Você está na página 1de 78

,17(/,*1&,$

*29(51$0(17$/
&217(;7261$&,21$,6('(6$),26
&217(03251(26

%RRNB,QW*RYHUQDPHQWDOLQGE 
%RRNB,QW*RYHUQDPHQWDOLQGE 
Marco Cepik
Organizador

,17(/,*1&,$
*29(51$0(17$/
&217(;7261$&,21$,6('(6$),26
&217(03251(26

Niteri, RJ
2011

%RRNB,QW*RYHUQDPHQWDOLQGE 
2011, Editora Impetus Ltda.

Editora Impetus Ltda


Rua Alexandre Moura, 51 Gragoat Niteri RJ
CEP: 24210-200 Telefax: (21) 2621-7007

Editorao Eletrnica: Editora Impetus Ltda.


Capa: Rafael Brum
Reviso de Portugus: Carmem Becker
Impresso e encadernao:

TODOS OS DIREITOS RESERVADOS proibida a reproduo, salvo pequenos trechos, mencionando-se a fonte.
A violao dos direitos autorais (Lei no 9.610/98) crime (art. 184 do Cdigo Penal). Depsito legal na Biblioteca
Nacional, conforme Decreto no 1.825, de 20/12/1907.
O autor seu professor; respeite-o: no faa cpia ilegal.
A Editora Impetus informa que se responsabiliza pelos defeitos grficos da obra. Quaisquer vcios do produto
concernentes aos conceitos doutrinrios, s concepes ideolgicas, s referncias, originalidade e atualizao
da obra so de total responsabilidade do autor/atualizador.

www.impetus.com.br

%RRNB,QW*RYHUQDPHQWDOLQGE 
DEDICATRIA

Dedico o livro minha equipe de assistentes de pesquisa,


orientandos e estudantes

%RRNB,QW*RYHUQDPHQWDOLQGE 
%RRNB,QW*RYHUQDPHQWDOLQGE 
AGRADECIMENTO

Agradeo aos colegas Dr. Denilson Feitoza, Dra. Priscila Brando e


Dr. Carlos Arturi, bem como a Christiano Ambros, Luza Schneider, Gustavo Vernier,
Gustavo Moller e Bruno Kern. Agradeo ainda a toda a equipe da Editora Impetus.

%RRNB,QW*RYHUQDPHQWDOLQGE 
%RRNB,QW*RYHUQDPHQWDOLQGE 
OS AUTORES

Marco Cepik professor associado na UFRGS, onde desenvolve atividades


de pesquisa, ensino, orientao e consultoria em trs reas: Estudos
sobre Inteligncia, Segurana Internacional e Governo e Digitalizao.
Pesquisador do Ncleo de Estratgia e Relaes Internacionais (NERINT-
UFRGS), do Centro de Estudos Internacionais sobre Governo (CEGOV-
UFRGS) e do Centro de Estudos de Inteligncia Governamental (CEIG-
UFMG), Cepik havia publicado 08 livros, 23 captulos de livros e 21 artigos
cientficos, at 2010. Marco Cepik foi pesquisador / professor visitante na
Indiana University of Pennsylvania (1997-1998), na FLACSO Ecuador (2003
e 2006), na National Defense University em Washington-D.C. (2000 e 2002)
e na Naval Post Graduate School em Monterey-CA (2004), dentre outras
instituies no Brasil e no exterior. Em 2005, foi bolsista de ps-doutorado
do CNPq na Universidade de Oxford, no Reino Unido.
Carlos Arturi Professor Associado do Departamento de Cincia Poltica
da Universidade Federal do Rio Grande do Sul (UFRGS). Obteve seu
Doutorado no Institut dEtudes Politiques de Paris (Sciences Po) e realizou
seu Ps-Doutoramento na Universidade de Lisboa. Ele coordena o Grupo
de Pesquisa Contestao Transnacional e Controles Democrticos,
credenciado pelo CNPq, integra o Ncleo de Estratgia e de Relaes
Internacionais (NERINT) do Instituto Latino-americano de Estudos
Avanados (ILEA), da UFRGS, e est associado ao LABMUNDO, da UFBA.
docente e orientador de mestrado e doutorado nos Programas de Ps-
Graduao em Cincia Poltica e em Relaes Internacionais da UFRGS,
bem como Professor-convidado do Mestrado em Cincia Poltica da UFPR.
Jlio Cssio Rodriguez possui graduao em Relaes Internacionais pela
Universidade Federal do Rio Grande do Sul (2007) e mestrado em Cincia
Poltica pela mesma universidade (2009). Atualmente Doutorando em
Cincia Poltica pela Universidade de Lisboa, com vnculo no Instituto de
Cincias Sociais (ICS). bolsista de Doutorado da Fundao para a Cincia
e Tecnologia - Portugal (FCT).
Gabriel Pessin Adam possui mestrado em Relaes Internacionais pela
Universidade Federal do Rio Grande do Sul e atualmente doutorando do

%RRNB,QW*RYHUQDPHQWDOLQGE 
Programa de Ps-Graduao em Cincia Poltica da mesma universidade.
Pesquisador do Ncleo de Estratgia e Relaes Internacionais (NERINT-
UFRGS).
Alexander Arciniegas Carreo advogado formado pela Universidad
Industrial de Santander (UIS) Colmbia e mestre em Cincia Poltica
pela Universidade Federal do Rio Grande do Sul (UFRGS). Atualmente,
doutorando em Cincia Poltica pela mesma universidade.
Mamadou Alpha Diallo possui graduao em administrao pela Pontifcia
Universidade Catlica do Rio Grande do Sul (2008) e mestrado em Cincia
Poltica pela Universidade Federal do Rio Grande do Sul (2011). Atualmente,
doutorando do Programa de Estudos Estratgicos Internacionais da
UFRGS e pesquisador do Ncleo de Estratgia e Relaces Internacionais
(NERINT-UFRGS).
Igor Castellano da Silva doutorando em Estudos Estratgicos Internacionais
pela Universidade Federal do Rio Grande do Sul (UFRGS), pesquisador
vinculado ao Ncleo de Estratgia e Relaes Internacionais (NERINT) e
bolsista da Coordenao de Aperfeioamento de Pessoal de Nvel Superior
(CAPES). Possui graduao em Relaes Internacionais e mestrado em
Cincia Poltica pela mesma universidade (UFRGS).
Nathaly Xavier possui graduao em Relaes Internacionais pela Universidade
Federal do Rio Grande do Sul (2008). Mestre e Doutoranda em Cincia
Poltica pela mesma universidade.
Marlia Bortoluzzi Severo doutoranda em Cincia Poltica pela Universidade
Federal do Rio Grande do Sul (UFRGS), pela linha de pesquisa em Poltica
Internacional. mestre em Cincia Poltica pela mesma instituio, e possui
graduao em Direito pela Universidade Federal de Santa Maria (UFSM).
Fabrcio vila possui graduao em Histria (Bacharelado) pela Pontifcia
Universidade Catlica do Rio Grande do Sul (2005), graduao em Histria
(Licenciatura Plena) pela Pontifcia Universidade Catlica do Rio Grande
do Sul (2005) e mestrado em Relaes Internacionais pela Universidade
Federal do Rio Grande do Sul (2008). doutorando em Cincia Poltica na
Universidade Federal do Rio Grande do Sul, onde pesquisa a dissuaso
nuclear no sculo XXI.
Marcos Carra possui graduao em Fsica (Bacharelado) (1990), graduao em
Histria (Licenciatura) (1995), graduao em Cincias Econmicas (2002),
graduao em Histria (Bacharelado) (2003), graduao em Cincias
Sociais (Bacharelado) (2006) e mestrado em Relaes Internacionais, todos
pela Universidade Federal do Rio Grande do Sul (2008). Doutorando em
Cincia Poltica pela mesma universidade.

%RRNB,QW*RYHUQDPHQWDOLQGE 
Christiano Ambros possui graduao em Relaes Internacionais pela
Universidade Federal do Rio Grande do Sul (2010). Atualmente
mestrando do Programa de Ps-Graduao em Cincia Poltica da mesma
universidade. bolsista snior e coordenador do Grupo de Trabalho
- Teoria e Inteligncia Comparada do Ncleo de Estratgia e Relaes
Internacionais (NERINT) da Universidade Federal do Rio Grande do Sul.
Jussara de Oliveira Machado possui especializao Lato Sensu em Inteligncia
de Estado e Inteligncia de Segurana Pblica pela Fundao Escola
Superior do Ministrio Pblico de Minas Gerais FESMPMG (2010);
especializao Lato Sensu em Gesto Pblica pelo Praetorium (2009) e
graduao em Direito pela Pontifcia Universidade Catlica de Minas
Gerais PUC/MG (2002). Pesquisadora estudante do Centro de Estudos
Estratgicos e Inteligncia Governamental da Universidade Federal de
Minas Gerais CEEIG/UFMG (desde 2010).

%RRNB,QW*RYHUQDPHQWDOLQGE 
%RRNB,QW*RYHUQDPHQWDOLQGE 
APRESENTAO
DA SRIE

A atividade de inteligncia essencial ao desenvolvimento e preservao


do Estado Democrtico de Direito brasileiro. Todos os pases economicamente
desenvolvidos, com democracias consolidadas, possuem servios de inteligncia
responsveis, legais e fortes.
H uma imensa massa de informaes com a qual o Estado tem de lidar
cotidianamente, seja quanto execuo de aes especficas, seja quanto ao
estabelecimento de suas polticas e estratgias institucionais.
No Brasil, o princpio constitucional da eficincia (art. 37, caput, da
Constituio da Repblica) veda que o Estado trabalhe com essa massa de
informaes de forma meramente emprica, com desperdcio de recursos
humanos, materiais e financeiros. O Estado deve utilizar-se de mtodos,
tcnicas e ferramentas adequados para lidar com as informaes necessrias
ao desempenho de suas finalidades constitucionais, superando a fase
individualista e amadorstica de seus agentes pblicos e polticos e alcanando
a racionalidade gerencial exigida pelo princpio constitucional da eficincia.
Os modelos estatais de inteligncia constituem uma certa ordenao,
adequao e organizao de mtodos, tcnicas e ferramentas de gesto
da informao e do conhecimento, especialmente destinados ao processo
decisrio estatal.
Nessa linha, a inteligncia de Estado (ou inteligncia clssica) voltada,
especialmente, para o assessoramento do processo decisrio. Por exemplo,
nos termos legais, o Sistema Brasileiro de Inteligncia (Sisbin) tem a finalidade
de fornecer subsdios ao Presidente da Repblica nos assuntos de interesse
nacional (art. 1o da Lei no 9.883/1999), possuindo, como rgo central, a Agncia
Brasileira de Inteligncia (Abin), subordinada ao Gabinete de Segurana
Institucional da Presidncia da Repblica.
Todavia, sendo sobretudo mtodo, a noo de inteligncia de Estado passou a
ser aplicada a rgos pblicos em geral, adequando-se a suas finalidades estatais
especficas, especialmente no mbito da segurana pblica e da fiscalizao.
Isso ocorreu nos Estados Unidos da Amrica, em que, at a Segunda
Guerra Mundial, a atividade de inteligncia era utilizada, basicamente, como
inteligncia clssica, ou seja, com fins militares (inteligncia militar) e

%RRNB,QW*RYHUQDPHQWDOLQGE 
polticos. Entre 1900 e 1950, gradualmente, a inteligncia criminal (criminal
intelligence) obteve reconhecimento como ferramenta efetiva de combate
ao crime, at que, em 1956, foi formada, com 26 agncias estatais e locais, a
Unidade de Inteligncia de Segurana Pblica (L.E.I.U. Law Enforcement
Intelligence Unit), que possui, atualmente, mais de 250 agncias, nos Estados
Unidos, Canad, Austrlia e frica do Sul.
Esse mesmo processo tem ocorrido, atualmente, no Brasil, no qual
desenvolvem-se as atividades de inteligncia de segurana pblica
(denominao recente que abrange, por exemplo, a inteligncia policial),
inteligncia ministerial (Ministrio Pblico), inteligncia fiscal, inteligncia
prisional/penitenciria etc.
De maneira irreversvel, apesar das resistncias culturais e institucionais,
a inteligncia de segurana pblica e, de modo geral, novas inteligncias
(como a ministerial, a fiscal e a prisional) tm firmado sua dupla natureza,
como inteligncia estratgica (processo decisrio natureza consultiva) e
inteligncia ttica (produo de provas natureza executiva), destinadas
tanto produo de provas para investigaes e processos criminais, cveis e
fiscais (inteligncia ttica), especialmente em situaes mais complexas como
combate s organizaes criminosas, programas de controle de crimes e defesa
de interesses coletivos, quanto produo de conhecimento destinado a
processos decisrios estratgicos.
Considerando que h vinte e sete unidades federativas no Brasil, cada uma
com Polcia Civil, Polcia Militar, Ministrio Pblico, Corpo de Bombeiros Militar,
Sistema Prisional e Secretaria da Fazenda, alm dos rgos da Unio (Exrcito,
Marinha, Aeronutica, Ministrio da Defesa, Abin, Secretaria da Receita
Federal do Brasil, Ministrio Pblico da Unio etc.) e dos municpios (Guardas
Municipais), facilmente se verifica que h, desenvolvidas ou embrionrias,
mais de 150 agncias ou servios de inteligncia brasileiros, das quais mais
da metade surgiu ou desenvolveu-se nos ltimos oito anos.
Essa rpida expanso deve continuar nos prximos anos.
A sociedade, a imprensa, os centros de ensino e pesquisa e o prprio Estado
finalmente despertaram para essa nova realidade, com o que renovaram-
se e ampliaram-se os questionamentos sobre a eficincia e a legalidade das
atividades de inteligncia, bem como sobre sua capacidade de respeitar
direitos humanos e direitos fundamentais.
H uma verdadeira efervescncia na rea da inteligncia, com realizao
de pesquisas acadmicas, edio de estudos, surgimento de ps-graduaes,
publicao de longas reportagens crticas, declaraes de importantes
personalidades pblicas (como as dos chefes dos Poderes da Unio), discusses
legislativas no Congresso Nacional, imensa repercusso na mdia de aes
estatais atribudas inteligncia (como as da Polcia Federal e da Abin) etc.

%RRNB,QW*RYHUQDPHQWDOLQGE 
A prospectiva para a inteligncia, nos prximos cinco a dez anos, indica
cenrios com significativas transformaes:
a) diante do dficit legal sobre a inteligncia, vrios aspectos da inteligncia
devero ser regulamentados por lei stricto sensu, como leis ordinrias
ou, possivelmente, at emenda Constituio;
b) novos servios de inteligncia continuaro a surgir, inclusive
sistemas de inteligncia constitucionalmente autnomos (como
Ministrios Pblicos, Poder Judicirio, Poder Legislativo e Municpios),
demandando que a Comunidade de Inteligncia se antecipe no
planejamento de sua integrao ou cooperao;
c) a inteligncia procurar justificar-se e adequar-se como mtodo
proporcional, controlvel, eficiente e federativo-cooperativo, bem
como desenvolver-se como mtodo pluriagencial, interdisciplinar e
interparadigmtico, adequado a fenmenos complexos e dialticos;
d) a inteligncia de segurana pblica e novas inteligncias firmaro sua
dupla natureza, como inteligncia estratgica (processo decisrio
natureza consultiva) e inteligncia ttica (produo de provas
natureza executiva);
e) a inteligncia tender a atuar de forma cooperativa, seguindo a tendncia
mundial ao compartilhamento informacional;
f) a inteligncia aumentar sua participao em investigaes criminais e
civis, seja auxiliando ou integrando rgos investigativos;
g) a inteligncia de segurana pblica e outras inteligncias orientadas
para a investigao procuraro desenvolver e consolidar seu devido
processo legal;
h) a inteligncia buscar padronizao, inclusive com desenvolvimento de
normas de qualidade e sistemas de certificao de qualidade;
i) a inteligncia buscar educao (capacitao, treinamento e
aperfeioamento, permanentes e continuados), segundo parmetros
internacionais, mas adequada realidade nacional atual e futura. Por
exemplo, a Fundao Escola Superior do Ministrio Pblico de Minas
Gerais (FESMP/MG) lanou a primeira Ps-Graduao brasileira de
Especializao em Inteligncia de Estado e Inteligncia de Segurana
Pblica, que j est na terceira turma, tendo, como alunos, Delegados
da Polcia Federal, Promotores de Justia, Delegados da Polcia Civil,
Oficiais da Polcia Militar, Agentes da Polcia Federal, Procuradores de
Justia, Procuradores da Repblica, Analistas da Agncia Brasileira de
Inteligncia (ABIN), Auditores Fiscais estaduais e federais, Analistas do
TCU, Juzes Federais, Juzes de Direito etc.

%RRNB,QW*RYHUQDPHQWDOLQGE 
A Editora Impetus, com o apoio da Fundao Escola Superior do Ministrio
Pblico de Minas Gerais (FESMP/MG), em face desses cenrios de relevantes
transformaes, decidiu lanar a primeira srie brasileira sobre inteligncia,
denominada Inteligncia, Segurana e Direito.
A srie Inteligncia, Segurana e Direito objetiva contribuir para o
desenvolvimento e o aperfeioamento da inteligncia e da segurana, por
meio da publicao de estudos, pesquisas, ensaios, manuais, cursos, tratados,
coletnea de artigos e outras obras de qualidade, nacionais ou estrangeiras,
produzidas por profissionais de inteligncia e segurana, pesquisadores,
professores, especialistas e estudiosos em geral. Ademais, a srie tambm
incorpora o novo campo de estudos e pesquisas do direito sobre a inteligncia
e a segurana.

Dr. Denilson Feitoza


Coordenador da Srie Inteligncia, Segurana e Direito
Presidente do Instituto Brasileiro de Inteligncia Criminal (INTECRIM)
Coordenador da Ps-Graduao de Especializao em Inteligncia
de Estado e Inteligncia de Segurana Pblica da Fundao Escola
Superior do Ministrio Pblico de Minas Gerais (FESMP/MG)
Membro da International Association of Law
Enforcement Intelligence Analysts (IALEIA)
Ex-Secretrio-Geral do Grupo Nacional de
Combate s Organizaes Criminosas (GNCOC)
Ex-Coordenador do Centro de Segurana e
Inteligncia Institucionais (CESIN) do MPMG
Ex-Coordenador Nacional do Grupo de
Inteligncia dos Ministrios Pblicos
Doutor em Direito e Procurador de Justia

%RRNB,QW*RYHUQDPHQWDOLQGE 
APRESENTAO

A inteligncia governamental uma parte do Estado contemporneo com


profundas implicaes para a democracia e a segurana. Se, por um lado, a
desconfiana perante estes rgos tem sido recorrente em diferentes contextos
polticos, por outro no possvel uma ordem democrtica sem servios de
inteligncia institucionalizados, ou seja, efetivos e legtimos. Eles so essenciais
na funo de governo, ao subsidiar governantes em seus processos dirios de
tomada de deciso. Alm destes dilemas j tradicionais, contudo, novos focos de
tenso surgem com os avanos tecnolgicos e as mudanas histricas recentes.
Nesse sentido, este livro tem o intuito de contribuir com este debate, atravs da
exposio de casos relevantes para o sistema internacional e para a poltica externa
brasileira, na Parte I, e tambm por meio de uma discusso terica a respeito dos
novos desafios enfrentados pela inteligncia governamental, na Parte II. *
No primeiro captulo, Carlos Arturi e Jlio Rodriguez comparam os casos de
Portugal e Brasil, analisando o tipo de transio poltica efetuado nas respectivas
democratizaes e o padro resultante para as relaes civis-militares e para as
organizaes de inteligncia e de segurana internas. Alm de contribuir com o
importante caso brasileiro, os autores concluem que o tipo de transio poltica
bastante diferente nos dois casos tem papel preponderante no resultado.
No caso portugus, em que a transio aconteceu de forma abrupta, atravs da
Revoluo dos Cravos de 1974, os atores no ficaram constrangidos pelo legado
do perodo anterior e conseguiram efetuar o controle civil sobre os militares de
forma mais profunda, institucionalizando os servios de inteligncia e segurana
internas sob controles democrticos embora, evidentemente isso no tenha sido
isento de conflitos. J no caso brasileiro, os autores demonstram a dificuldade dos
civis de institucionalizar e de instituir o controle democrtico sobre os militares,
devido lenta, gradual e pactuada transio da ditadura brasileira, mostrando,
contudo, que o processo tem avanado paulatinamente nas ltimas dcadas.

