Você está na página 1de 193

Escaneado por Haroldo Murilo.

Sem correção
_________
Michael J. Behe
A CAIXA PRETA
DE DARWIN
O desafio da bioquímica
à teoria da evolução
Tradução:
Ruy Jungmann
Consultoria:
Rui Cerqueira
Professor-titular de ecologia, UFRJ
Jorge Zahar Editor
Rio de Janeiro
Título original:
Darwin 's Black Box
(The Biochemical Challenge to Evolution)
Tradução autorizada da primeira edição norte-americana
publicada em 1996 por The Free Press, de Nova York, EUA
Copyright ©1996 Michael J. Bebe
Copyright © 1997 da edição em língua portuguesa:
Jorge Zahar Editor Ltda.
rua México 31 sobreloja
20031-144 Rio de Janeiro, RJ
tel.: (21) 2240-0226fax: (21) 2262-5123
e-mail: jze@zahar.com.br
site: www.zahar.com.br
Todos os direitos reservados.
A reprodução não-autorizada desta publicação, no todo
ou em parte, constitui violação do copyright. (Lei 9.610)
Capa: Carol Sá
Ilustração: Marcelo Torrico
CIP-Brasil. Catalogação-na-fonte
Sindicato Nacional dos Editores de Livros, RJ.
B365c Behe, Michael J.
A caixa preta de Darwin: o desafio da bioquímica à teoria
da evoluçãoMichael J. Behe; tradução, Ruy Jungmann; con-
sultoria, Rui Cerqueira. Rio de Janeiro: Jorge Zahar Ed.,
1997
(Ciência & Cultura)
Tradução de: Darwin's black box: the biochemical chal-
lenge to evolution
Inclui apêndices
ISBN 85-7110-412-3
l. Bioquímica. 2. Evolução (Biologia). I. Título. II. Série.
CDD574.192
97-1004 CDU 577. l
SUMÁRIO
Prefácio ........................................... 7
PARTE I: A caixa É ABERTA
1. Biologia liliputiana .............................. 13
2. Parafusos e porcas............................... 35
PARTE U: examinando O conteúdo DA caixa
3. Remar, remar, remar sem parar ................... 59
4. Rube Goldberg no sangue ........................ 81
5. Daqui para lá ................................... 105
6. Um mundo perigoso ............................. 123
7. Morte na estrada ................................ 145
PARTE III: O QUE NOS DIZ A caixa?
8. Publique ou pereça .............................. 169
9. Planejamento inteligente ......................... 190
10. Objeções ao planejamento........................ 211
11. Ciência, filosofia e religião ....................... 234
Apêndice .......................................... 255
Notas .............................................. 277
Agradecimentos .................................... 288
índice Remissivo ................................... 289
Para Celeste
PREFÁCIO
UM FENÓMENO MOLECULAR
É lugar-comum, quase banal, dizer que a ciência deu grandes passos na
compreensão da natureza. As leis da física são agora tão bem conhecidas
que sondas espaciais voam com precisão absoluta para fotografar mundos
situados a bilhões de quilómetros da Terra. Computadores, telefones, luzes
elétricas e incontáveis outros exemplos confirmam o domínio da ciência e
da tecnologia sobre as forças da natureza. Vacinas e culturas agrícolas de
alto rendimento venceram os antigos inimigos da humanidade, a doença e
a fome pelo menos em algumas partes do mundo. Quase todas as
semanas, anúncios de descobertas na área da biologia molecular reforçam
a esperança pela cura de doenças genéticas e de outras origens.
Ainda assim, compreender de que forma alguma coisa funciona não é a
mesma coisa que compreender como ela surgiu. Os movimentos dos
planetas no sistema solar, por exemplo, podem ser previstos com espantosa
exatidão. A origem do sistema solar (saber como o Sol, os planetas e suas
luas se formaram), contudo, ainda é controversa.' A ciência provavelmente
acabará por solucionar esse enigma. Ainda assim, permanece a questão de
que compreender a origem de alguma coisa é diferente de entender como
ela funciona no dia-a-dia.
O domínio da natureza pela ciência levou várias pessoas a supor que
ela pode na verdade, deve explicar também a origem da natureza e
da vida. Asugestão de Darwin, de que a vida pode ser explicada pela ação da
seleção natural sobre a variação, tem sido aceita esmagadoramente há mais
de um século nos círculos cultos, apesar dos mecanismos básicos da vida
terem permanecido um completo mistério até poucas décadas atrás.
A ciência moderna aprendeu que, em última análise, a vida é um
fenómeno molecular: todos os organismos são feitos de moléculas, que
funcionam como porcas e parafusos, engrenagens e polias dos sistemas
biológicos. Sem dúvida, há sistemas biológicos complexos (como a circu-
lação sanguínea, por exemplo) que surgem em níveis mais altos; os detalhes
comezinhos da vida, porém, constituem a função das biomoléculas. Por isso
mesmo, a ciência da bioquímica, que as estuda, tem por missão a inves-
tigação dos próprios alicerces da vida.
Desde meados da década de 1950, a bioquímica tem elucidado laborio-
samente o funcionamento da vida no nível molecular. Darwin desconhecia
o motivo pelo qual ocorria a variação em uma espécie (um dos requisitos
de sua teoria), mas a bioquímica identificou a base molecular do processo.
A ciência do século xix não podia sequer arriscar um palpite sobre os
mecanismos da visão, da imunidade ou do movimento, ao passo que a
! bioquímica identificou as moléculas responsáveis por essas e por outras
'
funções.
No passado pensava-se que a base da vida era extraordinariamente
simples. Essa ideia foi demolida. Verificou-se que a visão, os movimentos
e outras funções biológicas não são menos sofisticados do que câmeras de
televisão e automóveis. Embora a ciência tenha feito enormes progressos
na compreensão de como funciona a química da vida, a sofisticação e a
complexidade dos sistemas biológicos no nível molecular paralisaram suas
tentativas de explicar as origens dos mesmos. Não houve virtualmente
tentativa alguma da ciência de explicar a origem de sistemas biomoleculares
específicos, complexos, e muito menos qualquer progresso nesse sentido.
Muitos cientistas afirmaram corajosamente que já têm tais explicações, ou
que as terão mais cedo ou mais tarde, mas nenhum apoio para essas
alegações pode ser encontrado na literatura científica. Mais importante
ainda, há razões irresistíveis baseadas na própria estrutura dos sistemas
para se pensar que uma explicação darwiniana dos mecanismos da vida
será para sempre enganosa.
Evolução é uma palavra versátil.2 Pode ser usada por uma pessoa para
explicar algo tão simples quanto uma mudança ao longo do tempo, e por
outra para indicar a descendência de todas as formas de vida a partir de um
ancestral comum, sem especificar o mecanismo de mudança. Em seu
sentido mais conhecido, biológico, evolução significa um processo por
meio do qual a vida surgiu de matéria não-viva e, mais tarde, desenvolveu-se
inteiramente por meios naturais. Esse é o sentido que Darwin deu à palavra,
e o mesmo que conserva na comunidade científica. E é a acepção em que
usamos a palavra evolução em todo este livro.
PREFACIO 9
Há vários anos, Papai Noel deu um velocípede de plástico ao meu filho
mais velho. Infelizmente, ocupado como é, Papai Noel não teve tempo de
tirá-lo da caixa e montá-lo antes de ir embora: essa tarefa coube a este pai
aqui. Tirei as peças da caixa, abri o folheto com as instruções de montagem
e soltei um suspiro. Encontrei seis páginas de instruções detalhadas: alinhe
os oito diferentes tipos de parafuso, introduza dois parafusos de quatro
centímetros através do guidom até a coluna, enfie a coluna através do
orifício quadrado no corpo do velocípede, e assim por diante. Eu não queria
nem mesmo ler as instruções, pois sabia que não poderia fazê-lo apenas
com um passar de olhos como se faz com um jornal toda a finalidade
está nos detalhes. Arregacei as mangas, abri uma lata de cerveja e comecei
a trabalhar. Após várias horas, montei o velocípede. Nesse processo, eu
havia lido várias vezes cada instrução do folheto (para fixá-las na mente) e
realizado todas as ações exatas requeridas.
A aversão que sinto por instruções parece ser bastante comum. Embora
quase todos os lares possuam um aparelho de videocassete, a maioria das
pessoas não consegue programá-los. Essas maravilhas tecnológicas vêm
com instruções de operação completas, mas só de pensar em estudar cada
frase do manual faz com que a maioria das pessoas delegue o trabalho ao
garoto de dez anos que estiver mais próximo.
Lamentavelmente, grande parte da bioquímica é como um manual de
instruções, no sentido em que a importância está nos detalhes. Um estudante
que ler apenas superficialmente um livro didático de bioquímica pode estar
certo de que passará grande parte do exame seguinte olhando para o teto,
enquanto gotas de suor se formam em sua testa. Passar os olhos pelo texto
não prepara o estudante para perguntas como "Descreva em detalhe o
mecanismo de hidrólise de uma ligação peptídica pela tripsina, dando
especial atenção ao papel da energia de ligação no estágio de transição".
Embora haja princípios gerais de bioquímica que ajudam um simples mortal
a compreender o quadro geral da química da vida, princípios amplos só
podem levar o indivíduo até certo ponto. Um diploma em engenharia não
substitui o manual de instruções de um velocípede, nem nos ajuda a
programar o videocassete.
Muitas pessoas, infelizmente, estão bastante conscientes da minuciosi-
dade da bioquímica. Pessoas que padecem de anemia falciforme, sofrendo
muita dor em suas curtas vidas, conhecem a importância do pequeno detalhe
que mudou um dos 146 resíduos de aminoácidos de uma em cada dezena
de milhares de proteínas de seu corpo. Pais de crianças que morrem da
10 A CAIXA PRETA DE DARWIN
doença de Tay-Sachs, ou fibrose cística, ou que sofrem de diabetes o-
hemofilia sabem mais do que gostariam sobre a importância de detalhe
bioquímicos.
De modo que, como escritor que deseja que as pessoas leiam este livro
enfrento um dilema: as pessoas odeiam ler detalhes, embora a história dr
impacto da bioquímica na teoria da evolução dependa inteiramente d
detalhes. Tenho, por conseguinte, de escrever o tipo de livro que as pessoa;
não gostam de ler a fim de convencê-las das ideias que me levaram
escrevê-lo. Não obstante, a complexidade precisa ser experimentada par
ser apreciada. Assim, generoso leitor, imploro sua paciência: há um bocadc
de detalhes neste livro.
Ele é dividido em três partes. A Parte i fornece algumas ideias básicas t
mostra por que a evolução agora tem de ser discutida no nível molecular
o domínio da ciência da bioquímica. Essa parte é quase livre de detalhes
técnicos, embora alguns se insinuem no quadro durante a discussão do olho
A Parte n contém os "capítulos de exemplos", e nela se encontra a maiol
complexidade. A Parte m encerra uma discussão não-técnica das impli-
cações das descobertas da bioquímica.
Portanto, o material difícil está limitado principalmente à Parte II. Nesse
seção, contudo, faço muitas analogias a objetos conhecidos, de uso diário,
para transmitir ideias e, mesmo nessa parte, as descrições detalhadas de
sistemas bioquímicos são minimizadas. Os parágrafos que contêm as doses
mais pesadas de detalhes repletos de termos técnicos que parecem
assustadores são separados do texto regular com o sinal Q, a fim de
preparar o leitor. Alguns leitores podem preferir percorrer laboriosamente
a Parte li. Outros, contudo, talvez desejem ler a seção de forma superficial
ou mesmo saltar trechos, e, em seguida, voltar aos mesmos quando es-
tiverem prontos para absorver mais informações. Para os que desejam uma
compreensão mais profunda da bioquímica, incluí um apêndice descreven-
do alguns princípios bioquímicos gerais. Encorajo os que querem conhecei
todos os detalhes a que tomem emprestado um texto introdutório de
bioquímica na biblioteca pública mais próxima.
PARTE l
A CAIXA É ABERTA
BIOLOGIA LILIPUTIANA
Este livro é sobre uma ideia a evolução, de Darwin que está sendo
levada até seus últimos limites por descobertas na bioquímica. A bioquími-
ca é o estudo da própria base da vida: as moléculas que formam células e
tecidos, que catalisam as reações químicas de digestão, fotossíntese, imu-
nidade, entre muitas outras coisas.' O espantoso progresso realizado pela
bioquímica desde meados da década de 1950 constitui um tributo monu-
mental ao poder da ciência de compreender o mundo. Trouxe inúmeros
benefícios práticos à medicina e à agricultura. No entanto, talvez tenhamos
de pagar um preço por esse conhecimento. Quando escavamos alicerces,
as estruturas que neles repousam são abaladas e, às vezes, desmoronam.
Quando ciências como a física finalmente expuseram suas fundações,
velhas maneiras de compreender o mundo tiveram que ser jogadas fora,
revistas por completo, ou restringidas a uma parte limitada da natureza.
Ocorrerá a mesma coisa com a teoria da evolução pela seleção natural?
Como acontece com muitas grandes ideias, a de Darwin é elegantemente
simples. Ele observou que ocorrem variações em todas as espécies: alguns
membros são maiores, outros menores, uns mais rápidos, outros de cor mais
clara, e assim por diante. Uma vez que suprimentos limitados de alimentos
não conseguem sustentar todos os organismos que nascem, Darwin con-
cluiu que aqueles cuja variação, ocorrida ao acaso, lhes conferia uma
vantagem na luta pela vida tenderiam a sobreviver e a reproduzir-se,
vencendo na competição os menos favorecidos. Se a variação fosse herda-
da, as características da espécie mudariam ao longo do tempo. No decorrer
de grandes períodos, grandes mudanças poderiam ocorrer.
Há mais de um século, a maioria dos cientistas pensa que virtua
mente todas as formas de vida, ou pelo menos todas as suas característica
mais interessantes, resultaram de seleção natural, funcionando através c
variação aleatória. A ideia de Darwin tem sido usada para explicar o bio
do tentilhão, os cascos de cavalos, a coloração das mariposas e dos inseto
operários, e a distribuição da vida em todo o globo e ao longo das era.
A teoria foi ampliada por alguns cientistas para interpretar até mesmo
comportamento humano: por que pessoas em desespero cometem suic
dio, por que adolescentes têm filhos fora do casamento, por que algun
grupos se saem melhor em testes de inteligência do que outros, por qu
missionários religiosos renunciam ao casamento e a filhos. Nada há ne
nhum órgão ou ideia, nenhum sentido ou pensamento, que não tenha sid
objeto de elucubrações evolutivas.
Quase um século e meio após Darwin ter apresentado sua teoria,
biologia evolutiva tem obtido muito sucesso na explicação dos padrões t
vida que vemos ao nosso redor. Para muitos, seu triunfo é completo. A
verdadeira obra da vida, porém, não acontece no nível do animal ou do orgãc
completos. As partes mais importantes dos seres vivos são pequenas demais
para serem vistas. A vida é vivida nos detalhes, e cabe às moléculas se
encarregarem desses detalhes. A ideia de Darwin pode explicar cascos de
cavalos, mas poderá explicar os alicerces da vida?
Pouco depois de 1950, a ciência avançou até um ponto em que podia
identificar as formas e propriedades de algumas moléculas que constituem
os organismos vivos. Devagar, com muito trabalho, as estruturas de um nú-
mero cada vez maior de moléculas biológicas foram elucidadas e, com o
auxílio de incontáveis experimentos, inferida a maneira como funcionavam
Os resultados acumulados mostram com grande clareza que a vida se baseia
em máquinas máquinas compostas de moléculas! As máquinas molecu
lares transportam carga de um lugar na célula para outro, ao longo de "es
iradas" constituídas por outras moléculas, enquanto outras ainda agem co
mo cabos, cordas e polias que mantêm a forma da célula. Máquinas ligam e
desligam comutadores celulares às vezes matando a célula, ou fazendo com
que cresça. Máquinas a energia solar captam a energia dos fótons e a
armazenam em elementos químicos. Máquinas elétricas permitem que a
corrente flua pêlos nervos. Máquinas-ferramenta constróem outras máqui
nas moleculares, bem como outras iguais a si mesmas. Células nadam usan-
do máquinas, copiam a si mesmas usando maquinaria, e com ela ingerem
alimentos. Em suma, máquinas moleculares altamente sofisticadas contro-
lam todos os processos celulares. Assim, os detalhes da vida são finamente
calibrados e, a maquinaria da vida, de uma enorme complexidade.
Todas as formas de vida poderiam ser encaixadas na teoria da evolução
de Darwin? Uma vez que a mídia gosta de publicar matérias sensacionalis-
tas, e desde que alguns cientistas adoram especular sobre até que ponto
podem levar suas descobertas, tem sido difícil para o público separar fato
de conjectura. Se queremos encontrar evidências autênticas, temos de
mergulhar nos livros e revistas publicados pela própria comunidade cientí-
fica. A literatura científica divulga os experimentos em primeira mão, e
esses relatórios, em geral, estão livres dos voos de fantasia que acabam por
aparecer em suas repercussões. Mas, como deixaremos claro mais tarde, se
pesquisamos a literatura científica sobre evolução, e se concentramos a
pesquisa na questão de como surgiram as máquinas moleculares a base
da vida descobrimos que paira um silêncio total e misterioso em tomo
do assunto. A complexidade dos alicerces da vida paralisou as tentativas da
ciência de explicá-la; as máquinas moleculares como que erguem uma
barreira ainda impenetrável ao alcance universal do darwinismo. Com o
objetivo de descobrir o porquê disso, analisaremos neste livro várias
máquinas moleculares fascinantes e, em seguida, questionaremos se é
possível que elas sejam explicadas por mutação aleatóriaseleção natural.
A evolução é um tópico polémico, o que toma necessário esclarecer
algumas questões básicas já no início do livro. Muitas pessoas pensam que
questionar a evolução darwiniana significa defender o criacionismo. Da
forma habitualmente entendida, o criacionismo implica a crença em que a
Terra foi formada há apenas dez mil anos, uma interpretação da Bíblia ainda
muito popular. Desejo deixar claro que não tenho motivos para duvidar que
o universo tem os bilhões de anos de idade que os físicos alegam. Acho a
ideia de ascendência comum (que todos os organismos tiveram um mesmo
ancestral) muito convincente e não tenho nenhuma razão particular para
pô-la em dúvida. Respeito muito o trabalho de meus colegas que estudam
o desenvolvimento e o comportamento de organismos dentro do arcabouço
evolucionário, e acho que biólogos que assim pensam deram enormes
contribuições ao nosso conhecimento do mundo. Embora o mecanismo de
Darwin a ação da seleção natural sobre a variação possa explicar
muitas coisas, não acredito que explique a vida molecular. Tampouco acho
motivo de espanto que a nova ciência do muito pequeno possa mudar a
maneira como vemos o menos pequeno.
Quando as coisas correm suavemente em nossas vidas, a maioria de nós
tende a pensar que a sociedade em que vivemos é "natural", e que nossas
ideias sobre o mundo são axiomaticamente verdadeiras. E difícil imaginai
como outras pessoas, em outros tempos e lugares, viveram do modo como
viveram ou por que acreditaram em certas coisas. Durante períodos de
sublevação social, contudo, quando verdades aparentemente sólidas são
questionadas, pode parecer que nada no mundo faz sentido. Nesses tempos,
a história pode nos lembrar que a busca de conhecimento confiável é um
processo longo e difícil e que ainda não chegou ao fim. Com o objetivo de
construir uma perspectiva da qual possamos analisar a ideia da evolução
darwiniana, traçaremos nas poucas páginas seguintes um esboço muito
breve da história da biologia. De certa maneira, essa história tem sido uma
sucessão de caixas pretas; quando uma é aberta, outra se revela.
Caixa preta é um termo curioso para um dispositivo que faz alguma
coisa, mas cujo funcionamento interno continua misterioso às vezes
porque seu funcionamento não pode ser visto, às vezes porque simples-
mente não é compreensível. Computadores são bons exemplos de caixas
pretas. A maioria de nós usa essas máquinas maravilhosas sem a mais vaga
ideia de como funcionam, processando palavras, traçando gráficos, diver-
tindo-nos com videogames, em uma feliz ignorância do que acontece dentro
do gabinete. Mesmo que tirássemos a tampa, poucos de nós poderiam atinar
com a confusão de peças que há ali dentro. Não há uma conexão simples
observável, entre as partes do computador e as coisas que ele faz.
Imaginemos que um computador, acionado por uma bateria de longa
duração, fosse transportado de volta no tempo cerca de mil anos à corte do
rei Arthur. De que maneira as pessoas daquela época reagiriam a um
computador em ação? A maioria se sentiria tomada de reverência, mas, com
sorte, alguém poderia compreender a coisa. Uma pessoa poderia notar que
letras apareciam na tela quando ela tocava nas teclas; que algumas combi-
nações de letras correspondentes a comandos para o computador
faziam com que a tela mudasse. Após algum tempo, muitos comandos
seriam compreendidos. Esses ingleses dos tempos medievais poderiam
acreditar que haviam desvendado os segredos do computador. No entanto
alguém acabaria retirando a tampa do gabinete e olharia para dentro. De
repente, a teoria de "como funciona o computador" se revelaria profun
damente ingénua. A caixa preta que pouco a pouco havia sido decodificada
teria exposto outra caixa preta.
Nos tempos antigos, toda a biologia era uma caixa preta, porque ninguém
compreendia, mesmo no nível mais superficial, como as coisas vivas
funcionavam. Os antigos que olhavam boquiabertos para um animal ou
planta, e se perguntavam como as coisas funcionavam, estavam na presença
de uma tecnologia insondável. Encontravam-se, realmente, na escuridão.
As mais antigas pesquisas biológicas começaram da única maneira que
então era possível a olho nu.2 Vários livros, datados de cerca de 400 a.C.
(atribuídos a Hipócrates, o "pai da medicina"), descrevem sintomas de
algumas doenças comuns e atribuem as enfermidades à dieta ou a outras
causas físicas, e não à obra dos deuses. Embora esses escritos constituíssem
um começo, os antigos ainda continuavam perdidos quando o assunto era
a composição das coisas vivas. Acreditavam que toda matéria era composta
de quatro elementos: terra, ar, fogo e água. Pensavam que os corpos vivos
eram constituídos de quatro "humores" sangue, bile amarela, bile preta
e flegma e que todas as doenças, supostamente, tinham origem no
excesso de um desses humores.
O maior biólogo da Grécia foi também seu maior filósofo, Aristóteles.
Nascido ao tempo em que Hipócrates ainda vivia, Aristóteles compreendeu
(ao contrário de quase todos antes dele) que o conhecimento da natureza
requeria observação sistemática. Mediante exame cuidadoso, ele reco-
nheceu um volume espantoso de ordem no mundo vivo, o que constituiu
um primeiro passo de importância crucial. Aristóteles agrupou os animais
em duas categorias gerais de sangue e sem sangue que correspondem
bem de perto às classificações modernas de vertebrados e invertebrados.
Entre os vertebrados, reconheceu as categorias mamíferos, aves e peixes.
Colocou a maior parte dos anfíbios e répteis em um único grupo e as
serpentes em uma classe separada. Mesmo não contando com instrumentos
em suas observações, grande parte do raciocínio de Aristóteles permanece
válido, a despeito dos conhecimentos acumulados nos milhares de anos
transcorridos desde sua morte.
Foram poucos os investigadores biológicos importantes no milénio que
se seguiu a Aristóteles. Um deles, Galeno, um médico de Roma, viveu no
século II d.C. O trabalho de Galeno mostrou que a observação cuidadosa
das partes externa e interna (com dissecção) de plantas e animais, embora
necessária, não era suficiente para compreender a biologia. Galeno se
esforçou, por exemplo, para compreender a função dos órgãos dos ani-
mais. Embora soubesse que o coração bombeava sangue, ele não podia
descobrir, apenas pela observação, que o sangue circulava e voltava ao
coração. Erroneamente, Galeno supôs que o sangue era bombeado para
"irrigar" os tecidos, e que novo sangue era produzido de forma ininterrupta
para reabastecer o coração. Essa ideia foi ensinada por quase mil e qui-
nhentos anos.
Foi somente no século xvn que um inglês, William Harvey, apresentou
a teoria de que o sangue flui sem cessar em uma direção, fazendo um circuito
completo, e que volta ao coração. Harvey calculou que se o coração
bombeia apenas sessenta gramas de sangue por batida, a 72 batidas pó:
minuto, em uma única hora ele teria bombeado 240 quilos de sangue 01
seja, três vezes o peso de um homem! Uma vez que fabricar tanto sangui
assim em tempo tão curto era claramente impossível, o sangue tinha qu
ser reutilizado. O raciocínio lógico de Harvey (auxiliado pêlos ainda novo;
algarismos arábicos, que facilitavam os cálculos) em apoio a uma atividadí
não-observável não tinha precedentes; ele montou o cenário para o modemc
pensamento biológico.
Na Idade Média, o ritmo da investigação científica se acelerou. C
exemplo dado por Aristóteles foi seguido por números crescentes d(
naturalistas. Muitas plantas foram descritas pêlos primeiros botânicos
como Brunfeis, Bock, Fuchs e Valerius Cordus. A ilustração científic.
surgiu quando Rondelet desenhou animais em detalhes. Os enciclopedistas
como Conrad Gesner, publicaram grandes volumes, sumariando todo c
conhecimento biológico. Lineu ampliou consideravelmente o trabalho d(
classificação de Aristóteles, inventando as categorias de classe, ordem
género e espécie. Estudos de biologia comparativa indicaram numerosa;
semelhanças entre ramos diferentes de vida e a ideia de uma origem comun
passou a ser discutida.
Abiologia progrediu rapidamente nos séculos xvn e xvm, à medida qu
os cientistas fundiam os exemplos dados por Aristóteles e Harvey, d
observação atenta e raciocínio inteligente. Ainda assim, até a atenção mais
rigorosa e o raciocínio mais brilhante podem levar o observador somentt
até certo ponto se partes importantes de um sistema forem invisíveis
Embora o olho humano possa distinguir objetos tão pequenos quanto un
décimo de milímetro, muito da ação na vida ocorre em um micronível, en
uma escala liliputiana. Assim, a biologia estacionou em um platô: uma caix;
preta a estrutura bruta dos organismos foi aberta, mas apenas pari
revelar a caixa preta de níveis mais finos de vida. Afim de progredir mais
a biologia precisava de uma série de grandes progressos tecnológicos. C
primeiro foi o microscópio.
As lentes já eram conhecidas nos tempos antigos e, por volta do século xv
o uso de óculos nada tinha de incomum. Mas só no século xvn é que lente;
convexas e côncavas foram reunidas em um tubo formando um primein
tosco microscópio. Usando um dos primeiros instrumentos desse tipo
Galileu descobriu, espantado, que os insetos tinham olhos complexos
Stelluti examinou os olhos, a língua, as antenas e outras partes de abelh"'
e gorgulhos. Malpighi confirmou a circulação do sangue pêlos capilares e
descreveu o início do desenvolvimento do coração de um embrião de pinto.
Nehemiah Grew estudou plantas; Swammerdam dissecou uma efeméride;
Leeuwenhoek foi o primeiro a ver uma célula bacteriana; e Robert Hooke
descreveu células de cortiça e folhas (embora não tenha reconhecido sua
importância).
Começava assim a descoberta de um inesperado mundo liliputiano,
derrubando ideias tradicionais sobre o que são os seres vivos. Charles
Singer, o historiador da ciência, observou que "a complexidade infinita dos
seres vivos assim revelada era filosoficamente tão perturbadora quanto a
majestade organizada do mundo astronómico, que Galileu desvelara na
geração anterior, embora demorasse muito mais para que suas implicações
mergulhassem na mente do homem". Em outras palavras, às vezes as novas
caixas exigem que revisemos todas as nossas teorias. Nesses casos, pode
surgir uma grande má vontade.
A teoria celular da vida foi finalmente formulada, em princípios do
século xix, por Matthias Schieiden e Theodor Schwann. Trabalhando so-
bretudo com tecidos de plantas, Schieiden defendeu a importância funda-
mental de um ponto escuro o núcleo no interior das células. Schwann
concentrou-se em tecido animal, no qual era mais difícil ver as células. Não
obstante, ele descobriu que os animais eram semelhantes às plantas em sua
estrutura celular. Concluiu que as células ou suas secreções constituem todo
o corpo de animais e de plantas e que, de certa maneira, elas são unidades
individuais, com uma vida própria. Escreveu que "a questão sobre o poder
fundamental de corpos organizados resume-se no poder das células in-
dividuais". E como acrescentou Schieiden: "A pergunta fundamental, por-
tanto, é: Qual a origem deste pequeno organismo peculiar, a célula?"
Schieiden e Schwann fizeram suas pesquisas em princípios e meados da
década de 1800 a época das viagens de Darwin e da publicação de A
origem das espécies. Para Darwin, portanto, como para todos os demais
cientistas da época, a célula era uma caixa preta. Ainda assim, ele conseguiu
extrair sentido de grande parte da biologia acima do nível da célula. A ideia
de que a vida evolui não era criação de Darwin, embora ele a tenha
defendido de forma muito mais sistemática, e a teoria de como a evolução
funcionapor seleção natural agindo sobre variações é de sua autoria.
Enquanto isso, a caixa preta celular era continuamente estudada. A
investigação da célula levou o microscópio aos seus limites, que são
estabelecidos pelo comprimento de onda da luz. Por razões físicas, um
microscópio não pode separar dois pontos que estejam mais perto do que
aproximadamente metade do comprimento de onda de luz que os esteja
20 A caixa PRETA DE DARWIN
iluminando. Uma vez que o comprimento de onda da luz visível é de cerc
de um décimo do diâmetro de uma célula bacteriana, numerosos detalhe
pequenos e de importância fundamental de sua estrutura simplesmente nãi
podem ser vistos com um microscópio óptico. A caixa preta da célula nãi
poderia ser aberta sem novos avanços tecnológicos.
Em fins do século xix, com a física progredindo rapidamente, J.J
Thomson descobriu o elétron; a descoberta do microscópio eletrônio
ocorreu várias décadas depois. Uma vez que o comprimento de onda d
elétron é mais curto do que o da luz visível, objetos muito menores podec
ser separados, se são "iluminados" por elétrons. A microscopia eletrônic
enfrenta algumas dificuldades práticas, uma das quais é a tendência do feix
de elétrons de "fritar" a amostra. Maneiras de contornar o problema forar
descobertas, porém, e após a Segunda Guerra Mundial, a microscopi
eletrônica atingiu a maioridade. Novas estruturas subcelulares foram des-
cobertas, tais como orifícios no núcleo, e membranas duplas em tomo daí
mitocôndrias (as usinas de força das células). A mesma célula que havia
parecido tão simples sob um microscópio óptico tinha, nesse momento
aparência muito diferente. O mesmo espanto que os primeiros microscopis-
tas ópticos experimentaram quando viram a estrutura detalhada de insetos
foi sentido mais uma vez por cientistas do século xx, quando observaram
as complexidades da célula.
Esse nível de descoberta começou a dar aos biólogos meios de s
aproximarem da maior das caixas pretas. A pergunta sobre como a vuü-
funciona não era do tipo que podia ser respondida por Darwin ou seus
contemporâneos. Eles sabiam que os olhos são feitos para ver mas como,
exatamente, eles vêem? De que modo o sangue coagula? De que maneira
o corpo combate a doença? As complexas estruturas reveladas pelo micros-
cópio eletrônico eram em si mesmas constituídas de componentes menores.
O que eram esses componentes? Que aspecto tinham? De que modo
funcionavam? As respostas a essas perguntas tiram-nos do reino da biologia
e nos levam para o da química. Também nos trazem de volta ao século xix.
A QUÍMICA DA VIDA
Como todos podem ver, seres vivos são diferentes de seres inanimados.
Atuam de maneira diversa. São diferentes também ao tato: couro e cabelos
podem ser distinguidos facilmente de pedras e areia. Até o século XIX, a
maioria das pessoas pensava, o que era muito natural, que a vida era
composta de um tipo especial de material, diferente do que entrava na
composição de objetos inanimados. Em 1828, no entanto, Friedrich Wõhier
aqueceu cianato de amónio e, espantado, descobriu que o produto formado
era ureia, um resíduo biológico. A síntese da ureia a partir de material
; inamimado acabou com a distinção fácil entre vida e não-vida, e Justus von
Liebig, especialista em química inorgânica, começou a estudar a química
da vida (ou bioquímica). Ele mostrou que o calor corporal dos animais é
devido à combustão de alimentos, e não simplesmente uma propriedade
inata da vida. A partir desses sucessos, formulou a ideia do metabolismo,
através do qual o corpo compõe e decompõe substâncias por meio de
ï processos químicos. Emst Hoppe-Seyler cristalizou o material vermelho
; do sangue (a hemoglobina) e demonstrou que ele se liga ao oxigénio para
transportar este último por todo o corpo. Emil Fischer demonstrou que a
: grande classe de substâncias denominadas de proteínas era constituída, sem
exceção, por apenas vinte tipos de blocos de armar (denominados aminoá-
eidos), organizados em correntes, ou sequências.
; Com o que se parecem as proteínas? Embora Emil Fischer tivesse
i. demonstrado que eram constituídas de aminoácidos, os detalhes de sua
estrutura eram desconhecidos. O tamanho colocava-as abaixo até mesmo
do alcance da microscopia eletrônica, embora estivesse se tomando claro
f que as proteínas constituíam as máquinas fundamentais da vida, catalisando
|; a química e construindo as estruturas da célula. Uma nova técnica, por
conseguinte, era necessária para estudar a estrutura da proteína.
;| Na primeira metade deste século, a cristalografia de raios x era usada
T para determinar as estruturas de pequenas moléculas. A cristalografia
l; implica lançar um feixe de raios x sobre o cristal de um elemento químico;
I* os raios são dispersados por um processo chamado duração. Se um filme
fotográfico for colocado atrás do cristal, os raios x difratados podem ser
detectados por exame do filme exposto. O padrão da difração pode, após
aplicação de matemática rigorosa, indicar a posição de cada um e de todos
1, os átomos existentes na molécula. Aplicar as armas da cristalografia de
l raio x às proteínas lhes revelaria a estrutura, mas havia um grande proble-
!ç ma: quanto mais átomos existiam na molécula, mais difícil a matemática e
mais penosa, para começar, a tarefa de cristalizar o elemento químico. Uma
vez que as proteínas têm dezenas de vezes mais átomos do que as moléculas
r costumeiramente examinadas pela cristalografia, esse fato torna o proble
ma
; dezenas de vezes mais difícil. Algumas pessoas, porém, têm dezenas de
: vezes mais perseverança que o resto de nós.
s Em 1958, após décadas de trabalho, J.C. Kendrew determinou a estrutura
l. da proteína mioglobina, usando cristalografia de raio x. Finalmente, uma
técnica mostrava a estrutura detalhada de um dos componentes básicos da
l vida. E o que foi visto? Mais uma vez, maior complexidade. Antes da
22 A CAIXA PRETA DE DARWIN
determinação da estrutura da mioglobina, pensava-se que as proteínas
acabariam por se revelar estruturas simples e regulares, como cristais de sal.
Ao observar a estrutura enrolada, complicada, lembrando um intestino, da
mioglobina, Max Perutz murmurou: "Poderia a busca da verdade final tei
realmente revelado um objeto tão horrendo e parecendo tanto com vísce-
ras?" Desde então, porém, os bioquímicos vieram a apreciar as compli-
cações da estrutura da proteína. Aperfeiçoamentos nos computadores e em
outros instrumentos tomaram a cristalografia muito mais fácil hoje do que
era para Kendrew, embora ainda exija muito trabalho.
Como resultado do trabalho de raio X de Kendrew sobre proteínas e do
(mais famoso) trabalho de Watson e Crick sobre o adn, os bioquímicos-
pela primeira vez, conheceram realmente as formas das moléculas com qui
trabalhavam. O início da bioquímica moderna, que tem se desenvolvido i
um ritmo alucinante desde então, pode ser datado daquela época. Progresso;
na física e química, da mesma forma, transbordaram também para outros
campos e criaram um forte sinergismo na pesquisa sobre a vida.
Embora, em teoria, a cristalografia de raio x possa determinar a estrutura
de todas as moléculas de seres vivos, problemas práticos limitam seu uso a
um número relativamente pequeno de proteínas e ácidos nucleicos. Novas
técnicas, porém, foram adotadas a um ritmo estonteante para complementar
e suplementar a cristalografia. Uma técnica importante para determinar
estruturas é denominada de ressonância magnética nuclear (rmn). Com o
emprego da rmn, uma molécula pode ser estudada enquanto em solução
não tem de ser tediosamente cristalizada. Tal como a cristalografia de raio
x, a rmn encerra limitações que a tomam aplicável apenas a uma parte das
proteínas conhecidas. Juntas, porém, a rmn e a cristalografia de raio x
conseguiram esclarecer as estruturas das proteínas em número suficiente
para dar aos cientistas uma compreensão detalhada de como elas são.
Quando Leeuwenhoek usou um microscópio para ver, em uma minús-
cula pulga, um ácaro ainda mais minúsculo, Jonathan Swift sentiu-se
inspirado a escrever uma poesia jocosa, prevendo um processo intermi-
nável de insetos cada vez menores:
E assim, observam os naturalistas que uma pulga
Tem pulgas menores, que dela se alimentam;
E estas as têm ainda menores, que as picam,
E assim continua ad infinitum.
Swift enganou-se. O processo não continua para sempre. Em fins deste
século, estamos na maré alta da pesquisa sobre a vida e o fim está à vista.A última
caixa
preta restante era a célula, que foi aberta e revelou moléculas
os alicerces da natureza. Mais baixo não podemos descer. Além do mais,
o trabalho já realizado sobre enzimas, outras proteínas e ácidos nucleicos
lançou luz sobre os princípios em funcionamento no nível básico da vida.
Muitos detalhes ainda precisam ser fornecidos, e, sem dúvida, restam
algumas surpresas. Mas, ao contrário dos antigos cientistas que obser-
vavam um peixe, um coração ou uma célula e se perguntavam o que eram
e o que os fazia funcionar , os cientistas modernos estão convencidos de
que as ações das proteínas e outras moléculas são suficientes para explicar
a base da vida. Desde os dias de Aristóteles até a bioquímica moderna, uma
camada após outra foi retirada até que a célula a caixa preta de Darwin
foi aberta.
PEQUENOS SALTOS, GRANDES SALTOS
Vamos supor que uma vala de um metro de largura em seu quintal,
sstendendo-se até o horizonte, separa sua propriedade das terras do vizinho.
Se, um dia, você o encontrasse em seu quintal e lhe perguntasse como ele
Aegou lá, não haveria razão para duvidar da resposta: "Saltei por cima da
vala." Se a vala tivesse dois metros de largura e ele desse a mesma resposta,
yocê ficaria impressionado com a forma atlética dele. Se a vala fosse de três
metros, você poderia ficar desconfiado e lhe pedir que saltasse novamente,
mquanto o observa. Se ele se recusasse, alegando que torceu o joelho, você
teria dúvidas, mas não certeza de que ele estava mentindo. Se a "vala"
ivesse trinta metros de largura, contudo, você nem por um momento
icreditaria que ele saltou de um lado para o outro.
Mas vamos supor que seu vizinho um homem inteligente refaz a
ilegação. Ele não atravessou em um único salto. Em vez disso, explica, no
"Mnyon havia vários pequenos morros, a não mais de três metros de distância
um do outro. Ele saltou de um para o outro até chegar ao seu lado. Olhando
para o canyon, você diz ao vizinho que não está vendo nenhum morrote,
ipenas um largo abismo separando seu quintal do dele. Ele concorda, mas
sxplica que precisou de anos e mais anos para chegar ao seu lado. Durante
ssse tempo, os morrotes surgiam no abismo e ele os cruzava à medida em
que apareciam. Depois que passava, eles eram rapidamente corroídos e se
desfaziam. Tudo muito duvidoso, mas sem uma maneira fácil de desmen-
ti-lo, você muda a conversa para o futebol.
Essa historieta nos ensina várias lições. Em primeiro lugar, a palavra
wlto pode ser oferecida como explicação de como alguém transpôs um
abstáculo, mas a explicação pode variar, de inteiramente convincente a
absolutamente inaceitável, dependendo dos detalhes (como, por exemple
a largura do obstáculo). Em segundo, jornadas longas podem ser tomada
muito mais plausíveis se explicadas como uma série de saltos menores,
não um único grande salto. E, em terceiro, na falta de prova desses salto
menores, é muito difícil aceitar ou refutar alguém que afirma que alpondra
existiram no passado mas que desapareceram.
Claro, a alegoria de saltos por cima de valas, em contraste com canyons
pode ser aplicada à evolução. A palavra evolução tem sido usada par
explicar não só as mudanças minúsculas, mas também as enormes mudan
cãs que ocorrem nos organismos. Nesses casos, recebe nomes separados
em termos aproximados, a microevolução descreve mudanças que poden
ser feitas em um ou alguns pequenos saltos, ao passo que a macroevoluçâ
refere-se àquelas que, aparentemente, exigem grandes saltos.
A teoria de Darwin, de que mesmo mudanças relativamente minúscula.
poderiam ocorrer na natureza, constituiu um grande avanço conceituai. A
observação da realidade dessas mudanças foi uma prova muito agradáve
de sua intuição. Darwin encontrou espécies semelhantes, mas não idênt
cãs, de tentilhões nas ilhas Galápagos e formulou a teoria de que eles dês
cendiam de um ancestral comum. Recentemente, alguns cientistas de Prin
ceton observaram que o tamanho médio do bico de populações de tentilhõe
mudava no curso de alguns anos.3 Anteriormente, havia sido demonstrad
que os números de mariposas de cor clara e escura em uma populaça
mudava à medida que o ambiente passava de fuliginoso a limpo. De form
análoga, aves introduzidas na América do Norte por colonos europeu
diversificaram-se em vários grupos distintos. Em anos recentes, foi possíve
reunir provas de microevolução em escala molecular. Vírus como o qu
causa a aids, por exemplo, mudam seu revestimento a fim de iludir o sistem
imunológico humano. Bactérias causadoras de doenças fizeram seu reapa
recimento à medida que linhagens desenvolviam a capacidade de defende
se dos antibióticos. Muitos outros exemplos poderiam ser citados.
Na pequena escala, a teoria de Darwin triunfou; hoje é tão polêmic
quanto a alegação de um atleta de que pode saltar por cima de uma vale
de um metro de largura. Mas é no nível da macroevolução de grande
saltos que a teoria provoca ceticismo. Numerosos estudiosos seguiram
nas pegadas de Darwin, ao sugerir que enormes mudanças podem se
decompostas em passos pequenos, plausíveis, durante grandes períodos c
tempo. Não surgiram, porém, evidências convincentes em apoio a essa tes
Não obstante, como na história contada pelo vizinho sobre pequenos morros
que desapareciam, era difícil avaliar se os mal-defínidos e impalpáveis
pequenos passos poderiam existir... até agora.
Com o advento da bioquímica moderna podemos examinar hoje o nível
básico da vida. Podemos fazer uma avaliação fundamentada quanto a se os
supostos pequenos passos necessários para gerar grandes mudanças evolu-
tivas podem ser pequenos o suficiente. O leitor verá neste livro que os
canyons que separam formas de vida do dia-a-dia têm suas contrapartidas
nos canyons que separam sistemas biológicos na escala microscópica. Tal
como um padrão de fractais em matemática, no qual um motivo é repetido
mesmo quando olhamos para escalas cada vez menores, abismos intrans-
poníveis abrem-se até no nível mais minúsculo de vida.
A bioquímica levou a teoria de Darwin aos seus últimos limites. Fez isso
ao abrir a última caixa preta, a célula, permitindo que compreendêssemos
como a vida funciona. Foi a espantosa complexidade das estruturas orgâ-
nicas subcelulares que suscitou a questão: de que maneira tudo isso poderia
ter evoluído? Para sentir o impacto da pergunta e para ter uma amostra
do que nos espera , vejamos um exemplo tirado de um sistema bioquí-
mico. A explicação da origem de uma função deve acompanhar a ciência
moderna. Vejamos como a explicação da ciência para uma única função, a
visão, progrediu desde o século xix e, em seguida, perguntemos como isso
afeta nossa tarefa de lhe explicar a origem.
No século xix, a anatomia do olho já era conhecida em detalhe. Apupila,
sabiam os cientistas, funciona como um obturador, deixando passar luz
suficiente para que se possa ver com Sol brilhante ou na escuridão da noite.
As lentes do olho captam a luz e a focalizam na retina, onde ela forma uma
imagem nítida. Os músculos dos olhos permitem que eles se movam
rapidamente. Diferentes cores de luz, com comprimentos de onda dife-
rentes, produziriam uma imagem borrada, não fosse o fato de que as lentes
dos olhos mudam de densidade em sua superfície a fim de corrigir aber-
rações cromáticas. Esses métodos sofisticados deixaram espantados todos
os que os conheciam. Os cientistas do século xix sabiam que, se uma pessoa
carecesse de qualquer dos muitos aspectos integrados dos olhos, o resultado
seria uma grave perda de visão ou cegueira completa. Concluíram que o
olho só podia funcionar se estivesse quase intacto.
Charles Darwin também estava bem informado sobre o olho. Em A
origem das espécies, refutou muitas objeções à sua teoria de evolução por
meio da seleção natural. Discutiu o problema do olho em uma seção do
livro, apropriadamente intitulada "Órgãos de perfeição e complicação
extremas". Segundo pensava, a evolução não podia construir um órgão

26 A CAIXA PRETA DE DARWIN


complexo em uma única, ou em algumas poucas etapas; inovações radica
como o olho exigiriam que gerações de organismos acumulassem lenfc
mente, em um processo gradual, mudanças benéficas. Ele achava que se ei
uma única geração aparecesse, de repente, um órgão tão complexo como
olho, isso equivaleria a um milagre. Infelizmente, o desenvolviment
gradual do olho humano afigurava-se impossível, uma vez que seus muitc
aspectos sofisticados pareciam ser independentes. De alguma maneira, pá'
l que a evolução fosse aceita, ele tinha que convencer o público de que
órgãc
complexos poderiam ser formados através de um processo gradual.
E nisso teve um brilhante sucesso. De forma perspicaz, Darwin nãi
tentou descobrir a estrada real que a evolução poderia ter tomado par
formar o olho. Em vez disso, mencionou animais modernos, dotados d
tipos diferentes de olhos (variando de simples a complexos), e sugeriu qu
l a evolução do olho humano pode ter implicado órgãos semelhantes com
; intermediários (Figura 1-1).
Vejamos a seguinte paráfrase do argumento de Darwin: embora sere
humanos tenham olhos complexos como câmeras, muitos animais conse
guem viver com menos que isso. Algumas criaturas minúsculas dispõen
apenas de um grupo simples de células pigmentadas não mais do que un
ponto sensível à luz. Dificilmente se poderia dizer que esse arranjo simplei
lhes conferiria o sentido de visão, mas tais criaturas poderiam sentir luz (
escuridão e, dessa maneira, atender às suas necessidades. O órgão sensíve
à luz de algumas estrelas-do-mar é um pouco mais sofisticado. O olho s
localiza em uma região rebaixada. Uma vez que a curvatura da depressão
bloqueia a luz vinda de algumas direções, o animal pode reconhecer i
direção de onde ela vem. O senso direcional do olho melhora se a curva s
toma mais pronunciada, embora uma maior curvatura reduza também (
volume de luz que entra no olho, diminuindo sua sensitividade. Esta pod(
ser aumentada pela colocação de material gelatinoso na cavidade, a fim d
servir de lente. Alguns animais modernos têm olhos dotados dessas lenta
grosseiras. Melhoramentos graduais nas lentes poderiam criar imagens cadi
vez mais nítidas para atender aos requisitos do ambiente em que o animal
vive.
Utilizando um raciocínio desse tipo, Darwin convenceu muitos de seus
leitores de que um caminho evolutivo vai do mais simples ponto sensível à
| luz ao sofisticado olho-câmera do homem. A questão de como a visão
i começou, no entanto, continuou sem resposta. Darwin persuadiu grande
| parte do mundo de que o olho moderno evoluiu aos poucos, a partir de
uma
| estrutura mais simples, mas sequer tentou explicar de onde veio esse
ponto
| de partida o ponto relativamente simples sensível à luz. Muito pelo
A CAIXA E ABERTA 27
FIGURA 1-1
uma SÉRIE DE OLHOS. (esquerda) fragmento SIMPLES DE FOTORRECEPTORES,
COMO OS QUE PODEM SER ENCONTRADOS EM MEDUSAS (ÂGUAS-VIVAS). (DIREITA)
OLHO EM CONCHA, COMO OS ENCONTRADOS NAS LAPAS MARINHAS. (abaixo) olho
DOTADO DE LENTE, DE CARACOL MARINHO.
pigmento visual

Extraído de McGraw-Hill Encyclopedia ofScience & Technology, 6a. ed., Nova York,
McGraw-Hill, 1987. Reproduzido com permissão.
contrário, Darwin encerrou a questão da origem do olho: "O modo como
um nervo se toma sensível à luz pouco mais nos interessa do que a questão
de como surgiu a própria vida."4
Ele tinha um excelente motivo para declinar do trabalho de estudar a
questão; ela se situava muito além da capacidade da ciência do século xix.
O modo como o olho funciona isto é, o que acontece quando um fóton
de luz atinge a retina simplesmente não podia ser explicado na época.
Na verdade, nenhuma pergunta sobre os mecanismos subjacentes da vida
podia ser respondida. De que maneira os músculos do animal ocasionai
os movimentos? Como funciona a fotossíntese? Como a energia é extraíd
dos alimentos? Como o corpo combate as infecções? Ninguém sabia.
Para Darwin, a visão era uma caixa preta, mas, após o árduo trabalh(
cumulativo de inúmeros bioquímicos, estamos nos aproximando agora da
respostas às perguntas sobre o olho.5 Os cinco parágrafos seguintes fome
cem um esboço bioquímico da operação do olho. (Nota: Esses parágrafo
técnicos são destacados pelo símbolo |_1 no princípio e no fim.) Não se deixi.
abalar pêlos nomes estranhos dos componentes. Eles são apenas rótulos,
não mais esotéricos do que carburador ou diferencial para alguém que lê
pela primeira vez um manual de automóvel. Leitores que tenham apetite
por detalhes encontrarão mais informações em muitos livros de bioquímica;
outros podem desejar ler os parágrafos apenas superficialmente eou passar
às Figuras 1-2 e 1-3 para pegar o sentido da explicação.
Q Quando a luz atinge a retina, um fóton interage com uma molécula
denominada ll-cü-retinal, que se rearranja em um pico-segundo (um
trilionésimo de segundo) e se transforma em trarisretinaL (Um pico-
segundo é mais ou menos o tempo que a luz leva para cruzar a largura
de um único cabelo humano). A mudança na forma da molécula reti-
nal força uma mudança na forma da proteína, a rodopsina, à qual a retina]
está fortemente ligada. A metamorfose da proteína altera seu comporta-
mento. Nesse momento denominada de metarrodopsina n, a proteína
cola-se a outra proteína, chamada transducina. Antes de transformar-se
em metarrodopsina li, a transducina liga-se fortemente a uma pequena
molécula chamada gdp. Mas, quando a transducina interage com a
metarrodopsina li, a gdp se desprende e uma molécula chamada gtp
cola-se à transducina. (A gtp mantém uma estreita relação com a gdp,
mas é muito diferente dela.)
A GTP-transducina-metarrodopsina 11 liga-se agora a uma proteína
chamada fosfodiesterase, localizada na membrana interna da célula.
Quando ligada à metarrodopsina n e a seu grupo, a fosfodiesterase
adquire a capacidade química de "cortar" uma molécula chamada cgmp
(um elemento químico aparentado a gdp e gtp). Inicialmente, há grande
número de moléculas cgmp na célula, mas a fosfodiesterase reduz sua
concentração da mesma maneira que a retirada da tampa do ralo baixa
o nível de água em uma banheira.
A CAIXA É ABERTA 29
FIGURA 1-2
primeiro ESTÁGIO DA VISÃO. um FÓTON DE LUZ CAUSA UMA MUDANÇA NA FORMA DE
UMA PEQUENA MOLÉCULA ORGÂNICA, RETINAL. ESTA AÇÂO OCASIONA UMA MUDANÇA
NA FORMA DE UMA PROTEÍNA MUITO MAIOR, A RODOPSINA, À QUAL ELA SE LIGA. O
DESENHO DA PROTEÍNA ABAIXO NÃO ESTÁ EM ESCALA.

Luz

Outra membrana de proteína que se liga à cgmp é denominada


de canal iônico. Ela funciona como um portão que regula o número
de íons de sódio na célula. Normalmente, o canal permite que íons de
sódio entrem na célula, enquanto uma proteína separada os bombeia
ativamente para fora. Aação dupla do canal iônico e da bomba mantém
o nível de íons de sódio na célula dentro de uma faixa estreita. Quando o
volume de cgmp é reduzido devido à divisão efetuada pela fosfodies-
terase, o canal iônico se fecha, fazendo com que seja reduzida a con-
centração celular de íons de sódio positivamente carregados. Esse fa-
to ocasiona um desequilíbrio de carga de um lado a outro da membrana
da célula que, enfim, faz com que uma corrente seja transmitida pelo
nervo óptico até o cérebro. O resultado, quando interpretado pelo cére-
bro, é a visão.
Se as reações mencionadas acima fossem as únicas que ocorrem na
célula, o suprimento de 11-cü-retinal, cgmp e íons de sódio logo seria
esgotado. Alguma coisa tem que desativar as proteínas que foram ligadas
e fazer a célula voltar a seu estado inicial. Vários mecanismos se
encarregam disso. Em primeiro lugar, no escuro, o canal iônico (além
dos íons de sódio) também deixa que íons de cálcio penetrem na célula.
O cálcio é bombeado para fora por uma proteína diferente, de modo a
ser mantida uma concentração constante de cálcio. Quando os níveis de
cgmp caem, fechando o canal iônico, decresce também a concentração
de íons de cálcio. A enzima fosfodiesterase, que destrói a cgmp, diminui
em uma concentração mais baixa de cálcio. Em segundo, uma proteína
denominada guanilato ciclase começa a ressintetizar a cgmp quando os
níveis de cálcio começam a cair. Em terceiro, enquanto tudo isso
acontece, a metarrodopsina li é quimicamente modificada por uma
enzima chamada rodopsinacinase. Arodopsinamodificada liga-se auma
proteína conhecida como arrestina, que impede que a rodopsina ative
mais transducina. Acélula, portanto, contém mecanismos que limitam o
sinal amplificado iniciado por um único fóton.
Atransretinal por fim desprende-se da rodopsina e precisa ser recon-
vertida em 11-cu-retinal e, mais uma vez, ligada à rodopsina para voltar
ao ponto de partida de outro ciclo visual. A fim de realizar isso, a
(rawretinal primeiro é modificada quimicamente por uma enzima e
transformada em transtetmol uma forma que contém mais dois
átomos de hidrogénio. Uma segunda enzima converte, em seguida, a
molécula em 11-cü-retinol. Enfim, uma terceira enzima remove os
átomos de hidrogénio previamente acrescentados a fim de formar o
ll-rií-retinol, e o ciclo se completa. Q
A explicação acima é apenas uma visão muito superficial do todo da
bioquímica da visão. Em última análise, porém, esse é o nível de expli-
cação a que a ciência biológica deve aspirar. A fim de compreender
realmente uma função, temos de compreender, em detalhes, cada passo
A CAIXA É ABERTA 31
FIGURA 1-3
BIOQUÍMICA DA VISÃO. RH, RODOPSINA; RHK, CINASE DA RODOPSINA; A, ARRESTINA;
GC, GUANILATO CICLASE; T, TRANSDUCINA; PDE, FOSFODIESTERASE.

Extraído de Chabre, M. & Deterre, P. (1989). European Journal of Biochemistry, 179


,
p.255. Reproduzido com permissão.
relevante no processo. Os passos relevantes em processos biológicos
ocorrem, em última análise, no nível molecular, de modo que a explicação
satisfatória de um fenómeno biológico tal como a visão, a digestão ou
a imunidade precisa incluir a explicação molecular.
Agora que a caixa preta da visão foi aberta, não é mais aceitável que uma
explicação evolutiva dessa capacidade leve em conta apenas as estruturas
anatómicas de olhos completos, como fez Darwin no século xix (e como
continuam a fazer hoje os popularizadores da evolução). Todas as etapas e
estruturas anatómicas que Darwin julgou tão simples implicam, na verdade,
processos biológicos imensamente complicados que não podem ser disfar-
çados por retórica. Verifica-se hoje que os saltos metafóricos de Darwin,
um morrote a outro, foram muitas vezes saltos enormes entre máquin;
cuidadosamente construídas distâncias que exigiriam um helicópter
para serem cruzadas em uma única viagem.
A bioquímica, portanto, lança um desafio liliputiano a Darwin. A anato
mia, nos termos mais simples, é irrelevante para se descobrir se a evoluçã
poderia ou não ocorrer no nível molecular. O mesmo acontece com
registro fóssil. Já não importa se há imensos vazios no registro fóssil ou s
ele é tão contínuo como a lista dos presidentes norte-americanos. E se h
buracos, não importa se podem ser explicados plausivelmente.6 O registo
fóssil nada tem a nos dizer sobre se as interaçôes da 11-cu-retinal com
rodopsina, a transducina ou a fosfodiesterase, poderiam ou não ter s
desenvolvido passo a passo. Também não importam os padrões da biogeo
grafia, nem os da biologia das populações; tampouco as explicações tradi
cionais da teoria evolutiva sobre órgãos rudimentares ou abundância d
espécies. Isso não quer dizer que a mutação aleatória seja um mito, ou qu
o darwinismo nada explique (explica muito bem a microevolução), ou qu(
fenómenos em grande escala, como a genética das populações, não tên
importância. Têm, sim. Até recentemente, porém, os biólogos evolucionis
tas podiam ignorar os detalhes moleculares da vida porque muito pouco s
conhecia sobre eles. Agora, a caixa preta da célula foi aberta e o mundc
infinitesimal que veio à tona precisa ser explicado.
CALVINISMO
Parece ser típico da mente dos seres humanos que, quando esses vêem um
caixa preta em ação, imaginam que seu conteúdo é simples. Um bor
exemplo é visto na história em quadrinhos "Calvin e Haroldo" (Figura 1-4),
Calvin está sempre saltando em uma caixa em companhia de seu tigre de
pelúcia, Haroldo, e viajando de volta no tempo, "transformando-se" em
formas animais ou usando-a como "duplicador" e fazendo clones de s:
mesmo. Um menininho como Calvin pode facilmente imaginar que uma
caixa consegue voar como se fosse um avião (ou alguma outra coisa),
porque não sabe como os aviões funcionam.
De diversas maneiras, os cientistas adultos têm a mesma propensão ao
pensamento veleitário que meninos como Calvin. Há centenas de anos, por
exemplo, pensava-se que insetos e outros pequenos animais nasciam dire-
lamente de alimentos estragados. Era fácil acreditar nisso, porque se pen-
sava que animais pequenos eram muito simples (antes da invenção do
microscópio, os naturalistas pensavam que os insetos não possuíam órgãos
Calvin e Haroldo por Bill Watterson
ACHO QUE SE CONSEGUIRMOS UM
AMiSSOlAESTAAJUSMDABW, EU TCHHO UMA ItTCUtITA. rCK OUE ",,.,-,,,..,
-, ..
140 MILHÕES DEANOÏ W 1»SSADO. A CIEMTC MÃO HM MA» JWEX BrLü.tlSSaMAS|
QUE «xET
l «JÀkJC klMAc-1 OUWDO RECUAMOS NO TEMrO. E W! FXECKAR DE TIRADO "D"
EM
LA VAMOS N0009 DESAFAtECEMOSOJA»» UM BOCADO DE 7 MATCMÂTC,

calvin and hobbes, copyright 1990 Watterson. Distribuído pelo Universal Press Syn-
dicate. Reproduzido com permissão. Todos os direitos reservados.
internos). Mas, à medida que a biologia progredia e experimentos cuidado-
sos demonstravam que alimentos bem conservados não geravam vida, a
teoria da geração espontânea recuou para os limites além dos quais a ciência
não conseguia detectar o que estava realmente acontecendo. No século xix,
isso significava a célula. Quando se deixava que cerveja, leite ou urina
permanecessem por vários dias em recipientes, mesmo que fechados, eles
sempre se tomavam turvos com alguma coisa que neles crescia. Os micros-
cópios dos séculos xvin e xix mostraram que o crescimento era muito
pequeno, aparentemente de células vivas. Parecia razoável, portanto, que
organismos vivos pudessem surgir de forma espontânea em líquidos.
O importante para convencer as pessoas era a descrição das células como
"simples". Um dos principais defensores da teoria da geração espontânea
em meados do século xix, Emst Haeckel, foi um grande admirador de
Darwin e divulgador entusiástico de sua teoria. Com base na visão limitada
das células proporcionada pêlos microscópios da época, Haeckel acreditava
que a célula era um "um pedaço simples de combinação albuminosa de
carbono",7 não muito diferente de um ponto microscópico de gelatina. Por
isso, parecia a Haeckel que uma vida simples como essa sem órgãos inter-
nos, poderia ser gerada facilmente a partir de material inanimado. Hoje, é
claro, sabemos que não é assim.
Vejamos uma analogia simples: Darwin é para nossa compreensão da
origem da visão o que Haeckel é para nossa compreensão da origem da
vida. Em ambos os casos, brilhantes cientistas do século xix tentaram
explicar a biologia liliputiana que a eles era oculta e ambos assim fizeram
supondo que o interior da caixa preta deveria ser simples. O tempo pró'
estarem errados.
Até a primeira metade do século xx, os muitos ramos da biologia:
mantinham nenhuma comunicação entre si.8 Como resultado, a genétíc
sistemática, a paleontologia, a anatomia comparada, a embriologia e oul
áreas formularam opiniões próprias sobre o que significava evoluç
Inevitavelmente, a teoria evolucionária começou a representar coisas d:
j rentes para as diversas disciplinas e, dessa maneira, perdia-se um
a vi
coerente da evolução darwiniana. Em meados deste século, contudo, lide
desses campos organizaram uma série de reuniões interdisciplinares, a
vistas a fundir suas opiniões em uma teoria coerente da evolução bases
em princípios darwinianos. O resultado disso recebeu o nome de "sínt(
evolutiva", e a teoria foi denominada neodarwinismo. O neodarwinisi
forma a base do pensamento evolutivo moderno.
j Um ramo da ciência, porém, não foi convidado para a reunião, e por
i
| bom motivo: não existia ainda. Os primórdios da bioquímica moder
surgiram apenas depois de oficialmente lançado o neodarwinismo.
j mesma maneira que a biologia teve de ser reinterpretada após a desc
obe
| da complexidade da vida microscópica, portanto, o neodarwinismo tem
ser repensado à luz dos progressos na bioquímica. As disciplinas
científ
ic
que faziam parte da síntese evolutiva eram todas não-moleculares. Am
assim, para que fosse verdadeira, a teoria darwiniana da evolução teria q
explicar a estrutura molecular da vida. O objetivo deste livro é mostrar q
ela não o faz.
PARAFUSOS E PORCAS
Lynn Margulis é professora emérita de biologia da Universidade de Mas-
sachusetts. Muito respeitada por sua teoria, amplamente aceita, de que as
mitocôndrias, as fontes de energia das células de plantas e animais, foram
outrora células bacterianas independentes, Margulis diz que a história
acabará por julgar o neodarwinismo uma "pequena seita religiosa do século
XX, dentro da fé religiosa geral da biologia anglo-saxônica".1 Em suas
muitas palestras, ela pede a biologistas moleculares presentes na plateia que
citem um único e inequívoco exemplo de formação de uma nova espécie
pelo acúmulo de mutações. Ninguém aceita o desafio. Os proponentes da
teoria padrão, afirma ela, "espojam-se em sua interpretação zoológica,
capitalista, competitiva, regida pelo custo-benefício da obra de Darwin
tendo-o compreendido de forma errónea... O neodarwinismo que insiste
(em pequenas mutações cumulativas) está completamente aterrorizado."
Citações picantes, essas. E ela não está sozinha em seu desagrado. Nos
últimos 130 anos, o darwinismo, embora bastante enraizado, tem enfrenta-
do uma série ininterrupta de críticas, partidas tanto de dentro quanto de fora
da comunidade científica. Na década de 1940, o geneticista Richard Gold-
schmidt tomou-se tão desencantado com a explicação do darwinismo sobre
as origens de novas estruturas que foi levado a propor a teoria do "monstro
esperançoso". Goldschmidt pensava que, às vezes, mudanças grandes e
coordenadas poderiam ocorrer simplesmente ao acaso talvez um réptil
pusesse um ovo apenas uma vez, digamos, e nele fosse chocada uma ave.
A teoria do monstro esperançoso não pegou. A insatisfação com a in-
terpretação darwiniana do registro fóssil, no entanto, aflorou várias décadas
depois. O paleontólogo Niles Eldredge descreve assim o problema:
Não é de se espantar que os paleontólogos tenham ignorado a evolução
tanto tempo. Aparentemente, ela jamais ocorre. A coleta cuidados?
material na face de penhascos mostra oscilações em ziguezague, pequ
e uma acumulação muito rara de leves mudanças no decorrer de mill
de anos, a uma taxa lenta demais para explicar toda a mudança prodig
que ocorreu na história evolutiva. Quando vemos o aparecimento de n
dades evolutivas, isso ocorre em geral com um estrondo e, não raro,
nenhuma prova sólida de que os fósseis não evoluíram também em ou
lugares! A evolução não pode estar ocorrendo sempre em outros luga
Ainda assim, foi dessa maneira que o registro fóssil pareceu a mu
desesperados paleontólogos que queriam aprender alguma coisa sob
evolução.2
Na tentativa de suavizar o dilema, Eldredge e Stephen Jay Gould propi
ram, em princípios da década de 1970, a teoria a que denominai
"equilíbrio pontuado".3 Ela postula duas ideias: que, durante longos pé
dos, a maioria das espécies passa por poucas mudanças observáveis; e (
quando isso ocorre, a mudança é rápida e concentrada em populaç
pequenas e isoladas. Se isso acontecesse, intermediários fósseis ser
difíceis de encontrar, o que combinaria com o falho registro fóssil. Tal co
Goldschmidt, Eldredge e Gould acreditam em uma ascendência com
mas acham que outro mecanismo, que não a seleção natural, é necess
para explicar mudanças rápidas, em grande escala.
Gould tem ocupado o primeiro plano na discussão de outro fenôm
fascinante: a "explosão cambriana". Buscas cuidadosas revelaram ape
raros exemplares de fósseis de criaturas multicelulares em rochas de m
de seiscentos milhões de anos. Ainda assim, em rochas apenas um pó
mais jovens, é encontrada uma profusão de animais fossilizados, c
grande número de planos corporais muito diferentes. Recentement
tempo estimado em que ocorreu a explosão foi revisado para baixo
cinquenta milhões para dez milhões de anos o que equivale a um pi
de olhos em termos geológicos. Essa estimativa mais curta obrigou es
tores sensacionalistas a procurar novos superlativos, sendo um dos favor
o "Big Bang biológico". Gould argumenta que a rápida taxa de aparecim
to de novas formas de vida exige outro mecanismo para explicá-las que
a seleção natural.4
Ironicamente, voltamos ao ponto de partida desde os dias de Darw
Quando ele propôs sua teoria, uma das grandes dificuldades era a k
estimada da terra. Os físicos do século xix pensavam que a Terra t
apenas cem milhões de anos, ainda que Darwin pensasse que a seleç
natural precisaria de muito mais tempo para gerar vida. No início, provo
A CAIXA E ABERTA 37
que ele tinha razão; sabe-se hoje que a Terra é muito mais antiga. Com a
descoberta do Big Bang biológico, contudo, o espaço de tempo necessário
para que a vida passasse de simples a complexa encurtou para muito menos
do que a estimativa da idade da Terra no século xix.
Mas não são apenas paleontólogos à procura de ossos que estão desani-
mados. Muitos biólogos evolucionistas que examinam organismos comple-
tos também especulam como o darwinismo pode explicar suas observações.
Os biólogos ingleses Mae-Wan Ho e Peter Saunders queixam-se da seguinte
Passou-se aproximadamente meio século desde a formulação da síntese
neodarwiniana. Grande volume de pesquisa foi realizado dentro do paradig-
ma que ela define. Ainda assim, os sucessos da teoria se limitam às minúcias
da evolução, tal como a mudança adaptativa da coloração de mariposas, ao
mesmo tempo que pouquíssimo tem a dizer sobre as questões que mais nos
interessam, como, para começar, de que maneira surgiram as mariposas.5
O geneticista John McDonald, da Universidade da Geórgia, chama atenção
para um enigma:
Os resultados dos últimos vinte anos de pesquisa sobre a base genética da
adaptação levaram-nos a um grande paradoxo darwiniano.AçMees [genes]
que são obviamente variáveis em populações naturais não parecem cons-
tituir a base de muitas das grandes mudanças adaptativas, enquanto que
aqueles [genes] que parecem constituir, de fato, afundamento de muitas, se-
não da maioria, das grandes mudanças adaptativas, aparentemente não são
variáveis em populações naturais.6 [grifo do original]
O geneticista evolucionista australiano George Miklos tenta decifrar a
utilidade do darwinismo:
O que, então, essa teoria geral e abrangente de evolução prevê? Dado um
punhado de postulados, tal como mudanças aleatórias e coeficientes de
seleção, ela prognosticará frequências [em genes] ao longo do tempo. É
assim que deve ser uma teoria geral da evolução?7
Jerry Coyne, do Departamento de Ecologia e Evolução da Universidade de
Chicago, chega a um veredicto imprevisto:
Concluímos inesperadamente que há poucas provas que sustentem a
teoria neodarwiniana: seus alicerces teóricos são fracos, assim como as
evidências experimentais que a apoiam.8
38 A CAIXA PRETA DE DARWIN
E o geneticista John Endier, da Universidade da Califórnia, pensa o seguinte
sobre como surgem mutações benéficas:
Embora se saiba muita coisa sobre mutação, ela ainda é, na maior parte, um
"caixa preta" no que diz respeito à evolução. Funções bioquímicas nova
parecem ser raras na evolução, e a base de sua origem é virtualmente desco-
nhecida.9
Os matemáticos, ao longo de todos esses anos, têm se queixado de que
os números do darwinismo simplesmente não fazem sentido. Hubert Yo-
ckey, teórico da informação, argumenta que a informação necessária para
iniciar a vida não poderia ter surgido por acaso, e sugere que a vida seja
considerada um dado, como a matéria ou a energia.10 Em 1966, ilustres
matemáticos e biólogos evolucionistas realizaram um simpósio no Wistai
Instituto, na Filadélfia, porque o organizador do evento, Martin Kaplan,
entreouvira "uma discussão muito estranha entre quatro matemáticos...
sobre as dúvidas matemáticas relativas à teoria de evolução darwinia-
na".11 A um matemático que alegara que o tempo para o número de
mutações aparentemente necessárias para criar um olho era insuficiente,
biólogos disseram que seus números deviam estar errados. Os matemá-
ticos, porém, não se convenceram disso. Ou, como disse um deles:
Há uma grande lacuna na teoria neodarwiniana da evolução, e acreditamos
que ela deva ser de tal natureza que não possa ser conciliada com a
concepção corrente da biologia.12
Stuart Kauffman, do Santa Fe Institute, é um dos mais destacados
proponentes da "teoria da complexidade". Em curtas palavras, ela sugere
que numerosos aspectos dos sistemas vivos são resultados de auto-orga-
nização a tendência de sistemas complexos a se organizarem em
padrões e não de seleção natural:
Darwin e a evolução nos dominam, quaisquer que sejam as queixas dos
cientistas criacionistas. Mas será correta essa tese? Melhor ainda, será
adequada? Acredito que não. Não é que Darwin tenha errado, roas sim,
compreendido apenas parte da verdade.13
Se até agora atraiu poucos adeptos, a teoria da complexidade não padece
por falta de críticas. John Maynard Smith, orientador de Kauffman em seus
estudos de pós-graduação, queixa-se de que a teoria é matemática demais
e que pouca ligação tem com a química da vida real.14 Embora a queixa
tenha seus méritos, Smith não oferece solução para o problema identificado
por Kauflman a origem dos sistemas complexos.
Levando-se tudo isso em conta, a teoria de Darwin provocou discórdia
desde que foi publicada, e não apenas por razões teológicas. Em 1871, um
dos críticos de Darwin, St. George Mivart, elaborou uma lista de suas
objeções à teoria, muitas das quais são surpreendentemente semelhantes às
levantadas por críticos modernos.
O que caberia alegar (contra o darwinismo), poderia ser resumido da
seguinte maneira: que a "seleção natural" é incapaz de explicar os estágios
incipientes de estruturas úteis. Que não se harmoniza com a coexistência de
estruturas muito semelhantes, de origem diferente. Que há fundamentos
para pensar-se que diferenças específicas podem ser desenvolvidas súbita,
e não gradualmente. Que ainda é sustentável a opinião de que as espécies
têm limites definidos, embora muito diferentes, para sua variabilidade. Que
certas formas transicionais fósseis estão ausentes, quando se poderia esperar
que estivessem presentes... Que há numerosos fenómenos notáveis em
formas orgânicas sobre os quais a "seleção natural" pouco tem a dizer.15
Parece, então, que o mesmo debate tem sido repetido há mais de um século
sem solução. De Mivart a Margulis, sempre houve cientistas bem informa-
dos, respeitados, que julgaram o darwinismo inadequado. Ao que parece, ou
as questões levantadas inicialmente por Mivart passaram sem resposta, ou
alguns indivíduos não se satisfizeram com as respostas que receberam.
Mas, antes de prosseguir, devemos notar o óbvio: se uma pesquisa de
opinião fosse feita entre todos os cientistas do mundo, a grande maioria
responderia que acredita que o darwinismo é uma teoria correia. Os cientistas,
porém, tal como todas as pessoas, baseiam a maior parte de suas opiniões na
palavra de outras pessoas. Entre a grande maioria que aceita o darwinismo, o
maior número (embora não todos) assim age baseado em pronunciamentos de
autoridade. Além disso, infelizmente, com uma frequência grande demais, as
críticas foram ignoradas pela comunidade científica por medo de fornecer
munição aos criacionistas. É irónico que, em nome da defesa da ciência, uma
enrica científica incisiva da seleção natural tenha sido posta de lado.
Chegou a hora de pôr o debate às claras e ignorar os problemas dejelações
públicas. A ocasião do debate é agora, porque, pelo menos, chegamos aos
fundamentos da biologia e uma solução é possível. Nos níveis mais primários
da biologia a vida química da célula descobrimos um mundo complexo,
que muda radicalmente os fundamentos sobre os quais a polémica darwiniana
deve ser discutida. Vejamos, por exemplo, o que a visão bioquímica faz com
o debate criacionistasdarwinistas sobre o besouro-bombardeiro.
BOMBAS BESOUROS
O besouro-bombardeiro é um inseto de aparência comum, que tem cerc;
de um centímetro e meio de comprimento. Quando ameaçado por outrc
inseto, porém, ele dispõe de um método especial de defesa: esguicha umi
solução fervente contra o inimigo, através de um orifício em sua seçãc
posterior.16 O líquido quente escalda o alvo que, em geral, faz outros plano;
para o jantar. De que maneira é feito esse truque?
O besouro-bombardeiro usa a química. Antes da batalha, estrutura;
especializadas denominadas lobos secretórios fabricam uma mistur;
altamente concentrada de dois elementos químicos, o peróxido de hidrogê
nio e a hidroquinona (Figura 2-1). O peróxido de hidrogénio é o mesmc
material que podemos comprar na farmácia; a hidroquinona é usada ni
revelação de filmes. A vesícula coletora está ligada, mas em geral não ten
acesso, a um segundo compartimento chamado (evocativamente) de cama'
rã de combustão. Os dois compartimentos são mantidos separados por un
músculo esfíncter, muito parecido com aquele de que os seres humano;
dependem para manter continência fecal. Anexo à câmara de combustão hi
certo número de pequenos nódulos, denominados glândulas ectodérmicas
que produzem enzimas catalisadoras e as liberam na câmara de combustão
Quando se sente ameaçado, o besouro contrai os músculos que cercam i
câmara de armazenamento, relaxando ao mesmo tempo o músculo esfínc
ter. Essa ação obriga uma solução de peróxido de hidrogénio e hidroquinoni
a entrar na câmara de combustão, onde ela se mistura com enzima;
catalisadoras.
Nesse momento, quimicamente falando, as coisas se tomam muit(
interessantes. O peróxido de hidrogénio decompõe-se rapidamente em águi
comum e oxigénio, da mesma maneira que uma garrafa de peróxido d
hidrogénio comprado em farmácia se decompõe com o passar do tempo, s
deixada aberta. O oxigénio reage com a hidroquinona e produz mais água
além de um produto químico altamente irritante, denominado quinona
Essas reações liberam grande quantidade de calor. Atemperatura da solução
sobe para o ponto de ebulição. Na verdade, uma parte se transforma en
vapor. O vapor e o gás, o oxigénio, exercem grande pressão sobre as parede!
da câmara de combustão. Estando o esfíncter muscular nesse momento
fechado, um canal que se dirige para fora, a partir do corpo do besouro
proporciona a única saída para a mistura fervente. Os músculos qu(
envolvem o canal permitem que ojato de vapor seja dirigido contra a origen
do perigo. Como resultado final, o inimigo do besouro é escaldado por umi
solução fervente do produto químico tóxico denominado quinona.
A CAIXA E ABERTA
APARELHO DEFENSIVO DO BESOURO-BOMBARDEIRO: B, VESÍCULA COLETORA; E,
CÂMARA DE COMBUSTÃO; G, GLÂNDULAS ECTODÊRMICAS QUE SECRETAM CATALASE;
L, LOBOS SECRETÓRIOS; M, ESFÍNCTER MUSCULAR; O, DUTO DE SAÍDA. B CONTÉM
UMA MISTURA DE HIDROOUINONA E PERÓXIDO DE HIDROGÉNIO QUE É EXPLODIDA PELA
CATALASE AO ENTRAR EM E.
Extraído de Crowson, R.A. (1981), The Biology ofthe Coleoptera, Nova York, Academi
a
Press, Cap.15. Reproduzido com permissão.
O leitor pode querer saber por que a mistura de peróxido de hidrogénio
e quinona não reagiu explosivamente quando estava na vesícula coletora.
A razão é que numerosas reações químicas ocorrem com grande lentidão se
não houver uma maneira fácil de as moléculas se reunirem no nível atómico.
Se não fosse assim, este livro pegaria fogo ao reagir com o oxigénio do ar.
Como analogia, pense em uma porta trancada. Não há maneira fácil para
que pessoas (digamos, rapazes e moças adolescentes), que se encontram
nos dois lados, se reunam, mesmo que ficassem muito felizes se isso
acontecesse. Se alguém tem a chave, contudo, a porta pode ser aberta e
feitas as apresentações apropriadas. As enzimas catalisadoras fazem o papel
da chave, permitindo que o peróxido de hidrogénio e a hidroquinona se
reunam no nível atómico, de modo que possa ocorrer a reação.
O besouro-bombardeiro é um dos favoritos dos criacionistas. (Um livro
de histórias para crianças, Bomby, the Bombardier Beetie, de Hazel May
Rue, foi publicado pelo Instituto for Creation Research.) Eles provocam os
evolucionistas mencionando o notável sistema defensivo do besouro e
convidando-os a explicar como o mesmo poderia ter evoluído gradual-

mente. Richard Dawkins, professor de zoologia da Universidade de Oxfor


aceitou o desafio. Dawkins é o melhor divulgador do darwinismo e
atividade. Seus livros, incluindo o O relojoeiro cego, muito elogiado pé
crítica, são acessíveis ao leigo interessado e, de quebra, muito divertido
Dawkins escreve com paixão, porque acredita na verdade do darwinism
Acredita também que o ateísmo é uma dedução lógica do darwinismo,
que o mundo seria melhor se mais pessoas tivessem a mesma opinião.
Em O relojoeiro cego, Dawkins discute brevemente o besouro-bomba
deiro. Em primeiro lugar, cita um trecho de O pescoço da girafa, livro t
autoria do divulgador científico Francis Hitching, que descreve o sistem
defensivo do besouro como parte de um argumento contra o darwinismo
[O besouro-bombardeiro] esguicha uma mistura letal de hidroquinona
peróxido de hidrogénio no focinho do inimigo. Os dois produtos química
quando misturados, explodem, literalmente. Em vista disso, paraannazen
los no corpo, o besouro-bombardeiro desenvolveu um inibidor químico
fim de toma-los inócuos. No momento em que o besouro esguicha o líquk
pela cauda, um antiinibidor é acrescentado para tornar a mistura novamen
explosiva. A cadeia de eventos que poderia ter levado à evolução de u
processo tão complexo, coordenado e sutil como esse, está além da exp
cação biológica em uma simples base gradual. A menor alteração
equilíbrio químico resultaria imediatamente em uma raça de besouro
dizimados por explosões.17
Ao que Dawkins responde:
Um colega bioquímico forneceu-me, bondosamente, uma garrafa de peróx
do de hidrogénio e hidroquinona suficiente para cinquenta besouros-bom
bardeiros. Vou misturar os dois. De acordo com [Hitching], eles explodir
em minha cara... Bem, ainda continuo aqui. Derramei o peróxido de hidr
génio na hidroquinona e nada, absolutamente nada, aconteceu. Não se
nem mesmo calor... A declaração de que esses "dois produtos químico
quando misturados, explodem, literalmente" é, sem meias palavras, fals
embora costume ser repetida na literatura criacionista. Por falar nisso, se
leitor se sente curioso sobre o besouro-bombardeiro, o que de fato aconte
é o seguinte: é verdade que ele esguicha uma mistura escaldante de peróxk
de hidrogénio e hidroquinona contra os inimigos. O peróxido de hidrogên
e a hidroquinona, porém, não reagem violentamente, a menos que se
adicionado um catalisador. E é isso o que o besouro-bombardeiro faz
Quanto aos precursores evolutivos do sistema, o peróxido de hidrogénio
vários tipos de quinonas são usados para outros fins na química corporal.
A CAIXA E ABERTA 43
Os ancestrais do besouro simplesmente puseram em serviço elementos
químicos que já existiam. E é assim que a evolução funciona.18
Embora Dawkins se saia melhor no entrevero, nem ele nem os cria-
cionistas conseguem provar o argumento que defendem. A explicação de
Dawkins sobre o sistema repousa no fato que os elementos do mesmo "já
existiam". A evolução, portanto, poderia ser possível. Mas não explica
como operóxido de hidrogénio e as quinonas podem ser secretados juntos
em concentração muito alta em um único compartimento, que é ligado
através de um tubo acionado por um esfíncter a um segundo comparti-
mento, que contém as enzimas necessárias à reação rápida dos elementos
químicos.
Aquestão fundamental é a seguinte: De que maneira sistemas bioquími-
cos complexos poderiam ser produzidos? O problema com o "debate"
acima é que ambos os lados não se entendem. Um lado entende mal seus
fatos; o outro apenas os corrige. O trabalho dos darwinistas, porém, consiste
em responder a duas perguntas: Em primeiro lugar, quais 500 exatamente
os estágios da evolução do besouro, em toda sua complexa glória? Em
segundo, dados esses estágios, de que maneira o darwinismo nos leva de
um estágio ao outro?
Dawkins não nos fornece detalhe algum sobre a maneira como o sistema
defensivo do besouro-bombardeiro poderia ter evoluído. A fim de mostrar
o problema que existe em seu argumento, contudo, vamos utilizar o que
conhecemos sobre a anatomia dos besouros, com vistas a formular o melhor
argumento possível para a evolução do besouro-bombardeiro. Em primeiro
lugar, temos que notar que a função do aparelho defensivo do besouro-bom-
bardeiro é repelir atacantes. Os componentes do sistema são: l) peróxido
de hidrogénio e hidroquinona, produzidos por lobos secretórios; 2) enzimas
catalisadoras produzidas pelas glândulas ectodérmicas; 3) vesícula coleto-
ra; 4) esfíncter muscular; 5) câmara de combustão; e 6) duto de saída. Nem
todos esses componentes, no entanto, são necessários para a função do
sistema. A hidroquinona, em si, é nociva a predadores. Muitas espécies de
besouros sintetizam quinonas que não são nem mesmo secretadas, mas que
têm "gosto ruim". Inicialmente, vários besouros individuais são mastigados
e, em seguida, cuspidos pelo predador, que aprende a evitar, no futuro,
insetos semelhantes e, dessa maneira, a espécie como um todo se beneficia
com esse sistema de defesa.
A hidroquinona sozinha, portanto, exerce a função defensiva que atri-
buímos a todo o sistema. Poderão os outros componentes ser adicionados
de tal maneira ao sistema do bombardeiro que a função melhore continua-
mente? Ao que parece, sim. Podemos imaginar que o besouro se benefícia-
ria com a concentração da hidroquinona em um espaço de armazenamen
como a vesícula coletora. Isso permitiria ao besouro fabricar grande qu
tidade de elemento químico nocivo e, ao assim agir, tornar-se de péssil
gosto quando comido, mas sem causar problemas internos. Se a vesíc
coletora desenvolvesse, de alguma maneira, um canal para o mundo exte
no, a hidroquinona poderia vazar e talvez repelir os atacantes antes que eli
comessem o besouro. Numerosos besouros possuem sistemas defensiw
denominados glândulas pigidiais, que têm a seguinte estrutura básica: ui
espaço de armazenamento simples com um duto que leva para o exteric
frequentemente cercado por um músculo para expelir no espaço o conteúd
Essa função poderia ser melhorada desenvolvendo-se um esfíncter musci
lar que impedisse que o conteúdo vazasse até o momento apropriado.
Na verdade, o peróxido de hidrogénio é também um irritante, de manei
que o besouro poderia ficar em maior segurança se pudesse secretar, mesm
em baixa temperatura, a hidroquinona e o peróxido de hidrogénio, a fim (
aumentar o efeito irritante. Quase todas as células contêm uma enzim
denominada catalase, que decompõe o peróxido de hidrogénio em água
oxigénio, com liberação de calor. Se as células que revestem o trato para
exterior secretarem um pouco de catalase durante a ejeção, certa quantidac
de peróxido de hidrogénio seria decomposta, aquecendo a solução e, dess
maneira, tomando-a mais irritante. As espécies de besouro-bombardeiro (
Austrália19 e da Papua Nova Guiné20 esguicham soluções que variam e
temperatura de morna a quente, mas não fervente. Se as células liberasse
mais catalase, a solução se tomaria mais quente; por fim, um ponto ótim
seria alcançado entre o aquecimento da solução e a durabilidade do can
de saída. Com o passar do tempo, o canal poderia ser reforçado e expandic
a fim de trabalhar com temperaturas mais altas, até chegar ao ponto (
fervura da solução. Secreções subsequentes de peroxidases na mistu
catalítica produziriam um aparelho basicamente idêntico ao da Figura 2-.
Agora, temos um cenário apropriado para a literatura evolucionista. M
o desenvolvimento do aparelho de defesa do besouro-bombardeiro de fa
foi explicado? Infelizmente, a explicação apresentada aqui não fornece ma
detalhes que a história contada por Darwin no século xix sobre o olh
Embora, aparentemente, tenhamos um sistema em mudança constante,
componentes que controlam seu funcionamento permanecem desc
nhecidos. A vesícula coletora, por exemplo, é uma estrutura complex
multicelular. O que ela contém? Por que tem sua forma particular? Diz
que "o besouro se beneficiaria com a concentração de hidroquinona em um
espaço de armazenamento" é o mesmo que dizer "a sociedade se beneficia-
ria com a concentração de poder em um governo centralizado": em ambos
A CAIXA E ABERTA 45
i- os casos, a maneira como surgem a concentração e a vesícula coletora
ê permanece sem explicação, e os benefícios de ambas dependeriam forte-
| mente dos detalhes. A vesícula coletora, o músculo esfíncter, a câmara de
1 combustão e o duto de saída são todos estruturas complexas em si, com
; muitos componentes não identificados. Além do mais, os processos concre-
tos responsáveis pelo desenvolvimento da capacidade de produzir explosão
continuam desconhecidos. O que faz com que uma vesícula coletora se
desenvolva, que o peróxido de hidrogénio seja secretado, ou que um
músculo esfíncter as envolva?
1ido que podemos concluir a essa altura é que a evolução darwiniana
pode ter ocorrido. Se conseguíssemos analisar os detalhes estruturais do
besouro até a última proteína e enzima, se explicássemos todos esses
detalhes com uma explanação darwiniana, poderíamos concordar com
Dawkins. Por ora, no entanto, não temos como saber se os acréscimos
graduais à nossa hipotética corrente evolucionária são "saltos" de uma única
mutação ou voos de helicóptero entre morrotes distantes.
VER E CRER
Mas voltemos ao olho humano. Dawkins e Hitching também discordam a
respeito desse clássico órgão complexo. Hitching declarou em O pescoço
da girafa que
está bem claro que se a menor coisa der errada no caminho se a córnea
for turva, a pupila não se dilatar, ou a lente tornar-se opaca, ou ainda sair
errado o processo de focalização , uma imagem reconhecível deixa de ser
formada. Ou o olho funciona como um todo ou não funciona de modo
algum. Então, como ele veio a se desenvolver através de melhoramentos
darwinianos lentos, ininterruptos, infinitamente pequenos? Será de fato
plausível que milhares e milhares de felizes mutações aleatórias tenham
acontecido ao mesmo tempo de tal modo que a lente e a retina, que não
podem funcionar uma sem a outra, evoluíram em sincronia? Que valor de
sobrevivência pode haver em um olho que não vê?21
Dawkins, satisfeito porque Hitching, mais uma vez, fracassava em sua
explicação, não deixa passar a oportunidade:
Considere a declaração "se a menor coisa der errada... [se] sair errado o
processo de focalização , uma imagem reconhecível deixa de ser forma-
da". Não podem ser muito diferentes de 5050 as possibilidades de que você
esteja lendo estas palavras através de lentes de vidro. Tire-as e olhe em volta.
Concordaria em que "uma imagem reconhecível deixa de ser formada"
(Hitching) declara também, como se isso fosse óbvio, que lentes e retina r
podem funcionar uma sem a outra. Com que autoridade diz isso? U
parente próxima minha fez operação de catarata nos dois olhos. Ela não t
lentes nos olhos. Sem óculos, não poderia nem mesmo começar a jogar té
ou apontar um rifle. Mas ela me garante que se sente muito melhor com
olho sem lente do que se não tivesse olhos. Ela sabe se vai se chocar con
uma parede ou com outra pessoa. Se fôssemos animais selvagens, cer
mente poderíamos usar os olhos sem lente para detectar a sombra amea
dora de um predador e a direção pela qual ele se aproxima.22
Depois de atacar Hitching e cientistas como Richard Goldschmic
Stephen Jay Gould por se preocuparem com a complexidade do ol
Dawkins passa a parafrasear o argumento de Charles Darwin sobre
plausibilidade da evolução do olho:
Alguns animais unicelulares possuem um ponto sensível à luz com
pouco de pigmento por trás do mesmo. O escudo os protege da luz vinda
uma direção, o que lhes dá alguma "ideia" de onde ela vem. Entre os anim
multicelulares... as células sensíveis à luz, dotadas de pigmento, são encai
das em um pequeno cálice. Esse fato proporciona uma capacidade lige
mente melhor de descobrir a direção... Ora, se fazemos um cálice b
profundo e o viramos para cima, obtemos uma câmera sem lente, com u
abertura minúscula como um buraco de agulha... Se há um cálice como ol
quase todos os materiais vagamente convexos, vagamente transparentes
mesmo translúcidos por cima da abertura constituirão um melhoramen
devido às suas propriedades um tanto parecidas com as de uma lente. L
vez que tenha se formado essa grosseira protolente, ocorre uma se
contínua e graduada de melhoramentos, tornando-a mais espessa, m
transparente e menos distorsiva, culminando a tendência no que ré
nheceríamos como uma verdadeira lente.23
Dawkins e Darwin nos convidam a acreditar que a evolução do olho ocor
através de uma série de etapas intermediárias plausíveis, em aumen
infinitesimais. Mas são eles infinitesimais? Lembre-se de que o "pó
sensível à luz" que Dawkins usa como ponto de partida requer uma case
de fatores para funcionar, incluindo o ll-c-retinal e a rodopsina. Ele n
os menciona. E de onde veio o "pequeno cálice"? Uma bola de células
de onde deve ter forçosamente saído o cálice tenderá a ser redonda
menos que mantida na forma correia por suportes moleculares. Na verda
são às dezenas as proteínas complexas envolvidas no processo de mant
forma da célula, além de outras dezenas que controlam a estrutura extra
lular. Não existindo elas, as células assumem formas parecidas com outras
tantas bolhas de sabão. Representariam, essas estruturas, mutações em um
único estágio? Dawkins não nos diz como surgiu o "cálice" aparentemente
simples. E embora nos garanta que qualquer "material translúcido" seria
um melhoramento (lembre-se de que Haeckel, erroneamente, pensou que
seria fácil produzir células, uma vez que elas eram apenas "massas informes
simples"), ele não explica que dificuldade haveria para produzir uma "len-
te simples". Em suma, a explicação de Dawkins diz respeito apenas ao que
se chamaria de anatomia macroscópica.
Hitching e Dawkins focalizaram mal sua atenção. O olho, ou, na verdade,
quase todas as grandes estruturas biológicas, consiste de certo número de
sistemas separados. Aúnica função da retina é a percepção da luz. Afunção
da lente é captar a luz e focalizá-la. Se uma lente é usada com uma retina,
o funcionamento da retina é melhorado, mas retina e lente podem funcionar
por si mesmas. Analogamente, os músculos que focalizam a lente ou viram
os olhos funcionam como um aparelho de contração, que pode ser aplicado
a muitos sistemas diferentes. A percepção da luz pela retina não depende
deles. Os dutos lacrimais e as pálpebras também constituem sistemas
complexos, mas separáveis da função da retina.
O argumento de Hitching é vulnerável porque ele confunde um sistema
integrado de sistemas com um sistema único, e Dawkins, de modo correio,
menciona a separabilidade dos componentes. Dawkins, porém, simples-
mente adiciona sistemas complexos a sistemas complexos, e chama isso de
explicação. Isso é comparável a responder à pergunta "De que maneira é
feito um aparelho de som?" com as palavras: "Acoplando um conjunto de
alto-falantes a um amplificador e adicionando-se um aparelho de cd, um
receptor de rádio e toca-fitas." Ou a teoria darwiniana pode explicar a
montagem dos alto-falantes e do amplificador, ou não pode.
MUTAÇÃO
Darwin sabia que sua teoria de evolução progressiva, através de seleção
natural, carregava um pesado fardo:
Se pudesse ser demonstrada a existência de qualquer órgão complexo que
não poderia ter sido formado por numerosas, sucessivas e ligeiras modifi-
cações, minha teoria desmoronaria por completo.24

