Você está na página 1de 24

Exporters Capturing a river

Fu’s smile returns call building Work of 50 painters depicts


Famous swimmer finds reason to brands key the mighty Yangtze’s scenery
celebrate despite injury SPORTS, PAGE 16 LIFE, PAGE 24
BUSINESS, PAGE 17

TUESDAY, April 17, 2018


 www.chinadailyhk.com  $7

Reforms
Xi: Promise given credit
for increase
to open up in central
SOE profits
more is firm By ZHONG NAN
zhongnan@chinadaily.com.cn

Founder of Davos forum praises China’s central State-owned


enterprises saw their highest
president’s role in global affairs profit growth in five years as
well as a drop in the ratio of lia-
bilities compared with assets in
By AN BAIJIE last year during the World Eco- the first quarter, the country’s
anbaijie@chinadaily.com.cn nomic Forum meeting in top SOE regulator said on
Davos, Switzerland, still exist. Monday. The change was cred-
China will fulfill its commit- They are the lack of a driving ited to the country’s new round
ment made at the just-con- force for global economic of reform and opening-up.
cluded Boao Forum for Asia to growth, lagging global eco- Central SOEs saw profits rise
boost opening-up through nomic governance and unbal- by 20.9 percent year-on-year to
powerful measures, President anced global development. 377.06 billion yuan ($60 bil-
Xi Jinping said on Monday. Xi said that an anti-globali- lion) between January and
Xi made the remark while zation and trade protection- March, up from 15.2 percent for
meeting with Klaus Schwab, ism trend is rising and it has 2017, according to the State-
founder and chief executive of added risks and uncertainties owned Assets Supervision and
the World Economic Forum, at to the global economy. Administration Commission.
the Great Hall of the People in Facing so many problems President Xi Jinping and Klaus Schwab, founder and chief executive of the World Economic Forum, meet at the Great Hall of the The average asset-liability
Beijing. and challenges, the whole People in Beijing on Monday. LI TAO / XINHUA ratio for central SOEs stood at
As a responsible major world should enhance coordi- 65.9 percent by the end of
country, China will make joint nation among equals and made for his speech at the “You cannot imagine how Communist Party of China’s tion and multilateralism and it March, down by 0.4 percentage
efforts with the international resort to multilateral coopera- Davos forum in January 2017. much it is referred to in discus- 19th National Congress, the opposes trade protectionism points compared with the
community to enhance coop- tion, Xi said. The World Economic Forum sions again and again among recent session of the National and unilateralism, he said. beginning of this year.
eration, boost opening-up and History has repeatedly has upheld the spirit of inno- our members and partici- People’s Congress and the just- Schwab said that he was To ensure healthy growth,
pursue win-win results to proved that only by openness vation and exercised special pants,” Schwab told Xi. concluded Boao annual con- proud of the cooperation Peng Huagang, deputy secre-
bring a bright, stable and pros- and cooperation will the path influence over global affairs, Xi Schwab said he was “partic- ference. between the forum and China tary-general of the commis-
perous future to the world, Xi become ever wider, Xi said, said, adding that China is ularly interested in” Xi’s pro- Schwab spoke highly of Xi’s in the past four decades, and he sion, said central SOEs have
said. adding that major countries expanding cooperation with posal of building a community efforts to “keep our global sys- would like to enhance coopera- earnestly implemented the
Xi said there are some posi- shoulder important and special the forum. of a shared future for man- tem open and to keep it collab- tion with China in such areas requirements for deleveraging,
tive signs for the global econo- responsibilities for those issues. Schwab said Xi’s speech last kind, which has been men- orative”. as advancing the building of strictly controlling the scale of
my, but the three fundamental Xi expressed gratitude for January at Davos was impress- tioned by Xi on many The World Economic Forum the Belt and Road and boosting interest-bearing liabilities, sup-
contradictions he mentioned the arrangement that Schwab ive. occasions, including at the supports economic globaliza- innovative development. plementing equity capital
through multiple channels and
continuously optimizing the

US urged Beijing, Tokyo voice support for asset-liability structure.


The government will also
impose targeted regulations on

to choose free trade amid high-level talks different types of SOEs this
year depending on their debt
risk. For example, it will intro-
wisely on By ZHANG YUNBI
and WANG QINGYUN
Asia and believes such meas-
ures promote bilateral eco-
China, Japan and the Repub-
lic of Korea and to make an
duce stricter regulations on
SOEs with both higher debt
ratios and deleveraging diffi-
China ties China and Japan voiced
nomic ties, he said.
The two sides also
official visit to Japan.
China values the positive
culties.
Peng said central SOEs’
their support for free trade expressed their hope for coop- signs Abe has been showing emerging industries and new
By ZHANG RUINAN based on the World Trade eration under the Belt and since last year on improving products and types of business-
in Philadelphia, Pennsylvania Organization and warned Road Initiative. ties, Wang said, adding that es have been driven by sound
ruinanzhang@ against protectionism on China values Abe’s positive they should treasure the macroeconomic fundamen-
chinadailyusa.con Monday. comments on the Belt and hard-won momentum. tals, enabling them to develop
In a meeting with Japanese Road, Wang said, adding that Also on Monday, Wang rapidly in the first quarter.
Chinese Ambassador to the Prime Minister Shinzo Abe in China hopes to discuss with co-led the fourth bilateral Those in military industries
United States Cui Tiankai Tokyo, State Councilor and Japan appropriate ways and high-level economic dialogue have doubled their efforts in
urged Washington to make Foreign Minister Wang Yi specific paths for Tokyo to in Tokyo with Japanese For- military-civilian integration,
the “right choice at the cross- said both countries should participate. eign Minister Taro Kono. The State Councilor and Foreign Minister Wang Yi meets with speeding up the commerciali-
roads of history” for Sino- strengthen communication Abe said he expects the ini- dialogue had been stalled for Japanese Prime Minister Shinzo Abe in Tokyo on Monday. zation of research and develop-
American relations during a and coordination, stand tiative to help the regional nearly eight years. MA PING / XINHUA ment findings and actively
speech at the 2018 Penn against protectionism, safe- economy to recover and At the dialogue, ministers exploring new businesses,
Wharton China Summit on guard the global free trade develop. in charge of treasury, econo- including intelligent manufac-
Sunday. system with the WTO as the This year marks the 40th my and diplomacy reached a Wang said. In addition, they competition in third-party turing, smart security equip-
“China made the historic core and build an open world anniversary of the signing of wide range of consensuses, should move closer to build- markets such as Southeast ment and remote sensing
decision 40 years ago to carry economy. China-Japan Treaty of Peace according to a Foreign Minis- ing the Free Trade Area of the Asia and Africa into coopera- satellites.
out reform and opening-up, Abe said Japan also values and Friendship. Abe said his try news release. Asia-Pacific, he said. tion to minimize unnecessary The revenues generated by
which changed the course of WTO rules and thinks trade country values highly its ties Beijing and Tokyo should Jiang Ruiping, vice-presi- competition, Jiang added.
China’s future,” Cui said. “The problems should be settled with China and hopes to use jointly advance the integra- dent of China Foreign Affairs See SOEs, page 3
achievements China has according to such rules. Japan the opportunity to improve tion process of the East Asia University and an expert on Contact the writers at zhang-
made are because we pursued pays great attention to the their ties across the board and economy and spur negotia- Japan’s economy, said Beijing yunbi@chinadaily.com.cn
our own course independent- new measures President Xi achieve high level exchanges. tions on the China-Japan-Re- and Tokyo have every reason
Central SOEs’
ly, changed our policies as Jinping announced for Abe also said he looks for- public of Korea Free Trade to better coordinate with each asset-liability
required by the times, com- expanding China’s opening- ward to and welcomes Pre- Agreement and the Regional other to catalyze regional free Inside average ratios
mitted to a people-centered up at the recent annual con- mier Li Keqiang to attend the Comprehensive Economic trade negotiations.
Editorial > p12 Unit: percent
approach, stayed on the path ference of the Boao Forum for leaders’ meeting between Partnership free trade pact, They could shift mutual
of international development By the end of
and continued to pursue a 65.9%
March 2018
mutually beneficial strategy
of opening-up.”
Cui said China and the US
Advanced J-10C fighter placed on combat-ready duty By the end
of 2017
66.3%