*(PERUDFRPSDUWLOKDQGROHLWXUDVHXPDDJHQGDGHSHVTXLVDRULHQWDGDSDUDDH[SOLFDRGHDVSHFWRV
LQVWLWXFLRQDLVDQDOWLFRVHRSHUDFLRQDLVGDUHDGHLQWHOLJQFLDRVWH[WRVUHXQLGRVQHVWHYROXPHUHIOHWHP
DVIRQWHVTXHHVWLYHUDPGLVSRQYHLVDFDGDDXWRUHH[SUHVVDPDVFRQYLFHVHLQWHUSUHWDHVGHVHXV
DXWRUHV7UDWDVHSRLVGHXPYROXPHSOXUDOLVWDRQGHFRH[LVWHPGLIHUHQWHVRSLQLHVVHPSUHSURYLVULDV
HVXMHLWDVDRVUHVXOWDGRVGHSHVTXLVDVDGLFLRQDLV2HGLWRUGRYROXPHQRHQGRVVDQHFHVVDULDPHQWH
DVDILUPDHVFRQWLGDVQRVGLIHUHQWHVFDSWXORV7DPSRXFRHOHVUHIOHWHPQHFHVVDULDPHQWHTXDOTXHU
SRVLRLQVWLWXFLRQDOGD8)5*6RXGR&13TDTXHPDJUDGHFHPRVRDSRLRSHVTXLVDSRUPHLRGD
FRQFHVVRGHEROVDVHDX[OLRVGHSHVTXLVD

%RRNB,QW*RYHUQDPHQWDOLQGE 
J no Captulo 2, Gabriel Adam apresenta com o estudo de caso da Rssia,
analisando a atuao dos servios de inteligncia russos no ps-Guerra Fria. O
autor faz um breve histrico dos sistemas de inteligncia russos desde o tempo
dos czares, e aponta a continuidade expressiva nos mtodos e comportamentos
ao longo da histria russa. Mesmo em momentos polticos bastante distintos,
como no caso da descentralizao e enfraquecimento durante o governo de Boris
Yeltsin e no fortalecimento e centralizao da era Putin, o padro de atuao
bastante recorrente. Segundo o autor, portanto, os desafios ainda so grandes em
termos de institucionalizao, do estabelecimento de controles democrticos e
de uma conduta condizente com a preservao dos direitos humanos.
O captulo trs, de Alexandre Arciniegas Carreo, prope uma reflexo
sobre a irredutibilidade da segurana nacional e as tenses inevitveis entre
segurana coletiva/segurana individual e segredo/transparncia, atravs da
anlise das instituies de inteligncia da Colmbia. O autor descreve como as
complexidades da sociedade colombiana influenciam diretamente a agncia
de inteligncia, a qual se v muitas vezes como instrumento de interesses
especficos, minada pela corrupo e pelo patrimonialismo. Nesse sentido, ele
defende uma reforma no setor de inteligncia que consiga superar esta situao
delicada, e coloque a inteligncia colombiana em posio de cumprir seu papel
enquanto tal.
Nos captulos quatro e cinco, Mamadou Alpha Diallo e Igor Castellano,
respectivamente, analisam os casos da Nigria e da Repblica Democrtica
do Congo, demonstrando os desafios no apenas da institucionalizao dos
servios de inteligncia e segurana na frica, mas seu papel no delicado
processo de construo do Estado. A difcil equao entre o passado colonial e o
estabelecimento do monoplio do uso da fora, muitas vezes ainda no atingida
no continente africano, se combina com os dilemas prprios dos sistemas de
inteligncia e segurana tornando estes processos ainda mais complexos.
Contudo, se por um lado estes dilemas esto na pauta diria dos pases africanos,
por outro, o esvaziamento das funes de inteligncia e segurana tambm pode
ser complicado, uma vez que, como demonstra Castellano no caso da RDC,
estes rgos podem ser ilhas de capacidade estatal em um mar de ineficcia
e inao. Nesse sentido, o equilbrio parece encontrar grandes obstculos nos
pases africanos.
Terminados os estudos de caso, tem incio a Parte II do livro, que rene
trabalhos tericos a respeito dos novos desafios enfrentados pelas atividades
de inteligncia no mundo contemporneo. No captulo 6, Nathaly Xavier trata
do papel da inteligncia nas Operaes de Paz da ONU no ps-Guerra Fria. A
autora demonstra como, em um contexto de ampliao quantitativa e qualitativa
das operaes de paz da ONU, as atividades de inteligncia so cada vez mais
necessrias para o sucesso das misses. Por meio do estudo de alguns casos,

%RRNB,QW*RYHUQDPHQWDOLQGE 
fica clara a tenso entre a necessidade da inteligncia, de um lado, e o carter
multinacional das Naes Unidas, de outro. Como parte de conflitos armados,
a inteligncia fundamental para o sucesso de operaes e sua ausncia muitas
vezes compromete o sucesso das operaes, como no caso de Srebrenica. Por
outro lado, os pases membros relutam em ceder suas prerrogativas soberanas
e a prpria ONU no atua com a mesma liberdade que os Estados nacionais,
no admitindo, por exemplo, a obteno de informaes por meios ilegais ou
antiticos. Nesse sentido, a autora tenta identificar como os novos desafios
colocados pelo ps-Guerra Fria geraram mudanas institucionais na organizao
internacional.
No Captulo 7, Marlia Bortoluzzi Severo problematiza os conceitos de
propaganda, inteligncia e operaes encobertas, demonstrando ao leitor como
o componente informao presente nestes conceitos permite que se considere
propaganda como pertencente ao mbito das operaes de inteligncia.
Atividade h sculos largamente utilizada por governos dos mais diversos tipos,
a propaganda instrumento de persecuo de interesses nacionais. Segundo
a autora, o captulo se prope a investigar onde se encaixam os meios de
propaganda e de mdia nas atividades de inteligncia, desfazendo a confuso
conceitual em torno do termo propaganda e mostrando que tal instrumento
no constitui uma operao informacional do tipo operao psicolgica, mas
sim do tipo operao encoberta.
No captulo 8, Fabrcio vila demonstra como as novas tecnologias e o
processo de digitalizao tm impactado diretamente o sistema internacional
por meio de dois fenmenos. Em primeiro lugar, o barateamento dos custos faz
com que mais pases tenham acesso a determinadas capacidades, o que aumenta
a possibilidade de um balanceamento sistmico. Em segundo lugar, essas novas
tecnologias tm impactado diretamente nas capacidades de IMINT, por meio da
gerao e disponibilizao de imagens de satlite. Essas, por sua vez, no apenas
cumprem seu papel clssico como atividade de inteligncia, no fornecimento
de informao para a tomada de deciso, mas tambm influenciam diretamente
a opinio pblica a respeito de conflitos internacionais. Nesse sentido, o autor
demonstra, atravs do caso recente do Iraque, da tenso com o Ir e a Coria de
Norte e tambm de tenses mais profundas como aquelas entre Estados Unidos,
China e Rssia, como a IMINT e a digitalizao vm transformando e sendo
transformadas nas ltimas dcadas.
No captulo 9, Marcos Carra discorre sobre a utilidade da Teoria dos Jogos
para as atividades de inteligncia. Alm de discorrer sobre a teoria dos jogos em
si, o autor demonstra que, de um lado, a teoria dos jogos pode auxiliar o tomador
de decises, contribuindo diretamente para as atividades de inteligncia. Atravs
da teoria dos jogos, possvel compreender melhor a natureza do jogo, as
motivaes dos rivais e as aes e reaes dos competidores antes de desenvolver

%RRNB,QW*RYHUQDPHQWDOLQGE 
e implementar sua prpria estratgia. Contudo, o autor alerta que, por outro
lado, a aplicao da Teoria dos Jogos enfrenta diversos problemas, desde a
matematizao at a definio de alguns pressupostos caros a esta teoria, como
o da maximizao dos ganhos e o do comportamento racional.
No Captulo 10, Christiano Ambros colabora como uma interessante
discusso a respeito dos vieses cognitivos na tomada de deciso. As atividades
de inteligncia, cujo objetivo reside no fornecimento de informao para a
tomada de deciso, precisam levar em considerao esses possveis vieses,
como demonstra o autor. Embora sejam de difceis deteco e preveno, pois
intrnsecos e automticos na mente humana, o conhecimento a seu respeito
fundamental, para que a deciso seja ainda mais bem embasada. Alm disso, o
autor analisa a forma pela qual as emoes interferem diretamente na tomada
da deciso outro fator profundamente relevante nas atividades de inteligncia,
visto o stress e a presso sob os quais atuam os consumidores de inteligncia.
Por fim, no captulo 11, Jussara de Oliveira Machado, retoma o tema das
tecnologias digitais abordado no captulo 8, porm sob uma nova perspectiva
talvez um dos desafios contemporneos mais iminentes para a inteligncia e a
humanidade como um todo: as ameaas provenientes do ciberespao. A autora
mostra como a inteligncia enfrentar obstculos ainda mais complexos que
aqueles prprios de sua natureza, com o aumento do volume de informao, a
dificuldade de rastrear responsveis, o anonimato e as guerras no-declaradas,
alm das novas possibilidades de terrorismo por meio de sua verso ciberntica.
Ainda, restam intactos os dilemas da legitimidade e da privacidade. A ciberntica
traz novos desafios para a sociedade como um todo, mas principalmente para
aqueles que tm de encontrar informaes confiveis e abrangentes em um mar
de incerteza e anonimato.
Este livro, portanto, tenta suprir algumas lacunas na rea de inteligncia
governamental de duas formas: analisando casos significativos de uma perspectiva
institucional, de um lado, mas tambm casos normalmente deixados de lado e
sobre os quais o pesquisador tem dificuldades de encontrar informaes; e, em
segundo lugar, trazendo discusses tericas a respeito do papel da inteligncia
no sculo XXI e os novos desafios a serem enfrentados por ela, para alm de sua
prpria complexidade intrnseca.

Marco Cepik
Organizador da obra

%RRNB,QW*RYHUQDPHQWDOLQGE 
LISTA DE SIGLAS
E ACRNIMOS

As siglas e acrnimos utilizados ao longo do livro seguem a forma mais


comum pelos quais os rgos e conceitos so conhecidos no Brasil. Assim, por
exemplo, a Agncia Central de Inteligncia dos Estados Unidos da Amrica
aparece registrada sob a sigla CIA e no ACI. Quando for possvel ou necessrio
para auxiliar a compreenso, registra-se tambm o termo por extenso em lngua
estrangeira entre parnteses.

ABIN Agncia Brasileira de Inteligncia.


ACP frica, Caribe e Pacfico.
AFDL Aliana das Foras Democrticas para Libertao do Congo-Zaire
(Alliance de Forces Democratique pour la Liberation du Congo-Zaire)
AID Agncia para o Desenvolvimento Internacional (Agency for International
Development) (organismo do Banco Mundial)
ANC Exrcito Nacional Congols (Arme Nationale Congolaise)
AND Agncia Nacional de Documentao Congolesa (Agence Nationale de
Documentation)
ANI Agncia Nacional de Imigrao do Congo(Agence Nationale
dImmigration)
ANI Agncia Nacional de Inteligncia (Chile)
ANI Agncia Nacional de Inteligncia (Nigria)
ANP Academia Nacional de Polcia (Brasil)
ANR Agncia Nacional de Informao da Repblica Democrtica do Congo
(Agence Nationale de Renseignements)
AOF frica Ocidental Francesa.
AOFI Associao Nacional dos Oficiais de Inteligncia (Brasil)
AR Assemblia da Repblica (Portugal)
ARENA Aliana Renovadora Nacional (Brasil)
ASAT Arma Anti-satlite (Anti-satellite weapon)
AWAC Sistema Aerotransportado de Alerta e Controle (Airborne Early Warning
and Control)
C2W Guerra de Comando e Controle (Command and Control Warfare)
CA Operaes Encobertas (covert actions)
CAE Comisso de Assuntos Econmicos (Brasil).
CCAI Comisso Mista de Controle das Atividades de Inteligncia (Brasil)
CDN Conselho de Defesa Nacional (Brasil)
CEDEAO Comunidade Econmica dos Estados da frica Ocidental
(Communaut conomique des tats de lAfrique de lOuest)

%RRNB,QW*RYHUQDPHQWDOLQGE 
CENIMAR Centro de Informaes da Marinha (Brasil)
CERT Centro de Estudos, Resposta e Tratamento de Incidentes de Segurana
no Brasil
CETS Sistema de Rastreamento de Explorao Infantil (Child Exploitation
Tracking System)
CGT Confederao Geral do Trabalho (Portugal)
CIA Agncia Central de Inteligncia dos Estados Unidos da Amrica (Central
Intelligence Agency)
CIE Centro de Informaes do Exrcito (Brasil)
CIM Centro de Inteligncia da Marinha (Brasil)
CISA Centro de Informaes de Segurana da Aeronutica (Brasil)
CMC Comunicaes Mediadas por Computador
CND Centro Nacional de Documentao Congols (Centre Nationale de
Documentation)
CNDP Congresso Nacional para a Defesa do Povo da Repblica Democrtica
do Congo (Congrs national pour la dfense du peuple)
CNE Explorao de Redes de Computador (Computer Network Exploitation)
CNI Infraestruturas Crticas Nacionais (Critical National Infrastructure)
CNI Conselho Nacional de Inteligncia da Espanha (Consejo Nacional de
Inteligencia)
CNJ Conselho Nacional de Justia (Brasil)
CNMP Conselho Nacional do Ministrio Pblico (Brasil)
CNO Operaes de Redes de Computadores (Computer Network Operations)
CNS Gabinete de Coordenao de Segurana Nacional da Nigria.
COAF Conselho de Controle de Atividades Financeiras (Brasil)
CODI Centros de Operaes de Defesa Interna (Brasil)
COPEI Coordenao Geral de Pesquisa e Investigao (Brasil)
CSE Conselho de Segurana do Estado (Congo)
CSI Conselho Superior de Informaes (Portugal)
CSIS Centro de Estudos Estratgicos e Internacionais (Center for Strategic &
International Studies)
CSN Conselho de Segurana Nacional (Zaire)
CSSI Superior de Segurana Interna (Portugal)
CHEKA Comisso Extraordinria Panrussa para o Combate da Contra-
revoluo, Sabotagem e Especulao
DAS Departamento Administrativo de Segurana da Colmbia (Departamento
Administrativo de Seguridad)
DAS 4 Direo de Servios Administrativos (Portugal)
DCAF Controle Democrtico das Foras Armadas (Geneva Centre for the
Democratic Control of Armed Forces)
DEMIAP Deteco Militar das Atividades Anti-Patriticas (congols)
(Dtection Militaire des activits Anti-Patrie)
DEOPS Departamentos Estaduais de Ordem Poltica e Social (Brasil)
DFS Departamento de Suporte das Naes Unidas (United Nations
Department of Field Support)

%RRNB,QW*RYHUQDPHQWDOLQGE 
DFSP Departamento Federal de Segurana Pblica (Brasil)
DGM Direo Geral de Migrao do Congo (Direction gnrale de migration)
DGS Direo Geral de Segurana (Portugal)
DI Departamento de Inteligncia (Brasil)
DIE Departamento de Inteligncia Estratgica (Brasil)
DIM Direo de Inteligncia Militar (Nigria)
DINFO Diviso de Informaes (Portugal)
DIP Departamento de Investigaes e Propaganda (Brasil)
DNS Sistema de Nomes de Domnio (Domain Name System)
DOD Departamento de Defesa norte-americano (Department of Defense)
DOI Destacamentos de Operaes de Informaes (Brasil)
DOPS Delegacia de Ordem Poltica e Social (Brasil)
DPA Departamento de Assuntos Polticos das Naes Unidas (United Nations
Department of Political Affairs)
DPF Departamento de Polcia Federal (Brasil)
DPKO Departamento de Operaes de Paz da ONU (Department of Peace
Keeping Operations)
DPRF Departamento de Polcia Rodoviria Federal (Brasil)
DPS Diviso de Polcia Poltica e Social (Brasil)
DRGS Direo de Informaes Gerais e Servios Especiais da Polcia da
Repblica Democrtica do Congo (Direction des Renseignements Gnraux
et Services Spciaux de la Police)
DSEF 3 Direo de Servios de Estrangeiros e Fronteiras (Portugal)
DSI 1 Direo de Servios de Informao (Portugal)
DSI Diviso de Segurana e Informaes (Brasil)
DSIC 2 Diviso de Servios de Investigao e Contencioso (Portugal)
DSIC Departamento de Segurana da Informao e Comunicaes (Brasil)
DSN Doutrina de Segurana Nacional (Brasil)
DSP Diviso Presidencial Especial do Zaire (Division Spciale Prsidentielle)
DTEC Departamento Tcnico (Portugal)
ECOMOG Grupo de Monitoramento da Comunidade Econmica dos Estados
dos Estados do Oeste Africano (Economic Community of West African States
Monitoring Group)
ECPS Comit Executivo para Paz e Segurana da ONU (Executive Committee
on Peace and Security)
EIS Sistema de Informao da Europol (Europol Information System)
ELINT Inteligncia Eletrnica (Eletronic Intelligence)
ELN Exrcito de Libertao Nacional da Colmbia (Ejrcito de Liberacin
Nacional de Colombia)
EMC-FA Estado-Maior Conjunto das Foras Armadas (Brasil)
EMGFA Estado-Maior-General das Foras Armadas (Portugal)
EMGRM Estado-Maior de Inteligncia Militar (congols) (Etat-Major gnral
du Renseignement militaire)
ENASP Nacional de Justia e Segurana Pblica (Brasil)

%RRNB,QW*RYHUQDPHQWDOLQGE 
ESG Escola Superior de Guerra (Brasil)
EUA Estados Unidos da Amrica
EUPOL Polcia da Unio Europia
EUROSUR Sistema Europeu de Vigilncia das Fronteiras Externas (European
External Border Surveillance System)
EW Guerra Eletrnica (Eletronic Warfare)
FAC Foras Armadas Congolesas
FAPSI Agncia Federal de Comunicao e Informao Governamental (URSS)
FARC Foras Armadas Revolucionrias da Colmbia
FARDC Foras Armadas da Repblica Democrtica do Congo (Forces Armes
de la Rpublique Democratique du Congo)
FAZ Foras Armadas Zairianas (Forces Armes Zaroises)
FDLR Foras Democrticas de Libertao de Ruanda
FNP Fora Nacional da Polcia (Nigria)
FPS Servio Federal das Fronteiras da Rssia (Federalnaya Pogranichnaya
Sluzhba)
FRONTEX Agncia Europeia de Gesto da Cooperao Operacional nas
Fronteiras Externas dos Estados-Membros da Unio Europeia (European
Agency for the Management of Operational Cooperation at the External
Borders of the Member States of the European Union)
FSB - Servio Federal de Segurana da Rssia (Federalnaya Sluzhba Bezopasnosti)
FSK Servio Federal de Contra-Espionagem da Rssia (Federalnaya Sluzhba
Kontrrazvedki)
FSNP Servio Federal de Polcia de Impostos da Rssia
FSO Servio de Proteo Federal da Rssia
FSS Foras e Servios de Segurana (Portugal)
GC Guarda Civil do Zaire (Garde Civile)
GIG Rede de Informao Global (Global Information Grid)
GKU Diretoria Principal de Controle do Kremlin (URRS)
GN Polcia Nacional do Zaire (Gendarmerie Nationale)
GNR Guarda Nacional Republicana (Portugal)
GON Grupo de Observao Nacional e Internacional da Colmbia (Grupo de
Observacin Nacional e Internacional)
GR Guarda Republicana da Repblica Democrtica do Congo (Garde
Rpublicaine)
GRU Servio de Inteligncia do Exrcito da Rssia (Glavnoye Razvedyvatelnoye
Upravleniye)
GSI Gabinete de Segurana Institucional (Brasil)
GSIPR Gabinete de Segurana Institucional da Presidncia da Repblica
(Brasil)
GUGB Chefia de Administrao de Segurana do Estado da Rssia (Glavnoye
Upravleniye Gosudasrtvennoy Bezopasnosti)
GUSP Diretoria Principal de Programas Especficos do Presidente da Rssia
HEWS Sistema de Alerta Humanitrio Antecipado (Humanitarian Early
Warning Service)

%RRNB,QW*RYHUQDPHQWDOLQGE 
HSPD23 - Diretiva Presidencial de Segurana Interna dos EUA (Homeland
Security Presidential Directive 23)
HUMINT Inteligncia Humana (Human Inteligence)
IBW Guerra Baseada na Inteligncia (Intelligence Based Warfare)
ICBM Mssil Balstico Intercontinental (Inter-Continental Ballistic Missile)
IEW Guerra de Informao Econmica (Informational Economic Warfare)
IGAI Inspeo-Geral da Administrao Interna (Portugal)
IMINT Inteligncia de Imagens (Imagery Intelligence)
INSS Instituto para Estudos de Segurana Nacional (Institute for National
Security Studies)
INTERPOL Organizao Internacional de Polcia Criminal (International
Criminal Police Organization.
IO Operaes Informacionais (Information Operations)
IPES Instituto de Pesquisas e Estudos Sociais (Brasil)
ISE Elemento de Suporte de Inteligncia (Intelligence Support Element)
IW Guerra de Informao (Information Warfare)
IWS Site sobre guerra informacional (The Information Warfare Site)
JAI Justia e Assuntos Internos (Portugal)
JCS Junta de Chefes de Pessoal dos EUA (Joint Chiefs of Staff)
JDISS Sistema de Suporte de Inteligncia Destacvel Conjunta (Joint
Deployable Intelligence Support System)
JMAC Centro de Anlise conjunta de Misses da ONU (Joint Mission Analysis
Center)
JSN Junta de Salvao Nacional (Portugal)
KGB Comit de Segurana do Estado (URSS) (Komitet Gosudasrtvennoy
Bezopasnosti)
LP Legio Portuguesa
LRA Exrcito de Resitncia do Lorde (Lords Resistance Army)
MAD Destruio Mtua Assegurada (Mutual Assured Destruction)
MAI Ministrio da Administrao Interna (Nigria)
MAI Ministrio da Administrao Interna (Portugal)
MB Ministrio da Segurana (Rssia)
MDB Movimento Democrtico Brasileiro
MFA Movimento das Foras Armadas (Portugal)
MILDEC Dissimulao Militar (Military Deception)
MINUSTAH Misso das Naes Unidas para Estabilizao do Haiti (United
Nations Stabilization Mission in Haiti)
MIPONUH Misso de Polcia Civil das Naes Unidas no Haiti (United Nations
Civilian Police Mission In Haiti)
MONUC Misso das Naes Unidas para Organizao e Estabilizao
na Repblicia Democrtica do Congo (United Nations Organization
Stabilization Mission in the Democratic Republic of the Congo)
MPS Servio de Planejamento Militar da ONU (Military Planning Service)
MSB Servio Inter-republicano de Segurana (Rssia)

%RRNB,QW*RYHUQDPHQWDOLQGE 
MVD Ministrio do Interior da Rssia (Ministerstvo Vnutrennikh Del)
NCP Polcia da Costa do Nger (Niger Coast Police) (Nigria no perodo
colonial)
NEPAD Nova Parceria pelo Desenvolvimento (Nigria)
NF-E Nota Fiscal Eletrnica
NKGB Comissariado do Povo para a Segurana do Estado (URSS) (Narodnyy
Komitet Gosudasrtvennoy Bezopasnosti)
NKVD Comissariado dos Assuntos Internos do Povo (URSS) (Narodnyy
Komissariat Vnutrennikh)
NPC Conselho de Polcia da Nigria (Nigeria Police Council)
NPF Foras da Polcia Nigeriana
NPS Escola de Ps-graduao Naval (Naval Postgraduate School; Monterey,
California, EUA)
NSPD-54 Diretiva Presidencial de Segurana Nacional dos EUA (National
Security Presidential Directive 54)
OCHA Escritrio para Coordenao de Questes Humanitrias das Naes
Unidas (United Nations Office for the Coordination of Humanitarian Affairs)
OGPU Administrao Unida da Polcia Estatal (URSS) (Obyedinennoye
Gosudarstvennoy Politicheskie Upravlenyie)
OMA Escritrio de Assuntos Militares da ONU (Office for Military Affairs)
ONS/NSO Organizao Nigeriana de Segurana (Nigerian Security
Organization)
OPEP Organizao dos Pases Exportadores de Petrleo
OPSEC Operaes de segurana (Operations Security)
OSINT Inteligncia de Fontes Abertas (Open Source Intelligence)
OTAN Organizao do Tratado do Atlntico Norte
OUA Organizao da Unio Africana
PCB Partido Comunista Brasileiro
PCP Partido Comunista Portugus
PDA Polo Democrtico Alternativo
PDN Poltica de Defesa Nacional (Brasil)
PDS Partido Democrtico Social (Brasil)
PDSD Poltica de Defesa e Segurana Democrtica da Colmbia (Poltica de
Defensa y Seguridad Democrtica)
PFL Partido da Frente Liberal (Brasil)
PFS Polcia Federal de Segurana (Brasil)
PIAPS Plano de Integrao e Acompanhamento dos Programas Sociais de
Preveno da Violncia (Brasil)
PIDE Polcia Internacional de Defesa do Estado (Portugal)
PMDB Partido do Movimento Democrtico Brasileiro
PNC Polcia Nacional Congolesa (Police Nationale Congolaise)
PSDB Partido da Social Democracia Brasileira
PSP Polcia de Segurana Pblica (Portugal)
PSYOP Operaes Psicolgicas (Psychological Operations)

%RRNB,QW*RYHUQDPHQWDOLQGE 
PT Partido dos Trabalhadores (Brasil)
PVDE Polcia de Vigilncia e Defesa do Estado (Portugal)
RDC Repblica Democrtica do Congo
RNC Royal Nger Company (Nigria perodo colonial)
RNCP Royal Nger Company Police (Nigria perodo colonial)
SAC Comando Areo Estratgico dos EUA (US Strategic Air Comand)
SADEN Secretaria de Assuntos de Defesa Nacional (Brasil)
SAE Secretaria de Assuntos Estratgicos (Brasil)
SAP Setor Especial da Polcia Sul-africana (Special Branch of the South Afican
Police)
SARM Servio de Ao e de Informao Militar do Zaire (Service dAction et de
Renseignements Militaire)
SCI Servio Central de Investigao (Portugal)
SDCI Servio Diretor e Coordenador de Informao (Portugal)
SECINT Secretaria de Inteligncia (Brasil) (Aeronutica)
SENAD Secretaria Nacional Antidrogas (Brasil)
SENASP Secretaria Nacional de Segurana Pblica (Brasil)
SFICI Servio Federal de Informaes e Contra-Informaes (Brasil)
SGSSI Secretrio-Geral do Sistema de Segurana Interna (Portugal)
SI Servios Internacionais (Portugal)
SIC Servio de Inteligncia Colombiano (Servicio de Inteligencia Colombiano)
SIED Servio de Informaes Estratgicas de Defesa (Portugal)
SIEDM Servio de Informaes Estratgicas de Defesa e Militares (Portugal)
SIGINT Inteligncia de Sinais (Signals Intelligence)
SIN Servio de Inteligncia Nacional da Colmbia (Servicio de Inteligencia
Nacional)
SINAI Sistema Nacional de Inteligncia da Colmbia (Sistema Nacional de
inteligencia)
SINDE Subsistema de Inteligncia de Defesa (Brasil)
SIRP Sistema de Informaes da Repblica Portuguesa
SIS Servio de Informaes de Segurana (Portugal)
SISBIN Sistema Brasileiro de Inteligncia (Brasil)
SISC Sistema de Segurana e Credenciamento (Brasil)
SISNI Sistema Nacional de Inteligncia (Brasil)
SISP Subsistema de Inteligncia de Segurana Pblica (Brasil)
SISSEGIN Sistema de Segurana Interna (Brasil)
SM Segurana Militar do Congo (Scurit Militaire)
SMI Servio de Informaes Militares (Portugal)
SN Segurana Nacional do Congo (Sret Nationale)
SNI Servio Nacional de Informao (Brasil)
SNIP Servio Nacional de Inteligncia e Proteo Congols (Service Nationale
dInteligence e Protection)
SPEAI Secretrio de Poltica, Estratgia e Assuntos Internacionais do
Ministrio da Defesa (Brasil)