E seguro dizer que a maior parte do ceticismo científico sobre o danvinisn.


no último século, centralizou-se nessa condição. Da preocupação de Mivi
com os estágios incipientes de novas estruturas à refutação da evoluç
gradual por Margulis, os críticos de Darwin suspeitaram que seu critério
fracasso havia sido atendido. Mas como podemos confiar nisso? Que ti]
de sistema biológico não poderia ser formado por meio de "numerosa
sucessivas e ligeiras modificações"?
Bem, para começar, um sistema que seja irredutivelmente complex
Com irredutivelmente complexo quero dizer um sistema único compôs
de várias partes compatíveis, que interagem entre si e que contribuem pá
sua função básica, caso em que a remoção de uma das partes faria com q
o sistema deixasse de funcionar de forma eficiente. Um sistema irredutive
mente complexo não pode ser produzido diretamente (isto é, pelo m
lhoramento contínuo da função inicial, que continua a atuar através (
mesmo mecanismo) mediante modificações leves, sucessivas, de um s
tema precursor, porque qualquer precursor de um sistema irredutivelmen
complexo ao qual falte uma parte é, por definição, não-funcional. U
sistema biológico irredutivelmente complexo, se por acaso existir tal cois
seria um fortíssimo desafio à evolução darwiniana. Uma vez que a seleça
natural só pode escolher sistemas que já funcionam, então, se um sistem
biológico não pudesse ser produzido de forma gradual, ele teria que surgi
como uma unidade integrada, de uma única vez, para que a seleção natu
tivesse algo com que trabalhar.
Mesmo que um sistema seja irredutivelmente complexo (e, portanto, n
possa ter sido produzido diretamente), não podemos excluir por comple
a possibilidade de uma rota indireta, tortuosa. Aumentando-se a complex
dade de um sistema interatuante, porém, cai bruscamente a possibilidac
dessa rota indireta. E, à medida em que aumenta o número de sistem
biológicos irredutivelmente complexos, inexplicados, nossa confiança e
que o critério de fracasso de Darwin tenha sido atingido sobe vertiginos
mente para o máximo que a ciência permite.
Em teoria, poderia ser tentador imaginar que complexidade irredutív
requereria somente mutações simultâneas múltiplas que a evoluç
poderia ser muito mais aleatória do que pensávamos, mas ainda possíve
Esta é, no fundo, a teoria do monstro esperançoso de Goldschmidt. U
apelo desse tipo à sorte pura e simples jamais poderá ser refutado. Ain(
assim, é um argumento vazio. Poderíamos dizer também que o mundo, p
sorte, surgiu ontem, de repente, com todos os aspectos que ora possui. Só
é uma especulação metafísica; explicações científicas necessitam de caus
Admite-se quase sem contestação que esses eventos inesperados seriam
irreconciliáveis com o gradualismo imaginado por Darwin. Richard Daw-
kins explica bem o problema:
A evolução, na verdade, não é, como tudo indica, sempre gradual. Mas tem
de ser gradual quando usada para explicar o aparecimento de objetos
complicados, aparentemente planejados, como os olhos. Isso porque, se não
é gradual nesses casos, despoja-se também de qualquer capacidade expli-
cativa. Sem a gradualidade nesses casos, voltamos ao milagre, que é tão
somente um sinónimo de ausência total de explicação.25
A razão porque isso acontece está na natureza da mutação.
Em bioquímica, mutação é uma mudança no adn. Para ser herdada, a
mudança tem de ocorrer no adn de uma célula reprodutora. Amutação mais
simples ocorre quando um único nucleotídeo (os nucleotídeos são os
"blocos de armar" do adn) no adn de uma criatura muda para um nucleo-
tídeo diferente. Alternativamente, um único nucleotídeo pode ser adiciona-
do ou deixado de fora quando o adn é copiado durante a divisão da célula.
As vezes, porém, uma região inteira do adn milhares ou milhões de
nucleotídeos é acidentalmente apagada ou duplicada. Esse fato também
é contado como uma única mutação porque acontece em uma só ocasião,
como um evento único. De modo geral, uma única mutação pode, na melhor
das hipóteses, ocasionar apenas uma pequena mudança na criatura
mesmo que a mudança nos pareça grande. Há, por exemplo, uma mutação
bem conhecida, denominada antennapedia, que cientistas podem produzir
em moscas-das-frutas de laboratório: a pobre criatura mutante tem pernas
que crescem na cabeça, em vez de antenas. Embora isso nos pareça uma
grande mudança, na realidade não é. As pernas na cabeça são as pernas
típicas da mosca-das-frutas, apenas em um lugar diferente.
Uma analogia pode ser útil nesse particular: consideremos uma lista com
instruções passo a passo. A mutação é uma mudança em uma das linhas de
instruções. Assim, em vez de dizer "Pegue um parafuso de meio centímetro",
a mutação poderia dizer "Pegue um parafuso de um centímetro". Ou, em vez
de "Coloque o pino redondo no orifício redondo", poderíamos ler "Insira o
pino redondo no orifício quadrado". Ou, em vez de "Prenda o assento em cima
do motor", poderíamos ler "Prenda o assento no volante" (mas só consegui-
ríamos fazer isso se os parafusos e porcas pudessem ser presos ao volante). O
que uma mutação não pode fazer é mudar todas as instruções em um único
passo digamos, construir uma máquina de fax em vez de um rádio.
Voltando ao besouro-bombardeiro e ao olho humano, a questão consiste
em saber se numerosas mudanças anatómicas podem ser explicadas por um
número igual de pequenas mutações. A resposta, frustrante, é que não
sabemos. Tanto o aparelho defensivo do besouro quanto o olho do verte
brado contêm tantos componentes moleculares (da ordem de dezenas d
milhares de diferentes tipos de moléculas) que listá-los e especular sobr
as mutações que poderiam tê-los produzido é atualmente impossível
Um número grande demais de parafusos e porcas (além de roscas, peças de
motor, volantes etc.) permanece sem explicação. Em nosso caso, debater se
a evolução danviniana poderia produzir essas grandes estruturas seria muitc
parecido com cientistas do século xix debatendo se células poderiam surgil
de forma espontânea. Esses debates são infrutíferos porque nem todos os
componentes são conhecidos.
Não devemos, contudo, perder a perspectiva a esse respeito: outras
épocas tampouco conseguiram responder às muitas perguntas que as inte-
ressavam. Além do mais, o fato de não podermos ainda avaliar a questão
da evolução do olho ou do besouro não significa que não podemos avaliar
as alegações darwinianas relativas a qualquer estrutura biológica. Quando
descemos do nível do animal completo (como um besouro) ou de um órgão
completo (como um olho) para o nível molecular, podemos, em muitos
casos, fazer um julgamento sobre a evolução, uma vez que todas as partes
de numerosos sistemas moleculares são conhecidas. Nos cinco capítulos
seguintes, encontraremos alguns desses sistemas e emitiremos nosso
julgamento.
Mas voltemos agora à questão da complexidade irredutível. Aessa altura
de nossa discussão, a complexidade irredutível é apenas um termo cujo
poder reside principalmente em sua definição. Temos que perguntar como
podemos reconhecer um sistema irredutivelmente complexo. Dada a natu-
reza da mutação, quando podemos ter certeza de que um sistema biológico
é irredutivelmente complexo?
O primeiro passo para determinar a complexidade irredutível consiste
em especificar a função do sistema e todos os seus componentes. Um objeto
irredutivelmente complexo será composto de várias partes, todas as quais
contribuem para a função. A fim de evitar os problemas encontrados em
objetos extremamente complexos (tais como olhos, besouros, ou outros
sistemas biológicos multicelulares) começarei com um exemplo mecânico
simples: uma modesta ratoeira.
A função da ratoeira é imobilizar um rato, de modo que ele não possa
realizar certos atos desagradáveis, tais como roer sacos de farinha de trigo
ou fiação elétrica, ou deixar pequenos lembretes de sua presença em cantos
pouco varridos. As ratoeiras usadas por minha família consistem de certo
número de partes (Figura 2-2): l) uma tábua lisa de madeira que serve como
base; 2) um martelo (precursor) de metal, que realiza o trabalho de esmagar
A CAIXA E ABERTA 5 l
FIGURA 2-2

Barra de Retenção
Trava Plataforma
o ratinho; 3) uma mola com extremidades alongadas que faz pressão contra
a tábua e o martelo quando a ratoeira é armada; 4) uma trava sensível, que
dispara quando nela é aplicada leve pressão; e 5) uma barra de metal ligada
à trava e que prende o martelo quando a ratoeira é armada. (Há também
vários grampos para manter o sistema articulado.)
O segundo passo para determinar se um sistema é irredutivelmente
complexo consiste em perguntar se todos os componentes são necessários
à função. Nesse exemplo, a resposta, claro, é sim. Suponhamos que,
enquanto está lendo durante a noite, você ouve o ruído de pequenas patas
na copa, vai até uma gaveta e pega a ratoeira. Infelizmente, devido à
fabricação defeituosa, falta uma das peças listadas acima. Que parte poderia
estar faltando, mas que, ainda assim, nos permitiria pegar o rato? Se não
houvesse a base de madeira, tampouco haveria uma plataforma para nela
prender os outros componentes. Se faltasse o martelo, o rato poderia dançar
a noite inteira sobre a plataforma sem ficar preso à base de madeira. Se não
houvesse mola, o martelo e a plataforma estariam frouxamente ligados e o
roedor continuaria feliz da vida. Se não houvesse trava ou barra de metal,
então a mola dispararia o martelo logo que a soltássemos e, para pegar o
rato, teríamos que correr atrás dele, com a ratoeira aberta na mão.
A fim de compreender bem a conclusão de que um sistema é ir-
redutivelmente complexo e, por conseguinte, não tem precursores funcio-
nais, precisamos fazer uma distinção entre precursor físico e precursor
conceituai. A ratoeira descrita acima não é o único sistema que pode
imobilizar um rato. Em outras ocasiões, minha família usou uma ratoeira
de cola. Em teoria, pelo menos, podemos usar uma caixa inclinada, apoiac
em uma vareta que pode ser derrubada. Ou podemos simplesmente atir,
no rato com uma espingarda de chumbinho. Esses, porém, não são precu
sores físicos da ratoeira comum, uma vez que não podem ser transformado
um passo darwiniano após outro em uma ratoeira com base, marteL
mola, trava e barra de retenção.
Para esclarecer esse ponto, considere a seguinte sequência: prancha t
skate, trem de brinquedo, bicicleta, motocicleta, automóvel, avião, avião
jato, espaçonave. Parece uma progressão natural, uma vez que é uma lista (
mecanismos, todos os quais podem ser usados para transporte, e també:
por estarem alinhados em uma ordem crescente de complexidade. Eli
podem ser conceitualmente ligados e fundidos em um contínuo único. Ma
digamos, será a bicicleta um precursor físico (e potencialmente darwinian
da motocicleta? Não. Trata-se, apenas, de um precursor conceituai. Nenb
ma motocicleta na história, nem mesmo a primeira, foi fabricada apen:
modificando-se uma bicicleta através de etapas. É bastante possível que u
adolescente, numa tarde de sábado, pegue uma velha bicicleta, um velho mot
de cortador de grama e algumas peças avulsas e (com umas duas horas i
trabalho) construa uma motocicleta que funcione. Mas esse fato demonsi
apenas que seres humanos podem planejar sistemas irredutivelmente cor
plexos, o que já sabemos. Para ser precursora no sentido darwiniano, temos
demonstrar que uma motocicleta pode ser construída a partir de "números;
sucessivas e ligeiras modificações" introduzidas numa bicicleta.
Tentemos, então, transformar, por evolução, uma bicicleta em motocí
cleta através da acumulação gradual de mutações. Suponhamos que um
indústria fabricasse bicicletas, mas que, por acaso, acontecesse um erro n
processo de manufatura. Vamos supor ainda que, se o erro resultou em ur
melhoramento da bicicleta, os amigos e vizinhos do feliz comprado
passaram a exigir modelos semelhantes, e a fábrica readaptou-se par
transformar a mutação em característica permanente. Dessa maneira, ta
como as mutações biológicas, mutações mecânicas bem-sucedidas se ré
produziriam e se espalhariam. Se queremos conservar nossa analogi
relevante para a biologia, contudo, cada mudança terá de ser apenas um
modificação, duplicação ou rearranjo ligeiros de um componente preexis
tente, e a mudança tem de melhorar a função da bicicleta. Assim, se a fábric
erroneamente aumentasse o tamanho de um parafuso ou diminuísse i
diâmetro de uma porca, acrescentasse uma roda extra ao eixo dianteiro i
abolisse o pneu traseiro, colocasse um pedal no guidom ou ainda acresceu
tasse raios extras nas rodas, e se qualquer uma dessas ligeiras mudança
melhorasse o uso da bicicleta, o aperfeiçoamento logo seria notado pel
A CAIXA E ABERTA 53
público comprador, e as bicicletas modificadas, segundo o verdadeiro estilo
darwiniano, dominariam o mercado.
Dadas essas condições, podemos transformar por evolução uma bicicleta
em motocicleta? Podemos nos mover na direção certa fazendo, em peque-
nas etapas, com que o assento se tome mais confortável, as rodas maiores,
e mesmo (supondo que nosso comprador prefere a aparência "bike"), imitar
a forma geral de várias maneiras. A motocicleta, no entanto, depende de
uma fonte de combustível, e a bicicleta não tem coisa alguma que possa ser
ligeiramente modificada para transformar-se em um tanque de gasolina. E
que parte dela poderia ser duplicada para começarmos a construir um
motor? Mesmo que um acidente feliz levasse um motor de cortador de
grama de uma fábrica vizinha para a fábrica de bicicletas, o motor teria de
ser montado na bicicleta e ligado de maneira correta à corrente motriz. De
que maneira isso poderia ser feito passo a passo, a partir de peças de
bicicleta? Uma fábrica que produzisse bicicletas simplesmente não poderia
produzir, por seleção natural, uma motocicleta, aproveitando variações
através de "modificações numerosas, sucessivas, ligeiras" e, na verdade,
não há na história exemplo de uma mudança complexa em um produto que
tenha ocorrido dessa maneira.
A bicicleta, portanto, pode ser uma precursora conceituai da motocicleta,
mas não de natureza física. A evolução darwiniana requer precursores
físicos.
FUNÇÃO MÍNIMA
Até agora, analisamos a questão da complexidade irredutível como um
desafio à evolução gradual. Darwin, porém, enfrenta outra dificuldade.
Minha lista anterior de fatores que tomam a ratoeira irredutivelmente
complexa foi, na verdade, generosa demais, porque quase qualquer dis-
positivo que tivesse os cinco componentes de uma ratoeira padrão, ainda
assim, poderia deixar de funcionar. Se a base fosse feita de papel, por
exemplo, a ratoeira se desmancharia. Se o martelo fosse pesado demais,
quebraria a mola. Se a mola fosse frouxa demais, não acionaria o martelo.
Se a barra de retenção fosse muito curta, não alcançaria a trava. Se a trava
fosse grande demais, não dispararia na ocasião apropriada. Uma lista
simples dos componentes da ratoeira é necessária, mas não suficiente para
produzir um dispositivo que funcione.
Para ser candidato à evolução natural um sistema precisa ter umaunção
mínima: a capacidade de realizar um dado trabalho em circunstâncias
fisicamente realistas. A ratoeira feita de materiais impróprios não atenderia
54 A CAIXA PRETA DE DARWIN
ao critério de função mínima, mas até máquinas complexas que fazem
que se espera que façam talvez não sejam muito úteis. Dando um exempi
suponhamos que o primeiro motor de popa do mundo foi projetado e esta
sendo vendido. O motor funcionava suavemente queimando gasolina
uma taxa controlada, transmitindo força através de um eixo, e impriminc
rotação à hélice mas a hélice girava a apenas uma revolução por hor
Trata-se de uma impressionante façanha tecnológica. Afinal de conta.
queimar gasolina em uma lata próxima a uma hélice de modo algum a fa
girar. Ainda assim, poucas pessoas comprariam essa máquina, uma vez qu
ela não funciona em nível apropriado à sua finalidade.
O desempenho pode ser impróprio por uma de duas razões. Aprimeir
é que a máquina não consiga realizar o trabalho. Um casal que pescasse n
meio de um lago em um bote com uma hélice de rotação lenta não chegari
ao cais: correntes caprichosas na água e o vento tirariam o barco do curse
A segunda razão porque o desempenho pode ser impróprio é se for meno
eficiente do que se pode conseguir com meios mais simples. Ninguén
usaria um motor de popa ineficiente se conseguisse navegar tão bem o
melhor com uma vela.
Ao contrário da complexidade irredutível (caso em que podemos enume
rar as partes separadas), a função mínima é, às vezes, difícil de definir. S
uma revolução por hora é insuficiente para um motor de popa, o que dize
de cem? Ou mil? Não obstante, a função mínima é de importância fún
damental na evolução de estruturas biológicas. Qual, por exemplo, é
volume mínimo de hidroquinona que um predador pode provar? O quant
de elevação da temperatura da solução ele notará? Se o predador não notass
uma minúscula quantidade de hidroquinona ou uma pequena mudança n
temperatura, nossa história dawkinsesca sobre a evolução do besouro-bom
bardeiro poderia ser arquivada ao lado da história da vaca que deu um sal!
até a Lua. Sistemas irredutivelmente complexos constituem sérios obs
táculos à evolução darwiniana e a necessidade de função mínima agrav;
em muito o dilema.
A bioquímica demonstrou que qualquer aparelho biológico que envolv
mais de uma célula (tais como órgãos ou tecidos) constitui necessariament
uma rede intricada de muitos sistemas diferentes, identificáveis, de imens
complexidade. A célula replicadora auto-suficiente "mais simples" ter
capacidade de produzir milhares de proteínas diferentes e outras moléculas
em ocasiões diferentes e em condições variáveis. A síntese, a degradação
a geração de energia, a replicação, a manutenção da arquitetura da célula,
a mobilidade, o controle, o reparo e a comunicação todas essas funções
ocorrem, virtualmente, em todas as células e cada função requer a interação
de numerosas partes. Uma vez que cada célula é uma malha entrelaçada de
sistemas, repetiríamos o erro de Francis Hitching se perguntássemos se
estruturas multicelulares poderiam ter evoluído à moda gradual darwiniana.
Isso seria equivalente não a perguntar se uma bicicleta poderia evoluir e
transformar-se em motocicleta, mas se uma fábrica de bicicletas poderia
evoluir e transformar-se em uma fábrica de motocicletas! A evolução não
ocorre no nivel de fábrica, mas no nível de parafusos e porcas.
Os argumentos de Dawkins e Hitching não convencem porque eles
nunca discutem o que está contido nos sistemas sobre os quais discordam.
Não só o olho é extremamente complexo, mas o "ponto sensível à luz" com
que Dawkins inicia sua argumentação é, em si, um órgão multicelular, cujas
células, sem exceção, tomam a complexidade de uma motocicleta ou de um
receptor de televisão insignificantes. O aparelho defensivo do besouro-
bombardeiro não só depende de alguns componentes que interagem entre
si, como as células que produzem a hidroquinona e o peróxido de hidrogénio
dependem, para assim funcionar, de uma quantidade muito grande de
componentes. As células que secretam catalase são muito complexas, e o
músculo esfíncter que separa a vesícula coletora da câmara de combustão
é um sistema de sistemas. Por causa disso, os argumentos de Hitching sobre
a maravilhosa complexidade do besouro-bombardeiro facilmente se tomam
irrelevantes, ao passo que a resposta de Dawkins nos satisfaz apenas até o
ponto em que pedimos mais detalhes.
Em contraste com órgãos biológicos, a análise de objetos mecânicos
simples é um tanto banal. Mostramos sem dificuldade que uma ratoeira é
irredutivelmente complexa e, assim, podemos concluir o que já sabíamos
que a ratoeira é fabricada como um sistema completo. Já sabíamos que
uma motocicleta não era produzida inconscientemente por melhoramentos
pequenos e sucessivos introduzidos em uma bicicleta, e uma análise simples
nos mostra que é impossível fazer isso. Objetos mecânicos não podem se
reproduzir e sofrer mutação como sistemas biológicos, mas formular
hipóteses de eventos comparáveis em uma fábrica imaginária demonstra
que a mutação e a reprodução não são os principais obstáculos à evolução
desses objetos. São os requisitos da relação estrutura-fünção em si que
bloqueiam a evolução segundo o estilo darwiniano.
Máquinas são relativamente fáceis de analisar porque sua função e todas
as suas partes, cada parafuso e porca, são conhecidos e podem ser listados.
Toma-se fácil, portanto, verificar se qualquer dada parte é necessária à
função do sistema. Se um sistema requer várias partes estreitamente con-
dizentes para funcionar, então ele é irredutivelmente complexo e podemos
concluir que foi produzido como uma unidade integrada. Em princípio, os
sistemas biológicos também podem ser analisados dessa maneira, mas
apenas se todas as suas partes puderem ser enumeradas, e também se uma
função puder ser reconhecida.
Nas últimas décadas, a bioquímica moderna elucidou todos, ou a maio-
ria, dos componentes de muitos sistemas bioquímicos. Nos cinco capítulos
seguintes, discutirei alguns deles. No Capítulo 3, examinarei uma estrutura
fascinante, denominada "cílio", usada por algumas células para nadarem.
No capítulo seguinte, analisarei o que acontece quando cortamos um dedo
e mostrarei que a simplicidade aparente da coagulação do sangue é de
uma complexidade que engana. Após esse estudo, passarei à maneira como
as células transportam materiais de um compartimento subcelular para
outro, enfrentando muitos dos mesmos problemas com que o Federal
Express se depara ao entregar encomendas. No Capítulo 6, discutirei a arte
da autodefesa no nível celular, claro. Meu exemplo bioquímico final
estará no Capítulo 7, onde estudarei o intricado sistema que a célula requer
para fabricar um de seus "blocos de armar". Em todos os capítulos,
examinarei se o sistema discutido poderia ter-se desenvolvido gradual-
mente, segundo o estilo darwiniano, bem como o que a comunidade
científica diz sobre a possível evolução dos sistemas.
Esforcei-me para tomar esses cinco "capítulos de exemplos" tão legíveis
e agradáveis quanto possível. Não discuto nenhum conceito esotérico
peculiar à bioquímica nada que seja mais difícil que a ideia de "colar-se
a alguma coisa" ou "cortar". Não obstante, como disse no prefácio, para
compreender a complexidade temos de experimentá-la. Os sistemas que
discuto são complexos porque contêm muitos componentes. Não há, contu-
do, um questionário de exame ao fim do livro. As descrições detalhadas têm
por único objetivo dar ao leitor uma compreensão da complexidade do
sistema, e não submeter sua memória a teste. Alguns leitores talvez desejem
ir resolutamente até o fim dessa parte; outros podem achar melhor apenas
passar os olhos por ela e voltar a consultá-la quando estiverem prontos para
absorver mais detalhes.
Peço desculpas antecipadamente pela complexidade do material, mas
ela é inerente ao argumento que pretendo formular. Richard Dawkins pode
simplificar o quanto quiser, porque deseja convencer os leitores de que a
evolução darwiniana é facílima de entender. A fim de compreender os
obstáculos à evolução, porém, temos de experimentar o amargor da com-
plexidade.
PARTE II
EXAMINANDO O CONTEÚDO
DA CAIXA
REMAR, REMAR, REMAR
SEM PARAR
proteínas
Por mais estranho que possa parecer, a bioquímica moderna demonstrou
que a célula é operada por máquinas literalmente, máquinas moleculares.
Tal como suas equivalentes fabricadas pelo homem (ratoeiras, bicicletas e
naves espaciais, por exemplo), as máquinas moleculares variam de simples
a muito complexas: máquinas mecânicas, geradoras de força, como as que
existem nos músculos; eletrônicas, como as existentes nos nervos; e acio-
nadas a energia solar, como as que realizam a fotossíntese. É claro que elas
são feitas principalmente de proteínas, e não de metal ou plástico. Neste
capítulo, discutirei as máquinas moleculares que permitem que as células
nadem e o leitor verá o que é preciso para que elas assim se movimentem.
Mas, em primeiro lugar, alguns detalhes necessários. Se queremos
compreender a base molecular da vida, temos de saber como funcionam as
proteínas. Os que desejam conhecer todos os detalhes como elas são
fabricadas, como suas estruturas permitem que trabalhem com tanta efi-
ciência, e assim por diante são aconselhados a pegar um livro introdu-
tório de bioquímica na biblioteca pública mais próxima. No caso daqueles
que querem conhecer apenas alguns detalhes como são os aminoácidos
e quais os níveis da estrutura da proteína incluí um apêndice que os
discute, juntamente com os ácidos nucleicos. Para nossas atuais finalidades,
contudo, uma visão geral desses notáveis elementos bioquímicos será
suficiente.
A maioria das pessoas pensa em proteínas como alguma coisa que se
come. No corpo de plantas ou animais vivos, porém, elas representam um
papel muito ativo. As proteínas são as máquinas existentes nos tecidos vivos
que constróem as estruturas e se encarregam das reações químicas neces-
sárias à vida. O primeiro passo na captação da energia do açúcar e sue
transformação em uma forma que o corpo possa usar, por exemplo, é dadc
por uma proteína catalisadora (conhecida também como enzima) denomi-
nada hexocinase; a pele é constituída em grande parte por uma proteíní
chamada colágeno; e quando a luz atinge nossa retina, a proteína que atendi
pelo nome de rodopsina inicia o processo da visão. Pode-se ver, mesmc
com esse limitado número de exemplos, que elas são espantosamentf
versáteis. Não obstante, uma dada proteína tem apenas um ou alguns usos
a rodopsina não pode formar pele, e o colágeno tampouco pode interagi:
bem com a luz. Por isso mesmo, uma célula típica contém milhares
milhares de diferentes tipos de proteínas, que desempenham as muita;
tarefas necessárias à vida.
Proteínas são feitas encadeando-se quimicamente aminoácidos em um;
sequência. Uma sequência (ou corrente) de proteínas costuma ter algo entn
cinquenta a mil elos de aminoácidos. Cada posição na corrente é ocupadi
por um dos vinte diferentes aminoácidos. Nesse sentido, elas são come
palavras, que podem ter vários tamanhos, mas são constituídas de un
conjunto de apenas 26 letras. Na verdade, os bioquímicos freqüentement
referem-se a cada aminoácido usando uma abreviação de uma única letn
G para glicina, s para serina, H para histidina, e assim por diante. Todo;
os diversos aminoácidos têm formas diferentes e propriedades química;
também diferentes, w, por exemplo, é grande, ao passo que A é pequeno, l
conduz uma carga positiva, enquanto e conduz uma negativa, s prefere se
dissolvido em água, ao passo que l prefere óleo, e assim por diante.
Ao pensarmos em uma corrente, é provável que venha à mente a imagen
de alguma coisa muito flexível, mas sem uma forma geral bem definida
Mas as cadeias de aminoácidos em outras palavras, proteínas não sã(
nada disso. Proteínas que trabalham numa célula dobram-se em estrutura;
muito precisas, e essas podem ser bastante diferentes em tipos diferentes dl
proteínas. O pregueamento é feito de forma automática quando, digamos
um aminoácido positivamente carregado atrai outro de carga negativa
quando aminoácidos que preferem óleo se reúnem para excluir a água
quando grandes aminoácidos são expulsos de pequenos espaços, e assin
por diante. Duas diferentes sequências de aminoácidos (isto é, duas proteí
nas diferentes) podem dobrar-se formando estruturas tão específicas i
diferentes entre si quanto uma chave-inglesa e uma serra tico-tico.
É a forma da proteína pregueada e o posicionamento exato dos diferente;
tipos de grupos de aminoácidos que permitem que a proteína funcioní
(Figura 3-1). É tarefa de uma proteína, por exemplo, ligar-se especificamen
te a uma segunda proteína e, nesse caso, suas formas devem se ajustar comi
EXAMINANDO O CONTEÚDO DA CAIXA 61
uma mão à luva. Se há um aminoácido positivamente carregado na primeira
proteína, é melhor que a segunda tenha um aminoácido de carga negativa;
de outra maneira, os dois não se ligam. Se é trabalho de uma proteína
catalisar uma reação química, a forma da enzima, em geral, corresponde à
forma do elemento químico que tem como alvo. Quando se liga, a enzima
tem os aminoácidos exatamente posicionados para desencadear a reação
química. Se a forma de uma chave-inglesa ou de uma serra tico-tico é muito
empenada, a ferramenta não funciona. De igual maneira, se a forma da
proteína é empenada, ela não consegue realizar seu trabalho.
A bioquímica moderna surgiu há quarenta anos, quando a ciência
começou a compreender o que são as proteínas. Desde então, grandes
progressos foram feitos para compreender exatamente como determinadas
proteínas realizam determinadas tarefas. De modo geral, o trabalho da
célula necessita de equipes de proteínas, e cada membro da equipe encar-
rega-se de apenas uma parte de uma tarefa mais vasta. Com o objetivo de
tomar as coisas tão simples quanto possível, neste livro nos concentraremos
em equipes de proteínas. Agora, vamos nadar.
nadando
Suponhamos que, em um dia de verão, dirigimo-nos a uma piscina próxima
para fazer um pouco de exercício. Depois de passar um bloqueador solar
pelo corpo, deitamo-nos em uma toalha para ler o último número do Nucleic
Acids Research e esperamos a hora em que começa o período permitido a
adultos para começarmos a nadar. Quando, após uma longa espera, soa o
apito e a turma jovem e cheia de energia enfim sai da piscina, molhamos
com cuidado os dedões do pé. Devagar, com muito esforço, afundamos o
resto do corpo na água espantosamente fria. Por não ser respeitável, não
fazemos piruetas em cima de trampolins nem jogamos vôlei com os jovens.
Limitamo-nos a nadar de um lado para o outro.
Pegando impulso da borda, passamos um braço sobre a cabeça e o
mergulhamos na água, completando uma braçada. Durante a braçada,
impulsos nervosos viajam do cérebro para os músculos do braço, estimulan-
do-os a se contraírem em uma ordem específica. Os músculos que se con-
traem dão um puxão nos ossos, fazendo com que os braços se ergam e girem.
No mesmo momento, outros músculos apertam os ossos de nossos dedos,
dando à mão a forma de uma concha fechada. Impulsos nervosos sucessivos
fazem com que outros músculos relaxem e se contraiam, puxando de várias
maneiras o rádio e a uma, e dirigindo a mão para baixo e para dentro da
água. A força do braço e da mão na água nos impele para a frente.
62 A CAIXA PRETA DE DARWIN
FIGURA 3-1
(NO ALTO) QUANDO DUAS PROTEÍNAS SE LIGAM ESPECIFICAMENTE, SUAS FORMAS SE
ENCAIXAM DE MODO QUASE PERFEITO. (EMBAIXO) para CATALISAR UMA REAÇÂO
QUÍMICA, U MA ENZIMA POSICIONA GRUPOS PRÓXIMOS AO ELEMENTO QUÍMICO QUE LIGA.
A TESOURA REPRESENTA GRUPOS NA PROTEÍNA QUE CORTARÃO QUIMICAMENTE UMA
MOLÉCULA ESPECÍFICA, REPRESENTADA PELA FORMA EM COR MAIS CLARA.

Após a conclusão de cerca de metade, das ações listadas acima, inicia-se


um ciclo semelhante, dessa vez com os ossos e músculos do braço esquerdo.
Simultaneamente, impulsos nervosos viajam para os músculos das pernas,
EXAMINANDO O CONTEÚDO DA CAIXA 63
fazendo com que esses se contraiam e relaxem de forma rítmica, puxando
os ossos da perna para cima e para baixo. Cortando a água à velocidade
espantosa de três quilómetros por hora, porém, notamos que está ficando
mais difícil pensar; sentimos uma queimação nos pulmões; e, mesmo que
estejamos de olhos abertos, as coisas começam a escurecer. Ah, sim
esquecemos de respirar. Diziam que o presidente Ford não conseguia
caminhar e mascar chiclete ao mesmo tempo. Também achamos difícil
coordenar a virada da cabeça para dentro da água e para cima com os demais
movimentos necessários à natação. Sem oxigénio para metabolizar com-
bustível, nosso cérebro começa a parar, impedindo que impulsos nervosos
conscientes viajem para as regiões distantes do corpo.
Antes de desmaiarmos e passarmos pela humilhação de ser retirados da
água por uma salva-vidas, paramos, ficamos de pé em um metro e vinte de
água e notamos que estamos apenas a uns sete metros da borda. Para
contornar o problema de respiração, decidimos nadar de costas. O nado de
costas utiliza a maioria dos mesmos músculos usados no nado livre, e
permite respirar sem ter de coordenar os músculos do pescoço com todos
os outros. Mas, agora, não podemos ver para onde estamos indo. Acabamos
saindo do curso, aproximamo-nos demais do jogo de vôlei e somos atingi-
dos na cabeça pela bola errante de uma cortada.
A fim de nos afastar dos pesarosos jogadores de vôlei, resolvemos
simplesmente boiar, mexendo as pernas em pé na extremidade profunda da
piscina. Esses movimentos usam os músculos das pernas e nos proporcio-
nam o exercício que queremos. Permite também respiração fácil e visão
clara. Após alguns minutos, porém, aparecem cãibras nas pernas. Dentro
de nossos membros flácidos, e sem que saibamos disso, nossos músculos
raramente usados mantêm à disposição combustível suficiente apenas para
curtas explosões de atividade, seguidas de longos períodos de repouso.
Durante o exercício muito prolongado, eles logo ficam sem alimentação e
deixam de funcionar com eficiência. Freneticamente, impulsos nervosos
tentam provocar os movimentos necessários para que possamos nadar, mas,
com os músculos funcionando mal, nossas pernas são tão inúteis quanto
uma ratoeira com uma mola quebrada.
Relaxamos e permanecemos imóveis. Por sorte, a grande região de nosso
corpo em volta da cintura tem uma densidade menor que a da água e, assim,
nos mantém flutuando. Após um ou dois minutos flutuando, as cãibras
relaxam. Passamos o resto do período permitido a adultos boiando serena-
mente na parte funda da piscina. Essa atividade não nos exercita muito, mas
pelo menos é agradável até que o apito soa de novo e somos bombar-
deados pelas bolas dos desrespeitosos garotos.
O exemplo da piscina mostra o que é necessário para nadar. Mostra também
que a eficiência pode ser aumentada acrescentando-se sistemas auxiliares
ao equipamento básico de natação. Estudando, em primeiro lugar, a última
cena, boiar exige apenas que um objeto seja menos denso que a água. Não
requer atividade. A capacidade de flutuar de manter uma parte do corpo
fora da água sem esforço ativo com certeza é útil. Mas, como o indivíduo
que bóia simplesmente é levado pela corrente, a capacidade de boiar não é
a mesma coisa que a de nadar.
Um sistema localizador de direção (como a visão) também é útil para a
natação; não é, contudo, a mesma coisa que a capacidade de nadar. Na
historinha acima, poderíamos nadar de costas durante algum tempo e ainda
avançar na água. No fim, porém, a incapacidade de perceber o ambiente
poderia resultar em acidentes. Não obstante, podemos nadar com os olhos
abertos ou fechados.
Nadar, é claro, requer energia; músculos com cãibras, inúteis, causam
falha imediata do sistema. Mas havíamos nadado sete metros antes de
acabar o oxigénio, e depois boiámos em pé na água por algum tempo antes
das cãibras começarem. Embora certamente afetem a distância que pode-
mos cobrir, o tamanho e a eficiência do sistema de reserva de combustível
não fazem parte do próprio sistema de nadar.
Vejamos agora os requisitos mecânicos para nadar. Usamos as mãos e
os pés para entrar em contato com a água e empurrá-la, movendo, dessa
maneira, o corpo na direção oposta. Sem os membros, ou sem algum
substituto, a natação ativa seria inteiramente impossível. Assim, podemos
concluir que um dos requisitos para nadar é um remo. Outro é um motor,
ou uma fonte de energia que disponha de combustível suficiente para durar
pelo menos vários ciclos. No nível orgânico nos seres humanos, o motor é
o músculo da perna ou do braço que, altemadamente, se contrai e relaxa.
Se o músculo for paralisado não há motor eficaz, e nadar toma-se impos-
sível. O requisito final é que haja uma conexão entre o motor e a superfície
que proporciona a remada: nos seres humanos, essas são as áreas dos ossos
às quais os músculos aderem. Se for separado de um osso, o músculo ainda
poderá contrair-se, mas, como não move o osso, toma-se impossível ao
homem nadar.
Exemplos mecânicos de sistemas de natação são fáceis de se encontrar.
Minha filha mais nova tem um peixinho de brinquedo acionado a corda que
agita a cauda, movendo-se de modo um tanto desajeitado dentro da ba-
nheira. A cauda do peixinho é a superfície de remo, a mola enrolada é a !
EXAMINANDO O CONTEÚDO DA CAIXA 65
fonte de energia transmitida por uma vareta de ligação. Se falta um dos
componentes o remo, o motor ou a ligação o peixinho não vai a lugar
nenhum. Tal como a ratoeira sem mola, um sistema de natação sem remo,
motor ou conectar estará fatalmente incompleto. Por precisarem de várias
partes para trabalhar, esses sistemas são irredutivelmente complexos.
O leitor deve manter em mente que estamos discutindo apenas as partes
comuns a todos os sistemas de natação até os mais primitivos. Mas a
complexidade adicional é muito frequente. O peixinho de brinquedo de
minha filha tem, por exemplo, além da cauda, mola e barra de ligação, várias
engrenagens que transmitem força da barra para a cauda. Um navio movido
a hélice tem todos os tipos de engrenagens e eixos que redirecionam a
energia do motor até que ela, por fim, seja transmitida à hélice. Ao contrário
dos olhos do nadador, que são separados do sistema de natação em si, essas
engrenagens extras são, na verdade, partes do sistema e retirá-las faria com
que todo o conjunto parasse. Quando um sistema na vida real tem mais do que
o número teoricamente mínimo de partes, temos de verificar cada uma das
outras partes para saber se elas são necessárias ao funcionamento do sistema.
Uma simples lista de peças mostra o mínimo absoluto de requisitos. No
capítulo anterior, explicamos que uma ratoeira, mesmo contendo todas as
peças necessárias o martelo, a base, a mola, a trava e a barra de retenção
poderia não funcionar. Se a barra fosse muito curta, ou a mola leve
demais, por exemplo, a ratoeira seria um fracasso. Da mesma maneira, as
peças de um sistema de natação precisam ser compatíveis para desempe-
nhar pelo menos uma função mínima. O remo é necessário, mas se sua
superfície for pequena demais, talvez o barco não se desloque o suficiente
no tempo pretendido. E se, ao contrário, a superfície do remo for muito
grande, o conectar ou o motor poderão sofrer tensão e quebrar quando em
movimento. O motor precisa ser forte o bastante para mover o remo.
Também tem de ser regulado para desenvolver a velocidade apropriada:
lenta demais, e o nadador não obtém fisicamente o progresso necessário;
; rápida demais, o conectar ou o remo podem quebrar.
l Mas, mesmo que tenhamos as partes certas de um sistema de natação, e
í.-mesmo que as partes tenham o tamanho e a resistência correios e sejam
compatíveis, ainda é preciso outra coisa. O requisito adicional a neces-
; sidade de controlar o ritmo e a direção das remadas é mais fácil de observar
ïno exemplo de um nadador do que no caso de um barco a remo. Quando um
atindivíduo que não sabe nadar cai na água, ele bate impotente os braços e as
66 A CAIXA PRETA DE DARWIN
pernas, não fazendo maior progresso do que se apenas flutuasse. Até mesmc
um nadador iniciante como minha filha mais velha, que está aprendem
a dar braçadas afunda rapidamente se o papai não a segurar. Sm
braçadas são adequadas, mas não a coordenação do ritmo; ela não s
mantém paralela à superfície da água e sempre conserva a cabeça levantada
Sistemas mecânicos não apresentam esses problemas. Um navio nãc
bate a hélice de forma desordenada, e a sincronização e direção de um barcc
a remo são suaves e regulares desde o começo. Esse argumento, no entanto;
induz a erro. A capacidade aparentemente posta em ação sem esforço é, ns
verdade, inserida na forma e conectividade do remo, rotor e motor do barco,
Imagine um barco a vapor no qual as pás do remo não fossem fixada
corretamente em volta de uma estrutura circular. Suponhamos que a
lâminas fossem fixadas em ângulos diferentes e que o rotor se movess
primeiro para a frente e em seguida para trás, e depois de um lado para i
outro. Em vez de fazer um passeio turístico pelo Mississippi, o barco s.
moveria à deriva, flutuando com a corrente na direção do golfo do México
Uma hélice com lâminas cravadas em diferentes ângulos revolveria a águr
mas não poderia levar o barco em qualquer direção determinada. A aparent
facilidade com que um sistema mecânico pode remar em comparação
com as dificuldades de um indivíduo que não sabe nadar é uma ilusão
O engenheiro que projetou o sistema "treinou-o" para nadar, empurrando e
água na direção correta, com uma sincronização correia.
No implacável mundo da natureza, um organismo que despendesse
energia batendo inutilmente na água não teria vantagem alguma sobre outrc
que apenas flutuasse ao seu lado. Mas células nadam? Se nadam, que
sistemas usam para isso? Serão elas, como o barco a vapor do Mississippi:
irredutivelmente complexas? Poderiam ter evoluído de forma gradual?
Algumas células nadam usando um cílio. O cílio é uma estrutura que, eu
termos aproximados, parece um cabelo e bate como se fosse um chicote
Se uma célula dotada de cílio pode se mover em um líquido, o cílio move
a célula de modo muito parecido ao de um remo movendo um bote. Se eli
está presa no meio de uma camada de outras células, o cílio que bate move
o líquido por cima da superfície da célula estacionária. A natureza usa os
cílios para ambos os trabalhos. O esperma, por exemplo, usa cílios pars
nadar. Em contraste, as células estacionárias que revestem o trato res-
piratório têm, cada uma delas, várias centenas de cílios. O grande numere
de cílios bate em sincronia de forma muito parecida com remos operados
EXAMINANDO O CONTEÚDO DA CAIXA 67
por escravos nas galeras romanas para empurrar muco até a garganta e
daí para fora. Essa ação remove pequenas partículas estranhas tal como
fuligem , que são acidentalmente inaladas e ficam presas no muco.
Microscópios ópticos mostraram finos cabelos em algumas células, mas
a descoberta dos detalhes liliputianos dos cílios teve de esperar pela
invenção do microscópio eletrônico. Nas páginas seguintes, examinaremos
a estrutura do cílio. A maioria dos leitores provavelmente achará mais fácil
seguir a análise consultando com frequência a Figura 3-2.
Q O cílio consiste de um feixe de fibras revestido por uma membrana.1
A membrana ciliar (pense nela como uma espécie de cobertura de
plástico) é um crescimento da membrana da célula, de tal modo que o
interior do cílio é ligado ao interior da célula. Quando um cílio é cortado
transversalmente e a extremidade cortada é examinada por microscopia
eletrônica, vemos nove estruturas semelhantes a bastões em tomo da
periferia. Os bastões são denominados microtúbulos. Quando fotogra-
fias de alta qualidade são examinadas com atenção, nota-se que cada um
dos nove microtúbulos consiste na verdade de dois anéis fundidos.
Exames posteriores revelam que um dos anéis é constituído de treze
filamentos individuais. O outro anel, ligado ao primeiro, é formado por
dez filamentos. Em curtas palavras, cada um dos nove microtúbulos
externos de um cílio é constituído de um anel de dez filamentos fundido
com outro de treze.
Experimentos bioquímicos mostram que os microtúbulos são cons-
tituídos de uma proteína denominada tubulina. Na célula, moléculas de
tubulina se juntam como se fossem tijolos para formar uma chaminé
cilíndrica. Cada um dos nove bastões externos é um microtúbulo, que
parece uma chaminé dupla, em uma só peça, feita de tijolos de tubulina.
Fotos tiradas por microscopia eletrônica mostram ainda dois bastões no
centro do cílio. Eles também são microtúbulos. Em vez de serem
chaminés duplas, no entanto, são chaminés isoladas, cada uma delas
constituída de treze filamentos de tubulina.
Quando as condições no interior da célula são apropriadas (quando,
por exemplo, a temperatura está dentro de certos limites e quando a
concentração de cálcio é exatamente correta), a tubulina o "tijolo"
que forma as chaminés automaticamente se reúne para formar
microtúbulos. As forças que congregam as tubulinas são muito parecidas
com as que dobram a proteína individual em uma forma compacta:
cargas positivas atraem cargas negativas, aminoácidos oleosos se con-
traem para expulsar a água, e assim por diante. Uma extremidade da
68 A CAIXA PRETA DE DARWIN
FIGURA 3-2-
(NO ALTO) SEÇÃO TRANSVERSAL DE UM CÍLIO MOSTRANDO A ESTRUTURA DO ANEL
DUPLO FUNDIDO DOS MICROTÚBULOS EXTERNOS, A ESTRUTURA DE ANEL ÚNICO DOS
MICROTÚBULOS CENTRAIS, AS PROTEÍNAS DE LIGAÇÃO E O MOTOR DE DINEÍNA.
(EMBAIXO) O MOVIMENTO DESLIZANTE INDUZIDO PELA DINEÍNA, QUE "CAMINHA"
SUBINDO POR UM MICROTÚBULO VIZINHO, É CONVERTIDO EM UM MOVIMENTO ENCUR-
VADO PELA PROTEÍNA NEXINA, DE LIGAÇÃO FLEXÍVEL.
Braço externo da dineína
Braço interno da dinelr»

Nexina
Subfibra B
SubfibraA
:amiseta central
microtúbulos, cc
ponte de conexi
Membrana plasmi
Raio radial
Cabeça do raio

Curso da
energia

Parte superior extraídade Voet and Voet, fig. 34-77, p.1.256. Reproduzido com perm
issão.
molécula de tubulina tem uma superfície que é complementar à extre-
midade oposta de uma segunda molécula de tubulina, de modo que as
duas se colam. Uma terceira tubulina pode, em seguida, acoplar-se à
extremidade da segunda molécula, a quarta na extremidade da terceira,
e assim por diante. Como analogia, pense no empilhamento de latas de
atum. No supermercado onde minha família faz compras, uma vez que
o fundo da lata é chanfrado e do mesmo diâmetro do topo de borda reta,
as latas são arrumadas de forma que uma se encaixa perfeitamente à
outra. Se a pilha receber uma leve batida, as latas continuam na mesma
posição.
Se duas latas de atum são empilhadas com as faces superiores se
tocando, e não na ordem de cima para baixo, porém, elas não podem ser
empilhadas com segurança e bastará uma batida casual para deslocá-las
de posição. Além disso, se o atum da marca x não tem fundo chanfrado,
ele não pode ser empilhado com segurança porque suas latas não têm
superfícies suplementares. A associação de moléculas de tubulina é mui-
to mais específica que o empilhamento de latas de atum. Afinal de contas,
na célula há milhares de proteínas diferentes e a tubulina tem de ter
certeza de que se associa apenas a outras tubulinas e não a qualquer
proteína que apareça. Talvez, por isso mesmo, seja bom pensar na
tubulina como uma lata de atum com dez curtas proj ecoes em forma de
agulha distribuídas sobre a superfície superior, e dez reentrâncias no
fundo que se ajustam com perfeição às posições das projeções no topo.
Assim, nenhuma lata de atum poderá ser empilhada acidentalmente com
qualquer outro tipo de lata.
Ampliando nossa analogia do atum, suponhamos que também tivés-
semos várias projeções saindo de um lado da lata, que fossem comple-
mentares a reentrâncias localizadas quase, mas não de todo, no lado
oposto exato. Nesse caso, poderíamos juntar as latas lado a lado e, uma
vez que os orifícios não ficavam exatamente na frente das projeções,
quando acrescentássemos mais latas, elas acabariam por dar uma volta
e formar um laço fechado. Empilhando laços sobre laços construiríamos,
finalmente, com nossas latas de atum (depois de misturar bem nossas
metáforas), uma estrutura semelhante a uma chaminé.
Embora a tubulina tenha a capacidade de se associar e formar micro-
túbulos, estes não se juntam sem auxílio de outras proteínas. Há uma boa
razão para esse fato: os microtúbulos têm várias tarefas a realizar na
célula. No caso da maioria delas, são necessários microtúbulos isolados,
não-associados. Para outras (incluindo o movimento ciliar), contudo, são
necessários feixes de microtúbulos. Desse modo, os microtúbulos exis-
70 A CAIXA PRETA DE DARWIN
tem de forma individual, como os pequenos bastões de um jogo df
apanhar varetas, a menos que reunidos propositadamente em feixes par;
realizar um dado trabalho.
Em fotografias de cílios tiradas com microscópios eletrônicos, vário;
diferentes tipos de conectares podem ser vistos amarrando os microtú-
bulos individuais (ver Figura 3-2). Há uma proteína que serve de pontt
aos dois microtúbulos centrais isolados que se encontram no centro do cílio
Além disso, de cada um dos microtúbulos duplos projeta-se um raio radia
na direção do centro do cüio. A estrutura termina em uma massa arredon-
dada, denominada cabeça do raio. Finalmente, uma proteína chamad;
nexina liga cada microtúbulo duplo, externo, ao que está a seu lado.
Duas outras projeções adornam cada microtúbulo periférico, deno-
minadas, respectivamente, braço externo e braço interno. Análises bio-
químicas revelaram que essas projeções contêm uma proteína chamad;
dineína. A dineína é membro da classe de proteínas motores, qu
funcionam como minúsculos motores na célula, fornecendo energia ac
movimento mecânico. Q
Conhecer a estrutura de uma máquina complexa e saber como ela funcion;
são dois assuntos diferentes. Poderíamos abrir o capo de um carro e tirai
fotos do motor eternamente, mas os instantâneos em si não dariam um;
ideia clara de como as diferentes partes geram a função. Em última análise
se queremos saber como uma coisa funciona, temos de desmontá-la e re-
montá-la, parando em vários pontos para verificar se a função foi restaurada
Talvez nem mesmo isso, porém, forneça uma ideia clara de como a máquin;
opera, mas oferece, de fato, o conhecimento prático sobre quais compo
nentes têm importância decisiva. A estratégia básica da bioquímica nestf
século tem sido desmontar sistemas moleculares e tentar montá-los outr;
vez. Essa estratégia gerou imensos insights sobre as operações que ocorreu
na célula.
Q Experimentos desse tipo deram indícios aos bioquímicos sobre come
funciona o cílio. A primeira pista vem de cílios isolados. A natureza fo
muito gentil ao permitir que os cílios possam ser separados das célula;
com uma sacudida vigorosa. A sacudida quebra por completo as pró
jeções. Imprimindo-se um movimento rotativo de alta velocidade i
solução (o que faz com que partículas maiores, pesadas, se sedimenten
mais rapidamente do que as pequenas e leves), podemos obter um;
EXAMINANDO O CONTEÚDO DA CAIXA 71
solução de cílios puros em um tubo de ensaio. Se os cílios são despidos
de sua membrana e, em seguida, abastecidos com uma forma química
de energia denominada atp, eles baterão em uma forma característica de
chicotada. Esse resultado demonstra que o motor necessário para acionar
o movimento ciliar encontra-se no próprio cílio e não no interior da
célula, nesse momento ausente. A pista seguinte é que se (através de
macetes bioquímicos) os braços de dineína são removidos, mas o resto
do cílio permanece intacto, este fica paralisado, como se em rigor mortis.
A reposição de nova dineína nos cílios endurecidos permite que o
movimento se reinicie. Dessa maneira, parece que o motor do cílio está
contido nos braços da dineína.
Outros experimentos forneceram ainda mais pistas. Há enzimas (de-
nominadas proteases) que têm a capacidade de mastigar outras proteínas,
decompondo-as em aminoácidos. Quando uma pequena quantidade de
protease é adicionada por um curto período de tempo a uma solução que
contém cílios, a protease corta rapidamente os conectares de nexina na
borda da estrutura. O restante do cílio permanece intacto. O motivo pelo
qual a protease ataca com rapidez os conectares é que, ao contrário das
demais proteínas do cílio, os conectares de nexina não são dobrados com
firmeza. Em vez disso, são correntes frouxas, flexíveis. E porque são
frouxas, a protease pode cortá-las tão rápido quanto uma tesoura corta
uma tira de papel. (A protease corta proteínas firmemente dobradas com
a mesma velocidade que uma tesoura corta um livro fechado.)
As proteases permitiram aos bioquímicos descobrir como o cílio
funcionaria sem conectares de nexina. O que a remoção dos conectares
provocaria? Talvez o cílio funcionasse muito bem sem eles, ou talvez
entrasse em rigor mortis, como aconteceu quando os braços de dineína
foram removidos. Na realidade, não ocorreu nada disso; o cílio sem
conectar fez algo inteiramente inesperado. Ao lhe ser fornecida energia
bioquímica, o cílio, em vez de se dobrar, desenrolou-se rapidamente. Os
microtúbulos individuais começaram a deslizar um pelo outro, como os
segmentos de uma antena de rádio deslizam um pelo outro quando ela
é aberta. Eles continuaram a deslizar até que o comprimento do cílio
aumentou em quase dez vezes. Avista desse resultado, os bioquímicos
concluíram que o motor estava funcionando, uma vez que alguma coisa
tinha de mover os microtúbulos individuais. Concluíram também que os
conectares de nexina são necessários para manter o cílio integral quando
ele tenta se dobrar.
Essas pistas resultaram em um modelo da maneira como funciona o
cílio (ver Figura 3-2). Imagine várias chaminés feitas de latas de atum
que são mantidas bem juntas. As chaminés são ligadas por fios frouxos
Acoplado a uma chaminé há um pequeno motor com um braço que si
estende e segura a lata de atum de uma chaminé vizinha. O braço-moto
empurra a segunda chaminé para baixo, fazendo com que ela deslize par
o outro lado da primeira. À medida que as chaminés deslizam uma peL
outra, os fios frouxos começam a se esticar e a se tomar retesados. Em
purrando mais o braço-motor, a tensão do fio faz com que as chaminé
se curvem. Dessa maneira, o movimento de deslizamento foi convertido
em movimento de curvatura. Agora, vamos traduzir essa analogia eu
termos bioquímicos. Os braços de dineína em um microtúbulo se ligan
a um segundo microtúbulo, vizinho, e a dineína usa a energia biológic
do atp para "andar por cima" do vizinho. Quando isso acontece, os dói
microtúbulos começam a deslizar um pelo outro. Na ausência da nexins
eles continuariam a deslizar até se separarem. Os elos cruzados d
proteína, porém, impedem que os microtúbulos vizinhos deslizem mai
do que uma pequena distância. Quando os conectares flexíveis de nexin'
são alongados até seu limite, a continuação da caminhada da dineína fa
com que os conectares de nexina puxem os microtúbulos. Àmedida qu
a dineína continua sua caminhada, a tensão aumenta. Por sorte, o
microtúbulos são relativamente flexíveis, de modo que o movimenti
deslizante induzido pela dineína é convertido em movimento de curva-
tura. Q
Passemos agora em revista as atividades dos cílios e consideremos c
que elas implicam. Que componentes são necessários para que um cílic
funcione? O movimento do mesmo certamente exige microtúbulos. D
outra maneira, não haveria filamentos para deslizar. Além disso, ek
precisa de um motor, ou os microtúbulos do cílio permaneceriam duros
e imóveis. Ele também precisa de conectores para empurrar os filamentos
vizinhos, convertendo o movimento de deslizamento em movimento de
curvatura e impedindo que a estrutura desmorone. Todas essas peças sãc
necessárias para realizar uma única função: o movimento ciliar. De
mesmo modo que uma ratoeira não funciona a menos que todas as suas
partes constituintes estejam presentes, o movimento ciliar simplesmente
não existe na ausência de microtúbulos, conectares e motores. Podemos
por conseguinte, concluir que o cílio é de complexidade irredutível
uma enorme chave-inglesa jogada em sua presumida evolução gradua
darwiniana.
O fato de o cílio ser irredutivelmente complexo não deve nos surpreendei
Vimos neste capítulo que um sistema de natação requer um remo que façi
mtato com a água, um motor ou fonte de energia, e um conectar para ligar
3 dois. Todos os sistemas que se movem por ação de remo variando do
sixinho de brinquedo de minha filha à hélice de um navio fracassam
i um dos componentes está ausente. O cílio é um membro dessa classe
s sistemas de natação. Os microtúbulos são os remos, cuja superfície entra
«n contato com a água e a empurra. Os braços de dineína são os motores,
[ue fornecem a força necessária para mover o sistema. Os braços de nexina
ao os conectares, transmitindo a força do motor de um microtúbulo para
eu vizinho.2
A complexidade do cílio e de outros sistemas de natação é inerente à
irópria tarefa. Não depende do fato do sistema ser maior ou menor, se tem
|ue mover uma célula ou um navio: para remar, vários componentes são
lecessários. A questão é: De que maneira surgiu o cílio?
*lguns biólogos evolucionistas como Richard Dawkins têm uma ;
aaginação fértil. Dado um ponto de partida, eles quase sempre podem tecer
|
na história para obter qualquer estrutura biológica que se possa desejar,
l
sse talento pode ser valioso, mas é uma faca de dois gumes. Embora |
possam pensar em outras possíveis rotas evolutivas que passariam dês-
percebidas a outras pessoas, eles tendem também a ignorar detalhes e r
abstáculos que poriam por terra seus cenários. Aciência, contudo, não pode,
í
im última análise, ignorar detalhes relevantes e, no nível molecular, todos
:
as "detalhes" assumem importância crítica. Se falta um parafuso ou porca :
molecular, todo o sistema pode ruir. Sendo o cílio irredutivelmente com-
'
olexo, nenhuma rota direta, gradual, leva à sua criação. Dessa maneira, uma
ï
tlistória evolutiva do cílio tem de imaginar uma rota tortuosa, talvez S
idaptando partes que foram usadas primeiro para outras finalidades. Ten-
'
temos, portanto, imaginar uma rota indireta plausível para o cílio, usando
partes preexistentes da célula.
Para começar, microtúbulos existem em muitas células e, em geral, são |
[isados como meros suportes estruturais, como se fossem vigas mestras, para
sustentar a forma da célula. Além disso, proteínas motrizes participam de outras
funções da célula. Sabe-se que elas viajam ao longo dos microtúbulos, usan-
io-os como pequenas estradas para ir de um ponto a outro. Um argumento
svolutivo indireto poderia sugerir que, em algum ponto, vários microtúbulos
«e juntaram, talvez para reforçar alguma forma particular de célula. Depois
!
lisso, aproteínamotriz, que normalmente viajava pêlos microtúbulos, poderia
|
er adquirido por acaso a capacidade de empurrar dois microtúbulos vizinhos,

ocasionando um leve movimento de curvatura que, de alguma maneira,


ajudasse o organismo a sobreviver. Outros pequenos movimentos teriam
produzido gradualmente o cílio que encontramos em células modernas.
Por mais fascinante que esse cenário possa parecer, detalhes de impor-
tância crítica, porém, foram ignorados. A pergunta que temos de fazer a
respeito desse cenário indireto é uma com a qual os biólogos têm pouca
paciência: Como, exatamente?
Suponhamos, por exemplo, que queremos fabricar uma ratoeira. Na
garagem, podemos ter uma tábua de madeira velha (para a plataforma, ov
base), a mola de um velho relógio de corda, uma peça de metal (para servil
como martelo) na forma de uma alavanca, uma agulha de cerzir para segurai
a barra, e uma tampinha metálica de garrafa, que julgamos poder usar come
trava. Essas peças, no entanto, não poderiam formar uma ratoeira funciona!
sem modificações excessivas e, enquanto elas estivessem sendo feitas, as
partes não poderiam funcionar como ratoeira. Suas funções anteriores as
teriam tomado impróprias para quase qualquer novo papel como parte d(
um sistema complexo.
No caso do cílio, encontramos problemas análogos. A proteína que
sofreu mutação e que, por acaso, se ligou a microtúbulos, bloquearia sue
função como "estradas" para transporte. Uma proteína que reunisse micro-
túbulos de forma aleatória desorganizaria a forma da célula da mesmí
maneira como a forma de um prédio seria desorganizada instalando-se
cabos que acidentalmente juntassem vigas mestras que sustentam o edifí-
cio. Um conectar que reforçasse os feixes de microtúbulos como supor
tes estruturais tenderia a toma-los rígidos, ao contrário do conectar flexíve
de nexina. Uma proteína motora não controlada, ao ligar-se a microtúbulos
separaria o que deveria estar bem junto. O cílio não ficaria de forma algum;
na superfície da célula. Se aí não ficasse, a batida interna poderia desintegra
a célula; mas, mesmo que estivesse na superfície da mesma, a quantidadf
de proteínas motoras provavelmente não seria suficiente para movê-lo
Ainda que o cílio se movesse, um curso desajeitado não moveria neces
sariamente a célula. E se ela de fato se movesse, seria um movimento nã(
controlado que utilizaria energia e não corresponderia a qualquer neces
sidade da célula. Centenas de outras dificuldades teriam de ser superadas
antes que um cílio incipiente fosse um melhoramento para a célula.
O cílio é uma estrutura fascinante e tem deixado intrigados cientistas di
diversas disciplinas. O controle de seu tamanho e estrutura interessa ,
uoquímicos; a dinâmica de seu curso de energia fascina biofísicos; a
lanifestação das muitas codificações separadas de genes para seus com-
onentes absorve a mente de biólogos moleculares. Até mesmo os médicos
is estudam, porque os cílios são medicinalmente importantes; eles ocorrem
;m alguns microrganismos infecciosos, e os dos pulmões colam-se uns aos
)utros na doença genética denominada fíbrose cística. Uma rápida busca
iletrônica na literatura profissional mostra mais de mil trabalhos publicados
los últimos anos que têm a palavra cílio ou outras semelhantes no título.
surgiram trabalhos sobre tópicos correlatas em quase todas as principais
'evistas de bioquímica, incluindo Science, Nature, Proceedings of the
ational Academy of Sciences, Biochemistry, Journal ofBiological Che-
nistry, Journal of Molecular Biology, Cell, e muitas outras. Nas últimas dé-
adas, provavelmente dez mil trabalhos foram publicados a respeito dos cílios.
Havendo uma literatura tão vasta sobre o assunto tendo em vista o
nteresse que desperta em tantos campos e levando em conta a declaração
epetida de que a teoria da evolução constitui a base da biologia moderna
, seria de se esperar que a evolução do cílio fosse tema de uma grande
juantidade de trabalhos na literatura profissional. Poderíamos imaginar
ambém que, embora certos detalhes talvez fossem mais difíceis de explicar
io que outros, a ciência como um todo teria uma boa ideia de como o cílio
ivoluiu. Os estágios intermediários através dos quais provavelmente pas-
ou, os problemas que teria encontrado nos primeiros estágios, as possíveis
otas para contornar esses problemas, a eficiência de um suposto cílio
ncipiente como sistema de natação todos eles teriam sido, com certeza,
ismiuçados por completo. Nas duas últimas décadas, contudo, apenas dois
artigos tentaram sugerir um modelo para a evolução do cílio que levava em
conta considerações mecânicas reais. Pior ainda, os dois trabalhos discor-
dam até mesmo sobre a rota geral que tal evolução poderia ter tomado.
Nenhum dos dois discute detalhes quantitativos cruciais ou os possíveis
problemas que rapidamente fariam com que um dispositivo mecânico como
um cílio ou uma ratoeira se tornassem inúteis.
O primeiro trabalho, de autoria de T. Cavalier-Smith, foi publicado em
1978 na revista BioSystems.3 O trabalho não tenta apresentar um modelo
realista, quantitativo, nem mesmo para uma única etapa no desenvolvimen-
to do cílio em uma linhagem celular que inicialmente não o possuía. Em
vez disso, descreve o que o autor imagina terem sido eventos importantes
ao longo do caminho para a formação do cílio. Esses passos imaginários
são descritos em frases como "flagelos [cílios longos com frequência
recebem o nome de "flagelos"] são tão complexos que sua evolução deve
ter implicado numerosos estágios"; "Afirmo que, inicialmente, os flagelos

não precisariam ser móveis, mas que foram prolongamentos esguios de


células"; "organismos evoluiriam com uma grande variedade de estruturas
axonemais" e "é provável que os mecanismos de fototaxia (movimento em
direção à luz) tenham evoluído simultaneamente com os flagelos".
As citações acima dão uma ideia das confusas descrições verbais carac-
terísticas da biologia evolutiva. A falta de detalhes quantitativos cálculo
ou estimativa bem informados, baseados em uma suposta estrutura inter-
mediária de quanto uma dada mudança teria melhorado a capacidade ativa
de natação de um organismo toma essa história toda inteiramente inútil
para compreendermos como o cílio poderia de fato ter surgido.
Mas deixem-me logo acrescentar que o autor (um conhecido cientista,
que deu muitas contribuições importantes à biologia molecular) não preten-
dia que o trabalho fosse considerado como a apresentação de um modelo
realista. Ele estava apenas tentando ser provocador. Tinha esperança de
atrair outros especialistas com a promessa de seu modelo, por mais vaga
que fosse a elaboração deste e estimulá-los a realizar algum trabalho para
prover de carne o esqueleto despojado. Provocações desse tipo podem
prestar um serviço importante à ciência. Infelizmente, desde então, ninguém
construiu coisa alguma sobre o modelo.
O segundo trabalho, escrito nove anos depois por um cientista húngaro
chamado Eõrs Szathmary e publicado também na BioSystems, assemelha-
se de muitas maneiras ao primeiro.4 Szathmary defende a ideia, que teve
Lynn Margulis como paladina, de que os cílios surgiram quando um tipo
de bactéria nadadora chamada "espiroqueta" ligou-se acidentalmente a uma
célula eucariótica.5 A ideia enfrenta a grande dificuldade de as espiroquetas
se moverem graças a um mecanismo (descrito adiante) que é muito diferente
do usado pêlos cílios. A sugestão de que uma evoluiu e se transformou no
outro assemelha-se à proposta de que o peixinho de brinquedo de minha
filha poderia se modificar, um passo darwiniano após outro, e transformar-
se em uma barca do Mississippi. A própria Margulis não está interessada
em detalhes mecânicos; contenta-se em procurar semelhanças gerais em
alguns componentes dos cílios e dos sistemas natatórios bacterianos. Szath-
mary tentou ir um pouco adiante e, na verdade, discutiu dificuldades
mecânicas que teriam de ser superadas em um cenário dessa ordem.
Inevitavelmente, porém, seu trabalho (tal como o de Cavalier-Smith) é uma
mera pintura verbal, que apresenta à comunidade científica um modelo cru
para trabalho posterior. Ele também falhou em provocar tal trabalho expe-
rimental ou teórico, seja de parte do próprio autor ou de outros.
Em anos recentes, Margulis e Cavalier-Smith andaram polemizando na
imprensa.6 Ambos apontaram enormes problemas nos modelos recíprocos,
" ambos estavam certos. O pior, contudo, é que nenhum dos lados citou
[uaiquer detalhe mecanicista em seu modelo. Sem detalhes, a discussão
stácondenada a ser anticientífica e infrutífera. A comunidade científica em
;eral ignorou ambas as contribuições; nenhum desses trabalhos foi citado
lor outros cientistas mais do que um punhado de vezes nos anos após sua
lublicação.7
O volume de pesquisa científica que foi e que está sendo feita sobre o
alio, e o grande aumento de nossa compreensão de como ele funciona nos
ultimos anos levaram muitas pessoas a supor que mesmo que não saibam
;omo o cüio surgiu, alguém tem que saber. Mas uma busca na literatura
;ientífica prova que elas estão erradas. Ninguém sabe.
iós, seres humanos, tendemos a formar uma opinião muito lisonjeira de
lós mesmos, atitude esta que pode falsear a maneira como percebemos o
nundo biológico. Em particular, nossa visão sobre o que é mais e menos
lesenvolvido em biologia, sobre o que é um organismo avançado e um
irimitivo, começa naturalmente com a presunção de que a culminação da
latureza está em nós mesmos. Esse pressuposto pode ser defendido citan-
lo-se a dominação humana e também com argumentos filosóficos. Não
)bstante, outros organismos, se fossem capazes de falar, poderiam argu-
nentar com igual convicção sobre sua própria superioridade. Estes inclui-
iam as bactérias, que frequentemente consideramos as formas mais primi-
tivas de vida.
Algumas bactérias ostentam um maravilhoso dispositivo de natação, o
flagelo, que não tem equivalente em células mais complexas.8 Em 1973,
descobriu-se que algumas bactérias nadam girando os flagelos. O flagelo,
portanto, atua como se fosse uma hélice rotativa em contraste com o
cílio, que age mais como um remo.
Q A estrutura do flagelo (Figura 3-3) é inteiramente diferente da do cílio.
O flagelo é um filamento longo, parecido com um fio de cabelo,
enraizado na membrana da célula. O filamento externo consiste de um
único tipo de proteína, denominada "flagelina". O filamento de flagelina
é a superfície do remo que entra em contato com o líquido durante o
processo de natação. Na extremidade do filamento de flagelina, próximo
da superfície da célula, há uma protuberância na espessura do flagelo. É
nesse ponto que o filamento se liga à transmissão do rotor. O material
de ligação é composto de alguma coisa chamada de "gancho de proteí-
na". O filamento de um flagelo bacteriano, ao contrário do cílio, nãc
contém proteína motriz; se rompido, o filamento simplesmente flutua
rígido na água. O motor que imprime rotação ao filamento-hélice;
portanto, deve estar localizado em algum outro lugar. Experimento
demonstraram que ele se localiza na base do flagelo, onde a microscopi:
eletrônica revela que há várias estruturas em forma de anel. A naturez;
rotativa do flagelo produz claras e inevitáveis consequências, conforma
notado em um popular livro didático de bioquímica:
[O motor rotativo bacteriano] deve ter os mesmos elementos mecânicos qu
outros dispositivos rotativos: um rotor (o elemento que imprime rotação)
um estator (o elemento estacionário).9
O rotor foi identificado como o anel M na Figura 3-3 e o estator, come
anel s. Q
A natureza rotativa do motor flagelar bacteriano constituiu uma sur-
preendente e inesperada descoberta. Ao contrário de outros sistemas que
geram movimento mecânico (músculos, por exemplo), o motor bactéria-
no não usa energia diretamente, que é armazenada em uma molécuk
"portadora", como a atp. Em vez disso, para se mover o flagelo usa e
energia gerada por um fluxo de ácidos que circula na membrana bacte-
riana. Os requisitos de um motor baseado em tal princípio são muitc
complexos e estão sendo objeto de pesquisa ativa. Muitos modelos forair
sugeridos para o motor, nenhum deles simples. (Um desses modelos f
mostrado na Figura 3-3 apenas para dar ao leitor uma prova da esperada
complexidade do motor.)
O flagelo bacteriano usa um mecanismo de remo. Por isso mesmo, devf
satisfazer as mesmas condições que outros sistemas de natação. Uma vê;
que o flagelo bacteriano é necessariamente composto de pelo menos trê;
partes um remo, um rotor, e um motor ele é de complexidad
irredutível. A evolução gradual do flagelo, assim como a do cílio, encontn
obstáculos enormes.
A literatura profissional geral sobre o flagelo bacteriano é quase tão rici
quanto a existente sobre o cílio, com milhares de trabalhos sobre o assunte
publicados nos últimos anos. Esse fato não é surpreendente: o flagelo é un
sistema biofísico fascinante e as bactérias flageladas têm importâncii
médica. Ainda assim, mais uma vez, a literatura evolucionista brilha pel;
ausência. Embora nos digam que toda a biologia deve ser vista através da;
lentes da evolução, nenhum cientista jamais publicou um modelo qui
explicasse a evolução gradual dessa extraordinária máquina molecular.
EXAMINANDO O CONTEÚDO DA CAIXA
no ALTO) DESENHO DE UM FLAGELO BACTERIANO MOSTRANDO O FILAMENTO, O
ANCHO E O MOTOR ENRAIZADOS NAS MEMBRANAS INTERNA E EXTERNA DA CÉLULA
NA PAREDE CELULAR. (EMBAIXO) um DOS MODELOS PROPOSTOS PARA O FUNCIO-
NAMENTO DE UM MOTOR ROTATIVO MOVIDO A ÁCIDO. O DESENHO MOSTRA A COMPLEXI-
3ADE INTERNA DO MOTOR, QUE NÃO É DISCUTIDA NO TEXTO.
, Gancho (junta universal)
nbuchamento
Filamento (hélice)
. Membrana externa
-Camada peptidoglicana
Espaço periplasmático
Membrana interna
Bastão (eixo-motor)
Canal
complexo
H"1" Do meio
Elemento elástico
fixado à parede da célula
Para o citoplasma
Linha de Ligand
Desenho superior extraído de Vbet and Voet, fig. 34-84, p.l .259.
Desenho inferior extraído de Caplan, S.R., e Kara-Ivanov, M. (1993), fig. 9A, p.13
8.
Figuras reproduzidas com permissão.
Dissemos acima que o cílio contém tubulina, dineína, nexina e várias outras
proteínas conectoras. Se tomamos esses elementos e os injetamos em uma
célula que não possua um cüio, contudo, eles não se reúnem para produzir
um cílio funcional. E preciso muito mais para se obter um cílio numa célula.
Uma análise bioquímica exaustiva mostra que o cílio contém mais de
duzentos tipos diferentes de proteínas e sua complexidade é imensamente
maior do que pensávamos. As razões dessa complexidade ainda não estão
claras e aguardam investigações experimentais ulteriores. Outras tarefas
para as quais as proteínas podem ser necessárias, contudo, incluem a ligação
do cílio a uma estrutura-base no interior da célula; modificação da elas-
ticidade do cílio; controle da sincronização das batidas e reforço da mem-
brana ciliar.
O flagelo bacteriano, além das proteínas já discutidas, requer cerca de
quarenta outras proteínas para funcionar. Mais uma vez, permanecem
desconhecidos os papéis exatos da maioria das proteínas, embora se saiba
que incluem sinais para ligar e desligar o motor; proteínas que servem como
"buchas" para permitir que o flagelo atravesse a membrana e a parede da
célula; proteínas para ajudar na montagem da estrutura e proteínas para
regular a produção de outras que fazem parte do flagelo.
Em resumo, à medida que começaram a examinar estruturas aparente-
mente simples, como cílios e flagelos, os bioquímicos descobriram es-
pantosa complexidade, com dezenas ou mesmo centenas de partes fabrica-
das com precisão. É muito provável que muitas das partes não estudadas
aqui sejam necessárias para que qualquer cílio funcione na célula. Aumen-
tando-se o número de partes necessárias, a dificuldade de montar o sistema
de forma gradual sobe para as alturas, e cai vertiginosamente a probabili-
dade de cenários indiretos. Darwin parece cada vez mais abandonado.
Novas pesquisas sobre os papéis de proteínas auxiliares tampouco conse-
guem simplificar o sistema de complexidade irredutível. As dificuldades do
problema não podem ser aliviadas, e, na verdade, elas se tomam cada vez
piores. A teoria darwiniana não forneceu uma explicação para o cílio ou
para o flagelo; a imensa complexidade dos sistemas natatórios obriga-nos
a pensar que ela talvez nunca consiga fazer isso.
À medida em que aumenta a quantidade de problemas refratários a uma
interpretação gradualista, toma-se mais clara a necessidade de um novo tipo
de explicação. Cílios e flagelos dificilmente serão os únicos problemas para
o darwinismo. No capítulo seguinte, examinaremos a complexidade bio-
química subjacente à simplicidade aparente da coagulação do sangue.
RUBE GOLDBERG NO SANGUE
") nome de Rube Goldberg o grande cartunista que divertiu os Estados
Jnidos com suas máquinas malucas (Figura 4-1) continua vivo na
;ultura norte-americana, embora o próprio autor já tenha sido esquecido.
?ui apresentado à ideia de uma máquina Rube Goldberg quando menino,
ssistindo aos desenhos animados que passavam na tv nas manhãs de
abado. Meu favorito era a turma do Pemalonga e sempre gostei do galo
scandaloso, Chantecler. Lembro-me de vários episódios em que Chante-
ler, com grandes óculos sobre o bico, servia de babá de algum pintinho
abido, enquanto a mãe viúva do próprio (geralmente rica) ia às compras.
Lm algum momento Chantecler aborrecia o jovem, que planejava uma
vingança. Uma curta cena mostrava a inquieta figurinha rabiscando algu-
nas equações em um pedaço de papel. Esse fato mostrava exatamente como
3 pintinho era sabido (afinal de contas, é preciso ser muito sabido para
'abiscar equações) e era um sinal de que a vingança seria tomada de uma
naneira precisa, científica.
Uma ou duas cenas depois, Chantecler aparece andando quando vê uma
nota de dólar ou alguma outra isca no chão e a apanha. O dólar estava preso
ior um cordão a um bastão encostado em uma bola. Quando a nota é tirada
Io lugar, o cordão preso a ela puxa para baixo o bastão e a bola começa a
olar para longe, enquanto Chantecler observa boquiaberto a ação que se
'egue. Abola cai de um despenhadeiro sobre a extremidade elevada de uma
;angorra, abaixando-a e jogando no ar uma pedra, à qual está preso um
iedaço de lixa. Subindo, a lixa bate em um fósforo, que se projeta da face
Io despenhadeiro e acende a mexa de um canhão. O canhão dispara. Na
queda, a bala de canhão atinge a borda de um funil (a única concessão a
'rro em todo o cenário), rola em volta da borda algumas vezes e cai pelo fundo.
FIGURA 4-1
UMA MÁQUINA RUBE GOLDBERG.