established full diplomatic By the end


66.7%
relations almost at the same By ZHAO LEI 2004. In 2009, the plane was improvements will also avionics and fire-control sys- of 2016
time as China’s reform and zhaolei@chinadaily.com.cn declassified. There are four improve the engine’s per- tems. The rapid evolution in
By the end
opening-up four decades ago. models in the family — the formance such as the thrust,” the J-10 series, he said, was 66.2%
of 2015
“This is not just coincidence; The People’s Liberation J-10A, J-10B, J-10C and the he explained. “The jet uses an possible thanks to rapid
China’s opening-up can be Army Air Force said it began twin-seat J-10S. upgraded version of China’s advancement in China’s avia- By the end
63.3%
realized only in a peaceful deploying J-10C fighter jets to The Air Force and the active phased array radar, so it tion industry. of Nov 2014
international environment combat-ready duty on Monday. J-10C fighter jet Navy’s aviation units have had has better detection and mul- Wang suggested that future 0 10 20 30 40 50 60 70
and under a stable interna- The Air Force said in a hundreds of J-10s, making the titargeting capacity.” upgrades might involve Source: State-owned Assets Supervision
tional order,” Cui said. “So the statement that the move will striking ground or sea targets, aircraft a pillar of the national The J-10C also has been replacing the engine with and Administration Commission
CHINA DAILY
establishment of diplomatic strengthen its combat capa- the statement said. air defense network. armed with the country’s new- more powerful ones, includ-
ties is also a correct decision bility, adding that the jet has The single-seat J-10C, the Fu Qianshao, an aircraft est air-to-air missiles, which ing an additional fuel tank to
that has flourished … in all are- taken part in a series of aerial youngest member of the J-10 expert from the Air Force, said have longer ranges, Fu said. increase its fuel capacity and
as, including economy, fighting exercises organized family, was first shown to the the J-10C has a smaller radar Wang Yanan, editor-in- flight range, or modifying its A member of the
Asia News
finance, trade, society, culture, by the Air Force since 2016. public at a parade in July in signature and stronger opera- chief of Aerospace Knowledge airframe to make it stealthier. Network
people-to-people exchanges Developed and built by the the Inner Mongolia autono- tional capability than the magazine, said that the J-10A Lu Jianjun, a senior fighter
and science and technology, State-owned aircraft giant mous region and took part in J-10A or J-10B. and J-10B notably differed in jet pilot in the Air Force, pre- © 2018 ChinaDaily
All Rights Reserved
bringing tangible benefits to Aviation Industry Corp of drills. “There are new improve- their exteriors, but the viously told China Central
Vol. 22 — No.
peoples of both nations.” China, the J-10C is a superson- The first version in the J-10 ments to the plane’s air intake changes between the J10-B Television that compared
He said that approaching ic, multirole fighter capable of family, the J-10A, was first that make the jet more and J-10C were primarily on with its predecessors, the
maintaining short- and medi- flown in 1998 and entered ser- streamlined, lighter and the inside, involving upgrades J-10C is easier to fly and more
See Ties, page 3 um-range air supremacy and vice with the Air Force in harder to detect. The mostly in software like the maneuverable.
Tuesday, April 17, 2018  CH I N A DAI LY H O NG KO N G EDI TI O N

2 PAGE TWO
Looking ahead
Candid camera: Street art
Events and stories coming up in the next few days

PLA Navy to hold live-fire million people by air a year, according to


the Civil Aviation Administration of China.
drills in Taiwan Straits By 2024, the demand for passenger trans-
The People’s Liberation Army Navy will con- port in China will exceed that of the United
duct a live-fire drill in the waters of the Tai- States, becoming the largest air passenger
wan Straits on Wednesday, according to the market in the world, the International Air
Maritime Administration of Fujian province. Transport Association forecast.

Asian aviation meeting set Key global swimming event


to take flight in Shanghai will make splash in Beijing
The Asian Business Aviation Conference The FINA Artistic Swimming World Series
and Exhibition will be held at the Shanghai will be held at the National Olympic Sports
Hawker Pacific Business Aviation Center Center in Beijing from Friday to Sunday.
from Tuesday to Thursday. As a major avia- The Beijing leg is the second of the 10-leg
tion trade fair, the event will showcase the series, with the first leg held in Paris last
latest products, including air ambulance month. Swimmers from countries including
services and aircraft brokerages. By 2020, it the United States, Uzbekistan, Austria, Slo-
is expected that China will transport 720 vakia and Malaysia will participate.

On chinadaily.com.cn
Visit for breaking news and exclusive content

Photos: Rural girls pursue Trend: Computer coding goes


dreams of ballet glory viral with more focus on STEM A deliveryman passes a graffiti-strewn wall in Rio de Janeiro, Brazil, on April 7. WANG WEIGUANG / FOR CHINA DAILY
To prepare As parents
for a ballet are paving
school the way for
admission
exam,
Jiaojiao, a
their
children’s
futures,
A no-brainer when it comes to win-win
fifth-grad- computer
er, has program- One thing that’s always native of Salt Lake City, Utah, lose; or if you win, I lose. you also have to be confi-
been on a ming has amused me is China’s was also an educator, busi- “Life becomes a zero-sum dent. You not only have to be
diet for a year. The Hebei Vocational Art gone viral embrace of the Americanism nessman and keynote speak- game. There is only so much considerate and sensitive,
School in Shijiazhuang, Hebei province, has across China. Coding was not well-known “win-win”. er. He was a professor at the pie to go around, and if you you also have to be brave.”
recruited students from Duancun School in among children or their parents a decade It frequently pops up in Jon M. Huntsman School of get a big piece, there is less It’s obvious that China
Anxin county, Hebei, for the past three ago, but now even preschoolers are starting business, educational, diplo- Business at Utah State Uni- for me; it’s not fair, and I’m sees a lot of itself in Covey’s
years. Jiaojiao is one of a group practicing coding classes as China is pushing science, matic and governmental versity when he died at age going to make sure you don’t win-win approach to the
ballet under the guidance of Guan Yu, a technology, engineering and math (STEM) exchanges, and rarely a week 79 in July 2012 of complica- get anymore. We all play the world.
professor from the Beijing Dance Academy. education. Since 2015, the government has goes by that it’s not in a Chi- tions from a bicycling acci- game, but how much fun is it Still, maybe it’s time China
At the invitation of an art charity, Guan been issuing guidelines encouraging na Daily sto- dent two months prior. really?” trotted out a new American-
started a ballet course at Duancun School schools to experiment with STEM educa- ry. (Coincidentally, or maybe Covey wrote that a person ism, perhaps “no-brainer”?
in 2012 that offers rural children a chance tion, including coding. According to a In light of not, the son of the man after or organization that Basically, it’s saying that
to show their talent on stage. report by Deloitte, the investment in Chi- the current whom the business school approaches conflicts with a you don’t even have to think
nese startups in STEM education has seen a tariff tiff, it’s was named, Jon Jr, served as win-win attitude possesses about something twice to,
Rankings: Top 10 expensive 15-fold increase from 2014 to 2017. time to take a US ambassador to China three vital character traits: uh, win-win.
cities for business travelers look at the from 2009 to 2011.) Integrity: sticking to your No-brainer first surfaced
Hong Kong is China’s most expensive city, Animal: Scrap paper boosts William origin of the In the book, Covey’s habit true feelings, values and (supposedly) in December
followed by Shanghai and Shenzhen, conservation awareness Hennelly phrase and No. 4 is “Think Win-Win”. (It commitments; maturity: 1959 when it appeared in The
Guangdong province, according to a survey. Zhou
Second why the Chi- also can be found on expressing ideas and feelings Berrys cartoon by Carl Gru-
The survey examined 160 goods and servi- Jianqiao, 41,
Thoughts nese may www.stephencovey.com.): with courage and considera- bert in the Long Beach Inde-
ces in 133 cities worldwide. While the sur- who runs a have adopted “Think Win-Win isn’t tion for that of others; abun- pendent newspaper in
vey did not include property prices it is clothes it as a calling card. about being nice, nor is it a dance mentality: believing California. (A descendant of
considered a key reference point for expa- shop in The expression (at least quick-fix technique. It is a there is enough for everyone. that paper is the current
triates and business travelers. Visit our Changsha, according to my internet character-based code for “Many people think in Long Beach Press-Telegram.)
website to find out more about the top 10 Hunan searches) comes from a 1989 human interaction and col- terms of either/or: either Usage example: It’s a
expensive Chinese cities. province, bestselling book: The 7 Hab- laboration. you’re nice or you’re tough. no-brainer that both sides
started its of Highly Successful Peo- “Most of us learn to base Win-win requires that you be will be relieved when the
ple, which has sold more our self-worth on compari- both. It is a balancing act trade dispute is resolved.
Film: Big Fish and Begonia using scrap
than 25 million copies sons and competition. We between courage and consid-
paper for
wins plaudits in North America artworks in 2013. He said he creates his worldwide. think about succeeding in eration. Contact the writer at
Animated The book’s author, Ste- terms of someone else fail- “To go for win-win, you not williamhennelly@
works to call attention to environmental
fantasy phen Richards Covey, a ing — that is, if I win, you only have to be empathic, but chinadailyusa.com
protection and wildlife conservation. Visit
Big Fish
our website to view his artworks.
and Bego-
nia has This Day, That Year
arrived in Education: Scale for English
North will help standardize teaching
American China’s first scale for English proficiency development to the IMF, tural reform efforts.
theaters levels will be implemented on June 1, since Oct 1, 2016, the ren- The SDR is an internation-
two years according to the Ministry of Education and years minbi has been a freely usa- al reserve asset created by
after its release in China, receiving highly State Language Affairs Commission. The on ble currency and included in the IMF in 1969 to support
positive reviews from critics and moviego- scale — the first comprehensive system for the special drawing rights its member countries’ official
ers for its distinctive characters, stunning teaching, learning and Editor’s Note: This year basket of currencies along reserves.
images and unique Oriental cultural charm. testing the language — marks the 40th anniversary with the dollar, the euro, the Officially founded in 1946,
The film hit North American screens early will be helpful in unify- of China’s reform and open- Japanese yen and the Brit- the IMF is an organization of
this month. The movie, released in China in ing various English tests ing-up policy. ish pound, as seen in the 189 countries, working to
2016, brought in $89 million over the with different standards item from China Daily foster global monetary coop-
course of is run. The film has abundant Chi- and deepening the inter- The People’s Republic of (right). eration, secure financial sta-
nese traditional cultural elements and connection between China assumed responsibili- The Chinese currency is bility, facilitate international
mythology. Directed by Liang Xuan and exams at home and ty for China’s relations with the first currency from a trade, promote high employ-
Zhang Chun, it is based on ancient Chinese abroad. The scale is Scan it! the International Monetary developing country to be ment and sustainable eco-
legends and follows the tale of love, sacri- divided into nine levels Read Fund on April 17, 1980. added to the basket. nomic growth, and reduce
fice and the adventure of a 16-year-year girl based on English profi- more on An IMF resident repre- The SDR inclusion of the poverty around the world.
named Chun who lives in a magical world ciency, covering elemen- chinadaily. sentative office in China was renminbi indicates the rec- Last week, the China-
beyond the human realm. tary school to university. com.cn established in Beijing in ognition by the international IMF Capacity Development
1991. community of China’s eco- Center was established in
Marking a significant nomic ascendancy and struc- Beijing.