%RRNB,QW*RYHUQDPHQWDOLQGE 
SRF Secretaria da Receita Federal (Brasil)
SRM Servio de Informao Militar da Repblica Democrtica do Congo
(Service de Renseignement Militaire)
SSI Sistema de Segurana Interna (Portugal)
SSR Reforma do Setor de Segurana (congols)
SSS Servio de Segurana do Estado (Nigria) (State Security Service)
STF Supremo Tribunal Federal (Brasil)
SVR Servio de Inteligncia Estrangeira da Rssia (Sluzhba Vneshney Razvedki)
UA Unio Africana
UAV Veculo areo no tripulado (Unmanned Aerial Vehicle)
UE Unio Europia
UNITAF Fora Tarefa Unificada das Naes Unidas (United Task Force)
UNMIH Misso das Naes Unidas no Haiti (United Nations Mission in Haiti)
UNMIK Misso das Naes Unidas para Administrao Provisria do Kosovo
(United Nations Interim Administration Mission in Kosovo)
UNOSOM Operao das Naes Unidas na Somlia (United Nations Operation
in Somalia)
UNPROFOR Fora de Proteo das Naes Unidas (United Nations Protection
Force)
UNSC Conselho de Segurana das Naes Unidas (United Nations Security
Council)
UNSMIH Misso de Suporte das Naes Unidas no Haiti (United Nations
Support Mission In Haiti)
UNTMIH Misso de Transio das Naes Unidas no Haiti (United Nations
Transition Mission In Haiti)
URSS Unio das Repblicas Socialistas Soviticas
USIA Agncia de Informao dos Estados Unidos (United States Information
Agency)
WMD Arma de Destruio em Massa (Weapon of Mass Destruction)

%RRNB,QW*RYHUQDPHQWDOLQGE 
SUMRIO
Parte I
CASOS NACIONAIS

CAPTULO 1 OS SERVIOS DE INTELIGNCIA E DE SEGURANA


INTERNA NO BRASIL E EM PORTUGAL................................................. 3
1.1. A Evoluo dos Servios de Inteligncia e de Segurana em Portugal ........ 7
1.1.1. A polcia poltica em Portugal durante o Salazarismo ..................... 7
1.1.2. O 25 de Abril de 1974 e a Transio para Democracia em
Portugal ....................................................................................................... 11
1.2 . Os Servios de Segurana e Inteligncia no Brasil at a
Redemocratizao ...................................................................................... 15
1.2.1. A liberalizao poltica e as divises da comunidade de
segurana ................................................................................................... 19
1.2.2. A presidncia Sarney e o Servio Nacional de Informaes
(1985-1990) .................................................................................................. 24
1.3. A Configurao Atual do Sistema de Inteligncia em Portugal................... 27
1.4. A Trajetria do Sistema de Inteligncia do Brasil aps a Democratizao ..29
1.5. Consideraes Finais...................................................................................... 38
Referncias ...................................................................................................... 43

CAPTULO 2 OS SERVIOS DE INTELIGNCIA RUSSOS APS 1991 ........ 47


2.1. A Tradio dos Servios de Segurana na Rssia ......................................... 48
2.2. Da Reestruturao Ps-URSS: Perodo Yeltsin ............................................ 53
2.3. Os Servios de Segurana na Era Putin ......................................................... 55
2.3.1. O Fortalecimento do FSB (Federalnaya Sluzhba Bezopasnosti) .. 57
2.3.2. O SVR (Sluzhba Vneshney Razvedki) ............................................... 60
2.3.3. O GRU (Glavnoye Razvedyvatelnoye Upravleniye) ........................ 62
2.3.4. rgos do Departamento de Defesa da Federao que Possuem
Sees Prprias de Inteligncia ................................................................ 63
2.3.4.1. Servio de Proteo Federal (FSO - Federalnaya
Sluzhba Okhrany). ........................................................................... 63
2.3.4.2. Unidades com Destinao Especial (Spetsnaz) das
Tropas Interiores ............................................................................... 64
2.4. A Continuidade no Governo Medvedev........................................................ 64
2.5. Os servios de Inteligncia e a Poltica Externa Russa................................. 66
Consideraes Finais ............................................................................................ 69
Referncias ...................................................................................................... 70

%RRNB,QW*RYHUQDPHQWDOLQGE 
CAPTULO 3 INTELIGENCIA EN DEMOCRACIAS:
LA CRISIS DEL SERVICIO DE INTELIGENCIA COLOMBIANO ........... 73
3.1. La reforma de Inteligencia y el dilema entre poliarqua y seguridad
nacional ....................................................................................................... 74
3.2. El Departamento Administrativo de Seguridad (DAS) ................................ 78
Consideraciones Finales ....................................................................................... 85
Referncias ...................................................................................................... 86

CAPTULO 4 INTELIGNCIA E SEGURANA REGIONAL NA FRICA


OCIDENTAL: O CASO DA NIGRIA ...................................................... 91
4.1. Evoluo poltica da Nigria .......................................................................... 92
4.2. Segurana regional na frica Ocidental: papel da Nigria .......................... 95
4.3. Servio de inteligncia da Nigria ............................................................... 101
4.5. Consideraes Finais.................................................................................... 112
Referncias .................................................................................................... 112

CAPTULO 5 REFORMA DA INTELIGNCIA NA RDC: DIREITOS


INDIVIDUAIS E CONSTRUO DO ESTADO ..................................... 115
5.1. Construo do Estado e Servios de Inteligncia no caso africano ......... 116
5.2. A Coero Interna e os Servios de Inteligncia na RDC .......................... 119
5.3. Foras de Segurana e Inteligncia na Crise do Congo (1960-1965) ........ 121
5.4. Foras de Segurana e de Inteligncia no Regime de
Mobutu (1965-1997) ................................................................................. 124
5.5. Foras de Segurana e Inteligncia sob Laurent Kabila (1997-1998) ....... 128
5.6. Foras de Segurana e Servio de Inteligncia sob Joseph Kabila (2001) ... 131
5.7. Reforma da Inteligncia: a experincia das Foras Armadas e Policiais ....135
5.8. Consideraes Finais.................................................................................... 141
Referncias .................................................................................................... 142

Parte II
DESAFIOS CONTEMPORNEOS

CAPTULO 6 INTELIGNCIA E OPERAES DE PAZ DA ONU


NO PS-GUERRA FRIA ....................................................................... 149
6.1. Conceituao das atividades de inteligncia e a ONU .............................. 150
6.2. O Papel da Inteligncia nas Operaes de Paz ........................................... 153
6.3. As demais atividades de inteligncia no mbito da ONU ......................... 156

%RRNB,QW*RYHUQDPHQWDOLQGE 
6.4. Algumas Experincias anteriores e a MINUSTAH ..................................... 162
6.5. Consideraes Finais.................................................................................... 165
Referncias .................................................................................................... 166

CAPTULO 7 PROPAGANDA: OPERAO PSICOLGICA OU


OPERAO ENCOBERTA? .................................................................. 169
7.1. Inteligncia, operaes encobertas e operaes informacionais ............ 170
7.2. Uma impresso positiva das tcnicas de propaganda .............................. 173
7.3. Operaes psicolgicas: mais uma forma de propaganda? ...................... 176
7.4. A propaganda como operao encoberta .................................................. 179
7.5. Concluso...................................................................................................... 181
Referncias .................................................................................................... 182

CAPTULO 8 INTELIGNCIA E DISSUASO: IMINT E LEGITIMAO .... 185


8.1. Deterrence e a estabilidade estratgica ...................................................... 187
8.3. Deterence e preveno de conflitos ............................................................ 191
8.4. Compellence e apoio poltico ...................................................................... 193
8.5. Dissuasion e a ameaa do ataque preemptivo ........................................... 196
8.6. Concluso...................................................................................................... 199
Referncias .................................................................................................... 201

CAPTULO 9 TEORIA DOS JOGOS E INTELIGNCIA ............................... 205


9.1. As Origens da Teoria dos Jogos .................................................................... 206
9.2. Os Fundamentos da Teoria dos Jogos ......................................................... 208
9.3. Aplicando a Teoria dos Jogos na Inteligncia ............................................. 212
9.3.1 As Primeiras Aplicaes na rea de Inteligncia ........................... 213
9.3.2 O Quadro Atual: Problemas e Perspectivas.................................... 215
9.4. Concluso...................................................................................................... 230
Referncias .................................................................................................... 231

CAPTULO 10 ANLISES DE INTELIGNCIA: AMBIENTE,


PERCEPO, EMOO E NEUROCINCIA ....................................... 233
10.1. O Ambiente da Anlise de Inteligncia ..................................................... 235
10.2. Percepo, Julgamentos e Distores Cognitivas .................................... 239
10.3. Racionalidade Limitada, Percepo Ativa e Vieses Cognitivos ............... 240
10.4. Crenas e Imagens ...................................................................................... 243
10.5. Expectativa e Contexto nos Modelos Mentais.......................................... 244
10.6. Teoria dos Esquemas e Analogias Interpretativas .................................... 245

%RRNB,QW*RYHUQDPHQWDOLQGE 
10.7. Espelhamento de Imagem na Anlise de Inteligncia ............................ 249
10.8. Fechamento Cognitivo Prematuro ............................................................ 251
10.9. Sobre Explicaes Causais, Iluso de Controle e Atribuio de Culpa .. 254
10.10. Teoria da Atribuio ................................................................................. 257
10.10.1. Emoes e Neurocincia na Tomada de deciso e Anlise de
Informaes .............................................................................................. 260
10.11. Teoria da Inteligncia Afetiva e Teoria do Raciocnio Motivado ........... 262
10.12. Emoes e Neurocincia no Processamento de Informaes .............. 263
10.13. Concluso.................................................................................................. 265
Referncias .................................................................................................... 266

CAPTULO 11 INTELIGNCIA E CIBERESPAO: DESAFIOS


DO SCULO XXI .................................................................................. 271
11.1. Ciberespao e seus atores: Breves Conceitos ........................................... 274
11.2. Funes da cibersegurana e funes da inteligncia no ciberespao.. 279
11.3. Principais ameaas para a inteligncia no ciberespao .......................... 284
11.4. Principais Desafios da Inteligncia no Ciberespao................................ 292
11.5. Concluso.................................................................................................... 309
Referncias .................................................................................................... 309

%RRNB,QW*RYHUQDPHQWDOLQGE 
P A R

I
T E
I
CASOS NACIONAIS

%RRNB,QW*RYHUQDPHQWDOLQGE 
%RRNB,QW*RYHUQDPHQWDOLQGE 
&DStWXOR

266(59,d26'(,17(/,*1&,$
('(6(*85$1d$,17(51$
12%5$6,/((032578*$/

Carlos S. Arturi e Jlio C. Rodriguez

Este captulo analisa, sob uma perspectiva comparada, o desenvolvimento


das instituies de inteligncia e de segurana pblica de Portugal e do Brasil, a
partir do incio de seus processos de democratizao, em meados da dcada de
1970. O interesse na comparao advm de uma semelhana fundamental para
nosso trabalho: as transies de regime em ambos os pases integram as trs
dezenas de casos semelhantes que formam a terceira onda de democratizaes
(HUNTINGTON, 1991). O fato de terem iniciado a mudana de regime no
mesmo momento histrico facilita a comparao do desenvolvimento dos
rgos de inteligncia e de segurana interna durante a consolidao da
democracia. A comparao permitir igualmente qualificar melhor algumas
hipteses que relacionam o tipo de regime anterior e o modo de transio
como variveis explicativas para os constrangimentos consolidao dos
novos regimes democrticos, particularmente, aqueles dilemas que se referem
institucionalizao dos servios de inteligncia e de segurana pblica, com
legitimidade e sob controle democrtico.1
Compartilhamos a premissa, explicitada por diversos pesquisadores
(BRANDO, 2002; CEPIK & BRANDO, 2003; CEPIK, 2003, 2005, 2009;
NUMERIANO, 2010; BRANDO, 2010; MENDONA, 2010; PINTO, 2010), de que
servios de inteligncia e de segurana interna institucionalizados, legitimados
e eficazes so fundamentais para que os regimes democrticos cumpram as

 (VWHFDSWXORFRQWRXFRPDYDOLRVDFRODERUDRGRVDOXQRV-RDQD2OLYHLUDGH2OLYHLUDH)HUQDQGR


3UHXVVHU GH 0DWWRV UHVSHFWLYDPHQWH EROVLVWDV GH ,QLFLDR &LHQWILFD GD )XQGDR GH $PSDUR 
3HVTXLVD GR (VWDGR GR 5LR *UDQGH GR 6XO )$3(5*6  H GR &RQVHOKR 1DFLRQDO GH 3HVTXLVD H
'HVHQYROYLPHQWR7HFQROJLFR &13T 

%RRNB,QW*RYHUQDPHQWDOLQGE 
funes essenciais de manter a ordem interna, a soberania do pas e a eficcia
na formulao de polticas de segurana pblica. O problema crucial do tema
em anlise a tenso, sempre existente nos regimes democrticos, entre as
funes coercitivas dos rgos de segurana pblica e as liberdades e direitos
civis dos cidados, bem como entre as necessidades do segredo das funes de
inteligncia e os controles democrticos de suas atividades. Estes dilemas so
particularmente importantes para aqueles pases que saram de longos perodos
ditatoriais, como Portugal e Brasil (CEPIK, 2005:68-69).
Com efeito, nos pases da terceira onda de democratizaes, seus atuais
rgos de inteligncia e de segurana interna so, frequentemente, herdeiros ou
mera continuao daqueles que operavam durante as ditaduras, estreitamente
vinculados aos imperativos da represso poltica e das contingncias da Guerra
Fria; ao contrrio, nas democracias mais tradicionais, os servios de inteligncia
desenvolveram-se primordialmente sob a forte influncia da diplomacia e da
guerra (CEPIK, 2003). Assim, o amlgama entre segurana pblica e segurana
nacional, bem como entre inimigo externo e interno, impregnou os passos iniciais
da institucionalizao dos servios de inteligncia e de manuteno da ordem
interna na maioria dos pases recentemente democratizados, muitas vezes com
efeitos deletrios para as liberdades civis.
Uma das teses de path-dependency mais difundidas na literatura
especializada (ODONNELL, 1988) sobre transies para democracia, argumenta
que quanto maior apoio poltico auferisse o regime autoritrio no incio da
transio, mais gradual e controlado seria este processo e, portanto, maiores
seriam as dificuldades de consolidao da democracia, em virtude da presena
de resduos autoritrios no novo regime. Embora, para Share e Mainwaring
(1988), a maneira pela qual a democracia instalada no determine totalmente
seu desenvolvimento posterior, as condies iniciais do novo regime estabelecem
as regras do jogo, as modalidades de interao e os limites ao comportamento
dos atores e s mudanas polticas. No que concerne ao estudo dos servios de
inteligncia e de segurana pblica aps a terceira onda de democratizao,
examinados neste captulo, a perspectiva analtica da path-dependency foi
igualmente muito utilizada, explcita ou implicitamente, em valiosos estudos
comparados (CEPIK, 2005; NUMERIANO, 2010; BRANDO, 2010; MENDONA,
2010; PINTO, 2010). Todavia, difcil discernir a real influncia das diversas
variveis explicativas deste modelo, como argumentaremos ao longo do captulo.
Nesse sentido, os dilemas afrontados pelos regimes democrticos,
decorrentes de transies pactuadas, constituem-se de obstculos polticos
que, ou originaram-se deste modo de transio, ou constituam caractersticas
tradicionais do sistema poltico, e que foram reforados pelo processo de
democratizao gradual e controlado pelos dirigentes autoritrios. Este foi o

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
caso do Brasil, mas no o de Portugal. Entender as causas desta dessemelhana
fundamental permitir melhor compreender os casos singulares em estudo
(BADIE & HERMET, 1990).
As principais semelhanas entre os casos portugus e brasileiro
consistem no fato de que as organizaes de inteligncia e de segurana
pblica concentraram-se, primordialmente, durante as respectivas ditaduras,
na represso oposio poltica, o que torna especialmente problemtica sua
legitimao nos novos regimes democrticos. As divergncias entre ambos os
pases so, entretanto, mais numerosas. Em Portugal, no perodo salazarista,
houve as guerras coloniais, uma revoluo com ruptura entre o antigo e o novo
regime, a descolonizao, bem como a insero do pas na Unio Europeia aps
a redemocratizao. Desta insero decorreram reformas de sua organizao
da segurana interna que afastaram a tutela militar e, posteriormente, se
enquadraram nas respostas polticas aos atentados terroristas perpetrados
na Europa aps aqueles de 11 de Setembro de 2001 nos Estados Unidos. Essas
reformas visam a promover maior cooperao interestatal para a segurana
regional. Portanto, a institucionalizao dos servios de inteligncia portugueses
est solidamente implantada nas regras do regime democrtico, sob coordenao
civil e controle parlamentar.
Por sua vez, o Brasil vivenciou uma transio negociada sob controle
dos dirigentes autoritrios, que resultou em um regime democrtico com alta
continuidade poltica, prerrogativas militares muito importantes e baixo controle
civil sobre as organizaes de inteligncia e segurana. Estas caractersticas,
associadas incipiente capacidade estatal para garantir os direitos dos cidados e
ao estigma de polcia poltica granjeado pelos servios de inteligncia do passado,
dificultam sobremaneira a legitimao e a institucionalizao do sistema de
informaes e de segurana do pas no novo regime democrtico, apesar das
importantes reformas realizadas nos ltimos anos para aperfeio-los (CEPIK,
2009; BRANDO, 2010; MENDONA, 2010).
A questo que buscamos responder, portanto, em que medida os atuais
regimes democrticos de Portugal e Brasil conseguiram equacionar e/ou resolver
estes dilemas e tenses entre segurana e liberdade? Como esto constitudos
e atuam seus sistemas de inteligncia e de segurana interna? Qual o padro
estabelecido das relaes entre civis e militares? Qual o grau de controle poltico
democrtico sobre as organizaes de inteligncia e de segurana? Os limites,
atribuies, os mandatos legais e a coordenao destes rgos esto claramente
definidos?
Nossa principal hiptese de que as principais variveis explicativas da
configurao e evoluo recente dos sistemas de inteligncia e de segurana nos
dois pases so: as caractersticas das ditaduras, o modo de transio poltica,

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
as mudanas ocorridas durante a consolidao da democracia, o desenho
institucional inicial destes rgos, a interao entre os diversos atores envolvidos
e suas escolhas estratgicas, bem como as relaes entre civis e militares. Essas
variveis possuem pesos diferenciados e incidem diferentemente na configurao
dos atuais servios de inteligncia, conforme a histria poltica de cada pas,
como argumentaremos ao longo do captulo, luz dos trabalhos realizados por
outros pesquisadores sobre o tema. Igualmente, este esforo analtico permitir
aquilatar o grau atual de institucionalizao e de legitimidade dos sistemas
portugueses e brasileiros de inteligncia e de segurana interna, luz da ainda
escassa, mas qualificada, literatura cientfica a respeito do tema nos dois pases.
Adotamos a definio de servios de inteligncia elaborada por Marco
Cepik, que enfatiza o carter estatal e conflituoso de suas funes, demarcando-
se de concepes excessivamente amplas e genricas:
(...) organizaes permanentes e atividades especializadas na coleta, anlise
e disseminao de informaes sobre problemas e alvos relevantes para a
poltica externa, a defesa nacional e a garantia da ordem pblica de um pas.
(...) So organizaes que desempenham atividades ofensivas e defensivas na
rea de informaes, em contextos adversariais em que um ator tenta compelir
o outro sua vontade. Nesse sentido, pode-se dizer que essas organizaes de
inteligncia formam, juntamente com as Foras Armadas e a polcia, o ncleo
coercitivo do Estado contemporneo (CEPIK, 2003:75-76).

Este trabalho aborda principalmente os servios nacionais de inteligncia


externa e de segurana interna (voltada crescentemente para atividades de
carter policial e de manuteno da ordem, para as novas ameaas e para a
luta antiterrorismo) e, em menor medida, de inteligncia militar e de estruturas
de cooperao regional e internacional. No caso do Brasil, federao cujos
estados possuem secretarias estaduais de segurana pblica que comandam
suas prprias polcias judicirias e ostensivas (polcias militares), o nvel estadual
tampouco ser priorizado na anlise.
Embora no seja objeto da anlise, as polticas de defesa militar sero
abordadas apenas quando incidirem sobre a segurana interna, atravs da
militarizao crescente da luta antiterrorista, da eroso da distino entre inimigo
interno e externo e da ateno devotada s denominadas novas ameaas
(criminalidade transnacional, imigrao ilegal, contestao internacional,
etc.). Ateno semelhante ser dedicada verticalizao das atividades de
inteligncia e de segurana, que formam sistemas nacionais e regionais, e sua
horizontalizao, criada pela expanso de organizaes especializadas. As fontes
de dados utilizadas na pesquisa so provenientes de documentos oficiais, de
material de imprensa e da bibliografia especializada.
O captulo est estruturado em duas partes principais: a primeira consiste
de uma descrio histrica do desenvolvimento das organizaes de inteligncia

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
e de segurana interna, desde sua origem at sua consolidao nas ditaduras de
Portugal e do Brasil. A segunda parte trata da configurao atual do sistema e
das organizaes de inteligncia, conforme elas se desenvolveram ao longo do
processo de democratizao at o final da primeira dcada do sculo XXI nos
dois pases. Finalmente, faremos algumas consideraes finais sobre o tema do
trabalho, em uma perspectiva comparativa.

 $(YROXomRGRV6HUYLoRVGH,QWHOLJrQFLDHGH6HJXUDQoD
HP3RUWXJDO
Em maio de 1926, um golpe militar iniciou o perodo ditatorial em Portugal,
o qual, com a ascenso de Salazar ao poder no incio dos anos 1930, se tornou
conhecido como Estado Novo ou, ainda, perodo Salazarista. A inteno dos
golpistas era promover a restaurao da ordem, tendo em vista a turbulncia
social e poltica do incio do sculo XX, propsito que amalgamou militares da
direita radical, monrquicos e, tambm, republicanos conservadores, e deu incio
ao processo de Revoluo Nacional. As grandes manifestaes da Confederao
Geral do Trabalho (CGT) em 1924 e 1925, bem como a atuao da legio
vermelha, simbolizam o cenrio de desordem poltica e social para os militares
golpistas. O primeiro perodo da ditadura teve como Presidente o General
Carmona (1926-1951). Contudo, aps disputas no interior do regime militar,
principalmente no mbito do chamado Reviralho, que provocou insurreies
em 1927, 1928 e 1931, o Ministro das Finanas, Antnio Salazar chega ao poder
para institucionalizar a ditadura e transform-la em Estado Novo (PINTO, 2000;
NUMERIANO, 2010; PALACIOS CEREZALES, 2008). Em 1933, apresentada uma
constituio que institucionaliza, enfim, o regime sob o comando de Antnio
Salazar. Esta constituio, apesar de apresentar formalidades liberais, colocava
o poder legislativo sob o comando do executivo e continha uma legislao de
carter repressivo, alm de suprimir controles sobre o governo. Salazar assumiu
o comando do Conselho de Ministros e, embora houvesse um presidente (Gen.
Carmona), quem chefiou o regime at 1968 foi o prprio Salazar.