EXAMINANDO O CONTEÚDO DA CAIXA 83


laindo do funil, a bala atinge uma alavanca, que dá partida a uma serra
ircular. A serra corta uma corda que sustentava um poste telefónico.
Vagarosamente, o poste começa a cair e, tarde demais, Chantecler descobre
ye o espetáculo fascinante foi montado às suas custas. VÍrando-se para
correr, a ponta do poste atinge sua cabeça, enterrando-o no chão como se
fosse um prego.
Basta pensar por um momento nesse sistema para perceber que a
máquina Rube Goldberg é irredutivelmente complexa. Trata-se de um
sistema isolado, composto de várias partes que interagem e contribuem para
a função básica. A remoção de qualquer uma dessas partes faria com que o
sistema deixasse de funcionar. Ao contrário dos exemplos de complexidade
irredutível discutidos nos capítulos anteriores a ratoeira, o cílio eucarió-
tico e o flagelo bacteriano , o sistema apresentado no desenho não é uma
peça isolada, na qual os componentes exercem forças opostas recíprocas ao
mesmo tempo. Em vez disso, ele é constituído de peças separadas, cada
uma das quais atua sucessivamente, uma após a outra, a fim de cumprir uma
função.
Uma vez que os componentes do sistema do desenho animado são
separados entre si no tempo e no espaço, apenas um deles (o poste
telefónico) concretiza o objetivo final do sistema (atingir a vítima na
cabeça). Contudo, a complexidade da estrutura não é reduzida por causa
disso, porque todos os seus componentes são necessários para descarregar
o golpe no momento e no lugar exatos. Se o mecanismo para provocar sua
queda não estivesse no lugar, Chantecler poderia andar o dia inteiro em
frente do poste e nada de mal lhe aconteceria.
Da mesma maneira que podemos capturar um rato com uma ratoeira de
cola, em vez de uma mecânica, há outros sistemas que poderiam desfechar
um golpe esmagador no pobre Chantecler. Poderíamos usar um bastão de
beisebol ou derrubar o poste com um machado, quando Chantecler estivesse
no lugar exato. Poderíamos usar uma bomba nuclear em vez de um poste
ou amarrar o cordão, preso à isca, diretamente a uma espingarda. Mas
nenhum desses outros sistemas é um precursor darwiniano do sistema usado
no desenho. Suponhamos, por exemplo, que o cordão estivesse amarrado
a uma nota de dólar e esta direto ao canhão, que mandaria o pobre galo pêlos
ares quando ele pegasse a isca. Para transformar esse sistema mais simples
no de maior complexidade do desenho, seria preciso reposicionar gradual-
mente o canhão, apontá-lo em uma direção diferente, retirar o cordão e
amarrá-lo ao bastão, e adicionar as demais peças. Evidentemente, contudo,
o sistema ficaria inativo durante a maior parte do tempo, de modo que uma
transformação darwiniana passo a passo não seria possível.
84 A CAIXA PRETA DE DARWIN
Os sistemas de Rube Goldberg sempre provocam uma boa risada, as
pessoas gostam de ver a engenhoca funcionando, e apreciam o humo
existente na aplicação de grande volume de engenhosidade a uma fínalida
de tola. Mas, às vezes, um sistema complicado é usado para uma fínalidadi
séria. Nesse caso, o humor desaparece, embora permaneça a admiração
pelas delicadas interações dos componentes.
Os bioquímicos modernos descobriram muitos sistemas Rube Goldberg
à medida que estudavam o funcionamento da vida na escala molecular.
Nesses sistemas, o cordão, o bastão, a bola, a serra, a pedra, a lixa, o fósforo,
o estopim, o canhão, a bala de canhão, o funil, a corda e o poste telefónico
do desenho animado são substituídos por proteínas com nomes intimida-
dores, tais como "antecedente da tromboplastina do plasma" ou "cininóge-
no de alto peso molecular". O equilíbrio interno e o funcionamento apurado,
contudo, são os mesmos.
Quando escalava as rochas das Ilhas Galápagos perseguindo os tenti-
lhões que acabariam por levar seu nome, Charles Darwin deve ter cortadc
um dedo ou ralado um joelho sem querer. Jovem aventureiro como era
provavelmente não deu nenhuma atenção ao pequeno filete de sangue qu(
escorreu. A dor era algo inevitável para o intrépido explorador de ilhas, (
tinha de ser suportada com paciência se quisesse realizar um bom trabalho
Por fim, o sangramento parou e o corte cicatrizou. Mesmo que tivess(
notado, Darwin não tinha como especular sobre o que estava acontecendo
Ele não dispunha de informações suficientes sequer para tecer conjectura;
quanto ao mecanismo básico da formação de coágulos. A descoberta di
estrutura das moléculas da vida ainda estava a mais de um século no futuro
Darwin foi um gigante intelectual e grande inovador, mas ninguém pod
adivinhar o futuro, especialmente nos seus detalhes de importância crítica
O sangue se comporta de maneira peculiar. Quando o recipiente de un
líquido como uma caixa de papelão de leite ou um tanque cheio d
gasolina começa a vazar, o fluido escorre até acabar. A taxa de saíd;
depende da densidade do líquido (melado por exemplo, escorrerá mais len
lamente que álcool), mas, no fim, todo líquido escoa. Nenhum processe
ativo resiste a esse fato. Em contraste, quando uma pessoa sofre um corte, (
sangramento continua apenas por um curto espaço de tempo, até que s
forme um coágulo para interromper o fluxo. O coágulo endurece e o corti
sara. Aformação de coágulo do sangue parece algo tão banal que a maiorii
das pessoas quase nem pensa nisso. A investigação bioquímica, no entanto
EXAMINANDO O CONTEÚDO DA CAIXA 85
demonstrou que a coagulação do sangue é muito complexa; é um sistema de
entrelaçamento intricado, constituído de dezenas de partes interdependen-
tes de proteínas. Se apenas um entre a grande quantidade desses compo-
nentes estiver ausente ou apresentar defeitos importantes, o sistema pára de
funcionar: o sangue não coagula no momento ou no lugar adequados.
Algumas tarefas deixam pouca margem para erro. Para mim, por exem-
plo, a parte mais assustadora de uma viagem aérea é a aterrissagem. Grande
parte desse medo tem origem no fato de saber que o avião vai passar
raspando por cima de casas ou árvores, que há muitas vezes perto de aero-
portos, e de saber também que ele tem de parar antes do fim da pista. Há
alguns anos, no aeroporto LaGuardia, um avião não conseguiu parar a
tempo, e mergulhou no estreito de Long Island, provocando a morte de
muitas pessoas; as manchetes dos jornais frequentemente noticiam aci-
dentes que ocorrem pouco antes de o aparelho deixar a pista. Se as pistas
tivessem trinta quilómetros de extensão, e não apenas um quilómetro e
meio, eu, pelo menos, me sentiria muito mais seguro.
A aterrissagem é apenas um exemplo de um sistema que tem de funcio-
nar dentro de restrições muito rígidas para se evitar um desastre. Até mesmo
os irmãos Wright tiveram que se preocupar com uma aterrissagem correta.
Se a atemsagem for um pouco antes ou um pouco depois do momento certo,
ou se uma manobra for levemente mais alta ou baixa, avião e passageiros
correm sérios riscos. Imagine, porém, a dificuldade ainda maior de fazer
uma aterrissagem com piloto automático sem nenhum agente consciente
para nos guiar! A coagulação do sangue é feita com piloto automático, e o
processo exige precisão extrema. Quando um sistema pressurizado de
circulação de sangue é perfurado, um coágulo tem de se formar rapida-
mente, ou o animal sangrará até a morte. Se o sangue coagular no tempo
ou lugar errados, porém, o coágulo pode bloquear a circulação, como
acontece nos ataques cardíacos e nos derrames. Além disso, o coágulo tem
de interromper o sangramento ao longo de toda a extensão do corte,
fechando-o por completo. E mais, tem de se limitar ao corte ou então todo
o sistema sanguíneo do animal poderia se solidificar, matando-o. Em
consequência, a coagulação tem que ser controlada de forma precisa para
que o coágulo se forme apenas quando e onde for necessário.
Nas páginas seguintes, o leitor conhecerá as dezenas de proteínas que
participam do jogo da coagulação do sangue e aprenderá alguma coisa so-
bre seus respectivos papéis. Como acontece em equipes esportivas, al-
86 A CAIXA PRETA DE DARWIN
guns jogadores têm nomes estranhos. Não se preocupe se os nomes ou
funções da proteína desaparecerem rapidamente da mente o objetivo
dessa discussão não é decorar trivialidades. (Além do mais, os nomes e as
relações são mostrados na Figura 4-3.) O objetivo, na verdade, é ajudá-lo a
compreender a complexidade da coagulação e concluir se ela poderia ter
surgido por um processo gradual.
Q Cerca de 2% a 3% da proteína existente no plasma sanguíneo (a parte
que sobra depois de removidas as células vermelhas) consistem de um
complexo de proteínas denominado fibrinogênio.1 O nome fibrinogênio
é fácil de lembrar porque a proteína produz as "fibras" que formam o
coágulo. Ainda assim, ele é apenas material potencial de coagulação. Tal
como o poste telefónico antes de cair na história de Chantecler, o
fibrinogênio é uma arma à espera de ser disparada. Quase todas as demais
proteínas envolvidas na coagulação controlam a sincronização e o
posicionamento do coágulo. Esse também lembra nosso exemplo do
desenho animado: todos os componentes, exceto o próprio poste, eram
necessários para controlar sua queda.
O fibrinogênio é um composto de seis sequências de proteínas, con-
tendo pares geminados de três proteínas diferentes. A microscopia ele-
trônica revelou que o fibrinogênio é uma molécula em forma de bastão,
com duas protuberâncias em cada extremidade e uma única protuberân-
cia redonda no meio. O fibrinogênio, portanto, parece um par de halteres,
com um conjunto extra de pesos no meio da barra de levantamento.
O fibrinogênio, em geral, apresenta-se diluído em plasma, tal como
o sal dissolvido na água do mar. Flutua de um lado para o outro, cuidando
de sua própria vida, até que um corte ou contusão provocam sangramen-
to. Outra proteína, a trombina, corta e retira várias pequenas peças de
dois dos três pares de cadeias de proteínas no fibrinogênio. A proteína
podada nesse momento denominada fibrina2 apresenta pedaços
pegajosos expostos em sua superfície, que foram cobertos pelas partes
cortadas e separadas. Os retalhos pegajosos são exatamente complemen-
tares apartes de outras moléculas de fibrina. As formas complementares
permitem que grande quantidade de fibrinas se junte, da mesma forma
que as latas de tubulina-atum do Capítulo 3. Assim como a tubulina não
se agrega para formar pedaços aleatórios, mas sim formar uma chaminé,
tampouco as fibrinas se colam ao acaso. Devido ao formato da molécula
de fibrina, criam-se longos filamentos que se cruzam e (de maneira muito
parecida com uma rede de pesca), fabricam uma bonita malha de proteína
que aprisiona as células sanguíneas. Esse é o coágulo inicial (Figura 4-2).
EXAMINANDO O CONTEÚDO DA CAIXA 87
FIGURA 4-2
CÉLULA SANGUÍNEA CAPTURADA NA MALHA DE PROTEÍNAS DE FIBRINA DE UM
COÁGULO.

Manfred KagePeter Arnold Inc.


A malha cobre uma grande área com um mínimo de proteína; se for-
masse simplesmente uma massa informe, seria preciso muito mais
proteína para fechá-la.
A trombina, que corta e separa pedaços do fíbrinogênio, parece-se
com a serra circular do desenho animado de Chantecler. Tal como a serra,
a trombina põe em movimento a etapa final de um processo controlado.
Mas o que aconteceria se a serra circular funcionasse sem parar, sem
necessidade de outros passos para acioná-la? Nesse caso, ela cortaria
imediatamente a corda que mantém em pé o poste telefónico, muito antes
de Chantecler aparecer por ali. Da mesma forma, se as únicas proteínas
envolvidas na coagulação do sangue fossem a trombina e o fíbrinogênio,

não haveria controle no processo. A trombina rapidamente cortaria todr


o fíbrinogênio para fabricar fibrina, e um coágulo maciço se formarii
em todo o sistema circulatório do animal, solidificando-o. Ao contrarie
de personagens de desenho animado, animais de verdade morrerian
logo. Afim de evitar esse final infeliz, um organismo tem de controlar i
atividade da trombina.
A cascata
Q Normalmente, o corpo armazena enzimas (proteínas que catalisar
uma reação química, como a clivagem do fíbrinogênio) em form
inativa, para uso posterior. As formas inativas são chamadas de proen-
zimas. Ao ser recebido um sinal de que certa enzima é necessária, i
proenzima correspondente é ativada para produzir a enzima madura
Como acontece com a conversão do fíbrinogênio em fibrina, as proen
zimas frequentemente são ativadas ao se cortar um pedaço de proenzim;
que está bloqueando uma área crítica. Essa estratégia é comum con
enzimas digestivas. Grandes quantidades podem ser armazenadas sob;
forma de proenzimas inativas e, em seguida, ativadas com muita rapide;
quando chega a hora da boa refeição seguinte.
A trombina existe, inicialmente, em sua forma inativa, a protrombina
Uma vez que está inativa, ela não pode dividir o fíbrinogênio e o anima
é salvo da morte por coagulação maciça, inadequada. Ainda assim, (
dilema do controle permanece. Se a serra do desenho animado estivessi
desativada, o poste telefónico não cairia no momento errado. Se nad;
ligasse a serra, contudo, ela tampouco cortaria a corda e o poste tambér
não cairia no momento certo. Se o fíbrinogênio e a protrombina fossen.
as únicas proteínas no caminho da coagulação do sangue, nosso animal,
mais uma vez, estaria em má situação. Quando fosse cortada, a protrom-
bina simplesmente flutuaria impotente ao lado do fíbrinogênio, enquanto
o animal sangraria até a morte. Uma vez que a protrombina não pod(
dividir o fíbrinogênio e transformá-lo em fibrina, alguma coisa é neces-
sária para ativá-la. Talvez o leitor possa compreender agora por que c
sistema de coagulação do sangue é chamado de cascata um sistemí
em que um componente ativa outro, que ativa um terceiro, e assim poi
diante. Já que as coisas estão começando a ficar complicadas, serí
bastante útil ao leitor recorrer à Figura 4-3 para não se perder nessí
análise.
Uma proteína denominada fator de Stuart divide ao meio a protrom-
bina, transformando-a em trombina ativa, que pode então dividir ao meie
EXAMINANDO O CONTEÚDO DA CAIXA
FIGURA 4-3
PROTEÍNAS CUJOS NOMES ESTÃO EM TIPO
NORMAL FAZEM
CUJOS NOMES SÃO APRESENTADOS EM ITÁLICO PARTICIPAM DOS PROCESSOS DE
PREVENÇÃO, LOCALIZAÇÃO OU REMOÇÃO DOS COÁGULOS. AS PONTAS DAS FLECHAS
TERMINANDO EM U MA BARRA IN DICAM AAÇÃODE PROTEÍNAS PARA IMPEDIR, LOCALIZAR
OU REMOVER COÁGULOS.
Superfície
l do corte l
| Callcreína Pré-calicretna
Fator Hageman-.-Fator Hageman*
|TConvertina Pré-convertina
Fator Christmas »-Fator Christmasy]
r Fator
Anti-hemofillco AntI-hemofílIco**'Ide Tecido
____ Palor Stuart '* pator Stuarft*- Antitrombina
ProacelerInat-Acelerina'N. ..
t Protrombina 'Trombina
Fibrinogênto - Fibrina (coágulo mole)
Fibrina
(coágulo duro) l
Plasmina aS-antiplasmina
t-PA
plasminogênio
o fibrinogênio, transformando-o em fibrina, para formar o coágulo
sanguíneo.3 Infelizmente, como o leitor deve ter adivinhado, se o fator
de Stuart, a protrombina e o fibrinogênio fossem as únicas proteínas
coagulantes, o fator de Stuart geraria rapidamente uma cascata, coagu-
lando todo o sangue do organismo. O fator, portanto, também existe em
forma inativa, que precisa, antes de tudo, ser ativada.

90 A CAIXA PRETA DE DARWIN


Neste ponto ocorre uma certa peculiaridade na construção de noss
cenário galinha-ovo. Mesmo ativado, o fator de Stuart não pode acion
a protrombina. O fator de Stuart e a protrombina podem ser misturad
em um tubo de ensaio, durante mais tempo do que seria necessário par
um animal de grande porte sangrar até a morte, sem qualquer produçãi
visível de trombina. Acontece que outra proteína, denominada acelerina
é necessária para aumentar a atividade do fator de Stuart. A dupi
dinâmica a acelerina e o fator de Stuart ativado dividem
protrombina com velocidade suficiente para fazer algum bem ao anima
que sangra. De modo que, nesse caso, precisamos de duas proteína."
separadas para ativar uma proenzima.
Sim, a acelerina também existe inicialmente em uma forma inativa
denominada proacelerina (suspiro). E o que é que a ativa? A trombina
A trombina, porém, como já vimos, está mais abaixo na cascata contro
ladora do que a proacelerina. Assim, a ação da trombina, de controlar;
produção da acelerina, parece com uma neta que controla a produção di
uma avó. Ainda assim, devido à taxa muito baixa da divisão da protrom-
bina pelo fator de Stuart, parece que há sempre um traço de trombina na
corrente sanguínea. A coagulação do sangue, portanto, é autocatalítica,
porque as proteínas na cascata aceleram a produção de um número maior
das mesmas proteínas.
Precisamos recuar um pouco nesse ponto porque, como vimos, a
protrombina não pode, da forma inicialmente produzida pela célula, ser
transformada em trombina, mesmo na presença do fator de Stuart ativado
e da acelerina. A protrombina tem que ser antes modificada, processo
(não aparece na Figura 4-2) que acontece quando ela adquire dez
resíduos específicos de aminoácidos, denominados resíduos de glutama-
to (Glu), que são transformados em resíduos y-carboxiglutamato (Gla).
Amodifícação pode ser comparada a colocar a mandíbula inferior sobre
a mandíbula superior de um crânio. A estrutura completa pode morder e
segurar o objeto mordido; sem a mandíbula inferior, o crânio não poderia
prender coisa alguma. No caso da protrombina, os resíduos Gla "mor-
dem" (ou seguram) o cálcio, permitindo que a protrombina se cole às
superfícies das células. E só o complexo modificado pelo cálcio, intacto,
ligado a uma membrana de célula, pode ser dividido pelo fator de Stuart
ativado e pela acelerina, a fim de produzir trombina.
A modificação da protrombina não acontece por acaso. Tal como
quase todas as reaçôes bioquímicas, ela requer catálise através de uma
enzima específica. Além da enzima, porém, a conversão do Glu em Gla
precisa de outro componente: a vitamina k. A vitamina K não é uma
proteína, mas uma molécula pequena, como a ll-cü-retinal (descrita no
Capítulo l), necessária à visão. Tal como uma arma de fogo que precisa
de balas, a enzima que transforma o Glu em Gla precisa de vitamina K
para funcionar. Um tipo de veneno para ratos baseia-se no papel desem-
penhado pela vitamina K na coagulação do sangue. O veneno sintético,
denominado "warfarina" (no original warfarin, por causa do Wisconsin
Alumni Research Fund, que recebe uma percentagem dos lucros com
sua venda), foi produzido para parecer-se com a vitamina Kpara a enzima
que o usa. Na presença da warfarina, a enzima não pode modificar a
protrombina. Quando ratos comem alimentos envenenados com warfa-
rina, a protrombina não é modificada nem dividida, e o animal envene-
nado sangra até a morte.
Mas, parece que ainda não fizemos muito progresso temos que
voltar atrás agora e perguntar o que ativa o fator de Stuart. Descobrimos
que ele pode ser ativado por dois caminhos diferentes, denominados vias
intrínseca e extrínseca. Na primeira, todas as proteínas necessárias à
coagulação estão contidas no plasma sanguíneo; na segunda, há apenas
algumas proteínas coagulantes nas células. Mas examinemos primeiro
a via intrínseca. (Por favor, siga nosso raciocínio usando a Figura 4-3.)
Quando um animal sofre um corte, uma proteína denominada fator
de Hageman cola-se à superfície das células próximas ao ferimento. O
fator de Hageman é, em seguida, dividido por uma proteína chamada
hmk, a fim de gerar o fator de Hageman ativado. Imediatamente, esse
fator converte outra proteína, denominada pré-calicreína, em sua forma
ativa, a calicreína. A calicreína ajuda a hmk a acelerar a conversão de
mais fator de Hageman em sua forma ativa. O fator de Hageman ativado
e a hmk juntos transformam em seguida outra proteína, denominada pta,
em sua forma ativa. apta ativada, por seu lado, juntamente com a forma
ativada de outra proteína (discutida abaixo), chamada convertina, mu-
dam uma proteína chamada fator de Christmas para sua forma ativa. Por
fim, o fator de Christmas ativado, juntamente com o fator anti-hemofí-
lico (que é ativado pela trombina de forma semelhante ao que acontece
com a proacelerina), muda o fator de Stuart e lhe dá sua forma ativa.
Tal como a via intrínseca, a extrínseca também é uma cascata. Come-
ça quando uma proteína chamada proconvertina é transformada em con-
vertina pelo fator de Hageman ativado e pela trombina. Na presença de
outra proteína, o fator de tecido, a convertina transforma o fator de Stuart
em sua forma ativa. O fator de tecido, no entanto, aparece apenas no lado
externo de células que não estão habitualmente em contato com o sangue.
Só quando o ferimento põe o tecido em contato com o sangue, portanto,
é que se inicia a via extrínseca. (O corte desempenha um papel semelhan-
te ao de Chantecler quando apanha no chão uma nota de dólar. E o evento
iniciador algo fora do mecanismo de cascata em si.)
As vias intrínseca e extrínseca se cruzam em vários pontos. O fato:
de Hageman, ativado pela via intrínseca, pode mudar a proconvertina di
via extrínseca. Aconvertinapode em seguida realimentaravia intrínseci
para ajudar a pta ativada a ativar o fator de Christmas. A trombina em s
pode desencadear ambos os ramos da cascata da coagulação ao ativar (
fator anti-hemofílico, que é necessário para ajudar o fator de Christma;
ativado na conversão do fator de Stuart em sua forma ativa e também a(
ativar a proconvertina. |_]
Acompanhar em detalhes uma descrição do sistema de coagulação d(
sangue nos faz ansiar pela simplicidade de uma máquina Rube Goldberg.
Há algumas diferenças conceituais entre a engenhoca do desenho animado
de Chantecler e o sistema de coagulação do sangue da vida real; essa;
diferenças enfatizam a maior complexidade do sistema bioquímico. C
contraste mais importante encontra-se no fato de que a cascata da coagula
cão tem de ser desligada em algum ponto, antes de o organismo tomar-s
inteiramente sólido (o que será discutido logo em seguida). A segund;
diferença é que a via de controle da coagulação se bifurca. Potencialmente
portanto, há duas maneiras possíveis de desencadear a coagulação.
importância relativa das duas vias em organismos vivos ainda é muitc
obscura. Muitos dos experimentos com a coagulação são difíceis de fazer
algumas das proteínas em especial as que tomam parte nas etapas iniciai;
do caminho são encontradas no sangue apenas em volumes ínfimos
Trezentos e oitenta litros de sangue, por exemplo, contêm somente cerca d
0,028g do fator anti-hemofílico. Além disso, uma vez que as etapas iniciai;
da coagulação se realimentam para gerar um número maior das proteína;
ativadoras iniciais, muitas vezes é difícil esclarecer exatamente quem esti
ativando quem.
Há ainda uma importante semelhança conceituai entre o sistema d(
ataque de Chantecler e a via da coagulação: ambos são irredutivelmenti
complexos. Deixando de lado o sistema antes da bifurcação na via, etapi
em que alguns detalhes são menos conhecidos, o sistema de coagulação
ajusta-se à definição de complexidade irredutível. Isto é, trata-se de un
sistema único, composto de várias partes interatuantes que contribuem pari
EXAMINANDO O CONTEÚDO DA CAIXA 93
a função básica e no qual a remoção de qualquer uma delas fará com que o
sistema deixe de funcionar eficazmente. Afünção do sistema de coagulação
é formar uma barreira sólida, na ocasião e local apropriados, que possa deter
o sangramento de um vaso lesionado. Os componentes do sistema (depois
da bifurcação) são o fibrinogênio, a protrombina, o fator de Stuart e a
proacelerina. Da mesma maneira que nenhuma das partes do sistema de
Qiantecler é usada para nada mais que controlar a queda do poste telefónico,
nenhuma das proteínas da cascata é usada para outra coisa que não controlar
a formação do coágulo sanguíneo. Ainda assim, na ausência de qualquer
um dos componentes o sangue não coagula e o sistema entra em pane.
Há outras maneiras de deter o sangramento de ferimentos, mas elas não
são, em absoluto, precursoras passo a passo da cascata de coagulação. O
corpo, por exemplo, pode contrair os vasos sanguíneos perto de um corte,
a fim de ajudar a estancar o sangramento. Além disso, células sanguíneas
chamadas plaquetas colam-se'à área em volta do corte, ajudando a tampar
pequenos ferimentos. Esses sistemas, no entanto, não podem ser transfor-
mados gradualmente em um sistema de coagulação, da mesma forma que
uma ratoeira de cola não pode ser transformada em uma ratoeira mecânica.
O sistema de coagulação mais simples imaginável poderia ser apenas
uma única proteína, que se juntasse aleatoriamente a outras quando o orga-
nismo fosse cortado. Podemos comparar isso a um poste telefónico que, ser-
rado de um lado ao outro e com equilíbrio precário, depende de leves vi-
brações do solo para se deslocar e cair sobre Chantecler quando este passar
por ali. O vento ou outros fatores, contudo, poderiam derrubar, com
facilidade, o poste quando o galo nem estivesse por perto. Além do mais, o
poste não está apontado para qualquer direção particular (como na direção
da isca) onde Chantecler provavelmente estaria. De forma análoga, o
sistema de coagulação simplista seria desencadeado incorretamente, cau-
sando danos aleatórios e desperdiçando recursos. Nenhum desses "sis-
temas" simplificados, o do desenho animado e o de coagulação, atenderiam
ao critério de função mínima. Nos sistemas Rube Goldberg, o problema
não é a atividade final (a queda do poste, a formação do coágulo) mas,
sim, o sistema de controle.
Poderíamos imaginar um sistema de coagulação um pouco mais simples
do que o que existe de fato um sistema em que, digamos, o fator de
Stuart, após a ativação pelo resto da cascata, cortaria diretamente o fibrino-
gênio para formar fibrina, ignorando a trombina. Deixando de lado por um
momento questões de controle e regulagem da formação do coágulo,
podemos, pensando um pouco, concluir que um sistema ligeiramente
simplicado como esse não pode mudar passo a passo e transformar-se em
um sistema mais complexo, completo. Se uma nova proteína fosse inserida
no sistema destituído de trombina, ela o acionaria de imediato o que
resultaria em morte rápida ou nada faria, e portanto não teria motivo para
ser selecionada. Devido à natureza da cascata, uma nova proteína teria de sei
imediatamente controlada. Desde o início, uma nova etapa na cascata
exigiria uma proenzima e também uma enzima ativadora para acionar a
proenzima no local e ocasião correios. Uma vez que cada etapa requei
necessariamente várias partes, não apenas o sistema de coagulação é de
complexidade irredutível cada etapa na via também o é.
Acho que um canal de navegação constitui uma boa analogia com esse
aspecto do sistema de coagulação. O canal do Panamá permite que navios
cruzem o istmo do oceano Pacífico ao mar do Caribe. Se a terra é mais alta
que o nível do mar, a água existente numa comporta ergue o navio a um
nível no qual possa navegar por algum tempo. Depois outra comporta ergue
o navio ao nível seguinte, e a anterior fecha o outro lado para abaixá-lc
novamente ao nível do mar. Em cada comporta há uma portão que contém
a água enquanto o navio é erguido ou rebaixado; há ainda uma eclusa, ou
bomba, que drena ou enche a comporta. Desde o início, todas as comportas
precisam ter as mesmas características portão e eclusa ou nãc
funcionam. Em consequência, todas as comportas ao longo do canal sãc
irredutivelmente complexas. De forma semelhante, todos os pontos de
controle na cascata da coagulação precisam de uma proenzima inativa e de
uma enzima separada para ativá-la.
ainda não acabou
1_] Logo que começa a coagulação, o que a impede de continuar até qu
todo o sangue do animal se solidifique? Acoagulação é limitada ao loca
do ferimento de várias maneiras. (Por favor, volte à Figura 4-3.) En
primeiro lugar, uma proteína plasmática denominada antitrombina liga
se às formas ativas (mas não às inativas) da maioria das proteína;
coagulantes e as desativa. A antitrombina é em si relativamente inativa
a menos que se ligue a uma substância chamada heparina. A heparin;
ocorre no interior das células e em vasos sanguíneos não danificados.
segunda maneira pela qual os coágulos são localizados dá-se através d;
ação da proteína c. Depois de ativada pela trombina, a proteína c destro
a acelerina e o fator anti-hemofílico ativado. Finalmente, uma proteín;
chamada trombomodulina cobre as superfícies das células no lad
interno dos vasos sanguíneos. A trombomodulina prende a trombina
EXAMINANDO O CONTEÚDO DA CAIXA 95
tomando-a menos capaz de cortar o fíbrinogênio e, ao mesmo tempo,
aumentando sua capacidade de ativar a proteína C.
Logo que se forma, o coágulo é muito frágil: se a área lesionada sofrer
uma pancada, o coágulo pode ser facilmente dissolvido e o sangramento
recomeça. A fim de impedir isso, o corpo dispõe de um método para
reforçar o coágulo logo que esse é formado. Fibrina agregada é "amar-
rada" por uma proteína ativada chamada fsf (iniciais defibrin stabilizing
factor "fator estabilizador da fibrina"), que forma elos químicos
cruzados entre diferentes moléculas de fibrina. No fim, contudo, após a
cura do ferimento, o coágulo tem de ser removido. Uma proteína
denominada plasmina age como uma tesoura para cortar especificamen-
te os coágulos de fibrina. Por sorte, a plasmina não atua sobre o fíbrino-
gênio. A plasmina não pode agir rápido demais, contudo, ou o ferimento
não teria tempo suficiente para sarar de todo. Inicialmente, portanto, ela
ocorre na forma inativa denominada plasminogênio. A conversão do
plasminogênio em plasmina é catalisada por uma proteína denominada
t-PA. Há ainda outras proteínas que controlam a dissolução do coágulo,
incluindo a a2-antiplasmina, que se liga à plasmina, impedindo-a de
destruir os coágulos de fibrina. Q
A máquina do desenho animado que deu a pancada na cabeça do
Chantecler dependia criticamente do alinhamento, sincronização e es-
trutura precisos de muitos componentes. Se o cordão preso à nota de dólar
fosse longo demais, ou o canhão estivesse desalinhado, todo o sistema
fracassaria. Da mesma maneira, a cascata de coagulação depende critica-
mente da sincronização e velocidade com que ocorrem as diferentes
reações. Um animal poderia se solidificar se a trombina ativasse a procon-
vertina na ocasião errada; e ele poderia sangrar até a morte se a proace-
lerina ou o fator anti-hemofílico fossem ativados devagar demais. Um
organismo desapareceria dos registros da história se a trombina ativasse
a proteína c muito mais rapidamente do que ativasse a proacelerina, ou
se a antitrombina desativasse o fator de Stuart com a mesma rapidez com
que ele fosse formado. Se o plasminogênio fosse ativado logo após a
formação do coágulo, ele o Dissolveria rapidamente, fechando a via.
O fortalecimento, formação, limitação e remoção de um coágulo san-
guíneo constituem um sistema biológico integrado e problemas com com-
ponentes isolados podem levá-lo a parar de funcionar. A falta de alguns
fatores coagulantes no sangue, ou a produção de fatores defeituosos,
resultam frequentemente em problemas graves de saúde ou em morte. A
forma mais comum de hemofilia tem origem em uma deficiência do fator

96 A CAIXA PRETA DE DARWIN


anti-hemofílico, que ajuda o fator de Christmas ativado na conversão d(
fator de Stuart em sua forma ativa. A falta do fator de Christmas é a segundi
causa mais comum da hemofília. Graves problemas de saúde tambérr
podem surgir se outras proteínas na via da coagulação forem defeituosas
embora esses casos sejam menos comuns. Problemas de sangramentc
acompanham também deficiências em fsf, vitamina K, ou de a2-antiplas
mina, que não participam diretamente da coagulação. Além disso, a falta di
proteína c causa a morte de crianças devido à ocorrência de coágulo;
numerosos e desnecessários.
Será possível que esse sistema ultracomplexo tenha evoluído de acordo com
a teoria darwiniana? Vários cientistas dedicaram-se com afinco a especular
sobre como a coagulação do sangue deve ter evoluído. Na seção seguinte,
o leitor verá qual é a explicação fornecida pêlos mais recentes estudos sobre
a coagulação na literatura científica. Antes, porém, temos de esmiuçar
alguns detalhes.
Em princípios da década de 1960, notou-se que algumas proteínas têm
sequências de aminoácidos semelhantes às de outras proteínas. Supo-
nhamos, por exemplo, que os dez primeiros aminoácidos em uma sequência
são anvlegkiis e, em uma segunda proteína, anlldgkivs. Essas duas
sequências são iguais em sete posições e diferentes em três. Em algumas
proteínas, as sequências podem ser semelhantes em mais de cem posições
de aminoácidos. Afim de explicar a similitude de duas proteínas, teorizou-se
que, no passado, um gene foi de alguma forma duplicado e que, ao longo
do tempo, as duas cópias acumularam independentemente mudanças (mu-
tações) em suas sequências.4 Após certo tempo, haveria duas proteínas com
sequências semelhantes, mas não idênticas.
O rei do Sião certa vez pediu aos sábios de sua corte um provérbio que
fosse apropriado para todas as ocasiões. Eles sugeriram: "Até isso passará."
Bem, em bioquímica, é igualmente apropriado dizer em todas as situações:
"As coisas são mais complicadas do que parecem." Em meados da década
de 1970, demonstrou-se que os genes podiam existir em fragmentos. Isto
é, a parte do adn que codificava a parte esquerda de uma proteína poderia
ser separada, ao longo da sequência, das partes que codificavam o meio, e
que essas podiam ser separadas do adn que codificava o lado direito. Era
como se procurássemos a palavra carnaval no dicionário e a encontrás-
semos consignada como "bkcafjmavckjvalksy"'. Um tipo de gene poderia
estar inteiro; outro, dividido em dezenas de fragmentos.
Aobservação de genes divididos sugeriu a hipótese de que talvez duas novas
proteínas poderiam ser feitas embaralhando-se os fragmentos de adn de genes
que codificam partes de velhas proteínas como cartas retiradas de várias
pilhas para formar novos arranjos. Em apoio a essa hipótese, seus defensores
mencionam as semelhanças nas sequências de aminoácidos e as formas de
fragmentos separados (chamados domínios) de proteínas diferentes.
As proteínas da cascata da coagulação sanguínea muitas vezes são
usadas como prova desse embaralhamento. Algumas regiões das proteínas
da cascata, codificadas por diferentes partes de genes, têm semelhanças em
suas sequências de aminoácidos com outras regiões da mesma proteína
isso é, são parecidas com partes delas mesmas. Também há similaridades
entre regiões de proteínas diferentes da cascata. Aproconvertina, o fator de
Christmas, o fator de Stuart e a protrombina, por exemplo, possuem uma
região aproximadamente semelhante de duas sequências de aminoácidos.
Além disso, em todas essas proteínas, a sequência é modificada pela
vitamina K. E ainda, as regiões são semelhantes em sequência às de outras
proteínas (que não participam de forma alguma da coagulação do sangue)
que também são modificadas pela vitamina K.
As semelhanças de sequências são óbvias e não podem ser contestadas.
Em si mesma, contudo, a hipótese de duplicação de genes e embara-
lhamento nada diz sobre como qualquer proteína particular ou sistema de
proteínas surgiu se lenta ou subitamente, se por seleção natural ou por
algum outro mecanismo. Lembre-se, uma mola de ratoeira pode, de certa
forma, parecer-se com uma mola de relógio, e uma alavanca pode lembrar
um martelo de ratoeira, mas as semelhanças nada dizem sobre como a
ratoeira é produzida. Para sustentar que um sistema se desenvolveu gra-
dualmente através de um mecanismo darwiniano, temos de demonstrar que
a função do sistema poderia "ter sido formada por numerosas, sucessivas e
ligeiras modificações".
A ULTIMA PALAVRA
Agora estamos prontos para seguir em frente. Nesta seção, vamos reprodu-
zir uma tentativa de explicação evolucionista da coagulação oferecida por
Russell Doolittle. Sua hipótese consiste de uma série de etapas nas quais as
proteínas da coagulação surgem uma após a outra. Mas, como demons-
traremos na seçâo seguinte, a explicação é completamente inadequada
porque não dá razões para o aparecimento das proteínas, não tenta calcular
a probabilidade do aparecimento delas, tampouco procura estimar as pro-
priedades das novas proteínas.
Russell Doolittie, professor de bioquímica do Center for Molecular
Genetics, da Universidade da Califórnia, em San Diego, é a figura mais
ilustre entre os interessados na evolução da cascata da coagulação sanguí-
nea. Desde a apresentação de sua tese de PhD em Harvard, "A bioquímica
comparativa da coagulação do sangue" (1961), o professor Doolittie tem
estudado os sistemas de coagulação de organismos diferentes, "mais sim-
ples", na esperança de que isso leve à compreensão de como surgiu o sistema
dos mamíferos. Recentemente, em artigo publicado na revista Thrombosis
and Haemostasis, Doolittie passou em revista os conhecimentos atuais
sobre o assunto.5 A revista é dirigida a cientistas e doutores em medicina
que trabalham com vários aspectos da coagulação do sangue. Basicamente,
o público leitor da revista é formado de pessoas que sabem mais a respeito
da coagulação do sangue do que qualquer outro na terra.
Doolittie inicia seu artigo fazendo a grande pergunta: "Como, em nome
de Deus, esse processo complexo e delicadamente equilibrado evoluiu?...
O paradoxo é que, se todas as proteínas dependem de ativação por outra,
de que modo o sistema pode ter surgido? Que uso teria qualquer parte do
esquema sem todo o conjunto?"
Essas perguntas formam o cerne da indagação deste livro. Vale a pena
transcrever em certa extensão o artigo de Doolittle. (Será útil ao leitor
consultar a Figura 4-3.) Mudamos alguns termos técnicos na citação, com
vistas a torná-la mais acessível a um público leitor não-especializado.
A coagulação do sangue é um fenómeno delicadamente equilibrado, que
envolve proteases, antiproteases e substratos de protease. Em termos gerais,
cada ação progressiva gera alguma resposta regressiva. Várias metáforas
podem ser aplicadas a essa evolução gradual: ação e reação, ponto e
contraponto, ou boas e más notícias. A minha favorita, porém, é yin e yang.
Na antiga cosmologia chinesa, tudo o que existe é resultado da fusão dos
princípios opostos yin e yang. Yang, o princípio masculino, abrange ativi-
dade, altura, calor, luz e secura. Yin, o contraponto feminino, personifica
passividade, profundidade, frio, escuridão e umidade. O casamento de
ambos produz a essência real de todas as coisas. Mantendo-se em mente que
isso é apenas uma metáfora, consideremos o seguinte cenário de yin e yang
para a evolução da coagulação em vertebrados. Arbitrariamente, designei
as enzimas e proenzimas como yang e as não-enzimas como yin,
Q Yin: o fator de tecido (tf) aparece como resultado da duplicação de
um gene [de outra proteína] que se liga a domínios egf. O novo produto do
gene só entra em contato com o sangue, ou hemolinfa, após dano ao tecido.
Yang: a protrombina aparece em um antigo disfarce, com o(s) domínio(s)
egf anexados, resultado de uma... duplicação de gene por protease e...
embaralhamento. O domínio egf serve como local para combinação e
ativação pelo tf exposto.
Yin: um receptor de trombina é modelado em virtude da duplicação de
um gene para uma região de proteína que se ligará a uma membrana de
célula. A divisão efetuada pela protrombina ativada pelo tf influencia a
contratilidade ou a aglutinação da célula.
Yin, novamente: nasce o fibrinogênio, uma proteína bastarda derivada de
um pai sensível à trombina [alongado] e uma proteína com uma estrutura
compacta, a mãe.
Yin, novamente: a antitrombina m aparece. E produto da duplicação de
uma proteína com estrutura geral semelhante.
Yang: o plasminogênio é gerado a partir do vasto estoque de... proteases
já disponíveis. Aparece com... domínios que podem ligar-se à fibrina. Sua
atividade, por ligação a proteínas bacterianas... reflete um papel anterior
como agente antibacteriano.
Yin: a antiplasmina surge da duplicação e modificação de uma proteína
com estrutura geral semelhante, provavelmente a antitrombina.
Yin e Yang: uma trombina ativável [proteína de ligação] é liberada.
Yang: surge o ativador de plasminogênio de tecido (tpa). Domínios
embaralhados de várias maneiras permitem que ele se ligue a várias subs-
tâncias, incluindo a fibrina.
Casamento: modificação da protrombina pela aquisição de um domínio-
"gla". É conferida a capacidade de ligar-se ao cálcio e a superfícies es-
pecíficas [negativamente carregadas].
Yin: aparecimento da proacelerina6 como resultado da duplicação do gene
de uma proteína com estrutura geral semelhante e aquisição de alguns outros
[fragmentos de genes].
Yang: o fator de Stuart aparece, sendo uma duplicata da protrombina re-
centemente ungida pelo Gla. Sua capacidade de ligar-se à proacelerina pode
produzir... ativação da protrombina, independentemente da... ativação pelo
TF.
Yang, novamente: a proconvertina é duplicada a partir do fator de Stuart,
liberando protrombina para que se ligue melhor à fibrina. Quando combi-
nada com o fator de tecido, a proconvertina pode ativar, [cortando-o], o fator
de Stuart.
Yang, novamente: fator de Christmas a partir de fator de Stuart. Durante
certo período, ambos se ligam à proacelerina.
Yin: fator anti-hemofílico a partir da proacelerina. Adapta-se rapidamente
para interagir com o fator de Christmas.
Yang: a proteína c é genericamente derivada da protrombina. Desativa a

100 A CAIXA PRETA DE DARWIN


proacelerina e o fator anti-hemofílico mediante corte limitado.
Divórcio: a protrombina inicia uma troca [de fragmentos de genes] que í
deixa com domínios para ligar-se à fibrina, em lugar de seus domínios egf
que já não são necessários para interação com o tf. Q
Reservemos agora algum tempo para fazer um exame crítico do cenário de
professor Doolittle. O primeiro aspecto a notar é que não são citados fatores
causativos. O fator de tecido, por exemplo, "aparece", o fíbrinogênic
"nasce", a antiplasmina "surge", e assim por diante. O que, exatamente
poderíamos perguntar, causa todas essas inovações e liberações? Ao qu(
parece, Doolittle tem em mente um cenário darwiniano gradual, envolvendo
duplicação e recombinação não dirigidas, aleatórias, de fragmentos df
genes. Mas imagine quanta sorte seria necessária para conseguir os frag-
mentos certos de genes nos lugares certos. Os organismos eucarióticos teu
muitas peças de genes e, aparentemente, o processo que os troca é aleatório
Dessa maneira, criar uma nova proteína de coagulação mediante embara-
lhamento é como pegar ao acaso uma dezena de frases em uma enciclopédi;
na esperança de escrever um parágrafo coerente. O professor Doolittle nãc
se dá ao trabalho de calcular quantos "domínios variadamente embara-
lhados", incorretos, inativos, inúteis teriam de ser descartados antes de s
obter uma proteína com, digamos, uma atividade semelhante à do tpa.
A fim de tomar mais claro o problema, façamos um cálculo rápido
Considere-se que animais com cascatas de coagulação sanguínea têm cerc;
de dez mil genes, cada um dos quais se divide em média em três peças. Iss(
nos dá um total de trinta mil peças de genes. O tpa tem quatro diferente;
tipos de domínios.7 "Embaralhando-se variadamente", as probabilidades di
reunir esses quatro domínios8 são de trinta mil elevados à quarta potência
o que significa aproximadamente um décimo da décima oitava potência.
Ora, se uma loteria tivesse probabilidades de acerto de um décimo d;
décima oitava potência, e se um milhão de pessoas apostassem nessa loteri;
todos os anos, seriam necessários, em média, cerca de mil bilhões de ano;
antes que alguém (não apenas uma determinada pessoa) tirasse a sorte gran
de. Mil bilhões de anos é mais ou menos cem vezes a estimativa atual d;
idade do universo. Alinguagem informal de Doolittle ("surge" etc.) escondi
enormes dificuldades. O mesmo problema de probabilidade ultra-ínfim.
dificultaria o aparecimento da protrombina ("resultado de uma duplicaçãf
de um gene por protease e... embaralhamento"), do fíbrinogênio ("um;
proteína bastarda derivada de..."), do plasminogênio, da proacelerina e di
todos os vários supostos rearranjos da protrombina. Doolittie, aparente-
mente, precisa embaralhar e dar a si mesmo uma mão de cartas perfeita para
ganhar o jogo. E uma pena que o universo não tenha tempo para esperar.
A segunda questão a considerar é a suposição implícita de que uma
proteína feita de um gene duplicado teria imediatamente as novas e neces-
sárias propriedades. Ele diz que "o fator de tecido aparece como resultado
da duplicação de um gene para [outra proteína]". Ora, o fator de tecido com
certeza não apareceria como resultado da duplicação mas outra proteína,
sim. Se uma fábrica de bicicletas fosse duplicada, ela fabricaria bicicletas,
e não motocicletas. E isso o que significa a palavra duplicação. Um gene
para uma proteína talvez fosse duplicado por uma mutação aleatória, mas
não "acontece", simplesmente, que tenha também novas e sofisticadas
propriedades. Uma vez que um gene duplicado é somente uma cópia do
velho gene, uma explicação do aparecimento do fator de tecido deve incluir
a suposta rota que ele tomou para adquirir a nova função. Esse problema é
discretamente evitado. O esquema de Doolittie enfrenta o mesmo problema
na produção de protrombina, um receptor de trombina, antitrombina,
plasminogênio, antiplasmina, proacelerina, fator de Stuart, proconvertina,
fator de Christmas, fator anti-hemolítico e proteína c virtualmente todas
as proteínas do sistema!
O terceiro problema nessa descrição da coagulação sanguínea é que ela
evita as questões cruciais: quanto, com que rapidez, quando e onde. Nada
é dito sobre o volume de material de coagulação inicialmente disponível, a
resistência do coágulo que seria formado por um sistema primitivo, o tempo
de que o coágulo precisaria para se formar logo que ocorresse um corte, a
que pressão fluida ele resistiria, até que ponto a formação de coágulos
impróprios seria prejudicial, ou uma centena de outras questões seme-
lhantes. Os valores absolutos e relativos desses e de demais fatores pode-
riam tomar qualquer dado sistema hipotético tanto possível quanto (o que
seria muito mais provável) inteiramente errado. Se, por exemplo, houvesse
apenas um pequeno volume de fíbrinogênio, ele não cobriria o ferimento;
se uma fibrina primitiva formasse uma bolha aleatória, em vez de uma
malha, seria improvável que estancasse o sangramento. Se a ação inicial da
antitrombina fosse rápida demais, a da trombina muito lenta, o fator de
Stuart inicial, o fator de Christmas ou o fator anti-hemofílico se combinas-
sem frouxa ou rigidamente demais (ou caso se ligassem a formas inativas
de seus alvos, além das formas ativas), todo o sistema desmoronaria. Em
nenhuma etapa nem mesmo em uma única , Doolittie fornece um
modelo que inclua números ou quantidades; sem números, não há ciência.
Quando um quadro meramente verbal do desenvolvimento de um sistema
102 A CAIXA PRETA DE DARWIN
,
tão complexo assim é pintado, não há maneira alguma de saber se ele;
funcionaria de fato. Quando essas questões cruciais são ignoradas, deixa-
mos a ciência e entramos no mundo de Calvin e Haroldo.
Ainda assim, as obj ecoes levantadas até agora não são as mais graves. ,
Amais séria, e talvez a mais óbvia, diz respeito à complexidade irredutível. !
Enfatizo aqui que a seleção natural, o motor da evolução darwiniana, só
funciona se há alguma coisa para selecionar alguma coisa que é útil neste
instante, e não no futuro. Mesmo que, para fins de discussão, aceitemos o
cenário de Doolittie, de acordo com sua própria explicação nenhuma
coagulação aparece até, pelo menos, a terceira etapa. A formação do fator
de tecido no primeiro passo não é explicada, pois seria como ficar esperando |
sem ter nada para fazer. No passo seguinte (a protrombina surgindo de i
repente e já dotada da capacidade de ligar-se ao fator de tecido, que, de
alguma maneira, a ativa), a pobre proto-protrombina também ficaria giran-
do os polegares sem nada para fazer até que, finalmente, um hipotético
receptor de trombina aparecesse na terceira etapa e o fíbrinogênio caísse do
céu na quarta etapa. O plasminogênio aparece em uma etapa, mas seu
ativador (tpa), surge apenas duas etapas depois. O fator de Stuart é intro-
duzido em uma etapa, mas desperdiça seu tempo, nada fazendo até que seu
ativador (a proconvertina) aparece na etapa seguinte e, de alguma maneira,
o fator de tecido resolve que este é o complexo ao qual deseja se ligar.
Virtualmente, todas as etapas da via sugerida enfrentam problemas seme-
lhantes.
Simples palavras, como "o ativador só aparece duas etapas depois",
talvez não pareçam ter maior importância, até que pensemos em suas
implicações. Se duas proteínas a proenzima e seu ativador são
necessárias em uma etapa na via, as probabilidades de conseguir as duas
juntas são aproximadamente o quadrado da probabilidade de se conseguir
uma delas. Calculamos a probabilidade de obter apenas o tpa em um décimo
da décima oitava potência: a probabilidade de conseguir o tpa e seu ativador
juntos seria de cerca de um décimo da trigésima sexta potência! Trata-se de
um número terrivelmente grande. Não se pode esperar que um evento desse
tipo acontecesse, mesmo que os dez bilhões de anos da vida do universo
fossem comprimidos em um único segundo e revividos a cada segundo
durante dez bilhões de anos. Asituação, porém, é na verdade muito pior: se
uma proteína aparecesse em um passo,10 sem nada para fazer, a mutação e
a seleção natural tenderiam a eliminá-la. Uma vez que ela não está fazendo
nada de importância crítica, sua perda não seria prejudicial e a produção do
gene e da proteína custaria energia que outros animais não estão usando. A
produção da proteína inútil seria, pelo menos até certo ponto, prejudicial.
EXAMINANDO O CONTEÚDO DA CAIXA 103
O mecanismo da seleção natural de Darwin efetivamente impediria a
formação de sistemas de complexidade irredutível, como a cascata da
coagulação.
O cenário de Doolittie reconhece de forma implícita que a cascata da
coagulação é irredutivelmente complexa, mas ele tenta disfarçar o dilema
com referências metafóricas a yin e yang. O fundamental é que os conglo-
merados de proteínas têm de ser inseridos todos ao mesmo tempo na cascata.
Isso só pode ser feito postulando-se um "monstro esperançoso" que obtém,
simultaneamente, todas as proteínas por sua sorte, ou pela orientação de um
agente inteligente.
Seguindo o exemplo de Doolittie, poderíamos propor uma rota pela qual
a primeira ratoeira teria sido produzida: o martelo aparece como resultado
da duplicação de uma alavanca em nossa garagem. O martelo entra em
contato com a plataforma, resultado este do embaralhamento de vários
palitos de picolé. A mola nasce de um relógio de pêndulo. A barra de
contenção é fabricada com o canudinho que se projeta de uma latinha
abandonada de Coca-Cola, e a trava tem origem na tampinha de uma garrafa
de cerveja. As coisas, porém, não acontecem dessa maneira, a menos que
alguém ou alguma coisa oriente o processo.
Lembre-se que o público leitor do artigo de Doolittie publicado na
Thrombosis and Haemostasis é formado por líderes da pesquisa sobre
coagulação indivíduos que conhecem a última palavra sobre o assunto.
Ainda assim, o artigo não lhes explica como a coagulação poderia ter
surgido e, subsequentemente, evoluído; ele tão-somente conta uma história.
O fato é que ninguém na Terra tem a mais vaga ideia de como a cascata
da coagulação surgiu.
APLAUSOS, APLAUSOS
A discussão precedente não teve o objetivo de desacreditar Russell Doo-
littie, que realizou muitos bons trabalhos ao longo dos anos no campo da
estrutura da proteína. Na verdade, ele merece muito crédito por ser um dos
pouquíssimos talvez o único que está realmente tentando explicar
como esse complexo sistema bioquímico surgiu. Ninguém mais. fez um
esforço igual para compreender as origens da coagulação. A discussão
acima teve o objetivo exclusivo de esclarecer as enormes dificuldades (na
verdade, a evidente impossibilidade) de um problema que tem resistido há
quatro décadas de esforços resolutos de um excelente cientista. A coagula-
ção do sangue é um paradigma da espantosa complexidade subjacente até
mesmo a processos corporais aparentemente simples. Diante dessa comple-
104 A CAIXA PRETA DE DARWIN
xidade, existente inclusive em fenómenos simples, a teoria darwiniana cai
em silêncio.
Como uma espécie de máquina Rube Goldberg definitiva, a cascata da
coagulação é um fascinante espetáculo de equilíbrio, no qual um verdadeiro
zoológico de elementos bioquímicos exibindo vários ornamentos e
rearranjos gerados por enzimas modificadoras saltam uns após os outros
em ângulos exatos, em uma sequência de organização meticulosa, até que,
no desenlace, Chantecler empurra para o lado o poste telefónico e se levanta
do chão com o sangramento na cabeça já estancado. Aplatéia, de pé, aplaude
demoradamente.
DAQUI PARA LA
)SARAMPO
Na clínica, a médica examina o terceiro jovem paciente que não foi à escola
por causa de febre, dores no corpo e olhos vermelhos. Tal como os dois
primeiros, o menino está com sarampo. Como os outros dois, o garoto nunca
foi vacinado. Poucas crianças no bairro pobre, superpovoado, tomaram
vacina. O sarampo é raro nos dias de hoje. As pessoas esquecem como essa
doença pode ser perigosa. Os pais pensam que é apenas uma questão de
pintinhas temporárias e repouso na cama. Estão errados. O sarampo toma
o paciente muito mais suscetível a outras infecções. Como a encefalite. A
médica é informada de que o primeiro paciente acaba de falecer.
Três casos em uma semana no mesmo bairro significam que a doença
está se alastrando. A médica receia que esteja começando uma epidemia.
[mediatamente, liga para a Secretaria de Saúde Pública e relata o problema.
O secretário de saúde envia um fax ao Centro de Controle de Doenças dos
Estados Unidos (cdc), em Atlanta, pedindo dez mil doses de vacina contra
sarampo. O plano é iniciar um programa emergencial de vacinação nos
bairros mais próximos, de modo a isolar a doença. As crianças doentes
ficarão de quarentena; depois que o surto for controlado, será lançado um
programa educacional para alertar os pais sobre os perigos permanentes dos
vírus que atacam crianças. Mas as coisas mais importantes primeiro: há
necessidade imediata da vacina.
O fax é recebido no cdc e o pedido é aprovado. Um técnico desce para
uma área de armazenamento, onde há várias grandes salas refrigeradas e
onde são estocadas vacinas contra sarampo, varíola, catapora, difteria,
meningite e muitas outras. O técnico confere a rotulagem dos pacotes, nota
que as vacinas contra sarampo estão em caixas depositadas em um canto

106 A CAIXA PRETA DE DARWIN


nos fundos e coloca-as em um carrinho. Empurra o carrinho para um espaço
de carregamento, onde um caminhão refrigerado espera para levar os pa-
cotes ao aeroporto. No aeroporto o caminhão entra em um terminal de
serviço de entrega de cargas comerciais. Há muitos aviões estacionados no
terminal, mas o motorista do caminhão acha uma placa que indica o avião
que se destina à cidade certa.
As caixas de vacina são embarcadas no avião, que depois decola. No
aeroporto da cidade afetada, outro caminhão refrigerado espera para receber
a carga. As caixas são identificadas pêlos rótulos, separadas de outros
pacotes, e colocadas no caminhão. O motorista verifica o endereço da
clínica em um pedaço de papel preso aos pacotes e dá partida ao veículo.
Na clínica, uma verdadeira tropa de atendentes descarrega o caminhão e
abre as caixas. Logo depois já há uma longa fila de meninos e meninas
entrando na clínica para serem vacinados. A cada criança que passa, a
enfermeira pega um vidro da vacina, remove a tampinha de metal mole,
insere a agulha de uma seringa no frasco, extrai o líquido e o injeta no braço
da criança, que faz uma careta.
A estratégia funciona. Mais algumas crianças pegam sarampo, mas não
há mais mortes. A epidemia está sob controle e os funcionários do municí-
pio passam a planejar a campanha educacional.
O diretor se recosta na cadeira e joga o roteiro em cima da mesa. "Epide-
mia!" seu primeiro filme feito para a tv está indo muito bem. Tem
drama, ação, crianças encantadoras, médicos e enfermeiras atraentes e
respeitáveis membros do governo. Uma doença assassina foi derrotada pelo
planejamento, engenhosidade e perícia técnica do homem.
Bah! O diretor não gosta de finais felizes. Cético dos pés à cabeça, já
conheceu tanta gente estúpida e incompetente que não consegue engolir
tudo isso. A vesícula biliar de sua irmã foi extraída por um hábil cirurgião;
infelizmente, ela havia se internado para fazer uma operação de apendicite.
A comissão de zoneamento urbano, presidida pelo tio de um vizinho,
autorizou outro vizinho a abrir uma sala de vídeo em seu tranquilo bairro.
E arruaceiros da escola local esvaziaram os pneus de seu carro. O diretor
não gosta de médicos, odeia políticos e despreza crianças.
Além do mais, ele quer ser um grande artista. Os grandes artistas devem
chamar atenção para as fraquezas e tragédias humanas, ocasionadas por
limitações dos próprios homens. Não era isso o que Shakespeare fazia?
EXAMINANDO O CONTEÚDO DA CAIXA 107
Ninguém paparica as sensibilidades das massas maltrapilhas. O diretor
então fecha os olhos e começa a imaginar alguns cenários diferentes.
Começa a epidemia, os funcionários de saúde se reúnem e um pedido é
feito ao cdc. O técnico desce às salas refrigeradas e pega as caixas etique-
tadas como "vacina contra sarampo". Para o caminhão, para o avião, para
a cidade e, finalmente, para a clínica. As crianças desfilam barulhentas
diante da enfermeira e recebem suas picadas. Passam-se os dias. Mais três
crianças morrem. Passa-se uma semana, e morrem duas dezenas. Algumas
das crianças mortas haviam recebido a vacina. Dois meses depois, duzentas
crianças haviam morrido e milhares estavam doentes. Quase todas haviam
sido vacinadas. Os confusos chefes de governo ordenam uma investigação,
que apura que os pacotes foram etiquetados erroneamente, e que a vacina
era para difteria e não para sarampo. Nesse momento, quase todas as
crianças da cidade estão doentes. Nada pode ser feito. A doença tem de
seguir seu curso.
O diretor sorri. Vai dar um jeito, de qualquer maneira, de incluir al-
guns dos jovens arruaceiros locais no rol das crianças condenadas à
morte.
Mas talvez o filme precise de mais suspense à medida que a epidemia
continua. Assim, quando o pedido chega ao cdc, o técnico, talvez, desça
para a área de armazenamento e note que todas as etiquetas se soltaram
da caixa. O ventilador do refrigerador as espalhou por toda parte, mis-
turando-as irremediavelmente. Suor escorre pelo rosto do técnico. Ele
sabe que serão necessárias semanas para analisar as caixas e descobrir
qual vacina é a certa. Durante essas semanas, a doença se espalhará, os
políticos botarão a boca no mundo e crianças morrerão. Ele poderá ser
demitido.
Variações desse tema poderiam ser feitas à vontade. O caminhão leva as
caixas de vacina para o avião errado. O avião descarrega a carga em um
caminhão errado. O caminhão é sequestrado a caminho da clínica. Ou leva
a vacina para o prédio errado. As tampinhas dos frascos de vacina foram
acidentalmente feitas com metal duro, ao invés de mole, e não podem ser
retiradas sem quebrar o vidro e contaminar a vacina. Em todos esses casos,
nota satisfeito o diretor, a incompetência humana é destacada. As grandes
realizações da ciência vacinas para derrotar doenças, aviões e automó-
veis para levar suprimentos rapidamente são inutilizadas por pura e
simples estupidez.
O diretor bate na mesa. Sim, o tema do filme será uma batalha, uma luta
épica: Albert Einstein contra os Três Patetas. Einstein não tem a menor
chance.
Todos os problemas que surgiram nos cenários do diretor envolvem a
entrega de um pacote ao destinatário final. Embora o filme desse destaque
à morte e à doença, os mesmos problemas são comuns a todas as tentativas
de conseguir que um determinado pacote chegue a um destino específico.
Vamos supor que tenhamos ido a um terminal na Filadélfia para pegar um
ônibus com destino a Nova York. Cem ônibus estavam alinhados com
perfeição em uma fila, motores ronronando, prontos para partir para seus
destinos. Mas não havia placas neles, e os motoristas e passageiros se
recusavam a dizer para onde iam os ônibus. Pegamos o mais próximo e
acabamos em Pittsburgh.
O sistema de ônibus enfrenta o mesmo problema com que o cdc teve de
lidar: entregar os pacotes certos (passageiros) no destino certo. O antigo
correio a cavalo enfrentava a mesma situação. Quando o cavaleiro descia
da sela para pegar um malote, alguém tinha que se certificar de que a
correspondência ali contida devia seguir para o lugar para onde o cavalo ia.
E o cavaleiro tinha que reconhecer seu destino quando lá chegasse.
Todos os sistemas de entrega de carga enfrentam problemas seme-
lhantes: a carga deve ser etiquetada com o endereço de entrega correio; a
transportadora tem que reconhecer o endereço e colocar a carga no veículo
de entrega certo; o motorista do veículo tem que saber quando chega ao
destino certo; e a carga tem de ser desembarcada. Como vimos no filme
feito para a tv, se o pacote for mal etiquetado ou não existir etiqueta, ele
nem sai do depósito. Caso seja entregue no endereço errado ou o recipiente
não possa ser aberto quando chega, para todos os efeitos nunca foi enviado.
Todo o sistema deve estar instalado para que funcione.
Emst Haeckel pensava que a célula era um "glóbulo homogéneo de
protoplasma". Estava enganado: cientistas demonstraram que as células são
estruturas complexas. Em particular, as células eucarióticas (que incluem
as células de todos os organismos, menos as bactérias) possuem muitos
compartimentos diferentes, nos quais tarefas distintas são realizadas. Da
mesma maneira que uma casa tem cozinha, lavanderia, quartos de dormir
e banheiro, a célula conta com áreas especializadas e separadas para tarefas
diferentes (Figura 5-1). Essas áreas incluem o núcleo (onde reside o adn),
a mitocôndria (que produz a energia da célula), o retículo endoplasmático
(que processa as proteínas), o aparelho de Golgi (uma estação intermediária
para proteínas que estão sendo transportadas para outro lugar), o lisossomo
(unidade de remoção de lixo da célula), vesículas secretoras (que armaze-
nam carga antes desta ser enviada à célula), e o peroxissomo (que ajuda a
Endossomo-
. Lisossomo
Peroxissomo.
_ Aparelho de Golgi
_ Mitocôndria
Retículo endoplasmático
com polirribossomas
ligados à célula
. Membrana plasmática
Extraído de Alberts et ai., fig.l 2-1. Reproduzido com permissão.
metabolizar as gorduras). Todos os compartimentos são isolados do resto
da célula por uma membrana própria, da mesma maneira que um aposento
é separado do resto da casa por paredes e porta. As próprias membranas
também podem ser consideradas compartimentos separados, porque a
célula coloca nelas material que não é encontrado em outros locais.
Alguns compartimentos possuem seções separadas. As mitocôndrias,
por exemplo, são envolvidas por duas membranas diferentes. Pode-se, por
conseguinte, pensar numa mitocôndria como contendo quatro seções dis-
tintas: o espaço interior da membrana interna, a própria membrana, o espaço
entre as membranas interna e externa e a própria membrana externa.
Contando membranas e espaços internos, há na célula mais de vinte seções
diferentes.
A célula é um sistema dinâmico: fabrica ininterruptamente novas es-
truturas e se desfaz de material velho. Uma vez que seus compartimentos
são isolados uns dos outros, todas as áreas enfrentam o problema de obter
novos materiais. Há duas maneiras de se resolver isso. Em primeiro lugar,
cada compartimento pode fabricar todos os seus suprimentos, tal como
tantas aldeias auto-suficientes. Em segundo, novos materiais podem ser

1)0 A CAIXA PRETA DE DARWIN


fabricados em um centro e enviados para os demais compartimentos, tal
como uma grande cidade que fabrica calças jeans e rádios, que são remeti-
dos a pequenas cidades. Ou poderá haver uma mistura dessas duas pos-
sibilidades.
Nas células, embora alguns compartimentos fabriquem seu próprio
material, a grande maioria das proteínas é produzida centralmente e enviada
para os demais compartimentos. A remessa das proteínas entre os compar-
timentos constitui outro intricado e fascinante processo. Os detalhes podem
diferir, de acordo com o destino da proteína, da mesma forma que os
detalhes de um serviço de entrega podem diferir, dependendo se o pacote
deve cruzar uma cidade ou um oceano. Neste capítulo, vamos nos concen-
trar nos mecanismos usados pela célula para levar uma proteína à unidade
de remoção de lixo, o lisossomo. O leitor descobrirá que a célula tem que
enfrentar os mesmos problemas que o Centro de Controle de Doenças
encontra quando despacha um pacote de vacinas.
Uma nova proteína, recém-fabricada pela célula, encontra em seu caminho
numerosas máquinas moleculares. Algumas a agarram e enviam para o local
que deve atingir: daqui a pouco seguiremos uma proteína ao longo de seu
caminho, do começo ao fim. Todas as máquinas de proteínas têm nomes
um tanto exóticos, e é difícil para muitas pessoas formar uma imagem
mental dessas coisas se não estão acostumadas a pensar nelas. Por isso
faremos primeiro uma analogia, que nos ocupará nas páginas seguintes.
A época é o futuro distante. A humanidade tentou explorar diretamente
o espaço, mas, depois de enfrentar cometas, tempestades magnéticas e
extraterrestres hostis, percebeu que os perigos eram grandes demais. O
trabalho então foi passado a sondas espaciais mecânicas, que foram lança-
das no cosmo para explorar as bordas longínquas de nossa galáxia e mais
além. Claro, leva algum tempo para a sonda chegar às fronteiras da galáxia,
e ainda mais tempo para ir além, por isso as sondas espaciais foram
construídas para serem auto-suficientes. Elas podem aterrissar em planetas
estéreis e executar operações de mineração de matérias-primas; fabricar
máquinas novas com o minério local; e captar energia da luz das estrelas e
usá-la para carregar suas baterias.
A sonda espacial é uma máquina e, portanto, tem de realizar todas as
suas tarefas seguindo mecanismos minuciosamente detalhados, e não por
magia. Uma dessas tarefas é reciclar velhas baterias. As baterias se estragam
após certo tempo e a sonda tem que fabricar outras. As novas baterias são
feitas moendo-se as velhas, recuperando-se componentes usados, derreten-
do-os, refundindo peças fundidas e adicionando novos produtos químicos.
Uma das máquinas utilizadas nesse processo é denominada "trituradora de
baterias".
A sonda espacial tem a forma de uma enorme esfera. Dentro dela há
várias esferas menores, auto-sufícientes, cada uma contendo maquinaria
destinada a tarefas especializadas. Na maior das esferas internas vamos
chamá-la de "biblioteca" estão os projetos para a fabricação de todas as
máquinas existentes na sonda. Eles não são projetos comuns, contudo.
Podemos imaginá-los como projetos em braile ou talvez como uma
partitura furada de piano automático , pois as endentações físicas no
projeto fazem com que a máquina-mestra fabrique a máquina assim codi-
ficada.
Um belo dia, a sonda sente (por meio de algum mecanismo que vamos
ignorar) que precisa fabricar outro triturador de bateria e enviar uma
máquina recém-construída para trabalhar na sala de remoção de lixo, onde
ela ajudará na reciclagem de velhas baterias. Em vista disso, o processo
necessário é posto em movimento: o projeto do triturador de bateria é
fotocopiado na biblioteca e a cópia flutua para uma janela do local (lem-
bre-se, não há gravidade). Na borda do projeto há perfurações arrumadas
em um padrão especial, que se ajusta com exatidão a um mecanismo de
varredura eletrônica localizado na janela. Quando a planta se engata no
scanner, a janela se abre como se fosse o obturador de uma câmera
fotográfica. A planta se solta do scanner e sai flutuando da biblioteca a
caminho da área principal da sonda.
Na área principal há muitas máquinas e componentes: parafusos, porcas
e fios que flutuam livremente de um lado para o outro. Nessa seção há
muitas cópias das chamadas máquinas-mestras, cuja função é fabricar
outras máquinas. Elas fazem isso lendo as perfurações nos projetos, pegan-
do parafusos, porcas e outras partes que flutuam por ali e, mecanicamente,
montando a máquina peça por peça.
O projeto do triturador de bateria, flutuando na área principal, logo entra
em contato com a máquina-mestra. Zumbindo, apêndices móveis que se
projetam da máquina-mestra pegam parafusos e porcas e começam a
montar o triturador. Mas, antes de montar o corpo do triturador, a máqui-
na-mestra desenha primeiro um "ornamento" temporário que assinala que
a máquina tem de deixar a área principal.
Na área principal há outra máquina, chamada guia. A forma da guia é
exatamente complementar à do ornamento, e os pequenos imãs que ela
possui permitem-na ligar-se a este com segurança. Subindo até o omamen-
to, a guia empurra para baixo o comutador da máquina-mestra, fazendo com
que esta interrompa a fabricação do triturador.
Na parte de fora de uma das esferas internas (vamos chamar essa esfer;
de "sala de processamento n" l") há um local de recebimento, que tem um;
forma complementar a uma parte da guia e a uma parte do ornamento.
Quando a guia, o ornamento e as partes anexadas entram nessa seção, o
comutador da máquina-mestra é ligado fazendo com que se reinicie a
construção do triturador.
Junto a essa seção há uma janela. Quando o ornamento bate à janela (é
grande a quantidade de solavancos), ele ativa uma correia transportadora
dentro da sala de processamento, e esta correia puxa o novo triturador de
bateria, deixando do lado de fora a máquina-mestra, o projeto e a guia.
Enquanto o triturador estava sendo puxado pela janela, outra máquina
retirou o ornamento, então não mais necessário. Nesse instante, espantosa-
mente, máquinas de compressão embutidas nas paredes flexíveis da sala de
processamento n° l fazem com que uma seção da parede se feche em tomo
de algumas das máquinas, formando uma subsala nova e flutuante. O resto
da parede que foi deixado para trás fecha-se suavemente por si mesmo.
A subsala agora flutua a uma pequena distância através da área principal,
antes de entrar em uma segunda sala de processamento. A subsala se funde
com a parede e expele seu conteúdo na sala de processamento n° 2. O
triturador de bateria passa em seguida pelas salas de processamento n° 3 e
n° 4, utilizando mecanismos semelhantes aos que a levaram da sala n° l
para a sala n° 2. Nas salas de processamento, as máquinas recebem as
etiquetas que as orientam para seus destinos finais. Uma antena é instalada
no triturador de baterias e rapidamente ajustada para formar uma configu-
ração muito especial. A forma especial da antena ajustada diz a outros
mecanismos para orientar o triturador até a sala de tratamento de lixo.
Na parede da última sala de processamento há máquinas ("arrastadores")
com uma forma complementar à da antena ajustada do triturador. O
triturador se dirige para os arrastadores e essa área da parede começa a
expandir-se para formar uma subsala. Fora da subsala existe outra máquina
(a "codificadora de entrega"), com uma forma que complementa exata-
mente a forma de uma máquina (a "marcadora de saída"), que se projeta da
sala de tratamento do lixo. A subsala se engata na sala de tratamento de lixo
através das duas máquinas complementares. Outra máquina (a "portão de
saída") passa em seguida por ali; ela tem uma forma complementar a uma
parte do codificador de entrega e da marcadora de saída. Quando se liga a
elas, a máquina de portão de saída faz uma pequena perfuração na sala de
tratamento de lixo e a esfera em trânsito se funde com ela, despejando seu
EXAMINANDO O CONTEÚDO DA CAIXA l l 3
conteúdo na unidade de remoção. O triturador de baterias finalmente está
em condições de iniciar seu trabalho.
Talvez, a essa altura do livro, o leitor possa perceber com muita facilidade
que o sistema de transporte que enviou o triturador de baterias ao seu destino
é irredutivelmente complexo. Se qualquer um de seus numerosos compo-
nentes estiver ausente, o triturador não é entregue na sala de tratamento de
lixo. Além disso, o delicado equilíbrio do sistema tem que ser mantido; cada
um dos muitos componentes que se ligam têm de fazer isso com precisão
e, em seguida, desprender-se, e todos devem chegar e partir nas horas certas.
Um único erro fará com que o sistema entre em pane.
Isso é ficção científica, certo? Coisas tão complexas assim não existem na
natureza, correio? Acélula é um "glóbulo homogéneo de protoplasma", não
é? Bem, não, sim e não.
Todas as máquinas fantásticas de nossa sonda espacial possuem equiva-
lentes diretos na célula. A sonda em si é a célula, a biblioteca é o núcleo, o
projeto é o adn, a cópia do projeto é o arn, a janela da biblioteca é o poro
do núcleo, as máquinas-mestras são os ribossomos, a área principal é o
citoplasma, o ornamento é a sequência de sinais, o triturador de baterias é
uma hidrolase lisossomal, a guia é a partícula de reconhecimento de sinal
(srp), o local de recepção é o receptor srp, a sala de processamento n° l é
o retículo endoplasmático (er), as salas de processamento n° 2 e 3 são os
aparelhos de Golgi, a antena é um carboidrato complexo, as subsalas são
vesículas revestidas de túnica ou clatrina, e várias proteínas representam os
papéis do cortador, puxador, codificador de entrega, marcador de saída e
portão de saída. A sala de tratamento do lixo é o lisossomo.
Vejamos rapidamente uma descrição de como uma proteína sintetizada no
citoplasma chega ao lisossomo. A descrição exige apenas um parágrafo. Não
se preocupe se esquecer logo os nomes e processos do transporte celular; o
objetivo aqui é apenas fornecer um vislumbre da complexidade da célula.
l..) Uma cópia arn (denominada arn mensageiro, ou simplesmente arn)
é tirada do gene do adn que codifica a formação de uma proteína que
trabalha na remoção de lixo da célula o lisossomo. Chamaremos essa
proteína de "lixase". O mARN é feito no núcleo e, em seguida, flutua para
um poro do núcleo. As proteínas existentes no poro reconhecem um sinal
no mARN, o poro se abre, o mARN flutua e penetra no citoplasma. No
citoplasma, as "máquinas-mestras" da célula os ribossomos
começam a produzir lixase, usando a informação contida no mARN.
primeira parte da cadeia de proteínas em crescimento contém um
sequência de sinais formada por aminoácidos. Logo que se complet
a sequência de sinais, uma partícula de reconhecimento de sinal (srp)
capta e faz com que o ribossomo pare. O srp e as moléculas associadas
flutuam, em seguida, para o receptor de srp existente na membrana de
retículo endoplasmático (er) e nela se prendem. Esse fato faz simulta-
neamente com que o ribossomo reinicie a síntese e que se abra um canal
de proteína na membrana. Passando a proteína pelo canal e entrando nc
er, uma enzima interrompe a sequência do sinal. Uma vez no er, a lixase
recebe um grande e complexo carboidrato. Proteínas revestidas de túnica
fazem com que uma gota do er, contendo alguma lixase e outras proteí-
nas, se expanda, dirija-se ao aparelho de Golgi e se combine com c
mesmo. Algumas proteínas são devolvidas ao er, se contêm o sinal apro-
priado. Essa sequência ocorre mais duas vezes, à medida que a proteíns
progride através dos vários compartimentos do aparelho de Golgi. Ne
interior deste, uma enzima reconhece o sinal na lixase e põe sobre ei
outro grupo de carboidratos. Uma segunda enzima corta o carboidratc
recém-anexado, deixando como resíduo a manose-6-fosfato (móp). Ne
compartimento final do Golgi, proteínas de clatrina se juntam ecomeçair
a se desenvolver. No interior da vesícula de clatrina, há um receptor d(
proteínas que se liga ao M6p. O receptor de M6p agarra o móp da lixase
e o puxa antes que a vesícula desenvolvida se afaste. No lado externo aí
vesícula, há uma proteína, a v-snare, que reconhece especificamente e
6-SNARE do lisossomo. Uma vez cortadas, as proteínas nsf e snai
fundem a vesícula com o lisossomo. A lixase chegou nesse momento ac
seu destino e pode iniciar o trabalho para o qual foi fabricada. Q
A sonda espacial fictícia é tão complicada que ainda não foi inventada.
nem mesmo de forma aproximada. O sistema celular autêntico já está eir
funcionamento, e a cada segundo, todos os dias, esse processo ocorre
bilhões de vezes em nosso corpo. A ciência é mais estranha que a ficção.
A lixase atravessa uma distância de cerca de um décimo milésimo de
polegada em sua jornada do citoplasma para o lisossomo, mas, ainda assim,
precisa dos serviços de dezenas de proteínas diferentes para chegar en
segurança. Em nosso imaginário filme de tv, a vacina viajou, digamos, mi
e seiscentos quilómetros do Centro de Controle de Doenças até a grand
EXAMINANDO O CONTEÚDO DA CAIXA 115
;idade onde era necessária um trilhão de vezes mais que a distância
ïercorrida pela lixase. Muitos dos requisitos para o transporte da vacina são
3S mesmos para fazer com que uma enzima do citoplasma chegue ao
[isossomo. Eles são impostos pelo tipo de trabalho a ser feito. Não depen-
dem da distância percorrida, do tipo de veículo usado, ou dos materiais com
as quais os sinais são feitos.
Um livro didático recente menciona três métodos diferentes usados pela
ïélula para levar proteínas aos compartimentos.1 No primeiro, um grande
portão se abre e se fecha para regular a passagem das proteínas através da
membrana. E conhecido como transporte controlado por portão. Esse é o
mecanismo que regula o fluxo de material, tal como arn recém-produzido,
entre o núcleo e o citoplasma (ou, na linguagem da sonda espacial, o fluxo
de projetos da biblioteca para a área principal). O segundo método é o
transporte transmembrana. Ocorre quando uma única proteína entra como
se fosse um fio através de um canal de proteína, como aconteceu quando a
lixase passou do citoplasma para o er. O terceiro método é o transporte
vesicular, no qual a carga de proteínas é colocada em recipientes para
remessa, como aconteceu na viagem a partir do aparelho de Golgi (a sala
de processamento final) para o lisossomo (a sala de tratamento do lixo).
No que nos interessa, os dois primeiros métodos podem ser considerados
os mesmos: ambos usam portais de membrana que, seletivamente, permi-
tem a entrada das proteínas. No caso do transporte controlado por portão,
o portal é muito grande e as proteínas podem entrar em sua forma curva.
No caso do transporte transmembrana, o portal é menor e as proteínas têm
que entrar como se fossem fios. Em princípio, porém, não há obstáculo à
expansão ou contração do tamanho do portal, de modo que eles são
equivalentes. Em consequência, vamos denominá-lo transporte controlado
por portão.
Quais são os requisitos mínimos, essenciais, para esse tipo de transporte?
Imaginemos um local de estacionamento reservado para carros com placa
diplomática. Em lugar de um atendente, a garagem tem um scanner que lê
o código de barras na placa e, se este estiver correio, o portão se abre. Um
carro com placa diplomática chega, o scanner vasculha o código de barras,
a porta abre e o carro entra. Não importa se o carro percorreu três metros
ou dez mil quilómetros, ou se o veículo é um caminhão, um jipe ou uma
motocicleta. Se o código de barras está certo, o veículo pode passar. Por
conseguinte, três requisitos básicos são necessários ao transporte controla-
do por portão: uma etiqueta de identificação, um scanner e um portão que
éativado pelo scanner. Se um desses elementos falta, ou o veículo não entra
ou o estacionamento não é mais uma área reservada.
1)6 A CAIXA PRETA DE darwin
Por requerer um mínimo de três componentes para funcionar, o trans-
porte controlado por portão é irredutivelmente complexo. Sendo assim, a
suposta evolução darwiniana gradual do transporte por portão na célula
enfrenta grandes problemas. Se as proteínas não contivessem um sinal para
o transporte, elas não seriam reconhecidas. Se não houvesse um receptor
para reconhecer o sinal ou nenhum canal para elas passarem, o transporte
tampouco ocorreria. E se o canal estivesse aberto a todas as proteínas, o
compartimento fechado não seria diferente do resto da célula.
O transporte vesicular é ainda mais complicado do que o controlado por
portão. Suponhamos agora que em vez de os carros dos diplomatas entrarem
na garagem um após o outro, todos os diplomatas tivessem que entrar com
seus carros pela traseira de um grande caminhão, que entraria na garagem
especial e deles os carros sairiam e estacionariam. Nesse caso, precisamos
de uma maneira pela qual o caminhão possa reconhecer os carros certos, de
uma maneira da garagem identificar o caminhão, e de uma maneira de os
carros saírem do caminhão, já dentro da garagem. Um cenário desses exigi-
ria seis componentes separados: l) uma etiqueta de identificação nos carros;
2) um caminhão com capacidade para transportá-los; 3) um scanner no ca-
minhão; 4) uma etiqueta de identificação no caminhão; 5) um scanner na
garagem; e 6) um portão de garagem ativável. No sistema de transporte
vesicular da célula, esses componentes correspondem à manose-6-fosfato,
à vesícula de clatrina, ao receptor móp na vesícula de clatrina, e às proteínas
v-snare, t-SNARE e snapnsf. Na falta de qualquer uma dessas funções, o
transporte vesicular não pode ocorrer ou a segurança do compartimento de
destino corre perigo.
Uma vez que o transporte vesicular requer mais componentes do que o
transporte controlado por portão, ele não pode se desenvolver gradualmente
a partir deste último. Se tivéssemos adesivos com códigos de barra nos
carros dos diplomatas, a colocação dos carros dentro do caminhão (uma
vesícula para transportá-los) esconderia os adesivos e eles não conseguiriam
entrar na garagem. Ou suponhamos, em vez disso, que o caminhão tivesse
a mesma etiqueta que os carros e, portanto, pudesse entrar na garagem. Mas,
ainda assim, faltaria um mecanismo que permitisse que os carros entrassem !
no caminhão, e este não teria utilidade. Se alguns carros entrassem aleato-
riamente no caminhão, carros não pertencentes a diplomatas também
entrariam na garagem. Voltando ao mundo da célula, se "acontecesse" de
uma vesícula ser formada nesse local, não haveria mecanismo para identi-
ficar as proteínas que deveriam entrar nela e, tampouco, nenhuma maneira,
de especificar o destino das mesmas. Colocar proteínas com etiquetas d»s
endereço em uma vesícula sem etiqueta tornaria as etiquetas inúteis e,';
EXAMINANDO O CONTEÚDO DA CAIXA l l 7
portanto, seria prejudicial para o organismo que possuísse um sistema de
transporte por portão que funcionasse muito bem. O transporte controlado
por portão e o transporte vesicular são dois mecanismos separados; um não
ajuda a compreender o outro.
A curta descrição dos requisitos do transporte controlado por portão e
do vesicular, note-se, não levou em conta numerosas outras complexidades
do sistema. Mas, uma vez que elas apenas tornam o sistema mais compli-
cado, não podem diminuir a complexidade irredutível do transporte com
destino certo.
Sistemas irredutivelmente complexos como ratoeiras, máquinas Rube
Goldberg e transporte intracelular não podem evoluir à moda darwiniana.
Não podemos começar com uma base, pegar alguns ratos, acrescentar uma
mola, pegar mais ratos, acrescentar um martelo, pegar mais ratos, e assim
por diante. Todo o sistema tem de ser montado na mesma ocasião, ou os
ratos rugirão. De modo análogo, não podemos começar com uma sequência
de sinais e fazer com que uma proteína siga até certo ponto na direção do
lisossomo, adicionar uma proteína receptora de sinais, ir um pouco mais
adiante etc. É tudo ou nada.
Mas talvez estejamos ignorando uma coisa. Uma das partes da ratoeira
poderia ter sido usada para algum outro fim que não pegar ratos, o mesmo
tendo acontecido com os outros elementos. Em alguma ocasião, várias
partes que estavam sendo usadas para outras finalidades reuniram-se, de
repente, para produzir uma ratoeira funcional. E, quem sabe, os compo-
nentes do sistema de transporte intracelular estiveram inicialmente cum-
prindo outras tarefas na célula e, em seguida, mudaram para o papel que
ora representam. Será que isso poderia ter acontecido?
Não podemos fazer um exame exaustivo de todos os papéis possíveis
para um dado componente. Podemos, no entanto, examinar alguns papéis
prováveis para alguns dos componentes do sistema de transporte. Esse
trabalho demonstra que é extremamente implausível que componentes
usados para outros fins se adaptassem por acaso a novas funções em um
sistema complexo.
Vamos supor que começamos com uma proteína que, por ter uma região
oleosa, reside na membrana da célula. Vamos supor ainda, que era benéfico
para a proteína estar nesse local, porque ela reforçava a membrana, tornan-
do-a resistente a rasgões e buracos. Haveria algum modo dessa proteína se
transformar em um canal controlado por portão? Isso seria o mesmo que
118 A CAIXA PRETA DE DARWIN
perguntar se vigas de madeira em uma parede poderiam ser transformadas
um passo darwiniano após outro, uma pequena mutação após outra
em uma porta dotada de scanner. Imaginemos que as vigas estivessem
próximas e que a área entre elas fosse tão enfraquecida que a argamassa
rachasse e um buraco se formasse na parede. Isso seria um aperfeiçoamen-
to? O buraco na parede permitiria que insetos, ratos, cobras e outras coisas
entrassem, mas também deixaria sair o calor ou o ar-condicionado. Analo-
gamente, uma mutação que fizesse proteínas se agregarem na membrana,
deixando um pequeno buraco, permitiria que alimentos, sal, atp e outros
materiais necessários escorressem para fora. Isso não é um melhoramento.
Uma casa com um buraco na parede nunca seria vendida, e uma célula com
um orifício estaria em grande desvantagem em comparação com outras.
Q Suponhamos, em vez disso, que uma proteína poderia se ligar às fases
iniciais de novas proteínas à medida que essas fossem fabricadas pelo
ribossomo. Suponhamos ainda, que isso fosse um aperfeiçoamento,
porque proteínas novas, estiradas, são mais vulneráveis, de modo que
colocar sobre elas uma proteína pregueada as protegeria, até que sua
construção estivesse completa e elas se pregueassem. Poderá essa pro-
teína transformar-se por evolução em uma partícula de reconhecimento
de sinal (srp)? Não. Essa proteína ajudaria uma nova proteína a preguear-
se rapidamente, e não a mante-la lisa o oposto do que faz o moderno
srp. Proteínas dobradas, ou pregueadas, contudo, não podem cruzar o
canal controlado por portão, onde o srp moderno as recebe. Além do
mais, se um proto-SRP fizesse com que o ribossomo interrompesse seu
trabalho de sintetização como faz o moderno srp mas a maquinaria
para voltar a ligar o ribossomo ainda não estivesse instalada, esse fato
destruiria a célula (alguns venenos letais matam, ao ser desligado o
ribossomo da célula). Assim, temos um dilema: no início, um inibidor
sem controle da síntese da proteína mataria a célula, embora uma parada
temporária na síntese da proteína seja crucial nas células modernas. Se
o ribossomo não pára, a nova proteína toma-se tão grande que não pode
passar por um canal controlado por portão. Parece, assim, que a srp
moderna não poderia ter evoluído de uma proteína cujo trabalho fosse
ligar-se a novas proteínas e protegê-las contra a degradação.
Suponhamos que uma enzima colocasse um grande grupo de carboi-
dratos (o "ornamento") sobre as proteínas, à medida em que essas eram
fabricadas. Vamos imaginar que isso, de alguma maneira, ajudasse a
estabilizar a proteína, fazendo com que ela durasse mais na célula. Será
que esse passo poderia acabar se tomando parte da sequência de trans-
EXAMINANDO O CONTEÚDO DA CAIXA l l 9
porte intracelular? Não. O ornamento, uma vez que tomaria maior a
proteína, impediria que ela passasse por qualquer futuro portão que se
parecesse com um portão moderno no ER. O ornamento, na verdade, seria
um obstáculo ao desenvolvimento de um sistema de transporte.
Da mesma maneira, outras partes isoladas do sistema na verdade
seriam prejudiciais, e não úteis à célula. Uma enzima que cortasse a
sequência do sinal (o "ornamento") seria nociva se a sequência estivesse
representando um papel positivo em uma célula primitiva. A remoção
do ornamento seria um passo para trás se ele tivesse trabalho a fazer.
Aprisionar proteínas como a "lixase" em uma vesícula seria danoso se
a lixase originalmente tivesse que trabalhar solta. Q
No Capítulo 2, notamos que não poderíamos pegar partes es-
iecializadas de outros sistemas complexos (como a mola de um relógio
lê pêndulo), e usá-las diretamente como peças especializadas de um
iegundo sistema irredutível (como uma ratoeira), a menos que as peças
ossem antes muito modificadas. Partes análogas representando outros
)apéis em outros sistemas não podem atenuar a complexidade irredutível
ie um novo sistema. O foco simplesmente muda de "fazer" as peças para
'modificá-las". Em ambos os casos, não há nova função, a menos que
im agente inteligente oriente a montagem. Neste capítulo, vimos que a
;onstrução de um sistema de transporte enfrenta o mesmo problema: o
sistema não poderia ser montado aos poucos com peças novas ou de
segunda mão.
MORTE PREMATURA
Em uma das versões de nosso filme para a tv, uma etiqueta errada foi colada
em uma caixa de vacina e crianças morreram. Por sorte, foi apenas uma
história fictícia: uma história sobre uma história. Na vida real, porém,
etiquetas misturadas ou inexistentes podem causar mortes.
Uma garotinha de dois anos está de pé em frente a um gráfico de altura,
ajudada pela mão de um adulto. Ela tem apenas 60cm de altura. Ela tem o
rosto e os olhos inchados e suas pernas estão tortas. Move-se com gestos
rígidos. É uma menina gravemente retardada. O exame clínico revela co-
ração, fígado e baço dilatados. Tosse e coriza sugerem as muitas outras
infecções das vias respiratórias superiores que sofreu em sua jovem vida.
O médico tira uma amostra de tecido da menina e a envia a um laboratório
para análise. Um técnico de laboratório cultiva as células da amostra em
uma placa de Petri e as examina com um microscópio. Todas as células

