica a manifestao primria da doena. A recidiva da infeco her-
ptica possvel, uma vez que o vrus se aloja no trigmio, condicionando
reaparecimento de leses vesiculares/ulceradas labiais. Em alguns doentes
podem ocorrer, concomitantemente, leses herpticas na mucosa que
ratinizada oral (palato duro e gengivas), condicionando dor e dificuldade na
deglutio. O diagnstico clnico, podendo ser confirmado por biopsia. O
aciclovir oral diminui a durao das leses, devendo ser usado durante sete
a 10 dias.
VEB responsvel pela tricoleucoplasia oral, a qual consiste em leses
brancas irregulares, no removveis, envolvendo, em regra, os bordos da
lngua, uni ou bilateralmente. Esta patologia , habitualmente, assintomti-
ca, no necessitando de tratamento. Apesar de poder ocorrer em todos os
estdios da infeco VIH, mais frequente quando a contagem de linfci-
tos TCD4+ < 200 cls/mm3, estando, estatisticamente, associada a maior
risco de progresso da infeco retrovrica9.
Os condilomas orais, causados por VPH, so assintomticos e podem
localizarse em qualquer local da cavidade oral. O tratamento (remoo ci
rrgica) necessrio, apenas, por razes cosmticas ou funcionais.
VCM pode provocar, ocasionalmente, lceras da cavidade oral. Esta pa
tologia oral pouco frequente, ocorrendo em situaes de grave depresso
imunitria (TCD4+ < 50 cls/mm3) e no contexto de infeco por VCM
disseminada. O diagnstico confirmado por biopsia e o tratamento consis
te na administrao de valganciclovir.

Leses bacterianas
A doena periodontal uma patologia comum nos doentes com infeco
por VIH10, podendo assumir duas formas, isto , uma infeco grave e ra
pidamente progressiva periodontite ulcerativa necrotizante (PUN) e uma
forma mais ligeira eritema gengival linear (EGL). No EGL, as margens
das gengivas apresentam uma linha eritematosa e edemaciada e o doente
pode apresentar dor e gengivorragias. A PUN tem um incio agudo, traduzin
dose por rpida destruio dos tecidos moles e do osso subjacente. A
flora bacteriana, responsvel pela doena periodontal, na populao infec-
tada por VIH, semelhante encontrada na populao noinfectada. O
tratamento do EGL consiste em antisspticos locais, e no caso da PUN
necessrio, tambm, desbridamento e antibioterapia.
216 Patrcia Pacheco

Muito raramente ocorrem outras leses orais de etiologia bacteriana, no


meadamente provocadas por Mycobacterium spp, que se manifestam por massas
granulomatosas na cavidade oral11, sendo o diagnstico confirmado por biopsia.

Leses neoplsicas
O SK e o linfoma noHodgkin (LNH) so duas neoplasias associadas
infeco por VIH, que constituem critrios definidores de sida. Ambas as
neoplasias tm na sua etiopatognese uma infeco vrica (condio neces-
sria mas no suficiente), nomeadamente VEB no LNH e vrus herpes
humano tipo 8 (VHH8) no SK12.
O SK uma neoplasia vascular de apresentao clnica varivel, poden-
do manifestarse, apenas, por leses na cavidade oral, embora, mais frequen
temente, apresente componente cutneo concomitante 13. As leses orais so
de tom violceo, podendo ser planas ou nodulares e nicas ou mltiplas.
Habitualmente, ocorrem no palato duro, mas pode ser atingida qualquer
parte da mucosa oral, incluindo as gengivas (Foto 28). Ocasionalmente, as
leses tumorais esto envolvidas por uma mucosa de tom amarelado. O
diagnstico clnico e histolgico. O tratamento depende do estadiamento
da neoplasia, nomeadamente da existncia de leses cutneas e/ou viscerais.
No caso de leses orais isoladas, que interfiram com a alimentao ou a
linguagem, pode efectuarse teraputica local, incluindo remoo cirrgica,
quimioterapia intralesional ou radioterapia dirigida.
O LHN pode manifestarse como massa de tecidos moles intraoral, com
ou sem envolvimento do osso subjacente, ou como ulcerao oral persisten
te14. O exame histolgico essencial para o diagnstico e o tratamento
depende do estadiamento.

Leses idiopticas
Os doentes com infeco por VIH apresentam, ocasionalmente, lceras af
tosas recorrentes (UAR) da mucosa oral, de etiologia desconhecida 15. As
leses so nicas ou mltiplas, circunscritas por margens eritematosas, e
so de tamanho varivel (desde 0,1 mm at 4 cm). Habitualmente, distin-
guemse trs tipos de UAR:
1 UAR minor: Leses solitrias com 0,51 cm.
2 UAR herpetiforme: Conglomerados de pequenas lceras (0,10,2 cm)
no palato e na orofaringe.
3 UAR major: Habitualmente, leso nica, com 24 cm de dimetro,
dolorosa e persistente.
O diagnstico diferencial das UAR minor deve ser feito com as leses
herpticas intraorais (as quais ocorrem no epitlio queratinizado, enquanto
as UAR aparecem na mucosa noqueratinizada). Nas UAR major, neces-
sria a biopsia, para excluso de outras patologias, nomeadamente do linfo-
ma. O tratamento das UAR inclui diversas opes, nomeadamente a cortico
terapia tpica e a talidomida oral.
Manifestaes orais 217

Outra leso idioptica, que ocorre, em associao com a infeco por


VIH, a doena das glndulas salivares, nomeadamente, a hipertrofia paro
tdea benigna16. A etiologia desta doena desconhecida e o tratamento
sintomtico, com a utilizao de estimulantes da produo salivar (pastilhas
elsticas) ou substitutos salivares sintticos.

Bibliografia
1. Centers for Disease Control: 1993 Revised classification system for HIV infection and expanded survillance case
definition for AIDS among adolescents and adults. MMWR. 1992;41:119.
2. Fetter A, Partisani M, Koenig H, et al. Assymptomatic oral Candida albicans carriage in HIV infection: fre-
quency and predisposing factors. J Oral Pathol Med. 1993;22:579.
3. Dull J, Sem P, Raffanti S, et al. Oral candidiasis as a marker of acute retroviral illness. South Med J. 1991;84:7335,
739.
4. Redding SW, Kirkpatrick WR, Dib O, et al. The epidemiology of nonalbicans Candida in oropharyngeal can-
didiasis in HIV patients. Spec Care Dentist. 2000;20(5):17881.
5. Tumbarello M, Tacconelli E, Caldarola G, et al. Fluconazole resistant oral candidiasis in HIVinfected patients.
Oral Dis. 1997;3 Suppl 1:1102.
6. Cartledge JD, Midgley J, Gazzard BG. Clinically significant azole crossresistance in Candida isolates from
HIVpositive patients with oral candidosis. AIDS. 1997;11(15):183944.
7. Heinic GS, Greenspan D, MacPhail L, et al. Oral Histoplasma capsulatum infection in association with HIV
infection: a case report. J Oral Pathol Med. 1992;21:859.
8. Glick M, Cohen S, Cheney R, et al. Oral manifestations of disseminated Cryptococcus neoformans in a patient
with acquired immunodeficiency syndrome. Oral Surg Oral Med Oral Pathol. 1987;64:4549.
9. Feigal DW, Katz MH, Greenspan D, et al. The prevalence of oral lesions in HIVinfected homossexual and bis-
sexual men: three San Francisco epidemiological cohorts. AIDS. 1991;5:51925.
10. Robinson P. Periodontal diseases and HIV infection. A review of the literature. J Clin Periodontol. 1992;19:60914.
11. Volpe F, Schwimmer A, Barr C. Oral manifestations of disseminated Mycobacterium avium intracellulare in a
patient with AIDS. Oral Surg Oral Med Oral Pathol. 1985;60:56770.
12. Dezube BJ, Pantanowitz L, Aboulafia DM. Management of AIDSrelated Kaposi Sarcoma: advances in target
discovery and treatment. Aids Read. 2004;14(5):23653.
13. Ficarra G, Berson AM, Silverman S, et al. Kaposis sarcoma of the oral cavity: a study of 134 patients with a
review of the pathogenesis, epidemiology, clinical aspects and treatment. Oral Surg Oral Med Oral Pathol.
1988;66:54350.
14. Kaugars GE, Burns JC. NonHodgkin lymphoma of the oral cavity associated with AIDS. Oral Surg Oral Med
Oral Pathol. 1989;67:4336.
15. MacPhail L, Greenspan D, Greenspan J. Recurrent aphthous ulcers in association with HIV infection and treat-
ment. Oral Surg Oral Med Oral Pathol. 1992;73:2838.
16. Schiodt M, Dodd CL, Greenspan, et al. Natural history of HIVassociated salivary gland disease. Oral Surg Oral
Med Oral Pathol. 1992;74:32631.
VI Seco
Captulo 2

Manifestaes gastrintestinais*
Patrcia Pacheco

As manifestaes gastrintestinais so comuns nos doentes com infeco por


vrus da imunodeficincia humana (VIH), sendo as patologias oportunistas,
particularmente, frequentes quando a contagem de linfcitos TCD4+ inferior
a 200 cls/mm3. A utilizao da teraputica antiretrovrica combinada (TARVc),
a partir do final da dcada de 90, veio alterar o curso natural da infeco por
VIH/sida, condicionando um marcado declnio na prevalncia das infeces
oportunistas. Nos doentes com boa situao imunitria, as manifestaes
gastrintestinais so, fundamentalmente, devidas a toxicidade farmacolgica ou
a doena heptica crnica por coinfeco por vrus da hepatite C (VHC).
Neste captulo, procedese reviso das causas mais comuns de mani-
festaes gastrintestinais, associadas infeco por VIH, optandose por
uma sistematizao por rgo afectado. Os microrganismos implicados, com
maior frequncia, nas infeces gastrintestinais nos doentes com sida en
contramse listados no quadro 1.

Esfago
As leses esofgicas traduzemse, clinicamente, por disfagia, odinofagia e
dor retroesternal. A causa mais frequente de sintomatologia esofgica a
candidose (5070%), seguindose as lceras por vrus citomeglico (VCM)
(1020%), lceras idiopticas (1020%) e lceras por vrus herpes simplex
(VHS) (25%). A disfagia a queixa preponderante, na esofagite por Can-
dida, sendo a odinofagia e a dor retroesternal (dor episdica, no de
sencadeada pela deglutio, resultante de espasmo esofgico), mais vezes
observadas nas ulceraes esofgicas. A candidose oral pode ocorrer, con
comitantemente, com cada uma destas situaes:

*Nota do editor: Este captulo no foi actualizado em relao 3.a edio do Manual sobre sida (2008)
220 Patrcia Pacheco

Quadro 1. Patogneos gastrintestinais mais frequentes em doentes com infeco por VIH
Protozorios Cryptosporidium spp
Enterocytozoon bieneusi
Encephalolitozoon intestinalis (Septata intestinalis)
Isospora belli
Giardia lamblia
Entamoeba histolytica
Bactrias Salmonella spp
Shigella spp
Campylobacter spp
E. coli enteroaderente
Mycobacterium tuberculosis complex
Mycobacterium avium complex
Clostridium difficile
Vrus Vrus citomeglico
Vrus herpes simplex 1 e 2
Vrus das hepatites B e C
Vrus da imunodeficincia humana
Adenovrus
Fungos Candida spp
Cryptococcus neoformans
Histoplasma capsulatum

1 Candidose esofgica sendo a infeco por Candida a causa mais


comum de sintomatologia esofgica, preconizase o incio empri-
co de teraputica antifngica, reservandose a endoscopia digestiva
alta para os casos refractrios, aps sete dias de teraputica 1. Na
endoscopia observamse placas largas, esbranquiadas que cobrem
a mucosa esofgica. O diagnstico confirmado por histologia
(pseudomiclio invadindo os tecidos) e por exame micolgico. O
tratamento efectuado com fluconazol (200400 mg/dia), observan-
dose, em regra, rpida melhoria clnica. Na ausncia de recupera-
o imunitria, a candidose esofgica pode tornarse um problema
grave e recidivante. A instituio de teraputica de manuteno
deve ser evitada, uma vez que o uso prolongado de fluconazol
promove o aparecimento de resistncias2, tornandose mais difcil
erradicar a infeco a cada nova recidiva. Anteriormente, no caso
da candidose esofgica refractria aos azis apenas restava como
opo a anfotericina B endovenosa. Actualmente, j esto dispon-
veis mais opes teraputicas, nomeadamente os azis de nova
gerao (voriconazol ou posaconazol) e a caspofungina3.
2 lceras por VCM as lceras so, por norma, mltiplas, superfi-
ciais e de tamanho varivel (de 1 mm a 10 cm). O diagnstico
confirmado pelo exame histolgico da biopsia esofgica, obtida por
endoscopia. O isolamento de VCM, de uma leso, na ausncia de
Manifestaes gastrintestinais 221

alteraes histolgicas consistentes, no prova o diagnstico, uma


vez que este vrus pode ser cultivado da superfcie endotelial, sem
ser responsvel pela doena4. O tratamento consiste em antivricos
(ganciclovir ou foscarnet), por via endovenosa, durante duas a trs
semanas, sendo a resposta teraputica irregular. A instituio de
teraputica de manuteno controversa, no entanto pode utilizarse
o valganciclovir oral.
3 lceras por VHS em regra, so lceras pequenas, profundas e
em menor nmero que as lceras por VCM. O diagnstico his-
topatolgico, identificandose as clssicas incluses herpticas in-
tranucleares. A cultura vrica confirma o diagnstico, mas este
procedimento raro na prtica clnica. O tratamento consiste em
aciclovir, estando o foscarnet indicado para estirpes resistentes.
4 lceras idiopticas ou lceras aftosas as lceras so de grandes
dimenses, podendo ser nicas ou mltiplas. O diagnstico de
lceras idiopticas um diagnstico de excluso, assumido no caso
de negatividade dos exames histopatolgicos e microbiolgicos. O
tratamento efectuase com prednisolona 40 mg/dia, durante sete
dias, seguindose uma fase de desmame de 10 mg/semana 5.

Estmago
Os doentes com infeco por VIH/sida referem, com frequncia, queixas
disppticas (nuseas, vmitos, sensao de enfartamento e dor epigstrica),
que se relacionam, em geral, com intolerncias medicamentosas, com ou
sem patologia ulcerosa concomitante. Contudo, o estmago pode, tambm,
ser alvo de patologias oportunistas, nomeadamente doenas tumorais (lin-
foma noHodgkin [LNH] e sarcoma de Kaposi [SK]). O diagnstico destas
situaes baseiase na endoscopia com exame histolgico da biopsia.

Intestino
A diarreia a manifestao clnica mais comum de patologia intestinal, nos
doentes com infeco por VIH, e pode ser devida a frmacos, a doenas
oportunistas ou a processos patolgicos idnticos aos que ocorrem na po-
pulao em geral, como sejam a gastrenterite vrica aguda ou a sndrome
do clon irritvel. A prpria infeco retrovrica pode condicionar enteropatia,
com atrofia das vilosidades do intestino delgado, traduzida, clinicamente, por
sndrome de malabsoro com ou sem diarreia crnica, na ausncia de outro
agente patognico.
A metodologia de investigao da diarreia, no doente com infeco por
VIH, assenta na anlise de quatro factores:
1 Tempo de evoluo da diarreia a diarreia aguda pode ocorrer no
doente com infeco por VIH, de forma idntica ao que acontece
na restante populao e tem etiologia semelhante. Nos doentes com
imunodepresso grave, algumas infeces bacterianas (Salmonella,
222 Patrcia Pacheco

Quadro 2. Diagnstico diferencial de enterite e colite


Caractersticas Enterite Colite
N. dejeces (24 h) 38 330
Volume das fezes (24 h) 75010.000 ml 2501.000 ml
Volume das fezes (cada dejeco) abundante pequeno
Consistncia das fezes lquidas ou pastosas lquidas
Tenesmo no sim
Sangue oculto nas fezes no sim
Leuccitos fecais no sim
Gordura nas fezes sim no

Shigella e Campylobacter), responsveis por colite ou por entero-


colite aguda, podem ter um curso clnico mais prolongado e com-
plicado de bacteriemia, necessitando de diagnstico etiolgico e de
teraputica dirigida. As salmoneloses notficas so, relativamente,
mais frequentes nos doentes com sida, manifestandose por febre
(bacteriemias recorrentes), com ou sem diarreia acompanhante.
2 Estdio imunitrio o conhecimento da contagem de linfcitos
TCD4+ permite equacionar as hipteses de diagnstico na diarreia,
crnica. Microrganismos oportunistas como Cryptosporidium, VCM,
Mycobacterium avium complex, entre outros, podem causar diarreia
quando a contagem de TCD4+ < 100 cls/mm3, enquanto que em
doentes com imunidade preservada, as causas farmacolgicas so
preponderantes.
3 Hbitos medicamentosos a teraputica antiretrovrica pode con-
dicionar alteraes do trnsito intestinal, sendo, por exemplo, re-
lativamente frequente a diarreia associada aos inibidores da prote-
ase nelfinavir e lopinavir/ritonavir. O tratamento sintomtico, com
instituio de medidas dietticas e frmacos que diminuam a mo-
tilidade intestinal. Em doentes sujeitos a antibioterapia de largo
espectro deve ponderarse a possibilidade de infeco por Clostri-
dium difficile, o que pode ser diagnosticado pela pesquisa da toxi-
na desta bactria nas fezes.
4 Determinao do segmento intestinal afectado (Quadro 2) a en-
terite caracterizada por dejeces abundantes de fezes lquidas
ou semimoldadas, sem dor abdominal, sem leuccitos fecais e com
pesquisa de gordura nas fezes positiva. Na colite, as fezes so l-
quidas, menos volumosas, por vezes sanguinolentas e acompa-
nhamse, em geral, de clicas abdominais e febre, sendo a pesqui-
sa de leuccitos fecais positiva.
A investigao da diarreia crnica iniciase com coproculturas e com
exame parasitolgico de fezes, devendo ser enviadas vrias amostras para
maior rendabilidade do diagnstico. Uma vez que as infeces bacterianas
se acompanham, com frequncia, de bacteriemia, as hemoculturas fazem
Manifestaes gastrintestinais 223

parte, tambm, da investigao inicial. Na ausncia de diagnstico, e persis


tindo a diarreia, dever realizarse um exame endoscpico, estando a deci-
so da via de acesso (endoscopia digestiva alta vs rectosigmoidoscopia)
dependente do segmento intestinal, que se suspeita estar afectado. No caso
de enterite devem realizarse biopsias do intestino delgado, sendo a renta-
bilidade da biopsia jejunal superior da duodenal6. Apesar da investigao
exaustiva, a diarreia crnica, associada infeco por VIH, pode permane-
cer sem diagnstico etiolgico, em 50% dos casos 7.
Uma caracterstica comum, aos vrios processos infecciosos oportunistas,
responsveis pela diarreia crnica, uma resposta deficiente teraputica
dirigida. Na ausncia de recuperao imunitria, estas patologias persistem
ou recidivam, condicionando morbilidade e mortalidade importantes. A ins
tituio de TARVc, nos doentes em que isso seja possvel, a melhor
forma de controlar estas infeces oportunistas8,9. Nos casos de diarreia
crnica refractria fundamental a instituio de medidas dietticas (dieta
sem lactose, sem cafena, pobre em gorduras e hiperproteica) e de terapu-
tica sintomtica, com agentes antiperistlticos (loperamida) ou, em casos
refractrios, de octretido10.
A criptosporidiose causada por Cryptosporidium spp, protozorio que
infecta a mucosa do intestino delgado e, tambm, nos doentes imunocom-
prometidos, o intestino grosso e locais extraintestinais. Manifestase, mais
frequentemente, como enterite, com diarreia abundante, severa e persis-
tente, durante meses. Os oocistos destes protozorios podem ser detectados
no exame de fezes por colorao cidoresistente modificada. A biopsia
do intestino delgado mostra atrofia das vilosidades, hiperplasia das criptas
e linfcitos intraepiteliais, com esquizontes no bordo luminal do enter-
cito. No existe teraputica dirigida eficaz para a criptosporidiose, no
doente imunocomprometido. Ao longo do tempo, foram utilizados diversos
esquemas de tratamento, nomeadamente com paramomicina e azitromici-
na, com resultados pouco expressivos. Estudos recentes demonstraram o
valor da nitazoxanida, no tratamento de crianas imunocompetentes, pelo
que na ausncia de alternativas vlidas a nitazoxanida poder ser consi-
derada11. A instituio de teraputica antiretrovrica potente parte fun-
damental do tratamento, na medida em que a reconstituio imunitria
(linfcitos TCD4 > 100 cls/mm 3) se associa completa resoluo da
criptosporidiose.
A microsporidiose responsvel por enterite e resulta da infeco por
um grupo de parasitas intracelulares, pertencentes ao filo microspora, entre
os quais Enterocytozoon bieneusi, que concorre para 80% dos casos e En
cephalitozoon intestinalis. A suspeita de microsporidiose deve ser comuni-
cada ao laboratrio, para que possam ser utilizadas as coloraes apropria-
das no exame das fezes (colorao de tricrmio). As caractersticas
histolgicas so semelhantes s encontradas na criptosporidiose, excepto
pela morfologia e localizao do organismo no entercito. O tratamento
com albendazole eficaz, nos casos provocados por E. intestinalis, sendo
E. bieneusi refractrio a antimicrobianos.
224 Patrcia Pacheco

Isospora belli um protozorio, comum nos pases subdesenvolvidos,


que pode ser responsvel por enterite, no contexto de infeco retrovrica.
A infeco resulta da ingesto de gua ou de alimentos contaminados por
oocistos maduros. O diagnstico estabelecese pela identificao dos oocis-
tos nas fezes. O cotrimoxazol o antimicrobiano de primeira linha, para o
tratamento da isosporiose, sendo necessria a teraputica de manuteno,
atendendo ao alto ndice de recidivas.
A micobacteriose atpica provocada por Mycobacterium avium complex
(MAC) responsvel, tambm, por enterite, a qual se acompanha, com fre
quncia, de febre, dado o envolvimento sistmico da infeco. A leso intes-
tinal por MAC resulta da infiltrao mucosa e submucosa de macrfagos,
contendo microrganismos intracelulares. A infiltrao celular bloqueia a dre-
nagem linftica da mucosa intestinal e produz uma enteropatia exsudativa,
com malabsoro de gorduras. O diagnstico desta infeco no possvel
pelo exame das fezes, sendo necessrio o isolamento de micobactrias em
hemoculturas e/ou na biopsia do intestino delgado. As alteraes histolgi-
cas observadas so semelhantes s do doena de Whipple, com macrfagos
distendidos, contendo material PAS positivo, na lmina prpria. A colorao
de ZiehlNeelsen revela bacilos cidolcool resistentes. O tratamento con-
siste na associao de claritromicina e etambutol, com ou sem rifabutina.
A infeco por VCM uma das infeces intestinais oportunistas mais
frequentes, em fases avanadas da imunodepresso. Atinge, em regra, o
clon, mas pode ocorrer em qualquer local do tracto gastrintestinal. As ma
nifestaes de colite so preponderantes, incluindo febre, dor abdominal e
diarreia sanguinolenta. Durante a rectosigmoidoscopia podem observarse
ulceraes superficiais da mucosa e o diagnstico estabelecido pela de-
monstrao de incluses vricas tpicas nas biopsias intestinais, podendo ser
utilizadas coloraes imunohistoqumicas, para confirmao. A teraputica
deve ser efectuada com ganciclovir ou foscarnet por via endovenosa, sendo
a resposta clnica varivel.
Para alm das infeces oportunistas, a diarreia crnica pode ser causada,
ocasionalmente, por neoplasias, nomeadamente, LNH e SK. A doenas tu-
morais intestinais so, por norma, assintomticas, no entanto, em alguns
casos, podem manifestarse por alteraes do trnsito intestinal (diarreia/
obstipao). O SK intestinal costuma ocorrer na presena de leses cutne-
as, sendo a sua localizao apenas intestinal uma raridade. O LNH, habitu-
almente de alto grau e de clulas B, pode ocorrer, primariamente, no tracto
gastrintestinal ou a nvel hepatobiliar. Qualquer segmento pode ser atingido,
desde a cavidade oral ao recto. A sintomatologia depende da localizao e
do tamanho do tumor. As leses luminais podem condicionar diarreia, dor
abdominal, ocluso intestinal, enquanto que a doena heptica se manifesta
por febre, com elevao da fosfatase alcalina. O diagnstico confirmase por
exame histolgico.
Ocasionalmente, as patologias intestinais (VCM, tuberculose, linfoma),
sobretudo da poro terminal do delgado, condicionam perfuraes com
peritonite, implicando cirurgia abdominal. A incidncia de complicaes
Manifestaes gastrintestinais 225

psoperatrias e de mortalidade elevada, o que parece resultar da gravi-


dade da doena em causa12,13, no constituindo a imunodeficincia, por si
mesma, um factor de risco independente.