$SROtFLDSROtWLFDHP3RUWXJDOGXUDQWHR6DOD]DULVPR
Durante o incio do perodo salazarista houve a produo do aparelho
repressivo do Estado, com sua reorganizao e ampliao (PALACIOS CEREZALES,
2008). Ainda com os acontecimentos do Reviralho vivos na memria, corpos
policiais (Polcia de Segurana Pblica - PSP e Guarda Nacional Republicana -
GNR) foram organizados, com reforo da lealdade e de suas funes para com
o Estado Novo. Ocorre igualmente a organizao da PVDE (Polcia de Vigilncia
e Defesa do Estado), que mais tarde se tornar a famigerada PIDE (Polcia

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
Internacional de Defesa do Estado), esta ltima criada logo aps a II Guerra
Mundial. J sob o governo de Marcello Caetano (1969-1974), a PIDE muda de
denominao para DGS (Direo Geral de Segurana). Pode-se ainda destacar
o papel da legio portuguesa (LP) no Estado Novo, como auxiliar dos aparatos
repressivos e com perfil nitidamente fascista (ROSAS, 1998).
O processo de constituio da polcia poltica no incio da ditadura do
Estado Novo salazarista remetia a organizaes criadas no perodo da I Repblica
(1910-1926) que, at ento, eram fundamentalmente polcias de ordem pblica
(RIBEIRO, 1995:35). A partir da reestruturao policial de 29 de agosto de 1933,
criada a Polcia de Vigilncia e Defesa do Estado (PVDE). O perodo anterior a
1926, em que se inicia o perodo ditatorial em Portugal, j apresentava estruturas
policiais que seriam reorganizadas e incorporadas PVDE e, posteriormente,
PIDE. No entanto, deve ser considerado que a forma de atuao, subordinao
e suas demais caractersticas estruturais e institucionais se modificaram no
decorrer dos anos.
O perodo de maior relevncia para a compreenso da PVDE-PIDE, para
Maria da Conceio Ribeiro, o da ditadura de Sidnio Pais, a partir de 1917.
Isto se deve s reformas da Polcia Preventiva do sidonismo, que modifica sua
denominao duas vezes at 1922. Em outubro de 1922, modifica-se novamente
sua designao para Polcia Preventiva e de Segurana do Estado. O decreto de
outubro, segundo Ribeiro (1995), organiza esta polcia como polcia poltica da
I Repblica. Portanto, a Polcia Preventiva criada durante a ditadura de Sidnio
Pais surge como a primeira tentativa sistemtica de organizao de uma polcia
poltica considerada pea-chave do aparelho de Estado e dotada de amplos
poderes, incluindo o poder de deteno, de que nenhuma das suas congneres
anteriores parece ter disposto (RIBEIRO, 1995:51).
No perodo de 1926 a 1933, ocorrem diversas modificaes nas
denominaes e atribuies das polcias que compem o aparato repressivo da
ditadura. Com a ascenso de Salazar ao poder, em Setembro de 1930, extinta
a Polcia Internacional (imigrao e estrangeiros) e sua estrutura inserida na
Polcia de Investigao Criminal, que passa a ser subordinada ao Ministrio da
Justia e Cultos. Em junho de 1931, por sua vez, igualmente extinta a Polcia de
Informaes, que passa a ter suas atribuies destinadas Polcia de Segurana
Pblica, ligada ao Ministrio do Interior. Nota-se, aqui, a centralidade do
Ministrio do Interior em assuntos de inteligncia interna e de polcia poltica,
que ainda permanece atual, sob a gide do Ministrio da Administrao Interna.
Em maio de 1932, ocorre a primeira tentativa de unificao policial. Um ano
depois, criada a Polcia de Defesa Poltica e Social, subordinada ao Ministrio
do Interior. Este fato relevante porque, em agosto de 1933, feita a fuso entre
a Polcia de Defesa Poltica e Social com a Polcia Internacional Portuguesa e h

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
a criao da Polcia de Vigilncia e Defesa do Estado (PVDE), tambm submetida
ao Ministrio do Interior (RIBEIRO, 1995).
Aps a Guerra Civil Espanhola, o perigo vermelho passa a estar no centro
das preocupaes da PVDE. Entre 1936 e 1939, ocorre a Cruzada anticomunista,
que induziu a uma escalada da violncia repressiva. Com efeito, a defesa da
ordem adquire especial ateno, com foco na represso ao comunismo. Como
destaca Pimentel (2009), aps o fim da Segunda Guerra, as outras polcias polticas
fascistas ou nacional-socialistas foram extintas; em Portugal, contudo, com a
manuteno do regime ditatorial, a polcia poltica adquiriu novos poderes e nova
denominao. O Decreto-Lei no 35.046, de 22/10/1945, cria a Polcia Internacional
de Defesa do Estado (PIDE).
Centralizando no seu seio todos os organismos com funes de preveno e
represso poltica dos crimes contra a segurana interna e externa do Estado,
a PIDE conservou a instruo preparatria dos processos respeitantes queles
delitos e ficou ainda com a capacidade de determinar, com quase total
independncia, o regime de priso preventiva. (PIMENTEL, 2009:31).

Nos anos 1940, a PIDE era composta por trs divises: 1a Diviso Servios
Internacionais (SI), 2a Diviso Servio Central de Investigao (SCI), 3a Diviso
Servio de Segurana do Estado. Na Guerra Colonial (1960-1962), foram criadas
subdelegaes e postos de fronteira e vigilncia em Angola e Moambique,
colocando a PIDE, em relao ao ultramar, tal como se encontravam as
foras armadas (PIMENTEL, 2009:40). O recrutamento para Ultramar adquire
relevncia nesta fase e, em 1962, o nmero de funcionrios da PIDE no ultramar
ultrapassa o nmero no Continente e Ilhas.
As referncias encontradas do conta de que a PIDE no se militariza,2
como a GNR e PSP, para atuar nas colnias. Segundo Palacios Cerezales (2008)
e Pimentel (2009), h o recrutamento de mais agentes para atuar contra os
movimentos polticos na Colnia. Costa Pinto (2006, 2010) aponta para uma
desmilitarizao da PIDE na reestruturao ps-1974. Numeriano tambm
destaca que a PIDE/DGS, mesmo aps o golpe de 1974, segue com atividades
nas provncias, como organismo de informaes militares (NUMERIANO, 2010).
Podemos inferir que houve uma militarizao parcial devido amplitude de seu
papel no policiamento poltico. Pimentel e Numeriano tambm destacam o papel
da PIDE na fiscalizao dos militares de esquerda e direita dentro do regime.
A atuao deste rgo era ampla e atingia todas as esferas do poder, portanto.
Marcello Caetano, que substitui Salazar, em 1968, por motivos de sade do
velho ditador, extingue a PIDE e cria a Direo-Geral de Segurana (DGS), com o


 v0LOLWDUL]DRwGHLQVWLWXLHVGHLQWHOLJQFLDFLYLVGHYHVHUHQWHQGLGDQHVWHWUDEDOKRQDGHILQLR
GH3ULVFLOD%UDQGRv  HVWDPRVID]HQGRDOXVRDRIDWRGHRVSRVWRVGHFRPDQGRHVWDUHPHPVXD
PDLRULDFRQFHQWUDGRVQDVPRVGHPLOLWDUHVVHMDPHOHVGDDWLYDRXGDUHVHUYDw %5$1'2 

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
Decreto-Lei no 49.401 de 19 de novembro de 1969. A nova instituio continuou
sob a tutela do Ministrio do Interior, com exceo de sua implantao nas
colnias, que ficou sob o comando do Ministro do Ultramar. Embora Marcelo
Caetano tenha feito diversas crticas PIDE, a conduo e a prticas da DGS foram
mantidas como no perodo Salazarista. Em 1972, dois Decretos-Lei modificaram a
DGS e formataram a organizao, que permaneceu como tal at o final, em 1974.
O Ministrio dos Negcios Estrangeiros tambm atuou como grande colaborador
da PIDE. O Ministrio da Justia julgava os crimes identificados pela PIDE, porm
sempre em acordo com a documentao proveniente desta ltima.
O fim da 2a Guerra Mundial anunciou para a oposio ao Estado Novo o
fim dos fascismos como se d no Brasil com a queda de Getlio Vargas, em
1945 o que provocou algumas manifestaes sociais contra o regime, contidas
pelo sistema policial estruturado por Salazar. Porm, aps o fim da guerra, tm
lugar algumas modificaes na imagem e na estrutura do regime, como o caso
da modificao do nome da polcia poltica do regime, de PVDE para PIDE e do
retorno de alguns presos polticos. No entanto, as modificaes servem apenas
para dar suporte legal para o recrudescimento da represso, agora sob comando
da PIDE. A poltica externa de Salazar produziu alguns efeitos no ps-guerra que
permitiram um prolongamento do regime, mesmo com o aumento da presso
internacional pelo fim do regime corporativista portugus. O ingresso de Portugal
na OTAN simbolizou que a imagem externa do regime no o impedia de ingressar
no rol das democracias da Europa Ocidental (PINTO & TEIXEIRA, 2007).
O cenrio do incio da Guerra Fria de relativa estabilidade social e poltica
em Portugal, com certo grau de desenvolvimento econmico. Neste perodo, se d
a campanha presidencial de 1958, em que se enfrentam dois candidatos oriundos
do regime, porm com plataformas distintas: o general Humberto Delgado, de
oposio, e Amrico Toms, de situao. Durante e aps as eleies, houve
diversas manifestaes em apoio a Humberto Delgado, que simbolizava, para
uma parcela da populao, inclusive para o PCP (Partido Comunista Portugus),
uma perspectiva de abertura poltica. Contudo, a eleio fraudada a favor de
Amrico Toms e os protestos so reprimidos com violncia at 1962. Os cenrios
de fraude, violncia repressiva e o advento das lutas anti-coloniais pem o pas
na pauta mundial.
A subida ao poder nos EUA de John F. Kennedy fez com que as iniciativas
de descolonizao adquirissem amplitude mundial. Os blocos Afro-Asitico e
Sovitico foram de grande relevncia, como destacam Antnio Costa Pinto e
Nuno Severiano Teixeira (2007), no fortalecimento e apoio causa anticolonial.
H o endurecimento do regime militar no continente e a ampliao do papel das
polcias e da PIDE nas colnias (PALACIOS CEREZALES, 2008). A mudana social

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
no pas continua com maior crescimento econmico at a crise do petrleo de
1973, que afeta muito negativamente o pas.
Neste nterim, chega ao poder, em 1968, em substituio ao adoentado
Antnio Salazar, Marcello Caetano. O novo governo tem um discurso de abertura
poltica, mas o novo cenrio social do pas e a Guerra Colonial so os principais
complicadores do perodo marcelista. As manifestaes recrudescem, assim
como a represso, que agora fica a cargo da DGS. Como forma de evidenciar este
recrudescimento, o nmero de prises da polcia poltica atinge 766 indivduos
em 1973. neste mesmo ano que se iniciam as tratativas para a elaborao do
golpe de 25 de Abril de 1974, que pe fim ao regime militar e inicia a transio
para a democracia em Portugal (PALACIOS CEREZALES, 2008).

2GH$EULOGHHD7UDQVLomRSDUD'HPRFUDFLDHP3RUWXJDO
Aps o Golpe Militar de 25 de Abril de 1974, que pe fim ao regime
salazarista, tem incio o perodo conturbado de transio para a democracia,
que apenas se institucionaliza, de fato, aps a reviso constitucional de 1982.
Segundo Lobo, Magalhes e Pinto (2009), o contexto de transio no qual ocorre
o Golpe pode ser caracterizado pela falta de apoio internacional ao regime, no
cenrio de Guerra Fria, e pelo ambiente de crise do Estado e de descolonizao. A
singularidade do papel dos militares no caso portugus se destaca por configurar
um golpe militar para levar o pas democracia. Trata-se, portanto, de um golpe
em prol da democracia e da descolonizao. A incapacidade de Marcello Caetano
em por fim Guerra Colonial salientada com uma das principais razes para
o 25 de Abril.
Entre 1974 e 1976, desenvolve-se um dinmico perodo de transio,
repleto de incongruncias e conflitos entre as lideranas e grupos que apoiaram
o golpe. O processo de transio caracterizado por uma crise no interior das
elites revolucionrias, principalmente entre o Movimento das Foras Armadas
(MFA) e alguns generais conservadores que resistiam ao final do imprio colonial
portugus. A clivagem em torno da descolonizao, motor inicial do conflito
entre capites dirigentes do golpe e o General Spnola e outros oficiais generais
conservadores, marcou a emergncia poltica do MFA. Este fator abriu um
espao de mobilizao poltica e social e concomitante crise do Estado, que pode
explicar a incapacidade das elites moderadas dominarem por cima a rpida
institucionalizao da democracia representativa (PINTO, 2006:39).
A transio por ruptura com o regime salazarista passa a se tornar visvel,
principalmente com o chamado saneamento da administrao pblica e
empresas, uma purga de sessenta generais das foras armadas e, tambm, com a
extino da PIDE/DGS (PINTO, 2010). Todavia, o primeiro rgo de informaes
da Revoluo dos Cravos teve breve durao, pois o Servio Diretor e Coordenador

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
de Informaes (SDCI), criado no dia 23 de maio de 1975, foi extinto em 21
de maio de 1976, deixando acfala a rea de inteligncia civil (NUMERIANO,
2010:192-193).
Neste perodo ocorrem algumas clivagens na sociedade portuguesa das
quais emergem novos partidos, que representam a direita e a centro-direita no
pas (CDS e PPD). Os movimentos sociais e partidos de esquerda recrudescem
suas manifestaes, principalmente pela atuao do Partido Comunista
Portugus (PCP). A estrutura de governo aps o golpe era composta por um
Conselho de Ministros e, subordinados a este, encontravam-se o Presidente da
Repblica (General Spnola) e a Junta de Salvao Nacional. Relacionados com o
Presidente da Repblica estavam o I Governo Provisrio (Palma Carlos), o chefe
de Estado Maior (Costa Gomes) e o Comit de Coordenao do MFA.
O Movimento de Foras Armadas passa a atuar neste perodo como
balizador dos conflitos e configura-se como um movimento revolucionrio de
esquerda. Esta guinada esquerda pode ser notada pela promoo da Reforma
Agrria e de grandes nacionalizaes. O golpe militar transforma-se, ento, em
processo revolucionrio com a centralidade do MFA na conduo da vida poltica
e social do pas. Uma tentativa de golpe para reconduzir os conservadores ao
poder, em maro de 1975, no bem sucedida e provoca, de forma indireta, um
pacto entre os militares e partidos acerca da constituio. Garante-se o poder de
veto aos militares sobre o texto constitucional que seria aprovado pela Assembleia
Constituinte, a ser eleita em 1975 (PALACIOS CEREZALES, 2008).
Aps o chamado Vero Quente de 1975 (LISI, 2004, 2005) quando houve
diversas mobilizaes antirrevolucionrias, de esquerda e de direita, e uma
tentativa de golpe comunista por parte do PCP, que contou com apoio da Unio
Sovitica (PINTO, 2006) as foras moderadas venceram os radicais em 25 de
novembro de 1975. Foram eleitos, em 1976, para governar Portugal, aps a
aprovao da Constituio, o Presidente General Ramalho Eanes e o Primeiro-
Ministro socialista Mario Soares.
As manifestaes e a efervescncia poltica da sociedade portuguesa
geraram discursos oficiais dos novos governantes em prol da pacificao e
reconciliao do pas. Neste contexto de intensas manifestaes polticas, a
influncia do MFA no processo constitucional pode ser notada pela organizao
do poder Executivo, no qual h um Presidente e um rgo regulador o Conselho
da Revoluo. Portanto, dentre as condies impostas pelos militares, estavam
a escolha de um presidente militar e a criao do Conselho da Revoluo, que
funcionou, ento, como garantidor do processo revolucionrio proposto pelo MFA.
Neste contexto de intensas manifestaes polticas, aprovada a nova
Constituio da Repblica Portuguesa com todos os elementos acordados em
seu texto (LOBO, MAGALHES e PINTO, 2009).

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
A adaptao dos aparatos repressivos e policiais do perodo ditatorial
ao novo contexto de transio tambm turbulenta e, como considera Diego
Palacios Cerezales (2008), h um recrudescimento da violncia policial em
resposta ao novo ambiente de maior liberdade social e poltica. Num curto
perodo de tempo, a radicalizao das foras policiais (PSP e GNR) provocou
algumas mortes. O incio da desmilitarizao no impediu que abusos sejam
cometidos, principalmente pela cultura de violncia das polcias herdeiras do
perodo ditatorial. Era inteno do MFA expandir os expurgos nas foras policiais
com a criao do Comando Operativo do Continente (COPCON), organizao
que representava a desconfiana dos revolucionrios em relao s foras
policiais. A ruptura, entretanto, ocorre de forma mais abrupta e perceptvel
com as organizaes ligadas ao policiamento poltico, ou seja, PIDE/DGS, cujos
membros envolvidos em atos ilegais so expurgados do governo nos primeiros
momentos da transio.
Aps a aprovao da nova Constituio, inicia-se a consolidao do
processo democrtico, j que a reviso constitucional de 1982 extingue o
Conselho da Revoluo, determina a diminuio dos poderes do presidente e
cria duas novas instituies democrticas: o Conselho de Estado e o Tribunal
Constitucional. A Assembleia da Repblica, por sua vez, constitui o poder
legislativo na estrutura de poder do Estado. Aps esta reviso constitucional,
pode-se afirmar que houve, finalmente, a subordinao dos militares ao poder
poltico-partidrio (LOBO, MAGALHES E PINTO, 2009). Esta afirmao est
relacionada diretamente com a extino do Conselho da Revoluo e da Lei de
Defesa Nacional na reviso constitucional.
Assim, em 1982, criada a nova Lei de Defesa Nacional e das Foras
Armadas (Lei no 29/82) e reformulado o sistema de informaes. Para diferenciar
do antigo sistema de policiamento poltico, criado, tambm, em 1984, o Sistema
de Informaes da Repblica Portuguesa (SIRP), pela Lei no30/84.3 Faziam parte
do SIRP: Conselho Superior de Informaes (CSI), o Servio de Informaes de
Segurana (SIS), o Servio de Informaes Estratgicas de Defesa (SIED) e o
Servio de Informaes Militares (SMI). Em relao s informaes ou servios
de inteligncia no perodo anterior reviso constitucional de 1982, podemos
destacar dois organismos relevantes SDCI (Servio Diretor e Coordenador de
Informao, ligado ao Conselho da Revoluo), o posterior DTEC (Departamento
Tcnico), e a DINFO (Diviso de Informaes, vinculada ao Estado-Maior-
General das Foras Armadas EMGFA). No contexto, a criao de um servio
de informao para a democracia foi tambm posta em debate, assim como a
da Lei de Segurana Interna, o que s ocorrer em 1987.


 $OWHUDGDDSHQDVHPFRPD/HL2UJQLFDQR$UHJXODPHQWDRGHVWDOWLPDRFRUUHXSHOD
DSURYDRGD/HLQRTXHSURPRYHDUHIRUPDGR6,53

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
Se no plano das relaes civis-militares, a transio se consolidava num
eixo democrtico, na esfera dos servios de Inteligncia isto vai comear somente
em 1984. Nos primeiros dez anos do golpe dos capites, a esfera civil da rea
de informaes permanecera suspensa em um limbo institucional. A Junta
de Salvao Nacional extinguiu a PIDE/DGS em 1974, e, nos anos seguintes,
os governos provisrios no criaram nenhum rgo civil para a atividade de
Inteligncia e Contra-Inteligncia. (NUMERIANO, 2010).
Em relao aos Servios de Informaes durante a transio, como
mencionado anteriormente, h a criao e a extino de diversas estruturas,
bem como a reforma ou alterao de outras. Roberto Numeriano (2010) afirma
que entre 1974 e 1984 h o medo e a acefalia nos servios de informaes
servio de inteligncia em Portugal. Isto se deve herana dos abusos das polcias
polticas do perodo do Estado Novo e s mudanas nas estruturas do Estado.4
O saneamento posto em prtica no ps-1974 e o rompimento com o legado
autoritrio destas estruturas se consolida como prioridade da gesto do governo
durante a transio. Somente em 1984, com a criao do SIRP, que se inicia o
perodo de formao das novas estruturas de informaes do Estado Portugus
democrtico. Contudo, a Lei de Segurana Interna aprovada apenas em 1987,
que confere ao SIS (Sistema de Informaes de Segurana) atribuies relevantes
para seu funcionamento como rgo de inteligncia civil.
O perodo entre 1982 e 1995 marcado inicialmente pela Reviso
Constitucional de 1982 e finda com as eleies de 1995. Nesta campanha poltica,
a pauta de ampliao dos controles sobre as foras policiais adquire destaque
na poltica nacional. criada, ento, a Inspeo-Geral da Administrao Interna
(IGAI), com autonomia em relao ao Ministrio da Administrao Interior. Este
organismo fiscalizador passa a atuar decisivamente no controle dos abusos e
desvios de conduta das foras de segurana interna do Estado Portugus.
Nos anos 1990, outra alterao na legislao modifica a Lei-Quadro do SIRP.
Esta nova legislao cria o SIEDM (Servio de Informaes Estratgicas de Defesa
e Militares), que ser extinto e substitudo pelo SIED (Servio de Informaes
Estratgicas de Defesa) em 2004. Portanto, durante o perodo de transio para
democracia, entre 1975 e 1982, ocorrem revises constitucionais e reformas
constitucionais que alteram substancialmente as estruturas de segurana interna
e externa do Estado Portugus. As mais recentes modificaes destas estruturas
sero analisadas mais adiante.