120 A CAIXA PRETA DE DARWIN


contêm milhares de pequenos grânulos densos, que não aparecem eu
células normais. Os grânulos são denominados "corpos de inclusão".
menininha sofre de doença da célula.2 Uma vez que essa doença é progres-
siva, os problemas ósseos e neurais se agravarão com o tempo. Amenin;
morrerá antes de completar cinco anos de idade.
A doença da célula l é causada por um defeito na via de transporte da;
proteínas. As células dos pacientes com a doença carecem de uma da;
máquinas na longa sequência que leva as proteínas do citoplasma para c
lisossomo. Por causa do defeito, enzimas que deveriam chegar ao lisossomc
nunca completam a viagem. Em vez disso, são desviadas, na vesículi
errada, para a membrana da célula e jogadas no espaço extracelular.
A célula é um sistema dinâmico e, da mesma maneira que precisz
construir novas estruturas, tem que degradar continuamente as antigas
Material velho é levado ao lisossomo para degradação. Em crianças que
sofrem da doença da célula l, o lixo é jogado na lixeira, como deve ser, ma;
o sistema de remoção é interrompido: nem a "lixase" nem qualquer outn
enzima degradadora, que normalmente decompõe velhas estruturas, estãc
presentes. Como resultado, o lixo se acumula e os lisossomos ficam cheios
A célula fabrica novos lisossomos para lidar com o aumento do lixo, mas
os novos compartimentos acabam ficando abarrotados com os detritos dí
vida celular. Com o tempo, toda a célula se toma inchada, os tecidos se
dilatam e o paciente morre.
Uma criança pode morrer por causa desse único defeito em uma daí
muitas máquinas necessárias para levar proteínas ao lisossomo. Uma únicE
falha no caminho labiríntico de transporte da proteína na célula é fatal. A
menos que todo o sistema tivesse sido imediatamente instalado, nossos
ancestrais teriam sofrido destino semelhante. Tentativas de evolução gra-
dual do sistema de transporte de proteínas são uma receita para a extinção
Devido aos problemas médicos ocasionados pelo fracasso do sistema dt
transporte, e por este ser tão intricado e fascinante, poderíamos esperar qu(
o desenvolvimento evolutivo do sistema vesicular de transporte fosse umí
movimentada área de pesquisa. De que maneira um sistema como esse
poderia se desenvolver pouco a pouco? Que obstáculos a célula teria que
superar ao mudar de algum outro método de remover o lixo para ums
vesícula destinada e equipada especificamente para fundir-se com o lisos-
somo? Mais uma vez, se consultarmos a literatura especializada em buscs
de uma explicação da evolução do transporte vesicular, ficaremos bastan-
te desapontados. Não há nada a esse respeito.
O Amuai Review of Biochemistry (ou ARB) é uma série de livros, muitc
popular entre os bioquímicos, que analisa os conhecimentos atuais em áreas
EXAMINANDO O CONTEÚDO DA CAIXA 121
selecionadas de pesquisa. Em 1992, a arb publicou um artigo intitulado
"Veside-Mediated Protein Sorting".3 Os autores começam o trabalho di-
zendo o óbvio: "O transporte de proteínas entre organelas revestidas de
membranas é um processo imensamente complexo." E continuam, à ma-
neira profissional, a descrever os sistemas e a pesquisa corrente na área.
Mas podemos ler o artigo da primeira à quadragésima sexta página e não
encontraremos uma única explicação de como tal sistema poderia ter
evoluído gradualmente. O tópico está fora de alcance.
Acossando um banco de dados computadorizado da literatura das ciên-
cias biomédicas, temos meios de efetuar uma busca rápida por palavras-
chave nos títulos de literalmente centenas de milhares de trabalhos. Uma
busca para descobrir que títulos contêm as palavras evolução e vesícula
termina inteiramente vazia. Percorrer a literatura à velha maneira revela
alguns trabalhos dispersos, que especulam como o transporte controlado
por portão entre compartimentos de uma célula eucariótica poderia ter se
desenvolvido.4 Mas todos os trabalhos supõem que os sistemas de trans-
porte originaram-se de sistemas bacterianos de transporte preexistentes, que
já possuíam todos os componentes das células modernas. Essa suposição
não nos ajuda em nada. Embora as especulações possam ter algo a ver com
a maneira como os sistemas de transporte poderiam ser duplicados, elas
nada dizem sobre como os sistemas iniciais surgiram. Em algum momento,
essa máquina complexa teria que surgir, e isso não poderia ter acontecido
de forma gradual.
Talvez o melhor lugar para obter uma visão geral do transporte por
vesícula seja o livro Molecular Biology of the Cell, de autoria de Bruce
Alberts, presidente da Academia Nacional de Ciências, James Watson,
ganhador do prémio Nobel, e vários outros co-autores. O livro se estende
por cem páginas sobre os sofisticados detalhes do transporte controlado por
portão e vesicular.5 Nessas cem páginas há uma seção de página e meia
intitulada "Relações topológicas entre organelas revestidas por membranas
que podem ser interpretadas em termos de suas origens evolutivas". Nessa
parte, os autores observam que se uma vesícula se destaca da membrana da
célula e nela penetra, então sua parte interna é equivalente à parte externa da
célula. Sugerem, em seguida, que a membrana nuclear, o er, o aparelho de
Golgi e os lisossomos surgiram quando partes da membrana da célula se
soltaram. Isso pode ter acontecido ou não, mas os autores sequer mencio-
nam a questão da origem do transporte da proteína, seja vesicular seja
controlado por portão. Nessa curta seção, omitem qualquer referência à
clatrina, como também não mencionam os problemas de colocar a carga
correta na vesícula correia e orientá-la para o compartimento certo. Em
122 A CAIXA PRETA DE DARWIN
suma, a discussão é irrelevante para a pergunta que fazemos. Ao fim da
busca na literatura, verificamos que não sabemos mais do que quando
começamos.
RESUMINDO E OLHANDO PARA O FUTURO
O transporte vesicular é um processo extraordinariamente complicado, não
menos complexo do que a entrega automatizada de vacina de uma área de
armazenamento a uma clínica situada a milhares de quilómetros de dis-
tância. Defeitos no sistema vesicular podem ter as mesmas consequências
letais que a falha na entrega da vacina necessária a uma cidade devastada
pela doença. A análise mostra que o transporte vesicular é irredutivelmente
complexo e, portanto, seu desenvolvimento resiste bravamente a expli-
cações gradualistas, como desejaria a evolução darwiniana. Uma busca na
literatura bioquímica e nos livros didáticos revela que ninguém jamais
sugeriu uma rota detalhada, através da qual um sistema poderia surgir.
Diante da enorme complexidade do transporte vesicular, a teoria darwiniana
silencia.
No capítulo seguinte, vamos examinar a arte da autodefesa mas, é
claro, em escala molecular. Da mesma maneira que metralhadoras, cruza-
dores e bombas nucleares são máquinas necessariamente sofisticadas em
nosso mundo mais vasto, veremos que mecanismos minúsculos de defesa
celular também são muito complexos. Aliás, poucas coisas são simples na
caixa preta de Darwin.
UM MUNDO PERIGOSO
lá inimigos por toda parte. Não há nada de paranóia nisso; estamos
ercados por criaturas que, por uma razão ou outra, querem acabar conosco.
Ima vez que a maioria de nós não deseja morrer ainda, tomamos medidas
ara nos defender.
Ameaças de agressão vêm em todas as formas e tamanhos e, portanto,
i defesa tem de ser versátil. A ameaça em maior escala é a guerra entre
lações. Os governantes parecem estar sempre cobiçando as riquezas dos
izinhos, e por isso os países ameaçados têm que se defender ou sofrerão
;onseqüências desagradáveis. Nesses tempos modernos, as nações dispõem
lê meios de defesa realmente muito sofisticados. Os Estados Unidos têm
xanbas atómicas; se alguma outra nação fizer qualquer menção de ataque,
iles podem ameaçá-la com essas bombas. Se a ameaça aumentar e se
ransformar em violência e não desejarmos, por algum motivo, usar armas
itômicas, outras máquinas poderão ser utilizadas: jatos que lançam bombas
"inteligentes", aviões awacs que monitoram o espaço por muitos quilôme-
;ros, mísseis terra-ar que destroem mísseis terra-terra, e muito mais. Para o
Comentador de guerras tecnológico vivemos numa idade de ouro.
Grandes ameaças como as guerras são importantes, mas outros tipos de
igressão também podem matar. Ataques terroristas a bomba em aviões ou
itentados a gás em metros tornaram-se, infelizmente, frequentes demais
3ara que fiquemos tranquilos. Pior ainda, nenhuma das armas mencionadas
icima pode ajudar a impedir um atentado a gás a um metro. Quando a
natureza do inimigo muda de forma drástica de um país estrangeiro para
um grupo terrorista interno a natureza da defesa também tem de mudar.
Em vez de bombas, as autoridades governamentais instalam detectores de
metais em aeroportos e destacam guardas armados para locais estratégicos.
124 A CAIXA PRETA DE DARWIN
O terrorismo e a guerra nos ameaçam, é claro, mas são raros.
dia-a-dia, é mais comum que as pessoas sejam assaltadas ou atacadas p
vândalos nos bairros onde moram do que por grupos ou países estrangeiro
O habitante prudente das grandes cidades coloca grades nas janelas, us
interfone ou olho-mágico para saber quem bate à porta e carrega no bois
uma latinha de spray paralisante ao levar o cachorro para passear. El
regiões onde essas conveniências modernas são desconhecidas, muros c
pedra ou madeira podem ser construídos em tomo da cabana para mant(
longe os intrusos (de duas e de quatro pernas), e uma lança é conservada a
lado da cama, no caso de uma parede ser arrombada.
Porrete, pedra, muro, arma de fogo, sistema de alarme, tanque e bomt
atómica podem ser usados para ajudar a repelir ataques. Uma vez que s
circunstâncias em que cada arma será útil podem variar bastante, há muil
superposição. Pistola e porrete podem deter um assaltante; pistola e tanqu
podem assustar um grupo terrorista; tanque e bomba atómica podem s
usados contra um país estrangeiro. Encarada dessa maneira, é possível falar ei
"evolução" de sistemas defensivos. É possível falar em uma corrida arms
mentista, na qual o equipamento dos adversários se toma cada vez mai
sofisticado. Podemos contar histórias dizendo que a vida é uma luta e qu
sobrevivem os países e pessoas que contam com melhores defesas. Mas, ante
de saltarmos para dentro de uma caixa e decolarmos com Calvin e Harold(
precisamos lembrar a distinção entre precursores conceituais e precursore
físicos. Pedra e arma de fogo podem ser usadas como defesa, mas pedra na
pode ser transformada em revólver através de uma série de pequenas etapa.
Uma latinha de spray paralisante não é a precursora física de uma granada (
mão. Um avião a jato não pode ser transformado em bomba atómica, ur
parafuso e porca de cada vez, ainda que tanto o avião como a bomba c
contenham. Na evolução darwiniana, só contam mesmo os precursores física
Mas seres humanos e animais de grande porte não são as únicas ameaça
que enfrentamos. Há também agressores liliputianos, contra os quais bom
bas, pistolas ou pedras são ineficazes. Bactérias, vírus, fungos todo
adorariam nos comer vivos, se pudessem. As vezes eles de fato o fazerr
embora, em geral, passem fome porque nosso corpo dispõe de uma série l
sistemas de defesa para enfrentar ataques microscópicos. A primeira linh
de defesa é a pele. Tal como uma cerca, a pele funciona por um método (
tecnologia relativamente simples: é uma barreira difícil de transpor. Vítima
de queimaduras com frequência sofrem infecções graves porque a barrei
da pele foi destruída e as defesas internas não podem dar conta da quantid
de esmagadora de invasores. Embora seja uma parte importante das defesa
do corpo, a pele não é uma precursora física do sistema imunológico.
Para desencorajar um estranho que queira passar por cima delas, as
seroas às vezes têm prolongamentos pontiagudos no alto. Quando eu
morava no Bronx, quase todas as cercas anticiclone tinham na parte superior
Fios cortantes como navalhas que parecem ser mais eficazes para produzir
lacerações em intrusos do que o tradicional arame farpado. Prolongamentos
pontiagudos e fios cortantes não são partes da cerca propriamente dita; são
acréscimos que aumentam a eficácia da barreira. E, tal como a própria cerca,
3 fio cortante não é um precursor físico de, digamos, uma pistola ou uma
mina terrestre.
A pele também tem acréscimos que aumentam sua eficácia como bar-
reira. Em laboratórios de bioquímica, frequentemente temos de usar luvas
para nos proteger do material que manuseamos, embora, às vezes, tenhamos
que usá-las para protegê-lo de nós. Pessoas que trabalham com arn usam
luvas porque a pele humana excreta uma enzima que mastiga o arn. Por
quê? Muitos vírus são feitos de arn. Assim, para esses vírus a enzima é
como um fio cortante na pele: o arn que tenta furar a barreira é lacerado.
Há outros tipos de prolongamentos pontiagudos na pele. Um dos mais
interessantes é uma classe de moléculas denominadas magaininas, des-
cobertas por um biólogo chamado Mike Zasloff, depois que ele se
perguntou por que rãs de laboratório, que são abertas e costuradas em
condições não-estéreis, raramente pegam infecções. Ele demonstrou que
a pele das rãs excreta uma substância que pode matar células bacterianas.
Desde então, as magaininas foram descobertas em muitos tipos de
animais. Elas, porém, tal como as enzimas que destroem o arn, não são
precursoras dos sofisticados sistemas de defesa existentes sob a pele dos
animais.
Para descobrir o armamento pesado, é preciso olhar embaixo de nossa
pele. O sistema de defesa interna dos vertebrados é de uma complicação
atordoante. Assim como o moderno exército americano dispõe de grande
variedade de armas que podem coincidir em seu uso. Mas, tal como no
caso das armas que discutimos acima, não devemos supor automati-
camente que as diferentes partes do sistema imunológico são precursores
físicos recíprocos. Embora as defesas do corpo constituam ainda uma
área ativa de pesquisa, sabemos muitos detalhes de aspectos específicos
das mesmas. Neste capítulo, discutiremos partes selecionadas do sis-
tema imunológico e indicaremos os problemas que elas apresentam para
um modelo de evolução gradual. Aos que ficarem intrigados com a
inteligência dos sistemas e desejarem saber mais sobre o assunto,
aconselho procurar qualquer texto sobre imunologia, onde encontrarão
os detalhes.'
l 26 A caixa PRETA DE DARWIN
;ij
O MATERIAL CERTO ]
Quando um invasor microscópico rompe as defesas externas do corpo, o
sistema imunológico entra automaticamente em ação. Os sistemas molecu-
lares do corpo, tal como o sistema antimíssil Guerra nas Estrelas planejado
certa vez pêlos militares, são robôs desenhados para funcionar com piloto
automático. Uma vez que a defesa é automatizada, todas as etapas têm de
ser comandadas por algum mecanismo. O primeiro problema enfrentado
pelo sistema de defesa automatizada é reconhecer o invasor. Células bacte-
rianas têm que ser distinguidas de células sanguíneas; vírus têm que ser
distinguidos de tecido conjuntivo. Ao contrário de nós, o sistema imunoló-
gico não pode ver, de modo que tem de depender inicialmente de algo
parecido com o sentido do tato.
Q Os anticorpos são os "dedos" do sistema imunológico cego eles
permitem estabelecer a distinção entre um invasor e o próprio corpo.
Anticorpos são formados pela agregação de quatro sequências de ami-
noácidos (Figura 6-1): duas correntes leves idênticas e duas correntes
pesadas idênticas. As correntes pesadas são cerca de duas vezes maiores
que as leves. Na célula, as quatro correntes formam um complexo que
se parece com a letra Y. Uma vez que as duas correntes pesadas são iguais
e as leves também, o Y é simétrico: se pegássemos uma faca e o
cortássemos ao meio de cima a baixo obteríamos duas metades idênticas,
com uma corrente pesada e outra leve em cada metade. Em cada
extremidade do "v" do Y há uma depressão (denominada ponto de
união). Revestindo o ponto de união há partes das correntes pesada e
leve. Os pontos de união assumem uma grande variedade de formas. Um
anticorpo pode ter um deles, com uma peça projetando-se aqui, um
orifício ali, e um pedaço oleoso na borda. Um segundo anticorpo poderia
ter uma carga positiva à esquerda, um entalhe no meio e uma protube-
rância à direita.
Se a forma do ponto de união por acaso for exatamente complementar
à forma de uma molécula na superfície de um vírus ou bactéria invasores,
o anticorpo une-se a ela. Para entender bem, imaginemos um utensílio
doméstico com uma depressão e algumas protuberâncias projetando-se
da mesma. Minha filha mais nova tem um carrinho de boneca com
assentos nas partes dianteira e traseira ou algo parecido. Agora pegue
o carrinhoobjeto e ande pela casa, procurando ver quantos outros artigos
se ajustarão perfeitamente à depressão, preenchendo os assentos dian-
teiro e traseiro sem deixar nenhum espaço vago. Se encontrar ao menos
um, você tem mais sorte que eu. Nada em minha casa se encaixa bem
EXAMINANDO O CONTEÚDO DA CAIXA 127
FIGURA 6-1
desenho ESQUEMÁTICO DE UMA MOLÉCULA DE ANTICORPO.
Pontos de união
Corrente leve-
- Corrente pesada
no carrinho, e também nada em meu escritório ou laboratório. Imagino
que deva haver no mundo algum objeto com uma forma complementar
à dos assentos do carrinho, mas ainda não o encontrei.
O corpo enfrenta um problema semelhante: as probabilidades de
qualquer dado anticorpo unir-se a qualquer dado invasor são muito
remotas. Para ter certeza de que existe pelo menos um tipo de anticorpo
para cada atacante, fabricamos bilhões de trilhões de anticorpos. De
modo geral, para qualquer invasor determinado, apenas um entre cem
mil anticorpos funcionará.
Quando bactérias invadem o corpo, elas se multiplicam. Quando um
anticorpo se une a uma bactéria, pode haver muitas, muitas cópias da
invasora flutuando pelo organismo. Contra esse Cavalo de Tróia que se
reproduz, o corpo dispõe de cem mil armas de fogo, mas apenas uma
delas funciona. Mas uma única pistola não vai adiantar muito contra
uma horda; de alguma maneira, reforços têm de ser trazidos. Há uma
forma de fazer isso, mas, em primeiro lugar, temos que voltar atrás e
explicar um pouco mais a origem dos anticorpos.
128 A CAIXA PRETA DE DARWIN
FIGURA 6-2
DESENHO ESQUEMÁTICO DE UMA CÉLULA B.
Anticorpo
Há bilhões de diferentes tipos de anticorpos. Cada tipo é fabricado
em uma célula separada. As células que os produzem são chamadas d(
células b, o que é fácil de lembrar porque elas são produzidas na medula
óssea (boné marrow, em inglês).2 Quando uma célula B nasce, mecanis-
mos em seu interior escolhem aleatoriamente um dos muitos genes d(
anticorpos que estão codificados em seu adn. Diz-se que esse gene '
"ligado"; todos os demais genes de anticorpos são "desligados", i
célula, portanto, produz apenas um único tipo de anticorpo, com urr
único tipo de ponto de união. A célula que for produzida em seguida terá
com toda probabilidade, um gene de anticorpo diferente ligado, de modc
que fabricará uma proteína diferente com um ponto de união diferente
O princípio, então, é: uma célula, um tipo de anticorpo.
Uma vez que a célula se encarrega de fabricar seu anticorpo podería-
mos pensar que ele deixa a célula para patrulhar o corpo. Se o conteúdo
de todas as células b fosse despejado no corpo, porém, não haverii
maneira de saber de que célula provinha o anticorpo. A célula é a fábrica
que produz um tipo particular de anticorpo; se o anticorpo descobre uma
bactéria, precisamos dizer à célula que nos envie reforços. Mas, com
essa organização hipotética, não conseguimos obter uma mensagem de
resposta.
Por sorte, o corpo é mais inteligente do que pensamos. Quando uma
célula B fabrica seu anticorpo, este se fixa na membrana da célula, com
os "dentes" do Y projetando-se (Figura 6-2). A célula faz isso utilizando
o gene do anticorpo normal, mas usando também uma pequena parte do
gene que codifica uma cauda oleosa na proteína. Uma vez que a mem-
brana também é oleosa, a peça se cola a ela. Esse passo é fundamental,
porque agora o ponto de união do anticorpo está ligado à sua fábrica.
Toda a fábrica de célula b patrulha o corpo. Quando um invasor entra, o
anticorpo, com a célula grudada a ele, se cola ao inimigo.
Nesse momento, temos a fábrica bem perto dos invasores. Se fosse
possível enviar um sinal à célula para fabricar mais anticorpos, as
possibilidades da luta seriam melhoradas com a chegada de reforços. Por
sorte, há uma maneira de enviar o sinal; infelizmente, é muito compli-
cado. Quando um anticorpo em uma célula b se cola à molécula estranha,
ele aciona um mecanismo complexo que engole o invasor; na verdade,
a fábrica de munição faz um refém. O anticorpo destaca em seguida uma
peça da membrana para fazer uma pequena vesícula um táxi autofa-
bricado. Nesse táxi, o refém é trazido para a fábrica de célula B. No
interior da célula (ainda no táxi) a proteína estranha é mastigada e uma
parte dela cola-se à outra proteína (denominada proteína mhc). O táxi,
em seguida, volta à membrana da célula. No lado de fora da fábrica
aparece outra célula (chamada célula t auxiliadora). A auxiliadora T
liga-se à célula B, que "apresenta" a peça mastigada do invasor (o
fragmento estranho na proteína mhc) para que seja examinada. Se o
ajuste for exato, isso faz com que a célula auxiliadora T secrete uma
substância denominada interieucina. Ainterieucina é como uma mensa-
gem do departamento de defesa à fábrica de munições. Unindo-se à outra
proteína na superfície da célula B, a interieucina desencadeia uma série
de eventos que envia uma mensagem ao núcleo da célula b. A mensa-
gem é: cresça!
A célula b começa a reproduzir-se a uma taxa rápida. As células t
continuam a secretar interieucina, se estiverem unidas a uma célula B.
No fim, a fábrica de células B, cada vez maior, produz uma série de
fábricas-satélite, sob a forma de células especializadas, denominadas
"células plasmáticas". Em vez de produzir uma forma de anticorpo que
se cola à membrana, as células plasmáticas deixam a última peça oleosa
da proteína. Nesse momento, anticorpos livres são despejados em gran-
des volumes no fluido extracelular. A mudança é de importância fun-
damental. Se as novas fábricas de células plasmáticas fossem iguais à
velha fábrica de célula B, todos os anticorpos estariam confinados à parte
interna e seriam muito menos eficazes para combater os invasores. Q
passo a passo
Esse sistema poderia ter evoluído passo a passo? Pense por um momento
no imenso reservatório de bilhões a trilhões de células B. O processo de
escolher a célula certa, em uma mistura de células que produzem anticorpos;
é denominado de seleção clonal. Esta é uma maneira elegante de elaborai
uma resposta específica, em grandes quantidades, a uma imensa variedade
de possíveis invasores. O processo depende de várias etapas, algumas das
quais não discutimos ainda. Deixando-as de lado por ora, vejamos quais
são os requisitos mínimos para um sistema de seleção clonal e se eles
poderiam ser produzidos gradualmente.
A chave para entender o sistema é a conexão física da capacidade d
proteína de ligar-se à informação genética necessária à sua criação. Teori-
camente, isso poderia ser realizado fabricando-se um anticorpo no loca
onde a cauda do Y se liga ao adn que codifica a proteína. Na vida real
porém, esse método não funcionaria. A proteína poderia estar conectada e
sua informação genética, mas, uma vez que a célula é envolvida por um;
membrana, o anticorpo nunca entraria em contato com o material estranho
que flutua em volta, fora da célula. Um sistema em que o anticorpo e sei
gene anexo fossem exportados da célula superaria esse problema, ma;
apenas para encontrar outro: fora da célula não haveria maquinaria célula
para traduzir a mensagem do adn em mais proteínas.
Fixar o anticorpo na membrana é uma boa solução para o problema
nesse momento, ele pode fundir-se com a célula estrangeira e continua
ainda próximo de seu adn. Mas, embora o anticorpo possa prender (
material estranho sem flutuar para longe da célula, ele não mantém contatt
direto com o adn. Uma vez que a proteína e o adn são cegos, tem de have
uma maneira de transmitir uma mensagem de um para o outro.
Por ora, e no interesse do argumento, vamos esquecer o caminho tortuost
pelo qual a mensagem de ligação chega ao núcleo da célula b (exigindo (
táxi, a ingestão, o mhc, as células T auxiliadoras, a interleucina, e assim pó
diante). Em vez disso, imaginemos um sistema mais simples, no qual só h:
uma outra proteína. Digamos que quando o anticorpo se une à molécui;
EXAMINANDO O CONTEÚDO DA CAIXA 13)
estranha, alguma coisa acontece que atrai alguma outra proteína uma
; mensageira que deve levar ao núcleo da fábrica a mensagem de que foi feito
; um refém. Talvez, logo que o refém for capturado, a forma do anticorpo
mude, digamos, puxando um pouco sua cauda. Talvez parte da cauda do
anticorpo penetre no interior da célula, que é o fato que aciona a proteína
mensageira. A mudança na cauda poderia fazer com que a proteína mensa-
geira corresse para o núcleo e se ligasse ao adn em um ponto particular.
Colar-se ao lugar certo no adn é o que faz com que a célula comece a crescer
| e a produzir anticorpos sem a cauda oleosa anticorpos que são enviados
' da célula para combater a invasão.
Mesmo em um esquema simplificado como esse, temos três ingredientes
'de importância crítica: l) a forma do anticorpo ligado à membrana; 2) o
mensageiro; 3) a forma exportada do anticorpo. Se faltar qualquer um
desses componentes, o sistema deixa de funcionar. Se não houver anticorpo
jau membrana, não há maneira de ligar um anticorpo bem-sucedido, que se
ligou ao invasor estrangeiro, à célula que contém a informação genética. Se
tpão houver forma exportada de anticorpo, quando o sinal for recebido nada
|iaverá para enviar ao mundo para lutar. Se não houver proteína mensageira,
|não haverá conexão entre ligar o anticorpo da membrana e o acionamento
ido gene correio (tomando o sistema tão útil quanto uma campainha cujos
pôs foram cortados).
l A célula que tivesse a esperança de criar tal sistema em passos darwi-
|liános graduais ficaria em situação muito difícil: o que deveria fazer em
Iprimeiro lugar? Secretar um pouco de anticorpo no grande mundo externo
eria um desperdício de recursos, se não houvesse maneira de saber se ele
pstá conseguindo fazer alguma coisa. O mesmo se aplica à fabricação de
|Um anticorpo ligado à membrana. E, para começar, por que fabricar uma
proteína mensageira, se não houver ninguém a quem transmitir a mensagem
.ninguém para recebê-la, se ela lhe fosse passada? Somos levados inexo-
pvelmente à conclusão de que nem mesmo essa seleção clonal bastante
pmplificada poderia ter surgido por passos graduais.
l. Mesmo nesse nível simplificado, todos os três ingredientes teriam que
pvoluir simultaneamente. Todos os três itens o anticorpo fixo, a proteína
paensageira e os anticorpos soltos teriam de ser produzidos por um
vento histórico separado, talvez por uma série coordenada de mutações
|)ue alterassem proteínas preexistentes, que estivessem cumprindo outras
uefas nos componentes do sistema de anticorpos. Os pequenos passos de
rwin transformaram-se numa série de saltos muito improváveis. Ainda
im, nossa análise ignorou muitas complexidades: De que modo a célula
da, se uma peça oleosa extra for colocada ou não sobre a membrana? O
132 A CAIXA PRETA DE DARWIN
sistema de rtiensagem é fantasticamente mais complicado que nossa vei
simplificada. O lançamento, ingestão e mastigação da proteína ao mu
externo, em cima de uma proteína mhc, o reconhecimento específicc
MHCfragmento por uma célula t auxiliadora, a secreção da interleucir
ligação da interleucina com a célula B, o envio do sinal de que a interleui
ligou-se ao núcleo a possibilidade de abrir um caminho gradual pá
origem do sistema é suficiente para deixar lívidos mesmo homens fort
Fábricas flutuam por toda parte em grandes quantidades, prontas ]
entregar anticorpos que se colam a um invasor com virtualmente qualc
forma que tenha. Mas de que modo o corpo fabrica todos esses bilhõe
anticorpos com formas diferentes? Há um truque sutil para fazer muitos
ticorpos diferentes, sem haver necessidade de quantidades enormes
material genético para codificar as proteínas. Nas páginas seguintes, c
creveremos o sistema com alguns detalhes. Mais uma vez, o leitor não c
se preocupar se esquecer rapidamente esses detalhes. Nosso objetivo a
é apenas ajudá-lo a compreender a complexidade do sistema imunológ
QFoi preciso uma descoberta fascinante para levar os cientista
deslindar toda a complexidade do sistema imunológico. A descob
começou com um experimento potencialmente cruel, mas necessá
Apenas para ver o que acontecia, químicos fabricaram algumas peque
moléculas, que não ocorrem na natureza, e em seguida ligaram-nc
uma proteína. Quando a proteína que conduzia as moléculas sintét:
foi injetada em um coelho, os cientistas, atónitos, descobriram qu
coelho fabricava anticorpos que se colavam fortemente à moléc
sintética. De que modo isso podia acontecer? Nem o coelho nem s
ancestrais jamais haviam conhecido a molécula sintética; então, co
sabiam fabricar anticorpos contra ela? Por que deveriam reconhecer u
molécula que nunca viram antes?
O quebra-cabeças da "diversidade dos anticorpos" deixou confu
cientistas que estudavam imunologia. Várias ideias foram sugeri
como explicações possíveis. Sabia-se que as proteínas são moléci
flexíveis e que os anticorpos são proteínas. De modo que, talvez, qual
uma nova molécula é injetada no corpo, um anticorpo se enrola em to
dela, molda-se de acordo com essa forma e, em seguida, de algum mo
se congela nessa configuração. Ou, quem sabe, como a defesa é
vitalmente importante, o adn de organismos contém um número ime
ie genes para anticorpos, com muitas formas diferentes o suficiente
aara lhes permitir reconhecer coisas que não viram ainda. Mas esse
lúmero imenso de anticorpos ocuparia mais do que o espaço de codifi-
;ação disponível no adn. Assim, talvez houvesse apenas alguns anticor-
3os e, quando a célula se dividisse, quem sabe, haveria alguma maneira
ie produzir um bocado de mutações justamente nas áreas que codificam
as pontos de união dos anticorpos. Dessa maneira, cada nova célula B
10 corpo poderia conduzir mutações diferentes, codificando a formação
ie um anticorpo diferente de todas as demais células B. Ou talvez a
resposta fosse uma combinação dessas possibilidades ou, mesmo,
implicasse algo inteiramente novo.
A solução do problema da diversidade dos anticorpos teve que
ssperar por uma descoberta espantosa: um gene que codificava a forma-
rão de uma proteína não tinha que ser sempre um segmento contínuo do
adn ele poderia ser interrompido.3 Se comparássemos um gene a uma
frase, seria como se o código de proteína, "a rápida raposa cinzenta salta
por cima do cão preguiçoso" pudesse ser alterado (sem destruir a
proteína) para assumir a forma "a rápida brdkdjif rafjwkw posaown
cinzenta salta sobre o lapfqmzda cão sybagjufü preguiçoso". A sensata
mensagem do adn foi quebrada por pedaços de letras absurdas, que não
sstavam incluídas na proteína. Trabalhos posteriores demonstraram que,
no caso da maioria dos genes, correções seriam introduzidas corrigin-
do o absurdo depois que uma cópia arn fosse feita de um gene de
adn. Mesmo com o adn "interrompido", a mensagem corrigida e editada
no arn poderia ser usada pela maquinaria da célula para fazer a proteína
sorreta. E, mais surpreendente ainda, nos casos de genes de anticorpos
aproprio adn também podia ser corrigido. Em outras palavras, o adn,
que é herdado, poderia ser alterado. Assombroso!
O remendo e o rearranjo do adn desempenham um papel importante
na explicação do número de anticorpos que um corpo pode produzir. O
que se segue é uma curta explicação do trabalho que ocupou vários
cientistas durante muitos anos e, graças a seus esforços, o enigma da
diversidade dos anticorpos foi decifrado.
Na concepção, há certo número de peças de genes na célula fertilizada
que contribuem para a fabricação de anticorpos. Os genes são organiza-
dos em cachos, que chamaremos simplesmente de cacho l, cacho 2, e
assim por diante. Nos seres humanos, há aproximadamente 250 segmen-
tos de genes no cacho l; descendo no adn a partir do cacho l, há dez
segmentos de genes que formam o cacho 2; e, ainda mais baixo na estrada
do adn, há um grupo de seis segmentos que compreendem o cacho 3; e
ainda mais abaixo deste último há outros oito segmentos de genes, que
compõem o cacho 4. Esses são os jogadores.
Depois que o feto cresce um pouco e resolve nascer, uma das coisas
que deseja fazer é produzir células B. Durante a fabricação dessas células,
uma coisa engraçada acontece: o adn no genoma é rearranjado e, parte
dele, jogada fora. Um segmento do cacho l é apanhado, aparentemente
ao acaso, e ligado a um segmento do cacho 2. O adn interveniente é
cortado e descartado. Em seguida, um segmento do cacho 3 é apanhado;
mais uma vez aparentemente ao acaso, e ligado ao segmento dos cacho?
1-2.
A recombinação dos segmentos é um pouco descuidada não o que
geralmente se esperaria de uma célula. Devido ao procedimento des-
leixado, a codificação de alguns aminoácidos (lembre-se, eles são os
blocos de armar das proteínas) pode ser adicionada ou perdida. Uma ve2
reunido o cacho dos segmentos 1-2-3, a rearrumação do adn termina
Quando chega a vez de fabricar um anticorpo, a célula tira uma copie
arn da combinação do cacho 1-2-3 e adiciona-a à cópia arn de urr
segmento do cacho 4. Nesse momento, finalmente, as regiões que
codificam a fabricação de segmentos contíguos de proteínas encontram
se em um arranjo contíguo no arn.
Como esse processo explica a diversidade dos anticorpos? Partes do;
segmentos dos cachos l, 2 e 3 integram o ponto de união as ponta;
do y. Misturar e combinar segmentos diferentes implica multiplicar c
número de pontos de união com formas diferentes. Suponhamos, poi
exemplo, que um segmento do cacho l codificasse a existência de um;
saliência no ponto de união e outro codificasse uma carga positiva. I
imaginemos que segmentos diferentes do cacho 2 codificassem um;
placa oleosa, uma carga negativa e uma depressão profunda, rés
pectivamente. Pegando um segmento ao acaso nos cachos l e 2, teríamo'
seis combinações possíveis: uma saliência próxima a uma placa oleosa
carga negativa, ou depressão profunda; ou uma carga positiva próximi
a uma placa oleosa, carga negativa ou depressão profunda. (Este é, en
essência, o mesmo princípio pelo qual puxar três números de uma cartol;
explica a diversidade de uma loteria; escolher apenas três números de (
a 9 dá um total de mil combinações possíveis.) Quando está fabricando
a corrente pesada de um anticorpo, a célula pode pegar um de duzento;
e cinquenta segmentos do cacho l, um de dez do cacho 2, e um de sei:
do cacho 3. Além disso, o desleixo durante a recombinação "sacode" o;
segmentos (introduzindo um aminoácido na corrente ou deixando um di
fora). Esse efeito adiciona outro fator de cerca de cem à diversidade. a(
EXAMINANDO O CONTEÚDO DA CAIXA 135
misturar e combinar segmentos do adn, conseguimos 250 x 10 x 6 x
100, que representa cerca de um milhão de combinações diferentes de
sequências da corrente pesada. Processos semelhantes produzem cerca
de dez mil diferentes combinações de corrente leve. Combinar ao acaso
um gene de corrente leve com outro de corrente pesada em cada célula
produz um total geral de dez mil vezes um milhão, ou dez bilhões de
combinações! O número imenso de anticorpos diferentes fornece tantos
pontos de união diferentes que é quase certo que pelo menos um deles
se ajustará à qualquer molécula até mesmo a moléculas sintéticas. E
toda essa diversidade tem'origem em um total de apenas uns quatrocen-
tos diferentes segmentos de gene.
A célula dispõe de outros truques para aumentar o número de anti-
corpos possíveis. Um deles acontece após uma invasão. Quando uma
célula se liga a material estranho, ela recebe um sinal para se replicar.
Durante muitas rodadas de replicação, a célula, "intencionalmente",
permite um alto nível de mutação exatamente nas regiões variáveis das
correntes pesada e leve de genes. Esse fato produz variações que dão
certo. Uma vez que a célula-mãe codificou a formação de um anticorpo
ao qual já sabia que se liga muito bem, introduzir mutação na sequência
pode produzir uma união mais forte. Na verdade, estudos demonstraram
que anticorpos produzidos por células quando uma infecção já está muito
adiantada ligam-se com muito mais força às moléculas estranhas do que
os que são produzidos no início da doença. A "hipermutação somática"
acrescenta várias ordens de magnitude à diversidade dos anticorpos
possíveis.
Lembra-se da diferença entre as fábricas de célula B e de plasma?
Daquela placa oleosa do Y, que prende o anticorpo na membrana da
célula B? No caso da célula plasmática, quando a cópia arn do gene é
tirada, o segmento da membrana não é copiado. O segmento fica abaixo
do resto do gene. O adn pode ser comparado a uma mensagem que diz
"a rápida brdkdjf rofwkw nhroown wnposa cinzenta salta sobre o
cáofeqmzda Ifybnek preagufu guiçoso jdjkekiwif vmnd e come o
mnaiuw coelho". As palavras finais podem ser conservadas ou descar-
tadas, e a mensagem ainda continua a fazer algum sentido. Q
Um sistema de diversidade de anticorpos, para funcionar, precisa de vários
componentes. O primeiro, claro, é o próprio gene. O segundo é um sinal
que identifique o começo e o fim dos segmentos de genes. Em organismos
modernos, cada segmento é cercado por sinais específicos, que dizem a uma
enzima que venha e junte as partes. Isso é parecido com uma frase que diz
"a rápida lacorta aqui [fjwkw] corta aqui posa cinzenta salta sobre c
cãocorte aqui [Ifybnek sy] corta aqui preguiçoso". Enquanto o começo e
o fim estiverem presentes, a célula sabe que deve mante-los juntos. C
terceiro componente é a máquina molecular que reconhece, especifica-
mente, os sinais de corte e reúne as peças na ordem certa. Na ausência
da máquina, as partes nunca seriam cortadas e reunidas. Na falta dos sinais,
seria a mesma coisa que esperar de uma máquina que corta papel de formï
aleatória a confecção de uma boneca de papel. E, claro, na ausência
da mensagem destinada ao próprio anticorpo os demais componentes se-
riam inúteis.
A necessidade de uma função mínima reforça a complexidade irredutí-
vel do sistema. Imaginemos que estamos à deriva em uma balsa de salva-
mento em um mar tempestuoso e que, por acaso, passa boiando um barcc
que contém um motor de popa. Nossa alegria com a esperança de salvação
duraria pouco se, depois de prendê-la ao bote, a hélice do motor girasse ï
taxa de uma revolução por dia. Mesmo que um sistema complexo funcione
ele será um fracasso se o nível de desempenho não estiver à altura.
O problema da origem da diversidade dos anticorpos choca-se de frent
com o requisito de função mínima. Um sistema primitivo, com apenas umi
ou umas poucas moléculas de anticorpos, seria parecido com a hélice quf
gira a apenas uma revolução por dia: não é suficiente para ter importância
(A propósito, seria como se o banco de dados de identificação nacional de
pbi contivesse apenas dois conjuntos de impressões digitais. Entre centena;
de milhares de criminosos, o fbi só poderia ter a esperança de capturar esses
dois.) Uma vez que é tão pequena a probabilidade de que a forma de un
único anticorpo seja complementar à forma de uma bactéria ameaçador;
talvez uma em cem mil, mais ou menos , um animal que despendessi
energia fabricando cinco ou dez genes de anticorpo estaria desperdiçando
recursos que poderia investir para aumentar o número de sua prole 01
fabricar uma pele reforçada, ou ainda fabricar uma enzima para excreção
que degradasse o arn. Para fazer algum bem, um sistema gerador d
anticorpos precisaria produzir, desde o começo, um grande número deles.
Suponhamos que o tempo é mil anos no passado e que você vive em um,
grande aldeia com um grupo de pessoas. Uma vez que o local fica perto d;
costa, você tem de se preocupar com piratas vikings. A aldeia é cercada pó
uma sólida e alta cerca de madeira; durante um ataque, panelas de óleo
fervente são derramadas nos que tentam escalá-la com o uso de escadas.
Em um dia estranho, um feiticeiro bate à porta da aldeia. Abrindo a sacola,
ele se oferece para lhes vender uma arma do futuro. Chama-a de "pistola".
Quando o gatilho é apertado, diz ele, a pistola dispara um projétil na direção
para onde é apontada. A pistola é portátil e pode ser levada rapidamente de
um lado da aldeia para outro, se o inimigo mudar a direção do ataque. Você
e os outros membros da aldeia pagam ao feiticeiro duas vacas e quatro
cabras pela arma.
Eventualmente, sua aldeia é atacada. Há óleo fervente por todos os lados,
mas os atacantes têm um aríete. Ouvindo o barulho no portão, você se dirige
para lá, confiante, arma na mão. Enfim, o portão é derrubado e os atacantes
entram, uivando e girando suas maças de guerra sobre a cabeça. Você aponta
a arma e atira no chefe. O projétil voa pelo ar e gruda no nariz do chefe
viking. No cano da arma, em letras que você não consegue ler, há uma
inscrição: "Pistola de Dardos de Brinquedo". O chefe inimigo pára, olha-o
fixamente e começa a sorrir, enquanto seu próprio sorriso se dissolve nos
lábios. Ele e os outros invasores correm em sua direção. Por sorte, você
reencama como bioquímico no século xx.
Anticorpos são como dardos de brinquedo: não podem fazer mal a
ninguém. Tal como uma placa com a palavra "Condenada" pregada numa
velha casa ou um "x" alaranjado pintado em uma árvore a ser derrubada,
anticorpos são apenas sinais para outros sistemas, indicando que devem
destruir o objeto marcado. É surpreendente pensar que depois de o corpo
ter se dado a todo esse trabalho para desenvolver um sistema complexo,
destinado a gerar diversidade de anticorpos, e após ter feito tanto esforço
apanhando algumas células através do processo indireto da seleção clonal,
ele ainda seja virtualmente impotente contra o ataque de invasores.
Q Grande parte do extermínio concreto das células estranhas, que são
marcadas pêlos anticorpos, é feito pelo sistema "complemento", que é
assim chamado porque complementa a ação dos anticorpos para livrar-se
dos invasores. O caminho é notavelmente complexo (Figura 6-3). De
muitas maneiras, assemelha-se à cascata da coagulação do sangue
discutida no Capítulo 4. Consiste de cerca de vinte tipos de proteínas que
formam duas vias relacionadas, denominadas via clássica e via alterna-
tiva. A clássica começa quando um grande agregado de proteínas,
denominado Cl, fixa-se a um anticorpo que está colado à superfície de
uma célula estranha. Se o Cl se fixasse em um anticorpo que estivesse
flutuando solto na corrente sanguínea, todo Cl ficaria ensopado e inútil
138 A CAIXA PRETA DE DARWIN
FIGURA 6-3
A VIA-COMPLEMENTO.
Anticorpo
fixado
C2b + C4a
C4b,2a,3b
C3b Cõ-
Ce + C7 + C8 + C9
-(C3b)Bb
para ação contra os inimigos. Ou, se o cl se fixasse nos anticorpos unidc
à membrana das células b, seriam iniciadas reações que terminariam pç
matar células sadias.
Ode composto por 22 sequências de proteínas, que podem s
divididas em três grupos. O primeiro é denominado clq. Ele contém se:
cópias de três diferentes tipos de proteínas, em um total de 18. Os do
outros grupos são chamados cir e cis; ambos possuem duas cópias d
proteínas diferentes. Os três tipos diferentes de proteínas em clq com
çam com uma sequência especial de aminoácidos que lembra a seqüênci
de uma proteína da pele, o colágeno. A sequência permite que as caudí
dos três tipos de proteínas clq se enrolem umas nas outras como um
trança. Esse arranjo mantém um de cada tipo de proteína em ui
minicomplexo. O restante das cadeias de proteína encurva-se, em segu
da, em formas complexas, globulares, no alto da trança. Seis dos min
complexos se.reúnem em seguida. As seis tranças se colam uma à outi
no sentido do comprimento para criar um talo central, do qual se projetai
seis cabeças. Fotos de clq tiradas com um microscópio eletrônic
mostram uma coisa parecida com um monstro com cabeça de hidr
(Outras pessoas o comparam a um buque de tulipas, mas eu prefü
imagens mais dramáticas.) As cabeças do clq aderem ao complex

EXAMINANDO O CONTEÚDO DA CAIXA 139


anticorpocélula estranha. Pelo menos duas das cabeças têm de ser
Fixadas antes que a via seja iniciada. Uma vez aderidas, alguma coisa
muda no clq e essa mudança faz com que o cir e o cis se fixem mais
fortemente no clq. Quando isso acontece, o cir corta a si mesmo
[Manchete: cachorro morde cachorro!) para produzir dr. (Proteínas
"ativadas" são indicadas por uma barra sobre o número e a letra minús-
cula.) O dr, então, pode cortar o cis para produzir cis.
Após o Cis ser dividido, temos ainda um longo caminho a percorrer
antes de terminar o trabalho de destruir a célula invasora. As proteínas
do cl são chamadas coletivamente de "unidade de reconhecimento". O
grupo seguinte de proteínas (nomeadas como c2, c3 e c4) é denominado
"unidade de ativação". Ao contrário da unidade de reconhecimento, a de
ativação não está ainda reunida em uma única peça; ela tem que ser
montada. O primeiro passo na formação da unidade de ativação é a
divisão do c4 pelo cis. Quando o C4 é cortado pelo cis, um grupo muito
reativo, que se encontrava no interior de uma peça (c4b), é exposto ao
ambiente externo. Se o grupo está próximo de uma membrana, pode
reagir quimicamente com ela. Afixação do c4b é necessária para que as
demais proteínas na unidade de ativação possam ter uma âncora para
mante-las perto do invasor. Em contraste, se o c4b estiver apontado na
direção errada ou flutuando em solução, o grupo reativo dissolve-se
rapidamente, sem ligar-se à membrana correia.
Depois que o c4b aderiu à membrana-alvo, ele, em associação com
3 ds, divide c2 em duas peças. A peça maior, c2a, permanece ligada a
c4b, a fim de produzir c4b, 2a, conhecida também como "convertase de
c3". Esta tem que agir rapidamente ou se dissolve e o c2a se afasta,
autuando. Se uma molécula de c3 está nas vizinhanças, a convertase de
c3 se divide em duas peças. c3b liga-se à convertase de c3 para formar
c4b, 2a, 3b, que é também denominada "convertase de c5". A reação
Final da unidade de ativação é a divisão de c5 em dois fragmentos.
A essa altura, o sistema está finalmente pronto para atacar o invasor.
Uma das peças de c5 liga-se a c6 e c7. Esta estrutura tem a propriedade
notável de poder inserir-se em uma membrana de célula. c5b, 6, 7
ligam-se, em seguida, a uma molécula de c8 e um número variável de
moléculas (de um a dezoito) de c9 se junta a elas. As proteínas, contudo,
não formam uma massa indiferenciada. Em vez disso, organizam-se em
uma forma tubular, que abre um orifício na membrana da célula bacte-
riana invasora. Sendo o interior das células uma solução muito concen-
trada, a pressão osmótica faz com que água entre. O fluxo de água incha
a célula bacteriana até ela estourar.
140 A CAIXA PRETA DE DARWIN
Há uma via alternativa para a ativação do complexo membrana-ata-
que que pode agir logo após a infecção, não precisando esperar pel;
produção de anticorpos específicos. Na via alternativa, uma pequem
quantidade de c3b, que aparentemente é produzida de forma contínu;
em pequenos volumes, liga-se a uma proteína denominada fator B. c3b.
B pode, em seguida, ser cortado por outra proteína, o fator D, par;
produzir c3b, Bb. Este então pode agir como convertase de c3. Quandc
mais c3b é fabricado, uma segunda molécula de c3b pode ligar-se a el
para produzir (c3b)2Bb. Curiosamente, esta é agora uma convertase d(
c5, que produz c5b, que, em seguida, passa a dar início à formaçãc
do complexo membrana-ataque na maneira descrita acima para a primei
rã via.
E perigoso ter a proteína c3b flutuando à solta, uma vez que ela podi
ativar a extremidade destrutiva da via-complemento. Para minimiza
danos aleatórios, duas proteínas (fatores i e H), procuram, colam-se a i
destroem o c3b existente na solução. Mas, se o c3b estiver na superfíeii
de uma célula, outra proteína (properdina) liga-se a c3b e o protege conte
dissolução, de modo que ele possa realizar seu trabalho. De que maneir;
o c3b identifica as células estranhas na ausência de anticorpos? O c3b i
eficaz apenas se fixado à superfície de uma célula. A reação químic;
através da qual ele faz isso acelera-se na presença das moléculas típica
mente encontradas na superfície de muitas bactérias e vírus. Q
PROBLEMAS, PROBLEMAS
Tal como a via de coagulação do sangue, a via-complemento é uma cascata
E inevitável encontrar, em ambos os casos, as mesmas dificuldades ao tenta:
imaginar uma evolução gradual. O problema não está na atividade final d;
cascata. A abertura de um orifício em uma membrana não exige neces-
sariamente vários componentes diferentes; uma proteína assassina poderii
fazer isso. Nem a formação de um agregado de proteínas, como na coagu
lação do sangue, requer necessariamente múltiplos componentes; nas con
dições certas, todas as proteínas se agregam. (As formas específicas d(
complemento orifício-complexo e agregado de fibrina, porém, são es
pecialmente apropriadas para o trabalho que realizam e precisam se
explicadas.) Como vimos no Capítulo 4, um poste telefónico poderia por s
mesmo deixar Chantecler fora de combate.
E nos sistemas de controle que encontramos o problema. Em todos o;
pontos de controle, a proteína controladora e a proteína oculta que ela ativi
têm que estar presentes desde o começo. Se c5b estivesse presente, o reste
EXAMINANDO O CONTEÚDO DA CAIXA 141
da cascata seria ativado imediatamente. Mas, se estivesse presente sem nada
para ativá-lo, todo o caminho ficaria sempre bloqueado. Se c3b estivesse
presente, o resto da cascata seria ativado de imediato; mas, se c3 esti-
vesse presente sem nada para ativá-la, então toda a via ficaria fechada.
Mesmo que imaginemos uma via muito encurtada (quando, digamos, cis
corta diretamente c5), a inserção de pontos de controle adicionais no meio
da cascata enfrentaria o mesmo problema: a complexidade irredutível dos
comutadores.
Q Além das dificuldades genéricas de estabelecer uma cascata, a via-
complemento enfrenta o mesmo problema que a cascata da coagulação:
a fixação de proteínas a membranas é essencial. Vários fatores coagu-
lantes precisam ser modificados primeiro para sintetizar resíduos de Gla
para que possam colar-se à membrana. Na via-complemento, o c3 e o
c4 têm ambos grupos internos incomuns, muito reativos, que se ligam
quimicamente à membrana depois de as proteínas terem sido divididas
por outros fatores. Esses aspectos especiais têm que estar disponíveis
antes que a via se tome funcional, o que cria mais um difícil obstáculo
a seu desenvolvimento gradual.
Numerosos pequenos aspectos do sistema-complemento são pedras
no caminho do desenvolvimento gradual. Vejamos algumas caracterís-
ticas sutis apenas do sistema cl. Os três tipos de proteínas no clq
enrolam-se um no outro, mas não em si mesmos. Se fizessem isso, a
razão entre os diferentes tipos de correntes no complexo se modificaria
e a possibilidade de obter o complexo clq autêntico tomar-se-ia menor,
com seis cópias de três diferentes tipos de sequências. Se a fixação do
clq ao anticorpocélula estranha não desencadeasse a autoclivagem do
cir, a cascata seria paralisada em seu movimento. Se, ao contrário, o cir
se cortasse antes de o clq se fixar no complexo do anticorpo, a cascata
seria prematuramente desencadeada. E assim por diante. Q
O funcionamento correto do sistema imunológico é um pré-requisito da
saúde. Doenças graves como o câncer ou a aids têm sua causa ou sua cura,
ou ambas, nos caprichos do sistema. Devido a seu impacto sobre a saúde
pública, o sistema imunológico é objeto de forte interesse. Milhares de
laboratórios em todo o mundo trabalham em vários aspectos do sistema.
Seus esforços já salvaram muitas vidas e prometem salvar muitas mais no
futuro.
Embora tenham sido dados grandes passos na compreensão de como o
sistema imunológico funciona, continuamos a ignorar como surgiu. Ne-
nhuma das perguntas formuladas neste capítulo foi respondida por qualquer
dos milhares de cientistas que trabalham nesse campo; alguns sequer
fizeram as perguntas. Uma busca na literatura imunológica revela trabalhos 1
em andamento em imunologia comparativa (o estudo do sistema imunoló-
gico em várias espécies). Esses trabalhos, porém, por mais valiosos que
sejam, não tratam em detalhe molecular a questão de como os sistemas
imunológicos surgiram. Talvez o melhor esforço nesse sentido seja o conti-
do em dois curtos trabalhos. O primeiro, de David Baltimore, ganhador do
prémio Nobel, e de dois outros ilustres cientistas, é provocantemente inti-
tulado "Evolução molecular do sistema imunológico dos vertebrados". Mas
é difícil justificar um título desses em apenas duas páginas. Os autores
observam que
para que qualquer organismo tenha um sistema imunológico parecido com
o que é encontrado em mamíferos, as moléculas minimamente necessárias
são antígenos receptores (imunoglobulina e tcr), moléculas de apresentação
de antígenos (mhc), e proteínas reorganizadoras de genes.5
(Imunoglobulinas são anticorpos; as moléculas tcr são parecidas com eles.)
Os autores argumentam, em seguida, que os tubarões, que são parentes
muito distantes dos mamíferos, parecem possuir todos os três componen-
tes. Mas uma coisa é dizer que um organismo tem um sistema completo,
em funcionamento, e outra é explicar como o sistema evoluiu. Os autores
certamente sabem disso. Observam, aliás, que
os genes da imunoglobulina e do tcr exigem proteínas rag para rear-
rumação. Por outro lado, as proteínas rag requerem sinais específicos de
recombinação para rearranjarem os genes da imunoglobulina e do tcr.
(O rag é o componente que rearruma os genes.) Os autores iniciam uma
corajosa tentativa de explicar os componentes, mas, no fim, o que fazem é
dar um salto na caixa, juntamente com Calvin e Haroldo. Especulam que
um gene de uma bactéria poderia, por sorte, ter sido transferido para um
animal. Por um feliz acaso, a proteína codificada pelo gene poderia em si
mesma rearrumar os genes; afortunadamente, no adn do animal haveria
sinais que estariam próximos de genes de anticorpos, e assim por diante.
Em última análise, os autores identificaram problemas básicos na evolução
gradualista do sistema imunológico, mas a solução que ofereceram foi de
fato um discreto encolhimento de ombros.
EXAMINANDO O CONTEÚDO DA CAIXA 143
Outro trabalho que tenta corajosamente explicar uma parte do sistema
imunológico intitula-se "Evolução do sistema-complemento".6 Tal como o
trabalho discutido acima, é muito curto e constitui um artigo de comentários
em outras palavras, não é baseado em pesquisa. Seus autores dão alguns
palpites imaginativos sobre o que poderia acontecer em primeiro e segundo
lugares, mas, inevitavelmente, juntam-se a Russell Doolittie ao sugerir
proteínas inexplicadas que são "liberadas" e "surgem" ("Em algum ponto,
uma fusão crítica de genes criou uma protease com um ponto de união para
o primitivo c3b"; "A evolução dos componentes da via alternativa aumen-
tou ainda mais a amplificação e a especificidade"; e "o c2, criado pela
duplicação do gene do fator B, teria então permitido ulterior diversificação
e especialização das duas vias"). Nenhum cálculo quantitativo consta do
trabalho. Tampouco o reconhecimento de que duplicações de genes não
fabricariam imediatamente uma nova proteína. Nem há também qualquer
preocupação com a falta de controle para regular a via. Mas, é verdade, seria
difícil incluir essas preocupações nos quatro parágrafos do trabalho, que
trata de mecanismos moleculares.
Há outros trabalhos e livros que discutem a evolução do sistema imuno-
lógico.7 A maioria, contudo, situa-se no nível da biologia da célula e,
portanto, não se interessa por mecanismos moleculares detalhados, ou então
trata apenas de comparações entre sequências de adn ou proteínas. Com-
parar sequências pode ser uma boa maneira de estudar ligações, mas os
resultados não podem nos dizer coisa alguma sobre o mecanismo que gerou
os sistemas.
Podemos procurar por toda parte, em livros e em revistas, mas os
resultado serão os mesmos. A literatura científica não tem respostas para a
questão da origem do sistema imunológico.
Neste capítulo, estudamos três aspectos do sistema imunológico a
seleção clonal, a diversidade dos anticorpos e o sistema-complemento
e demonstramos que cada um deles constitui em si um forte desafio à
suposta evolução gradual. Mas mostrar que as partes não podem ser
construídas em etapas conta apenas parte da história, porque as partes
interagem. Da mesma forma que um carro sem volante, bateria ou carbu-
rador não é de grande serventia, um animal dotado de um sistema de seleção
clonal não tiraria muitos benefícios do mesmo se não houvesse maneira de
gerar diversidade de anticorpos. Um grande estoque de anticorpos não
poderá fazer muita coisa se não houver um sistema para matar os invasores.
Um sistema desse tipo não terá utilidade, se não houver uma maneira de
identificar os invasores. Em cada passo somos detidos não só por problemas
de sistemas locais, mas também pêlos requisitos do sistema integrado.
144 A CAIXA PRETA DE DARWIN
Vimos alguns aspectos positivos do sistema imunológico, mas tambén
há desvantagens em andar por aí com armas carregadas. Temos que te
certeza de que não daremos um tiro no pé. O sistema imunológico tem qu
discriminar o resto do mundo de si mesmo. Quando, digamos, ocorre um;
invasão de bactérias, por que o corpo fabrica anticorpos contra elas, ma;
não contra as células vermelhas, que circulam constantemente na correntf
sanguínea, ou contra qualquer um dos outros tecidos com que as células do;
anticorpos colidem? Quando o corpo de fato fabrica anticorpos dirigido;
contra si mesmo, geralmente acontece um desastre. Indivíduos que sofren
de esclerose múltipla, por exemplo, fabricam anticorpos que são dirigida
contra o isolante que recobre os nervos. Isso faz com que o sistemi
imunológico destrua o isolante, expondo os nervos e ocasionando curtos
circuitos nos mesmos, levando à paralisia. No diabetes juvenil, são fabrica
dos anticorpos contra as células P do pâncreas, que acabam sendo dês
fruídas. Apessoa não pode mais fabricar insulina e, em geral, morre, a menos
que a insulina seja fornecida de forma artificial. A maneira como o corpc
adquire tolerância a seus próprios tecidos continua obscura, mas, qualque
que seja o mecanismo, sabemos uma coisa: um sistema de autotolerânci!
teria que estar presente desde o começo do sistema imunológico.
A diversidade, a identificação, a destruição, a tolerância todos esse;
sistemas e outros mais interagem. Para onde quer que nos voltemos, i
explicação gradualista do sistema imunológico é impossibilitada por mui
tiplos requisitos interligados. Como cientistas, ansiamos por compreende
como esse mecanismo magnífico surgiu, mas a complexidade do sistemi
condena todas as explicações darwinianas à frustração. Sísifo teria pena di
nós.
Talvez não seja surpreendente descobrir uma complexidade incessanti
em máquinas tipo Guerra nas Estrelas que compõem o sistema imunoió
gico. Mas o que dizer de sistemas mais modestos? O que dizer das fábrica
que produzem os parafusos e as porcas de que são feitas as máquina;
moleculares? No capítulo final sobre provas iremos estudar o sistema qui
fabrica os "blocos de armar". Verificaremos que a complexidade estende-si
até os alicerces da célula.
MORTE NA ESTRADA
Minha família e eu moramos a uns oito quilómetros do campus, em uma
das muitas belas montanhas que embelezam a Pensilvânia. A área, embora
próxima da cidade, é rural, com floresta densa em todos os espaços ainda
não desmaiados para construção de imóveis. Uma estreita estrada de terra,
serpenteando montanha acima, leva à nossa casa. Dirigindo-me de carro
para o trabalho pela manhã ou voltando à noite para casa, vejo sempre
alguns pequenos animais agachados ao lado da estrada, prontos para arriscar
a vida numa corrida. Não sei se estão aceitando um desafio, tentando
impressionar o sexo oposto ou apenas ansiosos por voltar para casa. Mas
esse jogo é perigoso e alguns deles pagam o preço.
Os esquilos são os piores. Ao contrário de animais mais sensatos, eles
simplesmente não cruzam para o outro lado. Ainda longe podemos vê-los
sentados em um lado da estrada. Quando nos aproximamos, eles partem a
toda velocidade para o outro lado, param, invertem a corrida e voltam para
o centra Chegamos cada vez mais perto e eles continuam na estrada. Enfim,
quando estamos passando, eles chegam à conclusão de que é ao nosso lado
que realmente querem estar. Esquilos podem subir no carro, de modo que
há sempre a esperança de que, após terem desaparecido na parte da frente,
possamos vê-los pelo retrovisor, correndo para a segurança. As vezes eles
conseguem, às vezes não.
As marmotas costumam atravessar a estrada em linha reta, tornando fácil
prever sua posição, mas não temos como adivinhar quando elas surgirão.
Geralmente estamos dirigindo pensando no jantar quando, de repente, uma
massa pequena e redonda sai bamboleando da escuridão e entra em nossa
pista. A essa altura, tudo o que podemos fazer é cerrar os dentes e esperar
o choque pois, ao contrário dos esquilos, as marmotas não caberr
embaixo do carro. Na manhã seguinte, tudo o que sobra é uma pequen;
mancha na estrada, outros carros tendo destruído a carcaça. É a natureza eu
sangue, dentes, garras e asfalto.
Embora tenha aumentado recentemente, o tráfego na estrada ainda i
muito lento um carro a cada poucos minutos durante o dia, um a cadi
meia hora durante a noite. Assim, a maioria dos animais que cruza a estrad,
chega em segurança ao outro lado. Mas isso não acontece em todos o:
lugares. A Schuylkill Expressway, a principal rodovia que dá acesso ;
cidade de Filadélfia a partir do noroeste, tem de oito a dez pistas em certo:
trechos. O volume de tráfego é milhares de vezes maior do que na estrad;
que passa por minha casa. Não seria inteligente apostar em uma marmo-
ta que, saindo de um lado da Schuylkill, tentasse chegar ao lado oposto bem
na hora do rush.
Vamos supor que você é uma marmota sentada ao lado de uma estrad
centenas de vezes mais larga que a Schuylkill Expressway. Há milhares d
pistas na direção leste e outras milhares indo para oeste, todas elas cheia
de caminhões, carros esporte e caminhonetes que correm no limite d
velocidade. A sua namorada marmota está do outro lado e o convida
atravessar. Você nota que os restos de seus rivais no amor estão principal-
mente na pista um, alguns na pista dois e uns poucos espalhados pelas pista
três e quatro; não há mais nenhum além desse ponto. Além disso, a nomii
romântica determina que você deve ficar de olhos fechados durante
jornada, confiando no destino para levá-lo em segurança ao outro lado. Voe
vê a cara gordinha e parda de seu amor, sorrindo docemente, as pequena
costeletas se mexendo, os olhos mansos convidativos. Ouve as carretas de
18 rodas passarem com um chiado. E tudo o que você pode fazer é fechai
os olhos e rezar.
O exemplo de marmotas cruzando uma estrada esclarece um problem£
da evolução gradualista. Até este ponto no livro, enfatizei a complexidade
irredutível sistemas que exigem vários componentes para funcionar (
que são barreiras gigantescas à evolução gradual. Analisamos anteriormente
alguns exemplos; outros podem ser encontrados em qualquer livro d(
bioquímica. Alguns sistemas bioquímicos, no entanto, nada têm de com-
plexidade irredutível. Para funcionar, não exigem necessariamente várias
partes e parece haver (pelo menos à primeira vista) meios para montá-los
de forma gradual. Ainda assim, com um exame mais atento, surgem sérios
problemas. Descobrimos que transições supostamente suaves são efémeras
quando conferidas à luz do dia. Desse modo, embora alguns sistemas nãc
sejam de complexidade irredutível, isso não significa necessariamente qu(
EXAMINANDO O CONTEÚDO DA CAIXA 147
eles foram montados à maneira darwiniana. Tal como para a marmota que
tenta atravessar uma estrada de mil pistas, não há uma barreira absoluta à
montagem gradual de alguns sistemas bioquímicos. Mas as probabilidades
de tudo sair errado são esmagadoras.
As grandes moléculas que realizam o trabalho na célula as proteínas e
os ácidos nucleicos são polímeros (isto é, são constituídos de unidades
separadas, organizadas em fila). Os blocos de armar das proteínas são os
aminoácidos e os dos ácidos nucleicos são os nucleotídeos. Tais como
contas que se encaixam umas nas outras para formar um colar, aminoácidos
e nucleotídeos podem ser enfileirados para produzir uma variedade quase
infinita de moléculas. Mas de onde vêm as contas? Contas que se encaixam
com um estalo são produzidas em fábricas, e ninguém as encontra por acaso,
brotando da terra. A fábrica produz as contas em formas específicas, de
modo que o pequeno orifício em uma extremidade é do tamanho exato do
pequeno pino que se projeta do outro lado. Se o pino é grande demais, as
contas não podem ser ligadas; se os orifícios são largos demais, o colar se
desmancha. O fabricante de contas toma muito cuidado para modelá-las na
forma correia e usar o tipo certo de plástico. A célula também é muito
cuidadosa na fabricação de seus blocos de armar.
O ADN, o mais famoso dos ácidos nucleicos, é constituído de quatro tipos
de nucleotídeos: A, c, G e T.1 Neste capítulo, trataremos principalmente do
bloco de armar A. Quando não está ligado a um polímero, o bloco pode ter
várias formas, designadas como amp, adp, ou atp. A primeira forma
sintetizada na célula é o amp. Tal como contas, o amp é fabricado com
cuidado. A maioria das moléculas em organismos biológicos é feita de
apenas alguns tipos diferentes de átomos, e o amp não constitui exceção. É
constituído de cinco tipos diferentes: 10 de carbono, 11 de hidrogénio, 7 de
oxigénio, 4 de nitrogénio e l de fósforo.
Utilizamos a analogia de contas para explicar como os aminoácidos e os
nucleotídeos são reunidos em longas correntes. Afim de compreendermos
bem como o amp é sintetizado, lembremo-nos de um brinquedo como o
Tinkertoys. No caso dos leitores que não os conhecem bem, os Tinkertoys
têm dois tipos de peças rodas de madeira com orifícios na borda e no
centro, e varetas de madeira com o mesmo diâmetro dos orifícios. Enfiando
as varetas nos orifícios, podemos ligar várias rodas. Usando mais varetas e
rodas podemos formar um conjunto completo. As estruturas que podemos
construir apenas com esses dois tipos de peças de castelos e carros a

148 A CAIXA PRETA DE DARWIN


casas de boneca e pontes são limitadas apenas por nossa imaginação. Oi
átomos são como peças de um jogo de Tinkertoys: são as rodas de madeira
e os laços químicos formados entre eles são as varetas. Tal como c
Tinkertoys, os átomos podem ser reunidos para construir muitas forma;
diferentes. A grande diferença, porém, é que a célula é uma máquina, d
modo que o mecanismo necessário para montar as moléculas da vida tem
de ser automatizada. Imagine a complexidade de uma máquina que pudesse,
usando técnicas de automação, montar Tinkertoys, dando-lhes, digamos, a
forma de um castelo! O mecanismo usado pela célula para fazer o amp é
automatizado e, como se poderia esperar, nada simples.
Átomos são quase sempre encontrados nas moléculas; eles não andam
soltos por aí como peças de brinquedo de armar. Dessa maneira, para
fabricar uma nova molécula, em geral, temos que utilizar velhas moléculas
e ligá-las. Isso é semelhante a tirar uma torre de um castelo de Tinkertoy e
usá-la para fazer a carroceria de um carro. Analogamente, novas moléculas
são construídas com peças de outras mais antigas. As moléculas usadas para
construir o amp têm, sem exceção, nomes químicos compridos e maçantes.
Não iremos utilizá-los, a menos que obrigados. Em vez disso, apenas
descreveremos as moléculas por suas funções e lhes daremos nomes
inócuos, como "Intermediária III" e "Enzima vil".
A Figura 7-1 mostra as moléculas que participam da síntese gradual. A
maioria dos leitores provavelmente achará a descrição no texto muito mais
fácil de seguir, se consultar com frequência a figura. Mas não se preocupe
não vou falar em conceitos esotéricos, mas apenas dizer quem está
conectado a quem. O objetivo é compreender a complexidade do sistema,
notar o número de passos requeridos, observar a especificidade dos com-
ponentes que reagem entre si. A formação de moléculas biológicas não
acontece de uma forma confusa, no estilo de Calvin e Haroldo. Na verdade,
existem robôs moleculares específicos, altamente sofisticados, para realizar
o trabalho. Insisto que o leitor dê uma olhada nas duas seções seguintes, e
se maravilhe.
COMEÇA A CONSTRUÇÃO
Q Para construir uma casa precisamos de energia. As vezes a energia
está apenas nos músculos dos operários; em outras ocasiões, porém,
assume a forma da gasolina, que move escavadeiras, ou eletricidade, que
aciona furadeiras. A célula precisa de energia para fabricar o amp. A
energia chega em pacotes separados, que denominaremos "bolinhas de
energia". Pense nelas como barras moleculares de chocolate, que fome-
EXAMINANDO O CONTEÚDO DA CAIXA 149
IGURA 7-1
iiossíntese DO AMP. A FIGURA COMEÇA COM O INTERMEDIÁRIO III. F REPRESENTA
S "FUNDAÇÕES" - RIBOSE-5-FOSFATO. Os QUADRADOS BRANCOS SÃO ÁTOMOS DE
ITROGÊNIO, OS PRETOS DE CARBONO, E OS CINZENTOS DE OXIGÉNIO. Os ÁTOMOS
ECEBEM NÚMEROS NA ORDEM EM QUE SÃO ADICIONADOS. SÓ OS ÁTOMOS QUE FARAÓ
ARTE DO PRODUTO FINAL SÁO NUMERADOS. ÁTOMOS QUE SÃO ADICIONADOS, MAS
UBSTITUÍDOS OU REMOVIDOS POSTERIORMENTE, ESTÃO ASSINALADOS COM UM X.

.íll B

1-111 El
F
1-VII ?H
r- Q-E-
F
i-xi -B
r" B&srB-ro1

F
E-III

E-Vil

E-XI

l-IV
i-viii sã

"V-
11 l VM
r-]X B
[fij H

F
[fir°-G]'
F

E-IV

E -VIII

E-XII

y jl-R-H-R-H Fi

31151 n"3 Efil Kifl E*s RJ M ittl


v ,iv Sfa s
? H '-'x H-E .a
B-B B B El
1-XIII
Q

? Er8-
c ilsà i
' F
B
Ër0-

E-V

E-IX
1

E-IX

1-
a es .
? í
l l E-VI

150 A CAIXA PRETA DE DARWIN


cem energia aos músculos, ou galões de gasolina, que alimentam máqui-
nas. Há vários tipos de bolinhas de energia, incluindo o atp e o gtp. Não
se preocupe com seus formatos ou como funcionam. Mencionaremos
apenas em que passos precisamos delas.
Os dois primeiros passos na síntese do amp são mostrados na Figu-
ra 7-1 eles acontecem nos bastidores. Da mesma maneira que a
construção de uma casa começa com as fundações, o mesmo ocorre com
a síntese do amp. As fundações têm a forma de uma molécula complicada
cuja síntese não vamos discutir. Essa molécula consiste de um anel de
átomos: quatro de carbono e um de oxigénio. A três dos anéis de carbono
é ligado um átomo de oxigénio. O quarto átomo de carbono no anel é
ligado a outro de carbono, ao qual é conectado um átomo de oxigénio,
que por sua vez se liga a um de fósforo com três átomos de oxigénio. No
primeiro passo da síntese do amp, um grupo formado por dois átomos
de fósforo e seis de oxigénio é transferido en masse pela Enzima l para
um dos átomos de oxigénio das fundações, a fim de fabricar o Interme-
diário li. Essa operação requer uma bolinha de energia de atp. O
Intermediário li é usado pelo corpo como ponto de partida para a
fabricação de várias moléculas diferentes, incluindo o amp.
No passo seguinte, a Enzima II toma um átomo de nitrogénio do
aminoácido glu lamina e insere-o em um anel de átomos de carbono, para
obter o Intermediário III. No mesmo passo, o grupo fósforooxigénio,
que estava ligado no último passo, é descartado. E este o ponto em que
a Figura 7-1 passa a contar a história. Para torná-la mais fácil de seguir,
representaremos as fundações pela letra F. Assim, neste ponto da Figu-
ra l, vemos um átomo de nitrogénio ligado à letra F.2 Os átomos de
nitrogénio aparecem em branco na figura, os de carbono em preto e os
de oxigénio em cinza. Os átomos que terminarão no produto final (amp)
recebem números, de acordo com a ordem em que são adicionados. Os
que não terminam no amp são marcados com um "x".
Sob a orientação da Enzima 111, um aminoácido denominado glicina
(que consiste de um átomo de nitrogénio ligado a um de carbono, que
está ligado a outro de carbono, por sua vez ligado a dois de oxigénio)
desliza para dentro e se encadeia com o átomo de nitrogénio do Interme-
diário III através de um dos átomos de carbono. Esse processo usa uma
bolinha de energia do atp. Durante essa ação, um dos dois átomos de
oxigénio, originalmente ligado ao carbono n° 2, é descartado. A essa
altura a molécula dá a impressão de que as fundações têm uma cauda
que se agita à brisa. O produto acabado, o amp, terá uma aparência muito
diferente: dois anéis duros, fundidos, ligados às fundações. A fim de
EXAMINANDO O CONTEÚDO DA CAIXA 151
chegar lá a partir de onde estamos agora, a molécula tem de ser quimi-
camente preparada na ordem correia.
No passo seguinte, uma molécula de ácido fórmico (na verdade, o íon
correlato, o formato), que consiste de dois átomos de oxigénio ligados a
um átomo de carbono, une-se ao átomo de nitrogénio n° 4 do Interme-
diário IV para formar o Intermediário v. No processo, um dos átomos de
oxigénio do formato é descartado. De modo geral, o formato é inerte, de
modo que fazer com que se encadeie com outras moléculas requer
alguma preparação. Um livro de bioquímica enfatiza esse problema:
Formato... é muito inerte em condições fisiológicas e tem que ser ativado
para servir como agente eficiente da formulação... A importância fun-
damental do (iw) consiste em manter o formaldeído e o formato em estados
quimicamente equilibrados, não tão reativos que representem ameaças
tóxicas para a célula, mas disponíveis para processos essenciais através de
ação enzimática específica.3
Felizmente, como observa a citação, o formato não está simplesmente
flutuando ao léu na solução. Liga-se primeiro a uma vitamina denomi-
nada thf, uma prima do ácido fólico da vitamina B (nem mesmo pergunte
como a vitamina é sintetizada). Quando ligada por uma enzima à
vitamina (em uma reação que requer uma bolinha de energia do atp), o
formato é acelerado e preparado para ação. O complexo THF-formato,
contudo, não se ligaria ao Intermediário ivpara produzir o Intermediário
v, a menos que orientado a assim fazer pela Enzima iv: ele flutuaria para
longe da célula, até que reagisse com outra coisa ou se dissolvesse, e isso
bagunçaria nossa síntese do amp. Esse fato não acontece, porém, porque
a enzima orienta a reação para os produtos correios.
O passo seguinte consiste em substituir o átomo de oxigénio enca-
deado ao carbono n° 2 do Intermediário v por um átomo de nitrogénio.
Isso pode ser feito quimicamente expondo-se a molécula à amónia
mas não podemos apenas jogar amónia dentro da célula, porque ela
reagiria de má vontade com um bocado de coisas com as quais não
deveria reagir. Em vista disso, parte de um aminoácido é usada para doar
o átomo de nitrogénio necessário. O aminoácido glutamina, sob o olhar
vigilante da Enzima v, aproxima-se do Intermediário v, de maneira que
o nitrogénio do aminoácido fique próximo do primeiro átomo de oxigé-
nio do Intermediário v. Graças à feitiçaria catalítica, pela qual as enzimas
são famosas, o átomo de nitrogénio salta do aminoácido, o oxigénio é
chutado para fora do Intermediário v e o átomo de nitrogénio assume
152 A CAIXA PRETA DE DARWIN
seu lugar para produzir o Intermediário vi. Este passo utiliza uma bolinhi
de energia do atp. Q
Q O passo seguinte quando estamos construindo uma molécula de AM
é semelhante, em alguns aspectos, ao último passo. Mais uma vez, vamo
tomar um átomo de nitrogénio e usá-lo para substituir um átomo d
oxigénio, que está ligado a um átomo de carbono e, mais uma vez, est
passo usa uma bolinha de energia do atp. Desta vez, porém, não temo
que trazer de fora um átomo de nitrogénio. Em vez disso, vamos usar o
nitrogénio n° l que já estápresente em nossa molécula. O primeiro átomo
de nitrogénio que foi posto nas fundações o que chutou para fora o
grupo fósforooxigénio há alguns passos atrás agora entra em ação
Toma o lugar do átomo de oxigénio, que é o último da cadeia. Mas, ao
contrário do nitrogénio que veio do aminoácido no passo anterior, este
não rompe nenhum de seus laços com os outros átomos. Forma simples-
mente um novo átomo, como foi visto no Intermediário vil. Uma coisa
interessante nesse arranjo é que ele agora faz um anel de átomos. O ane
tem cinco membros, com dois grupos projetando-se dele. O primeiro é
o nitrogénio n° 6, que nos foi apresentado no último passo, e o segundo
grupo constitui as fundações.
Quando sacudimos uma lata de bebida gasosa e abrimos a tampa
geralmente somos borrifados pelo líquido. O borrifo é provocado pela
liberação súbita do gás dióxido de carbono que estava dissolvido no lí-
quido. Também há um pouco de dióxido de carbono dissolvido no fluido
celular (embora um animal não costume borbulhar quando sacudido), e
ele pode ser usado em reações bioquímicas. Isso é bom, porque o passo
seguinte na síntese do amp requer dióxido de carbono. Na reação, a
molécula do gás (na verdade, seu equivalente encharcado de água, o
bicarbonato) é colocada pela Enzima vil no carbono n° 3 para fabricar o
Intermediário viu. Uma bolinha de energia do atp aciona esse passo.4
Agora, chegou a hora de adicionar outro átomo de amónia. Este passo
também usará uma bolinha de energia do atp. Tal como na última vez
que em que a amónia foi adicionada, ela não será encontrada flutuando
livre na solução (como aconteceu com o dióxido de carbono): será doada
por um aminoácido. Mas, dessa vez, será o aminoácido chamado ácido
aspártico. E, outra novidade, o átomo de nitrogénio não deixa o aminoá-
cido quando reage com o Intermediário viu: conseguimos o nitrogénio
que queremos, mas também uma feia cadeia extra de átomos pendurados

EXAMINANDO O CONTEÚDO DA CAIXA 153


na extremidade do Intermediário ix. A Enzima ix remove o apêndice
indesejável, serrando apenas a parte estranha.
O resultado, o Intermediário x, é uma molécula construída pela
metade. Outra molécula de formato ativado mais uma vez encadeada
a uma vitamina é ligada ao nitrogénio n° 6 do Intermediário x para
produzir o Intermediário xi. No passo seguinte, a Enzima XI instrui o
nitrogénio n° 8 a chutar para longe o oxigénio do formato que acaba de
ser anexado, a fim de formar um laço com o carbono n° 9, o que resulta
no Intermediário xn. Uma vez que o nitrogénio que reage não rompe seu
laço com o carbono ao qual foi inicialmente ligado, a reação forma outro
anel. Os dois anéis fundidos do Intermediário xn são rígidos, e não moles
como as correntes de átomos que precederam sua formação. A forma-
ção do anel de seis membros nesse passo é semelhante à formação do
anel de cinco membros vários passos atrás, e a reação do formato no
último passo é quimicamente semelhante à prévia adição do mesmo.
Mas mesmo que os dois conjuntos de passos sejam semelhantes, eles
são catalisados por dois diferentes conjuntos de enzimas. Isso é neces-
sário porque a forma da molécula mudou durante a síntese, e as enzimas
frequentemente são sensíveis a mudanças de forma.
O Intermediário xil é um nucleotídeo denominado imp, que é usado
em algumas biomoléculas (como, por exemplo, em um tipo especial de
arn que ajuda a proteína a conter um pouco de imp). Formar amp de imp
requer uns poucos passos diferentes que são mostrados na Figura 7-1.
Em um passo que lembra outro anterior, a Enzima xil une uma molécula
do aminoácido ácido aspártico ao anel de seis membros, expulsando o
átomo de oxigénio com o átomo de nitrogénio da molécula que chega.
Essa ação produz o Intermediário xill. A reação usa uma bolinha de
energia, mas não atp. Em vez disso, por razões que discutiremos depois,
ela usa gtp. Mais uma vez, como aconteceu na última vez em que o ácido
aspártico foi usado, o passo nos deixa com um apêndice feio e prejudi-
cial. A Enzima IX volta (a única enzima usada duas vezes na via) para
cortar a parte dispensável e deixar o necessário átomo de nitrogénio.
Finalmente, temos o amp um dos "blocos de armar" dos ácidos
nucleicos. Q
chegando lá
Suponho que já perdi a maioria de meus leitores no labirinto, portanto peço
que me deixem bancar o contador e fazer o balanço da biossíntese do amp.
A síntese ocupa 13 passos e dela participam 12 enzimas; uma delas, a ix,
IS4 A CAIXA PRETA DE DARWIN
catalisa dois passos. Além da molécula das fundações, a ribose-5-fosfato,
síntese requer que cinco moléculas do atp forneçam energia para ativar a
reações químicas nos vários passos: uma molécula de gtp; uma de dióxid
de carbono; duas de glutamina, para doar átomos de nitrogénio em dife
rentes passos; uma de glicina; dois grupos de formil do thf em etapa
separadas; e duas moléculas de ácido aspártico, que doa átomos de nitre
génio em mais duas etapas. Além disso, em dois passos distintos, os reste
das moléculas do ácido aspártico têm que ser retirados e, em dois passe
separados, partes da molécula em crescimento têm que reagir entre si pan
fechar os dois anéis. Todos os treze passos ocorrem para produzir simples
mente um tipo de molécula. As moléculas precursoras ao longo do caminhe
sintético os Intermediários m a xi não desempenham papel indepen
dente, nem são usadas para nada mais do que para fabricar o amp ou o gmp
Todos os caminhos levam a Roma, diz o ditado, e, da mesma forma, ha
muitas maneiras de sintetizar o amp. Um livro de química que tenho em
minha estante menciona oito diferentes modos de fabricar adenina (que é
parte superior do amp, sem as fundações).5 O resto da molécula também
pode ser reunido de várias maneiras. Químicos que querem sintetiza
adenina, no entanto, usam rotas inteiramente diferentes das tomadas pel
célula. Uma vez que implicam reações em líquidos oleosos, em extremo
de acidez, essas condições causariam a morte rápida de qualquer organismo
conhecido.
No início da década de 1960, cientistas interessados na origem da vid
descobriram uma maneira interessante de sintetizar adenina.6 Eles notaram
que as simples moléculas de cianeto de hidrogénio e amónia que s
acredita terem sido abundantes nos primórdios da Terra formara
adenina nas condições certas. A facilidade da reação impressionou Stanie
Miller de tal maneira que ele a chamou de "a rocha da fé" para o
pesquisadores da origem da vida.7 Mas um problema se esconde em
segundo plano: o cianeto de hidrogénio e a amónia não são usados n
biossíntese do amp. Mesmo que existissem na antiga Terra, e ainda que iss
tivesse algo a ver com a origem da vida (o que é problemático por algumas
outras razões), a síntese da adenina a partir de moléculas simples no frase
do químico não nos fornece informação nenhuma sobre como surgiu o
caminho para fabricar a molécula na célula.
Staniey Miller ficou impressionado com a facilidade da síntese da
adenina a partir de moléculas simples, mas a célula evita a síntese simples.
Na verdade, se dissolvêssemos em água (usando os nomes químicos
formais) ribose-5-fosfato, glutamina, ácido aspártico, glicina, wlO-formil-
thf, dióxido de carbono e pacotes de energia de atp e gtp todas as
examinando O CONTEÚDO DA CAIXA 155
pequenas moléculas que são usadas pela célula para construir o amp e
is deixássemos em repouso por um longo tempo (digamos, mil ou um
nilhão de anos), não conseguiríamos qualquer AMP.8 Se Staniey Miller
nisturasse esses elementos químicos na esperança de descobrir outra rocha
aara a fé, ficaria muito desapontado.
Sapatos podem ser tudo de que necessitamos para ir de Milão a Roma,
nas precisaremos de mais do que isso para ir de Roma à Sicília; vamos
precisar de um barco. E para chegar a Roma vindo de Marte, será preciso
im equipamento de alta tecnologia. Para produzir amp com os ingredientes
isados pela célula também precisamos de equipamento de tecnologia muito
ivançada: as enzimas que catalisam as reações da via usada. Na ausência
ias enzimas, o amp simplesmente não é fabricado pelas reações mostradas
ia Figura 7-1.0 importante é que mesmo que adenina ou amp possam ser
Cabricados-por caminhos simples, esses caminhos não são precursores da
rota biológica da síntese, da mesma forma que sapatos não são precursores
ie naves espaciais.
consideremos uma via metabólica através da qual o composto A é trans-
ormado no composto D, passando pêlos intermediários B e c. Poderia esse
;aminho ter evoluído gradualmente? Depende. Se A, B e c são compostos
iteis para a célula, e se nem B, nem c ou D são essenciais desde o início,
ntão, talvez, um desenvolvimento lento seja possível. Nesse exemplo,
iodemos imaginar uma célula que produziu A, fazendo sem pressa uma
nutação, de modo que, feliz e inesperadamente, o composto B é produzido.
ie ele não fosse prejudicial, quem sabe com o tempo a célula descobrisse
im uso para o composto B. E, em seguida, talvez, o cenário pudesse se
epetir. Uma mutação aleatória levaria a célula a produzir c a partir de B,
-.eria descoberto um uso para c, e assim por diante.
Suponhamos, contudo, que D é necessário desde o começo. O amp,
necessário à vida na terra, é usado para fabricar o adn e o arn, bem como
algumas outras moléculas de importância crucial. É possível haver uma
maneira de construir um sistema vivo que não precise de amp; mas, se esse
meio existe, ninguém tem ainda uma pista de como criá-lo. O problema
com a evolução darwiniana é o seguinte: se apenas o produto final de uma
complicada via de biossíntese é usado na célula, de que modo a via evoluiu
em etapas? Se A, B e c não têm outro uso que o de precursores de D, que
vantagem haveria para um organismo em fabricar apenas A? Ou, se fabrica
A, fabricar B? Se uma célula precisa de amp, que proveito ela terá em fabricar
156 A CAIXA PRETA DE DARWIN
o Intermediário III, ou iv, ou v? Aparentemente, vias metabólicas em qi
intermediários não são usados lançam sérios desafios a uma esquen
darwiniano de evolução. Essa condição é fundamental no caso de algo com
o amp, porque a célula não tem opção: o amp é necessário à vida. Ou el
tem um meio de produzir ou obter imediatamente o amp, ou morre.
Alguns livros mencionam esse problema. A explicação típica é dada d
forma resumida por Thomas Creighton:
De que maneira a complexidade bioquímica das vias metabólicas pode ta
evoluído? No caso das vias biossintéticas que produzem os blocos de arma
dos aminoácidos, nucleotídeos, açúcares, e assim por diante, é provável qu
esses blocos estivessem originalmente presentes na sopa primordial e qu.
tivessem sido usados diretamente. Amedidaqueaq uantidade de organismos
aumentava, contudo, esses elementos constituintes teriam se tornado escas-
sos. Qualquer organismo que pudesse produzir um deles a partir de algum
componente não usado da sopa primordial, utilizando uma enzima recém-
surgida, teria uma vantagem seletiva. Logo que a disponibilidade desse
componente se tornasse limitada, teria havido seleção de qualquer organis-
mo que o pudesse produzir a partir de algum outro componente da sopa. De
acordo com esse cenário, as enzimas das vias metabólicas teriam evoluído
em uma sequência oposta à que seguem na via moderna.9
Em outras palavras, Creighton diz que se encontramos em um organismo
moderno uma via de reação que vai de A - B -» c »D, então D existia na
sopa primordial sintetizado por precursores químicos simples, sem o
benefício de enzimas. Diminuindo o suprimento de D, algum organismo
"aprenderia" a fabricar d a partir de c. Quando c acabasse, ele aprenderia a
fazê-lo com B. Quando a fome ameaçasse mais uma vez, ele aprenderia a
fazer B com A, e assim por diante. O mesmo esquema é descrito em
Molecular Biology ofthe Cell, um texto popular escrito por James Watson,
ganhador do prémio Nobel, pelo presidente da Academia Nacional de
Ciências, Bruce Alberts, e vários outros co-autores. Somos informados na
legenda de uma figura que a célula primordial
é abastecida por um suprimento de substâncias afins (a, b, c e o), produzidas
por síntese pré-biótica. Uma delas, a substância d, é metabolicamente útil.
Quando a célula esgota o suprimento disponível de d, uma vantagem seletiva
é obtida através da evolução de uma nova enzima que pode produzir d a
partir da substância c, uma aparentada muito próxima.10
Sim, todos concordam que se D acabou, a coisa a fazer é fabricá-lo a partir
de c. E, é claro, deve ser simples converter b em c. Afinal de contas, elas

