Você está na página 1de 42

Métodos Moleculares

Hoje veremos:

- Cromatografias

- Identificação de proteínas (MALDI-MS)

- Interacções proteicas (co-imunoprecipitações, GST-Pulldown)

- ELISA

- Citometria de fluxo

- Fraccionamento subcelular
Cromatografia
Cromatografia

tamanho Hidrofobicidade carga afinidade Hidrofobicidade


(phenil-sepharose) (grupos alquil-RCOOH)

O suporte físico (resina


ou “beads”) pode ser por
exemplo de agarose ou
“sepharose”
Cromatografia
Cromatografia

12 11 10 9 8 7 6 5 4 3 2 1

12 11 10 9 8 7 6 5 4 3 2 1

Filtração em gel (size exclusion)


Técnicas de purificação

Procedimento Proteína total Rendimento Purificação


mg % -vez

1- Extracto peroxissomal 32,0 100,0 1,0

2- Precipitação com PEG 10,8 78,0 2,3

3- Fraccionamento com
(NH4)2SO4 0,445 32,5 23,3
(salting out)
4- Cromatografia de filtração em gel 0,135 29,5 70,0

5- Cromatografia troca iónica 0,010 11,8 364,0


DEAE-sepharose
Imunoprecipitação
Imunoprecipitação

Input Eluido

1 23 45 6

IP: anti- Pex14

1, 4, 7- controlo
2, 5, 8- solubilização digitonina
3, 6, 9- solubilização desoxicolato/NP40
Imunoprecipitação

1- Marcadores
2- IP Anti-Pex14p DN
3- IP Anti-Pex14p Dig
4- IP IgG controlo Dig

Como identificar a(s) proteína(s) contida(S) numa banda?


MALDI: Matrix-Assisted Laser Desorption Ionization MS: Mass Spectroscopy
MALDI-MS
MALDI-MS
MFYFHCPPQLEGTAPFGNHSTGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQT
HYPDVFTREELAMKINLTEARVQVWFQNRRAKWRKTERGASDQEPGAKEPMAEV
TPPPVRNINSPPPGDQTRSKKEALEAQQSLGRTVGPTGPFFPSCLPGTLLNTATYA
QALSHVASLKGGPLCSCCVPDPMGLSFLPTYGCQSNRTASVAALRMKAREHSEAV
LQSANLLPSTSSSPGPASKQAPPEGSQDKTSPTKEQSEGEKSV
A tripsina digere nas argininas (R) e nas lisinas (K)

Lista dos péptidos obtidos por digestão por tripsina e


respectivo peso teóricos
MALDI-MS

Protease digestion (usually Tripsin) of the protein band

Espectro
de massa

Obtendo a lista dos péptidos obtidos pela análise, é possível proceder a uma busca
em base de dados para identificar a proteína
MALDI-MS

O programa compara o peso dos péptidos obtidos


experimentalmente com o perfil de digestão teóricos
de todas as proteínas conhecidas. Uma vez que cada
proteína tem um padrão único de acordo com a sua
estrutura primária, é possível por MALDI-MS identificar
a proteína presente na amostra
GST pull-down assay

GST
gene X

pGEX

prepare protein
express GST-fusion extract from brain
protein in E.coli

mix and incubate

GST- Glutationa S-transferase-


afinidade para a glutationa
GST pull-down assay

Extracto proteico
GST pull-down assay: Exemplo
ELISA (Enzyme Linked Immuno Sorbent Assay)

Vantagens da ELISA

Rápida e preciso

O antigénio não necessita de purificação prévia

Pode quantificar a quantidade absoluto de antigénio na


amostra
ELISA (Enzyme Linked Immuno Sorbent Assay)
Sandwich ELISA
Citometria de fluxo
FACS – Fluorescence activated cell sorting

Separação de células num cell sorter ativado por fluorescência – método


derivado da citometria de fluxo
FACS – Fluorescence activated cell sorting
FACS – Fluorescence activated cell sorting