 (VWDVLWXDRGHDFHIDOLDGDLQWHOLJQFLDFLYLOGXUDQWHXPDGFDGDVHPHOKDQWHGR%UDVLOTXDQGR
)HUQDQGR&ROORUDVVXPHDSUHVLGQFLD  HH[WLQJXHR6HUYLR1DFLRQDOGH,QIRUPDHV 61, 
PDVQRFULDRXWURUJRSDUDVXEVWLWXOR,VWRVLULDDRFRUUHUHPQRLQFLRGRVHJXQGRPDQGDWR
GH)HUQDQGR+HQULTXH&DUGRVRFRPDUHJXODPHQWDRGD$JQFLD%UDVLOHLUDGH,QWHOLJQFLD $%,1 

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
 2V6HUYLoRVGH6HJXUDQoDH,QWHOLJrQFLDQR%UDVLODWpD
5HGHPRFUDWL]DomR
De forma ainda embrionria, a atividade de Inteligncia institucionalizada
no Brasil teve incio em 29 de novembro de 1927, com o decreto no 17.999, que
instituiu o Conselho de Defesa Nacional (CDN) primeira repartio pblica
federal criada com o objetivo exclusivo de processar informaes em proveito da
Presidncia da Repblica (FIGUEIREDO, 2005). Ao final da Repblica Velha (1889-
1930), o pas assistia ao acirramento de rivalidades polticas e ao fortalecimento
dos movimentos operrios e de contestao contra as elites governantes, como
as grandes greves de 1917 e 1918 no Rio de Janeiro e em So Paulo, bem como
a fundao, em 1922, do Partido Comunista Brasileiro (PCB). Com a Revoluo
de 1930, Getlio Vargas assume a Presidncia da Repblica e, quatro anos mais
tarde, reorganiza duas vezes o Conselho de Defesa Nacional. Alm de dot-lo
de uma assessoria tcnica, o Decreto no 23.873, de 15 de fevereiro de 1934, cria,
para cada ministrio, as Sees de Defesa Nacional; em agosto de 1934, o CDN
renomeado Conselho Superior de Segurana Nacional.
A mudana na nomenclatura denota o emprego de um conceito mais
amplo, o de segurana, que pode ser aplicado a questes internas ou externas, em
situaes de guerra ou de paz, em detrimento do conceito mais restrito de defesa.
Esse processo revela a organizao do Estado face aos grupos e movimentos
de massa, por meio da tipificao de crimes contra a ordem poltica e social
e da criminalizao, principalmente, de comunistas e de estrangeiros. Com a
instaurao da ditadura do Estado Novo (1937-1945), a atividade de Inteligncia e
os servios de polcia passaram a se constituir, claramente, como polcia poltica,
instrumentalizando a represso aos opositores e inimigos do regime brasileiro.
A institucionalizao da inteligncia brasileira comea efetivamente aps a
II Guerra, embora suas estruturas estivessem voltadas para as atividades internas
e exercessem funes de polcia desde o Estado Novo varguista. Tambm desse
perodo resulta a criao de um Departamento Federal de Segurana Pblica
(DFSP), submetido ao Ministrio da Justia e Negcios Interiores, pelo Decreto-
Lei no 6.378, de 28/03/1944. Fruto de uma reforma do Poder Judicirio, a criao
do DFSP consistiu, de fato, na transformao da Polcia do Distrito Federal
( poca, o Rio de Janeiro) em um Departamento que se pretendia federal,
embora inicialmente restrito ao territrio do antigo DF. Somente em 1946, o
Departamento estenderia sua atuao nacionalmente, dotado de trs divises
e de seis delegacias especializadas (ROCHA, 2004:66). Sob responsabilidade da
Diviso de Polcia Poltica e Social (DPS), estavam no apenas as funes de
Inteligncia, mas tambm a represso aos opositores da ditadura de Vargas.
Posteriormente ao Estado Novo, o DFSP passou a operar mais com o objetivo
de coordenao do que propriamente como polcia investigativa. Mesmo assim,

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
conforme Rocha (2004: 76), no exagero repetir que o 1o DFSP, como agncia
de segurana pblica mais importante no regime de democracia competitiva
ps-Estado Novo, obteve seu eixo central atravs da polcia poltica. A polcia
poltica por excelncia, frente da represso poltica, bem como mquina de
propaganda e censura do Estado Novo, foi o Departamento de Investigaes e
Propaganda, o famigerado DIP.
A atividade de Inteligncia vinculada diretamente ao Estado e responsvel
por assessorar o poder Executivo surgiu em 1946, com a criao do SFICI
(Servio Federal de Informaes e Contra-Informaes). Com efeito, at ento, as
atividades sigilosas de interesse do Estado brasileiro vinham sendo desenvolvidas
por rgos policiais sob coordenao do DFSP - e caracterizavam-se pelo
aspecto de polcia poltica do regime vigente (RORATTO & CARNIELLI, 2006). A
experincia brasileira na 2a Guerra Mundial oportunizara o inter-relacionamento
entre os exrcitos Aliados e a Fora Expedicionria Brasileira, o que se mostrou
determinante para que os militares brasileiros percebessem a importncia da
Inteligncia para o assessoramento do governo. O presidente e general Eurico
Dutra, ex-ministro da Guerra do Estado Novo, que sucede Vargas, ao ser eleito em
1946, cria em setembro daquele mesmo ano, por meio do Decreto-lei no 9.775-A,
o SFICI, subordinado ao Conselho de Segurana Nacional (nova denominao
para o Conselho de Defesa Nacional) e dirigido por oficiais superiores das
Foras Armadas. Nota-se, j ento, a militarizao dos servios de inteligncia
civis no Brasil.
Todavia, o SFICI seria estruturado somente em 1956, por meio da
determinao do presidente Juscelino Kubitschek, sediado na segunda seo
da Secretaria Geral do Conselho de Segurana Nacional. Em setembro de 1958,
foram estabelecidas a chefia do SFICI e suas subsees do Exterior, do Interior,
de Segurana Interna e de Operaes, tendo a existncia do rgo um papel
discreto e de pouca significao (RORATTO & CARNIELLI, 2006:7), uma vez que
as foras policiais, e especialmente a Diviso de Polcia Poltica e Social, ainda
representavam a principal fonte de informaes poltico-sociais.
A atividade de Inteligncia brasileira passou a ter propores inditas a
partir do golpe militar de 31 de Maro de 1964. Pouco mais de dois meses aps
a deposio pelas armas do ento Presidente Joo Goulart (1961-1964), foi
criado o Servio Nacional de Informaes (SNI), pela lei no 4.341, de 13 de junho
daquele ano. A justificativa principal para a criao do rgo que simbolizou e
coordenou a comunidade de informaes do regime autoritrio brasileiro, e
que sobreviveu cinco anos aps o fim da ditadura, foi a de que o novo governo
buscava implantar um servio de Inteligncia que estivesse em conformidade
com a Doutrina de Segurana Nacional (DSN), idealizada no mbito da Escola
Superior de Guerra (ESG), desde 1949. Essa doutrina traava, basicamente, um

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
diagnstico das debilidades e capacidades nacionais no contexto da Guerra
Fria, enquanto destacava a vulnerabilidade do pas ao comunismo, tornando-
se necessrio, segundo seus proponentes, precaver-se ativamente contra essa
ameaa (FICO, 2001:39-42).
A estrutura do SNI contava com uma Secretaria Administrativa, uma
Inspetoria Geral de Finanas e uma Agncia Central, sediada no Palcio do
Planalto, em Braslia, e dividida entre sees de Informaes Estratgicas,
Operaes Especiais e Segurana Interna. O rgo passou a contar tambm
com agncias regionais, divididas nas mesmas sees que a Agncia Central,
inicialmente nas principais capitais, Rio de Janeiro e So Paulo, e em seguida nas
demais. A chefia do SNI ficaria, inicialmente, com o General Golbery do Couto e
Silva, at a transio presidencial de 1967, quando o general Costa e Silva assumiu
o posto do general Castelo Branco (1964-1967) e nomeou o general Emlio Mdici
como o novo chefe do rgo. Conforme Carlos Fico (2001:42), no surpreende,
portanto, que Golbery tenha se tornado o primeiro chefe do SNI, afinal coube
principalmente a ele a elaborao intelectual da DSN, alm de ter sido um dos
principais proponentes da criao de um rgo de informaes deste tipo, desde
a dcada de 1950. O general Golbery tambm atuou intensamente durante
a conspirao contra o governo Goulart, a frente do Instituto de Pesquisas e
Estudos Sociais (IPES).
O Departamento Federal de Segurana Pblica (DFSP), sofreu reformula-
es poca do golpe militar. Com a extino do SFICI e o surgimento do SNI,
o prprio DFSP se viu quase extinto. No entanto, o Departamento se manteve e
assumiu posio secundria, por assim dizer, no exerccio da represso poltica,
centrando suas atividades na gerao de inquritos judiciais, na autuao e no
controle do acesso de estrangeiros, bem como no combate ao trfico de entor-
pecentes funo esta em que se especializaria. Mais alm, caberia tambm ao
DFSP a execuo da censura, por meio da proibio, da busca e da apreenso
de materiais e de produtos culturais proibidos pelo regime.
A Academia Nacional de Polcia (ANP), fundada em 1961, pelo General
Osmar Soares, surge nesse contexto como instituio de ensino policial, ainda
que dirigida pelos militares. Em 1964, ocorre a transferncia completa do DFSP
para a nova capital do pas, sendo rebatizado de Polcia Federal de Segurana
(PFS). At esse momento, contudo, a maior Diviso do departamento, a DPS,
permanecia no Rio de Janeiro. Essa mesma Diviso seria transformada, ainda
em 1962, na Delegacia de Ordem Poltica e Social (DOPS).
A garantia do protagonismo militar nos rgos de segurana pblica se
deu, portanto, com a implantao de um modelo integrado: as polcias de base
municipal como as guardas civis foram dissolvidas, enquanto se unificaram
nas Polcias Militares estaduais (PMs) todas as polcias ostensivas, sob o comando

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
dos governadores dos estados. s PMs seria destinada a funo de policiamento
ostensivo, muitas vezes sob comando de oficiais do Exrcito, enquanto a funo
repressiva destinava-se aos DEOPS estaduais, diretamente vinculados aos
secretrios estaduais de segurana pblica, muitos deles militares, da ativa e da
reserva. Os Diretores Gerais da Polcia Federal, por sua vez, seriam todos oriundos
do Exrcito, em sua maioria generais.
A nacionalizao da ento PFS somente seria institucionalizada em
novembro de 1964 (ROCHA, 2004). 5 Em fevereiro de 1967, a PFS assume
definitivamente o nome de Departamento de Polcia Federal (DPF) e se constitui
como embrio da estrutura atual da Polcia Federal. No se pode desconsiderar
que, ao longo de toda a dcada de 1960, as reestruturaes do DFSP-PFS-
DPF seriam marcadas pela presena dos Estados Unidos na transferncia
profissional e nos programas de intercmbio e de ajuda, principalmente por
meio da Agency for International Development (AID).
A partir de 1968, com o surgimento de aes armadas por grupos de
esquerda e com o recrudescimento da represso, o governo proclama o Ato
Institucional No 5 em 13 de dezembro de 1968. O AI-5 seria a legislao mais
repressiva do regime comeam os anos de chumbo (1968-1976) da ditadura.
Nessa perspectiva, em 1970, o SNI passava a fazer parte de uma estrutura
maior de atividades de Inteligncia, o Sistema Nacional de Inteligncia (SISNI).
Coordenado formalmente pelo SNI, o SISNI era composto ainda pelos Sistemas
Setoriais de Informaes dos Ministrios Civis, pelos Sistemas Setoriais dos
Ministrios Militares e por outros rgos, como assessorias de informaes
situadas em empresas estatais e esferas da administrao pblica. Nos ministrios
civis, o rgo central de informaes passava a ser a Diviso de Segurana e
Informaes (DSI) a qual substitua as Sees de Segurana Nacional dos
ministrios civis, existentes at 1967 , aliado a diversas Assessorias de Segurana
e Informaes (presentes em rgos da administrao pblica).
Quanto aos ministrios militares, rgos especficos da Marinha, do
Exrcito e da Aeronutica compunham os Sistemas Setoriais de Informaes. A
Marinha contava com o Centro de Informaes da Marinha (CENIMAR), fundado
ainda na dcada de 1950; o Exrcito, com o Centro de Informaes do Exrcito
(CIE), o mais forte e mais atuante dentre os rgos militares de informaes,
criado em 1967, justamente para combater as organizaes armadas de esquerda.
Na Aeronutica, a estrutura de informaes era similar, dotada de um Centro de
Informaes de Segurana da Aeronutica (CISA).
Como constava no decreto criador do SNI, sua finalidade distanciava-se da
aplicao do poder de polcia, no entanto, estava isento da prestao de contas


 2ILFLDOPHQWHGHQRYHPEURGHWLGDFRPRDGDWDGHIXQGDRGD3ROFLD)HGHUDO 52&+$
 

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
ao Congresso sobre sua organizao, suas operaes e seu pessoal. A Chefia
do SNI mostrava-se cada vez mais influente nas decises da Presidncia, a tal
ponto que dois dos cinco Generais que chefiaram o rgo Emlio Mdici e Joo
Figueiredo tornaram-se Presidentes da Repblica. Muito embora, portanto, a
execuo da represso policial dissidncia poltica no dissesse respeito ao
rgo, formalmente, o SNI virou o smbolo do servio de inteligncia interna da
ditadura no Brasil.
O fortalecimento do Conselho de Segurana Nacional, em 1968, e o
estabelecimento do Sistema de Segurana Interna (SISSEGIN), seguindo a
escalada de represso do regime militar, buscavam, por sua vez, institucionalizar
a funo propriamente repressiva. Integravam o SISSEGIN os Destacamentos de
Operaes de Informaes (DOI) dos Centros de Operaes de Defesa Interna
(CODI), rgos de represso poltica e de combate direto esquerda armada,
formados a partir de 1970, organizados segundo as grandes regies militares
e comandados por oficiais do Exrcito. Os DOI-CODIs eram integrados por
oficiais e suboficiais das trs armas, membros das polcias militares e judiciria
dos estados e tambm da polcia federal. O conjunto dos DOI-CODIs estava
vinculado ao ministro do Exrcito.
digno de registro que as funes de polcia poltica e de combate
oposio armada em que a tortura era utilizada de forma sistemtica, bem
como o assassinato e o desaparecimento de opositores foram rotineiros no auge
da represso eram igualmente asseguradas pelos Departamentos Estaduais de
Ordem Poltica e Social (DEOPS), rgos das secretarias de segurana pblica dos
Estados brasileiros, onde se destacou, pela importncia na represso e tambm
pela brutalidade, o de So Paulo. Todos estes rgos e seus funcionrios formavam
a comunidade de segurana do regime, que foi responsvel por quase quatro
centenas de mortos e desaparecidos polticos e por milhares de torturados, a
maioria na primeira metade da dcada de 1970.

$OLEHUDOL]DomRSROtWLFDHDVGLYLV}HVGDFRPXQLGDGHGHVHJXUDQoD
Um processo de democratizao totalmente finalizado envolve
genericamente trs etapas: o incio da dissoluo do regime autoritrio, a criao
da democracia e a consolidao do novo regime (BERMEO, 1992:273). A longa
e gradual transio no Brasil permite distinguir com clareza estes perodos. O
primeiro se estende de maro de 1974 a maro de 1985, e abrange os dois ltimos
governos militares, as presidncias dos generais Ernesto Geisel (1974-1979) e
Joo Figueiredo (1979-1985). A segunda etapa a construo da democracia
desenvolve-se durante o governo civil de Jos Sarney (1985 - 1990). Quanto ao
processo de consolidao do novo regime democrtico, uma espcie de segunda
transio, ela inicia-se com a presidncia de Fernando Collor de Mello, em 15 de

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
maro de 1990, eleito por sufrgio universal e afastado do poder por um processo
de impeachment em dezembro de 1992. A partir da substituio de Collor por seu
vice-presidente, Itamar Franco (1992-1994), e dos dois mandatos presidenciais
de Fernando Henrique Cardoso, a democracia como regime poltico vai se
consolidando no pas. Com a posse do presidente eleito Lus Incio Lula da Silva,
em 2003, que significou uma real alternncia poltica no poder, consideramos que
o atual regime democrtico encontra-se consolidado, embora ainda persistam
fatores que o fragilizam, como o caso do poder real e das prerrogativas que
gozam os militares nas atividades relativas aos assuntos de defesa, inteligncia
e manuteno da ordem interna.6
Uma particularidade importante a ser ressaltada, que diferencia a
autocracia brasileira de regimes similares na regio, foi o fato de apresentar a
mais longa durao dentre todos, de ser o mais bem sucedido do ponto de vista
econmico, o menos repressivo entre seus congneres e aquele no qual os
militares como corporao, e no um militar, assumiram a responsabilidade
pelo poder e adaptaram as instituies polticas nova ordem autoritria
(SOARES, 1994:13). De fato, seus dirigentes sempre consideraram o autoritarismo
como formato poltico transitrio e mantiveram, praticamente durante todo
o perodo, a existncia de partidos polticos, um calendrio eleitoral e o
Congresso em funcionamento, embora com restries polticas importantes,
como veremos adiante. Esta ambiguidade institucional da ditadura no Brasil
se revela extremamente importante para a anlise, pois as caractersticas do
regime autoritrio precedente podem, de fato, ser consideradas como uma macro
varivel poltica fundamental para a determinao do modo de transio e do
tipo de democracia que resultar deste processo. O processo de democratizao
brasileiro apresenta tambm como uma de suas caractersticas centrais o fato
de ter se desenvolvido atravs de negociaes sob forte controle dos dirigentes
autoritrios. Sob este aspecto, ele similar ao caso espanhol, como ressaltam
Share e Mainwaring (1988), e se diferencia, como mencionamos, do caso
portugus.
O estudo da tentativa que os detentores do poder fizeram para liberalizar
gradual e controladamente o regime autoritrio e para institucionalizar uma
democracia forte, em que os militares mantivessem um direito de veto sobre
a vida poltica do pas, revelou que eles foram relativamente bem sucedidos em
seus propsitos. Isto, no obstante as dificuldades encontradas pelo general
Figueiredo para conduzir o processo poltico e sua sucesso nos ltimos anos de


 $FRQVROLGDRGDGHPRFUDFLDXPDHVSFLHGHVHJXQGDWUDQVLRHDDYDOLDRGDHVWDELOL]DR
HRHQUDL]DPHQWRGHVWHUHJLPHHPXPGHWHUPLQDGRSDVUHTXHUXPFRQVLGHUYHOUHFXRWHPSRUDO3DUD
XPDSRVLRFUWLFDHEHPIXQGDPHQWDGDVREUHRVSUREOHPDVSDUDDFRQVROLGDRGDGHPRFUDFLDQR
%UDVLOFHQWUDGDEDVLFDPHQWHQDVUHODHVFLYLVPLOLWDUHVYHU=DYHUXFKD  

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
governo, devido s presses e mobilizao crescente da oposio e de amplos
setores sociais que exigiam a democratizao efetiva e imediata do pas.
A longa durao e a evoluo extremamente gradual da fase de
liberalizao poltica, assim como a utilizao da competio eleitoral como
recurso institucional privilegiado da transio, criaram no mundo poltico
brasileiro uma percepo de normalizao do processo conduzido sob o
controle e segundo as regras impostas unilateralmente pelos detentores do
poder. Estas regras foram como que naturalizadas nas avaliaes, clculos e
elaborao de estratgias pelos principais atores polticos ao longo do perodo.
Este fator tempo revelou-se fundamental para o alargamento progressivo do
setor moderado da oposio e daquele reformista do regime. Neste sentido, a
perda de controle sobre a transio, ao final da presidncia Figueiredo, significou
a autonomizao da lgica deste processo (LESSA, 1989; LAMOUNIER, 1988),
originado por uma estratgia voluntarista dos dirigentes do regime e modelado
pelas caractersticas mais tradicionais da vida poltica brasileira: uma prxis
autoritria associada a uma lgica liberal (TRINDADE, 1985), a centralidade
poltica dos militares e a tradio de conciliao pelo alto das elites polticas
(ARTURI, 2001).
O alto grau de continusmo das elites autoritrias na Nova Repblica
pode ser ilustrado pelo fato de que, por ocasio das eleies gerais de 1986,
que formaram a Assembleia Constituinte, foram eleitos 217 deputados que
pertenciam ao antigo partido de apoio ao regime autoritrio (ARENA) e apenas
212 provenientes da antiga oposio democrtica (MDB) durante o perodo do
bipartidarismo imposto (1966-1979). Este resultado tambm se deve ao prestgio e
apoio significativos de que ainda desfrutava o regime autoritrio e suas lideranas
na poca, em virtude do desenvolvimento econmico alcanado durante o
perodo autoritrio e das posies de poder que mantiveram aps seu trmino.
Alis, a presena no poder da elite poltica civil do regime autoritrio aps a
instaurao da democracia foi maior do que no governo Sarney. De fato, o PFL, a
partir de 1990 passa a ser o principal partido de sustentao dos governos Collor
e Itamar Franco e, em 1994, forma com o PSDB (Partido da Social Democracia
Brasileira), a aliana que elegeu o presidente Fernando Henrique Cardoso e como
vice-presidente, Marco Maciel (PFL), ex-senador e ex-lder do governo Geisel na
Cmara dos Deputados. Em suma, os reformistas do regime autoritrio foram
os herdeiros polticos privilegiados do processo de transio.
As foras armadas conseguiram prerrogativas polticas extraordinrias, que
as mantm como um dos atores polticos centrais, com grande poder informal,
sobretudo em momentos de crise poltica. Os antigos dirigentes autoritrios
tambm obtiveram a garantia de que no haveria revanchismo contra os agentes
do Estado que cometeram crimes no exerccio da represso contra a oposio,

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
outro problema candente para a consolidao dos novos regimes democrticos
instaurados nas duas ltimas dcadas.
A partir do incio do processo de liberalizao poltica lenta, gradual
e segura, impulsionada pelo general Ernesto Geisel, logo aps assumir a
presidncia da Repblica, em 1974, o SNI expandiu paradoxalmente suas
atividades, passando a desfrutar de grande autonomia j no final desta dcada.
Muitas vezes, o SNI se confrontou com os DOI-CODIs e com os DEOPS em
defesa do projeto de abertura poltica das presidncias Geisel e Figueiredo
contra a linha-dura militar, encastelada nestes ltimos rgos, que se opunha
liberalizao do regime. Um momento grave deste conflito ocorreu durante
a acirrada luta poltica pela sucesso de Geisel, que ops como pretendentes o
chefe do SNI de ento, general Joo Figueiredo (o preferido de Geisel e do general
Golbery), e o Ministro do Exrcito, general Sylvio Frota. Ambos usaram os servios
de inteligncia sob seu comando, respectivamente o SNI e o CIE, para reforar
suas posies e recursos e enfraquecer a candidatura oposta. Esta disputa foi
selada com a dramtica demisso de Frota por Geisel em 12 de outubro de 1977.
O general Joo Figueiredo toma posse em maro de 1979, mas recebe
o poder sem contar com a legislao mais repressiva do regime, abolida em
dezembro de 1978, e simultaneamente com a ecloso de manifestaes de
estudantes e de trabalhadores pela redemocratizao do pas. A extrema-direita,
boa parte localizada nos rgos de inteligncia e de represso, especialmente
nos DOI-CODIs e nos escritrios regionais do CIE, comeou a praticar uma srie
de atentados aps a promulgao da anistia poltica, em agosto de 1979, e do
retorno dos exilados ao pas. Inconformada com a abertura poltica continuada
pelo presidente Figueiredo e temerosa de ser judicialmente perseguida no
futuro, em virtude dos crimes cometidos durante o auge da represso, a extrema-
direita reagia. Ocorreram atentados contra revistarias que vendiam jornais de
esquerda, contra personalidades, organizaes da oposio e da sociedade civil,
que resultaram na morte da secretria da Associao Brasileira de Imprensa, em
1980. Figueiredo coloca um general prximo, Octavio Medeiros, na chefia do
SNI e refora a estrutura deste ltimo, justamente na poca de abertura poltica
e na ausncia de grupos de contestao armada ao regime. O general Medeiros
tentou ser o terceiro presidente oriundo da chefia do SNI, mas suas pretenses
foram atropeladas pelo caso Riocentro, em 1981, no Rio de Janeiro. De fato, a
exploso de uma bomba no interior de um automvel ocupado por militares,
que resultou na morte de um deles, no estacionamento do centro de convenes
Riocentro, onde tinha lugar um show para milhares de pessoas, em 30 de abril,
teve consequncias mltiplas e importantes para o futuro poltico do pas
(ARTURI, 2000; BRANDO, 2002). Em primeiro lugar, o episdio significou o fim
dos atentados perpetrados pela extrema-direita inconformada com o processo
de transio, que ocorriam desde o final de 1979.