EXAMINANDO O CONTEÚDO DA CAIXA 157


estão bem perto umas das outras no alfabeto. E onde conseguimos A, B e o
resto? No alfabeto da sopa primordial, lógico.
O fato é que ninguém jamais deu nomes químicos reais a qualquer das
letras míticas na história a » B » c » D. Nos livros mencionados acima,
as explicações em forma de desenho não são mais desenvolvidas, apesar
desses livros serem usados por estudantes de doutorado que teriam facili-
dade para compreender explicações detalhadas. Com certeza não é nada
complicado imaginar que a sopa primordial poderia ter incluído um pouco
de c, que estaria flutuando à toa e que poderia ser facilmente convertido em
D. Calvin e Haroldo imaginariam isso sem a menor dificuldade. É muito
mais difícil, no entanto, acreditar que havia muito adenilossucionato (Inter-
mediário xill) para ser convertido em amp. E é ainda mais difícil crer que a
carboxaminoimidazola ribotide (Intermediário viu) estava sentada por ali,
esperando para ser convertida em 5-aminoimidazola-4-(-sucinilocarboxa-
mida) ribotide (Intermediário ix). E difícil de acreditar porque quando
damos nomes reais a elementos químicos temos que descobrir uma reação
química real que possa produzi-los. Ninguém fez isso.
Há inúmeros problemas com a teoria A » b » c » d. Vejamos alguns
dos mais importantes. Em primeiro lugar, com exceção do Intermediário x,
experimentos de síntese pré-biótica não produziram nenhum dos interme-
diários presentes na biossíntese do amp." Embora seja possível produzir
adenina pela reação entre amónia e cianeto de hidrogénio, isso não pode ser
feito com os precursores bioquímicos da adenina. Em segundo lugar, há
boas razões químicas para pensar que os intermediários na via bioquímica
não podem ser fabricados, exceto sob orientação cuidadosa de enzimas. Se
as enzimas certas, por exemplo, não estivessem disponíveis para dirigir as
reações que levam aos Intermediários v e XI, o formato, com toda probabi-
lidade, reagiria de maneiras não produtivas, e não nos modos necessários
para fabricar o amp. Note-se que essas enzimas teriam que estar disponíveis
antes que as enzimas para as etapas seguintes pudessem ser desenvolvidas,
pois, de outra forma, as enzimas posteriores não teriam nada com que
trabalhar. Além do mais, os passos que exigem bolinhas de energia precisam
ser cuidadosamente orientados, evitando dispêndio de energia em alguma
coisa inútil. A energia da gasolina, por exemplo, pode fazer com que um
carro se mova porque é canalizada da maneira correia por uma máquina
complexa; queimar gasolina em uma poça embaixo do carro não o faz se
mover. Amenos que houvesse uma enzima orientando o uso da bolinha de
energiaATP, a energia seria desperdiçada. Note mais uma vez que as enzimas
necessárias para orientar esses passos teriam que existir antes de o organis-
mo poder ter o elemento químico que é fabricado no passo seguinte da via.
158 A CAIXA PRETA DE DARWIN
O terceiro problema com oA-»B-»c-*Dé que alguns dos intermediá-
rios na via são quimicamente instáveis. De modo que mesmo se contra to-
das as probabilidades eles fossem fabricados em uma reação pré-biótica não
orientada, os intermediários rapidamente se desintegrariam ou reagiriam da
maneira errada e, mais uma vez, não estariam disponíveis para continuar a
via. Outras razões poderiam ser citadas contra oa-»b-»c-*d, mas
essas já são suficientes.
Há alguns anos li The Closing oftheAmericanMind, de Allan Bloom. Fiquei
espantado com sua alegação de que muitas ideias americanas modernas têm
raízes em velhas filosofias europeias. Em particular, fiquei surpreso ao saber
que a canção "Mack the Knife" era tradução de uma canção alemã, "Mackie
Messer", cuja inspiração Bloom diz remontar ao "prazer da faca" do
assassino, que Nietzsche descreve em Assim falou Zaratustra.11 Amaioria
de nós gosta de pensar que nossas ideias são nossas mesmo ou, pelo
menos, se foram propostas por alguém, que só concordamos com elas após
análise e assentimento conscientes. E desanimador pensar, como afirmou
Bloom, que muitas de nossas ideias importantes sobre a maneira como o
mundo funciona foram simplesmente captadas, sem nenhum exame, do
ambiente cultural em que vivemos.
A teoria A-»B-»c-»Dé uma velha ideia que foi transmitida adiante
sem que ninguém se desse ao trabalho de pensar muito sobre ela. Foi
proposta em 1945 por N.H. Horowitz, em Proceedings of the National
Academy ofSciences. Horowitz identifica o problema:
Uma vez que a seleção natural não pode preservar características não-fun-
cionais, a implicação mais óbvia dos fatos parece ser a de que uma evolução
gradual de biossínteses, através da seleção de uma única mutação de gene
de cada vez, é impossível.13
Mas há esperança:
Em essência, a hipótese proposta afirma que a evolução das sínteses básicas
ocorreu em passos graduais envolvendo uma única mutação de cada vez,
mas que a ordem em que foram dados os passos individuais ocorreu na
direção inversa daquela em que ocorre a síntese, isto é, o último passo na
corrente foi o primeiro a ser dado no curso da evolução, com o penúltimo
passo em seguida, e assim por diante. Esse processo exige, para sua
operação, um tipo especial de ambiente químico, isto é, um ambiente no

EXAMINANDO O CONTEÚDO DA CAIXA 159


qual produtos finais e intermediários potenciais estejam presentes. Adiando
por ora a questão de como esse ambiente surgiu, consideremos a operação
do mecanismo proposto. Supõe ele, desde o início, que a espécie requer uma
molécula orgânica essencial, d... Como resultado da atividade biológica, o
volume de d disponível é esgotado a um ponto em que limita o crescimento
posterior da espécie. Nesse ponto, uma vantagem seletiva importante será
desfrutada por mutantes que possam realizar a reação b+c = d... Com o
passar do tempo, b torna-se limitador para a espécie, o que toma necessária
sua síntese a partir de outras substâncias.14
Aí está a fonte da explicação do desenvolvimento das vias bioquímicas
dadas pêlos livros modernos. Mas qual era o estado da ciência nos dias de
Horowitz? Em 1945, ano em que esse artigo foi publicado, a natureza do
gene era desconhecida, como também as estruturas dos ácidos nucleicos e
das proteínas. Ainda não havia sido feito nenhum experimento para verificar
se o "tipo especial de ambiente químico" postulado por Horowitz era pos-
sível. Desde então a bioquímica progrediu enonnemente, mas nenhum
avanço apoia a hipótese que ele propôs. Sabe-se que as estruturas dos genes
e das proteínas são muito mais complicadas do que se pensava na época de
Horowitz. Há boas razões químicas para se pensar que os intermediários
na síntese do amp não existiriam fora da célula viva e nenhum experimento
provou o contrário. O "momento" para o qual Horowitz adiou a "questão de
como esse ambiente surgiu" já chega hoje a mais de cinquenta anos. A
despeito das dificuldades evidentes, a velha história é repetida nos livros,
como se fosse tão óbvia quanto nosso nariz. O progresso de cinco décadas
não provocou qualquer abalo na sabedoria consagrada. Lendo os textos
modernos, podemos quase ouvir os acordes persistentes de "Mack the
Knife".
Embora os livros repisem a ideia padrão, algumas pessoas estão insatis-
feitas. O laureado Nobel, Christian de Duve, em seu livro Blueprintfor a
Cell, mostra-se cético quanto à importância da via cianeto de hidrogé-
nioamónia. Em vez disso, ele sugere que o amp surgiu através de "vias
protometabólicas", nas quais muitas pequenas proteínas simplesmente
tinham capacidade de produzir muitos elementos químicos diferentes,
alguns dos quais eram intermediários na via do amp. Para ilustrar sua teoria,
ele usa uma figura na qual setas apontam a partir das palavras sínteses
abióticas para as letras a, B, c e D. Mas, desbravando novo território, ele
usa setas que apontam de A, B, c e d para m, N, s, T e w, e destas para p, o,
Q, R e u. Ao lado de cada seta, escreveu Cat (como abreviatura de "catalis-
ta"), a fim de mostrar como surgiram as letras, mas isso não é explicação:
a única "prova" do esquema é a própria figura! Em parte alguma ele ou
160 A CAIXA PRETA DE DARWIN
qualquer outro pesquisador dão os nomes de elementos químicos reais
letras míticas. Pesquisadores da origem da vida nunca demonstraram qi
os intermediários na síntese do amp teriam existido, ou poderiam t
existido, em uma sopa pré-biótica, quanto mais enzimas sofisticadas pá
interconverter os intermediários. Não há prova de que as letras existam e
qualquer outro lugar além da mente de Duve.
Outro cientista inquieto é Stuart Kauffman, do Santa Fe Institute.
complexidade do metabolismo de organismos vivos leva-o a duvidar qi
um enfoque gradual funcione:
Para funcionar um metabolismo tem que ser, no mínimo, uma ser
conectada de transformações catalisadas, levando do alimento aos pn
dutos necessários. De modo oposto, contudo, sem a rede conectora pá
manter o fluxo de energia e produtos, de que maneira poderia ter havic
uma entidade viva que fizesse a evolução de vias metabólicas conect
das?15
Com o objetivo de responder à sua própria pergunta, ele propõe, em termc
sumamente matemáticos, algo semelhante à ideia com que brincou de duv(
uma mistura complexa na qual alguns elementos químicos são por aças
transformados em outros, que são transformados em mais outros e, c
alguma maneira, isso forma uma rede auto-sustentadora. Fica claro por seu
trabalhos que Kauf&nan é um indivíduo muito inteligente, embora
conexão entre sua matemática e a química seja, na melhor das hipótese;
muito ténue. Kauffman discute essas ideias em um capítulo intitulado "i
origem de um metabolismo conectado", mas, se lermos o capítulo d
começo ao fim, não descobrimos o nome de um único elemento químico
nenhum amp, nenhum ácido aspártico, nada. Na verdade, se examinarmo
todo o índice de assuntos do livro, também não encontraremos o nome ('
um elemento químico. John Maynard Smith, antigo mentor de Kauf&na
acusou-o de praticar "ciência sem fatos".16 Trata-se de uma acusaçã
pesada, mas a falta completa de detalhes químicos no livro parece justifica
a crítica.
Kauffman e de Duve identificam um problema real da evolução gradua
lista. As soluções que eles sugerem, contudo, são meras variações da velh
ideia de Horowitz. Em vez de A -» B -» c -» D, eles simplesmente propõen
a » b » c » d multiplicados cem vezes. Pior ainda, à medida em qu
aumenta o número das letras imaginárias, a tendência é a de nos afastarmo
cada vez mais da química real e ficarmos aprisionados no mundo abstrai
da matemática.

EXCESSO DO BOM
Todas as crianças, mais cedo ou mais tarde, ouvem a história do rei Midas.
O ganancioso rei amava mais o ouro do que qualquer outra coisa, ou pelo
menos era isso que pensava. Quando lhe foi concedido o dom mágico de
transformar em ouro tudo o que tocasse, ele ficou felicíssimo. Vasos antigos,
pedras sem valor, roupas usadas, tudo se transformava em peças belas e de
valor inestimável ao seu toque. Nuvens negras, porém, já podiam ser
avistadas quando Midas tocava belas flores e estas logo perdiam seu
perfume. Ele teve certeza de que estava numa grande enrascada quando o
alimento que tentou comer se transformou em ouro. Finalmente, a loucura
transformou-se em dor quando a filha, a pequena Marygold, abraçou-o e
foi transformada em uma estátua de ouro.
A história do rei Midas contém algumas lições óbvias: não seja ganan-
cioso, amor vale mais que dinheiro ete. Mas há outra lição, menos evidente,
sobre a importância do controle. Não é suficiente ter uma máquina ou
processo (mágicos ou não) que fazem alguma coisa: é preciso poder ligá-los
e desligá-los, conforme a necessidade. Se o rei tivesse desejado o toque de
Midas e a capacidade de ligá-lo e desligá-lo quando quisesse, poderia ter
transmutado algumas pedras em pepitas de ouro, e evitado matar sua filha.
Poderia transformar os pratos em ouro, mas não a comida.
A necessidade de controle é óbvia no caso das máquinas que usamos
na vida diária. Uma serra que não pudesse ser desligada seria um grande
perigo, e um carro sem freios tampouco teria muita utilidade. Sistemas
bioquímicos também são máquinas que usamos na vida diária (quer pen-
semos nelas ou não) e também têm de ser controladas. Afim de ilustrar esse
ponto, vamos passar os três parágrafos seguintes examinando as maneiras
como a síntese do amp é controlada (mostradas na Figura 7-2).
Q A Enzima l requer uma bolinha de energia atp para transformar a
ribose-5-fosfato (as fundações) em Intermediário li. A enzima tem uma
área em sua superfície que pode fixar adp ou gdp quando há excesso
desses elementos químicos na célula. Afixação do adp ou gdp funciona
como uma válvula, reduzindo a atividade da enzima e tomando mais
lenta a síntese do amp. Esse processo faz sentido fisiologicamente: uma
vez que o adp é o resto de um atp gasto (como o estojo de um projétil
depois de disparada a arma), altas concentrações de adp na célula
significam que a concentração de atp, a bolinha de energia celular, é
baixa. Em vez de fabricar amp, o Intermediário i é usado como combus-
tível para produzir mais atp.
l 62 A CAIXA PRETA DE DARWIN
FIGURA 7-2
CONTROLE DA VIA DO AMP. as SETAS EM BRANCO SÓLIDO IN[
MODERAM A SÍNTESE. AS SETAS EM PRETO SÓLIDO INDIC;
Intermediário l
ADP, GDP -f [
Intermediário II
AMP,ADP,ATP, | - Intermediár
GMP, GDP.GTP [
Intermediário III
Intermediário XII
AMP 4 . GTP GMP f'
De modo geral em bioquímica, a primeira enzi;
partida a uma molécula ao longo de uma dada via m(
controlada. Avia do amp não é exceção. Embora o li
ser usado para outras coisas, logo que é transforma
III, a molécula é inevitavelmente impelida para fre
ou para o gnp, por outras enzimas existentes na v;
enzima que catalisa a reação crítica (Enzima li) tam
Enzima li, além de pontos de união para moléculas i
tem em sua superfície dois outros pontos de união:
EXAMINANDO O CONTEÚDO DA CAIXA 163
adp ou atp, e um segundo que fixará gmp, gdp ou gtp. Se um ponto é
ocupado, a enzima trabalha mais lentamente; se ambos o são, ela trabalha
de forma ainda mais lenta. E, além do lugar onde a reação ocorre, a
Enzima n contém outro ponto que fixa o Intermediário li, que é um
reagente. A união do Intermediário li com o segundo ponto faz com que
a enzima trabalhe mais rápido. Mais uma vez esse fato tem uma
importância fisiológica: se houver tanto Intermediário n que ele se ligue
a ambos os pontos da enzima, a célula se atrasa em seu trabalho de síntese
e precisa processar mais rapidamente o Intermediário li.
A síntese é controlada também em vários outros locais. Depois de
fabricado o imp, a via se divide para fabricar amp ou gmp. A Enzima xir,
que catalisa o primeiro passo do imp para o amp, é em si retardada por
volumes excessivos de amp. Analogamente, a catálise do primeiro passo
do imp para o gmp é inibida por excesso de gmp. (Ao contrário do rei
Midas, as enzimas sabem quando já têm quantidade suficiente de uma
coisa boa.) Por fim, a Enzima xil usa o gtp como uma bolinha de energia
porque, se há muito gtp em volta, mais nucleotídeos "A" (amp, adp e
atp) são necessários para manter o suprimento equilibrado. O passo final
da síntese do gmp usa o atp como fonte de energia por razões semelhan-
tes. O
falha DE CONTROLE
Quando o controle do metabolismo falha, o resultado é doença ou morte.
Um exemplo é o diabetes: a entrada de açúcar na célula é retardada mesmo
que as moléculas de açúcar que conseguem entrar sejam, à parte isso,
metabolizadas normalmente. Há uma doença muito menos comum que o
diabetes que tem origem em uma falha no controle da síntese do amp; é a
denominada smdrome de Lesch-Nyhan. Neste caso, falta ou está inativa
uma enzima necessária para reciclar nucleotídeos usados de adn ou arn
degradados. Este fato faz com que o Intermediário n se acumule de forma
indireta. Infelizmente, como mencionado acima, o Intermediário n estimula
a Enzima li que, por sua vez, aumenta a síntese do amp e do gmp. A síntese
aumentada leva à produção de excesso de ácido úrico (produto da decom-
posição do amp e gmp), que sai da solução e se cristaliza. Depósitos
dispersos de cristais de ácido úrico podem perturbar funções corporais
normais, como acontece no caso da gota. Na síndrome Lesch-Nyhan,
contudo, as consequências são mais graves. Elas incluem retardamento
mental e compulsão para a automutilação o paciente morde os lábios e
os dedos.
O controle da biossíntese do amp é um bom exemplo dos complicadr
mecanismos necessários para manter o suprimento de biomoléculas
nível correto: nem demais, nem de menos, e em proporção certa cc
moléculas correlatas. O problema com o gradualismo darwiniano é que i
células não teriam razão para criar mecanismos controladores antes d
aparecimento de um novo catalisador. O aparecimento de uma via nova
não controlada, porém, longe de ser uma bênção, pareceria ao organism
uma doença genética. Isso se aplica a antigas e frágeis células que supo
lamente se desenvolviam passo a passo, e que teriam poucas oportunidadi
de cometer erros. As células seriam esmagadas entre o Cila da falta e i
Caríbdis do controle.
Ninguém tem sequer um palpite sobre a maneira como a via do amp r
desenvolveu. Embora alguns pesquisadores tenham observado que a via e:
si constitui um sério desafio ao gradualismo, ninguém escreveu ainda sob
o obstáculo criado pela necessidade de controlar imediatamente a vi
metabólica da célula, quando de seu surgimento. Mas isso não é surpreen-
dente ninguém quer escrever sobre morte na estrada.
No passado distante, uma célula observa uma grande estrada. No outro
lado há uma via metabólica inteiramente nova. Os caminhões, ônibus,
furgões e motocicletas químicos passam em alta velocidade sem notar a
pequena criatura. Na primeira pista, marcada com "Intermediários não
encontrados na sopa", ela vê os restos da maioria das células mais antigas
que escutaram o canto da sereia. Há também alguns restos celulares na pista
dois marcada com "Mecanismos de direção são necessários". Um ou dois
jazem na terceira pista, "Instabilidade de intermediários". Não há corpos de
células na pista quatro, "Controle". Nenhuma chegou até esse ponto. O
outro lado está, realmente, muito distante.
construção rigorosa
Anona emenda à Constituição dos Estados Unidos estipula que "A enume-
ração de certos direitos na constituição não deve ser interpretada como
negação ou depreciação de outros exercidos pelo povo". Essa é uma
maneira conveniente de dizer que um documento curto não pode ter a
esperança de cobrir todas as bases, de modo que nada é insinuado sobre
coisas que não foram discutidas. Eu gostaria de deixar claro um repúdio
semelhante sobre este livro. Nos Capítulos 3 a 6 discuti vários sistemas
bioquímicos irredutivelmente complexos, descendo a um bocado de deta-
lhes para mostrar por que eles não podiam ser formados de uma forma
gradualista. Os detalhes foram necessários para que o leitor pudesse

EXAMINANDO O CONTEÚDO DA CAIXA 165


compreender exatamente quais são os problemas. Mas como passei muito
tempo comentando esses sistemas, não tive tempo de abordar outros, o que
não implica que eles, também, não constituam problemas para o darwinis-
mo. Há inúmeros outros exemplos de complexidade irredutível, incluindo
aspectos da replicação do adn, o transporte de elétrons, a síntese de
telômeros, a fotossíntese, o controle das cópias e assim por diante. Encorajo
o leitor a pegar emprestado um livro de bioquímica na biblioteca e verificar
quantos problemas a mais pode identificar para o gradualismo.
Este capítulo foi um pouco diferente; tentei demonstrar que não são
apenas os sistemas irredutivelmente complexos que constituem problemas
para o darwinismo. Até sistemas que, à primeira vista, parecem sensíveis a
um enfoque gradualista, acabam por se transformar em grandes dores de
cabeça em um exame mais atento ou quando resultados experimentais
começam a surgir, sem indícios de que possam ser solucionadas sob o
ponto de vista darwiniano.
A ideia originalmente proposta por Horowitz foi boa em sua época.
Poderia ter funcionado; poderia ter sido verdade. Com toda certeza, se uma
via metabólica complexa surgisse gradualmente, o esquema sugerido por
Horowitz poderia ter sido a maneira como isso aconteceu. Mas, à medida
que os anos passavam e a ciência progredia, os requisitos para tal sistema
desmoronaram. Se existe uma explicação darwiniana detalhada para a
produção do amp ninguém sabe qual é. Químicos intransigentes começaram
a afogar suas frustrações na matemática.
O amp não é o único dilema metabólico para Darwin. A biossíntese de
aminoácidos maiores, lipídios, vitaminas, hemes e demais elementos en-
frenta os mesmos problemas, e há outras dificuldades além do metabolismo.
Mas os outros problemas não nos interessam aqui. Desviaremos agora a
atenção da bioquímica per se e nos concentraremos em outros assuntos. Os
obstáculos científicos discutidos nos cinco últimos capítulos servirão como
exemplos evidentes dos abismos e montanhas que bloqueiam a explicação
darwiniana da vida.
PARTE III
O QUE NOS DIZ A CAIXA?

PUBLIQUE OU PEREÇA
Nos Capítulos 3 a 7, analisamos alguns sistemas bioquímicos complexos e
mostramos que ninguém explicou até hoje a origem dos mesmos. Nos Es-
tados Unidos, porém, há dezenas de milhares de cientistas interessados na
base molecular da vida. A maioria passa seu tempo no difícil trabalho de
isolar proteínas, analisar estruturas e esmiuçar os detalhes de como essas
coisas liliputianas funcionam. Ainda assim, alguns se interessam pela evo-
lução e publicam grande volume de trabalhos na literatura científica. Se
sistemas bioquímicos complexos permanecem sem explicação, que tipo de
trabalho bioquímico tem sido publicado sob o título "evolução"? Neste capí-
tulo, o leitor tomará conhecimento do que foi e do que não foi estudado.
Quando a base molecular da vida foi descoberta, o pensamento evolu-
cionista começou a ser aplicado às moléculas. Com o aumento da quanti-
dade de trabalhos de pesquisa nessa área, foi criada uma revista es-
pecializada, aJournal of Molecular Evolution. Fundada em 1971, aJME é
dedicada exclusivamente a pesquisas que procuram explicar como surgiu
a vida no nível molecular. E dirigida por figuras importantes no campo de
estudo. Entre as mais de cinquenta pessoas que constituem o corpo de
consultores editoriais e diretoria, há uma dezena de membros da Academia
Nacional de Ciências. O editor da revista é Emile Zuckerkandi que (junta-
mente com Linus Pauling) foi o primeiro a sugerir que diferenças nas
sequências de aminoácidos de proteínas semelhantes, originárias de dife-
rentes espécies, poderiam ser usadas para determinar o tempo em que as
espécies compartilharam pela última vez um ancestral comum.
Cada edição mensal da jme contém cerca de dez trabalhos científicos
sobre diversos aspectos da evolução molecular. Dez trabalhos por mês
significam mais de uma centena por ano, e cerca de mil por década. Un
levantamento de mil trabalhos em uma dada área pode nos dar uma idéi;
muito boa dos problemas que foram solucionados, dos que estão sendc
estudados, e dos que ainda são ignorados. Um olhar retrospectivo ao longe
da última década mostra que os trabalhos publicados na jme podem sã
divididos facilmente em três categorias distintas: síntese química de molé-
culas julgadas necessárias para a origem da vida, comparações entre se-
quências de adn e proteínas e modelos matemáticos abstratos.
No começo
A questão da origem da vida é de importância e interesse extraordinários. A
biologia, em última análise, terá que responder à seguinte pergunta: Mesmc
que a vida evolua por meio da ação da seleção natural sobre a variação,
como, para começar, surgiu a vida? Trabalhos sobre a síntese química de
moléculas consideradas necessárias para a origem da vida constituem cercí
de 10% de todo o material publicado na jme.
A história de Staniey Miller é uma das mais conhecidas da ciência
moderna. Jovem estudante de pós-gradução depois da Segunda Guerra
Mundial, trabalhando no laboratório de Harold Urey, laureado Nobel, na
Universidade de Chicago, Miller queria descobrir quais elementos quími-
cos poderiam ter estado presentes há bilhões de anos na Terra primitiva e
sem vida. Ele sabia que o hidrogénio é o elemento predominante no
Universo. Quando o hidrogénio reage com carbono, nitrogénio e oxigénio
elementos comuns na Terra formam-se metano, amónia e água. Em
vista disso, Miller resolveu descobrir quais elementos químicos poderiam
ser produzidos por uma atmosfera simulada que contivesse metano, amónia,
vapor d'água e hidrogénio.1
O metano, a amónia, o vapor d'água e o hidrogénio, em geral, são inertes,
Miller sabia que, para conseguir fazer com que os gases produzissem
elementos químicos potencialmente interessantes, teria que bombear algu-
ma energia no sistema para sacudir um pouco as coisas. Os relâmpagos
seriam a fonte de energia que teria estado disponível na Terra primitiva
Assim, Miller construiu no laboratório um aparelho que continha os gases
que considerou estarem presentes na Terra primordial, além de um pouco
de água, e juntou eletrodos para simular os relâmpagos.
Miller ferveu a água e descarregou faíscas na mistura de gases por cerca
de uma semana. Durante esse tempo, um alcatrão oleoso, insolúvel, apare-
ceu nos lados do frasco, e o depósito d'água tornou-se cada vez mais
avermelhado, à medida em que se acumulava material nele. Ao fim da
Miller analisou a mistura de elementos químicos dissolvidos na
escobriu que ela continha vários tipos de aminoácidos. O resultado
l o mundo. Uma vez que os aminoácidos constituem os blocos de
is proteínas, parecia, à primeira vista, que os materiais necessários
tíonstruir as máquinas da vida haviam sido abundantes na Terra
Uva. Cientistas emocionados não tiveram dificuldade em imaginar que
isos naturais poderiam induzir aminoácidos a se reunirem para formar
nas, que algumas das proteínas poderiam catalisar importantes
ss químicas, que as proteínas seriam aprisionadas no interior de
nas membranas semelhantes a células, que ácidos nucleicos seriam
zidos por processos semelhantes e que, aos poucos, a primeira célula
;nte auto-replicante nasceria. Como no caso do Frankenstein da obra
}ão de Mary Shelley, parecia que a circulação de eletricidade através
ateria inanimada poderia, de fato, gerar vida.
.litros cientistas se apressaram em dar continuidade ao trabalho fecundo
itaniey Miller. Ele detectara uns poucos tipos diferentes de aminoácidos
experimento, ao passo que organismos vivos contêm vinte diferentes
8. Outros pesquisadores introduziram variações nas condições experi-
itais de Miller. A mistura de gases na atmosfera simulada foi alterada,
ou-se a fonte de energia de centelha elétrica para radiação ultravioleta
_ m de simular a luz solar), ou pulsos muito fortes de pressão (para simular
piosões). Métodos analíticos mais sofisticados detectaram elementos
faücos que estavam presentes em quantidades muito pequenas. Esforços
tínuos de grande número de pesquisadores acabaram produzindo resul-
-s: quase todos os vinte tipos de aminoácidos que ocorrem naturalmente
Vasa identificados nos experimentos sobre a origem da vida.
Outros sucessos também foram relatados nos primeiros anos de pesquisa
»bre a origem da vida. Talvez os sucessos mais notáveis tenham sido os
trtidos pelo laboratório de Juan Oro. Eles demonstraram que o elemento
jímico simples cianeto de hidrogénio podia reagir consigo mesmo para
8 ar alguns produtos, incluindo a adenina, que é um componente de um
blocos de armar dos ácidos nucleicos. O resultado revelou o adn e o
como alvos da pesquisa química da origem da vida. Ao longo dos anos
ros componentes dos ácidos nucleicos as outras "bases", bem como
'? o açúcar-ribose que forma parte do arn foram produzidos por experi-
mentos de estimulação química.
À luz desses sucessos muito badalados, é compreensível que alguém
que não pertença a essa área de estudo sinta-se chocado quando encontra
por acaso uma análise pessimista da pesquisa sobre a origem da vida na
literatura especializada, tal como a que foi escrita por Klaus Dose, um ilustre
172 A CAIXA PRETA DE DARWIN
profissional nesse campo. Em sua avaliação do problema, Dose não mede
palavras.
Mais de trinta anos de experimentação sobre a origem da vida nos campos
da evolução química e molecular levaram a uma percepção mais clara da
enormidade do problema de seu aparecimento na Terra, em vez de à sua
solução. Atualmente, todas as discussões sobre os principais experimentos
e teorias nesse campo terminam em um impasse ou numa confissão de
ignorância.2
O que leva um profissional desse campo a uma opinião tão pessimista,
sobretudo após os dias embriagantes que se seguiram aos experimentos
pioneiros de Miller? Descobriu-se que os sucessos, embora reais, disfarçam
uma pletora de problemas que só podem ser compreendidos quando leva-
mos a discussão para além da simples produção química de alguns dos
componentes básicos da vida. Vejamos alguns desses problemas.
Fabricar as moléculas da vida através de processos químicos fora da
célula é, na realidade, muito fácil. Qualquer químico competente pode
comprar alguns elementos químicos em uma fornecedora comercial, pesá-
los na proporção correta, dissolvê-los em um solvente apropriado, aque-
cê-los em um frasco durante um período predeterminado de tempo e
purificar o produto químico desejado, separando os elementos químicos que
não quer e que são produzidos por reaçôes colaterais. O químico pode não
somente fabricar aminoácidos e nucleotídeos os blocos de armar mas
também usá-los e construir os próprios edifícios: proteínas e ácidos nuclei-
cos. Na verdade, o processo para se conseguir isso foi automatizado e
máquinas que misturam e fazem com que elementos químicos reajam para
gerar proteínas e ácidos nucleicos são vendidas por várias empresas.
Qualquer estudante de graduação pode ler o manual de instruções e produzir
em um ou dois dias uma longa peça de adn talvez o gene que codifica
uma proteína conhecida.
A maioria dos leitores percebe rapidamente o problema. Não havia
químicos há quatro bilhões de anos. Tampouco havia fornecedores de
produtos químicos, retortas, nem muitos dos outros aparelhos que o químico
moderno usa diariamente em seu laboratório e que são necessários para se
obter bons resultados. Um cenário convincente da origem da vida requer
que a direção inteligente das reaçôes químicas seja minimizada tanto quanto
possível. Ainda assim, a participação de algum tipo de inteligência é
inevitável. Palpites razoáveis sobre que substâncias existiam na Terra
primordial como os dados por Staniey Miller constituem um ponto
de partida necessário. O truque do pesquisador consiste em escolher um
ponto de partida viável e, em seguida, abster-se de intervir.
Como analogia, vamos supor que um famoso chefe de cozinha dissesse
que processos naturais aleatórios poderiam produzir um bolo de chocolate.
Em Seu esforço para provar a ideia, não o censuraríamos se ele levasse
plantas inteiras incluindo trigo, cacau e cana-de-açúcar e as colocasse
perto de uma fonte termal, na esperança de que a água aquecida extraísse
os materiais certos e os preparasse. Mas ficaríamos um pouco desconfiados
se ele trouxesse açúcar refinado, chocolate e farinha de trigo do supermer-
cado dizendo que não tinha tempo para esperar que a água quente extraísse
os componentes das plantas. Ficaríamos encafífados se ele, em seguida,
modificasse o experimento, substituindo a fonte termal por um fogão
elétrico, para "acelerar as coisas". E iríamos embora se, em seguida, ele
medisse cuidadosamente os componentes, misturasse tudo em uma tigela,
colocasse a massa em uma forma e a assasse no forno. Os resultados nada
teriam a ver com sua ideia original de que processos naturais poderiam
produzir um bolo.
O experimento que Staniey Miller relatou em 1952 impressionou o
mundo. Mas como ele logo explicou, esse experimento não fora o primeiro
que ele havia tentado. Antes, ele havia instalado seus aparelhos de uma
maneira ligeiramente diferente e descoberto que um pouco de óleo era
formado, mas nenhum aminoácido. Uma vez que pensava que os aminoá-
cidos seriam os elementos químicos mais interessantes a encontrar, ele
mexeu nos aparelhos na esperança de produzi-los. Claro, se as condições
na Terra primitiva se parecessem de fato com as malsucedidas tentativas de
Miller, então, na realidade, nenhum aminoácido poderia ter sido produzido.
Além do mais, ligar muitos aminoácidos para formar uma proteína
dotada de atividade biológica útil constitui um problema químico muito
mais difícil do que fabricar aminoácidos. A grande dificuldade em enca-
dear aminoácidos é que, quimicamente, isso envolve a remoção de uma
molécula de água em cada aminoácido ligado à cadeia em crescimento da
proteína. De modo oposto, a presença de água cria enorme dificuldade ao
aminoácido para formar a proteína. Uma vez que a água é tão abundante na
Terra, e tendo em vista que os aminoácidos nela se dissolvem facilmente,
os pesquisadores da origem da vida foram obrigados a propor cenários
incomuns para contornar esse problema. Um cientista chamado Sidney Fox,
por exemplo, sugeriu que talvez alguns aminoácidos tivessem sido jogados
do oceano primordial sobre uma superfície muito quente, tal como a bor-
da de um vulcão em atividade. Nessa altura, continua a história, eles seriam
aquecidos acima do ponto de ebulição da água; desaparecida a água, os
aminoácidos poderiam se interligar. Infelizmente, outros pesquisadore
haviam mostrado antes que aquecer aminoácidos produz um alcatra
marrom escuro, malcheiroso, e não proteínas detectáveis. Fox, porém
demonstrou que se uma porção muito grande de um de três aminoácido
diferentes for adicionada a uma mistura de aminoácidos purificados
aquecida em um forno de laboratório, eles se juntam. Mas, mesmo ness
caso, eles não produzem proteínas a estrutura que formam é química
mente diferente. Em vista disso, Fox e seus colaboradores deram a gsssl.
estruturas o nome de "proteinóides", e passaram a demonstrar que elas
exibiam algumas propriedades interessantes, incluindo modesta capacidad
catalítica, que lembrava proteínas autênticas.
A comunidade científica, no entanto, permaneceu profundamente célica
a respeito desses experimentos. Tal como aconteceu com nosso confeiteir
imaginário, um forte odor de envolvimento do pesquisador paira sobre os
proteinóides. A circunstância especial necessária para produzi-los con
dições quentes, secas (supostamente representando locais raros como bor
das de vulcão), com volumes exatos de aminoácidos já purificados, pesados
de antemão lança uma escura nuvem sobre a importância desses expe
rimentos. Pior ainda, uma vez que proteinóides não são proteínas de fato,
grande problema de formar proteínas autênticas permanece insolúvel. Em
seu livro, onde analisou as dificuldades das teorias de origem da vida,
Robert Shapiro nota que o trabalho sobre proteinóides gerou uma surpreen
dente unanimidade de opinião:
(A teoria dos proteinóides) atraiu a ira de muitos críticos veementes,
variando do químico Staniey Miller... a criacionistas como Duane Gish.
Talvez não haja nenhum outro ponto da teoria da origem da vida em que
possamos encontrar tal harmonia entre evolucionistas e criacionistas, como
na condenação da suposta importância dos experimentos de Sidney Fox.3
Outros pesquisadores propuseram maneiras diferentes através das quais
aminoácidos poderiam se ligar para formar proteínas. Todas elas padecem
dos mesmos problemas que perseguem os proteinóides, e nenhuma atraiu
muito apoio da comunidade científica.
O MUNDO DO ARN
Na década de 1980, um cientista chamado Thomas Cech demonstrou que
alguns tipos de arn exibem modesta capacidade catalítica.4 Uma vez que
o arn, ao contrário das proteínas, pode funcionar como um gabarito e assim,
potencialmente, catalisar sua própria replicação, ele sugeriu que o ARN
e não a proteína é que colocou a Terra na estrada da vida. Desde a
divulgação do trabalho de Cech, entusiastas vêm visualizando um tempo
em que o mundo estava ensopado de arn em seu caminho para a vida. Esse
modelo recebeu o nome de "o mundo do arn". Infelizmente, o otimismo
que o cerca ignora a química conhecida. De muitas maneiras, a coqueluche
do mundo do arn na década de 1990 lembra o fenómeno Staniey Miller na
década de 1960: esperança lutando bravamente contra dados experimentais.
Imaginar um cenário realista pelo qual processos naturais poderiam ter
fabricado proteínas em uma Terra pré-biótica embora extraordinaria-
mente difícil é uma mão na roda em comparação com imaginar a
formação de ácidos nucleicos como o próprio arn. O grande problema é
que cada "bloco de armar" de nucleotídeo é formado em si por vários
componentes, e os processos que os formam são quimicamente incompa-
tíveis. Embora um químico possa produzir com facilidade nucleotídeos em
laboratório, sintetizando os componentes em separado, purificando-os e,
em seguida, recombinando-os, reações químicas não dirigidas geram,
esmagadoramente, produtos indesejáveis e uma massa amorfa no fundo do
tubo de ensaio. Geraíd Joyce e Leslie Orgel dois cientistas que vêm
trabalhando longa e esforçadamente no problema da origem da vida
chamam o arn de "o pesadelo pré-biótico do químico". E são de uma
franqueza brutal:
Cientistas interessados na origem da vida aparentemente se dividem em
duas classes nítidas. A primeira, composta em geral, mas nem sempre, de
biólogos moleculares, acredita que o arn deve ter sido a primeira molécula
replicante e que os químicos exageram as dificuldades da síntese do nucleo-
tídeo... A segunda é muito mais pessimista: acredita que o aparecimento de
novo de oligonucleotídeos na Terra primitiva teria sido quase um milagre.
(Os autores concordam com esta última opinião.) O tempo dirá quem está
certo.5
Mesmo que a coincidência quase milagrosa ocorresse e o arn fosse
produzido, contudo, Joyce e Orgel nada vêem senão obstáculos à frente.
Em um artigo intitulado "Outro paradoxo galinha-ovo", escrevem o se-
guinte:
Essa discussão... em certo sentido, concentrou-se em um testa-de-ferro: no
mito de uma molécula auto-replicante de arn, que surgiu de novo de uma
sopa de polinucleotídeos aleatórios. Não só essa ideia é irrealista à luz de
nosso atual conhecimento da química pré-biótica, mas ela tem que forçar a
credulidade até mesmo sobre o potencial catalítico do arn... Sem evolução,
parece improvável que uma ribosima auto-replicante pudesse surgir, mas,
sem alguma forma de auto-replicação, não há maneira de conduzir un
busca evolucionista da primeira e primitiva ribosima auto-replicante.6
Em outras palavras, o milagre que produziu arn quimicamente intacto na
seria suficiente. Já que a imensa maioria dos arns não possui propriedad
catalíticas úteis, uma segunda coincidência milagrosa seria necessária pá
se conseguir o arn certo, quimicamente intacto.
A química da origem da vida sofre bastante com o problema da mort
na estrada, discutido no último capítulo. Da mesma maneira que não h
uma barreira absoluta à marmota que cruza uma estrada de mil pista
durante a hora do rush, tampouco existe barreira absoluta à produção d
proteínas, ácidos nucleicos ou qualquer outro elemento bioquímic
atavés de processos naturais, imagináveis. Não obstante, o morticínio n.
estrada é intolerável. A solução proposta por alguns químicos pré-bióti-
cos é simples. Soltam mil marmotas à beira da estrada e notam que ums
delas conseguiu cruzar a primeira pista. Em seguida, colocam mil novas
marmotas em um helicóptero e as levam para o começo da pista dois
Quando uma delas sobrevive à travessia da pista dois para a pista três
levam mais mil para a borda da pista três. Proponentes do mundo do
arn, que começam seus experimentos com arn longo, purificado
sintetizado por eles mesmos, tiram do helicóptero as marmotas da pista
700 e observam, enquanto uma delas cruza a distância até a pista 701
Embora seja um esforço corajoso, mesmo que elas cheguem ao outro
lado a vitória não terá valor algum.
Cientistas que trabalham sobre a origem da vida merecem muito apreço
eles atacaram o problema usando experimentos e cálculos, como deve faze
a ciência. E embora os experimentos não tenham dado os resultados que
muitos esperavam, graças a seus esforços temos agora uma ideia clara das
imensas dificuldades que a origem da vida enfrentaria através de processos
químicos naturais.
Privadamente, muitos cientistas admitem que a ciência não tem explica
cão para o início da vida.7 Por outro lado, muitos deles pensam que dada
origem, sua evolução subsequente é fácil de imaginar, a despeito das grandes
dificuldades descritas de forma breve neste livro. A razão dessa situação
peculiar é que enquanto químicos tentam submeter a teste cenários da
origem da vida através de experimento ou cálculo, biólogos evolucionistas
não fazem nenhuma tentativa de submeter à prova cenários evolucionis-
tas no nível molecular, através de experimento ou cálculo. Como resultado,
a biologia evolucionista está restrita à mesma disposição de espírito que
dominou os estudos da origem da vida no início da década de 1950, antes
de ter sido feita a maioria dos experimentos: a imaginação corre solta. A

bioquímica, na verdade, revelou um mundo molecular que resiste brava-


mente à explicação pela mesma teoria por tanto tempo aplicada no nível do
organismo completo. Nenhum dos dois pontos de partida de Darwin a
origem da vida e a origem da visão foi explicado por sua teoria. Darwin
nunca imaginou a complexidade estranhamente profunda que existe até nos
níveis mais básicos da vida.
Ao longo de todos esses anos, o Journalof Molecular Evolution publicou
pesquisas sobre a origem da vida referentes a numerosas questões, tais como
as seguintes: Outros aminoácidos, não encontrados por Miller, também
poderiam ser produzidos? O que teria acontecido se o dióxido de carbono
predominasse na atmosfera antiga, e não o metano? Poderiam outros
nucleotídeos, que não os modernos, ter dado origem à vida? Essas perguntas
foram feitas em trabalhos publicados na jme, com títulos como "Sínteses
pré-bióticas em atmosferas contendo CH4, CO e co2"8, "Radiólise de
soluções aquosas de cianeto de hidrogénio (pH6): compostos de interesse
em estudos de evolução química"9, "Bases alternativas no mundo do arn:
a síntese pré-biótica da urazola e seus ribosídios"10, e "Ciclização de
análogos de nucleotídeos como obstáculos à polimerização"". Essas per-
guntas são interessantes para os cientistas, mas sequer começam a respon-
der o desafio à evolução lançado pela coagulação do sangue, o transporte
celular ou o combate à doença.
A segunda categoria de trabalhos geralmente encontrados na Journal of
Molecular Evolution, respondendo por cerca de 5% do total, compõe-se de
modelos matemáticos da evolução ou de novos métodos matemáticos para
comparar e interpretar dados de sequências. Inclui trabalhos com títulos tais
como "Uma derivação de todas as invariantes lineares para um modelo de
transversão não-equilibrado"12 e "Simulação Monte Cario em filogenias:
uma aplicação a fim de testar a constância de taxas evolutivas"13. Embora
útil para compreendermos como processos graduais se comportam ao longo
do tempo, a matemática supõe que a evolução no mundo real é um processo
aleatório, gradual. Mas não demonstra (nem pode demonstrar) isso.
De longe, a maior categoria de trabalhos publicados na jme, respondendo
por mais de 80% dos originais, é a de comparação de sequências. Uma
comparação de sequências é um cotejo, de aminoácido com aminoácido de
duas proteínas diferentes, ou uma comparação de nucleotídeo com nucleo-
tídeo de duas diferentes peças de adn, notando-se as posições em que são
idênticos ou semelhantes e os locais onde não são.
Quando, na década de 1950, surgiram métodos para determinar as
sequências de proteínas, tomou-se possível comparar a sequência de uma
com a de outra. A pergunta imediatamente feita foi se proteínas análogas
em espécies diferentes, como hemoglobina humana e hemoglobina de
cavalos, têm a mesma sequência de aminoácidos. A resposta foi enigmáti-
ca: as hemoglobinas de cavalos e homens eram muito parecidas, mas não
idênticas. Seus aminoácidos eram os mesmos em 129 das 136 posições em
uma das cadeias de proteínas da hemoglobina, mas diferentes nas restantes.
Quando as sequências das hemoglobinas de macaco, galinha, rã e outras
tomaram-se disponíveis, elas puderam ser comparadas com a hemoglobina
humana e entre si. A hemoglobina de macacos apresenta 5 diferenças em
relação às de seres humanos; as de galinham mostram 26 diferenças e, as
de rãs, 46. Essas semelhanças eram altamente sugestivas. Numerosos
pesquisadores concluíram que sequências semelhantes davam apoio subs-
tancial à tese da descendência de um ancestral comum.
Na maior parte, demonstrou-se que proteínas análogas de espécies que
já se julgava serem estreitamente aparentadas (como homem e chimpanzé:
ou pato e galinha) tinham sequências muito parecidas e que proteínas de
espécies que se julgava de parentesco distante (tais como jaritataca e c
tinhorão fedegoso) não eram tão semelhantes assim. Na verdade, no case
de algumas proteínas, poderíamos correlacionar o volume da similaridade
da sequência com o tempo estimado, desde quando se pensava que as várias
espécies compartilharam pela última vez de um ancestral comum, e i
correlação era muito boa. Emile Zuckerkandi e Linus Pauling propuseran
então a teoria do relógio molecular, que diz que a correlação é causada pó;
proteínas que acumulam mutações ao longo do tempo. O relógio molécula
tem sido vigorosamente debatido desde que foi proposto, e numerosa;
questões que cercam o mesmo ainda são objeto de divergências. No todo
porém, ele permanece como uma possibilidade viável.
Em fins da década de 1970, surgiram métodos rápidos e fáceis d(
identificar a sequência do adn. Dessa maneira, poderíamos estudar não se
a sequência de uma proteína, mas também o gene da mesma, bem como (
adn que envolve o gene e que contém regiões de controle e outros aspectos
Demonstrou-se que genes de organismos superiores continham inter
rupções (chamadas íntrons) na sequência de codificação. Alguns gene;
tinham dezenas de íntrons; outros, apenas um ou dois. Nesse momento
portanto, um bioquímico poderia publicar comparações de sequências di
íntrons nos genes de espécies diferentes, bem como estudos sobre o númen
total dos íntrons, seus posicionamentos relativos nos genes, seu comprimen
to e base de composição, e dezenas de outros fatores. Outros aspectos d(
aparelho genético poderiam também ser comparados: a posição dos genes
em relação a outros, a sequência em que cada tipo de nucleotídeo era encon-
trada próxima a outra, o número de nucleotídeos quimicamente modifica-
dos, e assim por diante. Muitos desses trabalhos foram publicados durante
todos esses anos noJournal of Molecular Evolution, incluindo "Análise de
homologias de sequência de proteínas: iv. Vinte e sete ferrodoxinas bacte-
rianas"14, "Evolução dos genes da a-e (3-tubulina da forma inferida pelas
sequências de nucleotídeos de clones do cadn de ouriços-do-mar"15, "Fi-
logenia de protozoários deduzida de 55 sequências de rARN"16, e "Orienta-
ção cauda-a-cauda dos genes de a-e-P-globina do salmão do Atlântico"17.
Embora útil para determinar possíveis linhas de descendência, o que é
uma questão interessante em si, comparar sequências, não pode demonstrar
como um sistema bioquímico complexo adquiriu sua função a questão
que mais nos interessa neste livro.18 Fazendo uma analogia, os manuais de
instrução de dois modelos diferentes de computadores, fabricados pela
mesma empresa, podem conter muitas palavras, frases e mesmo parágrafos
idênticos, sugerindo uma ancestralidade comum (talvez o mesmo autor
tenha escrito ambos os manuais), mas comparar as sequências de letras nos
manuais nunca nos dirá se um computador pode ser produzido passo a passo
a partir de uma máquina de escrever.
Os três tipos gerais de trabalhos publicados na jme a origem da vida,
os modelos matemáticos da evolução e as análises de sequências incluí-
ram muitos estudos complicados, difíceis e eruditos. Esses trabalhos valio-
sos e interessantes refutarão por acaso a mensagem contida neste livro? Em
absoluto. Dizer que a evolução darwiniana não pode explicar tudo na
natureza não equivale a dizer que a evolução, a mutação aleatória e a seleção
natural não ocorram. Elas foram observadas (pelo menos nos casos de
microevolução) em muitas ocasiões diferentes. Tal como os analistas de
sequência, acredito que a prova confirma convincentemente a ascendência
comum. Mas a pergunta fundamental permanece sem resposta: O que teria
levado sistemas complexos a se formar? Ninguém jamais explicou de forma
detalhada, científica, como a mutação e a seleção natural poderiam construir
as estruturas complexas, intricadas, discutidas neste livro.
Na verdade, nenhum dos trabalhos publicados na jme durante todo o
curso de sua vida editorial propôs um modelo detalhado através do qual um
sistema bioquímico complexo poderia ter sido produzido à maneira darwi-
niana, passo a passo, gradualmente. Embora muitos cientistas perguntem
como sequências podem mudar ou como os elementos químicos neces-
sários à vida poderiam ser produzidos na ausência de células, ninguém
jamais fez nas páginas da jme perguntas como as seguintes: Como se
180 A CAIXA PRETA DE DARWIN
desenvolveu o centro de reação fotossintético? Como começou o transport
intramolecular? De que modo começou a biossíntese do colesterol? Com
foi que a retinal passou a fazer parte da visão? De que maneira se desenvo
veram as vias de sinalização da fosfoproteína? O simples fato de qu
nenhum desses problemas jamais foi tratado, para não dizer solucionado
constitui uma indicação muito forte de que o darwinismo é um marco d
referência inadequado para compreendermos a origem de sistemas bioqu
micos complexos.
Voltando às questões levantadas neste livro, precisaríamos encontra
trabalhos com títulos como "Doze passos intermediários que levam a
centro de reação fotossintética bacteriana", "Um protocílio poderia gerai
força suficiente para girar uma célula em dez graus", "Os intermediários n
biossíntese da adenosina copiam eficazmente a própria adenosina na fünçã
arn", e "Um coágulo primitivo feito de fibras aleatoriamente alinhadas
bloquearia a circulação em veias de menos de 0,3 milímetros de diâmetro
Esses trabalhos, porém, não existem. Nada remotamente parecido com ele
foi publicado.
Talvez possamos compreender por que modelos detalhados estão au
sentes das páginas daJME, perguntando com o que se pareceria uma pesquis
científica autêntica da evolução da ratoeira feita por um jovem e entusiá
tico cientista. Ele teria, em primeiro lugar, de pensar em um precursor (
ratoeira moderna, um precursor que fosse mais simples. Suponhamos qu
ele começasse apenas com uma base de madeira? Não, isso não pegar
ratos. E se começasse com uma ratoeira moderna, que tivesse uma barra (
retenção mais curta? Não, se fosse curta demais a barra não alcançaria
trava e a ratoeira dispararia inutilmente, ainda em nossa mão. E se começa
se com uma ratoeira menor? Não, isso não explicaria a complexidad
Vamos supor que as partes se desenvolvessem de forma isolada para outr
funções tal como um palito de picolé para a base, uma mola de relóg
para a mola da ratoeira, e assim por diante e em seguida, acidentalmeni
se reunissem? Não, suas funções anteriores as tomariam impróprias pá
pegar ratos e ele ainda teria que explicar como elas se desenvolveram pass
a passo, transformando-se em ratoeira. Quando a data de apresentação c
estudo se aproximasse, o jovem e inteligente cientista mudaria seu foco (
interesse para tópicos mais tratáveis.
As tentativas de explicar a evolução de sistemas altamente específico
de complexidade irredutível sejam eles ratoeiras, cílios ou a coagulaça
do sangue através de uma rota gradualista, foram até agora incoerente
conforme vimos nos capítulos anteriores. Nenhuma revista científica publi-
caria trabalhos evidentemente incoerentes, de modo que não é possível

ontrar nenhum estudo que faça perguntas detalhadas sobre evolução


lecular. As histórias de Calvin e Haroldo podem, às vezes, ser construí-
i ignorando-se detalhes críticos, como fez Russell Doolittie quando ima-
m a evolução da coagulação do sangue, mas mesmo essas tentativas
aficiais são raras. Na verdade, explicações evolucionistas até mesmo
istemas que não parecem ser irredutivelmente complexos, tais como vias
abólicas específicas, estão ausentes da literatura profissional. A razão
'.e fato parece ser semelhante à da incapacidade de explicar a origem da
i: uma complexidade intransponível sufoca todas essas tentativas.
dezenas de revistas dedicadas à pesquisa bioquímica. Embora z jme só
lique artigos relativos à evolução molecular, outras também os publi-
i, misturados com pesquisas sobre outros tópicos. Talvez, por isso
imo, seja um erro tirar um número excessivo de conclusões, baseando-
j apenas em um levantamento do material publicado pela jme. Talvez
trás revistas, não-especializadas, publiquem pesquisas sobre as origens
sistemas bioquímicos complexos. Afim de tirar a limpo se a jme é o lugar
ado onde procurar, vamos dar uma rápida olhada em uma revista de
uito prestígio, que cobre uma larga faixa de tópicos bioquímicos: a
roceedings oftheNationalAcademy ofSciences.
Entre 1984 e 1994, a pnas publicou cerca de vinte mil trabalhos, a
flioria dos quais no campo das ciências da vida. Anualmente a revista
iblica um índice que lista por categorias os trabalhos veiculados no ano.
i índice mostra que, nesses dez anos, cerca de quatrocentos trabalhos
veram como tema a evolução molecular.19 Isso equivale a cerca de um
rço dos trabalhos que a Journal of Molecular Evolution publicou no
esmo período. O número de trabalhos publicados a cada ano sobre esse
ipico na pnas aumentou muito, de 15 em 1984 para cerca de cem em 1994.
videntemente, estamos em uma era de crescimento. A grande maioria
nais ou menos 85%), porém, diz respeito a análise de sequências, da
lesma maneira que a maioria dos trabalhos na jme ignorava a questão
mdamental do como. Cerca de 10% dos trabalhos sobre evolução mole-
ilar são estudos matemáticos novos métodos para melhorar as compa-
ições de sequências ou modelos altamente abstratos. Não apareceu na pnas
alhum trabalho que propusesse rotas detalhadas através das quais es-
uturas bioquímicas complexas pudessem ter se desenvolvido. Levanta-
lentos em outras revistas de bioquímica mostram o mesmo resultado:
sqüências em cima de sequências, mas nada de explicações.
Mas, se não há respostas nas revistas, talvez seja bom procurar em livrod|
Darwin propôs em um livro sua revolucionária teoria, e o mesmo fe«|
Newton. A vantagem do livro é que dá ao autor espaço de sobra pan(|
desenvolver suas ideias. Contextualizar uma nova ideia, trazer exemplo
apropriados, explicar vários passos detalhados, responder a muitas e es«|
peradas objeções tudo isso pode ocupar um espaço bem grande. Um bcatí
exemplo na literatura científica moderna é um livro intitulado TheNeutrak
Theory of Molecular Evolution, de Motoo Kimura.20 No livro, ele teve
espaço para explicar a ideia de que a maior parte das mudanças emi
sequências que ocorrem no adn e em proteínas não afeta a maneira como
elas fazem seu trabalho; as mutações são neutras. Temos um segundo
exemplo em The Origins ofOrder, de Stuart Kauffman, que argumenta que;
as origens da vida, do metabolismo, dos programas genéticos e dos planos;!
corporais estão todas, sem exceção, além do alcance da explicação darwi- j
niana, mas que podem surgir espontaneamente através de auto-organiza- i
cão.21 Nenhum dos dois livros explica as estruturas bioquímicas: o trabalho'
de Kimura trata simplesmente de sequências, enquanto que o de Kauffman;
é uma análise matemática. Mas, quem sabe, nas bibliotecas do mundo haja
um livro que nos diga como estruturas bioquímicas específicas surgiram.
Infelizmente, uma busca computadorizada em catálogos de bibliotecas
revela que tal livro não existe. Esse fato não é surpreendente nesta época;
até livros como os de Kimura e Kauffman, que propõem novas teorias, em
geral são precedidos por trabalhos sobre o tópico publicados anteriormente
em revistas científicas. A ausência de trabalhos sobre a evolução dessas
estruturas nas revistas praticamente liquida qualquer probabilidade de haver
um livro publicado sobre o assunto.
Mas, em uma busca computadorizada por livros sobre a evolução
bioquímica, encontramos alguns títulos suculentos. Um livro publicado em
1991 de autoria de John Gillespie, por exemplo, tem o atraente título The
Causes of Molecular Evolution. Mas ele não trata de sistemas bioquímicos
específicos. É, como o de Kauffman, uma análise matemática, que deixa de
fora todos os aspectos específicos de organismos, reduzindo-os à categoria
de símbolos matemáticos e, em seguida, manipulando-os. A natureza é
lixiviada. (Cabe acrescentar que, é claro, a matemática é um instrumento
extraordinariamente poderoso. Mas é útil à ciência apenas quando os
pressupostos com que se inicia a análise são verdadeiros.)
Outro livro, publicado no mesmo ano, tem o título Evolution at the
Molecular Levei12 Embora o título pareça promissor, não é um texto que
proponha uma nova ideia. E um dos muitos livros académicos, sob a forma
de coletânea de artigos de diferentes autores, cada um tratando de uma área

O QUE NOS DIZ A CAIXA? l 83


particular, mas sem maior profundidade do que a encontrada em um
trabalho publicado em revista. Inevitavelmente, o conteúdo do livro lembra
muito o conteúdo de revistas: um bocado de sequências, alguma matemá-
tica, mas nada de respostas.
Um tipo diferente de livro é o que contém os resultados de uma confe-
rência científica. O Cold Spring Harbor Laboratórios, de Long Island,
patrocinou nos últimos anos algumas conferências sobre vários tópicos.
Uma delas, realizada em 1987, teve como tema "A evolução da função
catalítica", e cerca de cem trabalhos dos participantes foram publicados em
um livro.23 Como é típico em obras dessa natureza, cerca de dois terços dos
trabalhos são simplesmente descrições gerais do que acontecia no labora-
tório do autor na época, com pouca ou nenhuma tentativa de vinculação
com o tema do livro. Entre os trabalhos restantes, a maioria é composta de
análises de sequências e alguns dizem respeito à química pré-biótica ou a
catalistas simples (não à maquinaria complexa de organismos conhecidos).
A pesquisa pode ser ampliada, mas os resultados serão os mesmos.
Nunca houve conferência, livro ou artigo sobre detalhes da evolução de
sistemas bioquímicos complexos.
aculturação
Numerosos cientistas duvidam que mecanismos darwinianos possam ex-
plicar todas as formas de vida, mas muitos acreditam nisso. Uma vez que
acabamos de ver que a literatura bioquímica não contém trabalhos ou livros
que expliquem, em detalhe, como poderiam ter surgido sistemas com-
plexos, por que, apesar disso, o darwinismo é aceito por muitos bioquími-
cos? Uma parte importante da resposta é que eles foram ensinados, como
parte de formação bioquímica, que o darwinismo é verdade. A fim de
compreender os sucessos do darwinismo como ortodoxia, e seu fracasso
como ciência, no nível molecular, temos que examinar os livros didáticos
utilizados pêlos aspirantes a cientistas.
Um dos mais populares textos de bioquímica das últimas décadas foi
escrito em 1970 por Albert Lehninger, professor de biofísica da Johns
Hopkins University, tendo sido atualizado ao longo dos anos. Na primeira
página do primeiro capítulo de seu primeiro livro, Lehninger menciona a
evolução. Pergunta por que as biomoléculas, que existem em quase todas
as células, parecem extraordinariamente bem adaptadas às suas tarefas:
Neste capítulo, o primeiro de uma série de 12 dedicados às estruturas e
propriedades de grandes classes de biomoléculas, desenvolveremos a ideia
de que elas devem ser estudadas de dois pontos de vista. Temos, é claro,
examinar sua estrutura e propriedades, da mesma maneira como fanam
com moléculas não-biológicas, de acordo com os princípios e métoc
usados pela química clássica. Mas temos também que examiná-las à luz
hipótese de que elas são o produto de seleção evolutiva, que elas talvez seja
as moléculas mais aptas possíveis para sua função biológica.24
Lehninger, um excelente professor, estava passando a seus estudantes
visão de mundo dos bioquímicos que a evolução é importante pá
compreender bioquímica, que é um de dois "pontos de vista" apenas, a pari
dos quais devemos estudar as moléculas da vida. Embora um estudan
imaturo possa aceitar a palavra de Lehninger, um observador imparc
procuraria evidências da importância da evolução para o estudo da bioqu
mica. Um lugar excelente para começar é o índice do livro.
Lehninger fornece um índice muito detalhado, a fim de ajudar os esti
dantes a localizar informações prontamente. Muitos dos tópicos do índi
possuem entradas múltiplas, uma vez que devem ser estudados em vári
contextos. Os ribossomos, por exemplo, contam com 21 entradas no índi
da primeira edição de Lehninger; a fotossíntese, com 26; a bactéria E. c
com 42; e sob "proteínas", 70 referências. No total, há quase seis mil entr
das no índice, mas apenas duas sob o título "evolução". Encontramos
primeira menção a ela em uma discussão das sequências das proteínas. M
conforme discutido antes, embora dados sobre sequências possam ser us
dos para deles inferir-se relações, eles não podem ser usados para determ
nar como surgiu uma estrutura bioquímica complexa. A segunda referên
de Lehninger aparece em um capítulo sobre a origem da vida, no qu
discute proteinóides e outros tópicos que não resistiram ao teste do tem
Com apenas duas menções em seis mil, o conselho professoral (
Lehninger a seus alunos sobre a importância da evolução para seus estue
é desmentido pelo índice. Nele, Lehninger incluiu quase tudo que
relevante para a bioquímica. Ao que parece, porém, a evolução rarame
é tópico relevante.
Em 1982, Lehninger publicou uma nova edição do livro cujo índ
continha apenas duas referências à evolução em sete mil entradas. Apó
morte de Lehninger em 1986, Michael Cox e David Nelson, da Univer
dade de Wisconsin, atualizaram e reescreveram o texto de 1982.
prefácio, os autores incluem o seguinte, sob a lista de objetivos:
Colocar uma clara e repetida ênfase em grandes temas, especialmente
referentes ao controle, evolução, termodinâmica e relação entre estrutur
função.25
De fato, no índice da nova edição há 22 referências à evolução em um total
de oito mil entradas, um aumento de mais de dez vezes em comparação
com a anterior. Mas quando passamos da química da origem da vida e
comparações de sequências (as duas referências no texto anterior de Leh-
ninger), descobrimos que a nova edição usa a palavra evolução como
varinha de condão para solucionar mistérios. Uma citação, por exemplo, é
sobre a "evolução e adaptação do cachalote". Quando passamos à página
indicada, descobrimos que os cachalotes têm na cabeça várias toneladas de
óleo, que se toma mais denso em temperaturas mais frias. Isso permite que
o cachalote se iguale à densidade da água em grandes profundidades, onde
ele frequentemente mergulha e, portanto, nade com maior facilidade.
Depois de descrever esse tipo de baleia, o livro observa: "Assim, observa-
mos no cachalote uma notável adaptação anatómica e bioquímica, aperfei-
çoada pela evolução."26 Mas isso é tudo o que diz a frase! A baleia é
qualificada como "aperfeiçoada pela evolução" e ponto final. Os autores
não tentam explicar como o cachalote veio a adquirir a estrutura que possui.
As referências extras à evolução, na edição mais nova do livro de
Lehninger, podem ser encaixadas em três categorias: semelhanças de se-
quências, comentários sobre a linhagem das células e atribuição referente,
mas sem prova, de um dado aspecto à evolução. Mas nenhuma delas,
mesmo em princípio, pode nos dizer como a maquinaria molecular surgiu
passo a passo. Em nenhum caso é dada uma rota detalhada através da
qual um sistema bioquímico complexo poderia ter surgido à maneira dar-
winiana.
Um levantamento de trinta livros didáticos de bioquímica (listados na
Tabela 8-1), usados em grandes universidades na última geração, mostra
que muitos deles ignoram por completo a evolução. Thomas Deviin, da
Jefferson University, na Filadélfia, por exemplo, escreveu um texto de
bioquímica que foi inicialmente publicado pela John Wiley & Sons em
1982, com novas edições em 1986 e 1992. A primeira tem cerca de 2.500
entradas no índice alfabético; a segunda, também 2.500; e a terceira, cinco
mil. Nelas, o número referente à evolução é de zero, zero e zero. Um livro
de Frank Armstrong, da Universidade Estadual da Carolina do Norte,
publicado pela Oxford University Press, é o único livro recente a incluir um
capítulo histórico que analisa os progressos importantes ocorridos na
bioquímica, começando com a síntese da ureia por Friedrich Wõhier em
1828. O capítulo não menciona Darwin nem a evolução. Em três edições,
Armstrong julgou desnecessário mencionar a evolução no índice alfabético.
Outro texto publicado pela John Wiley & Sons contém uma única citação à
evolução no índice alfabético de 2.500 entradas. Ela se refere a uma frase na
186 A CAIXA PRETA DE DARWIN
TABELA 8-1
REFERÊNCIAS À EVOLUÇÃO NOS ÍNDICES ALFABÉTICOS DE LIVROS DIDÂTIC
Total de
Entradas Ent;
no Índice Refe
Autor Ano Editora Alfabético à Ev
Lehninger1970Worth6.000
Lehninger 1982 Worth 7.000
Lehninger et ai. 1993 Worth 8.000
Deviin 1982 John Wiley & Sons 3.500
Deviin 1986 John Wiley & Sons 2.500
Deviin 1992 Wiley-Liss 5.000
Strver 1975 Freeman 3.000
Voet & Voet
Voet & Voet
Mathews & van Holde
Horton et ai.
Moran et ai.
Zubay
Zubay et ai.
Armstrong & Bennett
Annstrong
Annstrong
Scheve
Abeles et ai.
Garrett & Grisham
Wood et a).
Conn & Stumpf
Conn et ai.
Kuchel & Raiston
John Wiley & Sons
John Wiley & Sons
Benjamin Cummings
Prentice Hall
Prentice Hall
Addison Wesley
Macmilian
Wm. C. Brown
Wm. C. Brown
Oxford University
Oxford University
Oxford University
Allyn and Bacon
Jones and Bartiett
Harcourt Brace
Benjamin Cummings
John Wiley & Sons
John Wiley & Sons
McGraw-Hill
McGraw-Hill
página 4: "Organismos evoluíram e se adaptaram a condições mutáveis em
uma escala de tempo geológico e continuam a assim fazer."27 Nada mais é
dito.
Alguns livros didáticos parecem fazer parte de um esforço concentrado
em inculcar nos estudantes uma visão evolucionista do mundo. Um livro
de Voet and Voet, por exemplo, contém um maravilhoso desenho colorido
mostrando o ponto de vista ortodoxo.28 O terço superior do desenho mostra
um vulcão, raios, um oceano e pequenos raios de luz solar, a fim de sugerir
como começou a vida. A parte do meio exibe um desenho estilizado de uma
molécula de adn, da origem da vida no oceano para uma célula bacteriana,
a fim de mostrar como a vida surgiu. O terço inferior não estou
brincando! parece o Jardim do Éden, mostrando alguns animais produ-
zidos por evolução andando de um lado para o outro. Incluídos na multidão
há um homem e uma mulher (ela oferecendo a ele uma maçã), ambos muito
bonitos e nus. Esse fato, sem dúvida, aumenta o interesse dos estudantes,
mas o desenho é uma provocação. A promessa implícita de que os segredos
da evolução serão revelados nunca é cumprida.29
Numerosos estudantes aprendem em seus livros a ver o mundo através
de uma lente evolucionista. Eles, contudo, não aprendem como a evolução
darwiniana poderia ter produzido qualquer um dos sistemas bioquímicos
notavelmente complicados que tais textos descrevem.
Como é que sabemos o que dizemos que sabemos não em algum sentido
filosófico profundo, mas no nível prático, do cotidiano? Todos os dias
podemos dizer a alguém que sabemos que nossa sala de estar é de cor verde,
que nosso time vai ganhar o campeonato estadual de futebol, que a Terra
gira em tomo do Sol, que a democracia é a melhor forma de governo, que
sabemos como ir a uma determinada cidade. Evidentemente, essas diferentes
afirmações baseiam-se em maneiras diferentes de saber. E quais são elas?
A primeira maneira de saber alguma coisa é, claro, pela experiência
pessoal. Sabemos que nossa sala de estar é pintada de verde porque
estivemos nela e vimos a cor. (Não vou me preocupar aqui com coisas do
tipo: como é que sabemos que não estamos sonhando, que não estamos
loucos etc.) Da mesma forma, sabemos o que é uma ave, como a gravidade
funciona (novamente no sentido diário), e como chegar ao shopping center
mais próximo, tudo por experiência direta.
A segunda é através da autoridade. Isto é, confiamos em alguma fonte
de informação, acreditando que esta merece confiança, quando não temos
188 A caixa PRETA DE DARWIN
experiência própria de alguma coisa. Assim, quase todas as pessoas c
frequentaram a escola acreditam que a Terra gira em tomo do Sol, mesi
que poucas pessoas sejam capazes de dizer como alguém poderia detec
esse movimento. Confiamos na autoridade se, quando nos perguntam
sabemos o caminho para uma determinada cidade, respondemos que sir
mostramos o mapa. Poderemos submeter pessoalmente a teste a confia
lidade do mapa, usando-o para ir à tal cidade, mas, até esse momen
estamos confiando na autoridade do mesmo. Muitas pessoas acreditam q
a democracia é superior a outras formas de governo, mesmo que não tenhï
vivido sob qualquer outro tipo de organização política. Confiam na auto
dade de livros e de políticos e, talvez, em descrições verbais ou gráficas
que é a situação em outras sociedades. Claro, outras sociedades fazen
mesmo e a maioria de seus defensores confia na autoridade.
Mas o que dizer do campeonato estadual de futebol? Como podem
saber que nossa equipe vai ganhar neste ano? Se pressionados, poderiam
admitir que nenhum comentarista esportivo apostou nela como vencedor
de modo que não estamos confiando em autoridade. Além do mais, n
temos informação de primeira mão de que, digamos, alguns jogadores est
treinando secretamente sob a orientação de um mestre zen que preme
aumentar muito sua agilidade. Não baseamos nosso palpite no desemperi
da equipe em anos recentes, que, digamos, tem sido de medíocre a ho
roroso. Se realmente pressionados, poderíamos mencionar sucessos n
passado distante e dizer que simplesmente sabemos que a equipe es
predestinada ao sucesso neste ano. De fato, não sabemos qual time ganha
o campeonato, era apenas uma figura de retórica. Nossa afirmação não
baseia nem em experiência nem em autoridade. E uma bazófía.
Cientistas também são pessoas, de modo que podemos perguntar com
eles sabem o que afirmam saber. Tal como todo mundo, eles sabem de cois
ou por experiência própria ou através de autoridade. Na década de 195
Watson e Crick viram um padrão de difração produzido por projeção (
raios x sobre fibras de adn e, usando suas habilidades matemáticas
determinaram que o adn era uma hélice dupla. Eles sabiam por tere
tentado, por experiência própria. Como estudante de graduação, aprem
que o adn é uma hélice dupla, mas nunca fiz um experimento par
demonstrar isso. Confio na autoridade. Todos os cientistas dependem (
autoridade no que interessa a quase todo o seu conhecimento científico.
perguntarmos a um cientista como ele conhece a estrutura do colesterol
comportamento da hemoglobina ou o papel das vitaminas, ele quase co
certeza citará a literatura científica, e não as suas próprias notas sobre o q
fez em seu laboratório.
O bom em ciência é a facilidade com que podemos localizar a autoridade:
está na biblioteca. O trabalho de Watson e Crick sobre a estrutura do adn
pode ser localizado e lido naNature. Aestrutura do colesterol e outras coisas
também podem ser encontradas nela. Desse modo, podemos dizer que
conhecemos a estrutura do adn ou do colesterol baseados em autoridade
científica, se trabalhos sobre esses tópicos fazem parte da literatura. Se
James Watson, ou uma Comissão Presidencial para a Ciência, decretassem
que o adn era feito de queijo verde, mas não publicassem provas cor-
roborantes na literatura especializada, não poderíamos dizer que a crença
no adn tipo queijo se baseava em autoridade científica. A autoridade
científica repousa sobre trabalhos publicados, não nas elucubrações de
indivíduos. Além disso, o trabalho publicado deve conter também a prova
pertinente. Se Watson publicasse uma mera declaração sobre a natureza
coalhada do adn em um trabalho dedicado, na maior parte, a alguma outra
coisa, mas não fornecesse prova relevante, continuaríamos sem autoridade
científica para coonestar a alegação.
A evolução molecular não se baseia em autoridade científica. Não há
publicação na literatura científica revistas de prestígio, revistas es-
pecializadas ou livros que descreva como a evolução molecular de
qualquer sistema bioquímico real, complexo, ocorreu ou poderia ter ocor-
rido. Há afirmações de que tal evolução ocorreu, mas nenhuma delas com
base em experimentos ou cálculos pertinentes. Uma vez que ninguém
conhece evolução molecular por experiência direta, e também por não haver
autoridade sobre a qual fundamentar alegações de conhecimento, podemos
dizer com convicção que tal como a alegação de que nosso time vencerá
o campeonato este ano a afirmação da existência de evolução molecular
darwiniana é simplesmente bazófia.
"Publique ou pereça" é um provérbio que os membros da comunidade
científica levam a sério. Se não publicamos nosso trabalho para que o resto
da comunidade o avalie, então nada temos a fazer nessa comunidade (e se
já não temos tempo de serviço que nos garanta estabilidade, dela seremos
banidos). Mas o provérbio pode ser aplicado também a teorias. Se uma
teoria é dita como explicação de algum fenómeno, mas não proporciona
nem mesmo uma tentativa de demonstração, ela deve ser banida. Adespeito
das comparações de sequências e da construção de modelos matemáticos,
a evolução molecular nunca tratou da questão de como estruturas com-
plexas surgiram. Na verdade, a teoria da evolução molecular darwiniana
não foi publicada, e portanto deve perecer.
9
PLANEJAMENTO INTELIGENTE
O QUE ESTÁ ACONTECENDO?
A incapacidade da teoria darwiníana para explicar a base molecular da vida
é evidente não apenas à vista das análises contidas neste livro, mas também
pela ausência completa, na literatura cientifica, de quaisquer modelos
detalhados mediante os quais sistemas bioquímicos complexos pudessem
ter sido produzidos, como foi mostrado no Capítulo 8. Em face da enorme
complexidade que a bioquímica moderna descobriu na célula, a comunida-
de científica ficou paralisada. Ninguém na Universidade Harvard, ninguém
na Academia de Ciências, nenhum laureado Nobel ninguém, abso-
lutamente, pode dar uma explicação detalhada de como o cílio, a visão, a
coagulação do sangue ou qualquer processo bioquímico complexo poderia
ter se desenvolvido à maneira darwiniana. Mas estamos aqui. Plantas e
animais estão aqui. Os sistemas complexos estão aqui. Todas essas coisas
chegaram aqui de alguma maneira: mas, se não à maneira darwiniana, como?
É claro que se alguma coisa não foi formada de maneira gradual, isso
deve ter acontecido rápida ou mesmo subitamente. Se adicionar peças iso-
ladas não melhora continuamente a função de um sistema, então peças
múltiplas têm de ser acrescentadas juntas. Duas maneiras de montar rapi-
damente sistemas complexos foram propostas por cientistas em anos re-
centes. Vamos fazer um curto exame dessas propostas e, em seguida, estudar
em profundidade uma terceira alternativa.
Aprimeira alternativa ao gradualismo teve como paladina Lynn Margu-
lis. Em lugar da tese darwiniana de progresso através de competição e luta,
ela propôs o avanço por meio de cooperação e simbiose. Em sua opinião,
os organismos se ajudam, conjugam forças e realizam juntos o que não
podem fazer separados. Enquanto ainda era estudante de pós-gradução, ela
190
O QUE NOS DIZ A CAIXA? l 9 l
aplicou tal ideia aos problemas da estrutura da célula. Embora tenha sido
inicialmente tratada com condescendência e ridicularizada, Margulis aca-
bou conquistando uma relutante aceitação e, em seguida, a fama (foi
eleita para a Academia Nacional de Ciências) pela ideia de que partes
da célula foram outrora organismos que viviam de modo independente.
A célula eucariótica, como vimos, é abundante em máquinas molecu-
lares complexas, ordenadamente separadas em muitos compartimentos
especializados. O maior dos compartimentos é o núcleo, que podia ser visto
mesmo com microscópios grosseiros já no século xvn. Compartimentos
menores só foram descobertos quando microscópios aperfeiçoados surgi-
ram em fins dos século xix e neste século. Um dos menores é a mitocôndria.
Talvez seja bom alertar que muitos dos compartimentos menores são
mitocôndrias: a célula típica contém cerca de duas mil delas, ocupando
cerca de 20% de seu volume total. Todos os pequenos compartimentos
contêm a maquinaria necessária para captar energia dos alimentos e arma-
zená-la em uma forma quimicamente estável, mas ainda assim sempre
disponível. Os mecanismos mitocondriais que se encarregam desse traba-
lho são muito complexos. O sistema utiliza, para acionar suas máquinas,
um fluxo de ácido que transporta elétrons em viagens de vai-e-vem entre
uma meia dúzia de transportadores, o que requer uma interação muito
delicada entre numerosos componentes.
As mitocôndrias são mais ou menos do mesmo tamanho e forma que
algumas células bacterianas que vivem livres. Lynn Margulis sugeriu que,
em alguma ocasião na Terra primitiva, uma célula maior "engoliu" uma cé-
lula bacteriana, mas não a digeriu. Em vez disso, as duas células uma
nesse momento vivendo dentro da outra adaptaram-se à situação. A
menor recebia nutrientes da maior e, em troca, passava a ela parte da energia
química acumulada que produzia. Quando a célula maior se reproduzia, a
menor fazia o mesmo, e seus descendentes continuaram a residir no interior
do hospedeiro. Com o tempo, a célula simbiótica perdeu muitos dos sis-
temas de que células livres necessitam e especializou-se em fornecer cada
vez mais energia ao hospedeiro. No fim, ela se transformou na mitocôndria.
Os risos abafados e de escárnio que acolheram a tese de Margulis sumiram
lentamente quando novas técnicas de seqüenciamento, criadas depois de ela
ter proposto a teoria, mostraram que proteínas mitocondriais parecem-se mais
com proteínas bacterianas do que com as proteínas da célula hospedeira. Nessa
ocasião foram notadas outras semelhanças entre as mitocôndrias e as bactérias.
Além disso, proponentes da origem simbiótica da mitocôndria mostraram
células simbióticas em organismos modernos que confirmam a teoria de
Margulis. Uma espécie de platelminto, por exemplo, não tem boca porque
nunca tem que comer contém algas fotossintéticas que forneça
energia de que necessita! Esses tipos de prova foram decisivos. Ateori
Margulis sobre as mitocôndrias tomou-se ortodoxia de livro didático.
Periodicamente nas duas últimas décadas, Margulis e outros cienti
sugeriram que outros compartimentos celulares também resultam de s
biose. Essas sugestões, porém, não tiveram uma aceitação tão geral. ]
seguir o argumento, contudo, vamos supor que a simbiose imaginada
Margulis fosse, na verdade, um fato de ocorrência comum durante tw
história da vida. A questão importante para nós, bioquímicos é: Po
simbiose explicar a origem de sistemas bioquímicos complexos?
Evidentemente que não. A essência da simbiose é a junção de (
células ou sistemas separados, ambos os quais já estão funcionando.
cenário da mitocôndria, uma célula viável preexistente entrou em rela
simbiótica com outra célula também já existente. Nem Margulis n
qualquer outro cientista ofereceu uma explicação detalhada de com
células preexistentes surgiram. Os proponentes da teoria simbiótica
mitocôndria supõem explicitamente que as células invasoras já põe
extrair energia de alimento, e também que a célula hospedeira já era ca
de manter um ambiente interno estável que beneficiaria o simbionte.
Uma vez que começa com sistemas complexos, já em füncionamen
simbiose não pode explicar os sistemas bioquímicos fundamentais (
discutimos neste livro. A teoria da simbiose pode ter importantes argum
tos a apresentar sobre o desenvolvimento da vida na Terra, mas não p
explicar as origens de sistemas complexos.
A segunda alternativa ao gradualismo darwiniano proposta em an
recentes é conhecida como "teoria da complexidade", e tem como princi
defensor Stuart Kauffman. Em curtas palavras, essa teoria afirma (
sistemas com grande número de componentes interatuantes juntam
espontaneamente em padrões organizados. Às vezes, há vários padrõe
disposição do sistema complexo, e "perturbações" neste podem fazer
que ele mude de um padrão para outro. Kauffman sugere que eleme
químicos na sopa pré-biótica organizaram-se em vias metabólicas com
plexas. E sugere ainda que a mudança entre diferentes "tipos" de céluli
(como acontece quando um organismo em desenvolvimento começa coi
apenas um óvulo fertilizado, mas em seguida passa a fabricar células d
fígado, de pele etc.) é uma perturbação de um sistema complexo e qu
resulta da auto-organização que imagina.
A explicação acima pode parecer um pouco confusa. Parte da confusão
deve-se, sem dúvida, à minha modesta capacidade de descrição. Mas grande
parte dela se deve ao fato de que a teoria da complexidade começou comQ