TUE - WED APRIL 17-18


-2/17 Beijing 11/25 C 12/27 S Shanghai 10/21 S 11/24 S
11/20 0/20 Changchun 9/21 C 8/21 C Shenyang 8/22 S 8/23 S
9/19 Changsha 13/26 S 15/29 S Shenzhen 16/22 O 20/26 C
Chongqing 14/27 S 17/29 S Shijiazhuang 11/26 S 13/29 S
11/25 Dalian 8/17 S 9/19 S Suzhou 9/22 C 12/23 O
12/27 Fuzhou 13/23 C 13/25 C Taipei 17/24 C 18/25 C
6/18 Guangzhou 14/23 C 17/25 C TUESDAY
Taiyuan 4/27 C 8/30 S
8/20 Guilin 12/28 C 15/25 C Tianjin 12/27 C 14/29 S WEDNESDAY
12/16
10/16 Guiyang 10/24 C 12/24 C Urumqi 11/20 S 9/19 C
13/27 Haikou 20/24 T 21/26 T Wuhan 10/25 S 13/28 S
16/29 10/21
11/24 Hangzhou 10/21 C 10/26 C Xi'an 9/27 S 12/30 S
23/36 Harbin 9/20 C 3/19 S Xiamen 16/24 C 16/26 C Abu Dhabi 24/38 S 24/32 S BuenosAires 16/23 C 21/23 O
23/37 17/24 Hefei 8/23 S 11/26 S Xining -3/24 S -1/24 C
14/23 18/25 Bangkok 28/36 R 27/35 D Caracas 24/24 D 25/25 D
17/25 Hohhot 5/23 S 9/27 S Yantai 8/22 S 11/25 S Colombo 25/32 D 24/32 D Chicago 1/4 Sn 1/4 O
24/39 Hongkong 18/23 C 21/25 C Yinchuan 8/27 S 9/28 S Dubai 27/38 D 24/30 D Houston 20/25 S 22/24 S
18/23 Jinan 14/25 S 18/29 S Zhengzhou 11/26 C 14/28 S
24/38 21/25 Hanoi 19/23 D 17/24 D Las Vegas 13/16 S 11/19 S
Kunming 10/20 Sh 10/21 Sh Zhuhai 16/22 C 19/24 C Islamabad 18/26 R 15/22 D Los Angeles 8/14 D 11/19 S
Lanzhou 5/26 S 7/28 S Jakarta 26/32 D 25/32 D Mexico city 13/20 S 16/18 C
28/36 Lhasa 2/15 O 3/15 Sh
27/35 Karachi 26/36 S 26/36 S New York 5/5 C 2/7 O
Lijiang 8/22 C 7/18 C Kuala Lumpur 25/29 D 24/30 D Ottawa -3/1 R/Sn -1/3 R/Sn
25/31 Macao 16/22 C 19/24 C Rio De Janeiro 17/21 D 22/23 D
24/28 25/32 26/35 Manila 26/35 D 24/34 D
24/34 Nanchang 12/24 S 14/27 S Mumbai 25/33 S 26/34 S San Francisco 6/11 D 4/11 O
22/30 Nanjing 9/22 S 10/25 S Athens 14/23 C 14/23 C
Berlin -4/13 O 10/13 C New Delhi 23/36 C 23/37 S Sao Paulo 12/18 D 12/19 D
Nanning 16/27 C 18/28 C Pyongyang 3/19 S 4/21 S Vancouver 3/6 D 5/7 D
25/29 Qingdao 8/14 S 9/14 S Brussels -1/11 S 8/15 C
24/30 Geneva 2/12 C 9/15 C Riyadh 17/27 S 14/28 S Washington 5/9 C 5/8 D
Sanya 23/29 T 23/26 T Seoul 6/18 S 8/20 S
Istanbul 11/19 D 9/18 D
25/28 London 9/12 D 10/14 C Singapore 25/28 D 25/30 D
25/30 Madrid -2/16 S 5/23 C Sydney 17/21 D 18/22 D Cairo 17/32 S 20/30 S
Moscow 10/19 D 9/11 D Teheran 4/9 D 6/11 S CapeTown 16/24 C 16/20 D
26/32 Paris -1/11 C 7/16 C Tokyo 12/16 D 10/16 R Johannesburg 9/20 D 9/20 D
25/32 Rome 2/16 C 13/16 O Wellington 14/20 D 14/18 D Lagos 26/27 D 26/28 D
Vienna 1/16 C 14/15 S Yangon 24/39 C 24/38 D Nairobi 16/21 R 18/22 D
CH INA DAILY HONG KONG EDIT ION Tuesday, April 17, 2018