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
O segundo efeito importante do caso Riocentro foi a demisso do general
Golbery do Couto e Silva, fundador do SNI, de seu cargo de ministro-chefe da
Casa Civil, que ocupava desde o incio da presidncia Geisel, j que ele exigia a
apurao completa dos fatos e a punio dos responsveis pelos atentados. Ao
no conseguir seu intento, teria pronunciado a clebre frase: Criei um monstro
[SNI]. Ao que se saiba, o SNI no esteve envolvido no caso Riocentro, obra
provvel agentes do DOI-CODI e do CIE, associados a civis extremistas. A dvida
se o SNI conhecia h mais tempo a identidade dos autores destes ataques; em
caso positivo, se no teria sido complacente com os atentados terroristas para,
eventualmente, justificar a escolha do chefe do servio de informaes como
sucessor do general Figueiredo, aps 1985. Ora, os planos do general Golbery
e de Geisel eram os de que o prximo presidente fosse um civil originado dos
quadros do partido do regime, o Partido Democrtico Social (PDS) e, assim,
afastar gradualmente os militares do exerccio direto do poder poltico.
Os resultados das eleies para governador de estado e para deputados
estaduais e federais em 1982 do uma vitria poltica expressiva para a oposio
e so diretamente responsveis pela perda do controle do processo de transio
pelo regime. Graas aos senadores escolhidos indiretamente em 1978, o partido
governamental mantm ainda a maioria no Congresso e no Colgio eleitoral que
ir se reunir em janeiro de 1985 para eleger o prximo Presidente da Repblica.
Mas, a partir da eleio de 1982, na qual os partidos de oposio conquistam dez
governos estaduais entre os mais importantes do pas e a maioria das cadeiras
na Cmara dos deputados, o governo deve administrar o pas negociando
diretamente com poderosos governadores da oposio e fazer face ao seu
desgaste poltico crescente. A oposio partidria e a sociedade civil organizada
comearam, assim, a tolher gradativamente a margem de manobra do regime
e a inverter o domnio poltico da transio, sempre na estrita observncia
da legislao poltico-eleitoral imposta pelos governos militares. Este quadro
poltico complexo, somado ao sentimento de segurana da oposio quanto
irreversibilidade da transio, notadamente aps a neutralizao da extrema-
direita militar devido ao caso Riocentro em 1981, provocaram uma multiplicao
de estratgias visando sucesso presidencial, com um objetivo poltico igual ao
do governo: eleger o futuro Presidente no Colgio eleitoral em janeiro de 1985.
neste contexto que surge a surpreendente mobilizao pelas eleies
diretas presidncia da Repblica em 1984, conhecida como movimento
Diretas-j. Ela foi a reivindicao mais forte e concreta pela democratizao
do pas aps 1964 e ps em cheque, momentaneamente, a estratgia poltica
do regime e os planos das lideranas oposicionistas mais conservadoras, que j
negociavam possveis alianas com setores do partido governista. O movimento
pelas eleies diretas para Presidente da Repblica mobilizou milhes de pessoas
por todo o pas, mas no conseguiu impedir a rejeio, em abril de 1984, do

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
projeto de emenda constitucional que a implantaria. Entretanto, este movimento
foi fundamental para estimular e justificar o apoio da dissidncia do regime, a
Frente Liberal, ao candidato do PMDB presidncia, Tancredo Neves. A grande
campanha pelas Diretas-J, e sua impotncia para alterar as regras impostas
pelo regime autoritrio, paradigmtica da liberalizao pelo alto atravs de
acordos e cises no seio das elites polticas no Congresso, pois, se ela facilitou a
dissidncia governista e impediu um hipottico recuo poltico-institucional, foi,
todavia, incapaz de dar um desfecho verdadeiramente democrtico ao processo
de transio, pelo simples fato de que a maioria das lideranas oposicionistas e
do prprio governo estavam, naquela conjuntura, satisfeitos com a legalidade
autoritria e com os ganhos polticos vislumbrados.
Finalmente, a oposio democrtica, que conseguiu provocar uma
dissidncia nas foras polticas e militares do regime, elege indiretamente, no
Colgio Eleitoral, em janeiro de 1985, o lder oposicionista moderado Tancredo
Neves como presidente da Repblica. Os eventos posteriores so bem conhecidos:
a eleio da chapa Tancredo Neves e Jos Sarney em janeiro de 1985; a internao
hospitalar de Tancredo, gravemente doente, na vspera de sua posse em 15 de
maro; sua morte em 21 de abril. Assim, a fortuna e as opes dos prncipes
tornaram Jos Sarney, ex-presidente do PDS, o partido da ditadura, o primeiro
Presidente civil desde 1964, resultado muito prximo daquele almejado pelo
grupo militar castelista que iniciara e controlara, durante quase todo o perodo,
a liberalizao do regime uma dcada antes. O pacto poltico, que certamente
ocorreu, entre o candidato oposicionista e os militares, para impedir qualquer
turbulncia poltica na reta final da liberalizao, garantiu queles ltimos
prerrogativas e salvaguardas polticas excepcionais para um regime democrtico.
O continusmo poltico e o excesso de garantismo tornaram-se as marcas da
democratizao no Brasil. A lentido, o gradualismo e o controle exercido neste
perodo pelos detentores do poder legaram resduos autoritrios e reforaram
prticas polticas tradicionais do pas, que problematizaram fortemente a fase
seguinte de democratizao, sob o governo Sarney, e constrangeram o processo
de consolidao do novo regime democrtico a partir de 1990.

$SUHVLGrQFLD6DUQH\HR6HUYLoR1DFLRQDOGH,QIRUPDo}HV

A fase de democratizao no Brasil desenvolve-se durante a presidncia
civil de Jos Sarney (1985-1990), intitulada Nova Repblica, na qual, em maio
de 1985, foi levantada a proibio dos partidos comunistas, deu-se a expanso
mxima do sufrgio, com a permisso ao voto dos analfabetos e foi convocada
uma Assembleia Nacional Constituinte, eleita em 1986. Posteriormente, a
Assembleia Constituinte (1987-1988) redige e aprova a nova Constituio

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
democrtica, em 08 de outubro de 1988, e realizam-se eleies diretas para
Presidente da Repblica em 1989, pela primeira vez aps 1961. Durante a
presidncia Sarney, os constrangimentos postos construo e consolidao
do novo regime so mltiplos e interdependentes: persistncia da crise
econmica com forte crescimento da inflao, fragilidade poltica da Aliana
democrtica, falta de legitimidade do novo presidente, eleito indiretamente, aos
olhos da maioria da populao, e presena de importantes resduos autoritrios
oriundos da transio pelo alto.
Os acordos da oposio com os militares, que permitiram a passagem do
poder sem maiores riscos, foram de fato centrados numa srie de garantias quanto
no punio dos crimes cometidos pelos rgos de segurana do antigo regime
e manuteno de prerrogativas das foras armadas, que lhes permitiram ampla
autonomia em relao s instituies polticas e influncia sobre o processo de
constituio da nova ordem democrtica, com a manuteno de seis ministrios
militares. A tutela militar sobre o sistema poltico vigorou durante o governo
Sarney, em que os ministros militares, sobretudo o do Exrcito, pressionaram
fortemente o presidente e o Congresso constituinte no sentido de restringir as
reformas sociais e polticas propugnadas pela oposio de esquerda, bem como
para manter parte de suas prerrogativas polticas no novo regime democrtico.
H autores que sustentam que os militares no Brasil perderam muito
do poder poltico que detinham no momento da posse do presidente Sarney
em 1985. Wendy Hunter (1997) afirma que a razo desta eroso do poder e das
prerrogativas polticas dos militares, durante os governos Sarney, Collor e Itamar
Franco, foi o desenvolvimento de uma dinmica poltica eleitoral tpica dos
regimes democrticos no perodo. Este processo, associado ao fim da Guerra
Fria e falncia da esquerda radical, teria provocado um esforo dos polticos
para reduzir tanto o oramento, como as esferas de influncia dos militares,
transferindo recursos econmicos e de poder para a arena partidrio-eleitoral.
Todavia, Zaverucha (2000, 2005) demonstra que o controle civil democrtico
sobre os militares ainda no se verifica, de fato, no Brasil, onde as foras armadas
continuam detendo largas prerrogativas e considervel autonomia poltica
at os dias de hoje. Este autor alerta que a dimenso militar na transio e na
consolidao democrtica tem sido subestimada pelos analistas polticos. Outros
autores tm uma opinio mais relativizada que Zaverucha a respeito do poder
dos militares aps a transio, pois destacam os avanos democratizantes que
ocorreram nas relaes civis-militares nos ltimos anos (OLIVEIRA, 2000), bem
como o despreparo e o descaso das elites civis em relao aos assuntos militares
e de defesa (DARAJO & CASTRO, 2001).
No que concerne aos servios de inteligncia, o Servio Nacional de
Informaes continuaria, de fato, em funcionamento durante o governo de Jos
Sarney (1985-1990), que assumira o cargo diante dos problemas de sade do

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
primeiro presidente civil eleito aps o regime militar, Tancredo Neves. Feita a
transio poltica e restabelecida a eleio direta para presidente da Repblica,
a ser realizada no final de 1989, a situao interna do pas mostrava-se muito
menos violenta se comparada s dcadas anteriores. Ao contrrio dos DOI-CODIs
e dos escritrios regionais do CIE, extintos durante a presidncia Sarney, o SNI,
sob a chefia do general geiselista Ivan de Souza Mendes, manteve a mesma
denominao e permaneceu praticamente intacto redemocratizao, inclusive
promulgao de uma nova Constituio em 1988, situao provavelmente
indita na terceira onda de democratizaes.
O SNI continuava concentrado em grupos contrrios aos interesses do
governo, produzia relatrios mensais a respeito da segurana interna do pas
e monitorava as greves que se multiplicavam no perodo (CEPIK & BRANDO,
2003). O reflexo desta situao a manuteno de uma hegemonia do ethos
militar ainda hoje na conduo das atividades de Inteligncia civil, na forma
de prticas e de legados institudos durante a ditadura (NUMERIANO, 2010).
Somente em 15 de maro de 1990, no primeiro dia da Presidncia de Fernando
Collor de Mello, o SNI seria abolido, como veremos adiante. A partir de 1986,
com a Diretriz de Segurana Interna, ficava a cargo do Departamento de Polcia
Federal (DPF) e das polcias estaduais a responsabilidade central pela segurana
interna (ROCHA, 2004:100). Dentre as atribuies previstas na Constituio de
1988 (artigo 144) para a DPF, destacam-se: a) o exerccio com exclusividade das
funes de polcia judiciria da Unio; b) a apurao de crimes contra a ordem
poltica e social papel este exercido anteriormente pelos rgos do SISSEGIN;
c) prevenir e reprimir o trfico internacional de entorpecentes e de outras drogas
afins, o contrabando e o descaminho; d) exercer as funes de polcia martima,
aeroporturia e de fronteiras; e) realizar aes de Inteligncia destinadas
preveno e represso criminal.
Quanto ao ltimo tpico, nota-se que h uma atividade paralela entre o
DPF e a atual Agncia Brasileira de Inteligncia (ABIN), fundada em 1999, como
rgos de Inteligncia federais. A distino, ao menos legalmente, reside no
objetivo da coleta, da anlise e da difuso das informaes: ao contrrio da ABIN,
a atividade de Inteligncia exercida pela PF volta-se apurao de crimes e ao
exerccio de polcia judiciria, e no ao fornecimento de informaes estratgicas
Presidncia com o objetivo de assessorar o Chefe de Estado. Apesar disso, houve
casos em que a atuao paralela mostrou-se, de fato, concorrencial (ROCHA,
2003); em outro, uma operao conjunta, denominada Satiagraha, em 2008,
originou um escndalo poltico com srias repercusses a ABIN e para PF at
os dias de hoje, como veremos mais adiante.

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
 $&RQJXUDomR$WXDOGR6LVWHPDGH,QWHOLJrQFLDHP
3RUWXJDO
As principais estruturas de policiamento em Portugal esto ligadas
diretamente ao Ministrio da Administrao Interna, enquanto a Polcia Judiciria,
devido ao seu atributo de investigao criminal, est ligada ao Ministrio da
Justia. Note-se ainda que o Sistema de Informaes de Segurana (SIS) remete-se
diretamente ao Primeiro-Ministro, ligado, tambm, ao Secretrio-Geral do SIRP. O
controle sobre as atividades de inteligncia externo e parlamentar. O principal
fiscalizador do SIRP, aps a reforma de sua Lei Quadro em 2004, o Conselho
de Fiscalizao, que, conforme consta nesta Lei, deve ser composto por trs
cidados de reconhecida idoneidade e no pleno gozo dos seus direitos civis e
polticos, eleitos pela Assembleia da Repblica por voto secreto e por uma maioria
de dois teros dos deputados presentes. Como destaca Numeriano (2010:307):
Em Portugal, a accountability da atividade de Inteligncia processada pelos
trs poderes da Repblica: Executivo, Legislativo e Judicirio. O SIS e o SIED
so controlados externamente pelo Conselho de Fiscalizao dos Servios
de Informao. O Conselho integrado por trs representantes eleitos pela
Assembleia da Repblica (AR), por voto secreto e maioria de dois teros o
que significa na prtica a escolha de nomes originrios das maiorias partidrias
no parlamento. O mandato dos conselheiros de quatro anos e s pode ser
revogado por deciso da maioria dos deputados da Assembleia. Outro rgo de
controle externo a Comisso de Fiscalizao dos Centros de Dados, integrada
por trs magistrados do Ministrio Pblico, designados pelo Procurador-Geral
da Repblica.

Deve-se ainda mencionar que a fiscalizao dos servios de informao em


Portugal, promovida pelo Conselho de Fiscalizao, no se restringe Inteligncia
Civil, pois o SIRP tambm composto por rgos que desempenham funo
de inteligncia militar SIED. O controle sobre as atividades de inteligncia em
Portugal est, aps 2004, com um grau de institucionalizao elevado, devido ao
seu histrico de rompimento com a herana do autoritarismo, principalmente
em relao Polcia Poltica, e apresenta uma consistente desmilitarizao. As
reformas constitucionais ou aprovaes de diplomas relacionados segurana,
no perodo recente, esto ligadas diretamente integrao regional europeia.
Contudo, o legado autoritrio maior em relao s foras de segurana
interna, pois, como demonstra Diego Palacios Cerezales (2010), a desmilitarizao
igualmente ocorre, porm de forma mais lenta que no mbito dos servios
de informao. Embora a transio por ruptura tenha como conduta padro
o expurgo, o saneamento e a dissoluo das estruturas do regime salazarista,
em algumas reas, em especial, nas foras de segurana pblica (PSP e GNR) o
processo no foi to rpido e radical.
A reformulao do Sistema de Segurana Interna (SSI) entrou na agenda
poltica recente de Portugal e, em 29 de agosto de 2008, foi aprovada a Lei de

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
Segurana Interna (Lei no 53/2008), que define a nova Poltica de Segurana
Interna, o Sistema de Segurana Interna, as foras e servios de segurana e as
medidas de polcia. Com a aprovao desta lei alterou-se, portanto, a organizao
da Segurana Interna em Portugal. O objetivo central desta alterao, que
modifica o diploma de 1987 (no 20/87), o de responder ao contexto atual de
segurana nacional e regional, que se alterou profundamente na ltima dcada.
A nova lei visou tambm a permitir uma maior coordenao e cooperao dos
rgos responsveis pela execuo da segurana interna.
O rgo central do novo SSI o Conselho Superior de Segurana Interna
(CSSI), o qual composto por representantes da Assemblia da Repblica, o
Secretrio-Geral do SIRP, o Chefe Estado-Maior General das Foras Armadas,
o Representante do Sistema Integrado de Operaes de Proteo e Socorro e o
Diretor-Geral dos Servios Prisionais. Institui-se o Secretrio-Geral do Sistema de
Segurana Interna (SGSSI), que se remete diretamente ao Primeiro-Ministro, o
qual por sua vez deve relatar ao Presidente as aes principais do sistema. Dentre
as principais mudanas promovidas pela reforma do SSI est a centralizao de
atividades na Secretaria-Geral de SSI, que passa coordenar as Foras e Servios
de Segurana (FSS), sob a tutela do Ministrio da Administrao Interna (MAI)
e do Ministrio da Justia.
As mudanas promovidas na organizao do SSI tambm se relacionam
com a integrao regional e as novas demandas de organizao e cooperao
securitria regional no mbito da Unio Europeia. O combate ao terrorismo
relacionado com o pilar de Justia e Assuntos Internos (JAI) destaque neste
aspecto, pois a cooperao policial entre as foras de segurana portuguesas e
o Servio Europeu de Polcia (EUROPOL), que ficou instituda a partir de 2010,
adquire relevncia na promoo de segurana na regio. Alm da cooperao
policial com esta agncia europeia, h o reforo da necessidade de troca de
informaes e controle de fronteiras, principalmente com a colaborao do SSI
com o FRONTEX e o EUROSUR, ambos relacionados com o controle do trnsito
de pessoas entre fronteiras na Unio Europeia.
Foram aprovadas na sequncia da nova Lei de Segurana Interna as novas
leis orgnicas das principais foras de segurana interna, a Guarda Nacional
Republicana (GNR) e a Polcia de Segurana Pblica (PSP). Tambm, aprova-
se a Lei de Organizao da Investigao Criminal e altera-se a Lei Quadro do
SIRP (Sistema de Informaes da Repblica Portuguesa), de 2004, com a Lei no
9/2007, que estabelece a organizao da Secretaria-Geral do SIRP, do SIED e do
SIS. Esta lei tambm regulamenta o regime jurdico ao qual sero submetidas
as estruturas do SIRP. Contudo, a organizao anterior, dada pela lei no4/2004,
permanece praticamente inalterada; apenas foram criadas as Secretarias-Gerais
acima mencionadas. Desta forma, o SIRP est sob a tutela de trs instncias de

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
poder que exercem a fiscalizao deste servio. Cabe ao Conselho de Fiscalizao
do SIRP da Assembleia da Repblica regular e fiscalizar este servio. Alm desta
fiscalizao, a Procuradoria Geral da Repblica, por intermdio da Comisso de
Fiscalizao de Dados do SIRP, tambm exerce controle institucional. Contudo, o
SIRP vinculado diretamente ao Primeiro-Ministro, que se remete ao Presidente
da Repblica. H dois conselhos Consultivo e Superior de Informaes
tambm vinculados ao Primeiro-Ministro. Portanto, o Secretrio-Geral do SIRP
remete-se a estes dois conselhos e ao Primeiro-Ministro.
Fica, enfim, destacado que as reformas e modificaes na Segurana
Interna de Portugal respondem a diversos aspectos e promovem uma adequao
ao novo contexto ps-11 de Setembro, de fortalecimento da integrao regional.
Nota-se ainda que a militarizao diminui e acompanha o avano da consolidao
democrtica. A institucionalizao destes servios e sua legitimidade perante a
populao tambm crescem, com a criao e regulamentao de estruturas de
controle mais efetivas das foras de segurana e de informaes. A estrutura e
o funcionamento do atual sistema de inteligncia brasileiro, como veremos a
seguir, encontra-se ainda distante da institucionalizao democrtica alcanada
em Portugal.

 $7UDMHWyULDGR6LVWHPDGH,QWHOLJrQFLDGR%UDVLODSyVD
'HPRFUDWL]DomR
A extino do Servio Nacional de Informaes (SNI) foi instituda pela
Medida Provisria no150, de 15 de maro de 1990 e, posteriormente, pela Lei no
8.028, de 12 de abril de 1990, nas quais o presidente eleito Fernando Collor, no dia
de sua posse, empreendeu uma srie de modificaes na estrutura da Presidncia
da Repblica. A Lei no 8.028 tambm extinguiu a Secretaria de Assuntos de Defesa
Nacional (SADEN), que havia sido criada durante o governo de Jos Sarney, e
criou a Secretaria de Assuntos Estratgicos (SAE), que passou a integrar, dentro
de sua estrutura organizacional, o Departamento de Inteligncia (DI). Foi na
recm-criada SAE, ento sob comando de um civil nefito nos assuntos da rea
e amigo pessoal do presidente Collor, que boa parte dos antigos funcionrios
do SNI foi realocada. Na realidade, esta Secretaria atuou mais como sucessora
da Secretaria Geral do Conselho de Segurana Nacional do que propriamente
do SNI (BRANDO, 2010). Ao que tudo indica, o presidente Collor extinguiu o
SNI movido, sobretudo, por sentimentos pessoais em relao instituio, e
no orientado por uma verdadeira inteno de reforma do setor de inteligncia
nacional. Este fato, aliado ao descaso com os assuntos de inteligncia, de
segurana e de defesa por parte do Congresso, bem como pelo estigma poltico
que as organizaes do setor gozavam junto sociedade civil (BRANDO, 2002),
foram responsveis por uma dcada de inexistncia de um servio de inteligncia

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
estratgica e civil no Brasil. Os servios militares, por sua vez, continuavam
intactos e sem nenhuma regulamentao que no fossem as originadas pelas
suas prprias iniciativas. De fato, a verdadeira instituio sucessora do SNI foi a
Agncia Brasileira de Inteligncia (ABIN), implementada apenas em 1999.
A estrutura da Presidncia da Repblica passou mais uma vez por alteraes
com o novo presidente Itamar Franco (1992-1994), aps o impeachment. De
certa forma, Collor havia, com a extino do SNI e outras medidas, afastado a
tutela militar da presidncia da Repblica, embora no houvesse tocado nos
servios de inteligncia militares. Em novembro de 1992, a Secretaria de Assuntos
Estratgicos foi reformulada e incorporou a recm criada Subsecretaria de
Inteligncia (SSI), atravs da Lei no 8.490. Segundo Brando (2010), houve um
retrocesso nas relaes civis-militares durante o governo Itamar Franco, com a
reintegrao de militares afastados por Collor na SSI, bem como pela ausncia de
diretrizes para o setor. A indicao para ministro-chefe da SAE de um almirante
da reserva colocou novamente a inteligncia civil sob comando de um militar,
embora a SAE permanecesse vinculada Secretaria-Geral da Presidncia da
Repblica.
Nos dois mandatos do presidente Fernando Henrique Cardoso (1995-2002),
houve uma tentativa articulada de requalificar as relaes civis-militares, atravs
da criao de um Ministrio da Defesa, a elaborao da Poltica de Defesa Nacional
(PDN), a formao da Comisso sobre Desaparecidos polticos durante o regime
autoritrio e a criao da ABIN (BRANDO, 2010:143). A PDN constituiu, na
avaliao de Diniz e Proena (1997), mais uma declarao de princpios genrica
do que uma poltica de defesa propriamente, mas se tornou um avano, j que
foi o primeiro documento do gnero. A Comisso dos Desaparecidos, por sua
vez, conseguiu lanar luz sobre centenas de casos de mortes e desaparecimentos
cometidos pelos rgos de represso poltica da ditadura e serviu de base para
as indenizaes posteriores efetuadas pelo estado brasileiro, embora no tenha
havido julgamentos por estes crimes. A Lei da Anistia recproca de 1979, que
perdoava os crimes polticos da oposio e aqueles cometidos pelos dirigentes
e agentes da represso, teve sua validade reiterada pela Constituio de 1988 e
confirmada por deciso, em 2010, do Supremo Tribunal Federal.
A criao da ABIN teve incio em 1995, no incio da presidncia de Fernando
Henrique Cardoso (1995-2002), atravs da Medida Provisria no 813. O processo
de criao da Agncia, contudo, alongou-se devido a resistncias polticas
relacionadas imagem negativa que granjearam os servios de inteligncia
no meio poltico e na sociedade durante a ditadura e tambm a presses
corporativas, at que, em 07 dezembro de 1999, foi sancionada pelo presidente
Fernando Henrique Cardoso a Lei no 9.883, que efetivava, de fato, o novo rgo.
Esta lei instituiu igualmente o Sistema Brasileiro de Inteligncia (SISBIN), que

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
estrutura este setor at o incio de 2011, pelo menos, e cuja responsabilidade a
de integrar as aes de planejamento e execuo das atividades de inteligncia
do pas. A ABIN foi designada como o rgo central do SISBIN e com misso
de planejar, executar, coordenar, supervisionar e controlar as atividades de
inteligncia do pas, diretamente vinculado ao presidente da Repblica e,
preferencialmente, sob direo civil.
Sobre as competncias da ABIN, a Lei determinou que a agncia deveria
planejar e executar aes relativas obteno e anlise de dados para a produo
de conhecimentos destinados a assessorar o presidente da repblica, planejar
e executar a proteo dos conhecimentos sensveis, relativos aos interesses e
segurana do Estado e da sociedade, avaliar as ameaas ordem constitucional,
tanto no nvel interno quanto externo e promover aperfeioamento dos recursos
humanos e da doutrina de inteligncia (BRANDO, 2010:176), no versando
sobre contra-inteligncia e aes encobertas. Merecem ateno dois pontos
relevantes e bastante positivos da Lei, aquele que regulamenta a participao
do Poder Legislativo na anlise da Poltica Nacional de Inteligncia, fixada pelo
Presidente da Repblica, e o que estabelece a responsabilidade de fiscalizao,
por parte do Congresso, sobre as atividades da ABIN. Ainda, so destacados como
princpios do sistema a preservao da soberania nacional, a defesa do Estado
democrtico de direito e a dignidade da pessoa humana.
Ainda durante o ano de 1999, alteraes importantes para a rea de
inteligncia provocaram a relativizao de alguns avanos da legislao que
criou o SISBIN, como a extino da SAE, em janeiro, e a criao do Gabinete de
Segurana Institucional (GSI) da Presidncia da Repblica, em setembro, cujas
responsabilidades estavam relacionadas extinta Casa Militar. O GSI passa a
granjear poderes crescentes durante as presidncias de Fernando Henrique
Cardoso sob forte influncia de seu ministro-chefe, o general Alberto Cardoso
e, igualmente, durante as de Lus Incio Lula da Silva (2003-2010). Hoje, seu
titular, que por determinao legal deve ser um oficial-general nomeado pelo
presidente da Repblica, possui status de ministro e a ABIN, cujo Diretor-geral
deve ser aprovado pelo Congresso, passa a ser subordinada ao GSI. Este arranjo
institucional subordina a principal agncia do sistema de inteligncia civil do
pas a ABIN , cujo Diretor-geral pode e deve preferencialmente ser um civil, a
um rgo obrigatoriamente comandado por um militar. A militarizao, agora,
formal e legal, e a ABIN permanece sem contato direto com a presidncia da
Repblica.
Apesar de representar a oficializao da atividade de inteligncia no
Brasil, a Lei deixou lacunas na regulamentao de pontos muito importantes
ao apresentar definies genricas e deixar temas implcitos. No artigo 2o, por
exemplo, no fica claro quem so os componentes do SISBIN, a Lei apenas