Fgado e vias biliares


As alteraes das transaminases, em doentes com infeco por VIH/sida, so
frequentes e podem ter etiologias mltiplas, nomeadamente, infeces opor-
tunistas, coinfeces vricas (VHB/VHC) ou toxicidades medicamentosas.
A elevada prevalncia de hepatites crnicas B e C, nos doentes com in
feco por VIH, uma situao sobejamente conhecida, reflectindo o facto
das vrias infeces partilharem idnticas vias de transmisso. A doena
heptica crnica e a cirrose, para as quais estes doentes progridem mais
rapidamente, constituem, actualmente, grande causa de morbilidade/mor
talidade, em doentes com situao imunitria estabilizada.
Relativamente a patologias oportunistas, com envolvimento heptico, h
a destacar a tuberculose, que, em Portugal, constitui uma das infeces
oportunistas mais observadas. A tuberculose disseminada manifestase, com
frequncia, apenas por sndrome febril, com hepatoesplenomegalia. Analiti
camente, observase elevao dos parmetros inflamatrios e alteraes das
provas de funo heptica. A ecografia pode demonstrar heterogeneidade
do parnquima heptico e o exame histolgico da biopsia demonstra hepatite
granulomatosa, com bacilos cidolcool resistentes, na colorao de
ZiehlNeelsen. A confirmao do diagnstico obtida pelo exame cultural,
com identificao de MAC. O diagnstico diferencial deve ser feito com
outras patologias oportunistas, como sejam a micobacteriose atpica, a leish-
maniose visceral e o LNH. Em pases com baixa incidncia de tuberculose,
a MAC o microrganismo mais encontrado na biopsia heptica. A infeco
por MAC ocorre em estdios muito avanados da imunodepresso (linfci-
tos TCD4+ < 50 cls/mm3), enquanto a tuberculose pode ocorrer, tambm,
em estdios mais precoces. As caractersticas histopatolgicas no permitem
distinguir, com segurana, entre Mycobacterium tuberculosis e MAC, pelo
que o exame cultural essencial para o diagnstico etiolgico. Causas me-
nos frequentes, em Portugal, de envolvimento heptico so a criptococose,
a histoplasmose e a peliose heptica.
Os doentes com infeco por VIH podem apresentar manifestaes cl-
nicas de doena das vias biliares (dor nos quadrantes abdominais superiores,
ictercia e prurido) quer devido a doena biliar no associada infeco
por VIH (litase biliar, neoplasias e estenoses benignas dos canais biliares),
quer por colangiopatia relacionada com a sida. Esta ltima situao se
cundria a estenose papilar e/ou a colangite esclerosante e mais vezes
devida a infeco por Cryptosporidium, microsporidia ou VCM. Quando a
colangiopatia domina o quadro clnico, com ictercia e prurido, deve ser
efectuada uma colangiopancreatografia retrgrada endoscpica (CPRE) com
biopsia e, ainda, com dilatao mecnica, embora o benefcio deste ltimo
procedimento seja, em regra, temporrio.
226 Patrcia Pacheco

Pncreas
A pancreatite, na infeco por VIH, , em regra, de etiologia medicamen-
tosa, sendo raras as causas infecciosas14. Os frmacos mais implicados so
a didanosina (ddI), seguido da pentamidina e do cotrimoxazol 1517. Outras
causas possveis so a litase vesicular, o alcoolismo e a hipertrigliceridemia.
A apresentao da pancreatite, nestes doentes, sobreponvel da popula-
o em geral e o tratamento idntico, com analgesia, interrupo da ali-
mentao oral e suspenso dos frmacos, potencialmente, implicadas no
processo. A incidncia de hiperamilasemia , significativamente, superior
de pancreatite, podendo atingir at 50% dos doentes com infeco por
VIH18.

Bibliografia
1. Wilcox CM, Alexander LN, Clark WS. A randomized trial of empiric fluconazole as compared to endoscopy for
human immunodeficiency virus (HIV) infected patients with esophageal symptoms. Gastroenterology 1995;108:41.
2. Boken D, Swindells S, Rinaldi M. Increasing resistance of Candida albicans to flluconazole. Clin Infect Dis
1993;17:1018.
3. Petrikkos G, Skiada A. Recent advances in antifungal chemotherapy. Int J Antimicrob Agents. 2007;30 (2):10817.
4. Wilcox CM, Diehl DL, Cello JP, et al. Cytomegalovirus esophagitis in patients with AIDS: a clinical, endo-
scopic, and pathologic correlation. Ann Intern Med 1990; 113:589.
5. Wilcox CM, Schwartz DA. Comparison of two corticosteroid regimens for the treatment of HIVassociated id-
iopathic esophageal ulcer. Am J Gastroenterol 1994;89:2163.
6. Bini EJ, Weinshel EH, Gamaris Z. Comparison of duodenal with jejunal biopsy and aspirate in chronic human
immunodeficiency virusrelated diarrhea. Am J Gastroenterol 1998;93(10):183740.
7. Weber R, Ledergerber B, Zbinden R, et al. Enteric infections and diarrhea in human immunodeficiency virusin-
fected persons: prospective communitybased cohort study. Swiss HIV Cohort Study. Arch Intern Med 1999;
12;159(13):147380.
8. Miao YM, AwadElKariem FM, Franzen C, et al. Eradication of cryptosporidia and microsporidia following
successful antiretroviral therapy. J Acquir Immune Defic Syndr 2000;25(2):1249.
9. Bini EJ, Gorelickc SM, Weinshel EH. Outcome of AIDSassociated cytomegalovirus colitis in the era of potent
antiretroviral therapy. J Clin Gastroenterol 2000;30(4):4149.
10. Fried M. Octreotid in the treatment of refractory diarrhea. Digestion 1999;60(S2):426.
11. The Cochrane Collaboration. Prevention and treatment of cryptosporidiosis in immunocompromised patients.
Cochrane Rev Abstract 2007.
12. Scannell KA. Surgery and human immunodeficiency virus disease. J Acquir Immune Defic Syndr 1989;2:43.
13. Robinson G, Wilson SE, Williams RA. Surgery in patients with acquired immunodeficiency syndrome. Arch Surg
1987;122:170.
14. Cappell M. The pancreas in AIDS. Gastroenterol Clin North Am 1997;26:33765.
15. Maxson CJ, Green SM, Turner JL. Acute pancreatitis as a common complication of 2,3dideoxyinosine therapy
in the acquired immunodeficiency syndrome. Am J Gastroenterol 1992;87:708.
16. Hart CC. Aerosolized pentamidine and pancreatitis. Ann Intern Med 1989;111:691.
17. Anatow DR. Acute pancreatitis associated with trimethoprimsulfamethoxazole. Ann Intern Med 1986;101:3635.
18. Zarro JF, Pichon F, Reigner B. HIV and the pancreas. Lancet 1987;2:1212.
VI Seco
Captulo 3

Complicaes dermatolgicas
Joo Borges da Costa

Estimase que as complicaes dermatolgicas ocorram em mais de 90%


dos doentes com infeco por VIH e a pele seja um dos rgos mais atin-
gidos nesta infeco13. As complicaes dermatolgicas da imunossupresso,
como o sarcoma de Kaposi, estiveram, tambm, entre as primeiras patologias,
que denunciaram a existncia dum novo agente infeccioso.
As manifestaes dermatolgicas, nos doentes com infeco por VIH,
podem ser atpicas e a resposta teraputica , muitas vezes, insuficiente 4.
As causas destas manifestaes so variveis, podendo ser devidas prpria
infeco por VIH, como no caso da infeco aguda sintomtica, ou causa-
das por outros agentes infecciosos, como Candida ou vrus herpes. As re-
aces medicamentosas e algumas neoplasias so, tambm, outras causas
frequentes de complicaes dermatolgicas.
A incidncia das infeces e doenas inflamatrias cutneas aumenta
com a reduo do nmero dos linfcitos TCD4+5. A introduo da terapu-
tica antiretrovrica altamente eficaz (Highly Active Antiretroviric Therapy
[HAART] ou teraputica antiretrovrica de combinao [TARVc]), nos anos
90 do sculo passado, alterou a epidemiologia das complicaes dermato-
lgicas, com reduo de algumas doenas definidoras de sida, como o
sarcoma de Kaposi ou a candidose esofgica6.
Em sries recentes de pases europeus e dos Estados Unidos da Amri-
ca (EUA)3,7, as doenas definidoras de sida j no so as mais frequentes
nas Consultas de Dermatologia, destacandose, como principais motivos de
referenciao, as foliculites, os condilomas, a dermatite seborreica, a xero-
se cutnea e as dermatofitias.
A TARVc no alterou a prevalncia das infeces por vrus do papiloma
humano (VPH) e est associada a vrios efeitos secundrios cutneos. Estes
228 Joo Borges da Costa

podem ser reaces de hipersensibilidade, lipodistrofia, fotossensibilidade


ou exacerbao de infeces, como o herpeszster (Foto 29), aps a re-
constituio do sistema imune, com o incio da teraputica 8.

Dermatoses infecciosas
Na patologia cutnea, associada infeco por VIH, predominam as infec-
es, nomeadamente vricas, fngicas e bacterianas, que atingiram, respec-
tivamente, 70%, 60% e 46% dos doentes em reviso efectuada na nossa
consulta9.

Infeco aguda sintomtica por VIH


A infeco aguda sintomtica mais frequente em indivduos de raa cau-
casiana e sempre em casos de transmisso sexual. Aps um perodo de
incubao de duas a quatro semanas surge febre, cefaleias, mialgias e exan-
tema morbiliforme ou maculopapular, que atinge, predominantemente, o
tronco. Podem, tambm, ocorrer ulceraes orais, faringite e sintomas gas-
trintestinais. A candidose oral rara, mas, quando est presente pode ser
exuberante; a razo da sua presena, numa altura em que ainda no h
dfice imunitrio, no est esclarecida. Laboratorialmente, verificamse
leucopenia, trombocitopenia, por vezes linfopenia e, tambm, aumento das
aminotransferases. Esta sndrome mononuclesica nem sempre levanta a
suspeio de infeco por VIH, perdendose, assim, a oportunidade do
diagnstico e do incio de tratamento precoces. Isto , especialmente, im-
portante nestes doentes, pelo risco de transmisso da infeco ou de pro-
gresso rpida da mesma10,11.

Infeces vricas
O herpeszster um dos indicadores precoces da infeco por VIH, sur-
gindo com valores de linfcitos TCD4+ ainda elevados. A suspeita levan-
tada pela exuberncia e agressividade das ulceraes, pelo atingimento de
mais de um dermtomo ou pela presena de leses disseminadas. No en-
tanto, alguns autores preconizam a pesquisa de VIH em todos os doentes
com menos de 60 anos12,13. semelhana das infeces por herpes simplex,
pode ocorrer sobreinfeco bacteriana e resistncia ao aciclovir.
O herpes simplex muito comum na populao em geral. No imunode-
primido tornase persistente, geralmente sob a forma de ulcerao dolorosa
perianal ou verrucoso. Estas formas clnicas podem ser a primeira indicao
de infeco por VIH concomitante, podendo haver, nesta altura, alteraes
imunitrias importantes e outras manifestaes, dermatolgicas ou no,
sugestivas de sida14,15.
O molusco contagioso uma infeco por um poxvrus, autolimitada
em crianas, e que nos adultos jovens ocorre como infeco sexualmente
transmissvel (Foto 30). Associado infeco por VIH surge, em adultos,
Complicaes dermatolgicas 229

em grande nmero, na face (Foto 31) ou, mais raramente, na regio genital
e no se observou uma reduo da sua incidncia com a TARVc16. As leses
podem ser de grandes dimenses (cinco a 10 mm de dimetro ou mais) e
ser, assim, necessrio estabelecer o diagnstico diferencial com fungos di-
mrficos, como Criptococcus neoformans e Histoplasma capsulatum. Como
o herpes, o molusco contagioso pode ser a primeira manifestao suspeita
de infeco por VIH, surgindo, em geral, em indivduos com contagem de
linfcitos TCD4+ < 20017,18. Os doentes devem evitar a depilao ou barbe-
ar as reas atingidas, para prevenir a autoinoculao e a disseminao.
O aumento da sobrevida dos doentes com infeco por VIH, aps a
introduo da TARVc, aumentou a prevalncia das patologias cutneas,
associadas infeco por VPH19. Os condilomas, a manifestao cutnea
mais observada na infeco por VPH, nestes doentes, so leses ssseis, de
superfcie lisa ou rugosa, por vezes com prolongamentos filiformes, localiza-
dos nos rgos sexuais e regio perianal (Fotos 32 e 33). Das infeces por
VPH so as que, com mais frequncia, fazem suspeitar de infeco por VIH,
principalmente, quando se tornam exuberantes, com aspecto de couveflor,
na regio perianal. No entanto, as verrugas planas podem, tambm, ser a
primeira manifestao da infeco por VIH. Surgem de forma quase explo-
siva, como pequenas ppulas achatadas, cor de pele, superfcie aveludada,
invadindo a rea da barba, tornandose algumas filiformes, com o tempo1.
Podem, ainda, ser observadas formas generalizadas de verrugas planas, se-
melhantes s existentes na epidermodisplasia verruciforme (Foto 34).
A tricoleucoplasia oral, uma das manifestaes de infeco por vrus
EpsteinBarr, tem diminudo de incidncia com a TARVc. Apresentase sob
o aspecto de placas esbranquiadas com projeces filiformes, nos bordos
laterais da lngua. Muitas vezes no necessitam de tratamento, regredindo
com a teraputica antiretrovrica (TARV), colocando, por vezes, problemas
de diagnstico diferencial com a candidose oral, o lquen plano ou a leu-
coplasia prmaligna20.
A infeco por vrus citomeglico (VCM) frequente nos doentes com
infeco por VIH, no entanto, o envolvimento da pele pouco frequente.
As leses cutneas mais frequentes so ulceraes perianais secundrias a
proctocolite por VCM ou as eroses herpticas com colonizao por
VCM21.

Infeces fngicas
A candidose oral pode ser a razo para suspeio de infeco por VIH,
principalmente num adulto jovem no diabtico e se tiver um aspecto sujo,
pseudomembranoso, invadindo a faringe. A candidose cutaneomucosa pode
disseminar, sistemicamente, em doentes com imunodepresso grave, sendo
geralmente fatal nestes casos1.
As dermatofitias so, tambm, frequentes e no claro se a sua inci-
dncia diminui com a introduo da TARVc. O agente mais implicado
Trichophyton rubrum e, na maioria dos casos, as leses so semelhantes s
230 Joo Borges da Costa

dos doentes imunocompetentes, apenas com maior tendncia para abranger


as unhas e para a recidiva (Foto 35). Alm disso, surgem, ocasionalmente,
quadros mais bizarros, como hiperqueratose plantar ou foliculites profundas
nas reas pilosas, quase sem alteraes epidrmicas (tinha oculta).
A pitirase versicolor menos frequente que as outras micoses superfi-
ciais, mas, pode ser extensa e persistente nalguns casos (Foto 36). A espo-
rotricose tem apresentao semelhante do imunocompetente, com ndulos
ao longo de um trajecto linftico (Foto 37), mas esto descritas formas
disseminadas, com envolvimento pulmonar e sseo.
Entre as micoses profundas, a criptococose a mais comum, surgindo
envolvimento cutneo, em cerca de 10% dos doentes com doena sistmica.
As leses so polimorfas, podendo aparecer como ppulas, ndulos, pstu-
las ou lceras da pele ou mucosas, levantando problemas de diagnstico
diferencial com infeces herpticas, bacterianas ou molusco contagioso 22.
Outras infeces fngicas sistmicas esto descritas, algumas, apenas,
em reas endmicas, associadas infeco VIH, como a penicilinose, his-
toplasmose (Foto 38), blastomicose e coccidioidomicose. No entanto, o
aumento das migraes e das viagens permite que, progressivamente, sejam
mais observadas estas infeces na Europa23,24. As leses so polimorfas e
o diagnstico , em regra, micolgico ou histolgico. Em formas dissemi-
nadas, com envolvimento cutneo, o apoio da dermatologia permite um
diagnstico mais clere.

Infeces bacterianas
As foliculites e o impetigo so, em regra, causados pelos mesmos agentes,
que atingem os imunocompetentes, isto estafilococos e estreptococos, com
Staphylococcus aureus sendo mais vezes identificado. No entanto, as foli-
culites tm tendncia a formar ppulas e pstulas maiores e o impetigo
localizase, em geral, nas grandes pregas (axilas e virilhas), e no na face,
como nos imunocompetentes. Os abcessos e a celulite so, muitas vezes,
mais agressivos e destrutivos, ultrapassando, com alguma frequncia, a
fscia e causando necrose muscular, principalmente quando as estirpes so
produtoras de toxinas ou quando Pseudomonas o organismo infectante25.
A angiomatose bacilar , na actualidade, raramente observada e tem di-
minudo de frequncia com a TARVc1. As leses cutneas expressamse por
ppulas vasculares, vermelhas ou purpricas, em nmero varivel, levantan-
do problemas de diagnstico diferencial com o sarcoma de Kaposi (Foto 39).
A ulcerao e manifestaes clnicas de compromisso sistmico, como febre,
perda de peso e sudao nocturna podem ocorrer. Alm de ceder bem
teraputica com eritromicina , tambm, sensvel ao cotrimoxazol.
As leses cutneas por micobactrias so, tambm, raras e esto a di-
minuir com o uso da TARVc1.
As lceras genitais e as outras infeces sexualmente transmissveis
aumentam, entre duas a cinco vezes, o risco de transmisso de VIH26. So
frequentes nas Consultas de Dermatologia, o que revela a manuteno de
Complicaes dermatolgicas 231

comportamentos de risco, depois de conhecida a seropositividade para VIH.


Dentro deste grupo de doenas, salientamse a gonorreia e a sfilis, sobre-
tudo em menwhohavesexwithmen (MSM) (Fotos 40 e 41), grupo no qual
a incidncia aumentou, semelhana do que observado em outros pases
europeus27. Vrios autores associam este aumento recente introduo da
TARVc e diminuio das campanhas de promoo do uso do preservati-
vo2830. Em doentes com sfilis e infeco por VIH, os quadros clnicos
podem ser diferentes, com leses psoriasiformes ou esclerodermiformes,
eroses ou ulceraes orais, ndulos profundos e vasculite (Foto 42). Outras
caractersticas so a rpida evoluo do acidente primrio para a fase se-
cundria e logo para a tardia e, ainda, o envolvimento mais frequente do
sistema nervoso central (SNC)31.
Doenas venreas, previamente raras na Europa, como o linfogranuloma
venreo, causado pelo sertipo L13 de Chlamydia trachomatis, voltaram a
ser observadas e foram, tambm, recentemente, descritas no nosso Pas como
causa de proctite em MSM32,33. Estas alteraes da epidemiologia destas in-
feces e as migraes/viagens recreativas obrigam os clnicos a aumentaram
o leque de hipteses de diagnstico, perante quadros clnicos mais atpicos.

Infestaes
A escabiose uma dermatose comum nos infectados por VIH9 (Foto 43).
Clinicamente, pode ser idntica, do ponto de vista de apresentao clnica,
do indivduo imunocompetente, com ppulas pruriginosas, escoriadas, disper-
sas, formando pequenos ndulos nas zonas de pele mais laxa, como as pregas
interdigitais, os cotovelos, mamilos e pnis. O prurido tem, como caracters-
tica, acentuao nocturna. Quando a imunodepresso mais acentuada, o
prurido menor e observase, apenas, descamao discreta e algumas ppulas
noescoriadas e dispersas. Por vezes, h leses hiperqueratsicas palmoplan-
tares, semelhantes psorase ou, ainda, formas exuberantes de sarna crostosa
(norueguesa), com incontveis parasitas nas leses e, portanto, altamente
contagiosas. O tratamento fundamentase na prescrio de benzoato de ben-
zilo, sendo, na sarna crostosa, prefervel usar a ivermectina oral e/ou pomada
de enxofre salicilada, que amolece e remove as crostas, mesmo as subungue-
ais, sem traumatizar a pele, j muito irritada pela doena. No esquecer,
tambm, a lavagem da roupa e o tratamento dos contactos.
A pediculose observada sobretudo em toxicodependentes, com ms
condies sociais e de higiene.
A coinfeco leishmania/VIH em Portugal mais frequente em toxicode-
pendentes, sendo raras as manifestaes cutneas, com casos espordicos de
envolvimento da pele aps doena visceral dermatite psKalazar (Foto 44).
Em viajantes de reas endmicas podem ser observadas lceras cutneas
com bordos elevados o boto do oriente (Foto 45).
Casos raros de outros parasitas cutneos esto descritos em doentes
imunodeprimidos, nomeadamente por Pneumocystis jirovecii (ppulas fri-
veis, por vezes semelhantes a molusco contagioso, nas narinas e canal
232 Joo Borges da Costa

auditivo), Strongyloides stercoralis (leses urticariformes ou livedides) e


Acanthamoeba castellani (ndulos necrticos)1.

Dermatoses noinfecciosas
Doenas eritematodescamativas
A dermite seborreica a patologia cutnea individual mais frequente nos
doentes com infeco VIH (Foto 46) e at 85% destes iro ter um episdio
desta dermatose3. uma dermatose comum, mesmo em doentes imunocom-
petentes, constituda por eritema e descamao, localizada na regio medio-
facial e couro cabeludo, na maioria dos casos. Pode atingir as regies
presternal e interescapular e, mais raramente, outras reas, como axilas e
virilhas, e ser a primeira manifestao de infeco por VIH. A suspeita
levantada pela sua extenso, grau de infiltrao e, principalmente, resistn-
cia teraputica34.
A xerose, secura difusa da pele com manchas descamativas, frequente
nestes doentes quer devido ao mau estado nutricional, quer por aco de
alguns medicamentos. Em casos de xerose intensa surgem leses de eczema,
com prurido e coceira, de que resultam fissuraes, possveis portas de
entrada de infeces e espessamento focal da pele.
A psorase no mais frequente nos doentes com infeco por VIH do
que na populao em geral, tendendo, no entanto, naqueles casos, a ser mais
grave e resistente teraputica. A psorase pode ser anterior infeco por
VIH ou manifestarse, clinicamente, apenas, aps a seroconverso. O risco
de desenvolver psorase35 aumenta nove vezes com contagens de linfcitos
TCD4+ menores que 200/mm3 e o incio da TARVc permite, em muitos
doentes, o controlo da doena, inclusive em leses previamente resistentes
aos tratamentos convencionais36. As placas rosavivo com descamao bran-
ca, miccia, permitem o diagnstico, estando as unhas atingidas, com fre-
quncia, com oniclise e hiperqueratose subungueal. A extenso do envol-
vimento da pele muito varivel, tal como o compromisso articular. Estes
doentes, em geral, toleram mal as teraputicas tpicas, as quais irritam,
ainda mais, as leses; quanto teraputica sistmica fica limitada acitre-
tina, dado o risco do uso de imunossupressores1.
A sndrome de Reiter caracterizase por uretrite, conjuntivite, artrite e
hiperqueratose palmoplantar. Constitui, raramente, a primeira manifestao
de infeco por VIH. tambm necessrio excluir esta infeco, antes do
incio da teraputica com metotrexato, pois este pode ser fatal nos seropo-
sitivos para VIH37.