TOP NEWS 3

92 leading officials swear oaths Guideline blends


internet, medicine
Li oversees
ceremony,
to assist patients
urges them By HU YONGQI
huyongqi@chinadaily.com.cn
punctual treatment and still
have unpleasant experiences
to follow China will continue inte-
when seeing doctors.
Jiao Yahui, deputy direct-
Constitution grating healthcare services
with the Internet Plus Initia-
or of the department of
health policies and manage-
tive to improve the quality ment under the commission,
By ZHANG YUE and efficiency of the sector said medical reforms should
zhangyue@chinadaily.com.cn under a new guideline be deepened and more inter-
approved by the State Coun- net-based procedures intro-
Central government offi- cil, senior officials said on duced to solve the problem.
cials should exercise govern- Monday. Many hospitals have
ance in accordance with the Management of health- developed their own applica-
Constitution and the law to care services should be tions, through which
realize development and improved by optimizing patients can register for an
bring more benefit to the resource distribution and appointment online, Jiao
people, Premier Li Keqiang innovative management said. Meanwhile, other plat-
said. models with higher efficien- forms are also being used to
Li made the remark at a cy and lower costs, Zeng Yix- pool resources from differ-
State Council ceremony to in, deputy head of the ent hospitals to make
swear in central government National Health Commis- appointments easily for
employees on Monday morn- sion, said at a policy briefing patients, she said.
ing, with 92 leading officials of hosted by the State Council Hospitals now are encour-
the new Cabinet from 42 Information Office. aged to divide appointments
departments pledging to Premier Li Keqiang oversees a State Council ceremony in Beijing on Monday during which leading officials of the new Cabinet pledge to The guideline on the pro- into different time periods to
uphold the Constitution. Li uphold the Constitution. XU JINGXING / CHINA DAILY motion of integrating prevent everyone from com-
oversaw the ceremony. healthcare with the internet ing in at rush hours. Smart
The 92 officials, appointed was approved at a State hospitals also will be encour-
from June to March, took an
oath in front of a red-bound
Efforts made by the people’s Chinese Characteristics for a
New Era, we should firmly
ceremony, which aims to
build a government based on
Council executive meeting
on Thursday, which was pre-
aged to help improve effi-
ciency, which was
copy of the Constitution in a
State Council assembly hall in
government boils down to ... hold development as our top
priority and implement the
the rule of law and to educate sided over by Premier Li
Keqiang. It’s the latest move
exemplified by one hospital
government officials to carry in Hangzhou, Zhejiang prov-
the Zhongnanhai leadership serving our people’s well-being.” new development concept to forward the spirit of the Con- by the central government to ince. In that hospital,
compound. All participants realize comprehensive devel- stitution. It came after the integrate traditional indus- patients can make appoint-
stood to sing the national Premier Li Keqiang opment of society.” Standing Committee of the tries with internet technolo- ments, pay bills and see
anthem before taking the An executive meeting of the National People’s Congress gies. results of checkups on their
oath. State Council on July 20, put forward a legal document According to the guide- computers or mobile
“Efforts made by the peo- people’s well-being and they took the oath. “Under the 2016, passed a regulation that in July 2015 requiring all pub- line, a service system will be phones.
ple’s government boil down to improving people’s lives,” Li guidance of Xi Jinping set out procedures for central lic servants swear an oath to established to promote inte- Internet technologies will
the purpose of serving our told the group of officials after Thought on Socialism with government officials’ oath the Constitution. gration in areas such as pub- be further used to help rebal-
lic health, privately ance the distribution of med-
contracted doctors, medical ical services across the

Rags to riches: Wholesale spot now high-tech center supplies and medical insur-
ance reimbursement settle-
ment, Zeng said.
country and provide better
services, especially in central
and western parts of China,
Meanwhile, supportive Zeng said.
By DU JUAN work, the government had INNOVATION dies to locate in the new center. is a vivid example of “red wall policies will be introduced to “Medical resources are
dujuan@chinadaily.com.cn moved out all vendors from the China’s internet security consciousness” — how the local boost sharing of medical clustered in major hospitals
ACTION IN A NEW ERA
Beijing Zoo wholesale markets. company 360 Enterprise Secu- government is offering better information and infrastruc- in large cities, leading to
Beijing’s largest clothing One of the buildings that rity Group will move into services to the public to build a ture upgrades for hospitals, scarcity of such resources in
wholesale markets have trans- used to host those vendors has another former wholesale mar- better city. along with measures to rural areas and faraway pla-
formed into a finance and high- been transformed into an inno- ket soon. This should help Since the Zhongnanhai lead- ensure the security of per- ces. ... Therefore, we hope
tech innovation center as the vation center and been named draw small and medium-sized ership compound is in Xicheng sonal medical information internet technologies can
city works on upgrading its the Baolan Finance Innovation companies in the industry to district, people who live and and the quality of healthcare make the access to high-
development structures, focus- Center. The upgraded Bei- the area. work there have developed a services, he said. quality doctors and medical
ing on the core functions. Many vendors that had been “I’m very confident about the loyalty to the Party, a sense of However, problems services easier for less-devel-
Located near the Beijing Zoo in the building, some for dec- jing Zoo area will development of this area since responsibility and a faith to remain for some hospitals, oped areas and, thus, change
in Xicheng district, these cloth- ades, moved to Tianjin and the local government has serve the public’s interest. where patients cannot get the imbalance,” Zeng added.
ing wholesale markets began Hebei province to restart their become an influ- shown its determination to This common awareness is
in the 1980s and over the years businesses. Many were unwill- ential internation- transfer this land into a gather- called “red wall consciousness”
swelled to about 13,000 stalls
covering more than 350,000
square meters.
ing at first to move but their
mindset changed from objec-
tion to understanding.
al center which
ing place for financial and high-
tech industries,” said Li Ran,
general manager of BL Stock
since 1999 because the walls of
Zhongnanhai are red. In Janu-
ary 2016, the central leadership
British pleased with
can further con-
However, the markets were
blamed for causing severe traf-
fic congestion, safety concerns
Most companies that have
moved into the building are in
the finance and technology tribute to the eco-
Co, a real estate operation com-
pany that manages the Baolan
Finance Innovation Center.
raised “Four Consciousnesses”
— the ideology, the whole, the
core and the line — to help
Xi’s IPR comments
and environmental disorders. It industries. It is fully occupied. The district will leave some build the Party through inner-
also was considered unfit for the The government continues nomic growth of land to improve roads and build Party discipline and directives. By ANGUS MCNEICE opportunities” for British
capital’s core functions set by to attract more high-tech com- parking lots. The traffic in the “The upgraded Beijing Zoo in London companies, especially in the
the central government, which panies. the capital.” area will definitely be better. area will become an influen- angus@mail.chinadailyuk.com engineering, financial and
are politics, culture, internation- A Shanghai-based digital Fang Ning, head of the Insti- tial international center which legal services sectors.
al communication and science company named Ucloud has Fang Ning, head of the Institute tute of Political Science at the can further contribute to the British business leaders “At the business level, we
and technological innovation. been offered 15 million yuan of Political Science at the Chinese Chinese Academy of Social Sci- economic growth of the capi- welcomed comments made are already cooperating furi-
By Nov 30, after two years of ($2.39 million) as rental subsi- Academy of Social Sciences ences, said the transformation tal,” Fang said. last week by President Xi Jin- ously and very pro Belt and
ping about the protection of Road,” Troubridge said.
foreign intellectual property Lord Mayor of the City of

SOEs: New businesses A day at the museum rights in China and about
the status of the Belt and
Road Initiative.
London Charles Bowman,
who recently led a delega-
tion to China to promote

help boost total profits Speaking at the annual


conference of the Boao
Forum for Asia, Xi said that
London’s role in the Belt and
Road Initiative, said UK cap-
ital is the “natural Western
China will engage in “exten- hub” for the initiative.
From page 1 seek cooperation on imports sive consultation” with other “President Xi’s comments
and in other fields at the first nations participating in the on the Belt and Road will
these new businesses account- China International Import Belt and Road Initiative. have been welcomed by
ed for more than 30 percent of Expo slated for November in China “has no geopolitical many people around the
the central SOEs’ total. New Shanghai. calculations”, Xi said, will world, including here in the
businesses such as data, infor- Under the government plan, seek no exclusionary blocs UK,” Bowman said.
mation and communications central SOEs will implement and impose no business In his speech, Xi also said
technologies in central tele- opening-up policies to expand deals on others as it moves government will ramp up
communications SOEs saw foreign investors’ shareholding forward with the initiative. efforts to protect intellectual
fast growth of 13.4 percent in certain sectors. Tom Troubridge, chair- property rights for local and
year-on-year. Those revenues Li Jin, chief researcher at the man of the China Business foreign companies operating
accounted for more than 51 China Enterprise Research Group at British accountan- in China.
percent of those companies’ Institute, said breaking the cy PwC, formerly known as “Improving property
total revenue. monopoly and boosting com- PricewaterhouseCoopers, rights protection will
Peng said central SOEs will petitiveness is the key to Chi- said Xi’s comments will help enhance the competitive-
continue opening up to na’s SOE reform. Diplomats from Spain, Cameroon, Samoa, Tajikistan, Chile, Jamaica and elsewhere, plus their fami- clarify the purpose of the ness of the Chinese econo-
increase imports and expand “The key is whether they lies, listen on Monday to Shan Jixiang (right), director of the Palace Museum, known in the West as Belt and Road Initiative to my,” the president said.
cooperation with other firms. are globally competitive and the Forbidden City. The envoys to China visited the museum to gain a better understanding of Chi- critics. Xi said the government
The country’s central SOEs are getting more efficient,” nese culture and history. WU BO / CHINA DAILY “Clearly there has been will reorganize the State
will form a purchasing team to said Li. some skepticism about Intellectual Property Office
exactly what China’s agenda this year, step up law
is, so President Xi’s words enforcement and signifi-

Ties: ‘No country’ can go it alone shared future for mankind.