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
define que os rgos e entidades da Administrao Pblica Federal que,
direta ou indiretamente, possam produzir conhecimentos de interesse das
atividades de inteligncia, em especial aqueles responsveis pela defesa externa,
segurana interna e relaes exteriores, constituiro o Sistema Brasileiro de
Inteligncia, na forma de ato do Presidente da Repblica. Ainda, no h clareza
no estabelecimento da rea de competncia da atividade, do que deveria ser
protegido por segredo governamental, e, mais importante, a quem o SISBIN seria
subordinado. Por fim, outra falha identificada por Priscila Brando, de que a
Lei regulamenta a atuao da ABIN dentro do SISBIN. No so regulamentadas
as atividades de inteligncia e contra-inteligncia das polcias estaduais, dos
comandos maiores e nem mesmo da Polcia Federal, que so de importncia
fundamental para o funcionamento de nossas bases institucionais (BRANDO,
2010:178).
O estabelecimento dos rgos acima citados no significou o fim da
institucionalizao da atividade de inteligncia no Brasil. Nos anos seguintes,
e at o presente momento, a rea continua a passar por mudanas estruturais
importantes, algumas positivas para a consolidao da democracia e para o
controle democrtico sobre as atividades de inteligncia, outras, no. No
sendo possvel fazer uma anlise de todas as alteraes j realizadas no campo
legal, buscaremos analisar algumas que se destacam. Marco Cepik, em Regime
Poltico e Sistema de Inteligncia no Brasil: Legitimidade e Efetividade como
Desafios Institucionais, lista e analisa cinco destas modificaes. Primeiramente,
a subordinao da ABIN ao Gabinete de Segurana Institucional foi uma das
alteraes que acarretou o aumento das responsabilidades do GSI, o qual,
no governo de Fernando Henrique Cardoso, transformou-se no principal
instrumento agregador dos fluxos informacionais vindos de vrios rgos federais
e no locus de gesto de crises nas reas de segurana interna e externa (CEPIK,
2005:84).
Em segundo lugar, a criao da Comisso Mista de Controle das Atividades
de Inteligncia (CCAI), atravs do Projeto de Resoluo do Congresso Nacional no
08, de 2001, implementou o j previsto rgo de Controle e Fiscalizao Externo.
Todavia, esta Comisso bastante inoperante; seu projeto de regulamento interno
ainda no havia sido aprovado at o fechamento deste captulo (2011). Em terceiro
lugar, o Decreto Executivo no 4.376, de 13 de setembro de 2002, regulamentou
a participao dos ministrios no mbito do SISBIN atravs da determinao
das unidades de cada ministrio que fariam a interao com o Sistema,
contribuindo assim para a delimitao da organizao dele. Ainda, o Ministrio
da Defesa criou, em 2002, o Subsistema de Inteligncia de Defesa (SINDE) com
a finalidade de articular, com o Ministrio da Defesa, os centros de inteligncia
da Marinha, Exrcito, Aeronutica e Estado-Maior de Defesa. Por fim, a ltima
mudana aqui destacada, a criao do Subsistema de Inteligncia de Segurana

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
Pblica (SISP), em 21 de dezembro de 2000. Cepik ressalta que, at 2005, seu
potencial integrador de fluxos de informao nas reas de inteligncia criminal,
inteligncia de segurana (interna), contra-inteligncia e contraterrorismo foi
pouco desenvolvido (CEPIK, 2005:89).
A expanso do SISBIN, atravs da criao dos dois subsistemas acima
mencionados, deveria incrementar a cooperao entre as agncias. Persistem,
contudo, sobreposies de interesse, alm de baixa especializao formal
caractersticas que dificultam a integrao de fluxos informacionais. O SISP
coordenado pela Secretaria Nacional de Segurana Pblica (SENASP), do
Ministrio da Justia, e tem entre seus principais componentes operacionais: o
Departamento de Polcia Federal (DPF) e o Departamento de Polcia Rodoviria
Federal (DPRF), do Ministrio da Justia; Conselho de Controle de Atividades
Financeiras (COAF), Coordenao Geral de Pesquisa e Investigao (COPEI) e
Secretaria da Receita Federal (SRF), do Ministrio da Fazenda; alm do Ministrio
da Integrao Regional, Ministrio da Defesa (SPEAI) e Gabinete de Segurana
Institucional da Presidncia da Repblica (ABIN e SENAD), bem como polcias
civis e militares dos 26 estados e do Distrito Federal. Nessa lista incompleta de
organizaes vinculadas, fica evidente a abrangncia desse subsistema que, na
prtica, transforma-se em um sistema apenas parcialmente integrado ao SISBIN
(CEPIK, 2009).
J o segundo subsistema, o SINDE, coordenado pelo Departamento
de Inteligncia Estratgica (DIE) do Ministrio da Defesa e foi uma tentativa
de articular este ministrio com os centros de inteligncia da Marinha,
Exrcito, Aeronutica e Estado-Maior de Defesa. Ao Ministrio de Defesa esto
subordinados formalmente os servios de inteligncia de cada fora, bem como
secretarias e chefias responsveis pela inteligncia estratgica e operacional. Os
servios militares de inteligncia e, portanto, o SINDE, no constituem o foco
deste trabalho, mas significativo que todos eles mudaram de denominao com
a democratizao do pas, estigmatizados que estavam por terem participado
diretamente da represso poltica ao contrrio do SNI, que manteve a sua
denominao durante todo governo Sarney. A Fora Area Brasileira foi a primeira
a iniciar seu processo de reorganizao, quando o Ministrio da Aeronutica
criou sua Secretaria de Inteligncia (SECINT), em janeiro de 1991, na mesma
poca em que a Marinha cria o Centro de Inteligncia da Marinha (CIM), em
substituio ao CENIMAR. Posteriormente, em 2004, a SECINT transforma-se em
Centro de Inteligncia da Aeronutica (CIAer), sua atual denominao. O servio
de informaes do Exrcito foi o mais demorado dos trs rgos a esvaziar suas
atribuies, talvez pelo fato de ele ter sido um dos maiores rgos de informao
e represso poltica durante o regime militar. Em 1992, o CIE mantm a sigla,
mas passa a utilizar o termo Inteligncia em seu nome, tornando-se o Centro de
Inteligncia do Exrcito. Mais tarde ocorreu a criao da Escola de Inteligncia

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
Militar do Exrcito, com o objetivo de reabilitar antigos servidores e preparar
novos analistas de inteligncia.
Este o perodo, portanto, em que os rgos da comunidade de
informaes brasileira comeam a substituir o termo informaes, utilizado
durante a ditadura, por inteligncia em seus documentos e em suas
denominaes, possivelmente como forma de se desvencilhar do estigma
do passado, alm de acompanhar a modernizao da denominao do setor
(BRANDO, 2002). Mendona (2010) descreve detalhadamente a formao de
subsistemas de inteligncia de cada fora armada singular, no qual cada um
integra vrios rgos sem controle civil.
Por fim, houve a criao do Ministrio da Defesa, em 09 junho de 1999, e a
transformao dos Ministrios da Marinha, Exrcito e Aeronutica em Estados-
Maiores, cuja repercusso na rea de inteligncia militar foi sua subordinao
aos comandantes de cada Estado-Maior. O Ministrio da Defesa possui tambm
uma Subchefia de Inteligncia, a qual cabe a funo de propor as bases para
a doutrina, alm de coordenar o Departamento de Inteligncia Estratgica
(DIE), atualmente pertencente Secretaria de Poltica, Estratgia e Assuntos
Internacionais (SPEAI), a quem estava designada a funo de execuo. O
Ministrio da Defesa, alm de racionalizar custos e melhor integrar as foras
armadas singulares, significou um passo importante para o relacionamento mais
democrtico entre civis e militares e diminuiu igualmente a presena militar no
centro do poder poltico. Seu desenvolvimento, entretanto, ocorreu de forma
muito dificultosa, com grande resistncia dos militares, cujas foras singulares
perderam o status de ministrio. Houve vrios ministros, todos civis, durante sua
ainda curta existncia, mas a maioria se demitiu em decorrncia de crises mais
ou menos abertas com a hierarquia militar.
A presidncia Lula, em seus dois mandatos (2003-2010), deixou um legado
ambguo a respeito da institucionalizao das organizaes e atividades de
inteligncia e de segurana internas. No primeiro mandato, Lula praticamente
nada alterou no setor, mas estabeleceu formalmente, por intermdio da Lei
no 10.683, de 28/05/2003, a coordenao da ABIN pelo GSI, comandado por
um general. Igualmente, no realizou alteraes na inteligncia militar, pelo
contrrio, aumentou paulatinamente as atribuies de inteligncia do Ministrio
da Defesa (MD) (MENDONA, 2010). apenas em julho de 2007, com a posse do
Ministro Nelson Jobim, ex-presidente do STF e um dos principais redatores da
Constituio de 1988, que o MD comea a ganhar estatura poltica, influncia nos
assuntos de defesa e a subordinar os respectivos comandos militares. O ministro
Jobim se tornou um intermedirio de confiana entre os militares e o governo
de esquerda durante o governo Lula. A atual presidente Dilma Roussef, que
tomou posse em 01 de janeiro de 2011, o manteve inicialmente como ministro da

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
pasta.7 Foram ainda elaborados, durante a presidncia Lula, a Poltica Nacional
de Defesa, em junho de 2005, e a Estratgia Nacional de Defesa, em dezembro de
2008, que, gradativamente, auxiliam a institucionalizao democrtica do setor.
Todavia, a alterao mais significativa nas relaes institucionais entre
poder civil e militar ocorreu recentemente, com as modificaes legislativas
introduzidas pela Lei Complementar no 136, em 25/08/2010, que transforma o
antigo Estado-Maior de Defesa que era subordinado ao MD, mas at ento com
poderes limitados em relao s Foras Armadas em Estado-Maior Conjunto
das Foras Armadas (EMC-FA), doravante responsvel pelo emprego, e aos
Comandantes das Foras Singulares, o preparo do Poder Militar. Em razo destas
competncias, o Chefe do EMC-FA situa-se na mesma hierarquia e linha de
prioridade dos Comandantes das trs Foras. (...) Com efeito, o ministro da Defesa
passou a estar inserido na cadeia de comando das Foras Armadas. Pela legislao
anterior, ele ficava na lateralidade como um [mero] chefe administrativo
(MENDONA, 2010:60). Adicionalmente, a legislao permitiu no apenas que
o ministro nomeasse indiferentemente civis ou militares para as Secretarias do
MD, antes restritas aos militares, como tambm adquirisse mais prerrogativas
na promoo dos generais.
Estas importantes modificaes legais para a alterao das relaes civis-
militares no Brasil em que, desde 1985, os militares exerciam efetivamente
autonomia no que dizia respeito s polticas de defesa e ao funcionamento de
suas instituies no foram acompanhadas por medidas semelhantes na rea
de inteligncia. Ao contrrio, o escopo da inteligncia militar foi ampliado e a
inteligncia civil, cujo rgo mximo a ABIN, que coordena legalmente o SISBIN,
encontra-se em crise, aps o envolvimento em mais um escndalo poltico,
a Operao Satiagraha, em 2008. Este epteto designa uma operao policial-
judiciria, comandada por um delegado da Polcia Federal, sobre um escndalo
financeiro que envolvia um banco de investimentos, companhias telefnicas e
a luta entre eles pela obteno do controle acionrio das companhias estatais
que haviam sido privatizadas no fim da dcada de 1990. A investigao policial
se utilizou de dezenas de agentes da ABIN, apesar de dirigida por um delegado
da PF, e acabou resultando no escndalo e na crise institucional das supostas
escutas clandestinas. Estas teriam sido realizadas por agentes da ABIN, que teriam
igualmente gravado conversas do Presidente do Supremo Tribunal Federal e de
outras autoridades.


 &RQWXGR R PLQLVWUR GHX GHFODUDHV TXH LQFRPRGDUDP R JRYHUQR GH 'LOPD GHVJDVWDQGR VXD
SRVLRDWWRUQODLQVXVWHQWYHO(PGHDJRVWRGHDSUHVLGHQWH'LOPDFRQYLGRXRH[FKDQFHOHU
&HOVR$PRULPSDUDFRPDQGDUDSDVWDGD'HIHVDRTXHIRLUHFHELGRFRPGHVFRQILDQDSHORVPLOLWDUHV
SULQFLSDOPHQWHSHODVSRVLHVSROWLFDVGH$PRULPIUHQWHDR,WDPDUDW\

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
O envolvimento da ABIN, em tal escala, com questes policiais de ordem
interna , de fato, esdrxulo e nunca foi bem explicado.8 H o fato de que o
ento diretor-geral da ABIN tambm era delegado da PF; e, em decorrncia do
escndalo, foi substitudo no posto. Mendona utiliza-se, como Priscila Brando,
do recurso analtico de path-dependency (COLLIER & COLLIER, 1991) mas,
ao contrrio da autora, em nvel puramente organizativo e institucional para
demonstrar como o caso Satiagraha foi um momento crtico para o conjunto
ABIN/SISBIN. Este pesquisador, e oficial de inteligncia concursado da ABIN,
como fez questo de esclarecer em sua dissertao da ESG, escora-se tambm
no argumento de Wolfgang Krieger (2009) de que o mais poderoso controle das
atividades de Inteligncia o controle legislativo e suas comisses especficas.
Todavia, segundo este autor, o legislativo geralmente ineficiente e mesmo
negligente at a ecloso de um escndalo poltico ou de um erro de inteligncia
grave no setor. Neste momento, o poder legislativo reage, quer estabelecendo
comisses de inqurito, quer formando comisses para reformas do sistema
de inteligncia, como veio a acontecer a partir do caso Satiagraha, no Brasil, e
dos atentados de 11 de Setembro de 2001 nos Estados Unidos, situaes que
Mendona compara em seu trabalho.
Aps a denncia da suposta escuta clandestina do presidente do STF, o
presidente Lula decide afastar a cpula da ABIN e cria, em fevereiro de 2009,
um Comit Ministerial para Elaborao da Poltica Nacional de Inteligncia e
Reavaliao do Sistema Brasileiro de Inteligncia, com prerrogativa de sugerir
medidas e reformas em todo o sistema (MENDONA, 2010:120). A Comisso
virou palco de disputa burocrtica que envolvia primordialmente o MD e o GSI,
bem como, secundariamente, o Ministrio das Relaes Exteriores. A Comisso
Ministerial (GT-SISBIN), onde a ABIN estaria sub-representada, realizou cerca
de quarenta reunies entre maro e agosto de 2009, e apresentou seus resultados
ao Presidente da Repblica em novembro do mesmo ano. A principal sugesto
do GT-SISBIN a de uma reformulao profunda do sistema de inteligncia
brasileiro e do papel da ABIN nele, pois esta agncia deixaria de ser o rgo
coordenador do sistema de inteligncia nacional, em prol de um colegiado
de mais alto nvel. Assim, a proposta sugere a criao de uma nova camada
superior, a cargo do GSI, seguindo a tendncia de expanso vertical do sistema
de inteligncia (CEPIK, 2003). Esta nova superestrutura coordenaria quatro
subsistemas (estratgica, defesa, segurana pblica e econmica), cabendo
ABIN apenas a coordenao do subsistema de inteligncia estratgico. Esta
proposio contraria, de fato, o esprito da lei que instituiu a agncia e o SISBIN,


 $$%,1MKDYLDVLGRHQYROYLGDGLUHWDRXLQGLUHWDPHQWHHPRXWURVHVFQGDORVTXHOKHIL]HUDP
SHUGHUJUDXVGHOLEHUGDGHQRVLVWHPDGHLQWHOLJQFLDFRPRVXDVXERUGLQDRDR*6,ORJRDSVR
FDVRGDVJUDYDHVFODQGHVWLQDVGHHPSUHVULRVHDXWRULGDGHVGXUDQWHRSURFHVVRGHSULYDWL]DR
GHDOJXPDVHPSUHVDVHVWDWDLVQRILQDOGDGFDGDGH9HU%5$1'2  

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
em 1999, que garantia, via ABIN, a coordenao civil de todo o sistema de
inteligncia nacional (MENDONA, 2010:131).
O problema principal da institucionalizao da inteligncia civil no seria,
portanto, o estigma que sofre a ABIN de ser a herdeira do SNI 9 ou sua militarizao
interna que, segundo Mendona, est declinante mas a de ser impedida de se
tornar a principal instituio civil de coordenao da inteligncia de Estado. Em
suas palavras: [A ABIN] alvo de crticas e disputas intragovernamentais as quais,
em princpio, tm suas origens no que se convencionou chamar de competio
burocrtica por poder ou autonomia no mbito do sistema estatal de deciso
estratgica (MENDONA, 2010:125). Neste caso, os militares procuram ampliar
seu territrio e os diplomatas, por sua vez, aliam-se ou com eles ou com os
agentes da ABIN, ao sabor de suas convenincias (Idem, 2010:153).
Alm dos problemas relativos institucionalizao do SISBIN sob
controle civil e democrtico e s prerrogativas militares remanescentes da
transio pactuada, na inefetividade do Estado de Direito democrtico
para boa parte da populao, explicitada pela violncia generalizada e pela
falncia da segurana pblica, que reside, em nosso entender, a caracterstica
mais insidiosa para o aprofundamento do regime democrtico no Brasil.
Inefetividade e violncia que atingem primordialmente os mais pobres. Com
efeito, o Estado no consegue exercer o monoplio da violncia e impor a
ordem poltico-democrtica no conjunto do territrio nacional. Por sua vez,
as agncias estatais resistem em atender com equidade e em reconhecer os
direitos da populao mais pobre e das minorias sociais; especialmente os
rgos de segurana pblica, que persistem no emprego de mtodos arbitrrios
e violentos sobre estes setores. ODonnell utiliza-se do conceito de cidadania
de baixa intensidade e de democracia iliberal para descrever a situao na
qual se respeitam os direitos participativos e democrticos da poliarquia, mas
se viola o componente liberal da democracia. (...) Esta bifurcao constitui
o reverso da moeda da complexa mescla de componentes democrticos e
autoritrios nestes estados (ODONNELL, 1993).
Sinal dos tempos, em 2010, foras do Exrcito e da Marinha, juntamente
com as polcias estaduais do Rio de Janeiro e da PF, participaram de uma grande
operao de policial em uma favela do Rio de Janeiro, indcio de militarizao
tambm na segurana pblica, bem como de federalizao das secretarias de
segurana pblica estaduais, cujos titulares so, hoje, em boa parte delegados de
polcias federais. A PF, baseada em seus recursos e em sua reputao de probidade
e eficincia, estende sua influncia sobre a inteligncia interna e de segurana
pblica e sobre as polcias estaduais, o que demonstra a falncia das estruturas
de ordem pblica da maioria dos entes federados no Brasil.


 9HU3ULVFLOD%5$1'2  HREUDPDLVUHFHQWHGDPHVPDDXWRUD %5$1'2 

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
No recente perodo de redemocratizao, a primeira tentativa de
formulao de um plano nacional de segurana pblica veio tona no segundo
mandato do presidente Fernando Henrique Cardoso (1999-2002), quando ele
lanou um documento que trazia importantes contribuies formulao
de polticas de segurana pblica, distanciando-se da reproduo acrtica
da tradio autoritria que caracterizara os governos anteriores: preveno
da violncia, por meio da implementao de programas sociais, o Plano de
Integrao e Acompanhamento dos Programas Sociais de Preveno da Violncia
(PIAPS), bem como pela afirmao da agenda de Direitos Humanos, enfatizada
com a criao da Secretaria Nacional de Direitos Humanos e com o primeiro
Plano Nacional de Direitos Humanos. Paralelamente, a atuao da Secretaria
Nacional de Segurana Pblica (SENASP) e a criao de um Fundo Nacional de
Segurana Pblica exemplificam a ateno dada pelo governo FHC ao setor, muito
embora a falta de sistematizao e de coordenao entre as instituies, bem
como a carncia de verbas e os atritos polticos, tenham inviabilizado muitos dos
objetivos propostos. Em suma, foi na presidncia de Fernando Henrique Cardoso
que tiveram lugar as iniciativas mais importantes para alterar as relaes civis
militares, com a criao do Ministrio da Defesa, e institucionalizar a inteligncia
estratgica civil, atravs da ABIN e do SISBIN.
No primeiro mandato do presidente Lula (2003-2006), um novo Plano
Nacional de Segurana Pblica foi incorporado ao programa de governo, tendo
incio a sua execuo por meio da SENASP. Por sua vez, sucessivas aes da Polcia
Federal foram levadas a cabo e amparadas por ampla cobertura da mdia, o que
contribuiu para a construo de uma identidade perante a opinio pblica de
competncia e destemor. Em agosto de 2007, o governo federal lana o Programa
Nacional de Segurana Pblica com Cidadania (Pronasci), propondo envolver
dezenove ministrios e articular estados e municpios nas suas 94 aes. Menos
do que uma alternativa aos planos anteriores na rea de segurana pblica, o
Pronasci reitera o Plano Nacional de Segurana Pblica do primeiro mandato do
presidente Lula, o qual, por sua vez, incorporava, sistematizava e explicitava o que
j estava, embrionria ou tacitamente, presente no Plano Nacional do governo
Fernando Henrique Cardoso (SOARES, 2007:92). Em acrscimo iniciativa do
Pronasci, o Ministrio da Justia em parceria com o Conselho Nacional do
Ministrio Pblico (CNMP) e o Conselho Nacional de Justia (CNJ) formulou,
em fevereiro de 2010, a Estratgia Nacional de Justia e Segurana Pblica
(ENASP). Todavia, ainda falta muito para avanar os princpios e procedimentos
democrticos nesta rea.