Erupes papulosas
Vrias erupes papulosas e pruriginosas esto descritas nos infectados por
VIH, tais como foliculite eosinoflica, papulose, urticria papulosa e pruri-
go nodular (Foto 47).
Complicaes dermatolgicas 233

Nos indivduos com infeco por VIH, com valores de linfcitos TCD4 +
< 200/mm3, h aumento de linfcitos Thelper 2 (Th2) em relao aos lin-
fcitos Thelper 1 (Th1)1. Neste meio rico em Th2, antignios exgenos
(artrpodes, caros) ou foliculares (pitirosporo, demodex, estafilococo), ha-
bitualmente tolerados, podem induzir uma resposta imunitria exagerada 38,
com elevada produo de imunoglobulina E (IgE) e eosinofilia local.
Clinicamente revelamse por ppulas centradas por folculo, dispersas
no tronco, face e pescoo, com tendncia a confluir e a liquenificar, devido
ao traumatismo da coceira. A teraputica destas erupes papulosas dif-
cil, so mais frequentes em indivduos com imunossupresso acentuada 39 e
podem responder introduo da TARVc. A teraputica etiolgica tem
efeito transitrio, visto que logo que se suspende, a carga antignica volta
a aumentar. Os antihistamnicos so pouco eficazes e as respostas terapu-
ticas mais promissoras foram obtidas com radiao ultravioleta, corticote-
rapia, isotretinona e talidomida.

Outras dermatoses
A porfiria cutnea tardia tem incidncia aumentada nos doentes com infec-
o por VIH. Em geral, secundria a infeco concomitante por vrus da
hepatite C (VHC).
A fotossensibilidade aumentada pode ser sinal de doena avanada; a
maioria dos doentes sensvel aos UVB, sendo nos casos mais graves sen-
sveis, tambm, aos UVA e mesmo luz visvel1. Podem ser, tambm, obser-
vadas reaces de fotossensibilidade a frmacos, com padro liquenide.
As alteraes da pigmentao so frequentes nos doentes com esta in-
feco, sobretudo em fottipos mais elevados. A hiperpigmentao psin-
flamatria, secundria a dermatoses infecciosas ou inflamatrias, a forma
mais observada nas Consultas de Dermatologia.
A urticria e vasculites, com envolvimento cutneo, podem surgir, tam-
bm, nos infectados por VIH. A medicao, a que esto sujeitos, e as in-
feces intercorrentes tornam difcil a determinao da etiologia.

Neoplasias cutneas
O aumento da sobrevivncia dos doentes com infeco por VIH, permite
que neoplasias cutneas sejam causa major de morbilidade. Os doentes tm
maior risco de desenvolver sarcoma de Kaposi, linfomas, melanomas e
neoplasias anogenitais por VPH, associadas infeco 40.
A introduo da TARVc reduziu a incidncia de neoplasias cutneas
definidoras de sida, como o sarcoma de Kaposi, mas no reduziu a inci-
dncia de neoplasias associadas infeco por VPH.
O sarcoma de Kaposi mais frequente em doentes com infeco por VIH,
transmitida sexualmente e com doena de progresso rpida, podendo ser a
primeira manifestao de sida. Em geral, tem o aspecto de pequenas manchas
violceas, lineares, localizadas no tronco, acompanhando as linhas de Blaschko
234 Joo Borges da Costa

(Foto 48). Mais tarde evoluem para ppulas, ndulos e placas, atingindo, em
regra, as pernas (Foto 49) e os ps, o nariz e a mucosa oral41. Esta neoplasia,
aps a introduo da TARVc, perdeu para o basalioma, relevncia, como a
neoplasia cutnea mais frequente, em doentes com infeco por VIH42.
A papulose bowenide, carcinoma espinocelular in situ, secundrio a
infeco por VPH, manifestase como maculoppulas acastanhadas, por
vezes semelhantes a condilomas, localizadas nos grandes lbios, pele do
pnis ou regio perianal43 (Foto 50).
O basalioma e o carcinoma espinocelular tm incidncia ligeiramente
superior da populao em geral. Em algumas sries42, o risco de desenvol-
vimento destas duas neoplasias est associado aos mesmos riscos da popu-
lao em geral, nomeadamente idade avanada e fottipo. No se observou
associaes com carga vrica, nmero de linfcitos TCD4+ ou TARVc e a
evoluo semelhante da populao em geral, embora os carcinomas
espinocelulares tenham maior risco de metastizao.
Os linfomas, com compromisso cutneo, no so frequentes, sendo a
maioria linfomas B, em geral agressivos e de mau prognstico. Os linfomas
T, associados infeco por VIH, so raros, semelhantes clinicamente a
micose fungide nos imunocompetentes44.

Reaces adversas medicamentosas


As reaces medicamentosas so as dermatoses reaccionais mais frequentes.
O espectro clnico vasto, indo dos menos graves, tais como eritema fixo
(Foto 51) e exantema morbiliforme, passando pela urticria, com ou sem
angioedema, eritema multiforme e sndrome de StevensJohnson (Foto 52),
terminando na necrose epidermoltica txica. No entanto, as formas mais
graves so, tambm, as mais raras.
O cotrimoxazol , nestes doentes, o medicamento que, com maior fre-
quncia, produz toxidermia. Em regra, surge um exantema morbiliforme,
uma a duas semanas aps o incio da teraputica. Por vezes, desaparece
mesmo sem suspender a medicao, outras prolongase por dias ou semanas,
depois desta ser interrompida. A reintroduo do medicamento pode ser
tentada, mas de modo controlado, pois h o risco de reaco anafilctica
ou de formas graves de eritema exsudativo multiforme. Reaces semelhan-
tes esto descritas com outros antibiticos como isoniazida, claritromicina,
rifampicina e amoxicilina - cido clavulnico 1.
A introduo da TARVc, sobretudo em doentes com menos de 200 linf-
citos TCD4+, pode causar manifestaes cutneas, que so as mais frequen-
temente observadas na sndrome de reconstituio imunitria (Quadro 1)45.

Inibidores nuclesidos da transcriptase reversa

Estes frmacos foram a primeira classe de antiretrovricos (ARVs) desenvol-


vidos para o tratamento de infeco por VIH e esto associados a toxicidade
mitocondrial. A zidovudina (AZT) e a emtricitabina (FTC) podem causar
Complicaes dermatolgicas 235

Quadro 1. Manifestaes cutneas da sndrome de reconstituio imunitria (infecciosas e


inflamatrias)
Herpeszster Psorase
Infeces por VPH Reaces de corpo estranho
Infeces por VCM Lpus
Molusco contagioso Sarcoidose
Leishmaniose Eritema nodoso
Micobacterioses Acne

pigmentao longitudinal das unhas ou pigmentao das mucosas e erupes


liquenides46 (Foto 53). A hiperpigmentao remite, gradualmente, com a
paragem do frmaco e o AZT, est tambm, implicado em casos de hiper-
tricose, aumento da intensidade das reaces picada de artrpodes e
vasculite leucocitoclssica47,48.
O abacavir (ABC) pode desencadear uma reaco de hipersensibilidade,
com exantema, febre, vmitos e diarreia, por vezes dores osteoarticulares,
dispneia e edema das mucosas. Esta reaco surge, em geral, aos 10 dias
de tratamento, mas pode manifestarse at seis semanas depois do incio da
teraputica, acompanhandose por linfopenia e trombocitopenia, aumento
das aminotransferases e da creatinina. O ABC deve ser interrompido e no
se deve tentar a reintroduo, pois esta pode ser fatal, estando esta reaco
associada ao alelo B*5701 da histocompatibilidade (HLA). Esto descritas
reaces de hipersensibilidade semelhantes com o AZT e com a zalcitabina
(ddC). A didanosina (ddI) e a estavudina (d4T) esto associadas lipodis-
trofia e a lamivudina (3TC) pode causar alopecia.

Inibidores da protease

Os inibidores da protease foram a segunda classe de ARVs a ser desenvol-


vida e tm um efeito semelhante aos retinides, causando queilite, asteato-
se e eczema, alopecia difusa ou cabelo encaracolado e, sobretudo, perioni-
quia, geralmente dos primeiros dedos dos ps. Tambm esto relatados
casos de angiolipomas e estrias (Foto 54). O ritonavir (RTV) pode causar
parestesias peribucais e um exantema morbiliforme pode ocorrer, geralmen-
te, em percentagem inferior a 10%, em todos os frmacos deste grupo.
A lipodistrofia, redistribuio da gordura do corpo, que se acumula na
face posterior do pescoo e na parede abdominal e que desaparece da face,
dos antebraos e pernas, , tambm, um efeito secundrio destes frmacos,
no entanto, estes no so os nicos responsveis por esta alterao, pois
outras classes de ARVs foram, tambm, recentemente, implicadas 49.

Inibidores nonuclesidos da transcriptase reversa

Estes frmacos podem causar exantema morbiliforme, surgindo uma a oito


semanas aps o incio da teraputica e mais frequente em doentes alrgicos
236 Joo Borges da Costa

s sulfamidas e no sexo feminino50. A atitude semelhante usada com o


cotrimoxazol, isto , manter a teraputica se a reaco discreta, interrom-
per se h agravamento. O frmaco pode ser reintroduzido, iniciandose com
uma dose menor do que a indicada, a qual se aumenta lentamente. Aquela
reaco frequente com nevirapina (NVP) e delavirdina (DLV) e rara com
efavirenz (EFV). A NVP pode causar, ainda, lceras orais e um exantema
associado a eosinofilia e manifestaes sistmicas denominado drug rash
eosinophilia systemic symptoms (DRESS).

Inibidores da entrada, fuso ou da integrase

Estes novos frmacos so as classes mais recentes da TARVc e no existe,


ainda, literatura disponvel sobre os seus efeitos adversos, excepto exantema
morbiliforme, descrito nos ensaios clnicos. A enfuvirtida (T20) pode causar
efeitos locais na rea de administrao, como eritema, quistos ou esclerose
cutnea e foram tambm descritas reaces inflamatrias, com formao de
granulomas51.

Concluses
As complicaes dermatolgicas so frequentes em doentes com infeco
por VIH e podem ter manifestaes clnicas atpicas. semelhana do
observado no incio da pandemia, algumas dermatoses, como o sarcoma de
Kaposi, candidose extensa, com envolvimento ungueal proximal ou do es-
fago, ou dermatite seborreica de difcil controlo podem ser a primeira ma-
nifestao, que leva ao diagnstico da infeco por VIH.
A introduo da TARVc e o subsequente aumento da esperana de
vida destes doentes alterou, no entanto, o espectro das complicaes
observadas nas Consultas de Dermatologia, com a maioria dos doentes a
recorrer, agora, por infeces bacterianas e vricas, xerose, efeitos secun-
drios dos frmacos ou neoplasias associadas idade mais avanada,
como o basalioma.
A infeco por VPH agora um dos principais motivos da observao
destes doentes e, apesar da TARVc, continua a aumentar a sua incidncia
e o risco de evoluo para neoplasias anogenitais.
As infeces sexualmente transmissveis so um dos problemas de mais
difcil controlo, em alguns grupos destes doentes, salientandose o aumento
recente destas na Europa, nomeadamente a sfilis e a gonorreia. O efeito
deletrio destas coinfeces, que aumentam o risco de transmisso da in-
feco por VIH, , tambm, uma das novas dificuldades no controlo desta
pandemia.

Agradecimento
O autor agradece ao Dr. Vasco SousaCoutinho a cedncia de material para
preparao deste captulo.
Complicaes dermatolgicas 237

Bibliografia
1. Aftergut K, Cockerell CJ. Update on the cutaneous manifestatioms of HIV infection. Dermatol Clin. 1999;17(3):
44571.
2. Jing W. A retrospective survey of mucocutaneous manifestations of HIV infection in Malaysia. J Dermatol.
2000;27(4):22532.
3. Zancanaro PC, McGirt LY, Mamelak AJ, et al. Cutaneous manifestations of HIV in the era of highly active
antiretroviral therapy: An institutional urban clinic experience. J Am Acad Dermatol. 2006;54:5818.
4. Kumarasamy N, Solomon S, Madhivanan P, et al. Dermatologic manifestations among human immunodefi-
ciency virus patients in south India. Int J Dermatol. 2000;39:1925.
5. Tschachler E, Bergstresser PR, Stingl G. HIVrelated skin diseases. Lancet. 1996;348:65963.
6. Ives NJ, Gazzard BG, Easterbrook PJ. The changing pattern of AIDSdefining illnesses with the introduction of
highly active antiretroviral therapy (HAART) in a London clinic. J Infect. 2001;42:1349.
7. Blanes M, Belinchn I, Merino E, et al. Current prevalence and characteristics of dermatoses associated with
human immunodeficiency vrus infection. Actas Dermosifiliogr. 2010;101(8):7029.
8. Domingo P, Torres OH, Ris J, et al. Herpes zoster as an immune reconstitution disease after initiation of com-
bination antiretroviral therapy in patients with human immunodeficiency vrus type1 infection. Am J Med.
2001;110:6059.
9. OliveiraSoares R, Ferreira P, SousaCoutinho V. Manifestaes cutneas de infeco VIH estudo retrospectivo.
Trab Soc Port Derm Ven. 2001;59(2):20913.
10. Kahn J, Walker B. Acute HIVInfection. N Engl J Med. 1998;339:339.
11. Do PH, Bricaire F. La primoinfection VIH, comment la reconnatre? SchweizRundschMedPrax. 2000;89(3):708.
12. FriedmanKien AE, La Fleur FL, Gendler EC, et al. Herpes zoster: A possible early clinical sign for development
of AIDS in highrisk individuals. J Am Acad Dermatol. 1986;14:10238.
13. Naburs AE, Leppard B. Herpes zoster and HIV infection in Tanzania. Int J STDAIDS. 2000;11(4):2546.
14. Siegal FP, Lpez C, Hammer GS, et al. Severe acquired immunodeficiency in male homosexuals, manifested by
chronic perianal ulcerative herpes simplex lesions. N Engl J Med. 1981;305:143944.
15. Thiers B. Treatment of skin disease in HIVinfected patients. Dermatol Clin. 1995;13:2318.
16. Hengge UR, Franz B, Goos M. Decline of infectious skin manifestations in the era of highly active antiretrovi-
ral therapy. AIDS. 2000;14(8):106970.
17. Katzman M, Carey JT, Elmets CA, et al. Molluscum contagiosum and AIDS: clinical and immunologic details
of two cases. Brit J Dermatol. 1987;116:1318.
18. Kolokotronis A, Antoniades D, Katsoulidis E, et al. Facial and perioral Molluscum contagiosum as a manifesta-
tion of HIV infection. Aust Dent J. 2000;45(1):4952.
19. Kreuter A, Wieland U, Brockmeyer NH. Genital human papillomavirusassociated (pre)malignant skin diseases
drastically increase in the era of highly antiretroviral therapy for HIV infection. J Am Acad Dermatol.
2006;55(6):1167.
20. Greenspan JS, Greenspan D, Lenette ET, et al. Replication of EpsteinBarr virus within epithelial cells of oral
hairy leucoplakia and AIDS associated lesion. N Engl J Med. 1985;313:156471.
21. Horn TD, Hodd AF. Cytomegalovirus is predictably present in perineal ulcers from immunosupressed patients.
Arch Dermatol. 1990;126:6424.
22. Manrique P, Mayo J, lvarez JA, et al. Polymorphous cutaneous cryptococcosis: nodular, herpeslike and mol-
luscumlike lesions in a patient with AIDS. J Am Acad Dermatol. 1992;26:1224.
23. Kok I, Veenstra J, Rietra PJ, et al. Disseminated Penicillium marneffei infection as an imported disease in HIV1
infected patients. Description of two cases and a review of the literature. Neth J Med. 1994;44(1):1822.
24. Norman FF, MartnDvila P, Fortn J, et al. Imported histoplasmosis: two distinct profilis in travelers and im-
migrants. J Travel Med. 2009;16(4):25862.
25. Tappero JW, Perkins BA,Wengor JD, et al. Cutaneous manifestations of opportunistic infections in patients in-
fected with HIV. Clin Microbiol Rev. 1995;8:44050.
26. Fleming DT, Wasserheit JN. From epidemiological synergy to public health policy and practice: the contribuition of
other sexually transmitted diseases to sexual transmission of HIV infection. Sex Transm Infect. 1999;75(1):317.
27. Spielmann N, Mnstermann D, Hagedorn HJ, et al. Time trends of syphilis and HSV2 coinfection among men
who have sex with men in the German HIV1 seroconverter cohort from 19962007. Sex Transm Infect.
2010;86(5):3316.
28. Dougan S, Evans BG, Elford J. Sexually transmitted infections in Western Europe among HIVpositive men who
have sex with men. Sex Transm Dis. 2007;34(10):78390.
29. Laporte A. A new decline in preventive behaviours among homosexual men: the role of highlyactive antiretro-
viral therapy? Euro Surveill. 2002;7(2):156.
30. Berglund T, Asikainen T, Grtzmeir S, et al. The epidemiology of gonorrhea among men who have sex with
men in Stockholm, Sweden, 19902004. Sex Transm Dis. 2007;34(3):1749.
31. Quinn TC, Cannon RO, Glasser D, et al. The association of syphilis with risk of HIV infection in patients at-
tending sexually transmitted diseases clinics. Arch Int Med. 1990;159:1297302.
32. Nieuwenhuis RF, Ossewaarde JM, Gtz HM, et al. Resurgence of lymphogranuloma venereum in Western Europe:
an outbreak of Clamydia trachomatis serovar I2 proctitis in The Netherlands among men who have sex with
men. Clin Infect Dis. 2004;39(7):9961003.
33. Castro R, Baptista T, Vale A, et al. Lymphogranuloma venereum serovar L2b in Portugal. Int J STD AIDS.
2010;21(4):2656.
34. Mathes BM, Douglas MC. Seborrheic dermatitis in patients with AIDS. J Am Acad Dermatol. 1985;13:94751.
35. Goh BK, Chan RKW, Sen P, et al. Spectrum of skin disorders in human immunodeficiency virusinfected patients
in Singapore and the relationship to CD4 lymphocyte counts. Int J Dermatol. 2007;46:6959.
36. Leal L, Ribera M, Daudn E. Psoriasis e infeccin por el vrus de la immunodeficiencia humana. Actas Der-
mosifiliogr. 2008;99:75363.
238 Joo Borges da Costa

37. Winchester R, Bernstein DH, Fisher HD. The coocurrence of Reiters syndrome and acquired immunodefi-
ciency. Ann Intern Med. 1987;106:1926.
38. Fearfield LA, Rowe A, Francis N, et al. Itchy folliculitis and HIV infection: clinicopathological and immuno-
logical features, pathogenesis and treatment. Br J Dermatol. 1999;141(1):311.
39. Boonchai W, Laohasrisakul R, Manonukul J. Pruritic popular eruption in HIV seropositive patients: a cutaneous
marker for immunosupression. Int J Dermatol. 1999;38(5):34850.
40. Patel P, Hanson DL, Sullivan PS. Incidence of types of Cancer among HIVInfected persons compared with the
general population in the United States, 19922003. Ann Intern Med. 2008;148:72836.
41. Rendon MI, Roberts LJ, Tharp MD. Linear cutaneous lesions of Kaposis sarcoma: A clinical clue to the diag-
nosis of AIDS. J Am Acad Dermatol. 1988;19:3279.
42. CrumCianflone N, Hullsiek KH, Satter E, et al. Cutaneous malignancies among HIVinfected persons. Arch
Intern Med. 2009;169(12):11308.
43. Lyter DW, Bryant J, Thackeray R, et al. Incidence of human immunodeficiency virusrelated and nonrelated
malignancies in a large cohort of homosexual men. J Clin Oncol. 1995;13:25406.
44. BeylotBarry M, Vergier B, Masquelier B, et al. The spectrum of cutaneous lymphomas in HIV infection: a study
of 21 cases. Am J Surg Pathol. 1999;23(10):120816.
45. Ratnam I, Chiu C, Kandala NB, et al. Incidence and risk factors for immune reconstitution inflammatory syn-
drome in an ethnically diverse HIV type 1infected cohort. Clin Infect Dis. 2006;42:41827.
46. Greenberg RG, Berger TG. Nail and mucocutaneous hyperpigmentation with AZT therapy. J Am Acad Dermatol.
1990;22(2):32730.
47. Diven DG, Newton RC, Ramsey KM. Heightened cutaneous reactions to mosquito bites in patients with acquired
immunodeficiency syndrome receiving zidovudine. Ach Inter Med. 1988;148:2296.
48. Torres RA, Lin RY, Lee M, et al. Zidovudineinduced leukocytoclastic vasculitis. Arch Intern Med. 1992;152:8501.
49. Introcaso CE, Hines JM, Kovarik CL. Cutaneous toxicities of antiretroviral therapy for HIV. Part I. Lipodystro-
phy syndrome, nucleoside reverse transcriptase inhibitors, and protease inhibitors. J Am Acad Dermatol.
2010;63(4):54960.
50. Introcaso CE, Hines JM, Kovarik CL. Cutaneous toxicities of antiretroviral therapy for HIV. Part II. Nonnucle-
oside reverse transcriptase inhibitors, entry and fusion inhibitors, integrase inhibitors, and immune reconstitution
syndrome. J Am Acad Dermatol. 2010;63(4):5639.
51. Ball RA, Kinchelow T. Injection side reactions with the HIV1 fusion inhibitor enfuvirtide. J Am Acad Derma-
tol. 2003;49:82631.
VI Seco
Captulo 4

Complicaes do sistema nervoso


na infeco por VIH
Antnio Mota Miranda

Introduo

O infectado por vrus da imunodeficincia humana (VIH) apresenta grande


vulnerabilidade a agentes infecciosos vrus, bactrias, incluindo mico-
bactrias, parasitas e fungos, habitualmente pouco patognicos no hospe-
deiro com mecanismos de defesa intactos, mas com elevada virulncia em
indivduos com compromisso imunitrio. A maioria dos casos resulta da
reactivao de microrganismos endgenos, mantidos em estado quiescente
no hospedeiro, aps a infeco primria, tantas vezes assintomtica e ad-
quirida em idades precoces. No entanto, podem, tambm, resultar duma
infeco adquirida no decurso da infeco por VIH, a qual apresenta maior
gravidade em resultado da imunodepresso induzida por esse vrus ou ser,
ainda, consequncia de reinfeco.
Alm disso, nestes doentes h maior susceptibilidade a doenas oncol-
gicas, com registo de maior incidncia de neoplasias, entre as quais o
sarcoma de Kaposi, os linfomas noHodgkin e o carcinoma invasivo do
colo do tero, todos entidades definidoras de sida.
Finalmente, deve citarse que o prprio VIH pode causar a sndrome de
emaciao e a sndrome demencial ou encefalopatia por VIH.
Os principais alvos dos agentes microbianos oportunistas so o aparelho
respiratrio, o sistema nervoso, o aparelho digestivo, o sistema hemolinfo-
poitico, a pele e as mucosas, sendo variadas as entidades nosolgicas de
apresentao.
Neste trabalho fazse uma reviso sucinta das manifestaes neurolgi-
cas mais prevalentes, no doente com infeco por VIH, fornecendo ao
mdico uma informao geral, que permita a orientao dos doentes e, se
240 Antnio Mota Miranda

Quadro 1. Relao entre as principais doenas neurolgicas e a imunidade


Entidade nosolgica Contagem de linfcitos TCD4+
500/l 200500 l 200/l
Meningite/encefalite da primoinfeco
Meningite assptica
Encefalopatia por VIH
Mielopatia vacuolar
Infeces oportunistas
Linfoma cerebral primrio
Sfilis meningovascular

justificado, o seu encaminhamento para centros com experincia no diag-


nstico e tratamento dessas situaes. Alm das manifestaes precoces,
sero revistas as manifestaes primrias e secundrias, que se podem ob-
servar na evoluo da infeco por VIH.