“We hope countries will
work together to build an
between China and the US is
not only in our own interests
but also our responsibility to
are obviously reassuring,”
Troubridge said. “Some have
said it’s just about giving
cantly raise costs for offend-
ers.
Tim Moss, chief executive
open, inclusive, clean and the global community”. China’s construction compa- of the UK government’s
From page 1 world’s future in the next cooperative attitude at the beautiful world that enjoys Cui said it was undeniable nies something to do. ... But Intellectual Property Office,
decades”. international level, countries lasting peace, universal secu- that because of differences it is going to do a lot of good said a healthy and balanced
the 40th anniversary of “For China, the decision is can better share opportuni- rity and common prosperity,” in national conditions, the for a lot of relatively poor intellectual property system
their establishment of diplo- clear and definite: We hope ties and achieve their own Cui said. two sides will not fully agree countries, and there’s no rea- is “important for economic
matic relations, “it’s the China and the US can build a development.” Cui said that because the on many issues. He said the son why the UK shouldn’t competitiveness”.
time … to make a new deci- strong, healthy and sustaina- Cui said that President Xi two nations are the world’s root cause of the imbalance support it, provided these “I welcome President Xi’s
sion, which will have an ble relationship,” he said. “No Jinping has put forward the largest economies and per- is the US economic struc- projects are done in a sus- commitment to IP protection
impact on China-US rela- country can deal with so vision of building a new type manent members of the ture, with low personal sav- tainable way. and look forward to support-
tions, on both of our many problems and challen- of international relations and United Nations Security ings rates and high He said the Belt and Road ing detailed implementa-
nations’ futures and the ges alone. If we can adopt a building a community with a Council, “cooperation consumption. Initiative presents “huge tion,” he said.
4 INTERVIEW Tuesday, April 17, 2018 CHINA DAILY HONG KONG EDITION

Tam looks back


on decade in govt
posts, by-election
By JOSEPH LI in Hong Kong
joseph@chinadailyhk.com

Raymond Tam Chi-yuen


has taken to fresh pastures People were tired
after leaving the government
in July last year when Chief
of filibusters and
Executive Carrie Lam Cheng disturbances in
Yuet-ngor set up the fifth-
term administration. LegCo over the
Since last October Tam past years and
has been with an enterprise
co-founded by his ex-boss, wanted to elect a
former financial secretary
Antony Leung Kam-chung. pragmatic law-
Tam also decided to stand
for election to the National
maker, while his
People’s Congress. He won (Vincent Cheng’s)
a place, drawing 1,580 votes
which ranked him at 15th of opponent’s elec-
the 36 elected deputies — the tioneering strate-
second-best result for a new
entrant. gies were desper-
Tam was the principal offi-
Raymond Tam Chi-yuen, Hong Kong deputy to the National People’s Congress and former secretary for constitutional and mainland affairs, said electoral reform
cial for constitutional and
ately unrealistic.”
is no longer the priority for the city’s government. JOSEPH LI / CHINA DAILY
electoral affairs for nearly Raymond Tam Chi-yuen, Hong
10 years. As a trio, Lam, Tam Kong deputy to the National

‘Slim chance’ to reopen and then secretary for justice


Rimsky Yuen Kwok-keung
handled constitutional devel-
opment for nearly two years.
“We had good, close work-
ing relations. I cannot say it
People’s Congress, commenting
on Vincent Cheng Wing-shun’s
victory in the Legislative Council
by-election on March 11

the past two years under the

electoral reform soon


had soured but it had come leadership of Martin Liao
to a time we didn’t always see Cheung-kong, the “prefect”
eye to eye. I also said last year of the camp.
it is healthy to have different “Vincent (Cheng) is a nice
opinions in a team. If team young man with ideals and
members have the same opin- a presentable public image.
Overhaul only possible if task force is in place by “Since they had vetoed
the proposal, another pro-
ions, the team will be lean-
ing toward the other side,” he
Being a district councilor for
10 years in that constituency,
posal would not come again explained. he has shown huge commit-
October, former constitutional affairs chief says so quickly and Hong Kong Tam also revealed that he ments to serving the resi-
If a task force is people may have to wait for would probably have stayed dents.
By JOSEPH LI in Hong Kong ment task force was formed in government. If a task force is not formed before another 10 years. in the post if the previous “I campaigned for him on
joseph@chinadailyhk.com October that year. not formed before 2018 third “If the opposition lawmak- chief executive Leung Chun- one or two occasions, as well
“This is now April 2018,” he quarter, I can say the chance 2018 third quarter, ers were willing to ‘pocket ying had remained in the as playing guitar and singing
The administration could said. “Unless a constitutional will be zero.” it first’ by carrying the 2017 position for a second term. with him live on Facebook.
reopen electoral reform efforts development task force is At this point, Tam couldn’t I can say the chance package, improvements of the Leung Chun-ying was very Other ex-officials Ko Wing-
so long as it forms a constitu- formed no later than the third avoid criticizing the opposition
lawmakers, who in 2015 defied
will be zero.” nomination procedure and
the expansion of the voter
receptive to opinions and
suggestions, he added.
man and K.C. Chan rallied
for him too. I didn’t know
tional reform task force later quarter this year, there will
this year, though the chance not be enough time to handle overwhelming public opinion Raymond Tam Chi-yuen, Hong base would definitely be made “On some occasions he had whether ‘an old battery’ like
is slim in the current term, this huge task,” Tam said in and vetoed the universal suf- Kong deputy to the National for 2022,” Tam said. rather strong views on cer- me would help or harm his
said Raymond Tam Chi-yuen an exclusive interview with frage package for electing the People’s Congress and former However, electoral reform tain issues and I had strong campaign but the feedback
— former secretary for consti- China Daily. CE by one-person-one-vote, secretary for constitutional and is no longer the priority for views too. And in the end, he was okay,” he said jokingly.
“Even though an electoral which could have been intro- mainland affairs Hong Kong’s governance, Tam accepted my suggestions. Our Given that the March 11
tutional and mainland affairs.
Tam, who is now a Nation- proposal to elect the chief duced for last year’s poll. noted. relationship has been good polling day clashed with
al People’s Congress deputy, executive by universal suffrage Tam said this was the heavi- the poll. Tam said it was in no “I believe constitutional and we also dined together the annual national legisla-
handled constitutional reform is carried, almost two years est failure of his ministerial way fake universal suffrage. reform is not high on the in Beijing last month,” Tam tive and consultative two
on three previous occasions. are needed for local legisla- career. “I wish I had the right to agenda of the central govern- disclosed. sessions, all 36 NPC depu-
Recalling his most recent tion — that is to rewrite the The electoral reform pack- vote and choose the CE last ment and Chief Executive Tam had worked closely ties remained in Beijing and
experience — during the main ordinance, amend the age, based on the constitu- year,” he lamented. Carrie Lam Cheng Yuet-ngor,” with other chief executives, could not return to Hong
government of former chief related ordinances and renew tional framework the NPC “The ‘pan-democrats’ acted Tam said. “And I agree with serving as director of the CE’s Kong to cast votes.
executive Leung Chun-ying in the voter-registration roster. Standing Committee set out wrongly to reject the electoral her that the special admin- Office in Donald Tsang Yam- Tam remembered a by-elec-
2012-17 — Tam began prepara- “There is a slim chance to in August 2014, would have proposal. I don’t know but I istrative region government kuen’s era. tion was last held in February
tory work in the summer of reopen the electoral reform let all eligible permanent resi- believe many of them regret- should now focus on economy “Donald (Tsang) was some- 2016. Scheduled for the end
2013; a constitutional develop- within the current term of dents of Hong Kong vote in ted doing that,” Tam said. and people’s livelihoods.” one who gave a total free of February after the Lunar
hand to his staff. He will not New Year holidays and bud-
employ you if he suspects get speech, it did not clash
you, but if he employs you, with the two sessions, which