&RQVLGHUDo}HV)LQDLV
O objetivo central do trabalho consistiu na comparao entre os arranjos
institucionais dos servios de inteligncia e de segurana interna de Portugal

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
e Brasil, que permitisse uma melhor compreenso do desenvolvimento destas
instituies e de seus desafios atuais, a partir dos processos de democratizao
nos dois pases. Alguns estudiosos dos processos de democratizao na Amrica
Latina destacam, com efeito, uma forte afinidade entre tipos de regimes
autoritrios precedentes, modos de transio democracia e dilemas decorrentes
das caractersticas destes processos para a consolidao dos novos regimes
democrticos (NOHLEN & THIBAUT, 1994), o que caracteriza um padro de path-
dependency. Este debate enquadra boa parte dos estudos realizados sobre os
servios de inteligncia e manuteno da ordem interna aps a redemocratizao,
embora com nuances significativas entre eles.
Ao tratar de Portugal, Antnio Costa Pinto (2010), ressalta igualmente a
importncia do modo de transio, se por ruptura ou pactuada, para a definio
das caractersticas e dos dilemas do novo regime democrtico. O autor descreve
a grande ruptura, em Portugal, com a ordem anterior a Revoluo dos Cravos
de abril de 1974 que implicou o desmantelamento do aparato de inteligncia e
de polcia poltica da ditadura e o afastamento da tutela militar sobre o sistema
poltico j em 1982, marco inicial da consolidao democrtica do pas. Portugal
torna-se, assim, uma espcie de caso de controle exemplar da democratizao dos
servios de inteligncia e de consolidao da democracia, durante poucos anos,
em contraste com o caso brasileiro (NUMERIANO, 2007). Entretanto, como bem
demonstra Antnio Costa Pinto, a democratizao no pas no se desenvolveu
de forma linear, nem sem conflitos agudos, devido ao peso do duplo legado da
revoluo de Abril: o protagonismo dos militares e a forte influncia do Partido
Comunista Portugus.10
Neste caso, a path-dependency muito evidente e a varivel explicativa
fundamental para a institucionalizao democrtica daquelas organizaes
reside mais no tipo de transio do que nas caractersticas do regime anterior,
na natureza da ruptura, como bem explica Antnio Costa Pinto (2010:407);
ruptura que foi exemplar em Portugal, inclusive com golpe de estado militar para
instaurar a democracia. Cremos que, efetivamente, nos modos de transio por
ruptura com o regime anterior, a varivel modo de transio decisiva, pois os
novos dirigentes buscam conscientemente romper com as instituies e prticas
do passado; portanto, o tipo de regime anterior perde importncia no desenho
das novas instituies polticas e coercitivas. Naqueles pases onde as ditaduras
caram por colapso, como na Argentina, ou por golpe, como em Portugal, o novo
regime democrtico possui menos constrangimentos e legados autoritrios da
transio, o que lhe permite impor uma ruptura poltica e institucional profunda


 3DUDXPDDQOLVHPDLVGHWDOKDGDGD5HYROXRGR&UDYRVHVHXVGHVGREUDPHQWRVYHU6FKPLWWHU
 

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
em relao ao ancien rgime, sobretudo no que concerne aos rgos coercitivos
e de inteligncia.
Mesmo assim, o novo sistema de inteligncia portugus demorou quase
uma dcada para ser criado aps a Revoluo de Abril, e foi antecedido pela
afastamento da tutela militar e pelo incio da consolidao da democracia, com a
reforma constitucional de 1982. Fenmeno semelhante ocorreu no Brasil, entre a
extino do SNI da ditadura, no incio da presidncia Collor, em 1990, e a efetiva
criao da ABIN no final de 1999, no incio do segundo mandato de Fernando
Henrique Cardoso. Esta coincidncia pode ter vrias causas, mas certamente
traduz a dificuldade das novas democracias mesmo naquelas que rompem
definitivamente com o antigo regime, como em Portugal para lidar com o
estigma dos servios de inteligncia criados nos tempos de represso poltica.
Conforme os diversos autores, as variveis explicativas que relacionam
democratizao e novas instituies de inteligncia e segurana interna
mudam de relevncia para a explicao dos constrangimentos ao controle
civil e democrtico sobre as organizaes de inteligncia brasileiras ps-
democratizao. Para aqueles, como Zaverucha (2000, 2005) e Numeriano (2010),
que privilegiam na anlise as relaes civis-militares, o fator mais importante a
desmilitarizao dos rgos de inteligncia externa e interna, condio necessria
para a consolidao do regime democrtico, a qual, para estes autores, no foi
ainda alcanada no Brasil. Numeriano (2007:283) considera que a inteligncia
civil brasileira est ainda em transio, sob hegemonia dos militares, e lembra
Boraz & Bruneau (2006), para quem a consolidao da democracia s estar
confirmada com o controle civil sobre a rea de inteligncia.
J, Cepik (2005, 2009), Priscila Brando (2010) e Mendona (2010) esto
mais atentos aos fatores institucionais, aos interesses e interao entre os
principais atores da rea. Todavia, h nuances entre todas estas interpretaes.
Priscila Brando atribui ao legado da transio e s escolhas feitas pelos atores
relevantes nos momentos crticos destes processos que, no caso brasileiro,
teve lugar no ano de 1984, quando da grande campanha popular frustrada
por eleies diretas para presidente da Repblica as principais origens dos
constrangimentos institucionalizao do setor de inteligncia civil no Brasil.
Nessa interpretao, tambm calcada no modelo de path-dependency, o tipo
de regime anterior teria menor valor explicativo que o modo de transio,
processo que deixou legados autoritrios (militarizao, estigma dos rgos de
inteligncia, descaso poltico e social para com o setor, etc.) que ainda dificultam,
no seu entender, a institucionalizao legitimada dos servios de inteligncia e a
supremacia poltica civil sobre os militares. Segundo a autora, na estrutura atual
dos servios de inteligncia ainda preponderam os interesses militares sobre
os civis (BRANDO, 2010). Esta pesquisadora conclui que a forma de transio

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
influencia mais o padro das relaes civis-militares no novo regime democrtico
que a reforma das instituies de inteligncia, cujos resultados encontram-se
muito mais ligados ao desempenho da sociedade poltica do que aos acordos
celebrados na transio (Idem, 2010:257).
Assim, para Brando, o interesse civil e legislativo torna-se uma varivel
mais relevante do que os constrangimentos institucionais no processo de
refundao das agncias nacionais civis de inteligncia no Brasil, no Chile e na
Argentina (Idem, 2010:259). No caso brasileiro, a extino do SNI no incio do
governo Collor bem o demonstrou, embora o governo no tivesse um projeto
alternativo. Quando o governo de Fernando Henrique Cardoso iniciou uma
reforma mais profunda nas relaes civis-militares e criou uma agncia civil que
coordenasse o sistema de inteligncia do pas, enfrentou resistncias ideolgicas,
corporativas e o descaso da sociedade poltica com estas alteraes, ainda
inconclusas e indefinidas.
A argumentao de Cepik distancia-se das teses que estabelecem vnculos
fortes entre o modo de transio e seus efeitos sobre a institucionalizao dos
servios de inteligncia e segurana pblica, embora reconhea a repercusso
daqueles processos sobre os constrangimentos atuais que pesam sobre
o setor.11 Este pesquisador, em trabalho sobre as agncias de inteligncia
brasileiras, baseado em modelo de Peter Gill (1994), conclui que, em 2004,
as reformas estruturais brasileiras na rea de inteligncia foram em larga
medida bem-sucedidas do ponto de vista de sua adequao ao contexto de um
regime democrtico consolidado (CEPIK, 2005:97). Todavia, ele alerta que a
profissionalizao dos servios de inteligncia no Brasil ainda depende de um
longo percurso no que diz respeito s Foras Armadas e polcia (Idem, 2005:96)
e que a inteligncia domstica est superdimensionada em relao externa,
bem como muito prxima das questes que envolvem a segurana do Estado e
a criminalidade violenta (CEPIK, 2009:vi).
Mendona (2010), por sua vez, o nico autor que no inclui os processos
de democratizao como uma varivel que influencia a configurao atual dos
rgos de inteligncia. Este autor analisa a evoluo da legislao que instituiu
o Sistema de Inteligncia Brasileiro e a Agncia Brasileira de Inteligncia, em
1999, que consagrava a supremacia do poder civil sobre a inteligncia de estado
(2010:129). A situao atual do setor, no entender do autor, caracteriza-se por
uma hipertrofia da inteligncia militar (2010:77) e por uma profunda disputa
intercorporativa entre militares, diplomatas e civis da ABIN, na qual os dois

 0DUFR&HSLNXWLOL]DHPHVWXGRVREUHDRULJHPGRVVHUYLRVGHLQWHOLJQFLD  DVFRQFOXVHV




GH$P\=HJDUW  SDUDTXHPDVYDULYHLVH[SOLFDWLYDVFRPPDLRULQIOXQFLDQDHYROXRGRV


UJRVGHVHJXUDQDQDFLRQDOVRGHFDUWHUSROWLFRHLQVWLWXFLRQDO

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
primeiros atores tentam impedir que este servio desempenhe efetivamente o
papel de rgo coordenador do SISBIN.
O projeto de Programa Nacional de Inteligncia, realizado pelo GT-SISBIN
ainda no foi aprovado, pois o presidente Lula sugeriu que a Comisso Mista
de Controle dos Assuntos de Inteligncia (CCAI) do Congresso elaborasse
um parecer sobre o documento. Entretanto, mesmo com a troca de governo,
a dinmica da reforma no arrefece. A nova Presidente da Repblica, Dilma
Roussef, que tomou posse em 01 de janeiro de 2011, j removeu a Secretaria
Nacional Anti-Drogas (SENAD) do Ministrio da Defesa para o da Justia, o
que sinaliza uma desmilitarizao do setor de segurana pblica. Os atores
interessados tampouco se desmobilizam. Assim, representantes da Associao
Nacional dos Oficiais de Inteligncia (AOFI) entregaram uma carta endereada
presidente Dilma, em fevereiro de 2011, onde reivindicam o fim da subordinao
militar ou policial da ABIN e acesso direto ao chefe de governo. A missiva
teria sido uma reao a supostas tentativas de interferncia do novo ministro-
chefe do GSI, um general do Exrcito, na ABIN (ZERO HORA, 09/02/2011, p. 6).
De todo modo, os oficiais da agncia, ao tambm se referirem tutela policial,
sugerem que tampouco preferem que seu diretor-geral seja um delegado da PF,
como ocorreu nos ltimos anos.
Percebe-se que o sistema de inteligncia brasileiro evolui com avanos e
recuos, no que concerne a sua coordenao civil e a seu controle democrtico,
e encontra-se, no incio de 2011, em mais um momento crtico de sua
institucionalizao. No que diz respeito aos modelos de path-dependency
baseados nos processo de democratizao, podemos afirmar que no caso das
transies pactuadas e graduais, como a brasileira, torna-se muito difcil discernir
o peso das variveis ligadas ao tipo de regime anterior, modo de transio e
dinmica da consolidao democrtica, pelo grau de influncia de uma fase
sobre outra. H a necessidade de mais estudos empricos e comparativos para
o avano da teoria sobre o tema.
Em suma, a estrutura do sistema de inteligncia brasileiro, ao contrrio
daquela de Portugal, defronta-se ainda com o desafio de se institucionalizar,
em perodo de conflito e de indefinio aguda em relao ao seu futuro
prximo, embora as primeiras atitudes do novo governo sejam alvissareiras.
No que concerne ao provimento da ordem pblica democrtica, segundo Luiz
Eduardo Soares (2007:86), pesquisador e ex-secretrio de segurana pblica do
estado do Rio de Janeiro, a transio democrtica no se estendeu segurana
pblica, a qual se mostra ainda, do ponto de vista dos interesses da cidadania,
ineficiente. Desta constatao, emerge como prioridade fundamental para
o setor, na atualidade, a reforma profunda na estrutura e nas instituies de
segurana pblica do pas (federais e estaduais), bem como o desenvolvimento

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
institucional das organizaes de inteligncia e de manuteno da ordem, sob
direo e controle poltico civil.

5()(51&,$6
ALENTE, Manuel Monteiro Guedes (Coord). (2005). I Colquio de Segurana Interna.
Instituto Superior de Cincias Policiais e Segurana Interna. Coimbra, Edies
Almedina.
ARTURI, Carlos S. (2000). Le Brsil: une tentative de dmocratisation octroye (1974-
1985). Villeneuve dAscq, Presses Universitaires du Septentrion, 502 p.
ARTURI, Carlos S. (2001). O Debate sobre Mudana de Regime Poltico Luz do Caso
Brasileiro. Revista de Sociologia e Poltica, Curitiba, n. 17.
BADIE, Bertrand; HERMET, Guy. (1990). Politique Compare. Paris, PUF.
BERMEO, Nancy. (1992). Democracy and the Lessons of Dictatorship. Comparative
Politics, v. 24, n. 3.
BORAZ, Steven & BRUNEAU, Thomas. (2006). Democracy and Effectiveness. Journal
of Democracy, v. 17, n. 3, National Endowment for Democracy and The Johns Hopkins
University Press.
BRANDO, Priscila C. (2010). Servios Secretos e Democracia e no Cone Sul: premissas
para uma convivncia legtima, eficiente e profissional. Niteri, mpetus.
BRANDO, Priscila Carlos. (2002). SNI & ABIN: uma leitura da atuao dos servios
ao longo do sculo XX. Rio de Janeiro, Editora FGV.
BRUNEAU, Thomas C. & MATEI, Florina C. (2008). Hacia una Nueva Conceptualizacin
de la Democratizacin y las Relaciones Civiles Militares. Democratization, v. 15, n. 5, pp.
909-929. ISSN 1351-0347 print/1743-890X online. DOI: 10.1080/13510340802362505
# 2008 Taylor & Francis.
CARRILHO, Maria. (2000). Foras Armadas e Democracia. In: PINTO, Antnio Costa
(Coord). Portugal Contemporneo. Madri, Edies Seguitur, p.143-159.
CEPIK, M. 2009. Prlogo. In: SWENSON, Russel G. & LEMOZY, Susana C. (2009).
Democratizacin de la Funcin de Inteligencia. El Nexo de la Cultura Nacional y la
Inteligencia Estratgica. Washington, National Defense Intelligence College.
CEPIK, Marco & BRANDO, Priscila Carlos. (2003). The New Brazilian Intelligence
System: An Institutional Assessment. International Journal of Intelligence and Counter
Intelligence, Nova York - NY, v. 16, n. 2, p. 167-194.
CEPIK, Marco. (2001). Espionagem e democracia: agilidade e transparncia como
dilemas na institucionalizao de servios de inteligncia. Rio de Janeiro, Editora FGV.
CEPIK, Marco. (2003). Sistemas nacionais de Inteligncia: Origens, Lgica de Expanso
e Configurao Atual. Dados (Rio de Janeiro), Rio de Janeiro, v. 46, n. 01, pp. 75-128.
CEPIK, Marco. (2005). Regime Poltico e Sistema de Inteligncia no Brasil: legitimidade
e efetividade como desafios institucionais (1999-2004). Dados (Rio de Janeiro), Rio
de Janeiro, v. 48, n. 01, p. 67-113.

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
COLLIER, David & COLLIER, Ruth. (1991). Shaping the Political Arena. Princeton,
Princeton University Press.
CRUZ, Manuel Brada da. (2000). A Evoluo da Democracia Portugues. In: PINTO,
Antnio Costa (Coord). Portugal Contemporneo. Madri, Edies Seguitur, p.122-142.
DARAJO. Maria Celina & CASTRO, Celso. 2001. Militares e Poltica na Nova
Repblica. Rio de Janeiro, Editora da FGV.
FICO, Carlos. (2001). Como eles agiam. Rio de Janeiro, Record.
FIGUEIREDO, Lucas. (2005). Ministrio do Silncio A histria do servio secreto
brasileiro de Washington Lus a Lula (1927-2005). Rio de Janeiro, Editora Record.
GILL, Peter. (1994). Policing Politics: Security Intelligence and the Liberal Democratic
State. London, Frank Cass.
GOUVEIA, Jorge Bacelar & PEREIRA, Rui (Coords). (2007). Estudos de Direito e
Segurana. Coimbra, Edies Almedina.
HUNTER, Wendy. (1997). Eroding military influence in Brazil: politicians against
soldiers. Chapel Hill, The University of North Carolina Press.
HUNTINGTON, Samuel P. (1991). The Third Wave: democratisation in the late
twentieth century. Norman, University of Oklahoma Press.
KRIEGER, Wolfgang. (2009). Oversight of Intelligence: A Comparative Approach. In:
TREVERTON, Gregory & AGRELL, Wilheim. National Intelligence System: Current
Research and Future Prospects. Cambridge (UK), Cambridge University Press.
LAMOUNIER, Bolivar. (1988). O Brasil autoritrio revisitado : o impacto das eleies
sobre a Abertura. In: STEPAN, Alfred. Democratizando o Brasil. So Paulo, Paz et
Terra, pp. 92-115.
LESSA, Renato. (1989). Reflexes sobre a gnese de uma democracia banal. In: DINIZ,
E., BOSCHI, R., e LESSA, R. (1989). Modernizao e Consolidao Democrtica no
Brasil: dilemas da Nova Repblica. So Paulo, Vrtice.
LISI, Marco. 2007. O PCP e o processo de mobilizao entre 1974 e 1976. Anlise
Social, vol XLII (182), pp.181-205.
LOBO, MAGALHES & PINTO. (2009). As Instituies Polticas da democracia
portuguesa. In: CABRAL, M; LOBO, M; FEIJ, R. (orgs.) Portugal: uma democracia
em construo: ensaios de homenagem a David B.Goldey. Lisboa, ICS, Imprensa de
Cincias Sociais, p.141-174.
LOFF, Manuel & PEREIRA, Maria da Conceio Meireles. (2006). Portugal 30 Anos de
Democracia (1974 2004). Actas do Colquio realizado na Faculdade de Letras da
Universidade do Porto. Porto, Editora da Universidade do Porto.
MENDONA, Ariel M. de. (2010). A Proposta de Reformulao do Sistema Brasileiro
de Inteligncia (SISBIN): similaridades e diferenas com o processo de reforma
na Comunidade de Inteligncia dos Estados Unidos da Amrica. Dissertao de
Concluso do Curso de Altos Estudos de Poltica e Estratgia da Escola Superior de
Guerra (ESG) (Brasil).
MORLINO, L. (1992). Consolidaes Democrticas na Europa Meridional. Indicaes
tericas para anlise emprica. DADOS, v. 35, n. 2.

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE 
NOHLEN, D. & THIBAUT, B. (1994). Investigacin sobre la transicin em Amrica
Latina: enfoques, conceptos, tesis. Arbeitspapier, n. 11, Universidade de Heidelberg.
NUMERIANO, Roberto. 2010. Servios Secretos. A sobrevivncia dos legados
autoritrios. Recife, Editora da UFPE.
ODONNELL, G. (1993). Acerca del estado, la democratizacin y algunos problemas
conceptuales. Una perspectiva latinoamericana com referencias a pases
poscomunistas. Desarollo Econmico, v. 33, n.130.
ODONNELL, G. (1988). Transies, continuidades e alguns paradoxos. In: REIS, F. W.
e ODONNEL, G. A democracia no Brasil: dilemas e perspectivas So Paulo, Vrtice.
OLIVEIRA, E. R. de & CORREA, S. (2000). Foras Armadas, direo poltica e formato
institucional. In: DARAUJO, M. C. & CASTRO, C. Democracia e Foras Armadas no
Cone Sul. Rio de Janeiro, Editora da FGV.
PALACIOS CEREZALES, Diego. (2008). Estado, rgimen y orden pblico en el Portugal
contemporneo (18342000). Tese Doutorado, Complutense University of Madrid.
Disponvel em: http://eprints.ucm.es/8075/
PALACIOS CEREZALES, Diego. (2010). Repressive Legacies and the Democratisation
of Iberian Police Systems, South European Society and Politics, 15: 3, p.429 448.
PIMENTEL, Irene Pimentel. (2009). A Histria da PIDE. Lisboa: Crculo de Leitores
e Temas e Debates. 6a Edio.
PINTO, Antnio Costa & TEIXEIRA, Nuno Severiano (org.). (2007). Portugal e a
Integrao Europeia 1945-1986: A perspectiva dos actores. Lisboa, Temas e Debates.
PINTO, Antnio Costa (Coord). (2000). Portugal Contemporneo. Madri, Edies
Seguitur.
PINTO, Antonio Costa. (2006). O Legado Autoritrio e a Transio Portuguesa para a
Democracia, 1974-2004. In: LOFF, Manuel e PEREIRA, Maria da Conceio Meireles.
Portugal 30 Anos de Democracia (1974 2004). Actas do Colquio realizado na
Faculdade de Letras da Universidade do Porto. Porto, Editora da Universidade do
Porto, p. 37-72
PINTO, Antnio Costa. (2010). Coping with the Double Legacy of Authoritarianism
and Revolution in Portuguese Democracy, South European Society and Politics, v.
15, n. 3, p. 395-412.
RIBEIRO, Maria da Conceio. (1995). A Polcia Poltica no Estado Novo (1926-1945).
Lisboa: Editorial Estampa,
ROCHA, B. L. (2003). O grampo do BNDES: quando o complemento da ABIN a mdia
oficiosa. Rio de Janeiro, Sotese.
ROCHA, Bruno L. (2004). Polcia Federal aps a Constituio de 1988: polcia de governo,
segurana de Estado e polcia judiciria. Dissertao apresentada como requisito parcial
para a obteno do ttulo de Mestre em Cincia Poltica no Programa de Ps-Graduao
em Cincia Poltica da Universidade Federal do Rio Grande do Sul, 2004.
RORATTO, J.M. & CARNIELLI, B.L. (2006). O pensar e a criao de um organismo
de Inteligncia Federal no Brasil: antecedentes histricos. In: Revista Brasileira de
Inteligncia, Braslia, Abin, v.2, n.2.

&$378/2
266(59,d26'(,17(/,*1&,$('(6(*85$1d$,17(51$12%5$6,/((032578*$/


%RRNB,QW*RYHUQDPHQWDOLQGE 
ROSAS, Fernando. (1998). O Estado Novo. In: MATTOSO, Jos. (dir.). Histria de
Portugal. Vol 7. Lisboa, Estampa.
ROSAS, Fernando. (2000). Salazarismo e Desenvolvimento Econmico nos anos 30
e 40. In: PINTO, Antnio Costa (Coord). Portugal Contemporneo. Madri, Edies
Seguitur, p. 93-110. ROSAS, Fernando. (2006). A Revoluo Portuguesa de 1974/75 e a
Institucionalizao da Democracia. In: LOFF, Manuel e PEREIRA, Maria da Conceio
Meireles. Portugal 30 Anos de Democracia (1974 2004). Actas do Colquio realizado
na Faculdade de Letras da Universidade do Porto. Porto, Editora da Universidade do
Porto. p. 15-36.
SCHMITTER, Philippe C. (1999). Portugal: do Autoritarismo Democracia. Lisboa: ICS.
SHARE, Donald e MAINWARING, Scott. (1986). Transies pela transao: a
democratizao no Brasil e na Espanha, Dados, Rio de Janeiro, v. 29, n. 2, pp. 207-235.
SOARES, Glucio A. D. (1994). O Golpe de 64. In: SOARES, G. A. D. & DARAUJO, M.
C. 21 anos de regime militar: balanos e perspectivas. Rio de Janeiro, Editora da FGV.
SOARES, L. E. (2007). A Poltica Nacional de Segurana Pblica: histrico, dilemas e
perspectivas. In: Estudos Avanados, v. 21, n. 61.
SWENSON, Russel G. & LEMOZY, Susana C. (2009). Democratizacin de la Funcin de
Inteligencia. El Nexo de la Cultura Nacional y la Inteligencia Estratgica. Washington,
National Defense Intelligence College.
TEIXEIRA, Nuno Severiano. (2000). A Poltica Externa Portuguesa. 1890-1986. In:
PINTO, Antnio Costa (Coord). Portugal Contemporneo. Madri, Edies Seguitur,
pp.61-93.
TRINDADE, Helgio. (1985). Bases da democracia brasileira: lgica liberal e prxis
autoritria. In: ROUQUI, A., LAMOUNIER, B., SCHWARCZ, J. Como renascem as
democracias. So Paulo: Brasiliense.
ZAVERUCHA, Jorge. (2000). Frgil democracia: Collor, Itamar, FHC e os militares
(1990-1998). Rio de Janeiro, Civilizao Brasileira.
ZAVERUCHA, Jorge. (2005). FHC, Foras Armadas e Polcia. Entre o autoritarismo e
a democracia (1999-2002). Rio de Janeiro, Record.
ZEGART, Amy. (1999). Flawed by Design: The Evolution of the CIA, JCS and NSC.
Stanford, Stanford University Press.
ZERO HORA [jornal dirio], Porto Alegre, 09/02/2011, p. 6.

 ,17(/,*1&,$*29(51$0(17$/
0$5&2&(3,.

%RRNB,QW*RYHUQDPHQWDOLQGE