Aspectos gerais
As complicaes neurolgicas nesses doentes so comuns, podendo atingir
qualquer departamento do sistema nervoso, seja o crebro, a medula espinal
e os nervos perifricos14. De modo significativo contribuem para a elevada
morbilidade e mortalidade do doente com infeco por VIH 14.
Estimase que entre 40-70% dos doentes desenvolvem doena neurol-
gica, conquanto se documentem alteraes neuropatolgicas em 80% dos
estudos necrpsicos14. No entanto, nos ltimos anos observouse uma reduo
da incidncia de algumas neoplasias e infeces oportunistas, incluindo do
sistema nervoso, consequncia da melhoria dos cuidados de sade, introdu-
o da teraputica antiretrovrica combinada (TARVc) e da quimioprofila-
xia primria, medidas aconselhadas e adoptadas na maioria dos doentes, que
tm acesso aos servios de sade513. Porm, em 1020% dos doentes, a
doena neurolgica constitui manifestao inaugural da sida 1,2,4,11.
Algumas particularidades sobre as complicaes do sistema nervoso
merecem ser salientadas:
1 A sua ocorrncia isolada ou em simultneo com outras patologias,
mesmo do foro neurolgico, facto a ter, sempre, em considerao
no diagnstico diferencial.
2 O seu aparecimento em qualquer momento da evoluo da infeco
por VIH, embora com maior frequncia em doentes com contagem
de linfcitos TCD4+ inferior a 200 cls/mm 3 (Quadro 1).
3 A sua etiologia poder ser causada pelo prprio vrus, por agentes mi-
crobianos oportunistas ou, por outro lado, ser consequncia de doenas
sistmicas ou, ainda, dos efeitos adversos dos medicamentos.
4 O diagnstico etiolgico dever ser apoiado na identificao do mi-
crorganismo ou de outro factor causal, o que implica, por vezes, o
recurso a mtodos de diagnstico invasivos. Actualmente, tcnicas
Complicaes do sistema nervoso na infeco por VIH 241

de biologia molecular podem ser usadas para identificao do ge-


noma microbiano, permitindo o diagnstico etiolgico e obstando
ao recurso a mtodos invasivos.

Aspectos clnicos
O polimorfismo clnico das doenas neurolgicas amplo e inespecfico,
assim como a variedade de quadros clnicos, que se encontram desde o
incio da infeco por VIH, at sua fase crtica de maior depresso imu-
nitria. Na criana, dada a imaturidade imunitria e neurolgica, a apresen-
tao clnica diferente da do adulto e a progresso da doena muito
mais rpida. Nesses casos habitual observarse atraso psicomotor ou per-
da de funes, cognitivas ou motoras, j adquiridas. Alm disso, as infeces
oportunistas surgem no em consequncia da reactivao de uma infeco
latente, mas, em regra, por exposio primria ao agente microbiano.
O incio da doena neurolgica pode ser agudo ou insidioso, sendo as
manifestaes clnicas mais comuns as alteraes da conscincia, do com-
portamento e das funes cognitivas, as cefaleias, os dfices ou perturbaes
neurossensoriais e as convulses, acompanhadas ou no de febre. Os sinais
menngeos, quase sempre presentes no hospedeiro imunocompetente, so
poucas vezes detectados nestes doentes. Por isso, e pela subtileza das ma-
nifestaes, deve recorrerse precocemente, alm de outros, a estudos neu-
rorradiolgicos, electrofisiolgicos e do lquido cefalorraquidiano (LCR) e
sangue, mesmo nos casos em que o quadro clnico no sugira atingimento
do sistema nervoso.
As formas de apresentao clnica mais habitual so a encefalopatia, com-
plexo demencial da sida ou disfuno cognitiva e motora associada a VIH, a
encefalite, a meningite, os abcessos ou neoformaes, a mielite e a neuropatia
perifrica14,9,11. Qualquer destas situaes pode ser ocasionada pelo prprio
vrus ou por microrganismos oportunistas, mas tambm podem ser de cau-
sa neoplsica, vascular, autoimune, metablica ou medicamentosa.
Logo, no momento da seroconverso, podem surgir manifestaes neu-
rolgicas, sob a forma de meningite aguda, encefalite, mielopatia aguda,
radiculopatia, neuropatia perifrica e sndrome de GuillainBarr, as quais
podem corresponder sndrome retrovrica aguda ou primoinfeco por
VIH1416. De um modo geral, este diagnstico no considerado num n-
mero significativo de doentes, no s porque pode evoluir sem qualquer
manifestao clnica, mas, tambm, pela sua subtileza e inespecificidade.
Nesse sentido, importante um elevado ndice de suspeita e perante essas
situaes clnicas e apoiados em aspectos epidemiolgicos dever-se- pon-
derar esse diagnstico, procedendo a estudo apropriado pesquisa de anti-
corpos antiVIH, habitualmente presentes entre a segunda e a oitava sema-
na aps o contgio, deteco do antignio p24 ou do genoma do vrus por
polymerase chain reaction (PCR) em ttulos elevados.
Em perodo assintomtico, ainda com imunodeficincia ligeira ou mo-
derada, podem ocorrer meningite assptica, acompanhada de neuropatia dos
242 Antnio Mota Miranda

pares cranianos, paralisia facial, polineuropatias, polirradiculopatias, mono-


nevrite multiplex benigna, cefaleias violentas (recorrentes ou crnicas) e
convulses, situaes estas que obrigam ao diagnstico diferencial com
meningite bacteriana, tuberculosa ou fngica, abcessos e neoformaes
cerebrais de mltipla etiologia e, ainda, disfuno do sistema nervoso peri-
frico por vrus citomeglico (VCM), herptico e varicelazster, entre
outras causas. Nesses doentes no se identifica outra causa orgnica que a
infeco por VIH.
Complicaes cerebrovasculares podem, tambm, surgir em qualquer fase
da evoluo da infeco por VIH e serem provocadas por doena vascular
oclusiva ou embolismo cardiognico arterial, as quais podem ser consequn-
cia de doena infecciosa ou no.
As manifestaes primrias, fundamentalmente atribudas a VIH, so
observadas em cerca de 30% dos doentes e so trs vezes mais comuns que
as infeces oportunistas. Estas englobam a encefalopatia por VIH ou sn-
drome demencial associada sida, a mielopatia vacuolar e a neuropatia
perifrica14,11. Os seus aspectos clnicos podem ser semelhantes aos de
outras causas, sendo comuns a disfuno cognitiva, as perturbaes motoras
e comportamentais, as alteraes da marcha, predominantemente ataxia e
espasticidade, e as manifestaes sensoriais. Habitualmente, cursam sem
febre e limitam de modo progressivo as actividades mentais e fsicas dos
doentes, tornandoos totalmente dependentes.
As manifestaes neurolgicas secundrias podem ter etiologia micro-
biana mltipla. Estas situaes eram raras antes do advento da sida, tornan-
dose ainda hoje, na ausncia de tratamento antiretrovrico (TARV), na
principal ameaa e na dominante causa de morte desses doentes. A toxo-
plasmose cerebral e as meningites criptoccica, tuberculosa e pneumocci-
ca so as mais comuns. As outras complicaes so menos habituais e, alm
da leucoencefalopatia multifocal progressiva (LMP), atribuda ao vrus JC,
as encefalites e outras sndromes neurolgicas por VCM, herptico e varice-
lazster, a mielite transversa e difusa e as neuropatias, deve, ainda, mencio-
narse a neurossfilis, assintomtica ou sintomtica, pela sua crescente inci-
dncia e implicaes teraputicas, que obrigam ao estudo do LCR 1723.
Entre as neoplasias do sistema nervoso, o linfoma cerebral primrio
merece destaque, pela sua ecloso com a sida e pela sua relao com o
vrus de EpsteinBarr4,24,25. Por isso, actualmente, a deteco do ADN do
vrus no LCR, por PCR, tem um importante valor diagnstico26. Com esta
tecnologia, obstase realizao da biopsia cerebral estereotxica, para
estabelecer o diagnstico definitivo, dadas as semelhanas clnicas e neu-
rorradiolgicas com outras patologias do sistema nervoso 27. O sarcoma de
Kaposi, a principal doena oncolgica nos doentes infectados por VIH, pode
tambm, embora de modo pouco habitual, envolver o sistema nervoso.
A sndrome de reconstituio imunitria surgiu com o advento da TARV.
Manifestase algumas a vrias semanas aps o seu incio e, habitualmente,
em doentes submetidos, pela primeira vez, a esse tratamento e que apre-
sentam recuperao imunitria e vrica. Caracterizase pela ocorrncia de
Complicaes do sistema nervoso na infeco por VIH 243

doenas oportunistas graves, sobretudo infeces, que podem atingir qual-


quer aparelho, sistema ou rgo, incluindo o sistema nervoso 28.
Finalmente, convm lembrar que doenas autoimunes podem evoluir
com atingimento do sistema nervoso central (SNC), em particular a artrite
reumatide, o lpus eritematoso sistmico e a sndrome de Sjgren prim-
ria, assim como importante no esquecer que o doente com infeco por
VIH susceptvel s mesmas complicaes neurolgicas, que possam surgir
no hospedeiro no infectado por VIH29.

Diagnstico
As complicaes neurolgicas podem ocorrer em qualquer idade e exigem
uma histria e um exame fsico minuciosos, que deve incluir os estudos ana-
lticos convencionais e de biologia molecular, no mbito da microbiologia,
bem como exames de imagiologia, de que se salienta a ressonncia magn-
tica nuclear (RMN) cerebral com ou sem administrao de gadolnio ou, na
sua impossibilidade, tomografia axial (TAC) cerebral com ou sem contraste.
Na histria clnica, alm do conhecimento da infeco por VIH, estado
imunitrio, quimioprofilaxias das infeces oportunistas e riscos comportamen-
tais, sobretudo toxicodependncia, , tambm, importante considerar a estada
ou vivncia em reas endmicas de patologias prevalentes nessas regies e
antecedentes de doenas infecciosas, com possibilidade de reactivao.
A orientao do diagnstico e da etiologia pode ser facilitada se o estu-
do do doente for feito de acordo com sndromes neurolgicas, que se podem
agrupar, preferencialmente, em sndromes tumorais, menngeas, demenciais,
de atingimento medular e do sistema nervoso perifrico (Quadro 2) 30.
Contudo, o diagnstico complexo e, muitas vezes, difcil, embora seja
necessrio um esclarecimento preciso, pois so vrias as situaes que be-
neficiam de tratamento etiotrpico, facto que permite uma melhor e maior
qualidade de vida dos doentes. Aquele , predominantemente, clnico e
baseado no exame neurolgico, complementado por estudos imagiolgicos,
neurofisiolgicos, do LCR e do sangue. No entanto, s a identificao do
microrganismo no LCR e/ou sangue ou no tecido cerebral permite definir
a etiologia. Apesar da elevada sensibilidade das tcnicas de imagem, a sua
especificidade baixa e no possibilita a identificao etiolgica. Porm,
so fundamentais na avaliao do doente com manifestaes neurolgicas
ou com suspeita de doena neurolgica, pois permitem obter informao
relevante para o diagnstico diferencial das doenas parenquimatosas do
sistema nervoso, como seja o nmero, o tipo e a localizao das leses, as
quais podem ser sugestivas de determinadas etiologias (Quadro 3).
Algumas dessas entidades, tratveis com medicao etiotrpica, so de
fcil diagnstico, recorrendo a exames acessveis, de simples execuo e
pouca agressividade, como hemoculturas, estudo do LCR, sobretudo exa-
me microbiolgico, pesquisa de antignios capsulares no sangue e/ou no
LCR e, mais recentemente, identificao do genoma do microrganismo
por PCR26,3134.
244 Antnio Mota Miranda

Quadro 2. Formas de apresentao das complicaes neurolgicas na sida


Focais
Sndromes tumorais Toxoplasmose cerebral
(abcessos ou neoformaes) Leucoencefalopatia multifocal progressiva
Linfoma cerebral primrio ou metasttico
Abcessos por Cryptococcus spp, Candida spp, Aspergillus
spp, Histoplasma spp, Coccidioides immitis, Listeria spp,
Nocardia spp, Mycobacterium tuberculosis e Treponema
pallidum
Metstases de sarcoma de Kaposi ou de outras neoplasias
Nofocais
Sndromes menngeas Meningite criptoccica, tuberculosa, por Mycobacterium
(meningite ou avium complex, S. pneumoniae, Listeria spp, E. coli e
meningoencefalite) Candida spp
Meningite ou meningoencefalite por VIH primoinfeco
Sfilis meningovascular
Meningite linfomatosa
Sndromes demenciais Encefalopatia por VIH
(encefalite ou demncia) Encefalite por VCM, vrus Herpes simplex e varicelazster
Leucoencefalopatia multifocal progressiva
Sndromes medulares Mielopatia vacuolar
e do sistema nervoso Mielite por VCM e Herpes simplex
perifrico Polirradiculite por vrus varicelazster, citomeglico,
(mielite e neuropatia) Herpes simplex
Polineuropatia desmielinizante inflamatria, aguda ou crnica
Polineuropatia simtrica distal ou neuropatia sensorial
Compresso medular tumoral (linfoma) ou infecciosa
(bactrias e fungos)

Outras situaes neurolgicas, como a encefalopatia por VIH, a LMP, o


linfoma primrio do crebro e as encefalites vricas so difceis de diagnos-
ticar. Nestes casos, s o estudo histolgico e/ou microbiolgico permite
estabelecer, com segurana, o diagnstico etiolgico, sendo para isso neces-
sria a realizao de biopsia cerebral estereotxica 27.
A possibilidade de identificao de microrganismos no LCR, por tcni-
cas de biologia molecular PCR veio permitir esclarecer mltiplas do-
enas neurolgicas, no identificadas pelos mtodos convencionais de
diagnstico, dando um importante contributo para o diagnstico microbio-
lgico26,3134. Actualmente, um valioso e til instrumento de diagnstico,
pois tornouse possvel identificar o genoma microbiano no LCR, permitin-
do, assim, uma investigao mais precisa das infeces do sistema nervoso.
A sua sensibilidade e especificidade so elevadas, permitindo o diagnstico
da doena citomeglica, por vrus Herpes simplex ou por varicelazster, da
LMP, da meningite tuberculosa, da encefalite toxoplsmica e da neurossfilis.
Complicaes do sistema nervoso na infeco por VIH 245

Quadro 3. Aspectos neurorradiolgicos das principais entidades neurolgicas


Doena neurolgica Nmero de leses Tipo de leses Localizao das leses
Toxoplasmose Mltiplas Efeito de massa; Gnglios da base;
cerebral captao de contraste crtex
em anel
Leucoencefalopatia Mltiplas Sem efeito de massa Substncia branca;
multifocal e sem captao de subcortical; fibras U
progressiva contraste; hipersinal
em T2 e hipossinal
em T1 na RMN
Encefalopatia Ausncia, Atrofia cerebral; sem Substncia branca
por VIH difusas ou efeito de massa e sem profunda; poupa as
mltiplas captao de contraste; fibras U; gnglios
hipersinal em T2 da base
difuso ou discreto
Encefalite Poucas Pequenas; captao Epndimo; crtex
por VCM de contraste;
hipersinal em T2
Meningite Variveis Espaos perivasculares Gnglios da base
criptoccica dilatados
Linfoma cerebral Uma ou Efeito de massa; Periventricular; invaso
poucas irregular; fraca subependimria;
captao de contraste substncia branca

Tambm, um mtodo de grande utilidade no diagnstico do linfoma


primrio do crebro, pela possibilidade de identificar o ADN do vrus de
EpsteinBarr, reconhecida que a ntima relao entre este vrus e o tumor
cerebral. A positividade da PCR , fortemente, sugestiva desse diagnsti-
co. Assim, a tcnica de PCR do LCR uma nova eficaz e rpida arma
de estudo das doenas neurolgicas associadas sida, de pouca agressi-
vidade e com possibilidade de diagnstico das principais complicaes
oportunistas.
Sob a forma de diagrama esquematizase o modo de avaliao do do-
ente com manifestaes neurolgicas, seguindo uma orientao escalonada,
que permita estabelecer o diagnstico etiolgico (Fig. 1).
Assim, em todo o doente com manifestaes suspeitas de doena neu-
rolgica deve fazer TAC cerebral, utilizando dose dupla do contraste e
efectuando imagens tardias, ou RMN cerebral, mtodo mais sensvel na
identificao de leses no aparentes na tomografia. Atravs destes exames
possvel detectar atrofia cerebral ou alteraes focais e, neste caso, deter-
minar a sua morfologia e as suas caractersticas, as quais podero sugerir
determinadas etiologias. Concomitantemente, procederse a pesquisa de
anticorpos especficos para toxoplasma, do antignio criptoccico e do
VDRL/TPHA no sangue.
246 Antnio Mota Miranda

Sndrome cerebral

Tumoral Menngeo Demencial

TAC cerebral
Antitoxoplasma IgG/antg. criptoccico/VDRL-TPHA no soro

Normal ou atrofia cerebral Leso focal nica ou leses mltiplas

Puno lombar para estudo do LCR:


Citologia, incluindo pesquisa de clulas malignas/protenas/
glicose/estudo microbiolgico/antg. capsulares bacterianos
antg criptoccico/antg. citomeglico/ADA/VDRL Tratamento emprico da toxoplasmose
PCR - M. tuberculosis/VCM e VHS

Positiva Negativa Ausncia de resposta Resposta teraputica

Toxoplasmose cerebral

Puno lombar para estudo do LCR:


Tratamento etiolgico RMN RMN Estudos anteriores
PCR - T. gondii, M. tuberculosis / Vrus JC, VEB,
VCM, VHS, VVZ e T. pallidum

Biopsia cerebral estereotxica: Positiva


Estudo histolgico/microscopia electrnica Tratamento etiolgico
Estudos por imunofluorescncia/
imunocitoqumica/PCR/cultura de vrus

Figura 1. Avaliao do doente com manifestaes neurolgicas.

Perante uma alterao focal dever considerarse, de imediato, o diag-


nstico de toxoplasmose cerebral, particularmente em reas com elevada
prevalncia desta infeco parasitria, como o caso de Portugal e, sobre-
tudo, se o doente tem serologia antitoxoplasma positiva17,18. A imagem
tomogrfica mais caracterstica apresentase sob a forma de uma ou mais
leses hipodensas, ovalares ou arredondadas e com captao do contraste
periferia, tomando a configurao anelar. A resposta ao tratamento antito-
xoplasma, habitualmente eficaz, clnica e neurorradiologicamente, em duas
a trs semanas, permite confirmar esse diagnstico.
A ausncia de resposta teraputica dever conduzir realizao de RMN
cerebral e/ou de puno lombar, cujo estudo dever incluir exame citolgi-
co com pesquisa de clulas neoplsicas e incluses vricas, doseamento de
protenas, glicose e ADA, determinao de antignio criptoccico e citome-
glico, serologia da sfilis VDRL e estudo microbiolgico, realando,
pela sua facilidade e rapidez de informao, a importncia dos exames di-
rectos, Gram, ZiehlNeelsen e colorao pela tinta da China. Tambm a
Complicaes do sistema nervoso na infeco por VIH 247

pesquisa de antignios capsulares bacterianos Streptococcus pneumoniae,


Haemophilus influenzae tipo b, Neisseria meningitidis deve fazer parte
dessa rotina.
Dever, ainda, ser considerada a pesquisa do ADN no LCR, por PCR,
de VCM, Herpes simplex, varicelazster, JC (agente da LMP), EpsteinBarr
dada a sua relao com o linfoma primrio do crebro, bem como de
Mycobacterium tuberculosis, Toxoplasma gondii e Treponema pallidum.
Na impossibilidade de se estabelecer o diagnstico definitivo, deve re-
correrse biopsia cerebral estereotxica ou por craniotomia, mtodo no
isento de complicaes e nem sempre esclarecedor, mas que a nica al-
ternativa, que pode identificar a etiologia, nas situaes em que no
possvel saberse o diagnstico por mtodos noinvasivos27. O processa-
mento do tecido cerebral, assim obtido, deve ser imediato e, alm do exame
histolgico, deve incluir estudos por ultramicroscopia, imunofluorescncia
e imunocitoqumica e, ainda, exames microbiolgicos e de biologia mole-
cular (PCR).

Tratamento
O tratamento etiotrpico das complicaes do sistema nervoso dever ser,
sempre que possvel, apoiado num diagnstico etiolgico, situao nem
sempre conseguida de imediato, o que implica a teraputica emprica, base-
ada na informao epidemiolgica, clnica, imunitria, neurorradiolgica e
nos estudos microbiolgicos, seroimunolgicos e de biologia molecular do
sangue e do LCR.
Alm do tratamento de induo da doena oportunista, deve manterse uma
teraputica de manuteno ou supressiva, de modo a impedir as recorrncias,
comuns e de maior gravidade, aps a suspenso do tratamento inicial6.
A teraputica da doena oportunista dever ser complementada pelo
tratamento sintomtico e, sobretudo, pelo tratamento da doena subjacente,
recorrendo associao dos mais eficazes frmacos antiretrovricos, con-
forme as normas de recomendao da TARV5,7. Na definio desta estrat-
gia teraputica, devem considerarse as mltiplas interferncias medicamen-
tosas e os vrios efeitos adversos dos medicamentos.
Medidas de higiene e dietticas, assim como quimioprofilaxia primria de
determinadas infeces oportunistas, devem ser aconselhadas, de maneira a
impedir a infeco ou a prevenir a reactivao de microrganismos e desenvol-
vimento de doena. A profilaxia primria est indicada em doentes com evi-
dncia de infeco prvia e determinado limiar de linfcitos TCD4+, habitual-
mente, nos casos das infeces do sistema nervoso, inferior a 100 cls/mm36.
Embora o tratamento supressivo deva ser mantido por toda a vida, po-
der considerarse a sua suspenso em doentes assintomticos submetidos
a TARV, com supresso da replicao vrica e reconstituio imunitria
contagem de linfcitos TCD4+ superior a 100200 cls/mm3, por mais de
seis meses. No entanto, a profilaxia secundria dever ser reintroduzida se
a contagem de linfcitos atingir valores inferiores a 200 cls/mm 36.
248 Antnio Mota Miranda

Tambm, nos doentes submetidos a TARV, com supresso da replicao


vrica e reconstituio imunitria, a interrupo da profilaxia primria pode
fazerse com segurana, desde que a contagem de linfcitos TCD4 + seja
superior a 200 cls/mm3 e mantida por um perodo de pelo menos trs
meses. Se, entretanto, houver uma contagem de linfcitos com valores
inferiores a 100200 cls/mm3, dever considerarse a reintroduo da pro-
filaxia6.