"Miceito matemático para descrever o comportamento de alguns pró-


is de computador, e seus proponentes ainda não conseguiram associá-
vida real. Em vez disso, o principal modo de argumentação tem sido
igora mencionar o comportamento de um computador e afirmar que ele
ssemelha ao comportamento de um sistema biológico. Kauffman, por
nplo, escreve o seguinte sobre mudanças (que denomina de mutações)
alguns programas de computador que elaborou:
. maioria das mutações ocasiona pequenas consequências por causa da
latureza do sistema (resistente à mudança). Algumas mutações, contudo,
geram maiores cascatas de mudança. Sistemas equilibrados, por conse-
uinte, se adaptarão aos poucos, via de regra, a um ambiente em mudança,
nas, se necessário, podem às vezes mudar rapidamente. Essas propriedades
ao observadas em organismos.'
outras palavras, algumas pequenas mudanças em um programa de
iputador causam grandes mudanças na produção do programa (tipica-
ite, um padrão de dots em uma tela de computador), de modo que, talvez,
lenas mudanças no adn possam produzir grandes e coordenadas mu-
ys biológicas. O argumento nunca vai além disso. Nenhum proponente
ioria da complexidade entrou ainda em um laboratório, misturou uma
ide variedade de elementos químicos em um tubo de ensaio e olhou para
'se vias metabólicas auto-sustentadoras se organizam espontaneamente.
jamais tentarem fazer um experimento desses, apenas repetirão o traba-
i frustrante dos cientistas que estudam a origem da vida e o dos que os
%deram e que viram as misturas complexas produzirem bastante
-sua nos lados dos frascos, e não muita coisa mais.
Em um livro sobre o assunto, Kauffman especula que a teoria da
nplexidade pode explicar não só a origem da vida e do metabolismo,
s também formas corporais, relações ecológicas, psicologia, padrões
lurais e economia.2 O caráter vago da complexidade, porém, começou
erder credibilidade entre os primeiros incentivadores da teoria. AScien-
cAmerican, por exemplo, publicou ao longo dos anos uma série de
igos favoráveis (um deles de autoria do próprio Kauffman). Na capa do
nero de junho de 1995, no entanto, a revista perguntava: "Será a
nplexidade uma fraude?". No miolo, um artigo intitulado "Da complexi-
Je à perplexidade" observava o seguinte:
Ávida artificial, um importante subcampo dos estudos da complexidade, é
"ciência destituída de fatos", de acordo com um crítico. Mas é excelente na
geração de gráficos de computador.
194 A CAIXA PRETA DE DARWIN
Realmente, alguns de seus defensores atribuem grande importância ao f
de que podem escrever curtos programas de computador que exitx
imagens na tela que lembram objetos biológicos, como a concha de l
molusco. A implicação é que não se precisa de muita coisa para fa;
um molusco. Mas, deseja saber o biólogo ou o bioquímico, se abrirmos ui
ostra de computador acharemos dentro dela uma pérola? Se ampliássen
a imagem o suficiente, vertamos cílios, ribossomos, mitocôndrias, sisten
de transporte intracelular e todos os demais sistemas de que necessit;
organismos reais, vivos? Fazer a pergunta é respondê-la. No artigo, Kauf
man observa que "em algum ponto, a vida artificial se desvia para algui
lugar, no qual não posso dizer onde corre a fronteira entre falar sobre
mundo quero dizer, tudo que nele existe e jogos de computado
formas de arte e brinquedos realmente delicados". A maioria das pessoa
começa a pensar que o ponto de desvio começa muito cedo.
No interesse do argumento, porém, vamos supor que a teoria da con)
plexidade é verdadeira que misturas complexas, de alguma maneira,»
organizam, e que isso tem algo a ver com a origem da vida. Admitida
suas premissas, a teoria da complexidade pode explicar os sistemas bioqui
micos complexos que discutimos neste livro? Não acredito que possa, í
mistura complexa e interatuante de elementos químicos que ela postu'
talvez tenha ocorrido antes de a vida desenvolver-se (mais uma vez, porei
não há virtualmente prova em apoio disso), mas não teria importado, loj
que a vida celular começasse. A essência da vida celular é o controle:;
célula controla quantos e que tipos de elementos químicos fabrica; quanc
perde o controle, morre. Um ambiente celular controlado não permi
interações milagrosas entre os elementos químicos (nunca especificado
de que Kauffman necessita. Uma vez que a célula viável mantém sei,
elementos químicos com rédea curta, ela tenderia a impedir que novas à
complexas vias metabólicas se organizassem por acaso.
Imaginemos ainda que o padrão de genes que é ligado e desligado i
célula, correspondente a diferentes tipos de células, possa mudar de acon
com as teorias de Stuart Kauffman. (Tipos diferentes de células formam-si
quando genes diferentes são ligados ou desligados. O gene da hemoglobin'
a proteína que leva oxigénio aos tecidos é ligado em células qui
fabricam as células vermelhas do sangue, mas desligado em outras células.)
Embora não haja prova para isso, vamos dizer que a teoria da complexidade
tem alguma coisa a ver com o comutador que transforma uma célula em,
célula vermelha do sangue e outra em célula nervosa. Isso poderia explicarj
a origem de sistemas bioquímicos complexos? Não. Tal como a teoria da;
simbiose, esse aspecto da teoria da complexidade requer sistemas preexis-
tentes, já funcionais. De modo que, se a célula desliga quase todos os genes,
exceto os que fabricam hemoglobina, ela poderia se transformar em uma
célula sanguínea vermelha; se outra célula liga outro conjunto de genes, ela
talvez pudesse fabricar as proteínas características de uma célula nervosa.
Mas nenhuma célula eucariótica pode ligar genes preexistentes e, de
repente, formar um flagelo bacteriano, porque nenhuma proteína preexis-
tente na célula interage dessa maneira. A única maneira como uma célula
poderia fabricar um flagelo seria se a estrutura já estivesse codificada para
ela no seu adn. Na verdade, Kauf&nan jamais alega que essas estruturas
novas e complicadas podem ser produzidas de repente, de acordo com a
teoria da complexidade.
A teoria em causa poderá ainda dar muitas contribuições importantes à
matemática e, talvez, fazer contribuições modestas à bioquímica. Mas ela
não pode explicar a origem de estruturas bioquímicas complexas que dão
sustentação à vida. E nem mesmo tenta.
Imagine um quarto no qual um corpo j az esmagado no chão, liso como uma
panqueca. Uma dezena de detetives rasteja pelo local, examinando o chão
com lupas, à procura de alguma pista da identidade do autor do horrendo
crime. No centro do quarto, perto do corpo, há um grande elefante cinza.
Os detetives cuidadosamente evitam bater nas pernas do paquiderme
enquanto rastejam à sua volta, e nem mesmo olham para ele. À medida que
o tempo passa, mais frustrados eles ficam com a falta de progresso, mas
insistem e examinam o chão de forma ainda mais atenta. Os livros dizem
que os detetives têm que "encontrar o homem", portanto eles nunca pensam
em elefantes.
Há um elefante em uma sala cheia de cientistas que tentam explicar o
aparecimento da vida. O elefante é rotulado de "planejamento inteligente".
Para uma pessoa que não se sente obrigada a restringir sua busca a causas
não-inteligentes, a conclusão óbvia é que muitos sistemas bioquímicos
foram planejados. Eles foram desenhados não por leis da natureza, pelo
acaso ou pela necessidade; na verdade, foram planejados. O planejador
; sabia que aparência os sistemas teriam quando completos, e tomou medidas
para toma-los realidade em seguida. A vida na terra, em seu nível mais
fundamental, em seus componentes mais importantes, é produto de ativi-
; dade inteligente.
A conclusão sobre o desenho inteligente segue-se de modo natural dos
; próprios dados não de livros sagrados ou de crenças sectárias. Inferir
196 A CAIXA PRETA DE DARWIN ,
que os sistemas bioquímicos foram planejados por um agente intelige"
um processo trivial que não requer novos princípios de lógica ou cie
Ele decorre simplesmente do trabalho árduo realizado pela bioquímica:
últimos quarenta anos, combinado com o exame da maneira como che
mós a conclusões sobre planejamento todos os dias. Não obstante, dizer
os sistemas bioquímicos foram planejados certamente parecerá estranr
muitas pessoas, portanto deixe-me tomar isso menos estranho, i
O que é um "planejamento"? O planejamento é tão somente o arra
intencional de partes. Com uma definição tão geral assim, podemos cc
preender que qualquer coisa poderia ter sido desenhada. Suponhamos (
em uma bela manhã, no caminho para o trabalho, você vê um carro qró
mando ao lado da estrada a parte da frente amassada, cacos de vidro p
todos os lados. Auns sete metros do carro, você identifica um corpo imóvd
Aperta o freio e pára no acostamento. Você corre para o corpo, pega o pufa
da pessoa para verificar se ainda bate e, em seguida, nota que há um rap
com uma minicâmera escondido atrás de uma árvore próxima. Você U
pede que chame uma ambulância, mas ele continua a filmar. Voltando-!
para o corpo, você descobre que ele está sorrindo. O ator ileso explica qi
é estudante de graduação no departamento de assistência social e que es
fazendo uma pesquisa sobre a boa vontade dos motoristas de socorr
pessoas desconhecidas que se acidentaram. Você olha furioso para o son
dente charlatão enquanto ele se levanta e enxuga o sangue de mentirinha (
rosto. Você o ajuda a assumir um aspecto mais realista e se afasta conten)
enquanto o cinegrafista sai correndo para chamar uma ambulância.
O pretenso acidente foi planejado; algumas partes foram intencional
mente organizadas para dar a impressão de um desastre. Outros fatos, mena
visíveis, também poderiam ser preparados da mesma maneira: os casaca
em um cabideiro de um restaurante podem ter sido arrumados pelo propriei
tário antes de você entrar. O lixo e as latas à beira de uma estrada podem
ter sido postos ali por um artista, que, com isso, tenta fazer algumi
declaração obscura sobre o meio ambiente. Encontros aparentemente for
tuitos entre pessoas podem ser resultado de um plano superior (teóricos de
conspiração adoram postular arrumações desse tipo). No campus de minha
universidade há esculturas que, se eu as visse ao lado da estrada, pensaria
serem resultado de pancadas ao acaso em refugo de metal, mas elas, na
verdade, foram planejadas.
A consequência dessa conclusão que qualquer coisa pode ser ar
ranjada intencionalmente é que não podemos saber que algo não fo
planejado. O problema científico, portanto, torna-se o seguinte: De qu
maneira podemos identificar o plano com absoluta certeza? Quando
razoável concluir, na ausência de conhecimento de primeira mão ou de
depoimento de testemunhas, que alguma coisa foi planejada? No caso de
sistemas físicos separados se não houver um caminho gradual para sua
produção , o plano é evidente quando certo número de componentes
separados, interatuantes, são organizados de maneira a realizar uma função
que está além da capacidade dos componentes isolados.3 Quanto maior for
a especificidade dos componentes necessários para produzir a função,
maior será nossa confiança na conclusão da existência de um plano.
Esse fato pode ser visto claramente em exemplos dados por sistemas
variados. Suponhamos que você e sua mulher recebem outro casal em uma
tarde de domingo para jogar caça-palavras. Quando o jogo termina, você
deixa a sala para descansar um pouco. Ao voltar, encontra as letras do jogo
na caixa, algumas com a face para cima, outras para baixo. Você não pensa
em nada até notar que as letras viradas para cima dizem: "Levem a gente
para jantar, seus chatos." Neste caso, você imediatamente infere que houve
um plano, sequer imaginando que o vento, um terremoto ou seu gato de
estimação poderiam ter virado fortuitamente as cartas com as letras certas.
Você deduz que houve um plano porque alguns componentes separados (as
letras) foram organizados para alcançar um fim (a mensagem) que nenhum
dos componentes poderia atingir por si mesmo. Além do mais, a mensagem
é muito específica; a modificação de várias letras a tornaria ilegível. Pela
mesma razão, não há um caminho gradual para chegar à mensagem: uma
única carta não lhe transmite parte da mensagem, algumas letras a mais
tampouco lhe passam um pouco mais da mensagem, e assim por diante.
A despeito de minha incapacidade de reconhecer um plano nas escultu-
ras em volta do campus, muitas vezes é fácil identificar um plano em outras
peças de arte. Jardineiros, por exemplo, arranjam as flores perto do centro
estudantil de modo a formar o nome da universidade. Mesmo que não os
tivéssemos visto trabalhando, poderíamos facilmente dizer que as flores
haviam sido arrumadas com um propósito. Por falar nisso, se você encon-
trasse, no meio de uma floresta, flores que formassem claramente o nome
"lehigh", não teria dúvidas de que a organização delas era resultado de
planejamento inteligente.
O plano pode ser inferido com mais facilidade no caso de.objetos
mecânicos. Andando por um depósito de sucata, você pode observar porcas,
parafusos e pedaços de plástico e vidro a maioria deles espalhada, alguns
empilhados, os demais apoiados uns sobre os outros. Suponhamos que você
viu uma pilha que parecia especialmente compacta e, quando levantou uma
barra que se projetava dela, toda a pilha desmoronou. Quando você a puxou,
a barra deslizou suavemente para um lado da pilha e puxou uma corrente
presa a ela. Acorrente, por seu turno, acionou uma engrenagem que aciol
três outras engrenagens que viraram uma barra, girando-a suavemente. V
conclui de imediato que a pilha não era um acúmulo aleatório de suc
mas que foi planejada (isto é, foi reunida naquela ordem por um age
inteligente), pois observa que os componentes do sistema interagem c
grande especificidade para fazer alguma coisa.
Sistemas constituídos inteiramente por componentes naturais po
exibir também planejamento. Suponhamos, por exemplo, que você e
passeando em um bosque em companhia de um amigo. De repente,
amigo é puxado alto no ar e fica pendurado pelo pé de uma gavinha, (
desce de um ramo de árvore. Depois de libertá-lo, você reconstrói a arm
lha. Nota que a gavinha estava enrolada em tomo do galho, sendo qu
extremidade era esticada e presa firmemente ao chão por uma forquilha
forquilha estava ligada a outra gavinha escondida pelas folhas
modo que, quando alguma coisa atingisse a gavinha-gatilho, ela puxas
forquilha, libertando a gavinha-mola. A extremidade da gavinha form
um laço com um nó corrediço para agarrar alguma coisa e erguê-la bem a
no ar. Embora a armadilha fosse feita apenas de materiais naturais, v
concluiria imediatamente que era produto de planejamento inteligente.
No caso de um objeto artificial simples, como uma barra de ferr
contexto muitas vezes é ainda mais importante para saber se houve
plano. Se você visse a barra do lado de fora de uma siderúrgica, inferin
existência de um plano. Suponhamos, contudo, que você viajou em u
nave espacial para um árido planeta, que nunca havia sido explorado
visse dezenas de barras cilíndricas de aço na encosta de um vul
precisaria de mais informações antes de ter certeza de que proce
geológicos alienígenas naturais nesse planeta produziram as bar
Ao contrário, se encontrasse dezenas de ratoeiras perto do vulcão, v
procuraria apreensivo por sinais do planejador.
Para saber se houve um plano na criação de algo que não seja um ob
artificial (como, por exemplo, o arranjo de gavinhas e forquilhas no bosc
para fazer uma armadilha) ou para chegar à conclusão de que houve intençãc
em um sistema composto por alguns objetos artificiais, terá que haver ume
função identificável do sistema. Precisamos, no entanto, ter cuidado ac
definir função. Um computador sofisticado pode ser usado como peso df
papel. Será esta sua função? Um automóvel complexo pode ser usado para
ajudar a represar um riacho. É isso o que devemos levar em conta? Não. Ao
pensar em plano, a função do sistema que devemos examinar é aquela que
requer o maior volume de complexidade interna do sistema. Podemos,
então, julgar com que perfeição as partes se ajustam à função.4
A função de um sistema é determinada por sua lógica interna: não é
necessariamente a mesma coisa que a finalidade à qual quem o projetou
deseja aplicá-lo. O indivíduo que vê uma ratoeira pela primeira vez talvez
não saiba que o fabricante esperava que ela fosse usada para pegar ratos.
Ele poderia, em vez disso, usá-la como defesa contra arrombadores ou
sistema de alarme de terremotos (se as vibrações pudessem disparar a
armadilha), mas ele ainda sabe, observando como as partes interagem, que
ela havia sido planejada. Da mesma forma, alguém poderia tentar usar um
cortador de grama como ventilador ou como motor de popa. Mas a função
do equipamento imprimir rotação a uma lâmina é melhor definida
por sua lógica interna.
quem está aí?
Para se deduzir que houve um plano não é preciso ter um candidato para o
papel de planejador. Podemos chegar à conclusão de que um sistema foi
planejado pelo simples exame do mesmo, e podemos ter muito mais certeza
sobre o planejamento em si do que sobre o planejador. Em vários dos
exemplos dados acima, a identidade do planejadornão era óbvia. Não temos
ideia de quem arrumou a engenhoca no pátio de sucata, ou a armadilha de
gavinhas, ou por quê. Não obstante, sabemos que todas essas coisas foram
planejadas por causa da organização de componentes independentes para
atingir certo fim.
A inferência de que houve um plano pode ser feita com bastante
segurança, mesmo que o planejador seja figura muito remota. Arqueólogos
que escavam sítios à procura de cidades perdidas podem encontrar pedras
retangulares, enterradas dezenas de metros na terra, com imagens de
camelos e gatos, grifos e dragões. Mesmo que isso fosse tudo o que
encontrassem, eles concluiriam que as pedras haviam sido planejadas. Mas
podemos ir mais longe que isso. Eu ainda era adolescente quando assisti o
filme 2001: Uma Odisseia no Espaço. Para dizer a verdade, não gostei
do filme; simplesmente não o entendi. Começava com macacos batendo
com paus uns nos outros, mudava em seguida para um voo espacial
em companhia de um computador homicida e terminava com um velho
derramando uma bebida e um bebé, ainda por nascer, flutuando no espaço.
Tenho certeza de que o filme continha um sentido profundo, mas nós, tipos
científicos, não "pegamos" logo essas coisas artísticas.
Havia uma cena, porém, que entendi logo. O primeiro voo espacial
chegara à Lua e um astronauta descia para iniciar a exploração. Em seus
passeios, ele encontrou um obelisco de forma lisa que se erguia contra a
paisagem lunar. Eu, o astronauta e o resto da plateia compreendei
imediatamente, sem que palavras fossem necessárias, que o objeto hs
sido planejado que algum agente inteligente estivera na Lua e escui
aquele objeto. Mais tarde, o filme nos mostrou que havia alienígenas
planeta Júpiter, mas não podíamos inferir esse fato a partir do obelisco. Ti
que podíamos saber olhando para o próprio objeto é que ele poderia ter s
planejado por alienígenas, por seres humanos do passado (fossem
russos ou habitantes da civilização perdida da Atlântida), capazes de v
pelo espaço, ou mesmo por um dos outros astronautas daquele voo (qi
numa piada de mau gosto, poderia ter escondido e instalado o obelisco
Lua antes da chegada do astronauta que mais tarde o descobriu). Se a trai
tivesse se desenrolado de uma dessas formas, o público não poderia dL'
que o aparecimento do obelisco desmentia o enredo. Mas, se o fíh
houvesse conseguido passar a ideia de que o obelisco não fora planejac
contudo, a plateia teria vaiado até o projecionista suspender a exibição.
É possível concluir que alguma coisa foi planejada sem que saibamc
absolutamente a identidade de quem a planejou. No que diz respeito a
procedimento, o plano primeiro precisa ser compreendido para que se poss
fazer alguma outra pergunta sobre o planejador. A dedução de que algo f
planejado pode ser mantida com toda firmeza possível neste mundo, mesm
que não se saiba nada sobre o planejador.
NA BORDA
Qualquer um pode dizer que o monte Rushmore foi planejado mas, como
dizia o rei do Sião, isso também passará. À medida que o tempo passar
chuvas caírem e ventos soprarem, o monte Rushmore mudará de forma
Dentro de milénios no futuro, pessoas poderão passar pela montanha e vê
apenas vagos indícios de rostos talhados na rocha. Poderia uma pesso
concluir que o corroído monte Rushmore havia sido planejado? Depende
Tal conclusão requer a identificação de componentes separados, que foram
organizados para atingir um fim, e a força da inferência não é algo fáci
de quantificar. Um monte Rushmore corroído poderá provocar ataques d
nervos nos arqueólogos do futuro se eles só puderem ver o que parec
uma orelha, um nariz, um lábio inferior e, talvez, um queixo, cada um dele
de uma diferente imagem presidencial. As partes não estão de fato or
ganizadas entre si e poderiam ser simplesmente uma formação rochosa
incomum.
Parece haver a face de um homem na superfície da Lua. Podemos apontar
áreas escuras que se assemelham a olhos e uma boca. Isso poderia ter sido

ilanejado, talvez por alienígenas, mas nem o número nem a especificidade


los componentes são suficientes para determinar se a finalidade atribuída
forma foi proposital. A Itália pode ter sido intencionalmente planejada
'ara parecer uma bota, mas talvez não. Não há dados suficientes para
negarmos a uma conclusão segura. A National Enquirer publicou certa
ez uma matéria que alegadamente mostrava um rosto humano na superfí-
ie de Marte. A semelhança, contudo, era apenas superficial. Em casos
orno esses, podemos dizer apenas que, como tudo mais, poderia ter sido
ilanejado, mas que não podemos saber com certeza.
Aumentando o número e a qualidade dos componentes que se juntam
Iara formar o sistema, podemos nos tomar cada vez mais confiantes na
mclusão de que houve um plano. Há alguns anos, a imprensa noticiou que
ma imagem de Eivis Presley havia sido formada por mofo na geladeira
lê uma mulher do Tennessee. Mais uma vez, a semelhança podia ser vista,
nas era ligeira. Suponhamos, porém, que a semelhança fosse muito grande.
Suponhamos ainda que a imagem fosse feita não só de mofo preto.
maginemos que houvesse também Serratia marcescens uma bactéria
que cresce em forma de lâminas vermelhas. E suponhamos ainda que
houvesse colónias do fermento Saccharomyces cerevisiae, que tem uma cor
branca brilhante. E também de Pseudomonas aeruginosa, que é verde, e de
Chromobacterium violaceum, que é roxa, e de Staphylococcus aureus, que
é amarela. E, por fim, vamos imaginar que microorganismos verdes estives-
sem crescendo com a forma das calças de Eivis e que bactérias vermelhas
formassem sua camisa. E, de quebra, que pequenos pontos de bactérias
alternadas vermelhas e brancas dessem aparência de carne a seu rosto.
Na verdade, suponhamos que as bactérias e o mofo na geladeira formas-
sem uma imagem de Eivis que fosse praticamente idêntica a um desses
pósteres de veludo que vemos em lojas de variedades. Poderíamos, então,
concluir que a imagem havia sido planejada? Sim, poderíamos com a
mesma confiança com que concluiríamos que os pósteres haviam sido
planejados.
Se o "homem na Lua" tivesse barba, orelhas, óculos e sobrancelhas,
poderíamos concluir que havia sido planejado. Se a Itália tivesse ilhoses e
cadarços, e se a Sicília se parecesse muito com uma bola de futebol, com
faixas coloridas e um logotipo, pensaríamos que foram planejadas. Aumen-
tando o número ou qualidade das partes de um sistema interatuante, nossa
conclusão sobre a existência de um plano também aumenta e pode chegar
à certeza. É difícil quantificar essas coisas.5 Mas é fácil concluir que
um sistema com tantos detalhes como o Eivis bacteriano completo foi
planejado.
202 A CAIXA PRETA DE DARWIN
É fácil notar planejamento em pósteres de Eivis, ratoeiras e mensage;
caça-palavras. Sistemas bioquímicos, porém, não são objetos inanim
mas partes de organismos vivos. Poderiam esses sistemas ser intelige
mente planejados? Não há muito tempo, pensava-se que a vida era feit,
uma substância especial, diferente do material que entrava na constitui
de objetos inanimados. Friedrich Wõhier derrubou essa ideia. Muito, mi
tempo depois, a complexidade da vida derrotou a maioria das tentativa;
entendê-la e manipulá-la. Em décadas recentes, contudo, a bioquímica
progressos tão grandes que mudanças básicas em organismos vivos es
sendo planejadas por cientistas. Vejamos alguns exemplos de planejame
bioquímico.
Quando o sistema de coagulação do sangue entra em pane, um coagi
perdido pode bloquear a circulação sanguínea no coração pondo em rii
a vida. No tratamento em uso hoje, uma proteína que ocorre naturalmei
é injetada no paciente a fim de auxiliar a dissolução do coágulo, Aprotei
natural, no entanto, apresenta certos inconvenientes, de modo que pesqi
sadores inovadores estão tentando agora fabricar uma nova proteína t
laboratório que possa realizar trabalho melhor.6 Em curtas palavras,
estratégia é a seguinte (Figura 9-1): numerosas proteínas do sistema i
coagulação são ativadas por outros fatores, que cortam um pedaço i
proteína-alvo, ativando-a. A peça cortada, contudo, é atingida apenas p
seu ativador, e por nenhum outro. O plasminogênio precursor (
plasmina, a proteína que dissolve o coágulo contém um alvo que
cortado apenas com grande lentidão, depois de formado o coágulo e iniciai
a cura. Se queremos tratar um ataque cardíaco, porém, há necessidac
imediata da plasmina no local do coágulo que está impedindo a circulaçã
Para tomar a plasmina imediatamente disponível no lugar certo, o gen
do plasminogênio foi isolado e alterado pêlos pesquisadores. A parte (
gene que codifica o ponto no plasminogênio que é dividido para ativar
proteína é substituída, e seu lugar tomado por um gene de outro componen
da via da coagulação (como o antecedente da tromboplastina do plasma, ffl
pta), que é dividido rapidamente pela trombina. Bem, a ideia é a seguinte
o plasminogênio de construção artificial, conduzindo a parte divisível pel
trombina, será cortado rapidamente e ativado bem perto de um coágulo
porque a trombina estará presente nesse local. Aatividade que é desencadea
da de imediato, porém, não é a da pta, mas sim a da plasmina. Se uma
proteína dessas for rapidamente injetada na vítima de um ataque cardíaco, a
esperança é que a ajude a recuperar-se com um mínimo de dano permanente.
O QUE NOS DIZ A CAIXA? 203
(l) O GENE DO PLASMINOGÉNIO É ISOLADO. (na FIGURA SÃO MOSTRADOS OSAMINOÁ-
CIDOS, E NÃO O ADN, QUE O GENE CODIFICA.) (2) A SEÇÃO DO GENE QUE CODIFICA A
ÁREA DA PROTEÍNA QUE É CORTADA LENTAMENTE DURANTE A ATIVAÇÃO É RETIRADA.
(3) A SEÇÂO DE OUTRO GENE OU E CODIFICA U MA REGIÃO DE PROTEÍNA QUE É CORTADA
RAPIDAMENTE PELA TROMBINA É INTRODUZIDA NO GENE DO PLASMINOGÉNIO. (4) UM
GENE PLANEJADO, HÍBRIDO, EXISTE AGORA E PRODUZIRÁ, QUANDO INTRODUZIDO NA
CÉLULA, UM PLASMINOGÉNIO QUE É RAPIDAMENTE ATIVADO PELA TROMBINA.
l) DCGKPQVEPKKCPGRVVGGCVAHPHSWPWQ
DCGKPQVEPKKC- -VGGCVAHPHSWPWQ
-TTKIKPRI-
3) DCGKPQVEPKKC- -VGGCVAHPHSWPWQ
4) DCGKPQVEPKKCTTKIKPRIVGGCVAHPHSWPWQ
A nova proteína é produto de planejamento inteligente. Alguém com
conhecimento do sistema de coagulação do sangue sentou-se à sua mesa e
traçou uma rota para produzir uma proteína que combinaria as propriedades
de dissolvedora de coágulo da plasmina com a propriedade de ativação
rápida de proteínas que são divididas pela trombina. O planejador sabia qual
seria o produto final de seu trabalho, e agiu para atingir esse objetivo. Depois
de traçado o plano, o planejador (ou seu aluno de pós-graduação) dirigiu-se
para o laboratório e executou os passos necessários para implementar o
plano. O resultado é uma proteína que ninguém no mundo havia visto antes
uma proteína que executará o plano de seu criador. Sistemas bioquímicos
podem, de fato, ser planejados.
O planejamento inteligente de sistemas bioquímicos é, na realidade,
muito comum nestes dias. Com vistas a fornecer a diabéticos a insulina
204 A CAIXA PRETA DE DARWIN
humana, difícil de obter, há uma década, pesquisadores isolaram o ger
insulina humana. Colocaram-no em um pedaço de adn que poderia se
viver em uma célula bacteriana e criaram as bactérias modificada
maquinaria celular da bactéria produziu, em seguida, insulina humana,
foi isolada e usada para tratar doentes. Alguns laboratórios estão modifk
do agora organismos mais desenvolvidos, ao incorporar diretamente i
alterado às suas células. Plantas planejadas que resistem à geada e a prï
já existem há algum tempo. Um pouco mais recente é o planejamenh
vacas que produzem leite com grandes quantidades de proteínas úteis.
pessoas que fazem isso, injetando genes estranhos em embriões de vá
chamam a si mesmas de "pharmers", contração de "pharmaceutical fi
mers" fazendeiros farmacêuticos.)
Cabe observar que embora os sistemas descritos acima sejam exemp]
de planos bioquímicos, o planejador, em todos os casos, fez mais do q
rearranjar peças da natureza; ele não criou um novo sistema a partir do na(
Isso é verdade, mas provavelmente não o será por muito tempo. Hoje e
dia, cientistas trabalham de forma ativa para desvendar o segredo daqui
que confere às proteínas sua atividade especial. O progresso tem sido leni
mas regular. Não demorará muito para que elas sejam fabricadas desde
início, planejadas para finalidades novas, específicas. Mais impressionan
ainda, novos sistemas químicos estão sendo elaborados por químicc
orgânicos para imitar as atividades da vida. Esse trabalho tem sido explt
rado na mídia sob o nome de "vida artificial". Embora isso seja um grand
exagero, destinado a vender revistas, o trabalho mostra, de fato, que uï
agente inteligente pode planejar um sistema que exiba propriedades seme
lhantes às bioquímicas sem usar os componentes bioquímicos que sabe qui
ocorrem em sistemas vivos.
Em anos recentes, alguns cientistas começaram mesmo a planejar nova
elementos bioquímicos, utilizando os princípios da microevolução l
mutação e a seleção.7 A ideia é simples: fabrique quimicamente grande
número de diferentes peças de adn ou arn, em seguida retire da mistura
algumas peças que possuam uma propriedade que o planejador deseja, tal
como a capacidade de ligar-se a uma vitamina ou proteína. Isso é feito
combinando-se partículas sólidas, às quais a vitamina ou proteína foram
fixadas, com uma solução que contenha uma mistura de peças de adn ou
arn e, em seguida, depurando-se a solução. As peças do adn ou arn ligadas
à vitamina ou à proteína permanecem ligadas ao sólido; todas as peças que
não se ligam são removidas com um líquido. Depois de escolher as peças
certas, o experimentador usa enzimas para obter cópias das mesmas. Geraíd
Joyce, um líder nesse campo, compara o processo à criação seletiva: "Se
' queremos uma rosa mais vermelha ou um gato persa mais fofo, escolhemos
como matriz os indivíduos que exemplificam melhor o traço desejado. Da
mesma maneira, se queremos uma molécula que exiba uma determinada
característica química, selecionamos de uma grande população de molécu-
las os indivíduos que manifestam melhor essa propriedade."8 Tal como a
criação seletiva, o método tem as vantagens da microevolução, mas também
suas limitações. Atividades bioquímicas simples podem ser produzidas,
mas não os sistemas complicados que discutimos neste livro.
De muitas maneiras, essa técnica assemelha-se à seleção clonal de
anticorpos discutida no Capítulo 7. Na verdade, outros cientistas estão
tirando vantagem da capacidade do sistema imunológico de gerar anticor-
pos contra quase todas as moléculas. Os cientistas injetam em um animal a
molécula que os interessa (por exemplo, de uma droga) e isolam os
anticorpos fabricados contra ela. Os anticorpos podem ser em seguida
usados como reagentes clínicos ou comerciais para detectar a molécula. Em
alguns casos, podem ser produzidos anticorpos que se comportam como se
fossem enzimas simples9 (chamadas de "abzimas"). Ambos os métodos
adnarn ou anticorpos prometem muito em aplicações industriais e
médicas nos próximos anos.
O fato de que sistemas bioquímicos podem ser planejados por um agente
, inteligente para seus próprios fins é admitido por todos os cientistas, até por
Richard Dawkins. Em seu mais recente livro, Dawkins imagina um cenário
hipotético em que um famoso cientista é sequestrado e obrigado a trabalhar
em armas biológicas para um país perverso, militarista.10 O cientista
consegue ajuda codificando uma mensagem na sequência de adn de um
vírus de gripe: contamina-se com o vírus alterado, espirra em cima de uma
multidão e, pacientemente, espera que a gripe se espalhe pelo mundo,
confiante em que outros cientistas isolarão o vírus, a sequência de seu adn,
e que decifrarão o código. Uma vez que Dawkins concorda que sistemas
bioquímicos podem ser planejados, e que pessoas que não viram ou ouviram
falar do planejamento podem, ainda assim, detectá-lo, a confirmação da
existência de planejamento num dado sistema bioquímico reduz-se, sim-
plesmente, à reunião de provas.
' Mas também temos que levar em conta o papel das leis da natureza. Elas
podem organizar matéria o fluxo de água, por exemplo, pode acumular
sedimentos suficientes para represar parte de um rio, obrigando-o a mudar
| de curso. As leis mais importantes são as da reprodução, mutação e seleção
; natural. Se uma estrutura biológica pode ser explicada em termos dessas
í leis naturais, não podemos concluir que ela foi planejada. Ao longo de todo
este livro, porém, demonstramos o motivo por que muitos sistemas bioquí-
micos não podem ser construídos por seleção natural através de muta
não existe nenhuma rota direta, gradual, para esses sistemas de comp
dade irredutível, e as leis da química operam fortemente contra o desen
vimento sem direção de sistemas bioquímicos que fabricam moléc
como a amp. Alternativas ao gradualismo que opera através de cai
não-inteligentes, tais como a simbiose e a teoria da complexidade,
podem (e nem mesmo tentam) explicar as máquinas bioquímicas i
damentais da vida. Se leis naturais peculiares à vida não podem explicar
sistema biológico, então os critérios para concluir que houve planejame
tomam-se os mesmos que se aplicam a sistemas inanimados. Não há
ponto mágico de complexidade irredutível no qual o darwinismo s
logicamente impossível. Mas as barreiras ao gradualismo tomam-se ci
vez mais altas à medida que as estruturas adquirem maior complexidad
interdependência.
Poderia haver um processo natural ainda desconhecido que explicas»
complexidade bioquímica? Ninguém seria tão tolo a ponto de negar es
possibilidade. Ainda assim, podemos dizer que, se há tal processo, ningaé
faz ideia de como funcionaria. Além do mais, ele seria contrário à toi
experiência humana, tal como postular que um processo natural poder
explicar computadores. Concluir que não há um processo desse tipo
cientificamente tão válido quanto concluir que a telepatia não é possível c
que o monstro do Loch Ness não existe. Diante das sólidas evidêncii
disponíveis de planejamento bioquímico, ignorá-las em nome de ui
processo imaginário seria fazer o mesmo papel daqueles detetives qu
ignoraram o elefante.
Esclarecidas e eliminadas essas questões preliminares, podemo
concluir que os sistemas bioquímicos discutidos nos Capítulos 3 a 6 foran
planejados por um agente inteligente. Podemos ter tanta confiança em noss;
conclusão sobre esses casos quanto na dedução de que uma ratoeira, o monte
Rushmore ou um póster de Eivis Presley foram planejados. Não há umí
questão de grau aplicável a esses sistemas, tais como os do homem na Lua
ou a forma da Itália. Nossa capacidade de confiar no planejamento do cílio
ou do transporte intracelular repousa sobre os mesmos princípios que nossa
capacidade de confiar no planejamento de qualquer coisa: a organização de
componentes separados para obter uma função identificável, que depende
nitidamente desses componentes.
A função do cílio é servir como um remo motorizado. A fim de cum-
prir essa função, microtúbulos, ligações de nexina e proteínas motoras têm
de ser organizadas com precisão. Elas têm que se reconhecer intimamente
e interagir de forma exata. A função não existirá se qualquer um dos

componentes estiver ausente. Além disso, muitos outros fatores, além dos
citados, são necessários para tomar o sistema útil à célula viva: o cílio tem
de ser posicionado no lugar certo, orientado corretamente e ligado ou
desligado de acordo com as necessidades da célula.
A função do sistema de coagulação do sangue é ser uma barreira forte,
mas transitória. Os componentes do sistema são organizados com esse fim.
Fibrinogênio, plasminogênio, trombina, proteína c, fator de Christmas e os
demais componentes da via realizam juntos alguma coisa que nenhum deles
pode fazer sozinho. Se a vitamina k não estiver disponível, ou faltar o fator
anti-hemofílico, o sistema falhará, exatamente da mesma maneira que uma
máquina Rube Goldberg não funciona se um dos componentes estiver
ausente. Os componentes se cortam em lugares exatos, alinham-se entre si
de maneiras precisas. Atuam para formar uma estrutura sofisticada, que
realiza uma tarefa específica.
A função do sistema de transporte intracelular é levar carga de um lugar
a outro. Para que isso seja feito, os pacotes têm de ser etiquetados, os
destinos reconhecidos e os veículos equipados. Os mecanismos precisam
estar nos lugares certos para poderem deixar uma área fechada da célula e
entrar em outra área fechada. A falha do sistema deixa um déficit de
suprimentos de importância crítica em um local, um excedente sufocante
; em outro. Enzimas úteis em uma determinada área produzem enormes
| estragos em outra.
r As funções de outros sistemas bioquímicos que discutimos anterior-
j mente são facilmente identificáveis, e suas partes interatuantes podem ser
l enumeradas. Uma vez que as funções dependem de forma crítica de
g interações complicadas das partes, temos que concluir que elas, tal como
| uma ratoeira, foram planejadas.
l O planejamento que ora ocorre em laboratórios de bioquímica em todo
o mundo a atividade necessária para planejar um novo plasminogênio
que possa ser dividido pela trombina, ou uma vaca que forneça hormônio
de crescimento em seu leite, ou uma bactéria que secrete insulina humana
; é análogo ao que precedeu o sistema de coagulação do sangue. O trabalho
de laboratório de estudantes de pós-graduação, reunindo pedacinhos de
genes em um esforço deliberado para fazer alguma coisa nova, é análogo
ao que foi feito para gerar o primeiro cílio.
Somente porque podemos inferir que alguns sistemas bioquímicos foram
planejados não significa que todos os sistemas subcelulares foram assim
208 A CAIXA PRETA DE DARWIN
concebidos. Além disso, alguns podem ter sido planejados, mas provar i
talvez seja difícil. A face de Eivis pode nos parecer clara e reconhecr
enquanto sua (suposta) guitarra é uma mancha impressionista. Detec
planejamento no cílio pode ser muito fácil, mas fazer o mesmo em ou
sistema talvez seja duvidoso ou mesmo impossível. Acélula contém sistern
que variam de obviamente planejados a nenhum planejamento visív
Mantendo em mente que tudo poderia ter sido planejado, vamos fazer,u
breve exame de alguns sistemas cujoplanejamento é de difícil identifícaça
A base da vida é a célula, na qual os processos bioquímicos que l;
servem de alicerce são isolados do resto do ambiente. A estrutura que
envolve é chamada de membrana. Ela é constituída na maior parte p(
moléculas que são quimicamente semelhantes aos detergentes com qu
lavamos nossos pratos e roupas. O tipo exato de moléculas tipo detergent
que são usadas nas membranas, varia muito de um tipo de célula para outrc
algumas são mais longas, outras mais curtas; algumas mais flexíveis, outra
mais rígidas; algumas têm carga positiva, outras, negativa, e outras, aind
são neutras. A maioria das células contém nas membranas uma mistura (
diversos tipos de moléculas, e essa mistura pode ser diferente em tipos
distintos de células.
Quando moléculas detergentes estão mergulhadas em água, elas tendem
a se associar. Um bom exemplo dessa associação é visto nas bolhas qu
rodopiam na máquina de lavar. As bolhas consistem de camadas mui
delgadas de detergente (com um pouco de água), nas quais as moléculas
são arrumadas lado a lado. Aforma esférica da bolha éproduto de uma forç
física denominada tensão de superfície, que age para reduzir a área da boi]
à menor área que possa conter o detergente. Se tomamos as moléculas (
uma membrana e as purificamos, separando-as de todos os demais compo
nentes da célula e as dissolvemos em água, elas frequentemente se acumu-1
Iam em uma forma esférica, fechada. ;
Uma vez que essas moléculas formam bolhas por si só, que a associação
de moléculas é indiscriminada, e porque uma molécula individual particular
não é necessária para formar uma membrana, é difícil inferir planejamento ;
inteligente nesse caso. Assim como pedras em um muro, todos os compo-
nentes são facilmente substituídos por um componente diferente. Tal como
o mofo em minha geladeira, o planejamento não é detectável.
Ou pensemos na hemoglobina a proteína das células vermelhas do
sangue, que transporta o oxigénio dos pulmões aos tecidos periféricos. A
hemoglobina é constituída de quatro proteínas individuais unidas e cada
uma delas pode fixar oxigénio. Duas das quatro são idênticas entre si, como
as duas outras entre si. Acontece que, por causa da maneira como as quatro
O QUE NOS DIZ A CAIXA? 209
proteínas componentes da hemoglobina grudam-se umas às outras, o
primeiro oxigénio que aparece liga-se menos fortemente do que os outros
três. A diferença na força da ligação do oxigénio resulta em um comporta-
mento denominado "atividade cooperativa". Em palavras mais simples,
isso significa que o volume de oxigénio fixado por um grande número de
hemoglobinas (como acontece no sangue) não aumenta diretamente com o
volume de oxigénio no ar. Em vez disso, quando o volume de oxigénio no
ambiente é baixo, praticamente nenhuma parte dele liga-se à hemoglobina
muito menos do que se ligaria se não houvesse atividade cooperativa.
Por outro lado, quando o oxigénio no ambiente aumenta, o volume ligado
à hemoglobina no sangue se eleva a uma taxa muito rápida. Esse fato pode
ser considerado uma espécie de efeito dominó. É preciso algum esforço
para derrubar a primeira pedra de dominó (capturar o primeiro oxigénio),
mas, em seguida, as demais pedras caem automaticamente. A atividade
cooperativa tem importantes consequências fisiológicas: permite que a
hemoglobina se tome inteiramente saturada onde há bastante oxigénio
(como nos pulmões) e que o descarregue com facilidade nos locais neces-
sários (como nos tecidos periféricos).
Há ainda outra proteína, denominada mioglobina, que é muito parecida
com a hemoglobina exceto por ter uma única sequência de proteínas, e não
quatro, e, por isso, fixa apenas um oxigénio. A fixação do oxigénio pela
mioglobina não é cooperativa. A questão é: Se supomos que já temos uma
proteína que fixa o oxigénio, como a mioglobina, podemos inferir planeja-
mento inteligente da função da hemoglobina? Ajustificação de planejamen-
to é fraca. O ponto de partida, a mioglobina, já pode fixar oxigénio. O
comportamento da hemoglobina pode ser conseguido por uma modificação
muito simples do comportamento da mioglobina, e as proteínas individuais
da hemoglobina lembram muito a mioglobina. Dessa maneira, embora
possamos considerar a hemoglobina um sistema de partes interatuantes, a
interação não faz muita coisa que esteja claramente além da capacidade dos
componentes individuais do sistema. Dado o ponto de partida da mioglo-
bina, eu diria que a hemoglobina mostra a mesma evidência de planejamen-
to que a face de homem na Lua: intrigante, mas longe de ser convincente.
O sistema bioquímico final já foi comentado no Capítulo 7 o sistema
que fabrica amp. Concluir que houve planejamento nesse caso é a mesma
coisa que concluir que um quadro atribuído a um artista famoso, mas
falecido, é na realidade uma falsificação feita por outra pessoa da mesma
época. Talvez notemos que o quadro contém no canto inferior esquerdo o
nome do famoso artista, mas as pinceladas, a combinação de cores, o tema,
o material da tela e a própria tinta são todos diferentes.
Uma vez que tantos passos sucessivos são necessários para fabricar o|
amp, já que intermediários não são usados, e tendo em vista que nossos
melhores conhecimentos químicos manifestam-se veementemente contra a
produção sem uma direção da via, a justificativa do planejamento no caso
da via amp parece ser muito forte. Em teoria, a conclusão de planejamento
nesse caso é vulnerável a um cenário do tipo Kauffman; a teoria da
complexidade, contudo, hoje pouco mais é do que uma ilusão, e o compor-
tamento químico conhecido das moléculas é um ponto de oposição muito j
forte a tal cenário. Além do mais, a conclusão de planejamento inteligente;
de outros sistemas bioquímicos reforça a credibilidade da mesma dedução
também no caso desse sistema.
Se qualquer coisa pode ter sido planejada, e se precisamos apresentar
evidências para prová-lo, não é de surpreender que possamos ter mais su-
cesso em demonstrar o planejamento em um dado sistema bioquímico e
menos em outro. Alguns aspectos da célula parecem ser resultado de
simples processos naturais; outros provavelmente são. Ainda outros foram
quase com certeza planejados. E, no tocante a certas características, pode-
mós ter tanta segurança que foram planejadas quanto qualquer outra coisa .
o foi.

OBJEÇÓESAO PLANEJAMENTO
IDEIAS SIMPLES
Uma ideia simples, por mais fecunda que seja, às vezes leva um tempo
surpreendentemente longo para desenvolver-se por completo. Talvez o
exemplo mais famoso disso seja a invenção da roda. Antes dela, as pessoas
se moviam vagarosamente em carroças puxadas a cavalo, que deslizavam
sobre varas, raspando o chão e produzindo um bocado de atrito. Qualquer
colegial de nossa época poderia tê-las aconselhado a construir carroças
dotadas de rodas, porque ele aprendeu alguma coisa sobre elas. A ideia da
roda é muito fecunda e, lembrando-nos do passado, espantosamente sim-
ples, e resulta em todo tipo de vantagens práticas na vida. Ainda assim, foi
formada e desenvolvida com muita dificuldade.
Outra ideia poderosa é o alfabeto fonético, composto de símbolos que
representam sons; juntando vários símbolos, conseguimos um série que
representa o som de uma palavra. Esses alfabetos contrastam com os
sistemas de escrita hieroglíficos, no qual caracteres pictóricos representam
palavras. De muitas maneiras, os hieróglifos constituem umamaneira muito
mais natural de escrever, em especial no caso de alguém que está começan-
do. E muito mais provável que uma pessoa que não conhece a comunicação
escrita desenhe a imagem de um cachorro comendo um osso em vez de
escrever marcas no papel sob a forma de "o cachorro come um osso" e,
em seguida, diga que a marca que parece a metade de um círculo (c)
representa o som de "Cê", que o círculo (o) representa o som "Oh!", e assim
por diante. Se já estivesse em uso, o sistema hieroglífico, mais natural,
tenderia a impedir que o alfabeto fonético fosse adotado, mesmo que este
último seja realmente mais simples e muito mais versátil, à medida que a
linguagem se toma mais complexa.
2)2 A caixa PRETA DE DARWIN
Na escola primária, aprendemos que, no número 561, o dígito l ré
senta l, mas que o dígito 6 representa 60, e que o 5 equivale a 500. Por a
desse pequeno macete de valor de posição, trabalhar com números tom
tão simples que até uma criança pode fazer isso. Qualquer menino de i
anos que tenha sido devidamente ensinado pode somar 561 a 427 para ol
988, e qualquer um de 12 anos pode multiplicar 41 por 17 para obter 6
Mas tente somar ou multiplicar esses mesmos números usando algarisn
romanos! Tente somar xxiv a lxxvi para conseguir c (sem prime
converter algarismos romanos em arábicos). Os algarismos romanos for
usados na Europa até a Idade Média; em consequência, a vasta maioria
povo não conseguia realizar cálculos simples, que o moderno caixa
tesoureiro faz sem a menor dificuldade. Somas simples requeriam
talentos de indivíduos especialmente treinados, que ganhavam a vi
fazendo contas.
A ideia de planejamento inteligente também é uma ideia simples, fecunt
óbvia, que foi desviada de seu caminho pela concorrência e contaminaç
de ideias estranhas. Desde o início, o principal concorrente de uma rigorc
hipótese de planejamento foi a sensação confusa de que, se alguma coi
se ajusta à nossa ideia de como as coisas devem ser, então isso é prova (
planejamento. Diógenes, o antigo filósofo grego, via planejamento nas e
tacões do ano:
Uma distribuição desse tipo não teria sido possível sem Inteligência, isto
que todas as coisas devem ter sua medida: inverno e verão, noite e dia, chw
e ventos, e períodos de tempo bom; e descobriremos também, se as e
tudarmos com atenção, que outras coisas têm o melhor arranjo possível.1
Não é de admirar que... a boca, através da qual o alimento é ingerido, dev
ter sido colocada tão perto do nariz e dos olhos, como se para impedir que;
sem ser notada, passe qualquer coisa imprópria à nutrição? E não podes
duvidar, Aristodemo, se a colocação de partes como essas foi obra do acaso
ou de sabedoria e intenção.2
Esses sentimentos, embora humanamente compreensíveis, baseiam-se tão
somente na impressão de que o mundo é um lugar divertido, e não muito
mais que isso. Não é difícil imaginar que, se Diógenes tivesse vivido no
O QUE NOS DIZ A CAIXA? 2)3
Havaí, onde não há inverno, ele poderia facilmente ter pensado que a falta
de estações era "o melhor dos arranjos possíveis". Se a boca de Sócrates
estivesse colocada junto à mão, poderíamos imaginá-lo dizendo que isso
era conveniente para transportar o alimento à boca. Argumentos para
justificar o planejamento, baseados na mera afirmação de que são "certos",
evaporam-se como o orvalho matutino quando enfrentam o menor ceticis-
mo.
Ao longo da história humana, a maioria dos indivíduos cultos (e, ainda
mais, incultos) pensou que o planejamento era evidente na natureza. Até o
tempo de Darwin, na verdade, o argumento de que o mundo baseava-se no
planejamento era lugar-comum tanto na filosofia quanto na ciência. A
validade intelectual do argumento, no entanto, era medíocre, sobretudo por
falta de ideias concorrentes. A força da noção do planejamento antes de
Darwin atingiu seu auge nas obras de um clérigo inglês do século xix,
William Paley. Servo devotado de Deus, Paley aplicou uma vasta erudição
científica a seus escritos, mas, ironicamente, tornou-se vulnerável à refuta-
ção por exagerar.
O famoso parágrafo inicial da Teologia natural, de Paley, mostra a força
do argumento, mas também contém algumas das falhas que resultaram mais
tarde em sua rejeição:
Cruzando uma charneca, suponhamos que bati com o pé numa pedra, e
alguém me perguntou como a pedra chegou ali. Eu bem poderia responder
que, por tudo que sabia, ela poderia ter estado ali desde sempre; e talvez não
fosse muito fácil demonstrar que a resposta era absurda. Mas suponhamos
que eu tivesse encontrado um relógio no chão, e alguém me perguntasse
como ele havia chegado ali. Eu dificilmente pensaria na resposta que dei
antes, que, tanto quanto sabia, o relógio devia ter estado ali desde sempre.
Ainda assim, por que essa resposta não serviria para o relógio, como havia
servido para a pedra; por que não seria tão admissível no segundo caso
quanto o fora no primeiro? Pela razão seguinte, e por nenhuma outra, isto
é, que quando examinamos o relógio, notamos o que não poderíamos
descobrir na pedra que suas várias partes foram fabricadas e reunidas
para um fim, isto é, foram formadas e ajustadas para produzir movimento,
e movimento regulado de maneira a indicar a hora do dia; que se as diferentes
partes tivessem sido formadas de modo diferente, ou colocadas de qualquer
outra maneira ou em qualquer outra ordem que não aquela, nenhum movi-
mento teria sido executado na máquina, ou nenhum que conferisse o uso
que agora tem. Ou, resumindo algumas dessas partes mais simples e suas
funções, todas elas tendem para um único resultado: vemos uma caixa
cilíndrica que contém uma mola elástica enrolada que, no esforço para se
desenrolar, gira na caixa. Observamos, em seguida, uma corrente flexível...
Descobrimos depois uma série de engrenagens... Podemos i
engrenagens são feitas de bronze a fim de evitar que se enferru
sobre o mostrador do relógio foi colocado um vidro, material q
sido empregado em nenhuma outra parte do trabalho, mas apf
em que a propriedade da transparência era desejável, indicand
que a caixa precisasse ser aberta. Tendo este mecanismo sido
e é preciso realmente um exame do instrumento e, talvez
nhecimento prévio do assunto para notá-lo e comprendê-lo;
como dissemos, observado e compreendido, a inferência em qi
é inevitável, que o relógio tinha que ser obra de um criador
existido, em algum tempo e em um ou outro lugar, um artífice,
que o formaram para a finalidade que o vemos realmente
compreenderam sua construção e planejaram seu uso.3
Comparado com o argumento dos gregos, o de Paley é bem melr
em Natural Theology, dê numerosos exemplos medíocres de p:
(semelhantes aos de Diógenes e de Sócrates), ele freqüentemen
cheio. Entre outras coisas, escreve sobre sistemas separado;
músculos, ossos e glândulas mamarias, que acredita que d
funcionar se um dos seus vários componentes faltasse. Essa é a
argumento do planejamento. Não obstante, é preciso enfatiz
nhecimento do leitor moderno, que, mesmo na sua melhor f
falava a respeito de caixas pretas biológicas: sistemas maiores
célula. Já o exemplo que nos dá do relógio, em contraste, é excel
o relógio não era uma caixa preta, já que se conheciam seus c
e respectivos papéis.
Paley expressa tão bem o argumento do planejamento que
respeito até de evolucionistas ferrenhos. Richard Dawkins tire
seu livro, O relojoeiro cego, da analogia do relógio traçada pó
alega que a evolução, e não um agente inteligente, represent;
relojoeiro;
Paley apresenta seu convincente ponto de vista com belas
descrições da maquinaria dissecada da vida, começando com (
no... O argumento de Paley é exposto com apaixonante s
baseado na melhor erudição biológica de sua época, mas é err
e totalmente errado... Se podemos dizer [que a seleção natural
papel do relojoeiro na natureza, é o do relojoeiro cego... Uma
O QUE NOS DIZ A CAIXA? 2 l 5
farei é depreciar a maravilha dos "relógios" vivos que tanto inspiraram
Paley. Muito ao contrário, tentarei passar minha certeza de que, neste
particular, Paley poderia ter ido ainda mais longe.4
Os sentimentos de Dawkins em relação a Paley são os de um conquistador
em relação a um inimigo valoroso, mas derrotado. Magnânimo na vitória,
o cientista de Oxford pode se dar ao luxo de render homenagem ao clérigo
que compartilhava de seu próprio encanto com a complexidade da natureza.
Certamente Dawkins tem razão em considerar Paley derrotado: poucos
filósofos ou cientistas a ele se referem, mesmo de passagem. Os que o
fazem, como Dawkins, agem assim apenas para ignorar, e não para discutir
seu argumento. Paley foi enterrado juntamente com a astronomia centrali-
zada na Terra e a teoria do flogístico outro derrotado na luta da ciência
para explicar o mundo.
Mas exatamente em que ponto, poderíamos perguntar, Paley foi refuta-
do? Quem rebateu seu argumento? De que maneira foi produzido o relógio,
sem um planejador inteligente? É surpreendente, mas verdadeiro, que o
principal argumento do desacreditado Paley nunca foi refutado de fato. Nem
Darwin nem Dawkins, nem a ciência nem a filosofia explicaram como um
sistema irredutivelmente complexo como um relógio poderia ser produzido
sem um planejador. Em vez disso, o argumento de Paley foi desviado do
alvo por ataques a seus exemplos mal escolhidos e por discussões teológicas
despropositadas. Paley, é claro, merece censura por não ter ordenado seu
ponto de vista com maior precisão. Mas muitos de seus detratores também
são censuráveis por se recusarem a discutir seu argumento principal,
bancando os bobos para chegar a uma conclusão que lhes fosse mais
aceitável.
de tudo um pouco
No Natural Theology, Paley indica exemplos biológicos que, afirma, são
sistemas de componentes interatuantes, como um relógio, e que, portanto,
indicam a presença de um planejador. Os exemplos de Paley mostram de
tudo um pouco, variando do realmente impressionante ao apenas interes-
sante e bastante tolo, de sistemas mecânicos a instintos e a meras formas.
Quase nenhum de seus exemplos foi especificamente refutado com a
demonstração de que as características poderiam ter surgido sem um
planejador, mas, uma vez que em muitos deles Paley não utiliza princípio
algum que impediria o desenvolvimento em pequenos passos, tem sido
216 A CAIXA PRETA DE DARWIN
suposto desde os dias de Darwin que esse desenvolvimento gradual é
possível.
Paley apresenta-se em sua melhor forma quando escreve sobre sistemas
mecânicos. A respeito do coração, observa o seguinte:
E evidente que o coração exige a intervenção de válvulas que, na verdade
o sucesso de sua operação depende delas; isso porque, quando qualquer una
de suas cavidades se contrai, a tendência necessária da força será impulsio»
nar o sangue aprisionado não só para a boca da artéria aonde deve ir, ma
também para a boca da veia de onde veio... O coração, constituído como 6
não pode funcionar sem válvulas, do mesmo modo como uma bomba n»Ji
poderia funcionar sem elas.5 ;|
Nesse trecho, ele identifica uma função do sistema e diz ao leitor por que|
coração requer várias partes não só uma bomba, mas também válvulas!
Paley é medíocre, porém, quando descreve instintos: j
O que deve induzir a ave fêmea a preparar o ninho antes de pôr o ovo?...B
plenitude ou distensão que ela poderia sentir em uma determinada parte (J
corpo, com origem no crescimento e solidez do ovo dentro dela, não pode
de modo algum informá-la de que estava prestes a produzir alguma cot
que, quando produzida, devia ser preservada e cuidada... Como saberiami
aves que seus ovos continham seus filhotes?6
O exemplo pode ser interessante, mas é difícil, neste caso, identificar ui
função exata. Além disso, muitas das partes componentes do sistet
(residindo talvez no cérebro da ave) são desconhecidas, de modo que eli
uma caixa preta.
Paley estava, provavelmente, muito cansado quando escreveu sobre;
desenvolvimento fetal:
O olho não tem utilidade na ocasião em que é formado. E um instrume(
óptico fabricado em uma masmorra, construído para refratar a luz parai)
foco e aperfeiçoado para sua finalidade antes que um raio de luz a ele tea
acesso... Ele está se preparando para o futuro.7 |
l
No exemplo, Paley convida-nos tão-somente a admirar a sincronização
um evento, e não a observar qualquer aspecto de um sistema particu
identificado.
Ele parece pedir encarecidamente que o ridicularizem quando csgb
sobre o que chama de compensação: ;

) pescoço curto e rígido do elefante é compensado pelo comprimento e


lexibilidade de sua tromba...
O tipo dos grous deve viver e procurar seu alimento entre as águas, mas,
omo não é palmípede, é incapaz de nadar. A fim de compensar essa
eficiência, essas aves são dotadas de longas pernas para andar na água ou
Migos bicos para tentear, ou ambas as coisas. Isso é compensação.9
raciocínio desse tipo pode constituir uma rica fonte de material para
Ias (ele é alto para contrabalançar o fato de ser tão feio; ela é rica
i compensar ser tão burra e assim por diante), mas faz muito pouco para
lonstrar o planejamento. Para sermos caridosos, Paley pode ter pensado
; seus fortes exemplos tomavam o planejamento inevitável e usou os
nplos mais fracos como cobertura do bolo. Ele, com toda probabilidade,
.previu que seus futuros adversários refutariam seu argumento atacando
-bertura.
futando paley
espeito de muitos de seus mal orientados exemplos, o famoso primeiro
agrafo de Paley sobre o relógio é absolutamente correio ninguém
:aria que, se achasse um relógio, concluiria, de imediato e com certe-
que ele havia sido planejado. A razão da conclusão é exatamente a que
ey sugeriu: a organização de componentes separados para realizar uma
ição além da capacidade dos componentes isolados. A função do relógio
narcar as horas. Seus componentes são as várias engrenagens, molas,
Tentes e as outras peças listadas por Paley.
Até agora, tudo bem. Mas se ele sabia o que procurar em seu paradigma
pânico, por que despencou ladeira abaixo com tanta rapidez? Porque se
aolgou e começou a examinar os aspectos errados do relógio.
3s problemas começam quando ele abandona sistemas de componentes
essariamente interatuantes para falar sobre arranjos que apenas se
istam à sua ideia de como as coisas deviam ser. O primeiro indício de
ïblemas aparece já no parágrafo inicial, quando diz que as engrenagens
'relógio são feitas de bronze para impedir a ferrugem. O problema é que
naterial exato, o bronze, não é necessário para que o relógio funcione. O
wize poderia ajudar, mas um relógio pode funcionar com engrenagens
tas de quase todos os materiais duros provavelmente até madeira ou
to. As coisas pioram ainda mais quando ele menciona a tampa de vidro
'relógio. Não só o material exato que menciona não é necessário, mas
Io o componente é dispensável: uma tampa não é necessária para o
218 A CAIXA PRETA DE DARWIN
funcionamento do relógio. A tampa do relógio é simplesmente uma conv"
niência que foi acrescentada a um sistema irredutivelmente complexo, eni
parte do próprio sistema. ;
Em todo o livro, Paley se afasta do aspecto do relógio um sistema d
componentes interatuantes que o levou, para começar, a selecioná-lc
Como frequentemente acontece com todos nós, seu argumento teria sid
muito melhorado se ele tivesse falado menos. ;
Por causa dessa imprudência, o argumento de Paley tem sido transfo
mado, ao longo desses anos, em um testa-de-ferro a ser derrubado. Em v»
de enfrentar a complexidade real de um sistema (como a retina ou u
relógio), alguns defensores do darwinismo se satisfazem contando un
história para explicar aspectos periféricos. Fazendo uma analogia, un
"explicação" darwiniana de um relógio com tampa começaria supondo-!
que uma fábrica já estava fabricando relógios sem tampa! E, em seguida,!
explicação continuaria, com vistas a mostrar que aperfeiçoamento um
tampa seria.
Pobre Paley. Seus adversários modernos sentem-se justificados em sup
pontos de partida imensamente complexos (como um relógio ou un
retina), se pensam que podem explicar um melhoramento simples (tal con
a tampa do relógio ou a curvatura do olho). Nenhum outro argumento K
apresentado, nenhuma explicação é dada da complexidade real, da coní
plexidade irredutível. E afirmam que a refutação dos exageros de Paley (
uma refutação de seu principal argumento, mesmo aqueles que sabem qujj
não é bem assim. '
Da mesma forma que o argumento em favor do planejamento inteligen
circula há muito tempo, o mesmo acontece com os argumentos contráril
Os melhores foram formulados por Darwin e seus sucessores, mas algi
são mais antigos que a teoria da evolução. O filósofo David Hume ar,
mentou contra o planejamento no Dialogues Concerning N aturai Religi
publicado em 1779. Em O relojoeiro cego, Richard Dawkins relembra u
conversa ao jantar com "um conhecido ateu", que tocou no assunto:
Eu disse que não conseguia imaginar ser ateu antes de 1859, quando f
publicada a Origem das espécies, de Darwin. "O que me diz de Hume?
replicou o filósofo. "Como foi que Hume explicou a complexidade organ
zada do mundo vivo?", perguntei. "Não explicou", disse o filósofo. "Porqi,
ela precisaria de alguma explicação especial?"9 ,
O QUE NOS DIZ A CAIXA? 2 l 9
vkins continua, explicando:
uanto ao próprio Hume, diz-se algumas vezes que o grande filósofo esco-
es, um século antes de Darwin, acabou com o argumento em favor do pla-
lejamento. Mas o que Hume fez foi criticar a lógica de se utilizar o
ilanejamento aparente na natureza como evidência positiva da existência
lê um Deus. Ele não ofereceu uma explicação alternativa ao planejamento
jiológico complexo.10
filósofo moderno, Eiliott Sober, da Universidade de Wisconsin, explica
l mais detalhes, em seu livro Philosophy of Biology, o raciocínio de
Hume acredita... que devemos perguntar até que ponto relógios e organis-
mos são semelhantes. Um único momento de reflexão mostra que eles são
muito dessemelhantes. Relógios são feitos de vidro e metal; não respiram,
não excretam, não metabolizam nem se reproduzem... A consequência
imediata, claro, é que o argumento favorável ao planejamento é um argu-
mento de fraca analogia. E absurdo inferir que os organismos têm uma dada
propriedade simplesmente porque os relógios a têm.11
ber, porém, não concorda com Hume:
Embora a crítica de Hume seja devastadora, se a tese do planejamento é
baseada em analogia, não vejo razão para que seja interpretada dessa
maneira. O argumento de Paley sobre organismos sustenta-se por si mesmo,
pouco importando se relógios e organismos são semelhantes. O motivo de
falar em relógios é o de ajudar o leitor a compreender que o argumento sobre
organismos é convincente.12
m outras palavras, David Hume pensava que o argumento em favor do
anejamento dependia de uma forte semelhança em detalhes acidentais
ïtre organismos biológicos e outros objetos planejados. Essa linha de
iriocínio, porém, destruiria todas as analogias, uma vez que dois objetos
uaisquer não-idênticos terão mais pontos de diferença do que de seme-
iança. Segundo o pensamento de Hume, por exemplo, não poderíamos
anparar um carro com um avião, porque o avião tem asas e o carro não
m, e assim por diante. Sober rejeita o pensamento de Hume, porque diz
lie o argumento do planejamento inteligente é, na realidade, algo denomi-
ïdo de inferência com base na melhor explicação. Isso significa simples-
lente que, dada uma escolha entre explicações conflitantes de planejamen-
inteligente versus forças naturais não orientadas, o argumento de Paley
220 A CAIXA PRETA DE DARWIN
parece mais aceitável (pelo menos, diz Sober, antes do aparecimento c
Darwin).
A conclusão de Sober é excelente até onde se aplica, mas ele poderia t@
dito também que o argumento baseado em analogia continua válido e qu
foi apenas distorcido e perdeu sua forma nas mãos de Hume. Analogias sã
sempre articuladas de modo que, explícita ou (mais comum) implicita
mente, sugiram que A é parecido com B em um subconjunto restrito &
propriedades. A ferrugem é semelhante à cárie dentária no sentido em qu
ambas começam em pequenos pontos e se espalham para fora, mesmo qu
o estrago no dente aconteça em materiais vivos, seja causado por bactérias
possa ser combatido por flúor etc. Uma máquina Rube Goldberg é seme
lhante ao sistema de coagulação sanguínea no sentido em que ambos sã
irredutivelmente complexos, mesmo que apresentem muitas diferenças
Para chegar a uma conclusão baseada em analogia, é necessário que
dedução se siga de propriedades compartilhadas: a máquina Rube Golt
berg, de complexidade irredutível, exigiu um planej ador inteligente para se
produzida; por conseguinte, o sistema de coagulação irredutivelment
complexo também exigiu um planejador.
Eventualmente, mesmo pêlos critérios de Hume, a analogia entre un
relógio e um organismo vivo poderia ser tomada muito forte. Abioquímic,
moderna poderia, com toda probabilidade, fabricar um relógio, ou un
dispositivo de marcação de tempo, com materiais biológicos se na
agora, com certeza no futuro próximo. Muitos sistemas biológicos marcan
o tempo, incluindo as células que dão ritmo ao coração, o sistema que inia
a puberdade, e as proteínas que dizem à célula quando ela deve se dividi
Além disso, são conhecidos componentes bioquímicos que podem funcio
nar como engrenagens e correntes flexíveis, e mecanismos de retroalimen
tacão (que são necessários para regular o relógio) são comuns em bioqu
mica. Acrítica de Hume ao argumento em favor do planejamento, ao afirma
que existe uma diferença fundamental entre sistemas mecânicos e sistema
vivos está desatualizada, destruída pelo progresso da ciência que descobri)
a maquinaria da vida.
Sober continua sua análise de Hume nos seguintes termos:
Volto agora à segunda crítica de Hume ao argumento em favor do planeja
mento, que não é mais pertinente do que a primeira... (Hume) alega que s
queremos ter uma boa razão para pensar que os organismos em nosso mund
são produto de planejamento inteligente, então devemos ter examinad
muitos outros mundos e observado planejadores inteligentes neles produ
zindo organismos.13
lê critica o planejamento por ser um argumento indutivo. Um exemplo
idução é o argumento de que, porque nunca se viu um porco voar,
ms, com toda probabilidade, não podem voar. Uma conclusão de
lejamento baseada em indução requereria que tivéssemos experiência
;oisas vivas sendo planejadas. Hume pensa que já que não observamos
)lanejamento em nosso mundo, temos de procurar essa experiência em
tos mundos. Uma vez que não temos conhecimento de outros mundos,
itudo, então não temos experiência para fazer uma indução. Sober
edita que o argumento de Hume é inválido porque, mais uma vez,
»r pensa que o planejamento inteligente é, na realidade, uma inferên-
baseada na melhor explicação possível, e não um argumento indutivo.
E Sober, novamente, tem razão até onde se aplica seu raciocínio, mas
i poderia ter ido mais longe. Embora a objeção de Hume pudesse ter sido
ida em seus dias, o argumento indutivo foi destruído pelo progresso da
ncia. Abioquímica moderna planeja sistemas bioquímicos em uma base
ineira, sistemas que hoje se sabe constituírem a base da vida. Nós, por
iseguinte, temos experiência na observação de planejamento inteligente
l componentes da vida. Provavelmente, já houve dezenas de milhares de
ferimentos nos quais novos sistemas bioquímicos foram reunidos e, no
ituro, deverá haver muitos, muitos mais.
O fracasso dos argumentos de Hume exigiram que os críticos modernos
ï planejamento apresentassem outros fundamentos lógicos para suas
leias. No restante deste capítulo, estudaremos os argumentos modernos
ais conhecidos contra o planejamento.
i ANALOGIA DA TÁBUA DE OUIJA
amigo filósofo de Richard Dawkins, que pensava que David Hume havia
futado o argumento em favor do planejamento, enganou-se tanto em sua
[osofia quanto em sua ciência. Eiliott Sober teve mais sucesso com
ia filosofia, mas, aparentemente, não está a par dos progressos relevantes
t ciência. Embora pense que Hume errou, Sober não demonstra simpatia
das alegações de planejamento inteligente, porque pensa que a evolução
uwiniana fornece um mecanismo para a geração de vida. Não baseia essa
Biclusão em modelos publicados de geração gradual de sistemas bioquí-
icos irredutivelmente complexos e nem mesmo leva em conta a base
olecular da vida. Em vez disso, rejeita o planejamento e adota o darwi-
smo, baseado principal (e ironicamente) em uma analogia. Explica ele
'aPhilosophy inBiology:
O fato de o processo mutação-seleção ter duas partes... é vividament'
destacado por Richard Dawkins em seu livro O relojoeiro cego. Imagine
mós um dispositivo que se parece com uma fechadura de combinação. El
é composto por uma série de discos postos lado a lado. Na borda de cad
disco, aparecem as 26 letras do alfabeto. Os discos podem ser girado
separadamente, de modo que sequências diferentes de letras podem aparecer
na janelinha. ,
Quantas combinações diferentes de letras podem aparecer na janelinha?
Há 26 possibilidades em cada disco e 19 discos no total. Portanto, há 269:
possíveis sequências diferentes. Uma delas é methinksitisaweasel... Apro-|
habilidade de que methinksitisaweasel apareça após todos os discos serem
girados é de 12619, o que é realmente um número muito pequeno... ;
Mas imaginemos agora que um disco é travado, se ele por acaso colocari
na janelinha uma letra que seja igual a uma da mensagem-alvo. Os discos'
restantes que não se ajustam ao alvo, então, são girados ao acaso, e o
processo se repete. Qual a probabilidade de que os discos exibam a mensa-
gem methinksitisaweasel, digamos, após cinquenta repetições?
A resposta é que podemos esperar que a mensagem apareça após um
número surpreendentemente pequeno de gerações do processo...
A variação é gerada ao acaso, ao passo que a seleção entre variantes é
não-aleatória.14
Essa analogia tem a intenção de mostrar como sistemas biológicos
complexos poderiam ter sido produzidos. Somos, portanto, convidados a
concluir, baseados na analogia com os discos rotativos, que o cílio evoluiu |
passo a passo, que as etapas iniciais na visão poderiam ser produzidas
gradualmente, e assim por diante. A analogia é oferecida em lugar de provas
concretas de que esses ou outros sistemas complexos poderiam ter evoluí-1
do à maneira darwiniana. E Sober pensa que a analogia é tão convincente j
que, baseada nela, a evolução darwiniana leva o prémio de inferência à -j
melhor explicação. A analogia de Dawkins (ligeiramente diferente em '
detalhes em seu livro, em comparação com a versão de Sober), embora ;
claramente falsa, empolgou a imaginação de alguns filósofos da biologia.
Além de Sober, Michael Ruse usou um exemplo semelhante em seu livro
Darwïnism Defended, como fez também Daniel Dennett em Darwin's
Dangerous Idea.
O que há de errado na analogia Dawkins-Sober? Tudo, apenas. Ela é
apresentada como uma analogia da seleção natural, que requer uma função
para ser selecionada. Mas que função existe em uma fechadura de combi-
nação que está errada? Suponhamos que, depois de girar os discos durante
algum tempo, conseguimos metade das letras certas, alguma coisa como
mdtuifkqinioaferscl (as letras correias estão alternadas). A analogia

O QUE NOS DIZ A CAIXA? 223


ma que isso constitui um melhoramento em comparação com uma série
atória de letras e que, de alguma maneira, nos ajudaria a abrir a fechadura.
as se nossa vida dependesse de abrir uma fechadura que tem a combina-
10 methinksitisaweasel, e tentássemos mdtuifkqinioaferscl, estaria-
os servindo de adubo para as margaridas. Se nosso sucesso reprodutivo
pendesse de abrir a fechadura, não teríamos descendentes. Ironicamente
ira Sober e Dawkins, uma fechadura de combinação é um sistema
pecificado, de complexidade irredutível, que ilustra muito bem por que,
) caso desses sistemas, a função não pode ser abordada gradualmente.
A evolução, dizem-nos os proponentes da teoria, não é dirigida para
na meta. Mas então, se começássemos com uma série aleatória de letras,
)r que terminamos com methinksitisaweasel, e não com mydarling-
mentine ou mebetarzanyoubejane? À medida que um disco gira,
iem está decidindo que letras imobilizar, e por quê? Em vez de uma
lalogia com a seleção natural aluando sobre mutação aleatória, o cenário
awkins-Sober é, na realidade, um exemplo do contrário: um agente
teligente dirigindo a construção de um sistema irredutivelmente com-
exo. O agente (Sober, neste caso) tem na mente a frase-alvo (a combinação
ifechadura) e dirige o resultado nessa direção, com tanta segurança quanto
n adivinho que conduz uma tábua Ouija. Essa situação dificilmente parece
'.r um alicerce seguro, sobre o qual construir uma filosofia da biologia.
Os problemas fatais com a analogia não são difíceis de identificar. Eles
Tam alfinetados com humor por Robert Shapiro, professor de química da
ewYorkUniversity, em seu livro Origins:A Skeptic's Guide to the Origin
'Life, publicado sete anos antes do livro de Sober.15 O fato de que um
listre filósofo ignore problemas lógicos simples, que são facilmente
acebidos por um químico, sugere, para variar, que uma visita a um
boratório de bioquímica seria aconselhável.
as discussões sobre planejamento inteligente, nenhuma objeção é mais
epetida do que o argumento baseado na imperfeição, que podemos resumir
m curtas palavras: se existe um agente inteligente, que planejou a vida na
erra, então ele seria capaz de criar vida que não tivesse defeito; aliás, ele
cria feito isso. Esse argumento parece ter grande apelo popular. Temos aqui,
ontudo, apenas o reverso do ponto de vista de Diógenes: se algo não se
lusta à nossa ideia de como devem ser as coisas, então isso é uma prova
ïontra o planejamento.
226 A CAIXA PRETA DE DARWIN
A psicologia de sociedades extraterrestres não é melhor compreendida q
a nossa. E inteiramente possível que sociedades extraterrestres possa
infectar outros planetas por razões muito diferentes daquelas que sugei
mós.18 ;
i
Em seus trabalhos, esses autores concluíram, com razão, que o plan
poderia ser detectado mesmo não havendo informações sobre os motive
dos planejadores. j
O problema seguinte é que os proponentes do argumento da imperfeiçaJ
usam com frequência sua avaliação psicológica do planejador como provi
categórica de evolução não-dirigida. Esse raciocínio poderia ser transcntt|
na forma de silogismo: j
1. Um planejador teria construído o olho dos vertebrados sem um ponti|
cego. l
2. O olho dos vertebrados tem um ponto cego. l
3. Por conseguinte, a evolução darwiniana produziu o olho. s
i
Para raciocínios como esse é que foi inventada a expressão non sequitur.i
literatura científica não contém evidências de que a seleção natural, traba
lhando sobre mutações, possa produzir um olho com um ponto cego, outtj
sem esse ponto, pálpebra, lente, retina, rodopsina ou refinai. O polenúsl
chegou a uma conclusão favorável ao darwinismo baseado exclusivament
em sentimentos sobre a maneira como as coisas devem ser. Um observada
mais objetivo poderia concluir apenas que o olho do vertebrado não ffl
projetado por uma pessoa que se deixou impressionar pelo argumento dj
imperfeição; a extrapolação para outros agentes inteligentes é impossível
Ken Miller não escreveu seu artigo para a Reader's Digest, mas parai
Technology Review. Seu público leitor é relativamente sofisticado, capa)
de lidar com conceitos científicos abstratos, e acostumado a seguir argu
mentos difíceis, que levam a conclusões sólidas. O fato de oferecer aq
leitores um argumento baseado em psicologia, e não em ciência nua e crui
transmite a imagem oposta que tenciona passar sobre as forças relativas q
planejamento inteligente em comparação com a evolução. ,
Há uma subcategoria de argumento, do tipo nenhum-planejador-teria-fe
to-isso-dessa-maneira, que requer uma resposta diferente. Em vez de diz»
que uma estrutura útil contém defeitos que não deviam ter sido tolerada
o autor menciona algum aspecto que aparentemente não tem uso algun

O QUE NOS DIZ A CAIXA? 227


Não raro, o aspecto lembra alguma coisa que é efetivamente usada em
. outras espécies e, portanto, parece ser algo que foi de fato usado em algum
tempo, mas que, em seguida, perdeu sua função. Órgãos vestigiais
desempenham um papel importante nesse argumento. O biólogo evolucio-
nista Douglas Futuyma, por exemplo, cita os "olhos rudimentares de
animais de cavernas, as pernas minúsculas, inúteis, de muito lagartos com
características de serpentes, e vestígios de pélvis em pítons", como prova
de que ocorreu evolução.19 Como sou bioquímico, prefiro as versões
moleculares desse argumento. Ken Miller fala de vários genes que produ-
zem formas diferentes de hemoglobina em seres humanos:
Serão os cinco genes desse complexo produtos superiores de planejamento, ou
uma série de erros dos quais se aproveitou a evolução? O cacho em si, ou mais
especificamente, o gene da sexta (3-globina no cacho, fornece a resposta. Esse
gene é... quase idêntico aos outros cinco genes. Estranhamente, contudo, esse
gene... nenhum papel desempenha na produção da hemoglobina. Biólogos
chamam essas regiões de "pseudogenes", refletindo com essa designação o fato
de que, por mais que eles se pareçam com genes funcionais, na verdade não o
Miller diz aos leitores que o pseudogene carece dos sinais apropriados para
informar ao resto da maquinaria da célula que deve fabricar uma proteína
com base no mesmo. E conclui da seguinte maneira:
' A teoria do planejamento inteligente não pode explicar a presença de
! pseudogenes não-funcionais, a menos que esteja disposta a reconhecer que
; o planejador cometeu vários erros, desperdiçando milhões de bases de adn
; em uma planta baixa cheia de coisas inúteis e de rabiscos. A evolução, em
,,: contraste, pode facilmente explicá-los como nada mais do que experimentos
( fracassados, em um processo aleatório de duplicação de genes, que persis-
, tem no genoma como resquícios da evolução.21
10 argumento não convence por três razões. Em primeiro lugar, o fato de
Iflão termos ainda descoberto um uso para uma determinada estrutura não
Xá que esse uso não exista. As amígdalas foram outrora consideradas
inúteis, embora uma função importante na imunidade tenha sido
erta para elas. A pélvis da píton poderia estar fazendo alguma coisa
til que ignoramos. Esse argumento aplica-se também em escala molecular:
bs pseudogenes da hemoglobina e outros pseudogenes, embora não sejam
Rsados para fabricar proteínas, talvez sejam utilizados para outras coisas
pie ainda não sabemos quais são. Alguns usos potenciais que me acorrem
tmente enquanto me encontro aqui à escrivaninha incluem ligar-se a genes
228 A CAIXA PRETA DE darwin
ativos de hemoglobina durante a replicação do adn, a fim de estabili
orientar recombinações de eventos ligados ao adn; e alinhar fato
proteína relativos a genes ativos. Pouco importa se estas são fi
concretas dos pseudogenes da hemoglobina. O argumento aqui é
afirmação de Miller baseia-se apenas em suposições.
A segunda razão por que o argumento de Miller não convence
mesmo que os pseudogenes não tivessem função, a evolução nunca'
cou" como eles surgiram. Até para que uma pseudocópia de um gen
fabricada, dezenas de proteínas sofisticadas são necessárias: separa
fios de adn, colocar a maquinaria de cópia no lugar certo, costui
nucleotídeos em uma corrente, voltar a inserir a pseudocópia no
muito mais. Em seu artigo, Miller nada nos disse sobre a maneira
qualquer uma dessas funções poderia ter surgido em um processo (
niano gradual, e tampouco indicou os artigos na literatura científíc
poderíamos encontrar a informação. E não pôde fazer isso pon
informação não existe em parte alguma.
Pessoas como Douglas Futuyma, que cita órgãos vestigiais como
da evolução, enfrentam o mesmo problema. Para começar, Futuyma.
explica como se desenvolveram uma pélvis e um olho concretos de
a dar origem mais tarde a um órgão vestigial. E tanto o órgão fun
como o vestigial precisam de explicação. Não quero passar por algue
sabe tudo sobre planejamento ou evolução muito longe diss
simplesmente, não posso ignorar a prova, que existe, de planejame
introduzo uma carta em uma fotocopiadora, por exemplo, e ela me
dezena de boas cópias e uma cópia com umas duas grandes mancha
erraria se usasse a cópia manchada como prova de que a fotocopie
surgiu por acaso.
Argumentos baseados em falhas percebidas ou em genes e 6ï
vestigiais correm o mesmo perigo do argumento de Diógenes, de q
progressão das estações demonstra planejamento inteligente. Cientil
mente, é inválido fazer suposições sobre as maneiras como as cc
deveriam ser.
HA MUITO, MUITO TEMPO
A terceira razão porque o argumento de Miller erra o ai vo é na verdade, l
compreensível. Ela tem origem na confusão entre duas ideias separad
a teoria de que a vida foi inteligentemente planejada e a teoria de que a
é jovem. Uma vez que grupos religiosos, que defendem com vêem
ambas as ideias, andaram ocupando as manchetes nas últimas déc
O QUE NOS DIZ A CAIXA? 229
ide parte do público pensa que elas estão necessariamente ligadas.
lícita no argumento de Ken Miller sobre os pseudogenes, e absoluta-
.te necessária às suas conclusões, há a ideia de que o planejador deve
criado a vida recentemente. Isso, porém, não faz parte da teoria do
'nejamento inteligente. A conclusão de que alguns aspectos da vida fo-
tt planejados pode ser tomada na ausência de prova sobre quando ocorreu
ilanejamento. Uma criança que olha para as faces esculpidas no monte
shmore percebe de imediato que elas foram planejadas, mas talvez não
ha ideia sobre sua história. Tanto quanto sabe, elas poderiam ter sido
oejadas um dia antes de sua chegada ali, ou datar dos primórdios dos
apôs. Um museu de arte pode exibir uma estátua de um gato de bronze
gadamente esculpida no Egito há milhares de anos até ela ser
iminada por métodos de tecnologia avançada e se demonstrar que se trata
uma falsificação moderna. Em ambos os casos, o gato de bronze
lamente foi planejado por um agente inteligente.
Os sistemas bioquímicos de complexidade irredutível que discutimos
?te livro não tinham que ser produzidos recentemente. É de todo possível,
ista do simples exame dos próprios sistemas, que tenham sido planejados
bilhões de anos e que chegaram ao presente através dos processos
Unais de reprodução celular. Talvez um cenário especulativo ilustre bem
Wí argumento. Suponhamos que há quase quatro bilhões de anos o plane-
pr fabricou a primeira célula, j á contendo todos os sistemas bioquímicos
|dutivelmente complexos discutidos aqui, e muitos outros. (Podemos
ptular que o planejamento de sistemas que deveriam ser usados mais
|e, como a coagulação do sangue, esteve presente, mas ainda não "liga-
r. Nos organismos modernos, numerosos genes são desligados tempo-
I, às vezes durante gerações, para serem ligados mais tarde.)
os ainda que o planejador colocou nas células alguns outros
iobre os quais não podemos fornecer prova suficiente, para
planejamento. A célula que continha os sistemas planejados
seguida, deixadas em piloto automático para reproduzir-se,
mutação, comer e ser comida, chocar-se com rochas e sofrer os
odos os caprichos da vida aqui na Terra. Durante esse processo,
Miller, pseudogenes poderiam ocasionalmente surgir e um órgão
tomar-se não-funcional. Esses fatos acidentais não significam
emas bioquímicos iniciais não foram planejados. As verrugas e
lares que Miller considera provas da evolução podem ser sim-
evidências de idade.
imples podem levar um tempo surpreendentemente longo para
)lverem. Uma das maneiras como uma ideia simples pode ser
230 A CAIXA PRETA DE DARWIN
desviada de sua rota é pela fusão com uma ideia estranha. Quando exami
nada em si mesma longe de ideias sem relação lógica , vê-se quei
ideia de planejamento inteligente é bem sólida, respondendo facilmente ai
argumento baseado na imperfeição.
A produção de alguns aperfeiçoamentos biológicos através de mutação
seleção natural de evolução é inteiramente compatível com a teo
do planejamento inteligente. Stephen Jay Gould, da Universidade Harva:
explorou muito a questão do "polegar" do panda.22 O panda gigante vi
com uma dieta de bambu. Afim de arrancar as folhas dos brotos de bamt
o panda agarra-os na pata com uma protuberância óssea que sai do puis
os cinco dedos normais também estão presentes. Gould argumenta que ï
planejador teria dado ao panda um verdadeiro polegar, que poderia movi
se para ficar opostw à palma da mão, e por isso conclui que o polegar i
animal em causa foi fruto de evolução. A conclusão de Gould, porém, sói
dos mesmos problemas que discutimos antes. Ele supõe que o planejad
agiria como ele o faria, que os polegares do panda "deveriam" ser dispost
de maneira diferente. Ele, em seguida, acha que essas asserções são prov
válidas de evolução. Gould nunca usou a ciência para dar base à sua ide
não demonstrou nem calculou que extensão mínima os ossos do cai]
deveriam ter para ajudar o panda; não justificou as mudanças compor!
mentais que seriam necessárias para tirar vantagem da mudança na estrutu
óssea; e não disse como os pandas comiam antes de adquirirem um poleg
Gould nada fez além de inventar uma história.
Mas, por ora, vamos ignorar essas questões e supor, em vez disso, qi
essa história realmente aconteceu. Mesmo neste caso, por que o cenário l
panda de Gould é incompatível com a teoria do planejamento inteligent
O polegar do panda constitui uma caixa preta. É inteiramente possível qc
no planejamento do polegar do panda, nenhum sistema de complexida
irredutível fosse necessário na célula. É possível que os sistemas jápresert
os sistemas que fabricam proteínas para os músculos e fibras nervos!
que constróem as proteínas e matriz dos ossos, que fazem com que célui
se dividam por algum tempo e, em seguida, suspendam a divisãofosse
suficientes. É possível que esses sistemas fossem inteiramente suficienf
para criar uma protuberância óssea, quando algum evento fortuito pertury
seu padrão normal de operação, e é possível também que a seleção natq
tenha posteriormente aceito essa mudança. A teoria do planejamento naj
tem a dizer a respeito de um sistema bioquímico ou biológico, a menos (|
; todos os componentes do sistema sejam conhecidos e seja demonstrado que
íle se compõe de várias partes interatuantes. A teoria pode coexistir de
riforma pacífica com o polegar do panda.
} Vivemos em um mundo complexo onde muitas coisas diferentes podem
, acontecer. Ao chegar a uma conclusão sobre como várias rochas vieram a
fíetvma dada forma, o geólogo pode considerar uma série inteira de fatores:
jadiuvas, ventos, movimento de geleiras, atividades de musgos e liquens,
l.ação vulcânica, explosões nucleares, impacto de asteróides ou a mão do
|,escultor. A forma de uma rocha pode ter sido determinada principalmente
ífoi um mecanismo e, a de outra, por um mecanismo diferente. A possibi-
lidade de um impacto de meteoro não significa que os vulcões devam ser
ignorados, e a existência de escultores tampouco quer dizer que muitas
itochas não sejam modeladas pelo intemperismo. Da mesma forma, biólo-
gos evolucionistas reconheceram que certo número de fatores pode ter
.flfetado o desenvolvimento da vida: ascendência comum, seleção natural,
migrações, tamanho de populações, efeitos de fundador (efeitos que talvez
Í m ao número limitado de organismos que iniciam uma nova
, deriva gênica (a disseminação de mutações "neutras", não-seleti-
1x0 gênico (a incorporação em uma população de genes de uma
ío separada), ligação (ocorrência de dois genes no mesmo cromosso-
pulso meiótico (seleção preferencial durante a produção de células
ie uma das duas cópias de um gene herdado de um organismo parental),
ição (transferência de um gene entre espécies separadas por meios
iais) e muito mais. O fato de que alguns sistemas bioquímicos possam
Manejados por um agente inteligente não implica que qualquer um dos
itores não seja atuante, comum ou importante.
l QUE FARÁ A CIÊNCIA?
'.descoberta de planejamento amplia o número de fatores que terão de ser
vados em conta pela ciência quando esta tentar explicar a vida. Qual será
efeito do reconhecimento do planejamento inteligente sobre os diferentes
anos da ciência? Biólogos que trabalham no nível celular ou acima podem
mtinuar suas pesquisas sem dar muita atenção ao planejamento, porque
ama do nível celular os organismos são caixas pretas e é difícil provar o
lanejamento. Dessa maneira, os que trabalham nos campos da paleonto-
igia, anatomiacomparativa, genética de população e biogeografía não deverão
tilizar o planejamento até que as ciências moleculares demonstrem que esse
COduz algum efeito sobre esses níveis mais altos. Claro, a possibilidade de
lanejamento deve levar os pesquisadores desses campos a hesitar antes de
232 A CAIXA PRETA DE DARWIN
alegar que um determinado aspecto biológico foi produzido em grandf
por outro mecanismo, como a seleção natural ou a transposição. B
disso, modelos detalhados devem ser elaborados para justificar a afil
de que um determinado mecanismo gerou um dado aspecto biológi
Ao contrário da evolução darwiniana, a teoria do planejamento i
gente é nova na ciência moderna, de modo que há uma série de perg
que precisam ser respondidas e ainda resta muito trabalho pela frenti
que interessa aos que trabalham no nível molecular, o desafio será det
nar rigorosamente que sistemas foram planejados e quais podem ter sul
por intervenção de outros mecanismos. Chegar a uma conclusão de
houve planejamento requererá a identificação dos componentes de
sistema molecular interatuante e dos papéis que desempenham, bem c
a verificação de que o sistema não é um composto de vários siste
separáveis. Chegar a um forte pressuposto de que não houve planejam!
por outro lado, exigirá a demonstração de que um sistema não
redutivelmente complexo, ou que não há muita especificidade entre
componentes. A fim de tirarmos conclusões sobre casos duvidosa
planejamento será necessário o exame experimental ou teórico de mod
através dos quais um sistema poderia ter se desenvolvido de man
contínua, ou uma demonstração de pontos em que o desenvolvimentc
sistema seria necessariamente descontínuo.
A pesquisa futura poderá tomar várias direções. Seria possível real
trabalhos para determinar se a informação necessária a sistemas planeja
poderia permanecer latente durante longos períodos de tempo, ou se
teria de ser acrescentada perto de quando o sistema se tomasse operacio
Uma vez que o cenário de planejamento mais simples presssupõe uma úe
célula formada há bilhões de anos que já continha todas as in
mações necessárias para produzir organismos descendentes, outros estu
poderiam submeter a teste esse cenário, tentando calcular quanto adn s
necessário para codificar as informações (levando-se em conta que grar
parte delas poderia ser implícita). Se o adn for insuficiente, seria adequa
iniciar estudos para descobrir se as informações poderiam ser armazenai
de outra maneira na célulapor exemplo, como informações posiciona
Outros trabalhos teriam como objetivo descobrir se sistemas compost
maiores (contendo dois ou mais sistemas complexos irredutíveis) poderií
ter se desenvolvido gradualmente ou se há irredutibilidades múltiplas.
As possibilidades precedentes são apenas perguntas óbvias que deriva
de uma teoria de planejamento. Sem dúvida, mais perguntas, e melh
formuladas, serão feitas à medida que mais e mais cientistas se tomare
curiosos sobre o planejamento. A teoria do planejamento inteligente pr
O QUE NOS diz A CAIXA? 233
revigorar um campo da ciência que se tomou desinteressante devido
a de soluções viáveis para problemas sem saída. A competição inte-
al criada pela descoberta do planejamento trará análises mais atentas
latura científica e exigirá que afirmações sejam fundamentadas em
s sólidos. A teoria deflagrará abordagens experimentais e novas hipó-
que, de outra maneira, não seriam tentadas. Uma teoria rigorosa de
sjamento inteligente será um instrumento útil para o progresso da
;ia em uma área que tem estado agonizante há décadas.
CIÊNCIA, FILOSOFIA E RELIGIÃO
O DILEMA
Nas últimas quatro décadas, a bioquímica moderna desvendou os se
da célula. Foi um progresso obtido a duras penas. Exigiu que dezer
milhares de pessoas dedicassem os melhores momentos de suas vk
trabalho maçante de laboratório. Estudantes de pós-gradução, com os
tos desamarrados, arrastando-se nos laboratórios até tarde da noite ir
nos sábados; colegas de doutorado trabalhando 14 horas por dia, set
por semana; professsores ignorando os filhos, enquanto dão os ret
finais a pedidos de doações de verbas, na esperança de arrancar um j
de dinheiro de políticos preocupados com maiores colégios eleito
atender são essas as pessoas que impulsionam a pesquisa científ
conhecimento que hoje temos da vida no nível molecular foi constn
partir de inumeráveis experimentos, nos quais proteínas eram purifíi
genes clonados, micrografías eletrônicas tiradas, células cultivada
truturas mapeadas, sequências comparadas, parâmetros variados e cor
instituídos. Trabalhos foram publicados, resultados passaram por
redigiram-se notas críticas, becos sem saída foram explorados e novas
surgiram.
O resultado desse esforço cumulativo para investigar a célula p
sar a vida no nível molecular é um alto, claro e agudo grito: "pli
mento!" Tão inequívoco e importante é o resultado que temos de co
rá-lo uma das grandes realizações da história da ciência. A descobf
compara às de Newton e Einstein, Lavoisier e Schrõdinger, Pás
Darwin. A observação de que houve planejamento inteligente da vid
importante quanto a observação de que a Terra gira em torno do Sol (
doenças são causadas por bactérias, ou ainda que a radiação é emiti