National Anthem Law ‘will not affect freedoms’ he will not suspect you,” Tam
remarked.
“I accepted the post because
are fixed in March every year.
“When I knew in Beijing
that Vincent had won, I was
he had trust in me. Because of very happy. The result was
By JOSEPH LI in Hong Kong promulgation and domestic his trust, we worked as best as the most unexpected because
joseph@chinadailyhk.com legislation, the special admin- we could not let him down.” I thought he would lose.
istrative region government “I have summed up why he
The National Anthem Law, prefers local legislation, adapt- By-election win a delight won. First, his personal quali-
which the government tabled ing the National Anthem Law Since he was no longer an ties are okay. Since Lam has
to the Legislative Council in to suit Hong Kong’s situation. official, Tam could rally for become CE, the social atmo-
the middle of last month, will Tam is optimistic that it Vincent Cheng Wing-shun, sphere has relaxed and there
not undermine Hong Kong will not take too long to pass the candidate from the big- are fewer confrontations,”
people’s rights and freedoms, the National Anthem Law gest political party in the Tam said.
says Raymond Tam Chi-yuen, although the opposition camp Legislative Council — the “Of course, people were
a National People’s Congress will, as a habit, filibuster and Democratic Alliance for the tired of filibusters and distur-
deputy. delay. Betterment and Progress of bances in LegCo over the past
“The legislative proposal “They have said a lot of Hong Kong — who won in years and wanted to elect a
is quite moderate,” said Tam, (clumsy) things, yet they fail last month’s LegCo by-elec- pragmatic lawmaker, while
who had the National Anthem to stir up trouble or cause dis- tion. his opponent’s electioneering
Law on his portfolio in the turbances in society,” he com- Tam was pleasantly sur- strategies were desperately
previous government, when mented. prised that Cheng beat an unrealistic,” he noted.
he was secretary for constitu- On national security legis- opposition candidate in the Tam reminded Cheng that
tional and mainland affairs. lation prescribed by Article Kowloon West geographical when the general election
“The law designates spe- 23 of the Basic Law, he sug- constituency. comes in 2020, the propor-
cial dates and occasions for gested the right time would be Equally, he was pleased the tional representation system
singing the national anthem, The national and Hong Kong Special Administrative Region flags are raised to the sound of September 2020 following the pro-establishment camp was will be used. This will be dif-
while singing of the nation- the national anthem during the ceremony to mark the 19th anniversary of the establishment of LegCo election, to save it from so united for the campaign, ferent from the “single-seat,
al anthem is encouraged in the HKSAR on July 1, 2016. PROVIDED TO CHINA DAILY being abused as an election demonstrating efficiency and single-vote” system used for
schools by way of education issue; the government should a close-knit team pattern over by-elections.
without carrying any penalty,” do some groundwork in the
Tam said. Refuting their claims, he Article 12 of the International “Flag-raising ceremonies on meantime.
“The spirit of the legislation said the national anthem is Covenant on Civil and Political July 1 and Oct 1 are occasions “Yet, the 2003 drafts are no
does not aim to punish people very solemn thing. In no way Rights. While people enjoy the designated by law and people longer applicable to the con- Raymond Tam’s major posts
who offend the law inadver- will it infringe on freedom of rights, they at the same time have to be solemn when the temporary global and internal
tently. It will only punish those speech or shall it become a are obliged to obey the laws of national anthem is played. situations,” he said.
who willfully distort or insult target of parody. Hong Kong.” Even when you visit the “Many years have passed 2001-03 Press Secre- Constitutional and Main-
United States, you need to be and we have seen big chang- tary to Financial Secretary land Affairs
the national anthem.” “Like anywhere in the He noted some people’s
es internationally, the rise Antony Leung Kam-chung 2012-17 Re-appointed
Tam is aware that people world, liberties of any kind fears they will unknowingly solemn when the US national
2008-09 Under Secre- Secretary for Consti-
from the opposition camp are not without limit,” Tam break the law if they do not anthem is played.” of terrorist and separatist
tary for Constitutional and tutional and Mainland
have proposed many extreme, stressed. sing along when the anthem Tam stressed Hong Kong activities, knowing the cen-
Mainland Affairs Affairs
weird scenarios and made “There should be reason- is broadcast on TV in a res- had a duty to enact the tral government attaches the
2009-11 Director of the 2018-now Deputy to
unsubstantiated claims that able restrictions, such as taurant. He said that this is National Anthem Law after it utmost importance to nation-
Chief Executive’s Office the National People’s
the National Anthem Law restrictions related to nation- surely unwarranted panic as was incorporated into Annex al security, sovereignty and
2011-12 Secretary for Congress
would harm freedom of al security, public order and restaurants are not designated III of the Basic Law. development interests,” Tam
speech and creation. public health as stipulated in places. Having the option of direct explained.
5

CHINA
Tuesday, April 17, 2018

The new ministry will be key in building


up an efficient emergency response system
to safeguard people’s lives and wealth.”
Shan Chunchang, specialist in emergency management for the State Council

CHINA DAILY HONG KONG EDITION

Ministry to improve emergency response


Briefly

FUJIAN
Ex-insurance
exec stands trial
Wang Yin-
cheng, former
In past, rescue teams were scattered, Shan Chunchang, a special-
ist in emergency manage-
prevention from the Ministry
of Land and Resources,
deputy Party
secretary and
but now they’ll be under a single body ment for the State Council,
said that while risk is on the
drought and flood control
from the Ministry of Water
president of rise from increasing popula- Resources and prairie fire
the People’s By HOU LIQIANG worst hit by natural disasters, tions and infrastructure in control from the Ministry of
Insurance Company of houliqiang@chinadaily.com.cn and is adapting to the situa- urban areas, emergency man- Agriculture.
China, a State-owned tion by establishing the minis- agement is underdeveloped “Previously, various rescue
enterprise, stood trial in The new Ministry of Emer- try, said Zhang Xingkai, in rural areas, especially in teams were scattered across
Fuzhou Intermediate Peo- gency Management, which president of China Academy the China’s central and west- different government bodies.
ple’s Court in Fujian prov- officially began functioning of Safety Science and Technol- ern regions. “The new minis- Not every one of these govern-
ince on Monday. Wang was on Monday, will help inte- ogy. try will be key in building up ment bodies, however, will
accused of taking advan- grate China’s scattered disas- Of the 50 natural disasters an efficient emergency respond to emergencies fre-
tage of his positions in the ter-relief resources to cope worldwide with more than response system to safeguard quently. Some of the teams
company from 2006 to with the country’s frequent 100,000 casualties over the people’s lives and wealth,” may be idle for a long period
2016 to seek profits for natural disasters and acci- past three centuries, 26 hap- Shan said. of time, which will affect their
others in return for bribes dents, experts said. pened in China, and 70 per- Officials help inaugurate the new Ministry of Emergency Management The new ministry will take capacity for emergency
of 8.7 million yuan ($1.38 Ceremonies inaugurating cent of the 151 million people on Monday, with Han Zheng, vice-premier and a member of the Stand- over the responsibilities of response,” Shan said.
million), the court said. A the ministry were held in Bei- killed in these disasters were ing Committee of the Political Bureau of the Communist Party of China the former State Administra- As the world enters the era
verdict will be issued at a jing and attended by Vice-Pre- Chinese. Central Committee (third from left). DING HAITAO / XINHUA tion of Work Safety, along of big data, the establishment
later date. mier Han Zheng, who is also Workplace accidents from with functions from other of the ministry will also help
member of the Standing Com- 2011 to 2015 in the country ministries including firefight- in integrating and applying
BEIJING mittee of the Political Bureau are estimated to have result- 1.1 trillion yuan, according to areas with more infrastructure, ing from the Ministry of Pub- emergency-related data, said
Website assists of the Communist Party of ed in direct economic losses Zhang. so improper emergency man- lic Security, disaster relief Wang Yukai, a professor at the
China Central Committee. of 562 billion yuan ($89.4 He said that populations are agement can result in great from the Ministry of Civil Chinese Academy of Govern-
national security China is one of the countries billion) and indirect losses of more densely concentrated in losses. Affairs, geological disaster ance.
Members of the public can
now use a website to alert