Concluso
As complicaes neurolgicas associadas sida so frequentes e causa
importante de morbilidade e mortalidade, interferindo de modo significativo
na sobrevivncia e na qualidade de vida dos doentes, com infeco por
VIH.
As suas causas so mltiplas, podendo ser devidas aco directa do
prprio VIH ou secundrias a vrias situaes, de que se salientam as ne-
oplasias e as infeces oportunistas, estas resultando, a maioria das vezes,
da reactivao de microrganismos endgenos em estado de latncia.
A sua ocorrncia mais comum em fases de grave imunodepresso, a
maioria das vezes a surgirem aps o primeiro episdio definidor de sida ou
em doentes com linfcitos TCD4+ inferiores a 200 cls/mm3.
As manifestaes clnicas so amplas e comuns a vrios processos pa-
tolgicos, tornando o diagnstico difcil e complexo. Por vezes, so frustes
e pouco evocadoras do envolvimento do sistema nervoso, sendo necessrio
um elevado ndice de suspeita para o seu diagnstico. A disfuno neuros-
sensorial, as cefaleias, a febre, as convulses e os sinais neurolgicos focais
so as manifestaes mais frequentes de doena neurolgica.
Dos exames subsidirios devem salientarse os estudos de imagem neu-
rorradiolgica, electrofisiolgicos, seroimunolgicos, do LCR e do sangue.
Apesar da grande sensibilidade de alguns desses estudos, no so especfi-
cos, tornando muitas vezes necessrio o recurso a mtodos invasivos para
estabelecer o diagnstico etiolgico.
Os estudos microbiolgicos de fluidos orgnicos, produtos patolgicos
e, por vezes, de tecido cerebral, obtido por biopsia estereotxica, so cruciais
para estabelecer o diagnstico. Esta ltima atitude importante por permi-
tir orientar a teraputica, que, em algumas situaes, tem tratamento etio-
trpico eficaz, permitindo melhorar, significativamente, a sobrevivncia e a
qualidade de vida do doente.
A possibilidade recente do diagnstico etiolgico, atravs de tcnicas
de biologia molecular (PCR), trouxe novas perspectivas de interveno no
diagnstico das doenas do sistema nervoso, em doentes com infeco por
VIH, sendo tcnicas de elevada sensibilidade e especificidade, que podero
obstar ao recurso de exames agressivos para o doente. No entanto, no
devem substituir os exames clssicos de diagnstico rpido, mas serem um
complemento desses estudos e, assim, interpretados de acordo com esses
resultados.
Complicaes do sistema nervoso na infeco por VIH 249

Finalmente, salientese que aps o tratamento de induo das doenas


oportunistas deve manterse a teraputica supressiva, e que a TARV actual
e a quimioprofilaxia primria das principais infeces oportunistas contri-
buram de modo significativo para a reduo da morbilidade e da mortali-
dade da sida e, ainda, para a significativa melhoria da qualidade de vida
dos doentes.

Bibliografia
1. Koralnik IJ. Neurologic diseases caused by human immunodeficiency virus1 and opportunistic infections. Em:
Mandell GL, Douglas RG, Bennett JE, eds. Principles and practice of infectious diseases. 6. a ed. Churchill
Livingstone; 2005. p. 1583601.
2. Price RW, Brew BJ. Central and peripheral nervous system complications. Em: AIDS: DeVitta VT Jr, Hellman
S, Rosenberg S, eds. Etiology, diagnosis, treatment and prevention. 4. a ed. LippincottRaven; 1997. p. 3423.
3. Price RW. Management of the neurologic complications of HIVinfection and AIDS. Em: Sande MA, Volberding
PA, eds. The medical management of AIDS. 5.a ed. WB Saunders Company; 1997. p. 197216.
4. Geraci AP, Simpson DM. Neurological manifestations of HIV1 infection in the HAART era. Compr Ther.
2001;27(3):23241.
5. Panel on Antiretroviral Guidelines for Adult and Adolescents. Guidelines for the use of antiretroviral agents in
HIVinfected adults and adolescents. Department of Health and Human Services. December 1, 2009;1161 [acesso
em 30/09/2010]. Disponvel em: http://www.aidsinfo.nih.gov/ContentFiles/AdultandAdolescentGL.pdf.
6. Centers for Disease Control and Prevention. Guidelines for Prevention and Treatment of Opportunistic Infections
in HIVInfected Adults and Adolescents. MMWR. 2009;58(RR4):1203.
7. MotaMiranda A, Maltez F, Antunes F, et al. Teraputica antiretrovrica da infeco por vrus da imunodefi-
cincia humana. VIH/SIDA Recomendaes teraputicas Portugal 2007. Monografia, Patrocnio Cientfico da
Associao Portuguesa para o Estudo Clnico da SIDA (APECS). Junho 2007.
8. Bower M, Palmieri C, Dhillon T. AIDSrelated malignancies: changing epidemiology and the impact of highly
active antiretroviral therapy. Curr Opin Infect Dis. 2006;19(1):149.
9. Bernstein WB, Little RF, Wilson WH, Yarchoan R. Acquired Immunodeficiency SyndromeRelated Malignancies
in the Era of Highly Active Antiretroviral Therapy. Int J Hematol. 2006;84(1):311.
10. Walensky RP, Paltiel D, Losina E, et al. The survival benefits of AIDS treatment in the United States. J Infect
Dis 2006;194:119
11. DArminioMonforte A, Cinque P, Mocrof A, et al. EuroSIDA Study Group. Changing incidence of central
nervous system disease in the EUROSIDA cohort. Ann Neurol. 2004;55:3208.
12. Ammassari A, Cingolani A, Pezzotti P, et al. AIDSrelated focal brain lesions in the era of highly active anti-
retroviral therapy. Neurology. 2000;55:1194200.
13. Palella FJ Jr, Delaney KM, Moorman AC, et al. Declining morbidity and mortality among patients with advanced
human immunodeficiency virus infection. N Engl J Med. 1998;338:85360.
14. Kahn JO, Walker BD. Current concepts: acute human immunodeficiency virus type 1 infection. N Engl J Med.
1998;339:339.
15. Schacker T, Collier AC, Hughes J, et al. Clinical and epidemiologic features of primary HIV infection. Ann
Intern Med. 1996;125:25764.
16. MotaMiranda A. Primoinfeco VIH: importncia do seu reconhecimento. Rev Port Doenas Infecciosas.
1996;20(2):34.
17. Montoya JG, Kovacs JA, Remington JS. Toxoplasma gondii. Em: Mandell GL, Douglas RG, Bennett JE, eds.
Principles and practice of infectious diseases. 6. a ed. Churchill Livingstone; 2005. p. 311098.
18. MotaMiranda A, Gomes MH, Guimares M, et al. Toxoplasmose cerebral em doentes com SIDA. Rev Port
Doenas Infecciosas. 1992;15(3):16372.
19. Perfect JR. Cryptococcus neoformans. Em: Mandell GL, Douglas RG, Bennett JE, eds. Principles and practice
of infectious diseases. 6.a ed. Churchill Livingstone; 2005. p. 29973012.
20. MotaMiranda A, Gomes MH, Figueiredo P, et al. Criptococose em doentes com SIDA. Arqui Med. 1993;
7(4):21924.
21. Fitzgerald D, Haas DW. Mycobacterium tuberculosis. Em: Mandell GL, Douglas RG, Bennett JE, eds. Principles
and practice of infectious diseases. 6.a ed. Churchill Livingstone; 2005. p. 285286.
22. Zuger A. When should you look for neurosyphilis? AIDS Clin Care. 2004;2(5).
23. Johns DR, Tierney M, Felsenstein D. Alteration in the natural history of neurosyphilis by concurrent infection
with human immunodeficiency virus. N Engl J Med. 1987;316:156972.
24. Trubowitz PR, Volberding PA. Primary central nervous system lymphoma. Em: Mandell GL, Douglas RG, Ben-
nett JE, eds. Principles and practice of infectious diseases. 5. a ed. Churchill Livingstone; 2000. p. 1445.
25. Bower M, Powles T, Nelson M, et al. Highly Active Antiretroviral Therapy and Human Immunodeficiency
VirusAssociated Primary Cerebral Lymphoma. J Natl Cancer Inst. 2006;98(15):108891.
26. Cinque P, Scarpellini P, Vago L, et al. Diagnosis of central nervous system complications in HIVinfected patients:
cerebrospinal fluid analysis by the polymerase chain reaction. AIDS. 1997;11:117.
27. Antinori A, Ammassari A, Luzzati R. Role of brain biopsy in the management of focal brain lesions in HIVinfected
patients. Gruppo Italiano Cooperativo AIDS & Tumori. Neurology. 2000;54(4):9937.
28. Venkataramana A, Pardo CA, McArthur JC, Kerr DA, Irani DN, Griffin JW. Immune reconstitution inflammatory
syndrome in the CNS of HIVinfected patients. Neurology. 2006;67(3):3838.
250 Antnio Mota Miranda

29. Markusse HM, van den Bent MJ, Vecht CJ. Immunology in medical practice. XIV. Central nervous system
complications in systemic autoimmune diseases. Ned Tijdschr Geneeskd. 1998;142(10):50812.
30. American Academy of Neurology. Evaluation and management of intracranial mass lesions in AIDS. Report of
the Quality Standards Subcommittee of the American Academy of Neurology. Neurology. 1998;50(1):216.
31. Quan C, Lu CZ, Qiao J, et al. Comparative evaluation of early diagnosis of tuberculous meningitis by different
assays. J Clin Microbiol, 2006;44:31606.
32. Bonington A, Strang JIG, Klapper PE, et al. TB PCR in the early diagnosis of tuberculous meningitis: evaluation
of the Roche semiautomated COBAS Amplicor MTB test with reference to the manual Amplicor MTB PCR
test. Tubercle and Lung Disease. 2000;80:1916.
33. Bonington A, Strang JIG, Klapper PE, et al. Use of Roche Amplicor Mycobacterium tuberculosis PCR in early
diagnosis of tuberculous meningitis. J Clin Microbiol. 1998;36:12514.
34. Barnes PF. Rapid diagnostic tests for tuberculosis progress but no gold standard. Am J Respir Crit Care Med.
1997;155:14978.
VI Seco
Captulo 5

Complicaes renais
Jos Antnio Lopes, lvaro Ayres Pereira

Introduo
A leso renal, com consequente insuficincia renal e/ou alteraes electro-
lticas, ocorre, frequentemente, no doente com infeco por VIH e contribui
para o aumento da mortalidade1. Deste modo, no infectado por VIH, tornase
fundamental a monitorizao regular da funo renal, de modo a permitir
o diagnstico precoce e a teraputica atempada da nefropatia.

Sndromes nefrolgicas
Leso renal aguda
A leso renal aguda (LRA) uma complicao frequente, no doente com
infeco por VIH, apresentando uma incidncia de 5,9/100 doentes por
ano no doente em ambulatrio 2, de 6% no doente hospitalizado 3 e de
37,4% no doente internado em Unidade de Cuidados Intensivos 4. A ida-
de avanada, o gnero masculino, a contagem de linfcitos TCD4 + in-
ferior a 200 cls/mm 3, a viremia superior a 10.000 cpias/ml, a comor-
bilidade (diabetes mellitus, doena renal crnica [DRC] prvia e
coinfeco por vrus da hepatite C [VHC]), so factores, tradicionalmen-
te, associados a um maior risco de LRA, no doente com infeco por
VIH24. A etiologia da LRA, no doente com infeco por VIH, multi-
factorial (Quadro 1), salientandose, no entanto, em termos de frequncia,
as causas prrenais e a necrose tubular aguda. Relativamente ao prog-
nstico, a LRA est associada ao aumento da mortalidade hospitalar,
assim como ao aumento da incidncia da doena cardiovascular e da
mortalidade a longo prazo 3,5.
252 Jos Antnio Lopes, lvaro Ayres Pereira

Quadro 1. Causas de leso renal aguda nos doentes com infeco por VIH
Doena Causas
Prrenal Diarreia, vmitos, doena heptica crnica, spsis
Vascular Microangiopatia trombtica
Glomerular Glomerulonefrite por imunocomplexos
(secundria a hepatite C, psinfecciosa,
nefropatia associada a VIH)
Necrose tubular aguda Spsis, frmacos nefrotxicos (aminoglicosdeos,
anfotericina B, aciclovir, cidofovir, tenofovir,
pentamidina), rabdomilise
Nefrite intersticial alrgica Frmacos (cotrimoxazol, rifampicina, foscarnet,
nevirapina), infeco por vrus citomeglico (VCM)
Obstruo intratubular Sulfadiazina, indinavir, foscarnet, aciclovir
Psrenal Litase, tuberculose, infeco fngica, neoplasia
Secundria a toxicofilia ev. Spsis, endocardite, rabdomilise

Doena renal crnica


Num estudo prospectivo norteamericano verificouse que a prevalncia
da proteinria, em doentes com infeco por VIH, foi de 32% e, ainda, de
2,1% dos doentes tiveram duplicao da creatinina srica, num perodo
de cinco anos (19952000)6. Recentemente, em 1.239 doentes com infeco
por VIH, a prevalncia de DRC foi de 15,5%7. Relativamente populao de
doentes com infeco por VIH, em programa de dilise, a prevalncia glo-
bal e a incidncia anual varivel, de acordo com o Pas e com a regio.
Em Portugal, a incidncia anual de doentes com infeco por VIH em di-
lise, praticamente duplicou entre 1997 e 2002 (0,5% e 0,9%, respectiva-
mente) e a maioria dos doentes (75%) encontravase a realizar tratamento
dialtico na regio de Lisboa8. Relativamente DRC, no doente com infeco
por VIH, h que considerar as vrias etiologias, na populao em geral (por
exemplo, diabetes mellitus, hipertenso arterial, entre outras), e as que se
encontram mais especificamente associadas infeco por VIH (Quadro 2).
Neste grupo de doentes, a nefropatia associada a VIH (NAVIH ou HIVAN
human immunodeficiency virus associated nephropathy) a causa mais
frequente de DRC9. Recentemente, foi demonstrado que a LRA , tambm,
um factor de risco de DRC, nos doentes com infeco por VIH 5.
A sobrevida dos doentes com infeco por VIH, em programa dialtico,
indistinta em funo da modalidade dialtica (hemodilise ou dilise pe-
ritoneal) e a sobrevida do transplante renal e do doente transplantado
semelhante da populao em geral, daqueles doentes em tratamento subs-
titutivo da funo renal.
Complicaes renais 253

Quadro 2. Causas de doena renal crnica nos doentes com infeco por VIH
Causas Doena renal crnica
Associada a VIH Nefropatia associada a VIH
Nefropatia immunoglobulin A (IgA) (IgA policlonal)
Outras glomerulonefrites por imunocomplexos (por
exemplo, glomerulonefrite membranoproliferativa)
Microangiopatia trombtica
Associada ao modo Nefropatia da herona (toxicofilia ev. prolongada)
de transmisso de VIH
Outras Diabetes mellitus, hipertenso arterial,
uropatia obstrutiva

Nefropatia associada a VIH


A HIVAN ocorre em 1-10% dos infectados e mais frequente na idade
adulta e no sexo masculino, e ocorre, quase exclusivamente, em negros.
Actualmente, nos Estados Unidos da Amrica, a terceira causa de DRC,
na populao adulta de negros que inicia dilise10,11. A HIVAN surge inde-
pendentemente do modo de transmisso do vrus. Nestes doentes, a contagem
de linfcitos TCD4+ , com frequncia, inferior a 200 cls/mm3. A HIVAN
causada pela infeco vrica directa do rim, que poder ser um reserva-
trio activo do vrus ou um alvo infeccioso. O mecanismo etiopatognico
no est, ainda, completamente esclarecido, uma vez que os receptores e os
coreceptores (CD4+, CXCR4 e CCR5) no se encontram, constantemente,
presentes nas clulas renais infectadas. Clinicamente, a HIVAN caracterizase
por proteinria nefrtica e insuficincia renal, geralmente sem edema e/ou
hipertenso arterial. A biopsia renal permanece o mtodo de referncia no
diagnstico da HIVAN, sendo as alteraes histolgicas mais frequentes a
variante colapsante da glomerulosclerose focal e segmentar, a dilatao
tubular microqustica com material hialino intratubular e o infiltrado infla-
matrio intersticial, predominantemente constitudo por clulas mononucle-
adas, acompanhado de grau varivel de fibrose intersticial. As incluses
tubuloreticulares endoteliais (viral footprints) so alteraes ultraestruturais
que tm elevada especificidade para o diagnstico de HIVAN1214. Do pon-
to de vista teraputico, os inibidores da enzima de converso da angioten-
sina (IECA) e, principalmente, a teraputica antiretrovrica combinada
(TARVc) tm demonstrado particular eficcia na preveno da progresso
da DRC e, em alguns casos, a TARVc tem proporcionado a melhoria das
alteraes histolgicas e da funo renal12.

Avaliao da funo renal no doente com infeco por VIH


O doente com infeco por VIH, aquando do diagnstico inicial da infeco,
deve ser submetido avaliao da funo renal e realizao de exame
254 Jos Antnio Lopes, lvaro Ayres Pereira

Quadro 3. Sndromes nefrolgicas secundrias a frmacos antiretrovricos


Classe farmacolgica Frmaco Sndrome nefrolgica
NITR Abacavir Leso renal aguda
(nefrite intersticial alrgica)
Didanosina, Sndrome de Fanconi
lamivudina,
estavudina
Tenofovir Sndrome de Fanconi, diabetes inspida nefrognica,
leso renal aguda
(leso tubular proximal)
Inibidores Indinavir Urolitase, clica renal, obstruo urinria, leso
da protease (IP) renal aguda (nefrite intersticial,
cristais intratubulares) e crnica
Nelfinavir Clica renal
Ritonavir Leso renal aguda
Inibidor Enfuvirtida Glomerulonefrite membranoproliferativa
da fuso

sumrio de urina. Na ausncia de alteraes, o doente de risco para pro-


gresso da DRC (com diabetes mellitus, com hipertenso arterial, com
coinfeco por VHC, com carga vrica superior a 4.000 cpias/ml e/ou com
contagem de linfcitos TCD4+ inferior a 200 cls/mm3) dever ser reava-
liado com periodicidade anual. Sempre que exista proteinria e/ou uma taxa
de filtrao glomerular inferior a 60 ml/minuto, o doente dever ser refe-
renciado Consulta de Nefrologia15.

Nefrotoxicidade dos antiretrovricos


Muitos dos antiretrovricos so nefrotxicos e, portanto, necessria a
monitorizao regular da funo renal, aquando da sua administrao. As
sndromes nefrolgicas, associadas administrao de antiretrovricos so
mltiplas (Quadro 3).

Ajuste posolgico da teraputica antiretrovrica,


de acordo com a taxa de filtrao glomerular
O ajuste posolgico dos antiretrovricos deve ser realizado de forma indi-
vidualizada, de acordo com a funo renal e a classe farmacolgica. Apenas
os nuclesidos inibidores da transcriptase reversa (NITRs), com excepo
do abacavir (sobre o qual ainda no existem dados disponveis), necessitam
de ajuste de dose e/ou de intervalo de administrao nos doentes com in-
suficincia renal.
Complicaes renais 255

Bibliografia
1. Selik RM, Byers RH Jr, Dworkin MS. Trends in diseases reported on U.S. death certificates that mentioned HIV
infection, 19871999. J Acquir Immune Defic Syndr. 2002;29:37887.
2. Franceschini N, Napravnik S, Eron JJ Jr, Szczech LA, Finn WF. Incidence and etiology of acute renal failure
among ambulatory HIVinfected patients. Kidney Int. 2005;67:152631.
3. Wyatt CM, Arons RR, Klotman PE, Klotman ME. Acute renal failure in hospitalized patients with HIV: risk
factors and impact on inhospital mortality. AIDS. 2006;20:5615.
4. Lopes JA, Fernandes J, Jorge S, Neves J, Antunes F, Martins Prata M. Acute renal failure in critically ill
HIVinfected patients. Crit Care. 2007;11:411.
5. Choi AI, Li Y, Parikh C, Volberding PA, Shlipak MG. Longterm clinical consequences of acute kidney injury
in the HIVinfected. Kidney Int. 2010;78:47885.
6. Szczech LA, Gange SJ, van der Horst C, et al. Predictors of proteinuria and renal failure among women with
HIV infection. Kidney Int. 2002;61:195202.
7. Wyatt CM, Winston JA, Malvestutto CD, et al. Chronic kidney disease in HIV infection: an urban epidemic.
AIDS. 2007;21:21013.
8. Lopes JA, Abreu F, de Almeida E, et al. Demographic and clinical characteristics of human immunodeficiency
vrusinfected patients receiving dialysis in Portugal: a Nationwide Multicentre Survey. Rev Port Nefrol Hipert.
2006;20:2018.
9. Klotman PE. HIVassociated nephropathy. Kidney Int. 1999;56:116176.
10. DAgati V, Appel GB. HIV infection and the kidney. J Am Soc Nephrol. 1997;8:13852.
11. Monahan M, Tanji N, Klotman PE. HIVassociated nephropathy: an urban epidemic. Semin Nephrol.
2001;21:394402.
12. Herman ES, Klotman PE. HIVassociated nephropathy: Epidemiology, pathogenesis, and treatment. Semin Neph-
rol. 2003;23:2008.
13. Khan S, Haragsim L, Laszik ZG. HIVassociated nephropathy. Adv Chronic Kidney Dis. 2006;13:30713.
14. Feehally J, Floege J, Johnson RJ. Comprehensive Clinical Nephrology. 3. a ed. Mosby; 2007.
15. Gupta SK, Eustace JA, Winston JA, et al. Guidelines for the management of chronic kidney disease in HIVin-
fected patients: recommendations of the HIV Medicine Association of the Infectious Diseases Society of
America. Clin Infect Dis. 2005;40:155985.
VI Seco
Captulo 6

Complicaes hematolgicas*
lvaro Ayres Pereira

Introduo

A infeco por vrus da imunodeficincia humana (VIH) est associada,


com frequncia e em qualquer momento da sua evoluo, a alteraes he-
matolgicas, que podem abranger as trs linhagens hematopoiticas. Estas
alteraes podem ser devidas aco directa de VIH, secreo de citoci-
nas, a infeces ou doenas infiltrativas da medula ssea ou resultar das
teraputicas utilizadas para combater as doenas associadas ou, ainda,
prpria infeco por VIH (Quadro 1). Embora os doentes apresentem, ha-
bitualmente, alteraes hematolgicas desde a primoinfeco VIH ou sn-
drome da seroconverso de VIH, nos estdios mais avanados da infeco,
que aparecem as alteraes mais relevantes.
Neste captulo revemse as citopenias e as alteraes da coagulao,
enquanto que as doenas hemoproliferativas, associadas infeco por VIH
so tratadas noutro captulo deste manual.
A presena de anemia, neutropenia ou trombocitopenia podem ser en-
contradas, isoladas ou associadas, com incidncia crescente, durante a pro
gresso da infeco por VIH1. Setenta a oitenta por cento dos infectados
por VIH desenvolvem anemia, durante a evoluo da infeco. Por outro
lado, 50% dos que tm infeco avanada podem apresentar neutropenia e,
aproximadamente, 40% tm trombocitopenia, que pode ser o primeiro sinal
de infeco por VIH, em 10% dos casos1,2. O tratamento destas alteraes
compreende a identificao e eliminao das suas causas, a utilizao de
factores estimulantes de colnias mielides e da teraputica antiretrovrica
combinada (TARVc). A TARVc, alm de elevar o nmero de linfcitos
TCD4+ circulantes, melhora as citopenias devidas a VIH, pelo que o seu

*Nota do editor: Este captulo no foi actualizado em relao 3.a edio do Manual sobre sida (2008)
258 lvaro Ayres Pereira

Quadro 1. Causas de complicaes hematolgicas nos doentes infectados por VIH


Causas de anemia Causas de leucopenia
Depresso da eritropoiese Linfopenia
Efeito directo de VIH Efeito directo de VIH
Anemia da doena crnica Neutropenia
Infeces (VCM, parvovrus B19, Relacionada com a infeco por VIH
MAC, tuberculose, fungos) Medicamentosa
Infiltrao medular neoplsica (LNH, Anemia megaloblstica
doena de Hodgkin e outras neoplasias) Anticorpos antineutrfilos
Medicao mielossupressiva Hiperesplenismo
Deficincia em ferro Infiltrao medular por neoplasia ou
Anemia da hemorragia infeco oportunista
Anemia megaloblstica (vitamina B12,
acido flico e medicamentosa)
Anemia hemoltica Causas de trombocitopenia
Anemia hemoltica autoimune PTI
Medicamentosa (sulfonamidas, Supresso medular associada a VIH
antimalricos e nitrofurantona) Medicamentosa
PTT/SHU PTT/SHU
Sndrome hemafagoctica Infiltrao medular (infeco ou neoplasia)
Coagulao intravascular disseminada
Spsis grave
Hiperesplenismo
Frmacos com toxicidade hematolgica, usados na infeco por VIH/sida

Anfotericina B, flucitosina, fluconazol, dapsona, pirimetamina, primaquina, pentamidina,


rifabutina, isoniazida, claritromicina, zidovudina, lamivudina, estavudina, didanosina,
ganciclovir, foscarnet, cidofovir, ribavirina, interfero , agentes antineoplsicos.
VIH: Vrus da imunodeficincia humana; VCM: Vrus citomeglico; MAC: Mycobacterium avium
complex; LNH: Linfoma noHodgkin; PTT: Prpura trombocitopnica trombtica; SHU: Sndrome
hemoltica urmica; PTI: Prpura trombocitopnica idioptica.

emprego fundamental na preveno e na reverso das alteraes hemato-


lgicas associadas a VIH37.