Análise histograma
FACS – Fluorescence activated cell sorting

Histograma Bidimensional
FACS – Fluorescence activated cell sorting
Exemplo: Imunofenotipagem (diagnóstico de
doenças associadas ao sistema imune, ex
leucemias,Processo
Imunofenotipagem: linfomas…)
de classificação de células do sistema imune baseado nas
suas diferenças estruturais e funcionais. O processo é comumente utilizado para analisar e
classificar linfócitos em sub-grupos baseados em antígenos cd pela técnica de citometria
de fluxo.
Centrifugação
diferencial

Fraccionamento subcelular por


centrifugação (separação com base no tamanho e
Centrifugação
diferencial

É possível
acrescentar um
passo adicional a
~3000g para
separar
mitocôndrias dos
lisossomas/peroxi
ssomas
Separação de moléculas por Sedimentação de
Equilíbrio ou Isopícnica (mesma densidade)

As moléculas sedimentam/flutuam no local


onde a densidade da solução na coluna de
gradiente iguala a sua própria densidade

É possível separar moléculas de DNA, RNA


ou moléculas marcadas com radioisótopos
por ultracentrifugação em gradiente de
cloreto de césio (36-48h)
Purificação de
organelos

Gradientes de
Densidade
Coeficiente de sedimentação:
Unidade de Svedberg “S”
Coeficiente de sedimentação:
Unidade de Svedberg “S”

Peroxisomes
Lysosomes
Purificação de
organelos

Peroxissomas Purificados Núcleos Purificados (ME)


Figure 2. Scanning electron microscopy of a low-speed pellet after cell homogenization (A); see
steps 1 through 3 in Figure 1.

Lukas A. Huber et al. Circulation Research. 2003;92:962-968

Copyright © American Heart Association, Inc. All rights reserved.


Fracionamento subcelular – Um exemplo

T- Homogenizado total
A- 600g
B- 2300g
D- citosol (Sobrenadante 100000g)
E- 100000g
C- 12000g
Per- Fração C purificada através de
gradientes de densidades

Catalase- Enzima peroxissomal


Esterase- Enzima do RE
Cyt-c oxidase- Enzima mitocondrial
Glucuronidase- Enzima lisossomal
Purificação de organelos: Um exemplo
Perfil proteico por SDS-PAGE

RE Mit Per

Fracções E (100Kg), B
(2,3Kg), C (12Kg) do slide
anterior posteriormente
purificadas em gradientes de
densidades originando
respectivamente:

RE- Retículo Endoplasmático


(microssomas)
Mit- Mitocôndria
Per- Peroxissomas
Fracionamento subcelular – Um exemplo
Fracionamento subcelular – Um exemplo

Isolation of secretory lysosomes


from YTS NK cells by fractionation
on Percoll gradients.A, YTS cells
were subjected to ball bearing
homogenization, and the resulting
homogenate was centrifuged to
yield a PNS that was subsequently
centrifuged on a 27% Percoll
gradient. A total of 24 fractions
were collected from the gradient of
which fractions 1 and 24 represent
the top and bottom of the gradient,
respectively. Fractions were
assayed for NAGA activity
(secretory lysosome marker) and
alkaline phosphatase activity
(plasma membrane marker).
Secretory lysosome-enriched
fractions (fractions 21 and 22) were
pooled and retained for proteomics
analysis. Results are expressed as
mean ± S.E. (n = 24). B, gradient
fractions were immunoblotted for
calnexin (endoplasmic reticulum
marker), TGN46 (trans-Golgi
network marker), EEA1 (early
endosome marker), MPR (late
endosome and trans-Golgi network
marker), GLUT1 (plasma membrane
marker), and CD63 (secretory
lysosome marker). Immunoblots
are representative of four different
experiments.
Marcadores proteicos de organelos
Marcadores fluorescentes de organelos

Você também pode gostar