Scientists find
authorities about activities
that compromise national
Accidental ox
security, including espio-
nage, according to the
Ministry of National Secu-
rity on Sunday. People can
use the ministry’s website,
www.12339.gov.cn, or call
solutions to keep
12339. In a statement, the
ministry pledged to pro-
tect the privacy of inform-
rockets working
ants. Those who provide
valuable information will By ZHAO LEI
be rewarded if the infor- zhaolei@chinadaily.com.cn
mation is true, but will be
held responsible for pro- Chinese engineers have
869
viding false information determined what caused the metric tons
intentionally, the state- failure of the second flight of
ment said. Liftoff weight of China’s
China’s largest carrier rock- largest carrier rocket, the
et, a Long March 5, in July Long March 5, which has
China plans new and have come up with cor- a maximum payload of 25
rective solutions, according
weather satellite to the State Administration
tons to a low-Earth orbit,
China will launch a new or 14 tons to a geosyn-
of Science, Technology and chronous transfer orbit
meteorological satellite in Industry for National
the first half of this year to Defense, which oversees the
further increase its weath- program.
er forecasting capabilities, The administration said as the government had to
according to China Aero- in a statement on Monday postpone several key mis-
space Science and Technol- on its website that a num- sions, including the
ogy Corp. The Fengyun II ber of simulations, calcula- Chang’e 5 expedition, which
09 satellite, the last in the tions and ground will send a rover to the
Fengyun II series, will be experiments were carried moon and return with sur-
able to collect meteorolog- out and results point to face samples.
ical, maritime and hydro- structural abnormalities China’s space launch
logical data to help inside the turbine exhaust activities were suspended
weather forecasting in device of one of the first for nearly three months aft-
China and neighboring stage’s liquid oxygen/liquid er the failure. They
regions. The satellite will An ox is hoisted onto a truck on an expressway in Qingdao, Shandong province, on Sunday. The animal fell off another truck and aggressively hydrogen engines. resumed at the end of Sep-
be launched from Xichang charged at vehicles. Police officers eventually subdued the ox and hauled it away. ZHANG XIAOPENG / FOR CHINA DAILY The abnormalities caused tember.
Satellite Launch Center in a sudden loss of engine The strongest and most
Sichuan province. thrust, depriving the rocket technologically sophisticat-
of lift, the statement said. ed rocket built by China, the
GUANGXI
Toddler dies
in knife attack
3 former minister-level officials are charged So far, engineers have car-
ried out several ground igni-
tion tests on the modified
Long March 5 has a liftoff
weight of 869 metric tons, a
maximum payload of 25 tons
engine and concluded that to a low-Earth orbit, or 14
A toddler died and three By ZHANG YAN fits for enter- In a sepa- People’s Proc- the changes are effective, it tons to a geosynchronous
others were injured in a zhangyan1@chinadaily.com.cn prises or rate develop- uratorate No 1 said, adding that a third transfer orbit. Its payload
stabbing in Nanning on individuals, ment, Yang Branch. Long March 5 is under con- capacity is about 2.5 times
Monday, local police said. Three former minister-level then accepted Chongyong, The Chong- struction and will be greater than any other Chi-
A mother was assaulted by officials have been charged huge bribes former vice- qing Procura- launched this year. The nese rocket.
a man with a knife at noon with bribery, the Supreme either paid in chairman of torate has sent statement did not say what The giant rocket’s first
as she was walking with People’s Procuratorate said on Xiang Junbo cash or prop- Yang the Hebei Peo- Yu Haiyan the case to that rocket’s payload will be. flight was in November at
her child in a stroller. The Monday. erty. Chongyong ple’s Congress Chongqing If the third flight goes well, the Wenchang Space
mother was injured, as Xiang Junbo, 61, former Xiang had Standing Municipal No 1 then the rocket’s fourth mis- Launch Center in Hainan
were two passers-by who chairman of the China Insur- served as vice-president of the Committee, was charged with Intermediate People’s Court sion will send the nation’s province.
intervened. The suspect ance Regulatory Commission, People’s Bank of China, Party bribery by Tianjin Municipal for prosecution. Chang’e 5 lunar probe to the Engineers have started
has been detained by was charged by Changzhou secretary and president of People’s Procuratorate No 2 Prosecutors charged that he moon, the administration assembling the first proto-
police, but no other infor- Intermediate People’s Court Agricultural Bank of China Branch. abused power to gain benefits said. type of the Long March 5B,
mation was released. in Jiangsu province. and chairman of the China According to the indict- for others, and demanded cash Scientists and engineers a variant that will be tasked
According to a witness, the When the investigation Insurance Regulatory Com- ment, Yang, while serving as a or property in return. are pinning their hopes on with lifting the Chinese
suspect is around 25 years was complete, the SPP trans- mission. member of the committee and According to a five-episode the Long March 5 and its space station’s core module
old. The police have inten- ferred the case to the The Central Commission as deputy governor of Hebei documentary released by the variants because the space and other parts, the China
sified armed patrols on the Changzhou people’s procura- for Discipline Inspection, Chi- province, made use of his Central Commission for Disci- industry wants to use them Manned Space Agency said
street. torate, which then forwarded na’s top anti-graft watchdog, position to benefit others in pline Inspection in Septem- to ferry the first Chinese last month.
the case to the court for pros- launched an investigation in exchange for large bribes. ber, Yu cut up all the photos space station into orbit, as That rocket is expected to
YUNNAN ecution. September. In October, Xiang Yu Haiyan, former vice- taken with the people who well as send probes to Mars make its first flight around
174 kg of drugs According to the indict- was expelled from the Party governor of Gansu province, bribed him and flushed them and Jupiter. June next year to verify its
seized by police ment, Xiang took advantage and dismissed from public was also accused of bribery down the toilet to destroy the The July failure affected reliability and capabilities,
of his position to gain bene- office for corruption. by the Chongqing Municipal evidence. the country’s space agenda the agency said.
Police in Yunnan province
have caught three suspects
and seized 174 kilograms of
methamphetamine, the
public security bureau in
Woman believes classmate stole her identity a woman of the same name
had been working with the
education bureau in her
through the admissions
office.
According to Jing, Li Min
Menglian county said on hometown, Sanyuan. She later had previously told her that
Monday. Earlier this month, By LI LEI accountable,” Liu Jun, an recognized by the real Jing as the exam and my student files recognized the person as Li the arrangement was han-
police received a tip that a lilei@chinadaily.com.cn officer of the province’s San- Li Min, a junior high school were lost, but I wasn’t told my Min. Jing believed Li had sto- dled by her parents and she
group of drug dealers were yuan public security bureau, schoolmate who she said had score,” she said, adding it was len her student file and went offered to settle the issue with
planning to bring a large Police in Shaanxi province told Shaanxi Television on not done well in school. a major blow that later had on to technical school using money, which Jing refused.
amount of drugs over the are looking into the case of a Monday. Jing, 36, who lives in Xi’an, tremendous effect on her her identity. The education bureau in
border to China. The gang woman who allegedly stole a The suspected impostor, Shaanxi, told China Daily that character. Jing also said it is not likely Sanyuan released a statement
was busted on Saturday in classmate’s student file 20 who allegedly assumed the she was doing well at school Jing went on to high school to be a single case because the on Saturday saying it had sus-
Lancang county, police said. years ago and has since lived identity of Jing Gaofeng, was and was certain she could pass but her academic perform- file of her sister, Jing Gao- pended the impostor from her
The case is under further under a fake identity. the former head of a local the technical school entrance ance declined. She then went fang, was also reported miss- duties and would investigate.
investigation. “The bureau will follow the kindergarten and transferred examination in 1998. on to junior college and found ing when applying for a Li Min resigned from the
case through to the end and to work with the local educa- “I was surprised when my a job in Xi’an. technical school and was bureau later that day, the
XINHUA—CHINA DAILY hold all the people involved tion bureau. She was later principal told me that I failed In 2017, Jing discovered that retrieved by their father bureau said.
6 CHINA Tuesday, April 17, 2018 CHINA DAILY HONG KONG EDITION