Anemia
A anemia uma complicao, vulgarmente, encontrada nos doentes com
infeco por VIH, particularmente se esto num estdio avanado da doen-
a. A anemia pode aparecer isoladamente ou em associao a outras citope
nias e est ligada a aumento do risco de morte2. A causa da anemia pode
ser devida quer diminuio eritropoiese, quer ao aumento da destruio
dos eritrcitos ou a perdas sanguneas, causada por aco directa do vrus
Complicaes hematolgicas 259

sobre os precursores eritrides, pela libertao de factores de necrose tu-


moral, por um efeito supressor da medicao em curso ou pela aco de
outras doenas concomitantes8. Na maior parte dos casos, a anemia apre-
senta as caractersticas da anemia da doena crnica, normocrmica normo-
ctica (em casos graves hipocrmica e microctica), com algum grau de
anisocitose, valores de hemoglobina entre os nove e 10 g/dl e alteraes da
cintica do ferro (diminuio do ferro srico, da transferrina e da capacida
de total de fixao pelo ferro e, ainda, elevao da ferritina) 9,10.

Anemia devida a diminuio da produo de eritrcitos


(hipoproliferativas)
As doenas infecciosas, com invaso da medula ssea (MO), so causa fre
quente de anemia, na infeco por VIH avanada. As infeces por mico-
bactrias so responsveis pelas anemias mais acentuadas. A infeco por
Mycobacterium avium complex (MAC), com bacteriemia e disseminao,
geralmente envolve a MO e causa frequente de anemia, sem outra cito-
penia, nos doentes com linfcitos TCD4+ inferiores a 100 106 cls/l11. A
tuberculose, como outras doenas infiltrativas da MO (histoplasmose, leish-
maniose, criptococose, pneumocistose e os linfomas) podem, tambm, cau
sar anemia grave, mas, em geral, com pancitopenia 12.
A anemia pode ser agravada por deficincias de ferro, resultantes de per
das sanguneas crnicas pelo tracto gastrintestinal, relacionadas com trom
bocitopenia concomitante ou com doenas associadas a VIH, como a colite
por vrus citomeglico (VCM), o sarcoma de Kaposi e o linfoma noHodgkin.
Um doente com anemia associada a febre, suores nocturnos ou emagreci-
mento deve ser submetido a biopsia ssea ou, pelo menos, a mielograma,
para excluso de uma doena infiltrativa da MO. O parvovrus B19, classi-
camente associado a crises aplsticas transitrias, foi, tambm, associado a
anemia crnica grave nos doentes imunodeprimidos, infectados por VIH 13.
O efeito mielossupressor de frmacos, utilizados na infeco por VIH,
pode ser responsvel por cerca de 20% dos casos de anemia na sida 2. A
zidovudina (AZT), uma das causas mais comum de anemia nestes doentes,
pode provocar hipoplasia ou aplasia medular eritride e anemia megalobls-
tica, embora as doses de AZT, habitualmente utilizadas na TARVc, estejam
associadas a baixa incidncia desta toxicidade14. Embora seja prtica rela-
tivamente comum, no foi provado o benefcio da administrao suplementar
de cido folnico ou vitamina B12 nessas situaes15. A didanosina, a lami-
vudina e a estavudina so muito menos mielossupresoras, mas tambm
podem estar associadas a anemia16. O trimetoprimsulfametoxazol e a piri-
metamina, utilizados na profilaxia e no tratamento de algumas infeces
oportunistas, causam, tambm, anemia megaloblstica 17,18.
O hipogonadismo, relativamente frequente nos homens infectados por
VIH, associado a fadiga, emagrecimento e disfuno sexual, pode causar
anemia, pelo que a determinao srica dos nveis de testosterona deve ser
includa nos casos com anemia e sintomas de hipogonadismo 19.
260 lvaro Ayres Pereira

Anemia devida a produo ineficaz de eritrcitos


(deficincias na maturao)
Os infectados por VIH podem, tambm, apresentar deficincias nutritivas,
com alteraes dos nveis sricos de ferro, acido flico e vitamina B 12.
Os indivduos com infeco por VIH, com dificuldade em se alimentarem
adequadamente ou com doena do jejuno, que perturbe a absoro de cido
flico, podem apresentar, ao fim de cerca de seis meses, anemia megalo-
blstica, neutropenia e trombocitopenia.
Os nveis sricos de vitamina B12 podem estar diminudos por m ab-
soro, devido a diarreia crnica ou por alteraes das protenas de trans-
porte da cianocobalamina20. Um balano negativo de vitamina B12 foi do-
cumentado em, aproximadamente, um tero dos doentes com sida, devido,
na grande maioria dos casos, a alterao da absoro desta vitamina 21. A
deficincia oculta de vitamina B12 pode agravar, ainda mais, a anemia asso
ciada ao AZT, pelo que conveniente a sua monitorizao srica nos casos
com alteraes gastrintestinais crnicas22. A deficincia de vitamina B12
pode causar alteraes neurolgicas, mesmo sem a presena de anemia, com
manifestaes motoras, sensoriais e psquicas, pelo que necessria a sua
excluso nos infectados por VIH, com alteraes neurolgicas.

Anemia hemoltica ou por perda sangunea


O aumento da destruio dos eritrcitos pode ser identificado nos infectados
por VIH, que apresentem deficincia de glicose6fosfato desidrogenase,
quando so expostos a substncias oxidantes (sulfonamidas, nitrofurantona
e antimalricos) ou na presena de infeces, coagulao intravascular dis-
seminada ou prpura trombocitopnica trombtica (PTT).
A presena de autoanticorpos antieritrocitrios, com teste de Coombs
directo positivo, pode estar presente em, aproximadamente, 20% dos infec-
tados por VIH, com hipergamaglobulinemia, embora, raramente, sejam cau
sa de anemia hemoltica23.
Anemia hemoltica e trombocitopenia fazem parte da constelao das
manifestaes clnicas da PTT e da sndrome hemoltica urmica (SHU). A
PTT caracterizada pela presena de alteraes neurolgicas, febre, insu-
ficincia renal, anemia hemoltica, trombocitopenia, elevaes marcadas da
DHL e hiperbilirrubinemia. O seu diagnstico precoce e tratamento so es
senciais, pois , geralmente, fatal sem teraputica. Um estudo relacionoua
com 3% da mortalidade associada a VIH24. A SHU uma anemia hemol-
tica microangioptica, que partilha algumas semelhanas com a PTT, sem
apresentar sintomas neurolgicos ou febre, com uma elevada taxa de neces-
sidade de dilise e alta mortalidade25.
A ribavirina, utilizada no tratamento da coinfeco por vrus da hepa-
tite C, est associada a anemia hemoltica.
As perdas sanguneas gastrintestinais causam anemia aguda ou crnica,
esta ltima caracterizada pela deficincia em ferro. Estas hemorragias podem
Complicaes hematolgicas 261

resultar da aco de antiinflamatrios noesterides, de linfoma intestinal,


sarcoma de Kaposi gastrintestinal ou de infeces oportunistas, especialmen
te por VCM ou candidose.

Diagnstico e tratamento da anemia


Os sintomas da anemia incluem fadiga, perturbao do estado de conscin-
cia, polipneia e, nos casos mais graves, insuficincia cardaca, dor torcica,
coma e morte. Nos doentes pode observarse palidez cutnea e conjuntival,
taquicardia e sinais de insuficincia cardaca congestiva, nos casos mais
avanados. A anemia afecta, significantemente, a qualidade de vida.
Perante a anemia, num infectado por VIH, deve procederse investiga-
o, semelhante dos doentes noVIH, mas tendo em conta que, naqueles
doentes, a sua etiologia pode ser multifactorial. A histria clnica do doen-
te deve ser revista, com particular ateno s manifestaes de hemorragia
gastrintestinal, anemia prvia ou de doena heptica, histria familiar de
anemia, sintomas neurolgicos e de doena oportunista, incluindo linfade-
nopatia, hipersudorese e perda de peso. Dado que estes doentes, esto,
habitualmente, submetidos a mltiplas teraputicas, que podem levar di-
minuio da produo ou ao aumento da destruio dos eritrcitos (AZT,
anfotericina B, ganciclovir, interfero, hidroxiureia, pirimetamina, primaqui-
na, sulfonamidas ou dapsona) deve ser examinada a histria medicamento-
sa, incluindo a relao temporal com o incio do desenvolvimento da anemia.
O hemograma com plaquetas, a contagem de reticulcitos, o volume glo-
bular mdio, a DHL srica, a bilirrubina total e directa, a capacidade total
de fixao pelo ferro e a creatinina devem ser revistos.
Quando a anemia est presente, num doente com febre, astenia, emagre-
cimento ou diarreia deve excluirse outra infeco ou doena neoplsica
associadas, com o recurso a exames auxiliares de diagnstico apropriados,
que podem incluir hemoculturas para micobactrias e fungos e, ainda, mielo
grama. Nos com infeco por VIH, o exame de medula ssea mostra, habi
tualmente, alteraes no especficas, pelo que a sua realizao na presen-
a de anemia, leucopenia ou trombocitopenias isoladas revelar, muito
provavelmente e apenas, essas alteraes12. A sua importncia maior na
presena de pancitopenia, febre de origem desconhecida e para o estadia-
mento de linfoma. O mielograma tem grande valor no diagnstico de in-
feces por micobactrias (quando as hemoculturas so negativas) ou outras
infeces oportunistas disseminadas, como leishmaniose e histoplasmose.
Na rara sndrome hemofagoctica, caracterizada por febre, esplenomegalia,
ictercia e evidncia de hemofagocitose, na medula ssea e noutros tecidos
(fagocitose macrofgica de eritrcitos, leuccitos, plaquetas e seus precur-
sores) e na aplasia eritride por parvovrus o mielograma fundamental 26.
O tratamento da anemia deve ser dirigido, sempre que possvel, sua
causa. Qualquer infeco oportunista ou doena maligna deve ser tratada
adequadamente. Nos doentes com anemia da doena crnica, devido a in-
feco avanada por VIH, a TARVc pode corrigir a anemia e melhorar a
262 lvaro Ayres Pereira

qualidade de vida27. Quando a anemia devida a um efeito adverso da


medicao, deve ponderarse se esta mesmo imprescindvel e se necessrio
substituila por uma alternativa aceitvel. Caso contrrio, pode utilizarse
teraputica de suporte com eritropoietina ou transfuses de concentrados de
eritrcitos. As anemias ferropnica ou por perdas hemticas so tratadas
pela identificao e correco da origem da hemorragia e por suplementos
de ferro. O ferro prescrito por via oral, sob a forma de sulfato ferroso, e
nos casos de intolerncia, por via endovenosa, como complexo de hidrxi-
do frricosacarose. Os doentes com deficincia em vitamina B12 ou cido
flico devem receber os respectivos suplementos. A PTT ou SHU, nos doen
tes com infeco por VIH, so tratadas da mesma maneira que nos noVIH,
recorrendo plasmaferese, transfuses de plasma fresco congelado e ao
suporte dialtico. A aplasia eritride pura, devida infeco por parvovrus
responde ao tratamento com imunoglobulina endovenosa (IGEV). O trata-
mento da anemia hemoltica autoimune inclui a utilizao de glucocorti-
cides (prednisolona 12 mg/kg/d), IGEV, esplenectomia e TARVc. A res-
posta corticoterapia pode no ser observada antes das trs semanas e aps
se ter obtido o resultado pretendido procedese a uma descalao, para a
mnima dose necessria ao controlo da hemlise. A esplenectomia est re-
servada para aqueles doentes que no respondem aos corticides. Outra al-
ternativa, em doentes seleccionados, a utilizao de IGEV (400 mg/kg/dia,
durante cinco dias)28. A TARVc, sobretudo se incluiu AZT, est associada
melhoria da anemia hemoltica autoimune29.
A utilizao de eritropoietina recombinante, no tratamento da anemia
por diminuio da eritroipoiese, causada por infeco VIH avanada, AZT,
quimioterapia ou outros frmacos, mostrou aumentar os nveis de hemo-
globina, diminuir as necessidades de transfuses e melhorar a qualidade
de vida nos doentes com infeco por VIH/sida 30. A dose inicial reco-
mendada foi, inicialmente, de 100200 UI/kg subcutnea, trs vezes por
semana. Contudo, estudos posteriores revelaram que doses nicas, sema-
nais, de 40.000 a 60.000 de eritroipoietina eram, igualmente, eficazes
e mais cmodas 31. A darbepoietina outro factor de crescimento eri-
tropoitico recombinante, mais recente, com uma semivida prolongada,
que necessita de ser administrado, apenas, com intervalos de duas a trs
semanas (200300 mcg por via subcutnea, cada duas a trs semanas), com
resultados semelhantes32.

Leucopenia
A leucopenia caracterstica da infeco por VIH/sida e as suas principais
causas encontramse sumariadas no quadro 1. A linfopenia a alterao
mais comum, particularmente a diminuio dos linfcitos TCD4 +. Tambm
pode ser observada diminuio e alterao dos moncitos. A neutropenia
um problema encontrado, com frequncia, nos doentes com infeco por
VIH. VIH afecta as linhagens celulares precursoras dos linfcitos, neutr-
filos e macrfagos e, embora, as leucopenias reflictam, em regra, a toxicidade
Complicaes hematolgicas 263

da TARVc ou da medicao utilizada nas doenas associadas infeco


por VIH/sida, estudos efectuados em doentes no tratados revelaram alta
incidncia de neutropenia, particularmente se existe imunodeficincia gra-
ve33. A neutropenia foi encontrada em cerca de 10% dos doentes, assin-
tomticos, infectados por VIH, e aumenta de frequncia, podendo ser
superior a 50%, com a evoluo da doena e com as intervenes tera-
puticas efectuadas1,34. A patognese da neutropenia, nestes doentes,
multifactorial e, embora qualquer doena infiltrativa (infecciosa ou neo-
plsica) da MO a possa provocar, na prtica clnica a toxicidade medi-
camentosa (sobretudo AZT, cotrimoxazol e, mais raramente, lamivudina,
didanosina, estavudina, ribavirina, ganciclovir, foscarnet, anfotericina B,
flucitosina, sulfonamidas, pirimetamina, pentamidina, interfero e citost-
ticos) a principal responsvel por esta condio. Tambm, foram observa-
das alteraes qualitativas dos granulcitos (deficincias de quimiotaxia,
desgranulao e fagocitose), mas desconhecese a implicao clnica des-
tes factos35.
Dentro da populao seropositiva para VIH, a incidncia de infeces
bacterianas e fngicas , significantemente, maior nos doentes com neutro-
penia36. O risco de infeco quase que duplica, quando a contagem de
neutrfilos inferior a 1.000 106 cls/l e , aproximadamente, oito vezes
maior quando estes so inferiores a 500 106 cls/l37. O risco de infeco
bacteriana , ainda, superior na presena de cateter venoso central, quimio-
terapia antineoplsica e baixa contagem de linfcitos TCD4 +.
As infeces estafiloccicas so as causadas por bactrias, mais comuns.
Outros agentes implicados so o pneumococo, Pseudomonas aeruginosa e
as salmonelas. As infeces fngicas, mais comuns, so as causadas por
criptococos e diversas espcies de Candida.
A neutropenia podese manifestar com febre, ulceraes orais, malestar,
linfadenopatia e infeces. Perante um quadro de neutropenia, deve avaliarse,
com cuidado, a medicao a que o doente est sujeito e suspender o po
tencial agente incriminado, sobretudo se a contagem de neutrfilos inferior
a 500 106 cls/L. Na maior parte dos casos possvel substituilo por ou-
tro equivalente, sem esse efeito adverso. Se a neutropenia acentuada ou
se no h alternativa medicao mielossupressora deve recorrerse aos
factores estimulantes de colnias mielides (GCSF ou GMCSF). Se a
etiologia desconhecida, deve excluirse a presena de doena oportunis-
ta ou linfoproliferativa, com a respectiva investigao, que deve incluir o
exame da MO.

Trombocitopenia
A trombocitopenia muito frequente durante a evoluo da infeco por
VIH. Esta pode ser o primeiro sinal de infeco por VIH, ocorrendo como
componente da sndrome da infeco vrica aguda ou ser uma manifestao
de imunodeficincia avanada33. Trombocitopenia definida como uma
contagem plaquetria inferior a 100.000 106 cls/l e encontrase em 38%
264 lvaro Ayres Pereira

dos seropositivos para VIH assintomticos e em 3045% dos que apresentam


estdios avanados de imunodeficincia1,38,39. As possveis etiologias da
trombocitopenia (Quadro 1) compreendem a destruio mediada imunitaria-
mente, a PTT, as alteraes da hematopoiese e a toxicidade medicamentosa.
Na maior parte das vezes, a trombocitopenia aparece isoladamente, associa-
da a aumento dos megacaricitos, na MO, e presena de nveis plasm-
ticos elevados de anticorpos antiplaquetrios, constituindo a entidade clni-
ca denominada de prpura trombocitopnica idioptica (PTI).
A PTI pode ser a manifestao mais precoce da infeco por VIH,
ocorrendo antes de qualquer doena definidora da condio de sida 40. A
PTI, associada infeco por VIH (PTIVIH), parece ser causada pela de-
posio de complexos imunes, contendo antiVIH gp 120 e anticorpos
complementares idiopticos, na parede das plaquetas, e, consequentemente
destruio pelo sistema reticulo-endotelial41. VIH parece, tambm, poder
infectar os megacaricitos e alterar a produo de plaquetas, conduzindo a
trombocitopenia42. O diagnstico de PTIVIH , sobretudo, de excluso, o
que quer dizer que se tem, previamente, de excluir outras causas, que sejam
responsveis por diminuio da produo de plaquetas ou por aumento da
sua destruio perifrica. A PTP uma sndrome clnica caracterizada por
febre, alteraes neurolgicas e renais, anemia hemoltica micro-angiopti-
ca e trombocitopenia e, anatomopatologicamente, por trombos microvascu-
lares hialinos, nas biopsias tecidulares. Qualquer outra doena infecciosa ou
neoplsica, que envolva a MO e a medicao, que cause mielossupresso,
podem dar origem a trombocitopenia. Os infectados por VIH podem, tam-
bm, apresentar trombocitopenia, por outras causas no relacionadas com a
infeco por VIH, como o alcoolismo, doena heptica crnica e espleno-
megalia e, ainda, a medicao com heparina e quinidina.
A hemorragia mucocutnea a manifestao mais comum de trombo-
citopenia. No frequente a hemorragia espontnea, quando as plaquetas
so superiores a 30.000 106 cls/l, sendo o risco maior, sobretudo, quan-
do este valor inferior a 10.000 106 cls/l. Doentes com hemofilia ou
outras coagulopatias tm um risco superior, para manifestaes hemorr-
gicas, quando as plaquetas so inferiores a 50.000 106 cls/l43. O doen-
te com manifestaes hemorrgicas deve ser questionado sobre uma hist-
ria anterior de doena heptica e hbitos alcolicos. A medicao em
curso deve ser revista, relacionado o incio da trombocitopenia com a in-
troduo de nova medicao e pesquisada a presena de sintomas e sinais
de doena oportunista e linfoma, como febre, arrepios de frio, sudorese,
adenopatias e perda de peso. Os exames laboratoriais devem incluir uma
observao de esfregao de sangue perifrico, avaliao da funo hepti-
ca, DHL, coagulao e creatinina. Se est presente trombocitopenia isola-
da, muito provvel que se trate da PTI e no obrigatria a realizao
de mielograma. Pelo contrrio, se esto presentes sinais e sintomas de
infeco oportunista, linfoma ou mltiplas citopenias, o doente deve reali-
zar mielograma, que ajudar a distinguir trombocitopenia destrutiva de
hipoproliferativa12.
Complicaes hematolgicas 265

Os doentes com trombocitopenias discretas ou moderadas no necessitam


de tratamento especfico. Este deve ser ponderado, quando aquela acen-
tuada ou apresenta manifestaes clnicas ou, ainda, o doente vai ser sub-
metido a procedimento invasivo. Pode haver necessidade de recorrer
corticoterapia, a altas doses de IGEV ou imunoglobulina antiRh endove-
nosa, plasmaferese, ao interfero , ao danasol ou esplenectomia, em-
bora com graus de eficcia variveis e, relativamente, insatisfatrios 44,45.
A TARVc, sobretudo se inclui AZT, melhora a PTIVIH, ao fim de
poucas semanas6,7.
Os corticides melhoram a contagem de plaquetas, em mais de 80% dos
casos. A resposta , habitualmente, rpida e o seu efeito mximo observase
ao fim de trs a quatro semanas. A dose habitual inicial de prednisolona
um mg/kg/dia, com posterior diminuio, para a mnima dose necessria.
A IGEV provoca rpida, mas transitria, subida na contagem plaquetria,
devido a bloqueio reticulo-endotelial, podendo ser utilizada em indivduos
esplenectomizados ou no. A dose recomendada 1.000 mg/kg/dia, duran-
te dois dias. O nmero de plaquetas sobe ao fim de 2472 horas, aps o
tratamento, e a resposta, habitualmente, permanece durante semanas. O tra
tamento pode ser repetido, cada duas a quatro semanas. O preo o prin-
cipal factor negativo, contudo , particularmente, til nos doentes com
hemorragia activa ou que vo ser submetidos a procedimentos invasivos 46.
O bloqueio reticulo-endotelial pode, tambm, ser obtido pela utilizao de
imunoglobulina antiRh (D) endovenosa em doentes noesplenectomizados,
que mais barata e melhor tolerada. A imunoglobulina reveste os eritrci-
tos, causando hemlise discreta e esta destruio dos eritrcitos bloqueia a
destruio esplnica das plaquetas. Sessenta a 70% dos doentes responderam
a este tratamento, embora possa estar associado a quebras de dois g/dl
na hemoglobina. A imunoglobulina antiRh (D) administrada na dose
de 25 mcg/kg por via endovenosa, durante 30 minutos, em dois dias. As
resposta so transitrias e permanecem durante trs semanas, em cerca de
50% dos doentes, pelo que pode ser repetida, na dose de 1325 mcg/kg
endovenosa, cada duas a quatro semanas. A esplenectomia foi utilizada,
tambm, com sucesso, resultando numa remisso sustentada da trombocito-
penia relacionada a VIH, e no foi associada a mais rpida progresso da
infeco47. Como aumenta o risco de spsis por organismos capsulados, os
doentes devem realizar, previamente, vacinao para pneumococo, menin-
gococo e Haemophilus influenzae tipo b.