O QUE NOS DIZ A CAIXA? 235


quanta. Seria de se esperar que a magnitude da vitória, obtida a um custo
tão grande em esforço sustentado no curso de décadas, fizesse rolhas de
champanha espocar em laboratórios em todo o mundo. Esse triunfo da
ciência deveria ter arrancado gritos de "Eureka!" de dez mil gargantas,
conduzido a muitas palmadinhas nas costas e a outros gestos de congratu-
lações entre colegas e, talvez, justificado um dia de folga.
Mas nenhuma garrafa foi aberta, nem houve qualquer outro tipo de
comemoração. Em vez disso, um silêncio curioso, constrangido, envolve a
complexidade pura da célula. Quando o assunto aflora em público, os pés
se arrastam, a respiração toma-se um pouco mais difícil. Em particular, as
pessoas se mostram um pouco mais relaxadas, muitas admitem explicita-
mente o óbvio, mas, em seguida, olham de forma fixa para o chão, sacodem
a cabeça e deixam o assunto morrer.
Por que a comunidade científica não aceita entusiasticamente a notável
descoberta? Por que a observação de que houve planejamento só é tocada
com luvas de pelica intelectuais? O dilema é que, enquanto um lado do
elefante é etiquetado como planejamento inteligente, o outro poderia ser
rotulado como Deus.
Um leigo poderia fazer a pergunta óbvia: e daí? A ideia de que um ser
como Deus existe não é impopular longe disso. Pesquisas de opinião
demonstram que mais de 90% dos norte-americanos acreditam em Deus, e
que cerca da metade comparece regularmente a ofícios religiosos. Políticos
o invocam com grande regularidade (com maior frequência em época de
eleição). Muitos treinadores de futebol rezam com seus jogadores antes das
partidas, músicos compõem hinos, artistas pintam quadros de eventos
religiosos, organizações empresariais se reúnem para orar. Hospitais e ae-
roportos possuem capelas; o Exército e o Congresso norte-americanos têm
capelães. Homens como Martin Luther King são reverenciados nos Estados
Unidos porque se acredita que seus atos tiveram como inspiração a crença
em Deus. Com toda essa manifestação pública, por que a ciência deveria
achar difícil aceitar a teoria que dá respaldo àquilo em que, de qualquer
modo, a maioria do povo acredita? Há várias razões. A primeira é um pro-
blema que aflige a muitos de nós simples chauvinismo. A outra depende
de relações históricas e filosóficas peculiares à ciência. Todas essas várias
razões interagem de formas complexas, mas vamos tentar destrinchá-las.
lealdade
Pessoas que dedicam a vida a um trabalho nobre tornam-se, não raro,
ferozmente leais a ele. Um diretor de faculdade, por exemplo, talvez
dedique todos os seus esforços a fortalecer o estabelecimento, porque
educar é um serviço nobre. Um oficial de carreira do exército trabalhará
para melhorar sua arma, porque defender o país constitui um objetivo
louvável. As vezes, contudo, lealdade a uma determinada instituição oca-
siona conflito de interesses com a finalidade a que ela serve. O oficial pode
lançar suas tropas em combate, de modo que o exército seja creditado pelai
vitória, mesmo que fosse mais prudente deixar que a força aérea atacasse
primeiro o inimigo. O diretor da faculdade poderá, talvez, convencer os
deputados de seu estado no Congresso a obter verbas federais para um novo
prédio no campus, mesmo que o dinheiro possa prestar melhor serviço à;
educação em outros lugares.
A ciência é uma atividade nobre capaz de gerar uma feroz lealdade.»
Tem por finalidade explicar o mundo físico o que é um trabalho muito|
sério. Não obstante, outras disciplinas académicas (principalmente filosofia
e teologia) também estão no campo da explicação de aspectos do mundo.
Embora na maior parte do tempo essas disciplinas não se cruzem, às vezes,
elas entram em conflito. Quando isso acontece, alguns indivíduos dedicados
colocam sua disciplina à frente do objetivo a que ela deveria servir.
Um bom exemplo de chauvinismo disciplinar pode ser encontrado no
excelente livro de Robert Shapiro, Origins: A Skeptic's Guide to the
Creation of Life on Earth. Depois de fazer uma crítica muito clara e
profundamente devastadora dos estudos científicos sobre a origem da vida,
Shapiro proclama sua inabalável lealdade não ao objetivo de "explicar
o mundo físico", mas à ciência:
Talvez ainda chegue o dia em que todos os experimentos químicos razoáveis;
para descobrir a origem provável da vida tenham fracassado inequívoca-
mente. Além disso, novas evidências geológicas talvez indiquem o apareci-
mento súbito da vida na Terra. Por último, podemos ter explorado o universo '
e não encontrado em lugar nenhum sinal de vida, ou de um processo que a j
ela conduza. Nesse caso, alguns cientistas talvez resolvam, em busca de uma |
resposta, voltar-se para a religião. Outros, contudo, eu entre eles, tentariam :
esmiuçar as explicações científicas menos prováveis, na esperança de
escolher uma que fosse mais provável que o restante.' :
Shapiro prossegue corajosamente e diz que, neste exato momento, as coisas
não parecem assim tão desesperadoras, o que contradiz grande parte do que
afirmara até então. Ele pode se consolar com a certeza de que nunca haverá
uma ocasião em que todos os experimentos terão "fracassado inequivoca-
mente", da mesma forma como nunca haverá um tempo em que a existência
do monstro de Loch Ness será descartada por completo. E o tempo em que
O QUE NOS DIZ A CAIXA? 237
g o universo terá sido inteiramente explorado ainda está, felizmente, muito
| longe.
l Ora, um indivíduo imparcial poderia pensar que, se nenhuma das hipó-
| teses científicas mais prováveis se confirmou, então, quem sabe, uma
i explicação basicamente diferente é o que se deve procurar. Afinal de contas,
l a origem da vida foi um evento histórico nada igual, por exemplo, à
| busca da cura do câncer, campo este em que a ciência pode continuar
j tentando até obter sucesso. Talvez a origem da vida não tenha sido simples-
| mente o resultado de reações químicas espontâneas, como Shapiro tem
| esperança de que tenha acontecido. Para um participante da pesquisa,
| contudo, a conclusão de que houve planejamento pode ser muito inquie-
I tante. Pensar que o conhecimento dos mecanismos usados para produzir
| vida estará para sempre fora de seu alcance é reconhecidamente muito
frustrante para numerosos cientistas. Não obstante, temos que tomar cuida-
' do para não permitir que a antipatia por uma teoria nos predisponha contra
a interpretação imparcial dos dados.
Alealdade a uma instituição é louvável, mas a pura lealdade não constitui
um argumento. Em conjunto, o efeito do chauvinismo científico sobre
teorias do desenvolvimento da vida é um importante dado sociológico a
' levar em contra, embora, em última análise, sua importância intelectual seja
nula para a questão do planejamento inteligente.
lição DA HISTÓRIA
Encontramos na história a segunda razão da relutância da ciência em lidar
com o elefante. Desde o dia em que a teoria da evolução foi proposta, alguns
cientistas entraram em choque com teólogos sobre ela. Embora muitos
desses teólogos e cientistas pensassem que a evolução darwiniana poderia
ser conciliada sem grandes dificuldades com as crenças básicas da maioria
das religiões, a publicidade sempre focaliza o conflito. O tom da discussão
provavelmente foi estabelecido de forma definitiva quando o bispo angli-
cano Samuel Wilberforce debateu com Thomas Henry Huxiey, cientista e
ardoroso defensor do evolucionismo, cerca de um ano após o lançamento
do fecundo livro de Darwin. Está documentado que o bispo bom teólogo,
mas biólogo medíocre encerrou seu discurso dizendo: "Eu gostaria de
saber: É por parte do avô ou da avó que Huxiey afirma ser descendente de
um macaco?" Huxiey murmurou alguma coisa como "O Senhor entregou-o
em minhas mãos", e prosseguiu dando à plateia e ao público uma erudita
lição de biologia. Ao fim da exposição, declarou que não sabia se era através
do avô ou da avó que tinha parentesco com um símio, mas preferia descen-
der de símios do que ser um homem dotado do dom da razão e vê-la usad"
como o bispo a usara naquele dia. Mulheres desmaiaram, cientistas aplau
diram e repórteres saíram correndo para redigir a manchete: "Guerra entr
a ciência e a teologia". ,
O acontecimento que definiu a maneira como o público via a relaç»
entre ciência e teologia nos Estados Unidos foi o processo Scopes. Em 1925
John Scopes, professor de biologia de escola secundária na minúscui
cidade de Dayton, Tennessee, apresentou-se voluntariamente para ser prestí|
por violar uma lei estadual, até então ignorada, que proibia o ensino da
evolução. A participação do renomado advogado Clarence Darrow na
defesa, e do três vezes derrotado candidato presidencial, William JenningS!
Bryan, como promotor, garantiu o verdadeiro circo montado pela mídia.
Embora a equipe de advogados de Scopes tenha perdido a causa, sua;
condenação foi tomada sem efeito devido a um pormenor técnico. Mato
importante, porém, foi o fato de que a publicidade criou um clima de
antagonismo entre religião e ciência.
O processo Scopes e o debate HuxIey-Wilberforce aconteceram há muito
tempo. Fatos mais recentes, no entanto, têm mantido o conflito em fogo
brando. Nas últimas décadas, grupos que, por razões religiosas, acreditam
que a Terra é relativamente jovem (da ordem de cerca de dez mil anos)
tentaram conseguir que esse ponto de vista fosse ensinado nas escolas
públicas. Os fatores sociológicos e políticos envolvidos na situação são
muito complexos uma mistura poderosa de tópicos potencialmente
polémicos, como liberdade religiosa, direitos dos pais, controle da educação
pelo governo e direitos estaduais versus direitos federais e tornados ainda
mais emocionais porque a briga envolve crianças.
Uma vez que a idade da Terra pode ser inferida por medições físicas,
numerosos cientistas, muito naturalmente, acharam que os grupos religio-
sos haviam invadido sua área de especialização e pediram-lhes evidências.
Quando esses grupos apresentaram provas físicas que, diziam, justificavam
sua tese de uma Terra jovem, os cientistas as desprezaram como incompe-
tentes e tendenciosas. Os ânimos se acirraram em ambos os lados e surgiu
uma grande má vontade recíproca. Parte dessa má vontade foi ins-
titucionalizada. Uma instituição denominada Centro Nacional de Educação
em Ciência, por exemplo, foi criada há doze anos ocasião em que vários
estados dos eua estavam promulgando leis favoráveis ao criacionismo
para combater os criacionistas sempre que eles tentassem influenciar a
política que regia as escolas públicas.
Esses conflitos repercutem até hoje. Em 1990, a Scientific American
pediu a um divulgador científico, Forrest Mims, que escrevesse vários
artigos para a coluna "Cientista Amador", da revista. A"Cientista Amador"
trata de tópicos tais como medição do comprimento de raios de tempestade,
construção de observatórios solares portáteis e fabricação de sismômetros
caseiros para registrar movimentos telúricos projetos divertidos para
pessoas que têm a ciência como hobby. O acordo foi que, se editores e
leitores gostassem dos artigos, Mims seria contratado como colaborador
permanente. Os artigos experimentais tiveram excelente repercussão, mas,
quando veio a Nova York para a entrevista final, Mims foi perguntado se
acreditava na evolução. Ele respondeu que, bem..., não; acreditava mesmo
era na explicação bíblica da criação.
A revista desistiu de contratá-lo. AScientificAmerican tinha receio de
que o simples fato de contar com um criacionista entre seus redatores
pudesse prejudicar sua reputação entre os cientistas, embora Mims fosse
bem qualificado e não tivesse plano algum de escrever sobre evolução. Sem
dúvida, cenas deinherit the Wind (o filme vagamente baseado no processo
Scopes) e notícias de jornal sobre batalhas entre criacionistas e seus
inimigos políticos passaram pela mente dos editores da revista. Pequenos
conflitos tão comentados como o caso Mims embora nada tivessem
diretamente a ver com as questões intelectuais autênticas de como veio a
surgir a vida na Terra jogam lenha nas fogueiras da história do conflito
entre ciência e religião, e convencem muitas pessoas que temos de pertencer
a uma facção ou à outra.
Os fatos históricos em tomo dos quais cientistas se chocaram com grupos
religiosos são autênticos e provocam verdadeiras reaçôes emocionais.
Levam algumas pessoas bem intencionadas a pensar que uma zona desmi-
litarizada deve ser estabelecida entre os dois campos, sem que se permita
qualquer confraternização. Tal como o chauvinismo científico, porém, a
importância de choques históricos para a compreensão científica profunda
do desenvolvimento da vida é quase nula. Não estou alimentando ingenua-
mente a esperança de que as descobertas da bioquímica possam estar livres
das sombras da história, mas, na maior extensão possível, deveriam estar.
Ao contrário de argumentos históricos e chauvinistas, os argumentos
filosóficos que procuram evitar a conclusão de planejamento inteligente são
substanciais; eles afetam as questões no nível intelectual, e não apenas
emocional. São várias as questões filosóficas. Vejamos algumas delas.
A regra
Richard Dickerson é um bioquímico ilustre, membro eleito de uma ins-
tituição de elite, a Academia Nacional de Ciências, especializado em
estudos de cristalografia de raio x de proteínas e do adn. Ele e seus
auxiliares de laboratório deram valiosas contribuições à nossa compreensão
da estrutura das moléculas da vida. Ele não é o cientista mais notável dos
Estados Unidos, e suas contribuições não foram as mais famosas, mas ele
é, de muitas maneiras, o paradigma do cientista dedicado. Ele e sua situação
profissional são tipos humano e profissional que milhares de es-
tudantes de graduação têm em mente enquanto trabalham dia e noite em
laboratórios, sonhando com o dia em que também serão membros res-
peitados da comunidade científica.
As opiniões publicadas de Dickerson captam muito bem a maneira
como numerosos cientistas encaram o mundo da religião. Há alguns anos,
Dickerson escreveu um curto ensaio resumindo suas opiniões sobre ciência
em comparação com religião, trabalho este publicado naJournal of Mole-
cular Evolution (revista científica secular) e na Perspectives on Science
and Christian Faith (revista publicada pela American Scientifíc Affilia-
tion, uma instituição de cientistas que são, também, cristãos evangélicos).
Desse modo, é seguro concluir que Dickerson não dirigia suas observações.
apenas a indivíduos que já aceitavam suas ideias estava, na verdade,
fazendo um esforço honesto para apresentar o que considerava opiniões
razoáveis e convincentes a indivíduos que tinham ideias divergentes. De-?
vido à sua consonância com o que a maioria dos cientistas pensa da ciência,
o ensaio de Dickerson constitui um ponto de partida útil para analisar a
maneira como a teoria do planejamento inteligente se ajusta à ciência:
A ciência, fundamentalmente, é um jogo. E é um jogo com uma regra
definitiva e definidora:
Regra n31: vejamos até que ponto e em que medida podemos explicar-
o comportamento do universo físico e material em termos de causas pura-
mente físicas e materiais, sem invocar o sobrenatural. ':
Aciência operacional não toma posição sobre a existência ou inexistência
do sobrenatural; requer apenas que esse fato não seja utilizado em expli-;!
cações científicas. Invocar milagres com uma finalidade especial, como,:
explicação, constitui uma forma de "cola" intelectual. Um jogador de xadrezj
pode, sem nenhuma dificuldade, remover fisicamente do tabuleiro o rei de
adversário e quebrá-lo no meio de um torneio. Esse fato, porém, não o
tornaria campeão de xadrez, porque as regras do jogo não foram seguidas.
Um corredor pode sentir a tentação de tomar um atalho em diagonal em um»
pista oval, a fim de cruzar a linha de chegada à frente de um colega mais
veloz. Mas evita fazer isso, porque essa ação não constituiria uma "vitória*
de acordo com as regras do esporte.2 ?
Vamos reformular a regra de Dickerson da seguinte maneira: a ciência deve
utilizar apenas causas naturais e explicar alguma coisa referindo-se apenas
à lei natural.3 A reformulação toma explícito o que é fortemente sugerido
pela expressão "vejamos até que ponto".
Em seu ensaio, portanto, Dickerson não diz que a prova científica
demonstra que o sobrenatural nunca afetou a natureza (aos preocupados
com a definição de sobrenatural, aconselhamos que a substituam por "uma
inteligência superior"). Em vez disso, ele argumenta que, em princípio, a
ciência não deve utilizá-lo. Aimplicação clara é que não deve ser invocado,
seja verdadeiro ou não. É relevante para nossa análise desse argumento
dizer que Dickerson é membro da American Scientific Affiliation, de modo
que ele acredita em Deus. Ele não tem razão apriori para pensar que nada
existe além da natureza, mas acha que não constitui boa ciência oferecer o
sobrenatural como explicação de um evento natural.
(Aliás, cientistas que acreditam em Deus ou numa realidade além da
natureza são muito mais comuns do que a mídia nos leva a crer e,
portanto, não há razão para pensar que os 90% da população em geral que
nele acreditam sejam muito diferentes no caso de cientistas. Ken Miller,
cujo argumento baseado na imperfeição analisamos no último capítulo, é,
como eu, católico romano, e faz questão de deixar claro em palestras que a
crença na evolução é inteiramente compatível com suas opiniões religiosas.
Concordo com ele nesse ponto.4 A compatibilidade ou a falta dela é,
contudo, irrelevante para a questão científica de se verificar a autenticidade
da evolução darwiniana de sistemas bioquímicos.)
E importante notar que o argumento de Dickerson não é em si científico
não foi descoberto por experimento de laboratório, não resulta da mistura
de elementos químicos em um tubo de ensaio e não constitui uma hipótese
acessível a teste. Ao contrário, é filosofia. Pode ser uma boa filosofia, ou
talvez não. Vamos examiná-la mais atentamente.
A maioria das pessoas ficaria surpresa em saber que "ciência, fun-
damentalmente, é um jogo". Por certo os contribuintes, que a financiam
com várias dezenas de bilhões de dólares todos os anos, ficariam surpresos.
Eles, com toda probabilidade, pensam que estão gastando seu dinheiro para
descobrir curas e tratamentos para o câncer, a aids e doenças cardíacas.
Cidadãos preocupados com doenças que têm, ou que talvez venham a afe-
tá-los na velhice, querem que a ciência seja capaz de curá-los, e não parti-
cipar de um jogo sem interesse para a vida real. Duvido que Darwin, Newton
ou Einstein tenham pensado em ciência nesses termos. Os gigantes da ciên-
cia foram motivados pela ânsia de conhecer o mundo real, e alguns deles
(como Galileu) pagaram um preço pelo que descobriram. No caso de es-
242 A CAIXA PRETA DE DARWIN
tudantes, os livros didáticos não a apresentam como um jogo, mas com
uma nobre busca da verdade. Amaioria, de contribuintes comuns a cientist
eminentes, provavelmente a consideraria não como um jogo, mas como u
esforço vigoroso para fazer afirmações verdadeiras sobre o mundo físico.
A afirmação de que a ciência é um jogo não resiste até mesmo a um'
análise superficial. Ninguém sustentaria por muito tempo essa posição s
questionado sobre ela. O próprio Richard Dickerson provavelmente logi
retiraria a afirmação se tivesse que defendê-la diante de uma platéi
descrente. É claro que Dickerson tem outra coisa em mente. Talvez queir
dizer que a ciência, como os jogos, é uma atividade pautada por regras
Outras atividades sérias, como processos criminais e campanhas políticas:
são assim pautadas. E a ciência, também? Se assim for, quais são as regras
Focalizemos a segunda pergunta. Dickerson menciona apenas ums
regra, a que exclui o sobrenatural. Onde foi que ele a descobriu? Consta de
algum livro? E encontrada nos estatutos de sociedades científicas? Não,
claro que não. Podemos examinar todos os livros usados para ensino de
ciências em todas as principais universidades dos Estados Unidos e não
encontraremos a "regra definitiva e definidora". Nem acharemos quaisque
outras regras gerais prescrevendo como a ciência deve ser praticada (com
exceção de regras de segurança, exortações à honestidade, e coisas seme
lhantes).
Não obstante, vamos perguntar: De que maneira a regra de Dickersoï
ajuda em alguma coisa? Por acaso ela diz quais questões estão além dl
competência da ciência? Fornece-nos diretrizes para separar a ciência ai
pseudociência? Oferece uma definição do que é ciência? A resposta a toda
essas perguntas é não. Há alguns anos, um laureado Nobel publicou ua
artigo em uma prestigiosa revista científica. O artigo analisava a racional!
dade de pessoas que renunciam a ter filhos a fim de ajudar ao próximj
(como, digamos, Madre Teresa) em termos de estratégias reprodutivij
evolucionistas.5 Essa "ciência" não viola a regra de Dickerson. A reg(|
"definitiva e definidora" de Dickerson toleraria, sem problemas, a frenoM
gia, uma desacreditada ciência do século xix (a pretensão de identifíclJ
inteligência e caráter de pessoas pela forma de seu crânio). Aregraem cauiJ
não nos fornece orientação sobre a legitimidade do marxismo e do freudi)
mo, as "ciências" da história e da mente, respectivamente. A regra nãonJ
permite concluir de antemão se aplicar ventosas a doentes ou sangrá-tg
para abaixar a febre são métodos que funcionarão. Assim, parece que muit)|
coisas poderiam reivindicar o título de "ciência" nos termos da regra |B
Dickerson, enquanto invocarem apenas forças materiais, por mais vagaq
esquivas que estas sejam. H
O QUE NOS DIZ A CAIXA? 243
Na verdade, a regra de Dickerson parece mais um aforismo profissional
tal como "o freguês sempre tem razão", "luz, câmera, ação". São as
regras pelas quais os antigos profissionais viveram, aquilo que pensam que
funciona e que resume, em curtas palavras, parte da sabedoria que desejam
passar à geração profissional mais jovem. Por trás da regra de Dickerson,
vemos vagas imagens de vikings atribuindo o trovão e o raio à obra dos
deuses, e feiticeiros tentando expulsar espíritos demoníacos de doentes.
Mais perto da ciência moderna, lembramo-nos do próprio Isaac Newton,
sugerindo que Deus intervinha ocasionalmente para estabilizar o sistema
solar. A preocupação é que se o sobrenatural fosse admitido como explica-
ção, não haveria maneira de deter a tendência seria invocado com
frequência para explicar numerosas coisas que, na realidade, têm explicação
natural. Trata-se de um medo razoável?
Ninguém pode prever o comportamento de seres humanos. Parece-me,
porém, que o medo de que o sobrenatural apareça de repente em todos os
lugares na ciência é muito exagerado. Se minha aluna de pós-graduação en-
trasse em meu gabinete e disesse que o anjo da morte acabou com sua
cultura bacteriana, eu não teria nenhuma inclinação a acreditar nela. E im-
provável que oJournal ofBiological Chemistry inicie uma nova seção sobre
o controle espiritual da atividade enzimática. A ciência aprendeu no último
meio século que o universo funciona com grande regularidade na maioria
das vezes, e que leis simples e comportamento previsível explicam a
maioria dos fenómenos naturais. Historiadores da ciência enfatizariam que
ela nasceu em uma cultura religiosa a Europa na Idade Média , cujas
tradições religiosas incluíam um Deus racional, que construiu um universo
racional, compreensível e regido por leis.6 Ciência e religião esperam que
o mundo quase sempre gire de acordo com a lei imutável da gravidade.
Há, é claro, exceções. Às vezes, fatos históricos excepcionais têm de ser
utilizados para explicar um efeito. Registros fósseis mostram que, há cerca
de sessenta milhões de anos, todos os dinossauros se extinguiram dentro de
um período geologicamente curto. Uma das teorias formuladas para expli-
car esse fato é que um grande meteoro se chocou com a Terra, levantando
nuvens de poeira na atmosfera e, talvez, fazendo com que muitas plantas
morressem, interrompendo assim a cadeia alimentar. Alguma prova indireta
apoia essa hipótese níveis do elemento irídio, raramente encontrado na
Terra, mas abundante em meteoros, são elevados em rochas daquele
período. A hipótese foi aceita por muitos cientistas. Contudo, não houve
uma corrida para apontar os meteoros como causa de todos os tipos de
eventos. Ninguém disse que meteoros abriram o Grand Canyon ou foram
responsáveis pela extinção dos cavalos na América do Norte. Tampouco
244 A CAIXA PRETA DE DARWIN
alguém disse que a poeira de meteoritos minúsculos, invisíveis, caus
asma ou que dão origem a tornados. A hipótese da participação de meteo
na extinção dos dinossauros foi avaliada na base de prova física relativ;
um dado evento histórico. Há todas as razões para se esperar que a pró
seja avaliada na base do caso a caso, se meteoros forem utilizados pi
explicar outros eventos históricos.
Analogamente, hipóteses de envolvimento de um agente inteligente
aparecimento da vida ou em outros eventos históricos têm de ser avaliac
na base caso a caso. Conforme notado no Capítulo 9, a prova é esmagado
no caso de alguns sistemas bioquímicos, e indetectável em outros. Se v
cientista postula a participação de inteligência em algum outro evei
histórico, caberá a ele o ónus de coonestar sua afirmação em prova obs
vável. A comunidade científica não é tão frágil que seu sadio ceticismo!
transforme em ingenuidade.
Outra preocupação que talvez esteja por trás do ensaio de Dickersc
diz respeito ao "método científico". Aformulação de hipóteses, a realiz
cão de testes cuidadosos, a replicabilidade todas essas condições se
viram bem à ciência. Mas de que modo um planejador inteligente põe
ser submetido a teste? Poderá ele ser posto em um tubo de ensaio? Na
claro que não. E tampouco isso pode ser feito com ancestrais comuns e
tintos. O problema é que, em todos os casos em que a ciência tenta e
plicar um evento histórico excepcional, testes cuidadosos e replicabi
dade são, por definição, impossíveis. A ciência pode ser capaz de estud
o movimento de cometas que atualmente aparecem nos céus e submet
a teste as leis da mecânica newtoniana que descrevem o movimento do
cometas. Ela, porém, jamais poderá estudar o cometa que supostamen
chocou-se com a terra há milhões de anos. Pode, no entanto, observ
os efeitos duradouros dele na Terra moderna. De forma análoga, pot
observar os efeitos que um planejador produziu sobre a vida.
A observação final que desejo fazer sobre o argumento de Dickerson
que, embora por certo não fosse essa a sua intenção, ele deu uma recei
para a timidez. Tenta restringir a ciência ao máximo da mesma cois
recusando-se a considerar uma explicação basicamente diferente. Ten
colocar a realidade em uma caixa elegante, mas o universo se recusa
receber esse tratamento. A origem do universo e o aparecimento da vida s
os alicerces físicos que resultaram em um mundo cheio de ageni
conscientes. Não há razão a priori para pensar que esses eventos básic
devam ser explicados da mesma maneira que outros eventos físicos.
ciência não é um jogo e cientistas devem seguir a prova física, aonde qu
que ela leve, sem restrições artificiais.
O QUE NOS DIZ A CAIXA? 245
CAÇA-FANTASMAS
A quarta e mais poderosa razão da relutância da ciência em aceitar uma
teoria de planejamento inteligente baseia-se também em considerações
filosóficas. Muitas pessoas, inclusive importantes e renomados cientistas,
simplesmente não querem que exista qualquer outra coisa além da natureza.
Não querem que um ser sobrenatural afeie a natureza, por mais curta ou
construtiva que essa intervenção tenha sido. Em outras palavras, tal como
os criacionistas da vertente da Terra jovem, eles assumiram um compromis-
so filosófico a priori com a ciência, que restringe os tipos de explicações
que aceitariam sobre o mundo físico. As vezes, essa disposição dá origem
a um comportamento muito estranho.
Há apenas setenta anos, a maioria dos cientistas acreditava que o
universo era infinito em idade e tamanho. Essa opinião foi sustentada por
alguns filósofos gregos na Antiguidade, e também por variados grupos
religiosos, sem falar naqueles que pensavam que nada havia além da
natureza. Em contraste, judaísmo e cristianismo acreditavam que o universo
.fora criado no tempo e que não era eterno. Sendo poucos os cientistas em
)?eu meio, os antigos judeus sequer tentaram aduzir provas do caráter finito
: do universo. Na Idade Média, são Tomás de Aquino, o famoso teólogo,
adisse que só através da fé se poderia saber que o universo tivera um começo.
L? tempo, porém, continua sua marcha. Em princípios deste século, Einstein
Descobriu que sua teoria geral da relatividade previa um universo instável
t que se expandiria e se contrairia, mas que nunca permaneceria es-
Itacionário. Einstein sentiu repulsa por tal universo e, no que mais tarde
|reconheceu ter sido o maior erro de sua carreira, inseriu um "fator de
I" nas equações, apenas para fazer com que elas previsssem um
estacionário, eterno.
) pais e professores sempre dizem, alunos que "colam" nunca saem
ï. Pouco tempo depois, o astrónomo Edwin Hubble observou que
s os quadrantes para onde apontava seu telescópio, as estrelas
l afastar-se da Terra. (Ele não pôde ver concretamente as estrelas se
n. Em vez disso, inferiu seu movimento de um fenómeno chamado
)oppler", de acordo com o qual estrelas que se afastam do obser-
litem luz de um comprimento de onda ligeiramente mais longo
iais rápidas se movem, maior a mudança no comprimento de onda.)
»mais, a velocidade com que elas se afastavam era proporcional à
i delas da Terra. Essa era a primeira prova baseada em observação
is equações não-manipuladas de Einstein eram correias em sua
relativa à expansão do universo. E não foi preciso um cientista
especializado em foguetes (embora houvesse muitos à disposição) para
inverter mentalmente o universo em expansão e concluir que, em algum
tempo no passado, toda a matéria do universo seria concentrada em um
espaço muito reduzido. Este foi o início da hipótese do Big Bang.
Para muitos, a ideia do Big Bang estava carregada de conotações de
evento sobrenatural a criação, os primórdios do universo. O ilustre físico
A.S. Eddington falou provavelmente por muitos ao manifestar profünd
repugnância por tal ideia:
Filosoficamente, acho repugnante a ideia de um começo brusco para a atua
ordem da Natureza, como acho que deve ser para a maioria; e mesmo os qu
receberiam bem a prova da intervenção de um Criador pensarão que um
único evento deflagrador, em alguma época remota, não é realmente o tipo
de relação entre Deus e seu mundo que traz satisfação à mente.7
Não obstante, a despeito de suas implicações religiosas, o Big Bang era uma
teoria científica que derivava naturalmente de dados de observação, e não
de escrituras sagradas ou visões transcendentais. A maioria dos físicos
adotou a teoria do Big Bang e organizou seus programas de pesquisa de
acordo com ela. Alguns, como Einstein antes deles, não gostaram das
implicações extracientíficas da teoria e esforçaram-se para elaborar alter
nativas.
Em meados deste século, o astrónomo Fred Hoyle defendeu outra teorii
do universo, denominada teoria do universo estável. Hoyle sugeriu que
universo era infinito e eterno, mas admitiu também que estava em expansão
Sabendo que um universo que viesse se expandindo durante um períocS|
infinito de tempo se tornaria infinitamente disperso, mesmo que começas
com um volume infinito de matéria, Hoyle tinha que explicar por que nossIJ
universo é relativamente denso. O eminente cientista sugeriu que matéri]
era criada de forma incessante no espaço exterior, a uma taxa de cerca d|
um átomo de hidrogénio por milha quadrada de espaço por ano. Bem,||
preciso enfatizar que Hoyle estava propondo a criação de hidrogénio
partir de nada e sem causa. A matéria simplesmente surgia à taxa nectí|
sária. Uma vez que não dispunha de dados de observação em que base(|
essa ideia, por que ele a teria proposto? Acontece que Hoyle, tal coia|
Eddington, pensava que o Big Bang tinha uma forte implicação sobrenatulli
e achava extremamente repugnante essa perspectiva, m
A teoria do universo estável de Hoyle enfrentou tempos difíceis ftf
explicar grande parte da prova observacional descoberta pela astronomia
Na década de 1960, os astrónomos Penzias e Wilson finalmente deram
tiro de misericórdia na teoria com sua observação da radiação de fumj
O QUE NOS DIZ A CAIXA? 247
Eles observaram que microondas bombardeiam a Terra, vindas de todas as
direções, com uma espantosa uniformidade de intensidade. Afirmaram que
essa radiação de fundo era um resultado indireto do Big Bang. A observa-
ção de sua existência foi, e ainda é, considerada a glória máxima da teoria
do Big Bang.
É impossível negar que o Big Bang constituiu um modelo físico imen-
samente fértil do universo e, embora muitas perguntas importantes perma-
neçam sem resposta (como sempre acontece na ciência básica), ele foi
confirmado por dados de observação. Cientistas como Einstein, Eddington
e Hoyle manipularam suas conclusões para resistir a uma teoria científica
que derivava naturalmente dos dados, porque pensavam que seriam obri-
gados a aceitar desagradáveis conclusões filosóficas ou teológicas. Não
foram. Eles tinham outras opiniões.
NÃO ME RESTRINJA
O sucesso do modelo do Big Bang nada teve a ver com suas implicações
religiosas. Parecia estar de acordo com o dogma judaico-cristão de um
começo do universo, mas ia contra outras religiões que acreditavam que o
universo era eterno. A teoria, no entanto, justificava-se com dados baseados
em observação a expansão do universo e não pela invocação de textos
sagrados ou experiências místicas de santos. O modelo procedia direta-
mente de dados de observação; não se prestava a um leito de Procusto de
dogma religioso.
Cabe notar, no entanto, que o Big Bang, embora se harmonize com um
ponto de vista religioso, não impõe essa crença. Ninguém precisa, por uma
questão de lógica, chegar a qualquer dada conclusão sobrenatural baseado
apenas em observações e teorias cientificas. Esse fato é visto inicialmente
nas tentativas de Einstein e Hoyle de construir modelos alternativos que se
ajustariam aos dados de observação e evitariam o pensamento desagradável
de que o universo teve um começo. Quando a teoria do estado estável foi
por fim desmoralizada, surgiram outras que supostamente aliviariam a
limitação filosófica de um começo absoluto. A opção mais popular foi a de
um universo cíclico, no qual a expansão que se iniciara com o Big Bang
acabaria por diminuir e, sob efeito da força de gravidade, toda a matéria
desmoronaria sobre si mesma em um "Big Crunch". A partir desse ponto,
.prossegue a história, talvez ocorresse outro Big Bang e repetições infin-
dáveis desse ciclo recapturariam uma natureza que era infinita no tempo. É
Hiteressante (embora cientificamente irrelevante) notar que a ideia de um
248 A CAIXA PRETA DE DARWIN
universo cíclico seria compatível com numerosas religiões, incluindo as c
antigos egípcios, astecas e hindus.8
A ideia de um universo cíclico parece atualmente ter pouca credibilid;
na física. Observou-se que não há matéria suficiente para provocar
futuro colapso gravitacional e mesmo que ela existisse, cálculos mosin
que ciclos sucessivos se tomariam cada vez mais longos, acabando fin
mente em um universo que não se contrairia. Uma teoria mais recei
sustenta que o universo real é imensamente maior do que aquele c
observamos, e que a parte dele que vemos é tão-somente uma "bolha" e
um universo infinito. O físico Stephen Hawking sugeriu que, embora
universo seja finito, não teria havido um começo se algo em suas equaçõ»
que ele denomina "tempo imaginário", de fato existir. Outra ideia é c
muitos universos existem infinitamente, e que este em que nos encontram
apenas possui as limitadas condições requeridas pela vida. Essa ideia
popularizada sob o nome de "princípio antrópico". Em essência, es
princípio diz que muitíssimos (ou um número infinito de outros) univers
existem, sujeitos a leis físicas variáveis e que apenas os que têm condiçõ
favoráveis à vida produzirão vida, talvez incluindo observadores conscie
tes. Dessa maneira, quem sabe, existe em algum lugar um enilhão
universos estéreis. Vivemos no enilhão e no primeiro universo porque
tem propriedades físicas compatíveis com a vida.
O princípio antrópico parece bastante tolo para a maioria das pesso
provavelmente porque elas não sabem muito bem onde colocariam to(
esses outros universos. Há, no entanto, outras ideias à disposição
indivíduos que ainda se recusam a invocar o sobrenatural. Na física quâ
tica, acredita-se que entidades microscópicas, denominadas "partícu
virtuais", podem aparecer de súbito, tomando emprestada energia do m
circundante (confúsamente denominado de "vácuo", mesmo que a palav
não seja usada pêlos físicos com o significado de "nada"). Alguns físic
levaram essa ideia um pouco mais longe e sugeriram que todo o unive
apenas surgiu, não de algum ambiente circundante, mas de absolutame
nada "uma flutuação de quantum, do não-ser para o ser" e sem un
causa. Essa tese mostra como os cientistas aprenderam a ser ambicios
em comparação com os dias em que Fred Hoyle, modestamente, propun
a criação ocasional, sem uma causa, de átomos de hidrogénio.
Nenhum experimento foi feito para dar respaldo à ideia de univers
bolhas, tempo imaginário, ou enilhôes de universos antrópicos. Naverda
parece que, em princípio, nenhum experimento poderia detectá-los. U
vez que nem eles nem seus efeitos podem ser observados, eles são p
miados metafísicos, não mais acessíveis à investigação experimental do (
O QUE NOS DIZ A CAIXA? 249
um ser reconhecidamente sobrenatural. Eles não trazem nenhum bem à
ciência. Seu único uso é o de servir como uma escotilha para escapar do
sobrenatural.
O objetivo da discussão acima é que, mesmo que a hipótese do Big Bang
possa parecer, à primeira vista, dar apoio a uma dada ideia religiosa,
nenhuma teoria científica, pela pura força da lógica, pode impor a crença
em um dogma religioso positivo. Dessa maneira, a fim de explicar o
universo, um indivíduo pode postular inobserváveis, como a teoria de que
há infinitamente mais universos, e a que diz que o nosso é apenas uma bolha
de um universo mais amplo. Ou podemos nos apegar à esperança de que
teorias que hoje parecem implausíveis, como a do estado estável ou a do
universo oscilante, possam parecer mais aceitáveis amanhã, quando cálcu-
los forem refeitos e novas medições efetuadas. Ou podemos simplesmente
abandonar o princípio da causação, como acontece nas teorias que dizem
que o universo surgiu sem uma causa. A maioria dessas pessoas pode
considerar as ideias muito fantasiosas, mas, apesar disso, elas não violam
a prova da observação.
Dizer que o universo começou com um Big Bang é uma coisa, mas dizer
que a vida foi planejada por uma inteligência é outra bem diferente. As
palavras Big Bang em si lembram apenas imagens de uma explosão, e não
necessariamente de uma pessoa. A expressão planejamento inteligente
parece despertar mais atenção e logo provoca perguntas sobre quem poderia
ter sido o planejador. Indivíduos com posições filosóficas firmes contra o
sobrenatural serão colocados contra a parede por uma teoria? Não. A
imaginação humana é poderosa demais.
Por qualquer que seja o critério, sir Francis H.C. Crick é um homem
inteligente. Há mais de quarenta anos, quando ainda era estudante de
pós-gradução em Cambridge, Crick e James Watson utilizaram dados
cristalográficos de raio x para deduzir a estrutura de hélice dupla do adn,
realização pela qual os dois mais tarde receberam o prémio Nobel. Crick
prosseguiu nos estudos e contribuiu para a elucidação do código genético
e para formular inspiradoras perguntas conceituais sobre a função do
cérebro. Já com mais de setenta anos, ele continua a levar a ciência cada
vez mais longe e mais rápido do que a maioria de nós jamais conseguirá.
Francis Crick também pensa que a vida pode ter começado entre nós
quando alienígenas de outro planeta enviaram uma nave-foguete contendo
esporos para semear a Terra. Não se trata de uma ideia tola. Ele a divulgou
pela primeira vez em 1973, com o químico Leslie Orgel, em um ar)
intitulado "Panspermia dirigida", publicado numa revista científica
pecializada, a ícarus. Uma década mais tarde, Crick escreveu um livro,J
Itself, reiterando a teoria; em 1992, entrevistado pela Scientific Ameri
na véspera da publicação de seu último livro, reafirmou que conside.
teoria razoável.
Aprincipal razão porque ele aceita essa ideia nada ortodoxa é que Cr
julga a origem espontânea da vida como um obstáculo virtualmente intra
ponível, mas deseja uma explicação naturalista. No que nos interessa
momento, a parte interessante da ideia de Crick é o papel de alieníga
que, especulou, enviaram para a Terra bactérias do espaço. Mas ele pode
com igual número de evidências, dizer que os alienígenas, na verda
planejaram os sistemas bioquímicos irredutivelmente complexos da vi
que enviaram para este planeta, e que projetaram também os sistemas
complexidade irredutível que surgiram depois. A única diferença é ur
mudança para o postulado de que alienígenas geraram vida, ao passo qi
originalmente, ele especulou apenas que a enviaram para a Terra. Não é l
salto muito grande, porém, dizer que uma civilização capaz de envi
naves-foguetes a outros planetas é também, provavelmente, capaz (
planejar vida sobretudo se tal civilização nunca foi observada. Projet,
vida, caberia observar, não requer necessariamente poderes sobrenaturai
na verdade, exige um bocado de inteligência. Se um estudante de pós-gn
dução pode hoje em um laboratório aqui na Terra fabricar uma proteí
artificial capaz de fixar oxigénio, então nenhuma barreira lógica impe
que se pense que uma civilização adiantada de outro mundo possa planej:
a partir do nada uma célula artificial.
Esse cenário deixa ainda sem resposta a pergunta sobre quem planeje
o planejador como a vida originalmente se originou? Um naturalis
filosófico estará neste momento numa armadilha? Mais uma vez, não..
questão do planejamento do planejador pode ser adiada de várias maneiri
Poderia ser desviada invocando-se entidades não observadas; talvez a vi
original seja inteiramente diferente de nós, consistindo de campos elétricí
ou gases flutuantes; talvez não exija estruturas irredutivelmente complex
para sustentá-la. Outra possibilidade é a viagem no tempo, que tem si(
sugerida com a maior seriedade em anos recentes por físicos. No nume
de março de 1994, a Scientific American informou a seus leitores que *
- .
longe de ser um absurdo lógico... a possibilidade teórica de fazermos de
excursão desse tipo a uma vida pregressa é uma consequência inescapáv
de princípios fundamentais da física.
Talvez, no futuro, bioquímicos enviem de volta à Terra primitiva células
ilormacao necessária a fnnctr,,..? .-i,,,, ..*.. . . .
, i -,_- »-j üülsi v ailius. INCtiSe Cl
podem ser seus próprios alienígenas, sua própria ,
Claro que a gem no tempo fcva a paradoxos evídentesconZ-
| andoavosanteseoJ
alguns tísicos estão dispostos a aceitá-los. A maioria das pessoas, eu entre'
elas, achará esses cenários inteiramente insatisfatórios, mas eles estão à
disposição dos çue quiserem evitar àesagiaàaveïs ïmpïicaçôes teo]ógïcas.
: Em O relojoeiro cego, Richard Dawkins diz aos seus leitores que, mesmo
yw Ums eytílS íâ ïfyeV Afsïâ swJâ&wycaa' ees, ofcy iso cewrísm
concluir que presenciaram um milagre.9 Talvez todos os átomos da braço
da estátua tenham simplesmente se movido ao mesmo tempo na mesma
direção um evento de baixa probabilidade, para sermos exatos, mas
possível. A maioria das pessoas que viu uma estátua adquirir vida diria a
Dawkins que há mais coisas entre o céu e a Terra do que sonha sua filosofia,
mas não conseguiriam que ele entrasse para a Igreja anglicana.
Nem deveriam tentar. Em um sentido muito real, a separação entre as esferas
da ciência e da filosofia e religião é como as coisas devem ser. Todas as
pessoas têm à disposição os dados fornecidos por seus sentidos e, na maior
parte, podem concordar com outras sobre o que são esses dados. Em um
alto grau, pessoas de diferentes convicções filosóficas e religiosas podem
também concordar sobre teorias científicas, tais como a gravitação, placas
tectônicas ou a evolução, para organizar os dados (mesmo que as teorias
sejam, em última análise, incorretas). Os princípios filosóficos fundamen-
tais, que dão base à realidade, e os princípios teológicos, ou a falta deles,
que podem ser extraídos da filosofia ou da experiência histórica, são, no
fundo, escolhidos pelo indivíduo. O homem tem de ser livre para procurar
o bom, o verdadeiro, o belo.
A recusa em conceder aos demais espaço para que definam suas crenças
levou repetidamente ao desastre. A intolerância não surge quando eu penso
que descobri a verdade. Em vez disso, surge apenas quando penso que,
porque a encontrei, todos têm de concordar comigo. Richard Dawkins
escreveu que todos os que negam a evolução são "ignorantes, estúpidos ou
insanos (ou maus mas eu preferiria não considerar essa possibilidade)".1()
Não é preciso dar um grande passo entre chamar alguém de mau e tomar
medidas efetivas para acabar com sua maldade. John Maddox, o editor de
252 A caixa PRETA DE DARWIN
Nature, escreveu em sua revista que "talvez não demore muito para a prátí
da religião ser considerada como anticiência".11 Em seu recente livi
Darwin 's Dangerous Idea, o filósofo Daniel Dennett compara os creni
religiosos 90% da população a animais selvagens, que precisam s
enjaulados e diz que devem ser impedidos (através de coerção, presume-s
de informar mal seus filhos sobre a verdade da evolução, que para ele é t
evidente.12 Isto não é receita para a tranquilidade doméstica. Uma coisa
tentar convencer alguém através de polémica; outra, inteiramente diferen
é usar de coerção contra os que discordam de nós. A medida que o pé
da prova científica muda de forma drástica, essa ressalva deve ser manti
cada vez mais em mente. Richard Dawkins disse que Darwin tom
possível ao homem ser um "ateu intelectualmente realizado".13 O fracas;
da teoria de Darwin na escala molecular pode fazer com que Dawkins se sin
menos realizado, mas ninguém deve tentar impedir que ele prossiga sua busc
A comunidade científica inclui muitos cientistas excelentes que pensa
que há alguma coisa além da natureza, e outros tantos que não acham na
disso. Como, então, a ciência tratará "oficialmente" a questão da identida
do planejador? Os livros de bioquímica terão de ser reescritos com a af
mação explícita de que "Deus fez isso"? Não, A questão da identidade (
planejador será simplesmente ignorada pela ciência. A história da ciênc
está repleta de exemplos de perguntas básicas, mas difíceis, que estão sem
adiadas para uma resposta posterior. Newton, por exemplo, declinou de e
plicar o que causava a gravidade, Maxwell recusou-se a especificar um me
transmissor para suas ondas de luz, logo que o éter foi desmoralizado
cosmologistas, de maneira geral, têm ignorado a questão do que causou
Big Bang. Embora a existência do planejamento seja fácil de ser vista
bioquímica da célula, identificar o planejador por meios científicos põe
ser extremamente difícil. Da mesma maneira, Newton podia facilmente obse
var a gravidade, mas a especificação de sua causa ainda estava a séculos
futuro. Quando uma questão é por demais difícil para que a ciência a enfrent
de imediato, ela é esquecida sem problemas, enquanto outras questões, mai
acessíveis, são investigadas. Se, entrementes, a filosofia e a teologia querer]
fazer uma tentativa nesse sentido, nós, cientistas, lhes desejamos todo o sucesso
mas nos reservamos o direito de nos intrometermos na conversa quando
ciência tiver mais alguma coisa para dizer.
A relutância da ciência em aceitar a conclusão de planejamento inteligenti
que seus longos e árduos trabalhos tomaram evidente, não conta com ut
alicerce justificável. O chauvinismo científico é um sentimento compreen-
sível, mas não se deve permitir que afete questões intelectuais sérias. A
história das desavenças entre religião e ciência é lamentável e causou
rancores por toda parte. A raiva herdada, porém, não constitui base para
proferir julgamentos científicos. O argumento filosófico (formulado por
alguns teístas) de que a ciência deve evitar teorias que lembrem o sobrena-
tural limita-a artificialmente. O temor de que explicações sobrenaturais
derrotem a ciência carece de fundamento. Além disso, o exemplo da teoria
do Big Bang mostra que teorias científicas com conotações sobrenaturais
podem ser muito frutíferas. O compromisso filosófico de alguns indivíduos
com o princípio de que nada existe além da natureza não deve ter permissão
de interferir em uma teoria que flui naturalmente de dados científicos
observáveis. Os direitos dessas pessoas de evitar uma conclusão sobrena-
tural devem ser escrupulosamente respeitados, mas tampouco se deve
admitir que sua aversão ao transcendente tenha o caráter de decisão final.
Ao chegarmos ao fim deste livro, ficamos sem uma defesa forte contra
o que parece uma conclusão estranha: que a vida foi planejada por um
agente inteligente. De certa maneira, porém, todo o progresso da ciência
nas últimas centenas de anos tem sido uma marcha ininterrupta para o
estranho. O homem, até a Idade Média, vivia em um mundo natural. ATerra
estável era o centro das coisas; o Sol, a Lua e as estrelas giravam inter-
minavelmente para fornecer luz, dia e noite; as mesmas plantas e animais
eram conhecidos desde a Antiguidade; reis governavam por direito divi-
no. Eram poucas as surpresas.
Em seguida, alguém sugeriu, de forma absurda, que a própria Terra se
novia, girando, enquanto descrevia círculos em torno do Sol. Ninguém
odia sentir a Terra girando, ninguém podia ver isso; mas ela girava. De
losso moderno ponto de observação, é difícil ter ideia do ataque aos
entidos desfechado por Copérnico e Galileu. Eles disseram, na verdade,
jue o homem não podia mais confiar nem no que seus olhos viam.
Com o passar dos anos, as coisas pioraram cada vez mais. Com a
descoberta de fósseis, tomou-se claro que os animais conhecidos do campo
e da floresta nem sempre haviam povoado a Terra; o mundo fora outrora
habitado por imensas e estranhas criaturas, ora extintas. Algum tempo
depois, Darwin sacudiu o mundo, argumentando que a biota conhecida
iescendia de vida bizarra e desaparecida nos confins de um tempo incom-
preensível para a vida humana. Einstein nos disse que o espaço é curvo e
yie o tempo é relativo. A física moderna diz que os objetos sólidos são
arincipalmente espaço vazio, que partículas subatômicas não têm posição
iefinida, que o universo teve um começo.
254 A CAIXA PRETA DE DARWIN
Agora chegou a vez de a ciência fundamental da vida, a bioquími
bagunçar um pouco as coisas. A simplicidade que antes se considerava
o alicerce da vida revelou-se uma ilusão; em vez disso, sistemas
complexidade irredutível, espantosa, residem na célula. A compreens
resultante de que a vida foi planejada por uma inteligência é um choq
para nós no século xx, que nos acostumamos a pensar nela como resulta
de leis naturais simples. Outros séculos, porém, também tiveram se
choques, e não há razão para pensar que deveríamos escapar deles.
humanidade continuou, enquanto o centro dos céus passava da Terra p£
além do Sol, à medida que a vida se expandia para abranger répteis há lon;
tempo extintos, na proporção em que o universo eterno mostrou que e
mortal. Nós sobreviveremos à abertura da caixa preta de Darwin.
APÊNDICE
A química DA vida
Este apêndice fornecerá ao leitor interessado uma visão geral dos princípios
Bioquímicos que formam a base da vida. Embora não seja necessário lê-lo
para seguir os argumentos contidos neste livro, os esclarecimentos que se
neguem os colocarão em um contexto mais amplo. Nele discutirei as células
S as estruturas de várias grandes classes de biomoléculas proteínas e
ácidos nucleicos e, rapidamente, lipídios e carboidratos. Focalizarei, em
leguida, a questão de como a informação genética é expressa e propagada.
.Claro, em um espaço tão curto, a descrição tem de ser forçosamente geral,
g(le modo que insisto com os que se sentirem intrigados com os mecanismos
(da vida que tomem emprestado em uma biblioteca um texto introdutório à
Bioquímica. Um mundo liliputiano fascinante estará à espera do leitor.
CÉLULAS E MEMBRANAS
& corpo humano é formado por centenas de trilhões de células. Outros
ffldes animais e plantas também são conglomerados de números imensos
Ias. A medida que o tamanho do organismo diminui, contudo, reduz-se
nbém a quantidade de células; O pequeno verme C. elegans, por exem-
lo, contém apenas cerca de mil. Descendo na escala de tamanho chegamos
nalmente aos filós unicelulares, tais como leveduras e bactérias. Nenhuma
ida independente existe abaixo desse nível.
O exame de sua estrutura mostra por que a célula é a unidade fun-
imental da vida. O aspecto definidor da célula é uma membrana uma
trutura química que separa o mundo externo do interior da célula. Com a
oteção da membrana, a célula pode manter em seu interior condições
ferentes das que predominam no lado de fora. Elas, por exemplo, podem
mcentrar nutrientes em seu interior, tornando-os disponíveis para produ-
256 A CAIXA PRETA DE DARWIN
cão de energia e para impedir que materiais estruturais recém-fabrica»
seja levados para longe pela solução. Na falta de membrana, o grar
conjunto de reações metabólicas necessárias para manter a vida se
dissipado rapidamente.
As membranas são feitas de moléculas anfifílicas, semelhantes, de cê
maneira, aos sabões e detergentes usados na limpeza doméstica. Apala
anfifílico deriva do grego e significa "ama a ambos"; uma moléci
anfifílica "ama" dois ambientes diferentes: o óleo e a água. A forma d
moléculas é parecida com a de um pirulito, com dois palitos saindo i
mesmo lado da bola doce. Os palitos consistem geralmente de hidrocarb
netos (constituídos de átomos de carbono e hidrogénio) e, tal como outr
hidrocarbonetos, como a gasolina, não se misturam bem com a água. Es
é a parte amante de óleo da molécula. Essas regiões são chamadas (
hidrofóbicas, do grego que significa "repele a água". A bola doce (
molécula-pirulito, em contraste, geralmente contém um grupo químico qu
tal como sal de cozinha ou açúcar, adora misturar-se com a água. Esss
regiões são denominadas de hidrofílicas ("amantes da água"). As duE
partes opostas da membrana estão quimicamente ligadas e, tal como gêmec
siameses, são obrigadas a andar juntas, a despeito de propriedades dife
rentes. Mas, e se uma parte da molécula quer estar na água e a outra prefer
estar fora dela, onde é que fica a molécula?
As moléculas anfifílicas resolvem seu dilema associando-se a outras d
mesmo tipo. Quando um grande número de anfifílicas se associam, a
caudas hidrofóbicas se juntam para excluir a água, enquanto as cabeça
hidrofílicas nela mergulham. Uma maneira eficiente das caudas se prote
gerem da água, embora ainda permitindo que os grupos que a "amam
tenham acesso a ela, consiste em formar dois lençóis (Figura A-1), chama
dos de dupla camada lipídica. Se os dois lençóis permanecessem lisos
contudo, os hidrocarbonetos existentes em suas bordas continuariam expôs
tos à água. Por isso eles se fecham como se fossem bolhas de sabão.
Uma vez que a parte intermediária da camada dupla da membrana é
oleosa, numerosas moléculas que preferem um ambiente aquoso (tais como
as de sal e açúcar) não podem cruzá-la. Dessa maneira, temos uma estrutura
com um interior fechado, que pode ser diferente do ambiente externo o
primeiro passo na fabricação da célula.
O mundo vivo contém dois tipos de células fundamentalmente dife-
rentes: as eucarióticas, nas quais uma segunda membrana, diferente da
membrana da célula, lhe envolve o núcleo; e as procarióticas, que não
possuem esse aspecto.' Os organismos procarióticos são sempre unicelu-
lares e, de muitas maneiras, muito mais simples que os eucarióticos.
FIGURA A-1
SEGMENTO DE UMA DUPLA CAMADA LIPÍDICA.

Além da membrana, apenas alguns aspectos sobressaem em fotografias


de procarióticas.2 O primeiro é o nucleóide, a massa de adn (ácido desoxir-
ribonucleico) celular, repousando confortavelmente no centro do citoplas-
ma (o conteúdo solúvel da célula). Além da membrana, as procarióticas têm
uma segunda estrutura, que envolve a célula, denominada parede celular.
Ao contrário da membrana, a parede é formada de polissacarídeos, elemen-
tos rígidos e inteiramente permeáveis a nutrientes e pequenas moléculas.
Eles conferem resistência mecânica à célula, impedindo que ela se rompa
sob pressão. Várias estruturas se projetam da membrana das células proca-
rióticas. A função de pêlos semelhantes a cabelo é, na maior parte, desco-
nhecida. O flagelo bacteriano é usado para locomoção. Os flagelos giram
rapidamente como se fossem uma hélice e impulsionam a procariótica.
A segunda categoria é a das eucarióticas, que entram na composição de
todos os organismos multicelulares, bem como de alguns organismos
unicelulares, como as leveduras. As células eucarióticas contêm certo
número de espaços subcelulares, que são separados do citoplasma por
membranas próprias. Estas são denominadas de organelas, porque lem-
bram os órgãos encontrados no corpo de animais. As organelas permitem
que a célula eucariótica desempenhe funções especializadas, em comparti-
mentos especializados.
258 A CAIXA PRETA DE DARWIN
A primeira organela especializada é o núcleo, que contém o adn d
célula. A membrana que envolve o núcleo é uma estrutura altament
especializada, perfurada por orifícios grandes, octogonais, denominado
poros do núcleo. Nenhuma grande molécula (como as proteínas ou o arn
passa pêlos poros nuleares sem dar a "senha" correta. Esse fato mantém a
moléculas que pertencem ao citoplasma fora do núcleo, e vice-versa.
Um bom número de outras organelas salpicam o citoplasma, entre ela.
as mitocôndrias, as "usinas de força" da célula: especializam-se nas reaçõe.
químicas que transformam moléculas nutrientes carregadas de calorias eu
formas de energia química, que a célula pode usar diretamente. As mitocôn
drias têm duas membranas. A"queima" controlada das moléculas nutrienta.
gera uma diferença entre a acidez do espaço fechado pela membrana intem
e o espaço existente entre as membranas interna e externa. O fluxo contro
lado de ácido entre os dois compartimentos gera energia, da mesma forni
que o fluxo de água por uma represa gera energia elétrica.
Os Usossomos são pequenas organelas envolvidas por uma única mem
brana. Basicamente, constituem sacos de enzimas que degradam moléculas
que sobreviveram à sua utilidade. As moléculas destinadas à degradaçã
são para lá transportadas em pequenas vesículas revestidas (ver Capítulo 5
A acidez no lisossomo é de cem a mil vezes maior do que no citoplasma
O aumento da acidez faz com que proteínas fortemente dobradas (preguea
das) se abram. As estruturas abertas são em seguida facilmente atacadas
pelas enzimas degradadoras.
O retículo endoplasmático (er) é um sistema de membrana extensa,
achatada, convoluta, que se divide em dois componentes diferentes, a E
áspera e a er macia. A er áspera tira sua aparência eriçada dos numeroso
ribossomos a ela ligados. Os ribossomos constituem a maquinaria celular
que sintetiza as proteínas. A er macia sintetiza lipídios as moléculas
gordas. O aparelho de Golgi (assim chamado em homenagem a Camill
Golgi, o primeiro a observá-lo) é uma pilha de membranas lisas, aonde as
muitas proteínas fabricadas na er vão para serem modificadas.
Acélula pode assumir formas radicalmente diferentes da esférica (como
por exemplo, a célula espermática) e também mudar de forma como reaçã
a mudanças no ambiente. O formato da célula é sustentado pelo citoesque
feto, que, como sugere o nome, é o arcabouço estrutural da célula. O
citoesqueleto é composto de três grandes materiais estruturais: microtúbu
los, microfilamentos e filamentos intermediários. Os microtübulo
desempenham uma série de funções, entre elas a formação do fuso mitótico
o aparelho que, durante a divisão da célula, empurra uma cópia da cac
cromossomo para a célula-filha. Os microtúbulos formam também a colun
APÊNDICE 259
vertebral dos cílios eucarióticos, que, como veremos, podem impulsar a
célula pelo ambiente. Finalmente, podem servir como "trilhos ferroviários"
para os motores moleculares que transportam carga para partes distantes da
célula. Os micro filamentos, mais finos que os microtúbulos, são feitos da
proteína actina, que é também um componente importante dos músculos.
Os microfilamentos se agarram uns aos outros e escorregam para se contrair.
Essa ação dá forma à célula, ao dobrar (ou preguear) a membrana celular
nos lugares certos. Os, filamentos intermediários, que são mais grossos que
os microfilamentos, embora mais finos que os microtúbulos, aparentemente
agem apenas como suportes estruturais (como se fossem vigas de aço). Os
filamentos intermediários são as estruturas mais diversificadas do citoes-
queleto.
Quase todas as células eucarióticas contêm as organelas descritas acima.
As células das plantas, porém, contêm várias organelas adicionais. O
cloroplasto é o local onde ocorre a fotossíntese. Os cloroplastos são, de
muitas maneiras, semelhantes às mitocôndrias, uma vez que ambos têm
responsabilidade de geradores de energia. Os cloroplastos contêm o pig-
mento clorofila, que atua como antena captadora de luz. A energia da luz é
transferida para uma maquinaria molecular extremamente complexa, que
gera diferenças em acidez nas membranas do cloroplasto. As células de
plantas possuem também um espaço grande, vazio, envolvido por uma
membrana, denominado vacúolo. O vacúolo é um depósito de dejetos,
nutrientes e pigmentos, mas desempenha também um papel estrutural. O
vacúolo ocupa cerca de 90% do volume de algumas células de plantas e
funciona sob alta pressão osmótica. A pressão, empurrando a forte parede
da célula da planta, enrijece a célula.
As células e organelas descritas acima, embora extremamente pequenas
pêlos padrões comuns, são muito grandes quando comparadas aos materiais
que entram em sua construção. Os materiais das células e das estruturas
subcelulares são, em última análise, compostos de átomos reunidos em
moléculas. Uma ligação química, ou ligação covalente, forma-se quando
cada dois átomos contribuem com um elétron, que dividem entre si.
Dividindo elétrons negativamente carregados, os átomos protegem com
mais eficácia seus núcleos atómicos positivamente carregados. Amolécula
consiste de dois ou mais átomos ligados covalentemente entre si.
No que é bastante surpreendente, são poucos os tipos de átomos encon-
trados em moléculas biológicas. Quase todas as biomoléculas são compos-
tas de átomos de seis elementos: carbono (c), oxigénio (o), nitrogénio (i
hidrogénio (H), fósforo (p) e enxofre (s). Alguns outros elementos (coe
cloro, sódio, cálcio, potássio, magnésio e ferro) comparecem sob a forr
de íons em sistemas biológicos. (Íons são partículas eletricamente ca
regadas que flutuam mais ou menos livremente na água.)
Os átomos de c, h, o, N, p e s podem ligar-se entre si. O carbono poi
ligar-se simultaneamente com até quatro átomos diferentes e, o fósfo
biológico, também com quatro outros átomos (quase sempre, quatro i
oxigénio). O nitrogénio pode formar três ligações (quatro em casos es
peciais) e o oxigénio e o enxofre, duas. O hidrogénio só pode formar ur
único laço com outro átomo. O carbono é excepcional entre os elemento
no sentido em que pode formar laços estáveis com outros átomos de carbon
para formar longas cadeias. Uma vez que um átomo de carbono no meio c
uma cadeia usa apenas dois de seus laços a fim de ligar-se ao átom
de carbono à direita e ao outro à esquerda ele continua com mais dói
laços a estabelecer. E pode usar um deles para ligar-se, digamos, a um átom
de nitrogénio e, o outro, talvez, a outra cadeia de átomos de carbono.
É na verdade muito grande o número de moléculas de carbono e de outro
elementos biológicos que podem ser fabricadas. Os sistemas biológico
contudo, não usam um grande número de moléculas inteiramente dife
rentes. Na verdade, só um número limitado delas é fabricado e as grande
"macro"moléculas da vida tais como proteínas, ácidos nucleicos
polissacarídeos são construídas reunindo-se em arranjos diferentes a
moléculas de um conjunto limitado. Esse processo pode ser comparado
escrever um número imenso de palavras e frases diferentes com as vinte
seis letras do alfabeto.
Os blocos de armar das proteínas são denominados aminoácidos. O
vinte diferentes aminoácidos que compõem virtualmente todas as proteína
têm uma estrutura comum. No lado esquerdo da molécula há um grup
contendo nitrogénio, denominado amina e, à direita, ligado à amina por um
átomo central de carbono, há um grupo de ácido carboxílico (daí o nom
aminoácido). Ligado também ao átomo central de carbono, em acréscim
a um átomo de hidrogénio, há outro grupo, denominado cadeia latera
(Figura A-2). A cadeia lateral varia de um tipo de aminoácido a outro. E
cadeia lateral que dá ao aminoácido seu caráter particular.
Os aminoácidos podem ser agrupados em várias categorias. O primeir
grupo contém cadeias laterais de hidrocarbonetos (cadeias laterais com
átomos de carbono e hidrogénio apenas). Essas cadeias são oleosas, como
a gasolina, e preferem evitar contato com moléculas aquosas. O grupo
seguinte é formado de aminoácidos eletricamente carregados, com três
FIGURA A-2
(NO ALTO) QUATRO AMINOÁCIDOS. Os AMINOÂCIDOS DIFEREM APENAS EM SUAS
CADEIAS LATERAIS. (EMBAIXO) OS QUATRO AMINOÁCIDOS FORAM QUIMICAMENTE
LIGADOS. PROTEÍNAS SÃO CADEIAS LONGAS DE NUMEROSOS AMINOÂCIDOS QUIMICA-
MENTE LIGADOS.
NHaCH-CO,- ''-CH-CO,- ''-CH-CO;, - -CH-CO;-
fenilalanina
NH3CHCNHCH-CNHCH-CNHCHCC2-
membros positiva e dois negativamente carregados. As cadeias laterais
carregadas preferem contato com a água. Outro grupo é formado de ami-
noácidos polarizados. Moléculas polarizadas, embora não inteiramente
carregadas, contêm átomos parcialmente carregados. Esse fato ocorre
quando um átomo atrai com mais força os elétrons do que o seu par em uma
ligação química, trazendo-os para mais perto de si. O átomo com a parte do
leão dos elétrons é mais ou menos negativamente carregado, enquanto que
os que apresentam deficiência de elétrons têm carga positiva parcial. As
interações entre cadeias laterais positiva e negativamente carregadas, e entre
átomos carregados de forma parcial, positiva e negativamente, das cadeias
laterais polarizadas, podem ser muito importantes na estrutura das proteínas.
Durante a síntese de proteínas, dois aminoácidos são quimicamente
ligados quando o grupo de amino de um aminoácido reage com o grupo de
ácido carboxílico de outro para formar um novo grupo, denominado ligação
262 A CAIXA PRETA DE DARWIN
de peptídio (Figura A-2). A nova molécula ainda tem um grupo livre i
aminos em uma extremidade e outro de ácido carboxílico livre na outra, (
modo que outro aminoácido pode ser ligado, contribuindo com sua extr
midade de amino para formar mais uma ligação de peptídio. Esse proces
pode ser repetido indefinidamente até que uma macromolécula, contenc
centenas ou milhares de "resíduos" de aminoácidos (a parte que sob
depois da reação química que liga dois aminoácidos), é formada. Ess
macromoléculas são conhecidas como polipeptídeos, ou proteínas.
Uma proteína típica contém entre cinquenta e três mil resíduos (
aminoácidos. A sequência de aminoácidos da proteína é denominada e
trutura primária. A proteína completa tem ainda um grupo de amino liv
em uma extremidade, denominada extremidade N-terminal, e um grupo (
carboxílico livre na outra extremidade, denominada extremidade c-tenn
nal. A sequência de aminoácidos da proteína é convencionalmente escr:
partindo do N-terminal para a extremidade c-terminal. Os átomos (
proteína que formam uma linha do n para o c terminal são denominad
coluna vertebral da proteína, que inclui todos os átomos, com exceção d
que pertencem às cadeias laterais.
Uma proteína recém-fabricada não flutua ao léu como uma cadeií
frouxa. Em um processo notável, virtualmente todas as proteínas biológica
se dobram (pregueiam) em estruturas separadas e muito precisas (Figur
A-3), que podem ser bastante diferentes em proteínas diferentes. Isto é feit
automaticamente, através de interações, tais como uma cadeia lateral posi-
tivamente carregada atraindo outra cadeia negativamente carregada, duas
cadeias hidrofóbicas reunindo-se para expulsar a água, grandes cadeias
sendo excluídas de pequenos espaços, e assim por diante. Ao fim de
processo de dobramento, que, tipicamente, demora de frações de segunde
a um minuto, duas proteínas diferentes se dobram para formar estrutural
tão precisas e diferentes entre si como uma chave inglesa e uma serra. l|
como acontece com ferramentas caseiras, se suas formas são muito einpfii
nadas, elas deixam de funcionar. [
Quando se dobram, as proteínas não se reúnem como um pedaço
barbante amassado na mão. Há regularidade no dobramento. Antes
proteína se dobrar, os átomos de sua coluna vertebral polarizada
átomos de oxigénio, nitrogénio e de hidrogénio em cada laço de peptíde
formam o que é denominado ligações de hidrogénio com moléculas (
água. Uma ligação de hidrogénio ocorre quando um átomo de oxigénio (
nitrogénio de um peptídeo carregado, em parte, positivamente, ligá-i
fortemente com os átomos de hidrogénio carregados, em parte, positiw
mente da água. Quando se dobra, contudo, a proteína tem que espremer t(X

(ou quase toda) a água, de modo que as cadeias laterais oleosas possa
arrumar eficientemente. Isso cria um problema: os átomos do pep
polarizado têm que encontrar parceiros com cargas opostas na pró
dobrada, ou então ela não se dobrará.
As proteínas resolvem esse problema de duas maneiras. Em prim
lugar, segmentos da proteína podem formar uma a-hélice. Nessa estrui
a coluna vertebral da proteína forma uma espiral. Ageometria da espira
com que o átomo de oxigénio de um grupo de peptídeos aponte diretam
na direção e se ligue a ele, do átomo de hidrogénio do grupo de peptíf
encontrado a quatro resíduos de aminoácidos atrás, ao longo da ca.
(Figura A-3). O átomo de hidrogénio do resíduo seguinte liga-se ao resíi
subsequente a quatro postos atrás do mesmo, e assim por diante. De mi
geral, uma a-hélice tem de cinco a 25 resíduos de aminoácidos, antes
termine a estrutura helicoidal (mas não necessariamente a cadeia de pró
nas). A a-hélice permite à proteína dobrar-se em uma forma compa
formando ainda laços de hidrogénio com átomos de peptídeos. Uma seg
da estrutura, que permite ligações regulares de hidrogénio com átomos
peptídeo, é denominada -lençol dobrado, ou simplesmente Çi-lençol. Na
estrutura, a coluna vertebral da proteína sobe e desce, como as pregas
um lençol, e os átomos do peptídeo se projetam perpendiculares à dire
da cadeia de proteínas. A cadeia se enrosca em seguida, volta, e os átom
de oxigénio no grupo de peptídeos do fio que retorna de hidrogénio ligam
ao grupo de peptídeos do primeiro fio. Como acontece com as a-héli
os Çi-lençóis permitem que os átomos da coluna vertebral polariz
formem ligações com átomos de hidrogénio.
As a-hélices e os p-lençóis são conhecidos como estrutura secundar
da proteína. Uma proteína típica tem cerca de 40 a 50% de seus resíduos (
aminoácidos nos lençóis e hélices. O restante dos resíduos é envolvic
altemadamente entre partes da estrutura secundária ou forma estrutup
irregulares. Hélices e lençóis se grudam uns nos outros para formar, i
maioria dos casos, uma proteína globular, compacta. A forma exata com'
os elementos da estrutura secundária se arrumam é denominada estrutura
terciária (Figura A-3) da proteína. Aforça impulsora da reunião das hélice
e lençóis vem da natureza oleosa de muitas cadeias laterais. Da mesm
forma que o óleo se separa da água para formar uma camada distinta, r
cadeias laterais oleosas, hidrofóbicas, se reúnem para formar uma zoi
isenta de água no interior da proteína. Lembre-se, porém, que algum.
cadeias laterais são ou polarizadas ou carregadas, e querem permanecer l
água. O padrão de cadeias laterais oleosas e polares ao longo da seqüêno,
de aminoácidos, e a necessidade da cadeia de proteínas de se dobrar, d.
APÊNDICE 265
modo que a maior parte dos grupos hidrofóbicos fiquem no interior da
proteína e a maioria dos grupos hidrofílicos no exterior, fornecem a infor-
mação que leva uma proteína específica a dobrar-se em uma estrutura
específica.
Outro fator também contribui para a especificidade do dobramento da
i proteína. Em todas elas, algumas cadeias laterais polarizadas são inevita-
| velmente sepultadas. Se os átomos polarizados sepultados não encontram
um parceiro que se ligue a átomos de hidrogénio, a proteína é deses-
tabilizada. Na maioria das proteínas, cerca de 90% dos átomos das cadeias
laterais polarizadas são, na verdade, átomos de hidrogénio ligados de forma
livre a outras cadeias laterais ou à coluna vertebral da proteína. O dobra-
mento de uma proteína típica com seus requisitos para acomodar grupos
hidrofóbicos e hidrofílicos e formar redes de ligações de hidrogénio pode
ser comparado a um quebra-cabeça de armar em três dimensões.
Frequentemente, vários polipeptídeos separados se juntam de uma ma-
neira muito específica para formar uma estrutura composta, que funciona
como uma única entidade. Nesses casos, é costume designar os polipeptí-
deos associados como sendo uma única proteína, composta de "subuni-
dades". A hemoglobina, proteína transportadora de oxigénio, por exemplo,
é composta de quatro polipeptídeos. Aproteína resultante de amálgama tem
propriedades de ligação com o oxigénio de que carecem os polipeptídeos
componentes. Dessa maneira, a proteína biológica funcional é o complexo
formado por quatro polipeptídeos. O arranjo específico de polipeptídeos
separados em uma proteína é denominado estrutura quaternária (Figura
A-3).
Tal como as proteínas, os ácidos nucleicos são polímeros formados de um
pequeno número de blocos de armar denominados nucleotídeos. O nucleo-
tídeo em si compõe-se de várias partes. A primeira parte é um carboidrato,
a ribose (no arn) ou a desoxirribose (no adn). A ribose está ligada a uma
das quatro bases, isto é, adenina (A), citidina (c), guanina (o), ou uracil (u).
Se o carboidrato é deoxirribose, então u é substituído por uma base
semelhante chamada timina (t). As bases a, c e G são também usadas com
a deoxirribose. Ligado a uma parte diferente do anel de carboidratos (ao
5'-OH, ou grupo "cinco-principais de hidroxil"), há um grupo de fosfato. A
parte açúcar-fosfato de um nucleotídeo é análoga à parte da coluna vertebral
de um aminoácido, e a base é análoga a uma cadeia lateral de aminoácido.
Só na base é que um nucleotídeo difere de outro.
266 A CAIXA PRETA DE DARWIN
Dois nucleotídeos podem ser ligados quimicamente através da reação
fosfato de um deles com o grupo 3'-OH da parte de carboidratos do segun
(Figura A-4). Esse fato ainda deixa um grupo de fosfato livre em ui
extremidade, e um de 3'-OH também livre na outra, que pode entrar e
reação com outros nucleotídeos. A repetição desse processo pode ger
polinucleotídeos realmente muito longos. Em extensão, o arn celular var
de setenta a cinco mil nucleotídeos. Uma única molécula de adn pode vari
de vários milhares a cerca de um bilhão de nucleotídeos. Aseqüência de u
polinucleotídeo é convencionalmente escrita partindo da extremidade
para a 3'.
Os arns celulares são encontrados como cadeias isoladas de nucleot
deos. Há várias classes biológicas de arn. A primeira é denominada AF
mensageiro (mARN); membros dessa classe são produzidos como cópi
fiéis dos genes do adn; a informação genética transportada pelo mARN
em seguida interpretada pelo aparelho sintetizador de proteína, a fim (
produzir outra proteína. O segundo tipo de arn é denominado arn ribo
sômico (rARN). Polinucleotídeos dessa classe se associam a grande númer
de proteínas diferentes para formar o ribossomo, o motor principal d
síntese da proteína. A última grande categoria do arn é chamada de ari
transportador (iarn). Os membros dessa classe são relativamente pequena
com setenta a noventa nucleotídeos de comprimento, e servem comi
"adaptadores" entre o mARN e a proteína em crescimento, que é produzia
pela ação do ribossomo.
O adn celular é encontrado sob a forma de uma molécula de duplo D
dois polinucleotídeos entrelaçados (a famosa hélice dupla) que sã
mantidos fortemente juntos por uma ligação de hidrogénio. A fim d
compreender a razão desse fato, temos que examinar a estrutura das base
dos nucleotídeos (Figura A-4). Os nucleotídeos podem ser divididos et
duas categorias as purinas (A e G) que transportam as bases maioró
(compostas de dois anéis fundidos), e as pirimidinas (c e T), que têm apeia
um anel. Se a e T são corretamente orientados, eles podem formar dua
ligações de hidrogénio entre si, e o pode formar três laços de hidrogêni
com c. Nas células, em todos os casos em que há um G em um fio do Arai
há um c no segundo fio, e vice-versa; e em todos os casos em que há usai
em um fio, há um T no segundo fio, e vice-versa. Esses dois fios si
chamados de "complementares" entre si. A £07
APÊNDICE 267
CURA A-4
KASMENTO DE ADN CONTENDO QUATRO NUCLEOTÍDEOS.