Alteraes da coagulao
Ocasionalmente, os doentes com infeco por VIH apresentam prolonga-
mento do tempo parcial de tromboplastina activada, devido presena de
anticorpos antifosfolipdicos, incluindo o anticorpo lpico e os anticorpos
anticardiolipina. Esta alterao da coagulao encontrada numa srie de
outras doenas, raramente associada a hemorragia e, paradoxalmente, foi
implicada na doena trombtica48.
266 lvaro Ayres Pereira

Bibliografia
1. Zon L, Groopman J. Hematologic manifestations of the human immune deficiency virus. Semin Hematol.
1988;25:20818.
2. Sullivan PS, Hanson DL, Chu SY, et al. Epidemiology of anemia in human immunodeficiency virus infected
persons: results from the Multistate Adult and Adolescent Spectrum of HIV Disease Surveillance Project. Blood.
1998;91:3018.
3. Huang SS, Barbour JD, Deeks SG, et al. Reversal of human immunodeficiency virus type 1associated hemato-
suppression by effective antiretroviral therapy. Clin Infect Dis. 2000;30(3):50410.
4. Semba RD, Shah N, Vlahov D. Improvement of anemia among HIVinfected injection drug users receiving
highly active antiretroviral therapy. J Acquir Immune Defic Syndr. 2001;26(4):3159.
5. Sloand EM, Maciejewski J, Kumar P, et al. Protease inhibitors stimulate hematopoiesis and decrease apoptosis
and ICE expression in CD34+ cells. Blood. 2000;96:27359.
6. Landonio G, Cinque P, Nosari A, et al. Comparison of two dose regimens of zidovudine in an open, randomized,
multicenter study for severe HIV related thrombocytopenia. AIDS. 1993;7:20912.
7. Caso JAA, Mingo CS, Tena JG. Effect of highly active antiretroviral therapy on thrombocytopenia in patients
with HIV infection. N Engl J Med. 1999;16:123940.
8. Scadden D, Zon L, Groopman J. Pathophysiology and management of HIVassociated hematologic disorders.
Blood. 1989;74:145563.
9. Frontiera M, Myers AM. Peripheral blood and bone marrow abnormalities in the acquired immunodeficiency
syndrome. West J Med. 1987;147:15760.
10. Gupta S, Imam A, Licorish K. Serum ferritin in acquired immune deficiency syndrome. J Clin Lab Immunol.
1986;20:113.
11. Gascom P, Sathe S, Rameshwar P. Impaired erythropoiesis in the acquired immunodeficiency syndrome with
disseminated Mycobacterium avium complex. Am J Med. 1993;94:418.
12. Northfelt DW, Mayer A, Kaplan LD, et al. The usefulness of diagnostic bone marrow examination in patients
with human immunodeficiency virus (HIV) infection. J Acquir Immune Defic Syndr Hum Retrovirol.
1991;4:65966.
13. Chernak E, Dubin G, Henry D, et al. Infection due to parvovirus B19 in patients infected with human immu-
nodeficiency virus. Clin Infect Dis. 1995;20(1):1703.
14. Walker RE, Parker RI, Kovacs JA, et al. Anemia and erythropoiesis in patients with the acquired immunodefi-
ciency syndrome and Kaposi sarcoma treated zidovudine. Ann Intern Med. 1988;108:3726.
15. Falguera M, PerezMur J, Puig T, Cao G. Study of the role of vitamin B12 and folinic acid supplementation in
preventing hematologic toxicity of zidovudine. Eur J Haematol. 1995;55:97102.
16. Bain BJ. Pathogenesis and pathophysiology of anemia in HIV infection. Curr Opin Hematol. 1999;6:8993.
17. Shami PJ, Crews J. Megaloblastic cytopenia in an AIDS patient treated with trimethoprimsulfamethoxazole. N
C Med J. 1995;56:6024.
18. Chute JP, Decker CF, Cotelingam J. Severe megaloblastic anemia complicating pyrimethamine therapy. Ann
Intern Med. 1995;122:8845.
19. Laudat A, Blum L, Guechot J, et al. Changes in systemic gonadal and adrenal steroids in asymptomatic
human immunodeficiency virusinfected man: Relationship with the CD4 cell counts. Eur J Endocrinol.
1995;133:41824.
20. Paltiel O, Falutz J, Vailleux M, et al. Clinical correlates of subnormal vitamin B12 levels in patients infected
with the human immunodeficiency virus. Am J Hematol. 1995;49(4):31822.
21. Harriman GR, Smith PD, Horne MK, et al. Vitamin B12 malabsorption in patients with acquired immunodefi-
ciency syndrome. Arch Intern Med. 1989;149:203941.
22. Richman D. AZT collaborative working group: The toxicity of azidothymidine in the treatment of patients with
AIDS and AIDSrelated complex. N Engl J Med. 1987;317:1927.
23. Toy PT, Reid ME, Burns M. Positive direct antiglobulin test associated with hyperglobulinemia in acquired im-
munodeficiency syndrome (AIDS). Am J Hematol. 1985;19:14550.
24. Gadallah MF, elShahawy MA, Campese VM, Todd JR, King JW. Disparate prognosis of thrombotic microan-
giopathy in HIVinfected patients with and without AIDS. Am J Nephrol. 1996;16:44650.
25. Kelleher P, Severn A, Tomson C, et al. The haemolytic uraemic syndrome in patients with AIDS. Genitourin
Med. 1996;72:1725.
26. Fisman DN. Hemophagocytic syndromes and infection. Emerg Inf Dis. 2000;6(6):6018.
27. Volberding P. The impact of anemia on quality of life in human immunodeficiency virusinfected Patients. J
Infect Diseases. 2002;185(2):S1104.
28. Gonzalez CA. Successful treatment of autoimmune hemolytic anemia with intravenous immunoglobulin in a
patient with AIDS. Transplant Proc. 1998;30:41512.
29. Tongol JM, Gounder MP, Butala A, Rabinowitz M. HIVrelated autoimmune hemolytic anemia: good response
to zidovudine. J Acquir Immune Defic Syndr. 1991;4:11634.
30. Moore RD, Keruly JC, Chaisson RE. Anemia and survival in HIV infection. J Acquir Immune Defic Syndr Hum
Retrovirol. 1998;19:2933.
31. Saag MS, Bowers P, Leitz G, Levine AM for the Community HIV Anemia Management Protocol Sites (CHAMPS)
Study Group. Onceweekly epoetin alfa improves quality of life and increases hemoglobin in anemic HIV+
patients. AIDS Res Hum Retroviruses. 2004;20(10):103745.
32. Glaspy JA, Tchekmedyian NS. Darbepoetin alfa administered every 2 weeks alleviates anemia in cancer patients
receiving chemotherapy. Oncology. 2002;16(10 Suppl 11):239.
33. Kaslow RA, Phair JP, Friedman HB, et al. Infection with the human immunodeficiency virus: clinical manifes-
tations and their relationship to immune deficiency. A report from the Multicenter AIDS Cohort Study. Ann
Intern Med. 1987;107:47480.
34. Jaresko GS. Etiology of neutropenia in HIVinfected patients. Am J Health Syst Pharm. 1999;56:S58.
Complicaes hematolgicas 267

35. Ellis M, Gupta S, Galant S, et al. Impaired neutrophil function in patients with AIDS or AIDS related complex:
comprehensive evaluation J Infect Dis. 1988;158:126876.
36. Keiser P, Higgs E, Scanton J. Neutropenia is associated with bacteremia in patients with HIV. Am J Med Sci.
1996;312:11822.
37. Moore RD, Keruly J, Chaisson RE. Neutropenia and bacterial infection in acquired immunodeficiency syndrome.
Arch Intern Med. 1995;155:196570.
38. Mientjes GH, van Ameijden EJ, Mulder JW, van den Hoek JA, Coutinho RA, von dem Borne AE. Prevalence
of thrombocytopenia in HIVinfected and nonHIV infected drug users and homosexual men. Br J Haematol.
1992;82:6159.
39. Murphy MF, Metcalfe P, Waters AH, et al. Incidence and mechanism of neutropenia and thrombocytopenia in
patients with human immunodeficiency virus infection. Br J Haematol. 1987;66:33740.
40. Jost J, Tauber MG, Luthy R, et al. HIVassociated thrombocitopenia. Schweiz Med Woc henschr. 1988;
118:20612.
41. Karpatkin S, Nardi M, Lennette ET, et al. Antihuman immunodeficiency virus type 1 antibody complexes on
platelets of seropositive thrombocytopenic homosexual and narcotic addicts. Proc Natl Acad Sci USA. 1988;
85:97637.
42. Ballem PJ, Belzberg A, Devine DV, et al. Kinetic studies of the mechanism of thrombocytopenia in patients with
human immunodeficiency virus infection. N Engl J Med. 1992;327:177984.
43. Marroni M, Gresele P, Vezza R, et al. Thrombocytopenia in HIV infected patients. Prevalence and clinical
spectrum. Recenti Prog Med. 1995;86:1036.
44. Oksenhendler E, Bierling P, Farcet JP, et al. Response to therapy in 37 patients with HIVrelated thrombocy-
topenic purpura. Br J Haematol. 1987;66:4915.
45. Ravikumar TS, Allen JD, Bothe A Jr, et al. Splenectomy. The treatment of choice for human immunodeficiency
virusrelated immune thrombocytopenia? Arch Surg. 1989;124:6258.
46. MajlufCruz A, LunaCastanos G, Huitron S, NietoCisneros L. Usefulness of a lowdose intravenous immuno-
globulin regimen for the treatment of thrombocytopenia associated with AIDS. Am J Hematol. 1998;59:12732
47. Schneider PA, Abrams DI, Rayner AA, Hohn DC. Immunodeficiencyassociated thrombocytopenic purpura (IDTP).
Response to splenectomy. Arch Surg. 1987;122:11758.
48. Smith KJ, Skelton HG, James WD, et al. Cutaneous histopathologic findings in antiphospholipid syndrome.
Correlation with disease, including human immunodeficiency virus disease. Arch Dermatol. 1990;126:117683.
VI Seco
Captulo 7

Interaces clnicas entre VIH


e os vrus das hepatites
Francisco Antunes

Introduo
Vrus das hepatites B e C (VHB e VHC) so os principais agentes das
hepatites nos coinfectados por vrus da imunodeficincia humana (VIH),
dado que partilham vias de transmisso similares (sangue e fluidos orgni-
cos). Porm, outros vrus das hepatites, tais como o vrus da hepatite A
(VHA), da hepatite D (VHD), da hepatite E (VHE) e, ainda, o da hepatite
G (VHG) tm, tambm, sido avaliados relativamente ao seu potencial de
interaco com VIH. Outros vrus hepatotrpicos (vrus herpes simplex,
vrus citomeglico, vrus varicelazoster, vrus de EpsteinBarr, adenovrus,
vrus herpes humano tipo 6), Mycobacterium tuberculosis e aviumintra-
cellulare, Cryptococcus neoformans e, ainda, alguns medicamentos podem
ser responsveis por doena hepatocelular nos infectados por VIH.
Dado que VHB e VHC so transmitidos pelas mesmas vias que VIH,
no de estranhar que mais de 82% dos toxicodependentes que utilizam
drogas ilcitas por via endovenosa e de 77% dos homossexuais, do sexo
masculino, com infeco por VIH, tenham marcadores de infeco antiga
ou crnica por VHB e, por outro lado, que 72% dos primeiros e 7% dos
segundos tenham marcadores de infeco antiga ou crnica por VHC 1.

Coinfeco VHBVIH
Alguns estudos sugerem que a infeco por VHB possa causar progresso
mais rpida da infeco por VIH2,3. Em contraste com estas duas referncias,
outros autores no encontraram efeito significativo na histria natural da
infeco por VIH, isto , progresso para sida e taxa de diminuio dos
270 Francisco Antunes

linfcitos TCD4+, podendo afirmarse que os dados disponveis no permi-


tem reconhecer que a infeco por VHB seja um cofactor, que influencie
a evoluo para sida48.
A resposta imunitria celular parece ter um papel fundamental nas ma-
nifestaes da infeco por VHB, no sendo, assim, de estranhar que algu-
mas situaes clnicas (insuficincia renal crnica e teraputica com corti-
cides e/ou citostticos) possam estar associadas a tendncia para formas
moderadas da hepatite B aguda e a um maior risco de evoluo para a
cronicidade, tal como acontece, tambm, com a infeco por VIH.
Quanto incidncia da ictercia, na infeco aguda por VHB, num es-
tudo, aquela foi inferior (10%) nos infectados por VIH, quando comparada
com os noinfectados (24%)9. Noutro estudo, porm, no foram encontra-
das quaisquer diferenas nem quanto ictercia, nem quanto aos nveis das
enzimas hepticas10.
Relativamente ao estado de portador crnico de VHB, os resultados dos
estudos so unnimes. Assim, em dois deles, comparando a percentagem
de portadores crnicos de VHB em coinfectados por VIH e em infectados,
apenas, por VHB, aquela foi de 23 e 21%, e de 4% nos primeiros e 7%
nos ltimos9,10.
Em infectados crnicos por VHB, a presena no soro de ADNVHB e
de AgHBe, assim como incidncia menor de seroconverso de AgHBe em
antiHBe foram observadas mais vezes em infectados por VIH, quando
comparados com indivduos noinfectados5,11,12.
Apesar da carga vrica elevada de ADNVHB, nos coinfectados por
VIH, os nveis de aminotransferases eram baixos, o que se correlaciona com
a contagem baixa de linfcitos TCD4+. Por outro lado, foi observada uma
tendncia maior de presena de antignio do core de VHB, nos infectados
por VIH, quando em comparao com os noinfectados13. Todos estes
dados, que apontam para uma taxa maior de replicao de VHB nos coin-
fectados por VIH, no foram observados em todos os estudos 14.
Assim, pode-se afirmar que a infeco por VIH modifica a histria na-
tural da infeco por VHB, nos coinfectados (VHBVIH), com maiores
taxas de evoluo para a cronicidade, de doena replicativa e de progresso
para estdios avanados da doena heptica, especialmente, em doentes com
contagens baixas de linfcitos TCD4+ e com consumo elevado de lcool15.
No entanto, apesar da replicao aumentada de VHB, nestes doentes, as
leses histolgicas hepticas so menores, o que abona para a ausncia de
efeito citoptico sobre o fgado, por parte de VIH 16.
Tal como nas outras situaes de imunodepresso, a reactivao de VHB
pode ocorrer nos coinfectados por VIH, expressandose por hepatite clnica
franca. Apesar de ser pouco comum, os doentes que tiveram no passado
infeco por VHB (AgHBs, antiHBs+ e antiHBc+) e com aminotransfe-
rases normais, persistentemente, quando no contexto da infeco por VIH
e com linfcitos TCD4+ baixos, podem tornarse AgHBs+ e antiHBs, com
aumento das aminotransferases17. Apesar de ser possvel explicar este fen-
meno por reinfeco, com outra estirpe de VHB, no contexto de um doente
Interaces clnicas entre VIH e os vrus das hepatites 271

Quadro 1. Recomendaes teraputicas para a infeco por VHB em noinfectados por VIH
AgHBe ADNVHB Alamina Estratgia
(UI/ml)* aminotransferase
+ < 20.000 Normal Monitorizar 612 meses.
Considerar biopsia; tratar se fibrose e
inflamao presentes
+ 20.000 Normal Considerar biopsia; se fibrose presente tratar
+ 20.000 Elevada Tratar
< 2.000 Normal Monitorizar 612 meses
2.000 Normal Considerar biopsia; se fibrose presente tratar
2.000 Elevada Tratar
*1 UI 5,6 cpias.

imunocomprometido, admitese, como mais provvel, a reactivao, dado


que no se verifica, apenas, seroconverso, mas, tambm, elevao franca
das enzimas hepticas, para alm de se ter constatado, pelo menos num
caso, que o subtipo de VHB isolado era idntico ao que se tinha identifi-
cado anteriormente6,18,19.
A reactivao, em termos de actividade de VHB, pode ser, tambm,
observada com aparecimento no soro de ADNVHB e aumento das amino-
transferases, sendo estes casos de alguma gravidade, com ictercia, ascite e
encefalopatia heptica20.
Um dos aspectos controversos nos resultados encontrados nos marcado-
res serolgicos, nos infectados por VIH, o achado isolado de positividade
para o antiHBc. Assim, 10-45% dos indivduos com um teste isolado po-
sitivo antiHBc tm nveis detectveis de ADNVHB, ou seja infeco
oculta para VHB21,22. Estes achados atpicos levaram recomendao de
que todos os infectados por VIH devam ser testados para AgHBs, antiHBs
e antiHBc. Se o AgHBs ou o antiHBc (ou ambos) forem positivos, devese
proceder quantificao do ADNVHB, dado que pode ser necessrio o
incio da teraputica antiVIH e antiVHB. Por outro lado, aqueles sem
ADNVHB quantificvel (apenas com antiHBc+) devem ser vacinados con-
tra a infeco por VHB23.
Os objectivos da teraputica para a infeco por VHB, em coinfectados
por VIH, so a supresso da replicao vrica (ausncia de ADNVHB ou
de AgHBe) e a melhoria da doena heptica. A biopsia heptica no im-
prescindvel, dado que os antivricos disponveis para o tratamento da he-
patite B so bem tolerados e, praticamente, isentos de toxicidade, no entan-
to, aquela pode fornecer informao importante sobre o prognstico. O
controlo imunitrio (perda do AgHBe e do AgHBs ou a seroconverso para
antiHBe e antiHBs) raro na coinfeco por VIH. As recomendaes
teraputicas para a infeco por VHB, nos coinfectados por VIH, funda-
mentase nos mesmos critrios utilizados para os monoinfectados, desde que
no seja necessrio tratar a infeco retrovrica (Quadro 1).
272 Francisco Antunes

A utilizao de interfero , no tratamento da infeco crnica por


VHB, em indivduos imunocomprometidos, tem menor eficcia teraputi-
ca, no sendo de estranhar que o mesmo acontea nos coinfectados por
VIH7,8. Porm, algum sucesso teraputico foi verificado nalguns portado-
res de VIH, tratados com interfero , com ou sem o recurso aos corti-
cides24,25. VHB tem oito gentipos (A a H), sendo os gentipos B e C
mais frequentes na sia e o gentipo A mais comum na Europa, respon-
dendo este ltimo melhor teraputica com interfero 26. O papel dos
gentipos de VHB na histria natural da infeco e na resposta terapu-
tica, nos doentes com coinfeco por VIH, no est, ainda, claramente
definido.
A zidovudina (AZT), apesar de ter efeito inibitrio sobre vrus de aves,
similares a VHB, no parece ter sobre este alguma eficcia, quer utilizan-
do a monoterapia ou a associao com interfero 27,28. Porm, a lamivu-
dina (3TC) tem sido utilizada no tratamento da infeco por VHB (em
infectados e noinfectados por VIH), com sucesso, revelandose este pela
melhoria da histopatologia heptica e desaparecimento do AgHBe 29,30. O
uso de 3TC, isoladamente, no tratamento da infeco por VHB est asso-
ciado a taxas muito elevadas de resistncia, de, aproximadamente, 2025%
ao ano e de 90% aos quatro anos31. A dose de 3TC recomendada, no tra-
tamento da infeco por VHB, de 100 mg por dia, no entanto, nos
coinfectados por VIH aquela s deve ser utilizada em teraputica antire-
trovrica de combinao (TARVc).
O adefovir, um anlogo nucletido, utilizado na dose de 10 mg por
dia, no tendo esta efeito antiretrovrico (em doses mais elevadas sim),
podendo, no entanto, ser administrado aos coinfectados por VIH, mas no
no contexto da teraputica antiretrovrica (TARV)32. O adefovir pode ser
utilizado em coinfectados por VIH sob TARV, desde que nesta no esteja
includo o tenofovir (TDF), dado que no existe qualquer critrio para as-
sociao destes dois nucletidos. O adefovir eficaz contra estirpes de VHB
resistentes ao 3TC, sendo recomendado, nestes casos, a substituio deste
por aquele nucletido33. O TDF um nucletido semelhante ao adefovir,
que foi, recentemente, aprovado para tratamento da hepatite B crnica34,35.
O TDF foi comparado ao adefovir, tendose revelado superior em relao
supresso de ADNVHB, normalizao da alanina aminotransferase e
seroconverso do AgHBe. Num dos estudos, s 96 semanas no foram de-
tectadas substituies na polimerase de VHB, conferindo resistncia ao
TDF35. A associao de 3TC ao TDF pode ser utilizada nos coinfectados
por VHBVIH, como parte da TARVc ou em adio mesma, porm,
de realar que os dados disponveis so insuficientes para se poder afirmar
da sua vantagem.
O entecavir eficaz no tratamento das estirpes selvagens de VHB, no
entanto, ocorre resistncia nas estirpes portadoras da mutao YMDD (a
primeira mutao de resistncia lamivudina descrita) 36. Recentemente,
foi demonstrado que o entecavir tem actividade contra VIH1, podendo
seleccionar variantes deste vrus resistentes ao 3TC e entricitabina
Interaces clnicas entre VIH e os vrus das hepatites 273

(FTC)37. Por esta razo, o entecavir no deve ser utilizado na coinfeco


VHBVIH, a no ser que o doente esteja ou seja, simultaneamente, trata-
do com TARVc.
Nos indivduos com coinfeco VHBVIH, que no requerem tratamen-
to para a infeco por VIH, o frmaco de eleio o interfero (os anlo-
gos dos nuclesidos administrados em monoterapia podem induzir resistn-
cias tanto para VIH, como para VHB). Naqueles em que seja necessria
TARV ou teraputica antiVIH e antiVHB, simultaneamente, recomenda-
da a seleco de dois antivricos com actividade antiVHB (TDF e FTC ou
3TC)38.
Os infectados por VIH no respondem, adequadamente, imunizao
contra a hepatite B39. Os resultados de alguns estudos apontam para uma
resposta muito fraca ou, mesmo, ausncia de seroconverso nos infectados
por VIH, no sendo encontrada correlao com a contagem de linfcitos
TCD4+, tipo de vacina ou durao e nmero dos reforos vacinais40,41. Ou-
tros estudos, todavia, encontraram correlao entre a resposta fraca imu-
nizao e a contagem baixa de linfcitos TCD4+7.
Assim, a vacina no , claramente, eficaz na imunizao dos infectados
por VIH, sendo de aconselhar comportamentos que diminuam o risco de
transmisso da infeco por VHB. Dado que, mesmo que a vacinao tenha
sido eficaz, a perda de antiHBs mais rpida e, neste contexto, contraria-
mente ao que se verifica nos imunocompetentes, pode estar associada a
risco de infeco por VHB39,42,43.

Coinfeco VHCVIH
A infeco por VHC representa a causa mais frequente de cirrose nos pa-
ses industrializados e a principal indicao para transplante do fgado na
Europa e nos Estados Unidos da Amrica, calculandose que a sua preva-
lncia seja de 1-2%, na populao em geral, destas regies do Mundo44. A
prevalncia da coinfeco VHCVIH mais elevada nos toxicodependentes
por via endovenosa, a qual chega a atingir 90%, do que nos outros grupos
de seropositivos.
A infeco por VHC tem tendncia para evoluo crnica em 80-90%
dos casos, sendo de 20% os que desenvolvem cirrose e 10% destes hepa-
tocarcinoma45,46.
Nos coinfectados VHCVIH, a doena heptica, devida infeco por
VHC, progride mais rapidamente para cirrose, do que nos infectados, ape-
nas, por VHC47,48.
VHC e VIH so ambos vrus cujo genoma constitudo por ARN, sen-
do o primeiro constitudo por uma nica cadeia helicoidal de ARN e o
segundo por duas. Apesar desta similaridade, o ciclo biolgico e o proces-
so de replicao de ambos os vrus mostram diferenas importantes, assim
VIH necessita de integrao de ARN no genoma da clula hospedeira, para
se replicar, contrariamente a VHC, cuja replicao se processa no citoplas-
ma da clula, sem integrao47,49.
274 Francisco Antunes

Ambos os vrus so constitudos por diversos gentipos e as chamadas


quasispecies. A taxa de mutao da polimerase ARNdependente de VHC
de 1/104 a 105 nucletidos, tendo sido descritos para VHC seis gentipos
principais e, pelo menos, 30 subtipos50. O conceito de quasispecies base-
ado na natureza heterognea de VHC, identificado num determinado mo-
mento, num determinado indivduo50. Esta enorme variabilidade gentica
permite que o vrus desenvolva mecanismos de sobrevivncia, evadindose
aos mecanismos imunitrios de defesa do hospedeiro e presso dos anti-
vricos. A classificao de VHC em variantes de relevncia clnica, pelo
seu diferente tropismo celular, virulncia e sensibilidade aos antivricos,
sendo que, neste caso, o subtipo 1b est associado a pior resposta terapu-
tica do que os outros, e o subtipo 3a (reconhecido como o mais frequente
em toxicodependentes de drogas por via endovenosa, na Europa) tende a ser
mais sensvel ao tratamento51. No entanto, de referir que, globalmente, os
gentipos 1 e 3 so os mais frequentes nos toxicoflicos 52.
Enquanto que o efeito da infeco por VHC, na histria natural da in-
feco por VIH, est, ainda, por determinar (dois estudos recentes concluem
que a hepatite C um factor que condiciona progresso mais rpida para
sida), existe evidncia de que a infeco por VIH afecta a histria natural
da hepatite C crnica, isto , progresso mais rpida e mais frequente, com
o consequente risco elevado de cirrose heptica, falncia heptica e carci-
noma hepatocelular5358.
A utilizao da TARVc, a partir de 1996, foi seguida de declnio dra-
mtico na morbilidade e mortalidade associadas sida, permitindo uma
expectativa de vida, aos infectados por VIH, comparvel dos doentes com
outras doenas crnicas (diabetes e hipertenso), porm, verificandose que
a maioria das mortes no atribudas sida tem sido, cada vez com maior
frequncia, da responsabilidade da doena heptica 5963.
Vrios estudos tm demonstrado que a progresso da doena heptica,
associada infeco por VHC, mais rpida nos coinfectados por
VIH57,6469. Os dados disponveis permitem dizer que a infeco por VHC
comportase como uma infeco oportunista, nos coinfectados por VIH, da
qual resulta uma progresso mais rpida da doena heptica e para a morte.
Vrios factores tm sido identificados como relacionados com mais
rpida progresso para fibrose, isto , seropositividade para VIH, consu-
mo elevado de lcool (> 50 g/dia), baixa contagem de linfcitos TCD4 +
(< 200 cls/mm3) e idade mais avanada, isto , superior a 25 anos data
da infeco por VHC70,71.
Todavia, a interpretao dos efeitos da infeco por VIH, na doena
heptica associada a VHC, foi, mais tarde, complicada pela TARVc. Assim,
a recuperao imunitria, induzida pela TARVc, pode, numa primeira fase,
provocar a destruio dos hepatcitos infectados por VHC, seguindose,
mais tarde, o controlo da replicao deste vrus 7274.
A hepatotoxicidade , relativamente, frequente nos indivduos com infeco
VIH, sob TARVc, incluindo inibidores da protease, sendo aquela mais frequen-
te nos coinfectados por VHC7578. Para alguns autores, a hepatotoxicidade,
Interaces clnicas entre VIH e os vrus das hepatites 275

nos coinfectados por VHCVIH, induzida pela TARVc, no est, totalmen-


te, esclarecida, podendo ser multifactorial (supresso da replicao vrica e
subsequente aumento dos linfcitos TCD4+, com recuperao funcional das
respostas imunitrias especficas contra VHC, acompanhada por libertao
de citocinas citotxicas responsveis pela leso heptica73,79; outra hiptese
pode relacionarse com a potenciao da disfuno mitocondrial, provocada
pelos inibidores da protease e/ou anlogos nuclesidos, em hepatcitos pre-
viamente lesados pela replicao de VHC)80. Para este efeito, a teraputica
antiVHC pode ser uma opo a considerar em doentes com hepatotoxici-
dade recorrente e grave, devida aos antiretrovricos (ARVs). Assim, o con-
trolo da infeco por VHC poder melhorar a tolerncia TARVc, o que
refora o interesse de se tratar esta, no contexto da coinfeco por VIH44,47.
Os candidatos teraputica so aqueles doentes com valores de transamina-
ses 1,5 vezes superiores ao normal e na presena de ARNVHC.
O objectivo da teraputica antiVHC conseguirse resposta vrica sus-
tentada, definida por nveis indetectveis, no soro, de ARNVHC, seis
meses aps o fim da teraputica. Tal resposta, , em geral, durvel e a in-
terrupo da replicao vrica resulta na reduo da leso do fgado e na
possvel reverso da fibrose81. O tratamento da infeco por VHC fundamen-
tase na utilizao de interfero associado ribavirina, conseguindose
resposta vrica sustentada de 40%82,83. Os factores que indiciam resposta
vrica sustentada teraputica antiVHC so carga vrica, antes do tratamen-
to, inferior a dois milhes de cpias/ml de ARNVHC, gentipo 2 ou 3, sexo
feminino, idade inferior aos 40 anos, ausncia de fibrose portal e de utili-
zao prvia de interfero84. A associao de ribavirina com interfero pe-
guilado temse revelado mais eficaz do que a combinao daquele antivri-
co com interfero , obtendose taxas de resposta vrica (abaixo do limite
de deteco) que chegam a atingir os 44% no final do tratamento, em do-
entes com cirrose8587.
Estes resultados so encorajadores, relativamente ao interesse do trata-
mento da infeco por VHC, no contexto da coinfeco VIH. No entanto,
dado que na coinfeco VHCVIH os nveis de ARNVHC so, em regra,
mais elevados, o nmero de quasispecies maior e a doena heptica mais
grave, deve considerarse que a resposta teraputica possa ser inferior aos
infectados, apenas, por VHC44. No entanto, nos coinfectados VHCVIH
tratados, apenas, com interfero , a resposta vrica sustentada ao tratamen-
to de 21%44. A teraputica com interfero associado ribavirina melho-
ra a resposta bioqumica e vrica, assim como reduz a toxicidade 43.
No entanto, a ribavirina pode ser responsvel por acidose lctica, espe-
cialmente em associao com a didanosina (ddI) ou com a estavudina (d4T)88.
Alm disto, a ribavirina causa, com frequncia, hemlise, aumentando o
efeito da anemia induzida pelo AZT (inibio ao nvel da medula ssea),
podendo ser corrigida com a administrao de eritropoietina. Recentemen-
te, foi referido que o abacavir (ABC) pode comprometer a actividade da
ribavirina, diminuindo o seu efeito na teraputica antiVHC89. Este efeito
pode ser devido competio na fosforilao intracelular, dado que ambos
276 Francisco Antunes

os frmacos so anlogos da guanosina. A monitorizao dos efeitos cola-


terais, provas de funo heptica, hematolgica e tiroideia, recomendada
mensalmente e a resposta teraputica trimestralmente, pela determinao
da carga vrica de VHC.
Na ausncia de efeitos adversos, a teraputica deve prolongarse por seis
meses nos portadores dos gentipos 2 e 3 e por 12 meses naqueles com
gentipo 1.
Em doentes com infeco unicamente por VHC, a associao de inter-
fero peguilado com ribavirina tornouse o tratamento de escolha, particu-
larmente nos portadores do gentipo 1, em que a diferena da resposta
teraputica, utilizando interfero peguilado mais marcada 9093. Nestes do-
entes, a resposta vrica sustentada em nocirrticos atinge valores superio-
res a 46%, para os casos do gentipo 1, e de 82% para os gentipos 2 e
39093.No que se refere aos coinfectados VHCVIH, vrias recomendaes
teraputicas tm sido divulgadas. Em 2007, um painel de peritos interna-
cionais publicou recomendaes actualizadas, fundamentandose em dados
novos relevantes94. De destacar, os seguintes aspectos, quanto ao tratamento
dos doentes com coinfeco VHCVIH:
1 O tratamento da hepatite C deve ser recomendado aos doentes com
aminotransferases normais, dado que a prevalncia e a progresso
para cirrose maior neste grupo de doentes, nos quais se consegue
obter respostas, ao interfero peguilado com ribavirina, idnticas
s daqueles com aminotransferases elevadas. No entanto, nos
coinfectados, menos de 10% desta populao apresenta, persisten-
temente, aminotransferases normais, por diversas razes. A expo-
sio aos ARVs, o abuso de bebidas alcolicas e outras condies
explicam a taxa relativamente baixa das aminotransferases normais
nos doentes com infeco por VIH e hepatite C crnica. Por outro
lado, a fibrose heptica, em estado avanado, tem sido referida em
25% a 40% dos coinfectados, com aminotransferases normais e
cirrose silenciosa, em cerca de 15% deles.
2 Em estudos antigos, usando interfero em monoterapia, sugerido
que a eficcia da teraputica da hepatite C seja influenciada pela
contagem inicial de linfcitos TCD4+. Os resultados do estudo
APRICOT mostraram que a resposta teraputica foi menor em
indivduos com contagem inicial baixa, de linfcitos TCD4+. Assim,
os candidatos teraputica antiVHC devem ter valores de linf-
citos TCD4+ superiores a 200350 cls/l, facilmente atingveis na
maioria dos doentes em TARV adequada.
3 Em doentes com contagem de linfcitos TCD4+ e sob TARV, a
deciso em tratar a infeco por VHC deve ter em conta, princi-
palmente, a durao estimada desta ltima, a gravidade da doena
heptica, o grau de supresso da infeco por VIH, os polimorfis-
mos IL28B e os factores clssicos de resposta teraputica, tais
como o gentipo de VHC e a carga vrica. A toxicidade ao inter-
fero peguilado e/ou ribavirina, assim como a m resposta ao
Interaces clnicas entre VIH e os vrus das hepatites 277

tratamento, so mais frequentes nos indivduos profundamente


imunocomprometidos. Naqueles doentes com contagem de linfci-
tos TCD4+ abaixo das 200 cls/l, em geral, a teraputica da in-
feco por VHC deve ser protelada pelas razes acima referidas
(risco acrescido de toxicidade e menor percentagem de resposta).
Para alm disto, o interfero pode causar, por si s, diminuio na
contagem de linfcitos TCD4+, o que pode colocar estes doentes
em risco de desenvolverem infeces oportunistas.A informao
sobre o estdio da fibrose heptica importante para as decises
teraputicas, no entanto, a biopsia heptica no mandatria, no
contexto do tratamento da hepatite C crnica. Actualmente, esto
disponveis meios noinvasivos para avaliar a fibrose heptica
(elastometria FibroScan e uma srie de marcadores biolgicos
sricos Fibrotest, APRI, SHASTA, FIB4, index de Forn, etc.).
Estes mtodos so, em geral, adequados para discriminarem entre
inexistncia de fibrose e fibrose avanada e menos precisos para
distinguirem os estdios intermdios de fibrose. O seu valor pre-
ditivo , em geral, bom para os estdios avanados de fibrose
heptica e de cirrose. No entanto, os marcadores serolgicos so
menos fiveis, em geral, nos coinfectados, dada a natureza infla-
matria da infeco por VIH e/ou a prescrio frequente de fr-
macos nesta populao, o que pode interferir com os resultados
dos marcadores sricos de fibrose (por exemplo, aumento da bilir-
rubina com o atazanavir (ATV), aumento da gamaglutamiltranspep-
tidase com os nonuclesidos inibidores da transcriptase reversa
ou incremento do colesterol, com a maioria dos inibidores da pro-
tease potenciados com ritonavir [RTV]). Em contraste, a elastome-
tria mais fivel nos coinfectados (valor preditivo superior a 90%,
para a fibrose heptica em estdio avanado), de execuo rpi-
da (10 minutos), pode ser repetida periodicamente e parece ter
valor prognstico, em termos de sobrevivncia, em coinfectados
VHCVIH.
4 Antes do incio da teraputica, para alm da avaliao da fibrose
heptica, necessrio o conhecimento do gentipo e da carga v-
rica (ARNVHC). O impacto dos polimorfismos de um nico
nucletido (SNPs) no gene IL28B (localizado no cromossoma
19q13), na resposta teraputica da infeco por VHC, foi muito
recentemente reconhecido. O SNP consiste na substituio no nu-
cletido a timidina (T) pela citosina. Assim, o gentipo homozi-
gtico mutante CC est associado a resposta vrica sustentada
superior a duas vezes do gentipo heterozigtico CT ou do
gentipo homozigtico selvagem TT. Deste modo, tendo em con-
siderao que os polimorfismos IL28B influenciam a resposta
teraputica antiVHC com interfero, a genotipagem de IL28B de
ser incorporada no algoritmo da deciso teraputica nos coinfec-
tados VHCVIH (Quadro 2).
278 Francisco Antunes

Quadro 2. Factores associados resposta vrica sustentada teraputica antiVHC, em


coinfectados por VIH
Hospedeiro Vrus Tratamento
Polimorfismos CC no Gentipo 2/3 Dose adequada de interfero
gene IL28B Carga vrica ARNVHC baixa peguilado
Caucasiano Carga vrica ARNVHC Dose elevada de ribavirina
Jovem indetectvel s quatro semanas Boa adeso
Fibrose heptica Sem coadministrao de ddI,
mnima AZT ou ABC
ndice de massa Utilizao de factores de
corporal baixo crescimento hematopoiticos,
Sem resistncia quando necessrio
insulina
Sem esteatose heptica
Contagem de TCD4+
elevada
Sem abuso de drogas
Sem doena
psiquitrica

5 O objectivo de se atingir a resposta vrica sustentada pode ser previs-


to na semana quatro de tratamento, baseandose na carga vrica nega-
tiva de ARNVHC. Por outro lado, reduo inferior a dois log UI/ml,
na carga vrica, s 12 semanas e/ou viremia detectvel s 24 sema-
nas, ambas so indicadoras de que no se conseguir resposta vrica
sustentada, pelo que o tratamento antiVHC deve ser interrompido.
6 A dose de interfero peguilado deve ser estandardizada para os
180 g/semana e a da ribavirina adaptada ao peso (1.000 mg/dia,
se peso < 75 kg e 1.200 mg/dia, se peso > 75 kg).
7 O tratamento da infeco por VHC crnica, em coinfectados por
VIH e portadores dos gentipos 1 e 4, fundamentase na associao
de interfero peguilado e ribavirina, durante 48 semanas. Nos do-
entes portadores dos gentipos 2 e 3 e com carga vrica indetect-
vel s quatro semanas, a durao da teraputica pode ser reduzida
para 24 semanas. Pelo contrrio, os portadores dos gentipos 1 e
4, com viremia no detectvel s 12 semanas (ou com reduo
igual ou superior a dois log UI/ml, na carga vrica), mas com
carga vrica detectvel s quatro semanas, devem ser tratados du-
rante 6072 semanas.
Os doentes com coinfeco VHCVIH, com descompensao heptica
(ascite, hemorragia gastrintestinal, encefalopatia heptica, etc.) no devem
ser tratados com interfero peguilado, dado o elevado risco de desenvolve-
rem efeitos colaterais graves. Estes doentes devem ser referenciados para
transplante heptico. Porm, os doentes com cirrose compensada (classe A
Interaces clnicas entre VIH e os vrus das hepatites 279

Quadro 3. Consideraes sobre a utilizao dos novos antivricos para o tratamento da


infeco crnica por VHC, em coinfectados por VIH
Carga vrica elevada de ARNVHC risco aumentado de resistncia
Proporo elevada de infeco por VHC1a do que por VHC1b menor susceptibilidade
aos inibidores da protease para a infeco por VHC
Taxas elevadas dos gentipos 3 e 4 de VHC sem actividade dos inibidores da protease e
dos anlogos nonuclesidos
Possibilidade de interaces medicamentosas (farmacocinticas e farmacodinmicas), com
os antiretrovricos

de ChildPugh) devem ser tratados com interfero peguilado e ribavirina,


dado que tm 25% de possibilidade de responderem teraputica. A hepa-
tite C crnica curvel, estando a infeco erradicada desde que o ARNVHC
seja indetectvel seis meses aps a teraputica.
Do ponto de vista do incio da teraputica antiVHC, esta deve ser pro-
telada em coinfectados com contagem de linfcitos TCD4+ baixa, devendo
ser dada prioridade TARV.
Logo que a contagem de linfcitos TCD4+ aumente e que a carga vri-
ca ARNVIH esteja sob controlo, a prescrio da teraputica antiVHC deve
ser, de novo, equacionada. Por outro lado, em doentes sem TARV prvio
com contagem de linfcitos TCD4+ adequada deve ser dada prioridade
teraputica antiVHC (mais tarde, estes doentes acabam por ter melhor
tolerncia teraputica antiretrovrica).
O advento de novos antivricos (STATC specifically targeted antiviral
therapy for HCV) para o tratamento da infeco por VHC abre uma nova
janela de oportunidades, para os doentes com fibrose heptica significativa,
com insucesso teraputica com interfero peguilado e ribavirina. No entanto,
em relao aos coinfectados VHCVIH o perfil clnicoepidemiolgico di-
ferente do dos monoinfectados por VHC (carga vrica mais elevada, maior
prevalncia dos gentipos 2 e 3, mais frequente a infeco por VHC1a do
que 1b e uso, concomitante, de TARV), o que pode influenciar a eficcia dos
novos antivricos para a infeco por VHC (Quadro 3). Assim, os novos anti-
vricos para teraputica da infeco por VHC no esto, ainda, recomendados
para o tratamento dos coinfectados VHCVIH. No entanto, para estes casos
aguardamse os resultados dos estudos em curso.

Coinfeco VHDVIH
A prevalncia da infeco por VHD, transmitida, principalmente, por via
parentrica, varia nos indivduos com coinfeco por VIH, de acordo com
os factores de risco associados infeco por este ltimo. Assim, os toxi-
codependentes, por via endovenosa, tm maior reactividade s infeces por
VHBVHD, do que os que se infectam por VIH, pela via sexual.
No existe evidncia de que a infeco por VHD possa afectar a replica-
o do VIH ou a progresso da imunodepresso. Porm, a doena heptica
280 Francisco Antunes

associada infeco por VHD pode condicionar interaco com os ARVs,


devido alterao do metabolismo heptico ou por hepatotoxicidade com-
binada. Alguns estudos mostraram que VHD pode reverter o efeito inibi-
trio que este vrus possa ter sobre a replicao de VHB e que o antiVHD
e o ARNVHD, assim como o antignio VHD no fgado no eram detec-
tados, com mais frequncia, nos indivduos coinfectados por VIH, suge-
rindo que esta no teria qualquer efeito sobre a replicao de VHD 95.
Porm, outros autores indicam uma prevalncia maior no soro de
ARNVHD, nos infectados por VIH 96.
Se bem que alguns autores tenham verificado que o aumento das ami-
notransferases, nos coinfectados por VIHVHBVHD, era mais frequente
do que nos noinfectados por VIH, outros, usando o critrio histolgico
para avaliao da gravidade da doena heptica, no identificaram qualquer
influncia da infeco por VIH na evoluo da infeco VHBVHD9597.
Nos infectados por VIH, a antigenemia delta prolongada parece no ter
qualquer efeito na evoluo da hepatite D6,9597.
Os testes disponveis ELISA podem estar associados a resultados falsa-
mente positivos antiVHD em doentes com sida98.

Coinfeco do VIH com outros vrus das hepatites


(VHA, VHE, VHG e VHJ)
No existem dados que sugiram que a infeco por VHA, nos infectados
por VIH, possa afectar a replicao deste retrovrus. Por outro lado, nos
infectados por VIH, que adquirem mais tarde a infeco por VHA, a evo-
luo desta parece no ser afectada por aquela99.
A replicao de VHA poder ser mais prolongada nos coinfectados por
VIH, do que no hospedeiro imunocompetente, correlacionandose aquela
com nveis mais elevados de aminotransferases100.
Os indivduos com infeco por VIH, no imunizados contra a infeco
por VHA, devem ser vacinados quando viajem para reas de elevada ende-
micidade de hepatite A ou quando estejam infectados por VHC, sendo as
taxas de seroconverso e os ttulos antiVHA mais baixos do que na popu-
lao em geral101103.
No se conhece evoluo para a cronicidade dos infectados por VHE,
no existindo, praticamente, informao sobre interaces directas entre
aquele e o VIH.
Finalmente, VHG foi, recentemente, reconhecido, no se sabendo,
ainda, qual o seu papel quer na hepatite aguda, quer na crnica, o mesmo
em relao a interaces com VIH, partilhando, todavia, as mesmas vias
de transmisso, tal como acontece em relao a vrus da hepatite J
(VHJ)104106.

Agradecimento
O autor agradece a Ana Sequeira a preparao do manuscrito.
Interaces clnicas entre VIH e os vrus das hepatites 281

Bibliografia
1. Francisci D, Baldelli F, Papili R, et al. Prevalence of HBV, HDV and HCV hepatitis markers in HIVpositive
patients. Eur J Epidemiol. 1995;11:1236.
2. Greenspan D, Greenspan JS, Overby G, et al. Risk factors for rapid progression from hairy leukoplakia to AIDS:
a nested casecontrol study. J Acquir Imune Defic Syndr. 1991;4:6528.
3. Eskild A, Magnus P, Petersen G, et al. Hepatitis B antibodies in HIVinfected homosexual men are associated
with more rapid progression to AIDS. AIDS. 1992;6:5714.
4. Solomon RE, VanRaden M, Kaslow RA, et al. Association of hepatitis B surface antigen and core antibody with
acquisition and manifestations of human immunodeficiency virus type 1 (HIV1) infection. Am J Public Health.
1990;80:14758.
5. Gilson RJC, Hawkins AE, Beecham MR, et al. Interactions between HIV and hepatitis B virus in homosexual
men: effects on natural history of infection. AIDS. 1997;11:597606.
6. Horvath J, Raffanti SP. Clinical aspects of the interactions between human immunodeficiency virus and the
hepatotrophic viruses. Clin Infect Dis. 1994;18:33947.
7. Newell A, Francis N, Nelson M. Hepatitis and HIV: inter relationship and interactions. Br J Clin Pract.
1995;49:24750.
8. McNair ANB, Main J, Thomas HC. Interactions of the human immunodeficiency virus and the hepatotropic virus.
Semin Liver Dis. 1992;12:18896.
9. Bodsworth NJ, Cooper DA, Donovan B. The influence of human immunodeficiency virus type1 infection on
the development of the hepatitis B carrier state. J Infect Dis. 1991;163:113840.
10. Hadler SC, Judson FN, OMalley PM, et al. Outcome of hepatitis B virus infection in homosexual men and its
relation to prior human immunodeficiency virus infection. J Infect Dis. 1991;163(3):4549.
11. Bodsworth N, Donovan B, Nightingale BN. The effect of concurrent human immunodeficiency virus infection
on chronic hepatitis B: a study of 150 homosexual males. J Infect Dis. 1989;160:57782.
12. Mai AL, Kim C, ORourke K, et al. The interaction of human immunodeficiency virus infection and hepatitis
B virus infection in infected homosexual men. J Clin Gastroenterol. 1996;22:299304.
13. Mills CT, Lee F, Perrillo R. Relationship between histology, aminotransferase levels and viral replication in
chronic hepatitis B. Gastroenterology. 1990;99:51924.
14. Bonacini M, Govindarajan S, Redeker AG. Human immunodeficiency virus infection does not alter serum
transaminases and hepatitis B virus (HBV) DNA in homosexual patients with chronic HBV infection. Am J
Gastroenterol. 1991;86:5705.
15. Thio CL, Seaberg EC, Skolasky R Jr, et al. HIV1, hepatitis B virus, and risk of liverrelated mortality in the
Multicenter Cohort Study (MACS). Lancet. 2002;360:19216.
16. Perrillo RP, Regenstein FG, Roodman ST. Chronic hepatitis B in asymptomatic homosexual men with antibody
to the human immunodeficiency virus. Ann Intern Med. 1986;105:3823.
17. Vento S, di Perri G, Luzzati R, et al. Clinical reactivation of hepatitis B in antiHBspositive patients with AIDS.
Lancet. 1989;1(8633):3323.
18. Vento S, di Perri G, Garofano T, et al. Reactivation of hepatitis B in AIDS. Lancet. 1989;2(8654):1089.
19. Lazizi Y, GrangeotKeros L, Delfraissy JF, et al. Reappearance of hepatitis B virus in immune patients infected
with the human immunodeficiency virus. J Infect Dis. 1988;158:6667.
20. Levy P, Marcellin P, MartinotPeignoux M, et al. Clinical course of spontaneous reactivation of hepatitis B virus
infection in patients with chronic hepatitis B. Hepatology. 1990;12:5704.
21. Santos EA, Yoshida CF, Rolla VC, et al. Frequent occult hepatitis B virus infection in patients infected with
human immunodeficiency virus type 1. Eur J Clin Microbiol Infect Dis. 2003;22:928.
22. Shire NJ, Rouster SD, Rajicic N, Sherman KE. Occult hepatitis B in HIVinfected patients. J Acquir Immune
Defic Syndr. 2004;36