ete.
xtraído de Conn, E.E., Stumpf, P.K., Bruening, G., e Dói, R.H. (1987) Outíines of
iochemistry, Sd., Nova York, John Wiley & Sons, fig. 6.1. Reproduzido com per-
issão.
268 A CAIXA PRETA DE DARWIN
passo que o de muitas bactérias são formados, surpreendentemente, dl
fios complementares circulares.
O volume de adn na célula varia de forma aproximada com a com
dade do organismo. As bactérias têm aproximadamente vários milho
nucleotídeos de adn. O volume de adn eucariótico varia de umas p
dezenas de milhões de nucleotídeos em fungos para muitas centen
bilhões em algumas plantas produtoras de flores. Seres humanos têm
de três bilhões de nucleotídeos.
Temos duas outras grandes categorias de biomoléculas nos lipídios e
polissacarídeos. Os polissacarídeos são polímeros de moléculas de aç
e seus derivados e desempenham uma grande variedade de funções. Po
ser usados como materiais estruturais, tais como a celulose encontrada
plantas lenhosas e nas árvores e como depósitos de energia, com
glicogênio, que é armazenado no fígado. Os lipídios, ao contrário i
proteínas, ácidos nucleicos e polissacarídeos, não são polímeros feitos
blocos de armar separados. Em vez disso, cada molécula de lipídio tem (
ser sintetizada a partir de materiais iniciais sumamente básicos. Embora i
sejam macromoléculas, os lipídios podem ligar-se para formar granc
estruturas, como membranas.
O adn, o repositório das informações genéticas, é um polinucleotídeo. i
informações que conduz, porém, dizem às células como fabricar polipep
deos proteínas. De que modo as informações podem ser traduzidas
uma "linguagem" de polímero para outra? Pouco depois da descoberta -
estrutura de dupla hélice do adn, o físico George Gamow sugeriu a ide
nada química de que as informações genéticas são armazenadas em fonr
codificada e que dar expressão às informações implica decodifícação d
polinucletídeo e tradução da mensagem para a linguagem de polipeptídt
das proteínas.3 Embora enganado sobre a natureza específica do código, i
intuição de Gamow foi profética.
Em princípios da década de 1960, conseguiu-se decifrar o código. Q
laureados Nobel Marshall Nirenberg, Severo Ochoa, H. Gobind Khoranài
seus colegas demonstraram que, no código genético, três nucleotídee
contínuos correspondem a um aminoácido (Figura A-5). Uma vez que t
APÊNDICE 269
'64 possíveis combinações de quatro bases, tomadas três de cada vez,
ocorrem permutações mais do que suficientes para codificar todos os vinte
aiBlaoatíàos. Todas as três bases fodawiossívtís sso ussàas)e)3 cé)ü}s,
'Üe modo que o código genético é superabundante, significando que vários
códons diferentes podem designar o mesmo aminoácido. açu, acc, aça e
ACG, por exemplo, codificam, todos, o aminoácido treonina. A maioria dos
aminoácidos tem dois ou três códons que os designam; vários, contudo, têm
apenas um. Um total de 61 dos possíveis 64 códons designa os aminoácidos;
os restantes são usados como códons de "parada". Quando o aparelho de
decodificaçâo encontra um desses sinais especiais, ele interrompe a produ-
ção de proteína nesse ponto.
O grande número de passos envolvidos na extração das informações
contidas no adn pode ser dividido em duas categorias conceituais, deno-
minadas de cópia e tradução. Em curtas palavras, no primeiro caso uma
célula tira uma cópia arn de uma pequena parte de seu adn (denominada
ene) que codifica a fabricação de uma proteína; na tradução, a informação
contida no arn é usada para produzir a proteína.
, Acópia de um gene envolve várias decisões, a primeira das quais é onde
começar, ao longo da imensa cadeia do adn. Aposição inicial é, em geral,
marcada por várias sequências especiais do adn, denominadas "promoto-
ras". Nas procarióticas, uma sequência de nucleotídeos do adn (em geral,
tcttgacat), denominada "região-35", ocorre a cerca de 35 nucleotídeos
antes de um gene; outra sequência (em geral, tataat), denominada "caixa
de Pribnow", ocorre de cinco a dez pares de base antes do local de início
da cópia. Além de sinais semelhantes, as eucarióticas têm sequências de
ADN denominadas "reforçadoras", situadas a milhares de pares de base de
distância do local onde começa a cópia. As promotoras podem influenciar
fortemente a taxa à qual o gene é copiado.
A fim de iniciar a cópia, no caso das procarióticas, uma enzima de
múltiplas subunidades chamada polimerase do arn liga-se ao adn. A
polimerase do arn consiste de cinco cadeias de polipeptídeos. Primeiro a
fenzima liga-se frouxamente, movendo-se ao longo do adn como os carros
em uma montanha-russa, até que encontra a região da promotora de um
gene. Quando isso acontece, uma das subunidades da proteína, denominada
o, reconhece a sequência adn promotora. Logo depois de encontrar a
Sequência da promotora, a polimerase do adn flutua para longe, terminado
seu trabalho. Na falta de o, a polimerase do arn liga-se estreitamente com
b ADN e não pode mais mover-se livremente. Nesse momento, começa seu
trabalho. Apolimerase do arn "derrete" cerca de dez pares de bases do adn,
separando nessa região os dois fios de polinucleotídeos de cada uma. Esse
p
270 A CAIXA PRETA DE DARWIN
FIGURA A-5
O CÓDIGO GENÉTICO.
UUU Fenilalanina
UUC
Serina UAC
Tirosina UGU
Parada UGA
Triptofa
CUU Leucina
Prolina CAU Histidine CGU
Arginin;
Glutamine CGA
Asparagina AGU
AUC Isoleucina
Treonina AAC
Lisina AGA
AUG Metionina
Acido GGU
aspártico
GUC Valina
Alanina GAC
Acido GGA
Glutâmico
passo é necessário, para que a cadeia de arn que será fabricada possa "l
o molde do adn através do átomo de hidrogénio que se liga ao mesr
Nesse momento, a polimerase liga-se à forma ativada de um ribonucle»
deo que é complementar à primeira base do adn, onde começa a cópia, l
seguida, liga-se ao segundo ribonucleotídeo, complementar à segunda b
do adn.
Logo que os primeiros dois ribonucleotídeos correios são comparados cr
o molde, a polimerase do arn liga-se quimicamente a eles. Apolimerase dês
em seguida, uma posição ao longo do molde do adn, mantendo separador
fios do adn enquanto se move. Compara a terceira posição com seu riboi
cleotídeo correspondentemente ativado e o liga à cadeia crescente. Essespas
são repetidos ao longo do gene a uma taxa muito alta, movendo-se a apro
madamente vinte a cinquenta nucleotídeos por segundo.
APÊNDICE 271
Acópia causa um problema: o movimento da polimerase através do adn
entrelaçado, helicoidal, faz com que o adn à frente da polimerase se tome
superconvoluto.4 Isso faria com que a cópia diminuísse de ritmo ou parasse
inteiramente, não fosse o fato de que outra proteína, denominada topoiso-
merase, desembaraça o adn. Faz isso através de uma manobra complicada
cortando um fio do adn emaranhado, passando o fio não cortado através
do fio cortado e, em seguida, reparando o corte.
A cópia termina quando a polimerase do arn encontra uma sequência
especial do adn. Nas procarióticas, é uma região palindrômica5 que contém
cerca de seis ou sete pares de bases gc, seguidas por uma região do mesmo
comprimento, rica em pares de bases at. Alguns genes, mas não todos,
requerem uma proteína adicional, denominada p, para fazer com que a
polimerase se desprenda do adn.
Acélula bacteriana típica contém milhares de genes, e a célula típica de um
mamífero chega a dezenas de milhares. De que maneira a célula sabe
quando copiar um gene, e de que modo escolhe um gene específico entre
milhares? O problema do "controle do gene" constitui um grande campo
de pesquisa. Muitos detalhes foram descobertos, mas bastante coisa perma-
nece ainda nebulosa. Um dos exemplos mais simples do controle do gene
encontra-se no ciclo de vida do bacteriófago X. Os bacteriófagos os
análogos procarióticos dos vírus são fragmentos de adn revestidos por
uma camada de proteína. Para tirar cópias de si mesmo, o bacteriófago
precisa descobrir uma célula bacteriana apropriada, ligar-se a ela e injetar
seu adn na hospedeira. O adn do fago é bem pequeno, contendo a
codificação de apenas uns cinquenta genes. Esse número não é suficiente
para criar sua própria maquinaria de replicação, de modo que, inteligente-
mente, o fago sequestra a maquinaria da hospedeira. O fago, portanto, é um
parasita, incapaz de sustentar-se por si mesmo.
Às vezes, quando o bacteriófago À. invade uma célula, esta fabrica tantas
cópias de X que explode. Este fenómeno é denominado ciclo lítico. Em
outras ocasiões, porém, X insere seu adn no adn bacteriano, fazendo de
duas uma única molécula. Nela, o adn do X pode descansar tranquilamente,
ser replicado junto com o resto do adn bacteriano quando a célula se dividir,
e esperar a sua hora. Isso é conhecido como ciclo lisogênico. Quando a
bactéria, talvez muitas gerações depois, enfrenta problemas (encontrando,
digamos, altas doses de luz ultravioleta), o adn de À no adn bacteriano
muda para o modo lítico. Ocorre apenas que, dessa vez, o fago fabrica
milhares de cópias de si mesmo, explodindo a célula, com transbordamentc
de novos bacteriófagos.
O que fará com que o bacteriófago À. mude do ciclo lisogênico para c
lítico? Quando o adn de um bacteriófago penetra na célula, a polimerasf
do arn liga-se à cópia da promotora de um bacteriófago X. Um dos primei-
ros genes a ser ativado é o relativo a uma enzima, denominada "integrase"
que insere quimicamente o adn de no adn bacteriano. A enzima realiz
isso cortando o adn circular de X em um local específico, que tem um
sequência semelhante a um local no adn hospedeiro, que a integrase cort
também. Essa operação deixa ambos os fragmentos de adn com extremi-
dades complementares, "pegajosas", que o átomo de hidrogénio liga entre
si. A enzima de integração liga-se em seguida a fragmentos do adn.
Outo gene X codifica a fabricação de uma proteína denominada "repres-
sora". Arepressora liga-se fortemente a uma sequência do adn de X, à qua
a polimerase do arn deve juntar-se para iniciar o ciclo lítico. Quando a
repressora de À, está presente, contudo, a polimerase do arn não pode
ligar-se, de modo que o ciclo lítico é desligado. Há, na verdade, três locais
de ligação para a repressora todos enfileirados. Arepressora liga-se mais
fortemente ao primeiro local do que ao segundo, e ao segundo mais forte-
mente do que ao terceiro. O terceiro local sobrepõe-se à promotora do gene
que codifica a própria repressora. Esse arranjo permite que a repressora seja
sintetizada de forma incessante, até que o terceiro local é preenchido
ocasião em que se interrompe a síntese. Se a concentração da repressora
falha no ponto em que ela se dissocia do terceiro local, o gene da repressora
é novamente ativado.
Através desse mecanismo, a repressora X controla sua própria produção
Na presença de alguns elementos químicos, de luz ultravioleta ou de outros
agentes nocivos, o gene de uma enzima que destrói especificamente À. é
ativado. Quando a repressora é retirada do primeiro local, o gene de uma
proteína denominada Cro é ativado. A proteína Cro liga-se fortemente ao
local de ligação da terceira repressora , desligando-a de forma definitiva
e lançando o bacteriófago no ciclo lítico. Todos os gentes necessários para
tirar cópias do adn X e revesti-los de capas de proteínas são copiados nesse
momento.
O controle do ciclo de vida do bacteriófago À. é um dos exemplos mais
simples do controle do gene. O controle de outros sistemas de gene, em
especial nas eucarióticas, pode implicar dezenas de proteínas. Não obstante,
pensa-se que a maioria dos genes é controlada por sistemas análogos ao de
X, com controles de retroalimentação e fatores múltiplos colaborando para
decidir quando um único gene deve ser ativado.
APÊNDICE 273
TRADUÇÃO
Logo que o arn mensageiro é produzido, a tarefa passa a ser a de traduzir
a mensagem para uma proteína. Esse processo é melhor compreendido nas
procarióticas.
O mARN copiado é fixado por uma partícula denominada ribossomo. Os
ribossomos são complexos imensos, compostos de 52 proteínas separadas
(várias das quais estão presentes em cópias múltiplas) e três fragmentos do
arn, com comprimentos de 120,1.542, e 2.904 nucleotídeos. O ribossomo
pode ser facilmente decomposto em duas grandes peças, denominadas
subunidade 30s e subunidade 50S.6 Incrivelmente, o ribossomo é automon-
tável. Experimentos demonstraram que quando ribossomos são separados
em seus componentes e em seguida remisturados, os componentes, nas
condições correias, formarão espontaneamente novos ribossomos.
O ribossomo enfrenta um problema semelhante ao da polimerase do
arn: tem que descobrir o ponto no mARN em que iniciará a tradução. Nas
procarióticas, o local é marcado por um trecho denominado sequência
Shine-Dalgamo, a uns dez nucleotídeos acima, a partir do ponto de inicia-
ção. A iniciação ocorrre na primeira sequência aug subsequente (o aug
codifica a fabricação do aminoácido metionina). Nas eucarióticas, a inicia-
ção começa simplesmente na primeira sequência aug, a partir da extremi-
dade 5' do mARN.
Por si mesmos, os ribossomos não podem ligar-se diretamente ao mARN.
Vários outros fatores são necessários. Nas procarióticas, três proteínas
denominadas faiares de iniciação rotuladas como IF-1, IF-2 e IF-3 são
necessárias. A fim de iniciar a tradução, if-i e IF-3 ligam-se à unidade
ribossomal 30s. Este complexo passa em seguida: l) a ligar-se a um
complexo previamente formado de uma molécula iarn que transporta
metionina e liga-se a IF-2, e, 2) à molécula mARN no local da iniciação do
processo. Em seguida, a subunidade ribossomal 30s liga-se a um complexo
crescente, fazendo com que if-i, IF-2 e IF-3 se desprendam. Nas eucarióti-
cas, a iniciação da tradução ocorre em passos semelhantes, embora o
número de fatores de iniciação possa ser tão alto como dez ou mais.
No passo seguinte, uma segunda molécula de tARN, associada a uma
proteína denominada fator de alongamento Tu (EF-Tu) aparece, trazendo o
aminoácido apropriado e se liga ao ribossomo. Um laço de peptídeo é
formado entre os dois aminoácidos mantidos no ribossomo. A primeira
molécula tARN perdeu nesse momento seu aminoácido, e os resíduos de
aminoácidos covalentemente associados são ligados ao segundo tARN.
Nesse ponto, o primeiro tARN dissocia-se do ribossomo, o segundo tARN
274 A CAIXA PRETA DE DARWIN
entra no local do ribossomo antes ocupado pelo primeiro tARN e o rib
somo desce exatamente três nucleotídeos no mARN. Esse processo
tradução requer outra proteína, denominada ef-g, para uma função aü
desconhecida.
Esses passos são repetidos até que o ribossomo alcança uma seqüên
de três nucleotídeos, que correspondem a um códon de parada. Ou
proteína, denominada fator de liberação, liga-se ao códon de para
impedindo que o ribossomo chegue até lá. Além disso, o fator de libera
muda o comportamento do ribossomo. Em vez de ficar simplesmente
mARN, esperando que o fator de liberação se mova, o ribossomo cor
separa a cadeia completada depeptídeos da molécula tARN final, a qual ain
está ligado, e a proteína flutua livre e entra na solução. O ribossomo inat
dissocia-se em seguida do mARN, flutua para longe e está livre para mi
outra rodada de síntese de proteína.
Outros fatores, numerosos demais para mencionar neste curto esboç
são também necessários a um sistema funcional de tradução. Eles inciu
as enzimas que inserem quimicamente o aminoácido correto no tAl
correio, vários mecanismos para "conferir" a tradução, e o papel da ener
química, sob a forma do nucleotídeo ativado gtp, em todas as etapas
tradução. Não obstante, esse esboço pode dar ao leitor uma ideia doprocess
através do qual a informação genética é transmitida e também uma noç
da complexidade envolvida na transmissão.
replicaçâo do adn
Chega um momento na vida de toda célula em que ela começa a pensar e
divisão. Uma das considerações importantes nessa divisão é assegurar qi
a informação genética seja copiada e passada adiante sem falha, e ir
bocado de esforço é investido nessa tarefa. '
Em 1957, Arthur Komberg demonstrou que uma certa enzima po
polimerizar as formas ativadas de deoxinucleotídeos e transformá-las a
uma nova molécula de adn, que era uma cópia exata de qualquer "mold
de adn que ele introduzia na mistura da reação. Ele denominou a enzifl
de polimerase l do adn. A comunidade científica ficou extasiada comi
descoberta. Com o passar dos anos, contudo, foi demonstrado que o pap
principal da polimerase l não é sintetizar o adn durante a divisão da célut
mas sim reparar o adn que foi danificado por exposição à luz ultraviold
a mutágenos químicos ou outras agressões ambientais. Mais tarde, foral
descobertas duas outras polimerases do adn, a Pol ir e a Pol liï. O papel"Í
Pol u permanece obscuro: células mutantes que carecem da enzima BE
APÊNDICE 275
exibem defeitos observáveis. A Pol 111 foi identificada como a principal
1 enzima envolvida na replicação do adn em procarióticas.
i Apolimerase III do adn é, na realidade, um complexo de sete subuni-
Idades diferentes, variando em comprimento de trezentos a cerca de 1.100
resíduos de aminoácidos. Apenas uma das subunidades participa da ligação
química concreta de nucleotídeos; as outras comparecem em funções
acessórias de importância crítica. As subunidades polimerizantes, por
exemplo, tendem a se desprender do molde do adn, após ligar-se a apenas
dez a quinze nucleotídeos. Se isso acontecesse na célula, a polimerase teria
que voltar atrás centenas de milhares de vezes, antes de a replicação ser
completada, atrasando-a enormemente. Não obstante, a Pol m completa
com todas as sete subunidades só se desprende depois que todo o
ADN-molde (que pode ter uma extensão de mais de um milhão de pares de
bases) é copiado.
Além de uma atividade polimerizante, a Pol m desempenha, ironica-
mente, uma atividade de nuclease 3' -» 5'. Isso significa que pode degradar
adn polimerizado e transformá-lo em nucleotídeos livres, iniciando-se em
uma extremidade 3' livre e trabalhando de frente para trás na direção da
extremidade 5'. Agora, por que uma polimerase degradaria também o adn?
Acontece que a atividade de nuclease do Pol Hl é muito importante para
assegurar a precisão do procedimento de cópia. Suponhamos que o nucleo-
tídeo errado se incorporasse à cadeia crescente do adn . Afunção de nuclease
do Pol in permite que ela volte atrás e remova o nucleotídeo incorreto e mal
emparelhado. Nucleotídeos corretamente emparelhados são resistentes à
atividade de nuclease. Essa atividade é denominada de "conferência de
prova tipográfica". Sem ela, milhares de vezes mais erros se insinuariam
quando o adn fosse copiado.
A replicação começa em uma certa sequência do adn, conhecida apro-
priadamente como "origem da replicação", e prossegue em ambas as
direções imediatamente, ao longo do adn parental. A primeira tarefa a ser
abordada durante a replicação, como no caso da cópia, é a separação dos
dois fios do adn parental. Este é o trabalho da proteína DnaA. Depois de
separados os fios, duas outras proteínas, denominadas DnaB e DnaC, se
ligam aos fios separados. Mais duas proteínas são recrutadas para a "bolha"
crescente do adn aberto: proteína de ligação de fio único (ssb), que mantém
os dois fios do adn parental separados, enquanto o adn é copiado; e a girase,
que desembaraça os nós que ocorrem enquanto o complexo se desenvolve
através do adn de dois fios.
Nessa altura, a polimerase do adn pode iniciar a síntese. Surgem, porém,
vários problemas. A polimerase do adn não pode iniciar a sintetização
276 A CAIXA PRETA DE DARWIN
ligando dois nucleotídeos da mesma maneira que a polimerase do arn
a cópia; a enzima do adn só pode adicionar nucleotídios à extremid;
um polinucleotídio existente. Em vista disso, a célula emprega outra ei
para fabricar uma curta extensão de arn no molde exposto do adn.
enzima pode iniciar a síntese do arn a partir de dois nucleotídeos. Log
a cadeia do arn alcança a extensão de dez nucleotídeos, a polimera
adn pode usar o arn como "espoleta", adicionado desoxinucleotídeos
extremidade.
O segundo problema ocorre quando se abre a "forquilha" da replici
A síntese de um fio do novo adn pode prosseguir sem dificuldade. E
o fio que a polimerase fabrica enquanto lê o molde na direção 3' -
criando um novo fio na direção 5' -» 3', como fazem todas as polimer
Mas de que maneira sintetizar o segundo fio? Se feito diretamen)
polimerase teria que ler o molde em uma direção 5' - 3' e, dessa man
sintetizar o novo fio numa direção 3' -» 5'. Embora não haja razão ta.
por que isso não poderia ocorrer, nenhuma polimerase conhecida sinti
na direção 3' * 5'. Em vez disso, depois de ter sido aberta uma extei.
de adn, uma espoleta arn é fabricada perto da forquilha e a síntese do y
prossegue de frente para trás, para longe da forquilha de replicação, em l
direção 5' -» 3'. Síntese ulterior nesse fio "atrasado" terá que esperar,
que a forquilha de replicação abra outro trecho do adn; outra espoleta
arn tem que ser feita e a síntese do adn continua de frente para trás
direção do fragmento previamente sintetizado. As espoletas de arn têm
ser então removidas, preenchidos os espaços com adn, e "costura
juntas" as extremidades das peças do adn. Essa operação requer vár
enzimas mais.
A descrição da replicação do adn de uma procariótica foi tom
possível pêlos enormes esforços de inúmeros laboratórios. A replicação
adn de eucarióticas é muito mais complexa e, por isso mesmo, se conh
muito menos a esse respeito.
1. Cameron, A.G.W. (1988), "Origin of the Solar System", Amuai Review of
Astronomy andAstrophysics, 26, p.441-72.
2. Johnson, P.E. (l 991), Darwin on Trial, Regnery Gateway, Washington, DC, Cap.
5; Mayr, E. (1991), One Long Argument, Harvard University Press, Cambridge, ma,
p.35-9.
1. Por bioquímica entendo todas as ciências que estudam a vida no nível molecular,
mesmo que a ciência seja praticada em disciplinas com outros nomes, tais como
biologia molecular, genética ou embriologia.
2. O esboço biográfico aqui apresentado baseia-se principalmente em Singer, C.
(1959), A History ofBiology, Abelard-Schuman, Londres. Fontes adicionais incluem
Taylor, G.R. (1963), The Science ofLife, McGraw Hill, Nova York; e Magner, L.N.
(1979), A History ofthe Life Sciences, Mareei Dekker, Nova York.
3. Descrito em Weiner, l. (1994), TheBeak ofthe Finch, Vintage Books, Nova York.
4. Darwin, C. (l 872), Origin ofSpecies, 6a. ed. (l 988), New York University Pr
ess,
Nova York, p. 151.
5. Um bom resumo da bioquímica da visão pode ser encontrado em Deviin, T.M.
(1992), Textbook ofBiochemistry, Wiley-Liss, Nova York, p.938-54.
6. Como, por exemplo, os esperados padrões resultantes de eventos de formação
de espécies que ocorreram em populações isoladas.
7. Farley, J. (1979), The Spontaneous Generation Controversy from Descartes to
Oparin, Johns Hopkins University Press, Baltimore, p.73.
8. Mayr, E. (1991), One Long Argument, Harvard University Press, Cambridge,
MA, Cap.9.
l. Mann, C. (1991), "Lynn Margulis: Science's Unruly Earth Mother", Science,
252, p.378-81.
278 A CAIXA PRETA DE DARWIN
2. Eldredge, N. (l 995), Reinventing Darwin, Wiley, Nova York, p. 95.
3. Eldredge, N. e S.J. Gould (1973), "Punctuated Equilibria: An Altemative te
Phyletic Gradualism", in Modeis in Paleobiology, org. T.J.M. Schopf, Freeman
Cooper and Co., São Francisco, p.82-115.
4. Beardsley, T, "Weird Wonders: Was the Cambrian Explosion a Big Bang or a
'WïmpeT?",ScientificAmerican, junho 1992, p.30-1.
5. Ho, M.W. e P.T. Saunders (1979), "Beyond Neo-Darwinism An Epigenetk
Approach to Evolution", Journal of Theoretical Biology 78, p.589.
6. McDonald, J.F. (1983), "The Molecular Basis ofAdaptation",Awii(o?evíeH'o)
Ecology and Systematics 14, p.93.
7. Miklos, G.L.G. (1993), "Emergence of Organizational Complexities During
Metazoan Evolution: Perspectives from Molecular Biology, Paleontology and Neo-
Darwinism", Memoírs ofthe Association ofAustralasian Paleontologists, 15, p.28.
8. Orr, H.A. e J.A. Coyne (1992), "The Genetics ofAdaptation: A Reassessment",
American Naturalist, 140, p.726.
9. Endier, J.A. e T. McLelIan (1988), "The Process of Evolution Toward a Newer
SynÏhesis",AnnualReviewofEcology and Systematics, 19, p.397.
10. Yockey, H. (1992), Information Theory and Molecular Biology, Cambridge
University Press, Cambridge, Inglaterra, Cap.9.
11. Kaplan, M. (1967), "Welcome to Participants", in Mathematical Challenges to
the Neo-Darwinian Interpretation of Evolution, org. P.S. Moorhead e M.M. Kaplan,
Wistar Institute Press, Filadélfia, p.vii.
12. Schützenberger, M.P. (1967), "Algorithms and the Neo-Darwinian Theory of
Evolution", in Mathematical Challenges to the Neo-Darwinian Interpretation of
Evolution, org. P.S. Moorhead e M.M. Kaplan, Wistar Institute Press, Filadélfia, p
.75;;
13. Kauffman, S. (1993), The Origins ofOrder, Oxford University Press, Oxfordj
Inglaterra, p.xiii.
14. Smith, J.M. (l 995), "Life at the Edge of Chãos?", New YorkReview, 2 de marçoj
p.28-30. S
15. Mivart, St. G. (1871), On the Génesis ofSpecies, Macmilian and Co., LondreS(
p.21. ,
16. Aneshansley, D.J., T. Eisner, J.M. Widom e B. Widom (l 969), "Biochemistrj|
at 100" C: Explosivo Secretory Discharge of Bombardier Beeties", Science, 165, p
.6ïJ
Crowson, R.A. (1981), The Biology of the Coleoptera, Academic Press, Nova Yóri
Cap.15. |
17. Hitching, F. (1982), The Neck ofthe Giraffe, Pan, Londres, p.68. |
18. Dawkins, R. (1985), The Blind Watchmaker, W.W. Norton, Londres, p.86-7. l
19. Eisner, T., A.B. Attygalle, M. Eisner, D.J. Aneshansley e J. Meinwaid (1991)
"Chemical Defense ofa Primitive Australian Bombardier Beetie (Carabidae); Myi
tropomus regularis", Chemoecology, 2, p.29. ;
20. Eisner, T, G.E. Bali, B. Roach, D.J. Aneshansley, M. Eisner, C.L. Blankespoa
e J. Meinwaid (l 989), "Chemical Defense ofan Ozanine Bombardier Beetie fromNCT
Guinea",Psycie,96,p.l53. j
21. Hitching, p.66-7. i,
22. Dawkins, p.80-1.
23. Dawkins, p.85-6. |
NOTAS 279
24. Darwin, C. (l 872), Origin ofSpecies, 6a. ed. (l 988), New York University P
ress,
NovaYork,p.l54.
25. Dawkins, R. (1995), River Out ofEden, Basic Books, Nova York, p.83.
1. Uma boa introdução geral ao estudo dos cílios pode ser encontrada em Voet, D.,
e Voet, J.G. (WS), Biochemistry, 2a. ed., John Wiley and Sons, Nova York, p.1.25
3-9.
2. Há ainda outros conectores nesse sistema. Os contatos que o braço da dineína
estabelece com o microtúbulo, por exemplo, servem também como conectores.
Conforme mencionado antes, um sistema pode ser mais complexo que o sistema mais
simples imaginável, e o cílio é um exemplo de tal sistema.
3. Cavalier-Smith, T. (1978), "The Evolutionary Origin and Phylogeny of Micro-
tubules, Mitotic Spindies, and Eukaryote YïageWyBioSystems, W, p.93-114.
4. Szathmary, E. (1987), "Early Evolution of Microtubules and Undulipodia",
BioSystems, 20, p.l 15-31.
5. Bermudes, D., L. Margulis e G. Tzertinis (1986), "Prokaryotic Origin of
Undulipodia", Annals ofthe New York Academy ofScience, 503, p. 187-97.
6. Cavalier-Smith, T. (l 992), "The Number of Symbiotic Origins of Organelles",
BioSystems, 28, p.91-106; Margulis, L. (1992), "Protoctists and Polyphyly: Comme
nt
on 'The Number of Symbiotic...' by T. Cavalier-Smith", BioSystems, 28, p.107-8.
7. Uma busca no Science Citation índex revela que cada trabalho recebe em média
menos de uma citação por ano.
8. Uma boa introdução geral aos flagelos é encontrada em Voet e Voet, p. l.259-60.
Maiores detalhes sobre o motor flagelar podem ser encontrados nas seguintes font
es:
Schuster, S.C., e S. Khan (l 994), "The Bactéria! Flagellar Motor", Annual Review
of
Biophysics and Biomolecular Structure, 23, p.509-39; Caplan, S.R., e M. Kara-Iva
nov
(1993), "The Bacterial Flagellar Motor", International Review of Cytology, 147,
p.97-164.
9.VoeteVoet,p.l260.
Capítulo 4
1. Uma boa introdução geral à coagulação sanguínea pode ser encontrada em Voet,
D., e Voet, J.G. (1995), Biochemistry, John Wiley & Sons, Nova York, p.l.196-207
.
Para descrições mais detalhadas, ver qualquer uma das seguintes fontes: Furie, B.,
e
B.C. Furie (1988), "The Molecular Basis ofBlood Coagulation", Ce, 53, p.505-18;
E. W. Davie, K. Fujikawa e W. Kisiel (1991), "The Coagulation Cascade: Initiatio
n,
Maintenance, and Regulation", Biochemistry, 30, p.l.363-70; Halkier, T. (1991),
Mechanisms m Blood Coagulation, Fibrinolysis and the Complement System, Cam-
bridge University Press, Cambridge, Inglaterra.
2. O sufixo génio designa o progenitor inativo de uma molécula ativa.
3. A palavra fator é frequentemente usada em pesquisas quando não se conhece
com certeza a natureza de uma substância sob estudo seja ela proteína, gordura,
carboidrato ou outras. Mesmo depois de esclarecida a identidade, contudo, o velh
o
nome continua às vezes a ser usado. Na via da coagulação sanguínea todos os
"fatores"
são proteínas.
280 A caixa PRETA DE DARWIN
4.0 gene é uma parte do adn que instrui a célula sobre como fabricar uma proteína
5. Doolittie, R.F. (1993), "The Evolution ofVertebrate Blood Coagulation: ACaa
of Yin and Yang", Thrombosis and Haemostasis, 70, p.24-8.
6. As proteínas que participam da coagulação sanguínea são freqüentementi
identificadas com algarismos romanos, tais como Fator v e Fator Viu. Doolittie u
sa ess;
terminologia em seu artigo publicado na Thrombosis aiid Haemostasis. Por questão d
l
clareza e coerência, usei na citação os nomes comuns das proteínas.
7. O tpa tem um total de cinco domínios. Dois deles, contudo, são do mesmo tipo
8. As probabilidades não são diminuídas se os domínios são encadeados juntos en
ocasiões diferentes com os domínios l e 2 reunindo-se em um evento, e o domínio
3 reunindo-se mais tarde a eles, e assim por diante. Pense nas probabilidades de
pegai
quatro bolas pretas em um barril contendo bolas pretas e brancas. Se tiramos ime
dia-
tamente quatro, ou duas na primeira tentativa e uma em cada das duas tentativas
seguintes, as probabilidades de terminar com quatro bolas pretas são as mesmas.
9. Esse cálculo é extremamente generoso. Supõe, nada menos, que os quatro tipo'
de domínios teriam que estar na ordem linear correia. A fim de funcionar, porém, a
combinação teria que estar localizada em uma área ativa do genoma, os sinais
correios
para ligar as partes teriam de estar instalados, as sequências de aminoácidos dos
qu
atrc
domínios teriam que ser compatíveis entre si, além de outras considerações que
afetariam o resultado. Essas considerações ulteriores tomam o evento ainda mais
improvável.
10. É bom manter em mente que um "passo" poderia muito bem ser de milhares de
gerações. Uma mutação tem que começar em um único animal e, em seguida,
espalhar-se através da população. Para isso, os descendentes do animal mutante têm
que substituir todos os outros animais.
1. Alberts, B., D. Bray, J. Lewis, M. Raff, K. Roberts e J.D. Watson (1994),
Molecular Biology ofthe Ce, 3a ed., Garland Publishing, Nova York, p.556-7.
2. Komfeld, S., e W.S. SIy (1995), "1-CeII Disease and Pseudo-Hurler Polydys-
trophy: Disorders of Lysosomal Enzyme Phosphorylation and Localization", in The
Metabolic and Molecular Bases of Inherited Disease, Jd., org. C.R. Scriver, A.L
Beaudet, W.S. Sly e D. Valle, McGraw-Hill, Nova York, p.2.495-508.
3. Pryer, N.K., L. J. Wuestehube e R. Schekman (1992), "Vesicle-Mediated Proteja
Sorting", Annual Review ofBiochemistry, 61, p.471-516.
4. Roise, D., e M. Maduke (1994), "Import of a Mitochondrial Presequence into R
Denitrifícans", FEBS Letters, 337, p.9-13; Cavalier-Smith, T. (1987), "The Simui»
neous Symbiotic Origin of Mitochondria, Chioroplasts and Microbodies", Annals of
lhe New York Academy of Science, 503, p.55-71; Cavalier-Smith, T. (1992), "The
Number of Symbiotic Origins of Organelles", BioSystems, 28, p.91-106; Harti, R,
J;
Ostermann, B. Guiard e W. Neupert (l 987), "Successive Translocation into and ou
tof
the Mitochondrial Matrix: Targeting of Proteins to the Inner Membrane Space by l
Bipartite Signal Peptide", Cell, 51, p.1.027-37.
'
5.Albertsetal.,p.551-651. i

1. Boas introduções ao sistema imunológico podem ser encontradas nas seguintes


fontes: Voet, D., e J.G. Voet (1995), Biochemistry, 2., John Wiley & Sons, Nova
York, p.l.207-34; e Alberts, B., D. Bray, J. Lewis, M. Raff, K. Roberts e J.D. W
atson
;1994), Molecular Biology ofthe Cell, 3'ed., Garland Publishing, Nova York, cap.
23.
2. As células são na realidade denominadas células b, porque foram descobertas na
Bursa fabricius de aves.
3. Acélula tem enormes problemas para colar peças de genes entre si empregando
ama maquinaria muito complexa que deve alinhar devidamente as extremidades e
;osturar juntas as peças. Exceto no caso de genes de anticorpos, contudo, a razão
po
r
:|ue existem "genes interrompidos" continua a ser um mistério.
4. Exceto pelas células que fabricam classes especiais de anticorpos, não
discutire-
nos mais aqui essa complicação.
5. Baril, S., D. Baltimore e I.L. Weissman (1994), "Molecular Evolution of the
vertebrate Immune System", Proceedings of the National Academy ofSciences, 91,
3.10.769-70.
6. Farries, T.C., e J.P. Atkinson (1991), "Evolution of the Complement System",
mmunology Today, 12, p.295-300.
7. Os exemplos incluem: DuPasquier, L. (1992), "Origin and Evolution of the
vertebrate Immune System", apmis, 100, p.383-92; Stewart, J. (l 994), The Primor
dial
VRM System and the Evolution ofVertebratelmmunity,'R..G.Lwdes Co., Austin;Sima,
P. e V. Vetvicka (1993), "Evolution of Immune Reactions", Criticai Reviews m
'mmunology, 13, p.83-114.
1. O arn é constituído de quatro nucleotídeos: a, C, G e u.
2. Várias outras simplificações serão usadas. Os átomos de hidrogénio das molé-
;ulas não serão discutidos nem indicados na Figura 7-1. Os átomos de hidrogénio, na
naior parte, simplesmente acompanham outros átomos na síntese do amp, de modo
w não é realmente necessário dar atenção aos mesmos para expor a ideia. Além disso,
aços duplos e simples tampouco serão diferenciados aqui, uma vez que estamos
nteressados apenas em conectividade.
3. Zubay, G., W.W. Parson, e D.E. Vance (W5),Principles of Biochemistry, Wm.C.
3rown Publishers, Dubuque, ia, p.215-6.
4. Embora se pensasse anteriormente que essa etapa não exigiria o atp, trabalhos
nais recentes demonstraram que o atp é necessário para que a reação ocorra em
:oncentrações fisiológicas de bicarbonato. Voet, D., e J.G. Voet, 1995.
Biochemistry,
ïd., John Wiley & Sons, Nova York, p.800.
5. Hall, R.H. (1971), The Modified Nucleosides m Nucleic Acids, Columbia
Jniversity Press, Nova York, p.26-9.
6. Oro, J. (1961), "Mechanism of Synthesis of Adenine from Hydrogen Cyanide
JnderPlausible Primitive Earth Condiiions",Vaftwe, 191, p.1.193-4. Deve-se mante
r
:m mente que só a base adenina é fabricada pelas reações de amónia e cianeto de
lidrogênio. O nucleotídeo amp seria muito difícil de se produzir em condições
plausíveis na Terra primitiva, conforme notado em Joyce, G.F. (l 989), "rna Evolut
il
and the Origins ofLife", Nature, 338, p.217-24.
7. Citado em Joyce, G.F., e L.E. Orgel, 1993, "Prospeets for Understanding tu
Origin of the rna Worid", in The rna Worid, org. R.F. Gesteland e J.F. Atkins, C
ol
Spring Harbor Laboratory Press, Cold Spring Harbor, NY, p. 18.
8. Exceto peia degradação do ATP, que deve ser primeiro fabricado com AMP,
9. Creighton, T. (1993), Proteins: Structure and Molecular Properties, W.H. Frei
man and Co., Nova York, p. 131.
10. Alberts, B., D. Bray, J. Lewis, M. Raff, K. Roberts e J.D. Watson (1994
Molecular Biology ofthe Ce, 3eü., Garland Publishing, Nova York, p.l4.
11. Perris, J.P. e W.J. Hagan (1984), "hcn and Chemical Evolution: The Possiblt
Role of Cyano Compounds in Prebiotic Synthesis", Tetrahedron, 40, p.l.093-120
Deve-se manter em mente que os compostos descritos nesse trabalho não têm a
fundação anexada.
12. Bloom, A. (1987), The Closing of the American Mind, Simon and Schuster
Nova York, p. 151.
13. Horowitz, N.H. (1945), "On the Evolution ofBiochemica] Syntheses", Procee
dingsoftheNationalAcademyofSciences, 31, p. 153-7.
14. Para manter coerência com outras descrições, mudei as letras A e D no trabalho
de Horowitz.
15. Kauffman, S. (1993), The Origins ofOrder, Oxford University Press, Nova
York, p.344.
16. Smith, J.M. (l 995), "Life at the Edge ofChaos?",A'ew YorkReview, 2 de março
p.28-30.
Capítulo 8
1. Pensa-se agora que a atmosfera da Terra primordial era muito diferente do que
supôs Millere, portanto, muito menos provável que produzisse aminoácidos mediante
processos atmosféricos.
2. Dose, K. (1988), "The Origin ofLife: More Questions than Answers", Interdis-
ciplinary Science Reviews, 13, p.348.
3. Shapiro, R. (1986), Origins: A Skeptic's Cuide to the Creation ofLife on Eart
h,
Summit Books, Nova York, p. 192.
4. Cech ganhou o prémio Nobel por seus trabalhos. A citação que acompanhou o
prémio aludiu ao impacto de sua obra sobre os estudos relativos à origem da vida. O
próprio Cech, contudo, raramente menciona a origem da vida em conexão com seu
trabalho.
5. Joyce, G.F. e L.E. Orgel (1993), "Prospeets for Understanding the Origin ofth
e
rna Worid", in The rna Worid, org. R.F. Gesteland e J.F. Atkins, Cold Spring Har
bor .
Laboratory Press, Cold Spring Harbor, ny, p. 19.
6. Joyce e Orgel, p. 13.
7. Embora numerosas declarações nos livros e revistas da comunidade científica
sejam pessimistas, declarações públicas à mídia tendem a ser do tipo a-situação-
está-
sob-controle. John Angus Campbell, professor de retórica da Universidade de Mem-
phis, observou que "enormes edifícios de ideias como o positivismo nunca
desabam de fato. Pensadores gradualmente os abandonam e mesmo os ridicularizam '
:
NOTAS 283
entre si, mas mantêm as partes convincentemente úteis para amedrontar os desinfor-
mados." Campbell, J.A. (1994), "The Comic Frame and the Rhetoric of Science:
Epistemology and Ethics in Darwin's Origin", Rhetoric Society Quarterly, 24, p.2
7-50.
Essas palavras certamente se aplicam à maneira como a comunidade científica lida
com as questões sobre a origem da vida.
8. Schiesinger, G. e S.L. Miller (1983), "Prebiotic Syntheses in Atmospheres
Containing CH4, CO, and COz", Journal of Molecular Evolution, 19, p.376-82.
9. Niketic, V., Z.D. Draganic, S. Neskovic, S. Jovanovic e I.G Draganic (1983),
"Radiolysis of Aqueous Solutions of Hydrogen Cyanide (pH6): Compounds of Interes
t
in Chemical Evolution Studes",JournalofMolecular Evolution, 19, p.184-91.
10. Kolb, V.M., J.P. Dworkin e S.L. Miller (1994), "Altemative Bases in the rna
Worid: The Prebiotic Synthesis of Urazole and Its Ribosides", Journal ofMolecula
r
Evolution, 38, p.549-57.
11. Hill, A.R., Jr., L.D. Nord, L.E. Orgel e R.K. Robins (1989), "Cyclization of
Nucleotide Analogues as an Obstacle to Polymerization", Journal of Molecular
Evolution, 28,p.l70-l.
12. Nguyen, T. e T.P. Speed (1992), "A Derivation of Ali Linear Invariants for a
Nonbalanced Transversion Model", Journal of Molecular Evolution, 35, p.60-76.
13. Adell, J.C. e S. Dopazo (1994), "Monte Cario Simulation in Phylogenies: An
Appiication to Test the Constancy of Evolutionary Rates", Journal o f Molecular
Evolution, 38, p.305-9.
14. Otaka, E. e T. Ooi (1987), "Examination ofProtein Sequence Homologies: IV.
Twenty-Seven Bacterial Ferredoxins", Journal of Molecular Evolution, 26, p.257-6
8.
15. Alexandraki, D. e J. V. Rudennan (1983), "Evolution ofa-and p-Tubulin Genes
as Inferred by the Nucleotide Sequences of Sea Urchin cdna Clones", Journal of
Molecular Evolution, 19, p.397-410.
16. Kumazaki, T, H. Hori e S. Osawa (1983), "Phylogeny ofProtozoa Deduced
from 5s rRNA Sequences", Journal of Molecular Evolution, 19, p.411-9.
17. Wagner, A., F. Deryckere, T. McMorrow e F. Gannon (1994), "Tail-to-Tail
Orientation ofthe Atlantic Salmon Alpha-and Beta-Globin Genes", Journal ofMole-
cular Evolution, 38, p.28-35.
18. Na verdade, algumas proteínas que discutimos neste livro têm sequências ou
formas semelhantes às de outras proteínas. Os anticorpos, por exemplo, têm o
formato
parecido com o de uma proteína denominada superóxido dismutase, que ajuda a
proteger a célula contra danos provocados pelo oxigénio. E a rodopsina, que é usada
na visão, é semelhante a uma proteína encontrada em bactérias, denominada
bacterior-
rodopsina, que participa da produção de energia. Ainda assim, as semelhanças nada
nos dizem sobre a maneira como a visão ou o sistema imunológico poderiam desen-
volver-se em etapas.
Seria de se esperar que proteínas com sequências semelhantes levassem à cons-
trução de modelos que explicassem como sistemas bioquímicos complexos poderiam
ter se desenvolvido. De forma oposta, o fato de que essas comparações de sequências
não nos ajudam a compreender as origens de sistemas bioquímicos complexos milita
fortemente contra a teoria da evolução gradual.
19. Incluí nesta categoria trabalhos que são listados nos índices de revistas sob
os
títulos "Evolução molecular", "Evolução de proteínas" e alguns tópicos variados.
20. Kimura, M. (1983), The Neutral Theory ofEvolution, Cambridge University
Press, Nova York.
21. Kauffman, S.A. (1993), The Origins ofOrder: Self-Organízation and Selection
in Evolution, Oxford University Press, Nova York.
22. Selander, R.K., A.G. Clark e T.S. Whittam (l 991), Evolution at the Molecula
r
Levei, Sinauer Associates, Sunderland, MA.
23. Cold Spring Harbor Symposia on Quantitative Biology (1987), vol. 52, Evolu-
tion ofCatalytic Function, Cold Spring Harbor Laboratory Press, Cóld Spring Harbor
,
NY.
24. Lehninger, A.L. (1970), Biochemistry, Worth Publishers, Nova York, p.l7.
25. Lehninger, A.L., D.L. Nelson e M.M. Cox (1993), Principies o f Biochemistry,
ld., Worth Publishers, Nova York, p.viii.
26. Lehninger et ai. (1993), p.244.
27. Conn, E.E., P.K. Stumpf, G. Bruening e R.H. Dói (l 987), Outiines of Biochemis
-
try, Sd., John Wiley & Sons, Nova York, p.4.
28. Voet, D. e J.G. Voet (1995), Biochemistry, fed., John Wiley & Sons, Nova
York, p. 19.
29. Para seu crédito, o texto de Voet e Voet contém, no início da discussão padrão,
um repúdio ao cenário Staniey Miller, no qual diz que há "objeções científicas
válidas
l Capítulo 9
i
1. Kauffman, S.A. (1991), "Antichaos and Adaptation", Scientific American, agos-
to, p.82.
2. Kauffman, S.A. (l 993), The Origins ofOrder, Oxford University Press, Oxford,
Inglaterra.
3. A detecção de planejamento em padrões tipo cara-coroa e outros sistemas que
não interagem fisicamente é feita de outras maneiras. Ver Dembski, W. (1996), The
Design Inference: Eliminating Chance Through Small Probabilities, dissertação de
doutorado, Universidade de Ulinois.
4. Esta é uma questão de juízo de valor. Jamais poderemos provar que uma dada
função é a única que poderia ser intencional ou que e mesmo intencional. Nossa
prova, ainda assim, pode tomar-se muito convincente. :
5. É difícil quantificar planejamento, mas não impossível, e pesquisas futuras
deveriam ser feitas nesse sentido. Uma partida excelente foi dada porBill Dembsk
i em '
sua dissertação (Dembski, 1996), que tenta quantificar a inferência de planejamento
;
em termos do que ele chama de "recursos probabilísticos" de um sistema.
6. Dawson, KM., A. Cook, J.M. Devine, R.M. Edwards, M.G. Hunter, R.H. Raper J
e G. Roberts (l 994), "Plasminogen Mutants Activated by Thrombin", Journal of |
Biological Chemistry, 269, p. 15.989-92. S
7. Resenhado em Gold, L-, B. Polisky, O. Uhienbeck e M. Yarus (1995), "Diversity
ofOligonucleotide Vmcüons", Annual Reviewof Biochemistry, 64, p.763-97.
8. Joyce, G.F. (l 992), "Directed Molecular Evolution", Scientific American, dez
em-
bro, p.90.
9. Benkovic, S.J. (l 992), "Catalytic Antibodies", Annual Review of Biochemistry
,:
61, p.29-54.
NOTAS 285
Capítulo 10
1. Citado em Barrow, J.D., e F.J. Tipler (1986), The Anthropic Cosmological
Principie, Oxford University Press, p.36.
2. Barrow e Tipler, p.36.
3. Paley, W., Natural Theology, American Tract Society, Nova York, p.9-10.
4. Dawkins, R. (1985), TheBlind Watchmaker, W.W. Norton, Londres, p.5.
5. Paley, p.l 10-1.
6. Paley, p. 199-200.
7. Paley, p.l 71-2.
8. Paley, p. 184-5.
9. Dawkins, p.5.
10. Dawkins, p.6.
11. Sober, E. (1993), Philosophy ofBiology, Westview Press, Boulder, Co., p.34.
12.Sober,p.34-5.
13. Sober, p.35.
14. Sober, p.37-8.
15. Shapiro, R. (1986), Origins: A Skeptic's Cuide to the Creation ofLife onEarf
h,
Summit Books, Nova York, p.179-80.
16. Miller, K.R. (1994),"Life'sGrandDesign", TechnologyReview, fevereiromar-
ço, p.29-30.
17. Dyson, J.F. (1966), "The Search for Extraterrestrial Technology", in Pers-
pectives in Modern Physics, org. R.E. Marshak, John Wiley and Sons, Nova York,
p.643-4.
18. Crick, F.H.C., e L.E. Orgel (1973), "Directed Panspermia", ícarus, 19, p.344.
19. Futuyma, D. (1982), Science on Trial, Pantheon Books, Nova York, p.207.
20. Miller, p.31-2.
21. Miller, p.32.
22. Gould, S.J. (1980), The Pandas's Thumb, W.W. Norton, Nova York.
|
;°;
Capítulo 11 |
1. Shapiro, R. (l 986), Origins: A Skeptic's Cuide to the Creation ofLife on Ear
th, |
Summit Books, Nova York, p.l 30.
B
2. O ensaio de Dickerson pode ser encontrado na Journal of Molecular Evolution,
|
34, p.277 (1992), e no Perspectives on Sclence & Christian Faith, 44, p.137-8 (1
992).
3. A regra reformulada é basicamente idêntica ao que um filósofo peripatético da
|
ciência chamado Michael Ruse disse que eram as características definidoras da
ciência
|
durante o julgamento de 1981 para determinar a constitucionalidade da lei "Trata
mento j
Equilibrado para a Ciência da Criação e a Ciência da Evolução", do estado de
Arkansas.
|
A decisão do juiz William Overton, declarando a lei inconstitucional, fundamentou-
se |
bastante nas ideias de Ruse. A decisão, no entanto, foi violentamente criticada co
mo |
inepta por outros filósofos da ciência. Muitos e relevantes documentos do processo
§
foram reunidos em Ruse, M., (org.) (1988), But [s It Science?, Prometheus Books,
j
Buffalo, ny.
l
236 A caixa PRETA DE DARWIN
O juiz Overton, repetindo os argumentos de Ruse, escreveu que: "l) A ciência é ,
orientada pela lei natural; 2) Tem que ser explicativa, com referência à lei
natural
; i
3) Pode ser submetida a teste em comparação com o mundo empírico; 4) As conclusões
j
são provisórias, isto é, não constituem necessariamente a palavra final; e 5) E
falsifí-
cável (depoimento de Ruse e de outras testemunhas da ciência)." A decisão de
Overton
foi recebida com desprezo por outros filósofos da ciência. Philip Quinn, por
exemplo
,
escreveu: "As ideias de Ruse não representam um consenso firme de opinião entre os
filósofos da ciência. Pior ainda, algumas delas são evidentemente falsas e algumas
se
|
baseiam em argumentos falaciosos" (in Ruse, 1988, p.384). Larry Laudan listou J
consecutivamente os problemas: "Algumas teorias científicas são bem testadas;
outras
j
não. Alguns ramos da ciência demonstram atualmente alta taxa de crescimento; i
outros não. Algumas teorias científicas fizeram grande número de prognósticos
bem- ,
sucedidos sobre fenómenos surpreendentes; outras, poucos, se é que algum. Algumas
hipóteses científicas são adhoc; outras não. Algumas conseguiram uma 'concordância
de induções'; outras, não" (in Ruse, 1988, p.348). Laudan citou numerosas exceções
à opinião de Overton: "Esse requisito (de explicação através de lei natural) é um
padrão
inteiramente impróprio para verificar-se se uma alegação é científica. Durante
séculos,
cientistas reconheceram uma diferença entre provar a existência de um fenómeno e a
explicação do mesmo de uma forma legítima... Galileu e Newton assumiram a
responsabilidade de provar a existência de fenómenos gravitacionais, muito antes de
alguém ser capaz de dar uma definição causal ou explicativa da gravitação. Darwin
assumiu a responsabilidade de provar a existência da seleção natural quase meio
século
antes de os geneticistas serem capazes de formular as leis da hereditariedade, d
as quais
dependia a seleção natural" (in Ruse, 1988, p.354). Laudan não viu motivo para
sentir-se satisfeito: "A vitória no processo de Arkansas foi vazia, pois conseguid
a
apenas às expensas da perpetuação e canonização de um falso estereótipo do que a
ciência é e como funciona" (in Ruse, 1988, p.355).
4. Claro, o fato de "evolução" e "religião" serem compatíveis depende da maneira
como cada um as define. Se o indivíduo assume a posição de que a evolução ocorreu
não só exclusivamente por lei natural, mas que o processo é "aleatório" e
"imprevisível"
em um sentido metafísico, então essa postura põe a "evolução" em curso de colisão
com muitas fés religiosas. Phillip Johnson realizou um trabalho admirável ao
apontar
as várias maneiras como a palavra evolução é usada, e como definições mutáveis
podem
confundir a discussão pública do problema. Johnson, P.E. (1991), Darwin on Trial,
Regnery Gateway, Washington, DC.
5. Simon, H. (l 990), "A Mechanism for Social Selection and SuccessfuI Altruism"
,
Science, 250, p. l. 665-8.
6. A influência das várias culturas religiosas sobre o desenvolvimento da ciência é
descrito em Jaki, S. (l 986), Science and Creation, Scottish Academic Press, Edi
mbur-
go-
: 7. A reaçâo da ciência à hipótese do Big Bang, incluindo a de
Eddington e
de outros
ilustres físicos, é relembrada por Jaki, S. (1980), Cosmos and Creator, Regnery
Gateway, Chicago.
8. Jaki, S., (1986).
9. Dawkins, R. (1986), The Blind Watchmaker, W.W. Norton, Londres, p.159.
: 10. Dawkins, R. (l 989), New York Times, 9 de abril de 1989, seç.7
, p.34.
NOTAS 287
11. Maddox, J. (1994), "Defending Science Against Anti-Science", Nature, 368,
p.185.
12. Dennett, D. (1995), Darwin 's Dangerous Idea, Simon & Schuster, Nova York,
p.515-6.
13.Dawkins,R.(1986),p.6.
1. As procarióticas podem ser divididas em duas categorias: arqueobactérias e
eubactérias. A distinção não tem interesse para a nossa finalidade, isto é,
descrever a
arquitetura interna das células.
2. Uma vez que as células são tão pequenas, vê-las requer microscópios poderosos.
A maioria das "fotos" detalhadas das células é obtida com microscopia eletrônica,
na
qual a iluminação é feita com elétrons, e não com luz.
3. Gamow, G. (1954), "Possible Relation Between Deoxyribonucleic Acid and
b
Protein Structure", Nature, 173, p.318; Gamow, G. e M. Ycas (1958), "The Crypto-
|
graphic Approach to the Problem of Protein Synthesis", in Symposium on Informati
on g
Theory in Blology, org. H.P. Yockey, R.L. Platzman e H. Quastier, Pergamon Press
, l
Nova York, p.63-9.
|
4. O problema pode ser compreendido pelo seguinte exemplo: enrole um cadarço
|
de sapato várias vezes em volta de outro e peça a alguém para segurar fortemente
nas
g
duas mãos as pontas do cadarço. Em seguida, pegue um lápis, insira-o entre os
cadarços
g
perto de uma mão e empurre o lápis na direção da outra mão. Os cadarços atrás do
lápis
f
serão, no jargão da bioquímica, "fundidos".
|
5. Palíndromo é a palavra ou frase que pode ser lida da mesma maneira da frente
|
para trás e de trás para a frente. Um exemplo seria "Roma me tem amor". Quando
|
aplicado ao ADN, palíndromo significa uma sequência de nucleotídeos que tem o
|
mesmo sentido na direção 5' -* 3' nos dois fios da hélice dupla.
|
6. A abreviação S representa unidades Svedberg, e é uma medida da rapidez com
|
que uma partícula se sedimenta em um líquido.
||
AGRADECIMENTOS
A elaboração deste livro beneficiou-se muito de conversas que tive c
várias pessoas. Numerosos agradecimentos a Tom Bethell e a Phil John
pelo estímulo e por terem mostrado a este cientista de laboratório o
fazer para conseguir publicar um livro. Sou grato a meu editor, Bi
Nichols, por ter evitado que o livro se transformasse em um texto enfado
por excesso de jargão técnico e por me ensinar a organizar as partes
argumento e toma-lo mais facilmente compreensível. Gostaria de agradi
também a Dei Ratzsch e a Paul Nelson por me ajudarem a reforç,
argumentação, guiando-me através de tantas armadilhas filosóficas qi
tas puderam identificar. Obrigado a minhas colegas da Lehigh, Li
Lowe-Krentz e Lynne Cassimeris, por conferirem os detalhes científ
contidos nos capítulos de exemplos. Sou grato também às contribuiçõe
Bill Dembski, Steve Meyer, Walter ReMine, Peter van Inwagen, E
Kenyon, Robin Coilins, Al Plantinga, John Angus Campbell e Jonal
Wells. Os pontos altos deste livro devem muito à ajuda que me deram
deficiências que permanecem são de minha total responsabilidade.
Fico feliz pela oportunidade de agradecer publicamente à minha esp
Celeste, pelo apoio e estímulo incansáveis e por ter enfrentado sozinha,
com alegria, a tarefa cansativa de correr atrás de nossos filhos enquant'
passava os fins de semana e noites na tranquilidade de meu escrito
digitando. E peço desculpas a Grace, Ben, Clare, Leo, Rose e Vincent p
passeios ao parque que não fizemos e pelo Frisbee que não jogamos. ]
isso agora vai mudar.
ÍNDICE REMISSIVO
abzima, 204-5
acelerina, 90, 94-5
ácido aspártico, 152-3
ácido fónnico, 151
ácidos nucleicos, 147,171-2, 265-8
adenina (a), 265, 267
síntese da, 155-6, 157-8
ADN,
genes de anticorpos no, 128-9,132-3
princípios bioquímicos do, 265-76
controle, 271-2
replicação, 274-6
cópia, 268-71
tradução, 273-4
mudança no, 48-50
planejamento inteligente e, 204-6
"interrompido", 134
localização do, 258
nucleotídeos do, 148, 265, 267
pseudogenes e,227-8
polimerase do arn e, 269-71
seqüenciamento do (sequência), 178-9
ligação e rearrumação do, 96-7, 132-6
estrutura celular do, 266-8
adn, polimerase do, 81-3
i (Pol i), 274
li (Pol 11), 274
iii (Pol 111), 274-5
adp, 161,162-3
agressão, ameaças de, 123-5
Alberts, Bruce, 121, 156
a-2-antiplasmina, 95, 96
a-hélice, 264
alfabeto fonético, criação do, 211-2
alienígenas, planejamento inteligente e,
249-51
lealdade à ciência, 235-7, 252-3
amina, 260-1
aminoácidos
anticorpos e, 126
como blocos de armar das proteínas,
21,59-61,96,147,259-62
categorias de, 260-1
cadeias (correntes) de, 60, 147-8
códons que designam os, 269
na pesquisa da origem da vida, 171,
172-4
propriedades de diferentes, 59-60
referências bioquímicas aos, 59-60
sequências de, 96
estrutura dos, 259-62
aminoácidos de hidrocarbonetos, 260-1
aminoácidos eletricamente carregados,
260-1
aminoácidos polarizados, 260-1
amónia, 151-3, 154
analogia com a sonda espacial, 109-14
anfifílicas, moléculas, 256
Amuai Review of Biochemistry (mis),
série de livros, 120
antennapedia, 49
anticorpos, 126-42
aminoácidos e, 126
células b e, 128-30, 132
ponto de união de, 126-9
seleção clonal e, 130-2
via-complemento e, 137-42
função dos, 126
genes dos, no adn, 128-9, 133
células t auxiliadoras, 129
aumento, 134-5
agente inteligente e, 204-6
limitações dos, 137-8
células plasmáticas, 129-30
proteínas, 132-3
arn e, 134
antitrombina, 94,101
antrópico, princípio, 248
aparelho de Golgi, 108, 113-4, 257
Aquino, são Tomás de, 245
argumento da característica inútil contra
o planejamento inteligente, 226-8
argumento da imperfeição contra o
planejamento inteligente, 223-7
Aristóteles, 17, 18
Armstrong, Frank, 185,186
ARN
anticorpo e, 133-4
classes biológicas do, 266
mensagem corrigida e editada no, 133
planejamento inteligente e, 203-5
questão da origem da vida e, 175-7
pesquisa de Cech sobre, 174-5
pesquisa de Joyce e Orgel sobre o,
175
pele e, 124-5
arn mensageiro (ctarn), 113, 265-6,
273-4
arn, polimerase do, 269-71, 273, 276
arn ribossômico (rARN), 266
arn teoria do mundo, 175
arn transportadora (tARN), 265-6, 273-4
arrestina, 30
ativação, unidade de, 139
átomos, 148, 259-62
atp, 71, 72,150,151, 161-2,163
autocatalítica, coagulação sanguínea
como, 90
autoridade, conhecimento obtido através
de, 187-8
bactérias, adn das, 266, 268
bacteriófagos,271-2
bacteriorrodopsina, 283n.l8
Baltimore, David, 142
bases, 265
besouro-bombardeiro, evolução do, 40-5,
55
P-lençol, 264
p-lençol dobrado (pregueado), 264
Big Bang, teoria do, 36-7, 246-7, 249,
252-3
biologia,
síntese evolucionista
(neodarwinismo) na, 34
micronível da, 18-20
teoria de geração espontânea e, 33
biomoléculas, 259-60
bioquímica,
evolução darwiniana e desafio à, 13,
24-5, 31-2
definição da, 13
primeiros estudos de, 20-3
do sistema imunológico, 132-6
influência da cultura no ponto de vista
evolucionista darwiniano, 183-7
planejamento inteligente, 195-6,
201-10
dificuldade em distinguir o, 208-10
macroevolução e, 24-5
microevolução e, 24-5, 204-5
máquinas moleculares e, 14-5, 59-60,
136,161-2
fenómeno molecular e, 8
estruturas multicelulares e, 54-5
mutação na, 48-9
neodarwinismo e, 34, 35
progressos desde meados da década
de 1950, 8,13, 14
geração espontânea e, 33
livros didáticos de, 183-7
da visão, 26-32
bioquímicos, princípios, 255-76
de células e membranas, 255-9
do adn, 266-76
controle, 271-2
replicação, 274-6
cópia, 268-71
tradução, 273-4
de lipídios, 268
de ácidos nucleicos, 265-8
de polissacarfdeos, 268
de proteínas, 259-65
biossíntese do amp, 147-8,149
via metabólica A-*B-»c»De,
155-60
evolução darwiniana e, 155-60, 163-5
descrição da, 148-54
planejamento inteligente e, 209
moléculas envolvidas na, 148,149
controle da, 161-3, 164
falha do, 163-4
resumido, 154
blocos de armar das células, 147-65
ver também biossíntese do amp
descrição dos, 147, 149
passos na construção dos, 148-53
Bloom, Allan, 159
Blueprintfor a Cell (de Duve), 159
bolinhas de energia, 148-50, 153, 157-8,
161-2
Bryan, William Jennings, 238
cadeia lateral, 260-1
caixa de Pribnow, 269
caixa preta
interna, 18-9
a célula como uma, 19-20, 24-5
o computador como uma, 16
definição, 16
a reação da mente humana a, 32-3
da visão, 25-8, 31-2
calicreína, 91
Campbell, John Angus, 282n.7
carbono, 260-1
Causes of Molecular Evolution, The
(Gillespie), 182
Cavalier-Smith, T, 77
Cech, Thomas, 174
célula(s), 255-9
b, 128-30, 132-3
princípios bioquímicos da(s), 255-9
como caixa preta, 18-20, 24-5
blocos de armar da(s), 147-65
ver também biossíntese do amp
evolução darwiniana e, 165
descrição da(s), 147-9
etapas na construção, 148-54
complexidade da, transporte
intracelular e, 108-10
como sistemas dinâmicos, 109-10,
119-20
eucarióticas, 108-9, 191, 256-9,
266-8.-269-70
auxiliadoras t, 129
planejamento inteligente e, 234-5
máquinas moleculares e, 14-5
núcleo da, 19, 20, 108-9, 258
partes da, 108-9
das plantas, 259
plasma, 129-30
procariótica, 256-7, 269-70, 271
replicação do adn na, 274-6
tradução do adn na, 273-4
pesquisa de Schieiden e Schwann
sobre a, 19
tamanho do organismo e, 255
estrutura da, 255-9
célula t auxiliadora, 129
células b, 128-30, 132
células de plantas, 259
células plasmáticas, 129-30
Centro Nacional de Educação em
Ciência, 238
cgmp, 28, 30-1
chauvinismo, científico, 237, 252
cianeto de hidrogénio, 154-5
ciclo lisogênico, 271-2
ciclo lítico, 271-2
ciência
lealdade à, 235-7
sistemas complexos e, 8
história e, 237-9, 252-3
planejamento inteligente e, 231-3, 235
máquinas moleculares e, 14-5
fenómeno molecular e, 7-9
a questão da origem da vida e a, 175-7
filosofia e, 251-2
religião e, 237-45, 251-3, 285-6n.3
explicações sobrenaturais e, 245-9,
252-4
cílio, 66-80
descrição, 66-7
evolução do, esforços para moldar,
74-8, 80
o flagelo comparado com o, 77-80
planejamento inteligente e, 206-7
complexidade irredutível e, 73-5,
78-80
proteínas em, 80
292 A CAIXA PRETA DE DARWIN
literatura de pesquisas sobre o, 76-7
separação das células, 71-2
estrutura do, 66-70
funcionamento do, 70-4
cinase da rodopsina, 30
circulação do sangue, 17-8
citidina (c), 265
citoesqueleto, 258-9
citoplasma, 257-8
citosina, 267
classificação de vertebrados, 17
classificações de plantas, 18
clorofila, 259
cloroplasto, 259
ClosingoftheAmericanMilvi, The
(Bloom), 158
coagulação do sangue ver coagulação
sanguínea
coagulação sanguínea, 84-103
característica autocatalítica da, 90
como sistema em cascata, 88-92, 94,
103, 104
controlando a, 94-6
a evolução darwiniana e a, 96-100
criticada, 100-4
explicação de Doolittie da, 97-104,
180
inadequação da, 100-4
fluxo de sangue e, 84-5
função da, 93-4
problemas de saúde causados por
deficiência na, 95-6
planejamento inteligente e, 201-4,
206-8
complexidade irredutível da, 84-5, 93,
103-4, 220
precisão requerida pela, 84-6
proteínas na, 85-8, 97, 100-4, 202
a máquina Rube Goldberg e, 92, 104
analogia com canal de navegação, 94
sistemas simples de, 92-4
desencadeamento da, 92
cenário yin e yang da, 98-100
códons, 269
colágeno, 60
Cold Spring Harbor Laboratórios,
conferências patrocinadas por, 183
coluna vertebral, proteínas da, 262
complexidade irredutível 47-9, 50-3
ver também sistemas bioquímicos
complexos
da coagulação sanguínea, 84-5, 93,
102-4,218-9
do cílio, 74-5, 78-80
precursor conceituai e, 51-3
evolução darwiniana e, 47-53, 116-8,
164-5, 181
definição da, 47-8
determinação da, 50-3
do flagelo, 78, 80
do sistema imunológico, 135-7,
140-1, 144
do transporte intracelular, 115,
116-20, 121-2
função mínima e, 54
da ratoeira, 50-1, 55-6
precursor físico e, 51-3
como problemas para o darwinismo,
164-5, 180-1
da máquina Rube Goldberg, 83, 93,
219-20
componentes naturais, planejamento
inteligente e sistemas construídos
com, 197-8
computadores como caixas pretas, 16
conferência de provas tipográficas, 274,
275
conhecimento baseado em bazófía, 189
conhecimento da evolução molecular,
bases da, 185-9
convertase c3, 138-40
convertase c5, 139-40
convertina, 91-2
cooperação e simbiose, 191-2, 195,205-6
cooperatividade, 209-10
Copérnico, 253
cópia, adn, 266-71
Cox,Michae), 184
Coyne, Jerry, 37
Creighton, Thomas, 157
criação seletiva, 204-5
criacionismo 15, 41-2, 239
ver também religião
Crick, Francis H.C., 22, 188, 225, 249-50
cristalografia de raio x, 21-2, 249
Darrow, Clarence, 238
Darwin, Charles, 7-8, 13-5, 24-8, 34,177,
252-4
Darwin's Dangerous Idea (Dennett), 252
Dawkins, Picharei, 42-3, 45-7, 54-6, 73,
205-6, 214-5, 218, 221, 222, 251-2
de Duve, Christian, 159,160
Dennett, Daniel, 222, 252
deoxinucleotídeos, 274
deoxirribonucleico, ácido ver adn
deoxirribose, 265
deriva gênica, 230-1
Deviin, TholTias, 185
diabetes, 144, 163
diabetes juvenil, 145
Dialogues Concerning Natural Religion
(Hume),218
Dickerson, Richard, 239-44
dineína,68,70,71-2,74
Diógenes,212,223,228
dióxido de carbono, 152
diversidade de anticorpos, 132-8
DnaA, Dnae e Dnac, proteínas dos, 275
doença da célula i, 120
Doolittie, Russell, 97-104,181
Dose, Klaus, 171
dupla camada de lipídios, 256, 257
duplicação de genes, 96,100-1
Dyson, Freeman, 225
Eddington, A.S., 246
efeito Doppier, 245
efeitos de fundador, 231
Einstein, Albert, 245, 246, 253
Eldredge, Niles, 35-6
elementos, 260
elétron, 260, 261
descoberta do, 20
Endier, John, 38
enzimas catalisadoras, 60
biossintese do amp e, 148-53, 161-3
cascata da coagulação sanguínea e,
88,90-1,94
no besouro-bombardeiro, 40-2
enzimas digestivas, 89
"equilíbrio pontuado", teoria do, 36
esclerose múltipla, 143
estrutura primária da proteína, 262, 264
estrutura quaternária da proteína, 263, 265
estrutura secundária da proteína, 262,
263, 264
estrutura terciária da proteína, 263, 264-5
eucarióticas, 108-9, 191, 256-9, 266, 268,
269-71
evolução darwiniana (gradualismo)
aceitação da, 39
alternativas à, 190-5, 205-6
ver também planejamento
inteligente
biossíntese do amp e a, 155-60,163-5
bioquímica e desafio à, 13, 24-5, 31-2
coagulação sanguínea e, 96-100
criticada, 100-4
besouro-bombardeiro e, 40-5, 56
cílio e, 73-6, 80
criacionismo e, 15, 41-2, 239
apoio de Dawkins à, 42-3, 45-8
descrição da, 13-4
do transporte controlado por portão,
115-6
sistema imunológico e, 130-2, 141-4
como marco inadequado para
entender a origem de sistemas
bioquímicos complexos, 179-80
complexidade irredutível e, 47-54,
116-7, 164-5, 180-1
limites da, 13-5,35-9,146-7
macroevolução, 23-4
vias metabólicas desafiando a,
155-60, 163-5
microevolução, 23-5, 204-5
função mínima e, 53-4
pesquisa da evolução molecular e,
179-80, 181, 182-4, 189, 190
influência da cultura na visão
evolucionista e, 183-7
seleção natural e, 8, 13-4, 15, 36-7,
47-8, 53-4
neodarwinismo, 34, 35
precursores conceituais versus
precursores físicos e, 51-3
rejeição da, 35-9
transporte vesicular e, 123
visão e, 25-8, 46-7
evolução, definição, 7, 9
ver também evolução darwiniana
(gradualismo); pesquisa da
evolução molecular
evolução gradual ver evolução
darwiniana (gradualismo)
Evolution at the Molecular Levei
(Selander, Clark, e Whittam), 182
experiência pessoal, conhecimento
através de, 187-8
explicações sobrenaturais, ciência e,
245-50, 252-4
"explosão cambriana", 36
extremidade c-termina), 262
fator anti-hemofílico, 91, 95-6, 101
fator anti-hemofílico ativado, 94-6
fator de alongamento tu (ef-tu), 273
fator de Christmas, 91, 92, 96, 97, 101
fator de Hageman, 91
fator de liberação, 274
fator de Stuart, 89-93, 96, 97, 102
fator de tecido, 91-2
fator estabilizador da fibrina (fsf), 95, 96
fatores de iniciação, 273
fibrina, 86, 87-9, 93-4, 95, 101-2
fibrinogênio, 86-8, 89, 93, 94, 101-2
filamento do flagelino, 79
filamentos intermediários, 258-9
filosofia
planejamento inteligente e,
argumentos contra, 238-47, 252-3
ciência e, 251-2
Fischer, Emil, 21
flagelino, 79
flagelo bacteriano, 73, 77-81, 256-7
fluxo gênico, 230-1
formato, 151, 157-8
fosfodiesterase, 28, 30
fósforo, 151
fotossíntese, 259
Fox, Sidney, 173-4
função de sistema, planejamento
inteligente e, 198-9, 206-8
função mínima, 53-4, 135-6
fuso mitótico, 259
Futuyma, Douglas, 227-8
Galeno, 17
Galileu, 18,253
Gamow, George, 268
gdp, 28, 161-2
gene(s), 267-8
ver também adn; arn
anticorpo, 127-8, 132-3
duplicado, 96, 100-1
insulina, 203
íntronsnos, 178-9
mutações nos, 48-50, 96,
pseudogenes, 227-8, 229
controle do, 271-2
replicação do, 274-6
divisão do, 96-7
cópia do, 268-71
tradução do, 273-4
geração espontânea, 32-4
Gesner, Conrad, 18
Gillespie, John, 182
Gla (y-carboxiglutamato), rés
90-1,142
glândulas ectodérmicas, 40, 4
glicina, 150-1
glutamina, 150, 152
gmp, 162, 163
Goldschmidt, Richard, 35-6,'
Gould, Stephen Jay, 36, 230
Grew, Nehemiah, 19
grupo do ácido carboxilico, 2(
GTp,28, 162, 163
guanilato ciclase, 30
guanina (o), 265, 267
Haeckel, Ernst, 33-4, 108
Harvey, William, 17-8
Hawking, Stephen, 248
hemofilia, 95-6
hemoglobina, 21, 177, 208-10
heparina, 94
hexoquinase, 60
hidrogénio, 260-1
hidroquinona, 40, 41, 42-3, 44
Hipócrates, 17
história, ciência e, 237-9, 252
Hitching, Francis, 42, 45-8, 5'.
hmk (proteína), 91
Ho, Mae-Wan, 37
ÍNDICE REMISSIVO
Hooke, Robert, 19
Hoppe-Seyler, Emst, 21
Horowitz, N.H., 158-9,165
Hoyle, Fred, 246, 247
Hubble, Edwin, 245
Hume, David, 218-21
Huxiey, Thomas Henry, 237-8
ícarus (periódico), 250
ideias simples, 211-2
imp, 152-3,162-3
imunoglobulinas, 142-3
imunologia comparativa, 141-2
influência da cultura sobre a visão
darwiniana evolucionista do mundo,
182-7
informação genética, codificação da,
268-9
insulina, 202-4
integrase, 272
interleucina, 129
íntrons, 178-9
invertebrados, classificação de, 17
íon,canal de, 30
íons de cálcio, 30
íons de sódio, 30
Joumal of Molecular Evolution (iMÈ),
169-81,240
historiada, 169
modelos detalhados faltando na,
179-81
modelos matemáticos da evolução na,
176-8
pesquisa da origem da vida na, 169-77
pesquisas de comparação de
sequências na, 177-9, 283n.l8
Joyce, Geraíd, 175, 205
Kaplan, Martin, 38
Kauffman, Stuart, 38-9,160, 182,192-5
Kendrew, J.C., 21
Khorana, H. Gobind, 268
Kimura, Motoo, 182
Kornberg, Arthur, 274
Laudan, Lan-y, 286n.3
Leeuwenhoek, Anton van, 19,22
Lehninger, Albert, 183-5,186
lentes, uso científico de, 18
Lesch-Nyhan, síndrome de, 163-4
Liebig, Justus von, 21
Life fce;(Crick), 250
ligação, 230-1
ligação covalente, 259-60
ligação química, 259-60
ligações de hidrogénio, 262, 264, 266-8
Lineu,C., 18
lipídios, 268
lisossomos, 108-9, 113-5, 120, 258
lobos secretórios do besouro, 40, 41
macroevolução, 24
Maddox,John, 251
magaininas, 125
Malpighi, M., 18
manose-6-fosfato (M6p), 116
máquinas de manufatura celular, 14-5
máquinas elétricas, 14-5
máquinas moleculares, 14-5, 59-60, 136,
161
máquinas movidas a energia solar, 13-4
Margulis, Lynn, 35, 78,190-1
mARN (arn mensageiro), 113, 266, 273-4
Maxwell, J.C., 252
McDonald, John, 37
membrana ciliar, 67
membranas ver membranas da célula
membranas da célula, 207-8, 255-9
metabolismo, 21
metarrodopsina, 30
metarrodopsina n, 28-9, 31
método científico, 243-4
mhc, proteína, 129
microevolução, 24, 203-5
microfi lamentos, 258-9
microscopia eletrônica, estruturas
reveladas pela, 20, 67-70, 79, 85-6
microscópio
microscopia eletrônica 19-20, 67-70,
79,86
limites do, 19-20
microtúbulos, 67-70, 71-2, 74, 75, 258-9
Miklos, George, 37
Miller, Kenneth, 224-5, 227-8, 229, 241
Miller, Staniey, 154-5, 170-1, 172-3
Mims, Forrest, 238-9
mioglobina,21-2,208-10
296 A CAIXA PRETA DE DARWIN
mitocôndria, 20, 35, 108-9, 191-2, 258
Mivart, St. George, 39
modelos matemáticos da evolução, 176-8
Molecular Biology ofthe Cell (Alberts,
Watson et a).), 121, 156
moléculas
anfífilicas, 256
na síntese do amp, 147-9
biomoléculas, 259-60
nas membranas das células, 207-8
definição, 259
regiões hidrofilicas das, 256
regiões hidrofóbicas das, 256
magaininas, 125
novas, fabricação, 148
polarizadas, 260-1
ciência e fenómeno molecular, 7-8
"monstro esperançoso", teoria do, 35,
48-9, 102-3
monte Rushmore, planejamento
inteligente do, 200-1, 229
motor meiótico, 230-1
mutações, 48-50, 96, 132-3, 203-5
teoria da complexidade e as, 193
natação, requisitos para a, 61-6
ver também cílio
Natural Theology (Paley), 213, 214
natureza, leis da, 204-6
Nelson, David, 184
neodarwinismo, 34, 35
Neutral Theory ofMolecular Evolution,
The (Kimura), 182
Newton, Isaac, 252
nexina, 68, 70, 71, 72, 74, 76
Nirenberg, Marshall, 268
nitrogénio, 150-2, 153-4
nsf, proteína, 114
N-terminal, extremidade, 262
núcleo, 19,20, 108-9,258
nucleóides, 256-7
nucleotídeos, 147-8, 153, 265-6, 267,
268, 269-70
objetos artificiais, planejamento
inteligente, inferido de, 197-9
objetos mecânicos, planejamento
inteligente inferido de, 197-8
obra de arte, planejamento inteligente na,
196-7
Ochoa, Severo, 268
ollio ver visão
11-ctí-retinal, 28, 29, 30, 46, 9]
organelas, 257-9
órgãos vestigiais, 226, 227-9
Orgel, Leslie, 175, 225, 250
origem da replicação, 275
origem da vida, a questão da
aminoácidos na, 171, 173-4
processos químicos e, ) 70-6
fatores que influenciam a, 230-2
planejamento inteligente e, 173, 253-4
Jownal of Molecular Evolution,
trabalhos publicados na, 169-77
resenhas pessimistas sobre pesquisas
a respeito da, 172
pesquisa do arn, 174-7
ciência c, 175-7
Origem das espécies, A (Darwin), 19, 25
Origins: A Skeptic's Cuide to the
Creation ofLife onEarth (Shapiro),
236
Origins: A Skeptic's Cuide to the Origin
ofLife (Shapiro), 223
Origins ofOrder, The (Kauffman), 182
Oro, Juan, 171
Overton, William, 285n.3
oxigénio, 150, 151, 152, 260
ligação com a hemoglobina,
cooperatividade e, 207-9
Paley, William, 213-8
parede celular, 255-6
partícula de reconhecimento de sina)
(srp), 113-4, 118
partículas virtuais, 248-9
Pauling, Linus, 178
pele, proteçao oferecida pela, 124-5
pêlos, 257
Penzias (astrónomo), 246
peróxido de hidrogénio, 40, 41, 42-3, 44,
55-6
peroxissomo, 108-9
Perspectives on Science and Christian
Faith (periódico), 240
perturbações de sistemas complexos,
192-3
ÍNDICE REMISSIVO
Perutz, Max, 22
Pescoço da girafa, O (Hitohing), 42, 45
pesquisa da evolução molecular
livros sobre, 181-3
a evolução darwiniana e a, 179-81,
183,189,190
influência da cultura na, 183-7
na Journal of Molecular Evolution,
169-81
historiada, 169
modelos detalhados inexistentes
na, 179-81
modelos matemáticos da evolução
na, 176-8
pesquisa sobre a origem da vida,
170-7
pesquisa de comparação de
sequências, 177-9, 283n.l8
conhecimento da evolução molecular
bases da, 185-9
Proceedings ofthe National Academy
ofSciences, 181
o provérbio "publique ou pereça"
e a,189
pesquisa de comparação de sequências,
177-9,283n.l8
Phihsophy ofBlology (Sober), 219, 221-2
pico-segundo, 28
pirimidinas, 266
planejamento ver planejamento inteligente
planejamento bioquímico, 195-6, 202-10
ver também planejamento inteligente
exemplos de, 202-5
planejamento de novos elementos
bioquímicos, 204-5
planejamento inteligente, 190-254
alienígenas e, 249-51
síntese do amp e, 210
anticorpos e, 204-6
argumentos contra o
chauvinistas, 236-7, 252-3
históricos, 237-8
deHume,218-21
imperfeição, 223-7
filosóficos, 239-47, 252-3
religiosos, 246-50
sentimentais, 212-3, 244-7
de Sober, 219-23
características inúteis, 226-9
objetos artificiais e, 197-9
obra de arte e, 196-8
planejamento bioquímico, 195-6,
201-10
dificuldade em identificar
planejamento, 207-10
casos de, 200-4
exemplos de, 201-4
novos elementos bioquímicos, 204
coagulação sanguínea e, 201-3,
205-8
células e, 234-5
cílio e, 205-7
complexidade do mundo e, 229-32
opinião de Dawkins sobre o, 214-5
definição do, 195-6
planejador e, 199, 225-6, 249-50, 251,
252
identificação do, 194-9, 206-10
evolução e, 230
exemplos de, 195-7
forma do sistema e, 200-2
função de sistemas e, 198-9, 205-7
pesquisa futura sobre o, 231-2
inferências de, 196-201
gene da insulina e, 202-4
transporte intracelular e, 205-8
objetos mecânicos e, 197-8
microevolução e, 204-5
componentes naturais e, 197-8
natureza e, leis do, 204-7
questão da origem da vida e o, 173,
253-4
analogia da Tábua de Ouija e o, 221-3
opinião de Paley sobre o, 213-7
refutação da, 217-8
ideias pré-darwinianas do, 212-8
proteínas e, 204-5
ciência e, 231-3, 235
ideias simples e, 211-2
em situação social, 197
o tempo na história do, 228-30
viagem no tempo e, 250-1
plantas planejadas, 203-4
plaquetas, 93
plasma sanguíneo, 86-7
A CAIXA PRETA DE DARWIN
plasmina, 95, 202-3
plasminogênio, 95, 101-2, 202-3
pol i (polimerase i do adn), 274
pol n (polimerase 11 do adn), 275
pol in (polimerase 111 do adn), 275-6
polegar do panda, opinião de Gould sobre
o, 229-31
polímeros, 147
polinucleotídeos, 268
polipeptídeos, 262, 268
polissacarídeos, 257, 268
ponto de união de anticorpos, 126-9
ponto do olho sensível à luz, 45-7, 54-5
poros nucleares, 258
pré-calicreína, 91
precursor conceituai, 51-3
precursor físico, 51-3
precursores físicos versus precursores
conceituais, 51-3
proacelerina,90,91,93
procarióticas, 256-7, 269, 271
replicação do adn nas, 274-6
tradução do adn nas, 273-4
Proceedings ofthe Nacional Academy of
Sciences (pnas), 158, 181
proconvertina, 91, 97
proenzimas, 88, 94, 102-3
promotoras (sequências de adn), 269-70
proteases, 71
proteína c, 94-5, 96
proteína c2,138-9
proteína c3, 138-40, 141
proteína c4, 138-40, 141
proteína c5, 140-1
proteína Cro, 272
proteína de ligação de fio único, (ssb), 275
proteína encadeadora, 79
proteína snap, 114
proteínas
aminoácidos como blocos de armar
das, 21, 59-61, 96, 147, 260-2
anticorpos e, 132-3
capacidade de ligação das, 130-1
do sistema de coagulação sanguínea,
85-6, 97, 100-4
cadeias, 60
no cílio, 78-9
no sistema complemento, 137-40
cópia do adn e, 268-72
de genes duplicados, 100-1
no flagelo, 78, 80
dobradas (pregueadas), 60-1, 2i
264-5
funções das, 60, 61
na hemoglobina, 178, 207-9
planejamento inteligente das, 2
transporte intracelular das, 109
assassinas, 140-1
mascaradas, 140-1
máquinas moleculares e, 59-60
motoras, 70, 74-6
RAO,142
reguladoras (controladoras), 14
ligação de fio único (ssb), 275
estrutura das, 258-65
síntese das, 113-5,261-2
funcionamento das, 60
cristalografia de raio x e, 21-2
proteínas assassinas, 140-1
proteínas cl, 137-9, 141
proteínas controladoras, 140-1
proteínas de clatrina, 114
proteínas mascaradas, 140-1
proteínas molor.-is, 70, 74-6
protcinóidcs, 174
protrombina, 88-9, 90, 91, 93, 97,
pseudogenes, 226-8, 229, 230
pta (tromboplastina plasmática), 9
202-4
"Publique ou pereça", provérbio, l
purinas, 266
química da vida ver bioquímica
Quinn, Philip, 286n.3
quinona, 40-1
radiação de fundo, 246-7
rag, proteínas, 142
rARN (arn ribossômico), 266
ratoeira, complexidade irredutível i
50-5
reforçadoras (sequências de adn), ;
regiões hidrofílicas das moléculas,
regiões hidrofóbicas das moléculas
registro fóssil, 32, 36
ÍNDICE REMISSIVO
regulação (controle)
da síntese do amp, 161-2, 164
falha da, 163-4
ADN,271-2
relatividade, teoria de Einstein da, 245-6
religião
criacionismo e, 15, 41-2, 239
planejamento inteligente e
argumentos contra a, 246-50
Paleyea,213-8
ciência e, 237-45, 251-3, 285-6n.3
Relojoeiro cego, O (Dawkins), 42, 214,
218,251
replicação, adn, 274-6
repressora, 272
resíduos de glutamato (Glu), 90-1
resíduos y-carboxiglutamato (Gla), 90-1,
141
ressonância magnética nuclear (rmn), 22
retículo endoplasmático (er), 108-9,
113-4,258
ribonucleotídeos, 269-70
ribose, 264-5
ribossomos, 113-4, 258, 273
roda, invenção da, 211
rodopsina, 28-9, 46-7, 59-60, 283n.l8
Rube Goldberg, máquina de, 81-4, 92-3,
95,104,220
Ruse, Michael, 222, 285n.3
sarampo, cenário de epidemia, 105-8,
119-20
Saunders, Peter, 37
Schieiden, Matthias, 19
Schwann, Theodor, 19
Scientific American, 193, 238-9, 250
Scopes, John e o processo Scopes, 238
seleção clonal, 130-2
seleção natural, 8, 13,14-5, 36-7, 47-8,
53-4
Shapiro, Robert, 174, 223, 236
simbiose, cooperação e, 191-2,195, 205-6
Singer, Charles, 19
síntese abiótica, 159
síntese evolucionista, 34
sistemas bioquímicos complexos ver
também coagulação sanguínea; blocos
de armar das células; sistema
imunológico; transporte intracelular;
complexidade irredutível
formação de
teoria da complexidade sobre a,
38-9, 192-5, 204-6
por cooperação e simbiose, 191-2,
194-5,206
falta de explicação detalhada da,
179-80
o tempo na história da, 228-30
forma dos, 201
função dos, 198-9
planejamento inteligente dos ver
planejamento inteligente
perturbações dos, 192
ciência e, 8
sistemas de entrega de carga, problemas
dos, 108
sistema em cascata
a coagulação do sangue como, 88-92,
94,103, 104
via-complemento como, 140-1
sistema imunológico, 123-44
agressão e, ameaças do, 123-6
diversidade dos anticorpos e, 132-3,
135-8
bioquímica do, 132-5
seleção clonal e, 130-2
via-complemento e, 137-41
evolução darwiniana e, 130-2,141-4
defeitos do, 143-4
problemas de saúde decorrentes de
defeitos no, 141-2
complexidade irredutível do, 135-7,
140-1,144
fabricação de proteínas e, 130-1
literatura de pesquisas sobre o, 141-4
pele e, 125
funcionamento do, 126-30
Smith, John Maynard, 38, 160
Sober,Elliot,219-23
Sócrates, 212-3
srp (partícula de reconhecimento de
sinal), 113-4, 118
ssb (proteína de ligação de fio único), 275
Stelluti, 18
superóxido dismutase, 283n.l8
Swammerdam, Jan, 19
300 A CAIXA PRETA DE DARWIN
Swift, Jonalhan, 22
Szathmary, Eõrs, 77
tábua de Ouija, analogia da, 221-3
tcr, moléculas, 342
tempo imaginário, 247-8
teoria da bolha, de formação do universo,
248
teoria da complexidade, 38-9, 192-5,
204-6
teoria da vida baseada na célula, 19
teoria do estado estável, 246-8
teoria do relógio molecular, 177-8
teoria do universo cíclico, 247-8
thf (vitamina), 152
Thomson, 1.3., 20
Thrombosis and Haemostasis (periódico),
98
timina (r), 265, 267
topoisomerase, 271
(-pa (proteína), 95
tpa, 100, 102
tradução, 273-4
transducina, 28-9, 30
transporte controlado por portão, 115,
116-7
transporte intracelular, 105-22
complexidade da célula e, 108-10
problemas de saúde causados por,
defeituoso, 119-21
planejamento inteligente e, 206-7
complexidade irredutível do, 115,
116-9, 121-2
cenário da epidemia de sarampo e o,
105-8, 119
métodos
de portão, 114, 115-7
transmembrana, 114-5
vesicular, 115-7, 120-2
processo, 114
de proteínas, 1)0
analogia com a sonda espacial e, 110-3
transporte transmembrana, 114-6
transporte vesicular, 115-7, 120.2
transposição, 230-2
ff-atíretinal, 28, 29, 30
ü-awretinol, 30
trombina, 88-92, 94, 95, 101-2, 202-4
trombomodulina, 94-5
tromboplastina plasmática (pta),
202-3
t-SNARE, proteína, 114
tubulina, 66-70, 86
unidade de reconhecimento, 138-9
universo, teorias do, em expansão,
uracil (u), 265
vacüolo, 259
valor posicionai dos números, uso d
211-2
vasos sanguíneos, 93
vesículas secretoras, 108
via-complemento, 137-41
via extrínseca, 91-2
via intrínseca, 91
via metabólica, 154-65
a -* b -* c d, 155-60
controle de, 161-3, 164
falhado, 164
via metabólica a -» b -» c -* d, 155-61
viagem no tempo, 250-1
visão
bioquímica da, 26-32
caixa preta da, 25-8, 31-2
evolução darwiniana e, 25-8,46-7
opinião de Dawkins sobre a, 45-8
opinião de Hitching sobre a, 45-8
vitamina k, 91, 96
Voet,D.,186,187
Voet, J.G., 186, 187
v-snare, proteína, 114
warfarina, 91
Watson, James, 22, 121, 156,188, 189,
249
Wilberforce, Samuel, 237
Wilson (astrónomo), 246
Wôhier, Friedrich, 20-1, 202
yin e yang, cenário da coagulação
sanguínea através do, 98-100
Yockey, Hubert, 38
Zasloff, Mike, 125
Zuckerkandi, Emile, 178
Final HJR