Residents
VR provides
Learning tour

love their
training for free-range
chickens
autistic kids SHIJIAZHUANG — Chick-
ens roam on a vast farm in
Hebei province, occasionally
fluttering up into the trees.
Unlike other free-range
Simulated environments help them fowl, each wears an electronic
anklet that count steps to
learn how to interact in real world determine when they are
ready for market.
“We don’t sell them until
By ZHOU WENTING watching people’s faces, nor they have taken more than 1
in Shanghai do they pay attention to oth- million steps, roughly 160
zhouwenting@chinadaily.com.cn ers’ expressions,” said Liu days,” said He Xiaofei, manag-
Xiao, senior marketing man- er of the chicken farm in Wuyi
More than 1,000 autistic ager at Invision. “The game county. Walking around tight-
children in Shanghai have was designed to help them ens chickens’ muscles and
been getting positive results form the habit of looking at makes their meat more tasty.
from training that uses virtual others’ facial expressions.” Canadian Hager Braham (left) and South African Jyotika Chauhan (center) learn Chinese during a tour of the Binhai Cultural Center Some 10,000 chickens are cur-
reality technology to improve In a rowing game, users can — a complex of multiple cultural facilities that includes an art gallery, library and theater — in Tianjin on Sunday. The community rently strolling around the
their perception of people and control two paddles with the college of Tianjin Economic-Technological Development Area has conducted Chinese courses for foreigners working in the area farm’s 14 hectares. All of them
their surrounding environ- gamepads and keep the virtu- since 2014. JIA CHENGLONG / FOR CHINA DAILY eat only natural food.
ment. al boat moving toward the The chicken farm is a pover-
It works by immersing the shore. Liu said the game is ty alleviation project support-
children in interactive games. aimed at cultivating better ed by the county government
“The features of VR, such as
users being immersed and
interactive, inspire imagina-
tion and perfectly fit what
physical coordination and a
sense of direction and dis-
tance.
More than 1,000 autistic
Job prospects improve for graduates and shopping site JD.com.
Wuyi is one of the poorest
counties in China, with most
of the farmland barren and
children suffering from children between 3 and 12 at By JIANG CHENGLONG related to manufacturing, said Zhou Rong, the universi- alkaline. More than 60 percent
autism need,” said Zhai the city’s rehab centers have jiangchenglong@ software and information ty’s top employment official. of the residents in poverty are
Guangtao, co-developer of the tried the system, and teachers chinadaily.com.cn technology,” said Xue Yong, “We will continue enhancing elderly, sick or unable to sup-
system and a professor at said they appear to enjoy the an employment official in our career guidance.” port themselves.
Shanghai Jiao Tong Universi- games when playing. Employment prospects for Jiangsu province’s human Beijing’s urban compre- With small interest-free
ty. “VR can be an ideal “Another advantage of VR is college graduates are better resources department. hensive plan, released in 2017, loans provided by JD.com, vil-
approach to assist in interven- that some scenarios are hard this year, as employers flock “It’s the Internet Plus strat- required that the capital’s reg- lagers are able to claim some
tion and treatment for these to create with physical items, to universities to recruit egy and the manufacturing ular resident population chickens and receive a divi-
kids.” and it’s costly in time and them, according to university industry’s upgrade to the should be no greater than 23 dend when they are sold.
The approach was devel- labor to take the children to employment officials and high-end level that are driv- million in 2020. The number Some also have part-time jobs
oped jointly by Shanghai Invi- real places because each local authorities. ing the trend,” he said. “The at the end of 2017 was 21.7 mil- on the farm.
sion Digital Technology Co needs an escort,” said Li Chao- “Companies have present- need for talent in industrial lion, which was its first drop The government insures the
and experts at the Shanghai bai, director of Wucailu, a ed information at our univer- research and robots is grow- in 17 years. That means there chickens, guaranteeing the
Mental Health Center and the rehab center for autistic chil- sity since September — a ing.” won’t be as many jobs in Bei- incomes of the resident “inves-
university’s School of Elec- dren. “VR makes it possible at much earlier start than in the In 2015, the State Council jing for graduates as before. tors”.
tronic Information and Elec- a low cost.” past,” said Liu Rui, deputy launched the Internet Plus Wei Boyu, a master’s degree Li Xisheng, 76, borrowed
trical Engineering. Invision co-founder Pan director for career develop- and Made in China 2025 candidate in water conserva- 4,500 yuan ($716) to claim 100
Pan Geng, co-founder of said the games are just the ment at Beihang University, a strategies, aiming at combin- tion engineering at China chickens last year. When they
Invision, said that compared children’s first step. Develop- prestigious engineering Medical students wait in line ing the internet with the Agricultural University, said were ready for market, JD.com
with pictures — which teach- ers are working on a second school in Beijing. at a career fair for grassroots economy deeply and fully he never expected to work in paid him 10,000 yuan. After
ers traditionally use to explain phase, which uses VR to simu- “There were more than 200 medical facilities in Xi’an, enhancing the ability to make Beijing. deducting loan repayment
objects and scenarios to chil- late different social scenes to job fairs held last year — also Shaanxi province, earlier this equipment at a high technical Heavier demand for talent and farm management fees —
dren — VR brings in a lifelike help children obtain and far more than before,” he said. month. LI YIBO / XINHUA level. may not be good for gradu- water, electricity and slaugh-
environment and provides a improve communication “Our graduates received four Data from recent years ates who didn’t prepare well tering — Li was left with a net
stronger sense of reality. skills and better integrate into offers on average, an increase show that more graduates of for the job market. Renmin’s 3,000 yuan.
“Autistic children are easily society. from three in recent years. said Lu Yu, deputy head of Beijing universities are choos- Zhou said many students “The chickens have changed
distracted. But when wearing “With such a VR system, The offers’ average salary was Henan province’s talent ing to work outside the city. regretted hurriedly signing my life,” Li said, adding that he
a VR helmet, most of them are children will walk virtually higher, too.” exchange center. The ratio of “In 2003, nearly 80 percent contacts with thirsty compa- has just bought an electric tri-
highly interested and into classrooms, restaurants According to the Ministry jobs to students is 1.61 to 1, of graduates took jobs in Bei- nies last year. cycle.
immersed in the three-dimen- and scenic spots and be greet- of Education, nearly 8.2 mil- meaning there are more jobs jing. But in the most recent A human resources worker The free-range chickens sell
sional pictures and sound,” he ed by different people. They lion university students will available per student than five-year period more than surnamed Wang with New well online and are shipped
said. will gradually learn how to complete their studies at the last year, Lu said. half have taken jobs in other Hope Group, a leading com- ready-to-cook. They cost 168
Five games are included in respond in various scenarios,” start of summer. To get first As the manufacturing and cities,” said Wan Yi, deputy pany in the agriculture and yuan to 188 yuan, three or four
the VR system, Pan said. In Pan said. pick of the graduates, most information technology head of career development food sector, said the company times the price of a normal
one, users wear a VR helmet Li said the VR system companies in the past have industries in the nation devel- at Tsinghua University. found that many graduates chicken. Buyers have left more
and virtually “walk” toward a should include scenarios of held information sessions or op, more graduates majoring Renmin University of Chi- didn’t know exactly what they than 14,000 comments on
wall of pictures showing dif- crossing a street and riding a hosted job fairs starting in in science and engineering na has actively helped its wanted. JD.com, mostly expressing
ferent facial expressions. The bus to give the children safety October or November. are needed. graduates find jobs outside “We prefer those with awe about the taste.
child clicks on the matching training and help them “There were nearly 126,400 “Based on our statistics in Beijing. “Now the proportion good preparation and who China’s expanding middle-
faces. acquire the ability to go out graduates seeking jobs at our the first quarter of this year, of our students who work in know themselves better,” she income group has created a
“Autistic children don’t like alone. recruitment service agencies,” more than half of the jobs are other places is 49 percent,” said. lucrative market for high-
quality agricultural products,
attracting investors that

Shanxi province sees tech as key Men of


steel
include internet giants Aliba-
ba and NetEase. Both compa-
nies have free-range pig farms.

to its industrial transformation In the industrial park of


Delong Steel Co in Xingtai,
Liu Wei, deputy head of Wuyi
county, said the chicken farm
benefited poor villagers while
Hebei province, workers are bringing profits to big business,
By SUN RUISHENG early March, 30 million tons He said the production dwarfed by some of the 215 Liu said. It has helped lift more
in Taiyuan of excess steel capacity and base is expected to reach a steel sculptures made from than 400 households out of
and YANG WANLI in Beijing 150 million tons of excess coal capacity of 800,000 tons of waste car components and poverty since March 2016 and
capacity will be cut this year. cobalt-based Fischer and other metal parts. The larg- will be expanded this year with
Shanxi province, long a To achieve the target, 400,000-ton synthetic lubri- est figure stands 10.8 facilities catering to tourists.
powerhouse of coal and steel Shanxi has overhauled its cating oil within three years, meters high and weighs “With more income expect-
production, is stepping for- resource strategy, which now aiming to be the largest high- 4.2 metric tons. ed, more people will cast off
ward to transform its tradi- includes the expansion of end lube production base in LAO CHEN / FOR CHINA DAILY poverty this year,” Liu said.
tional coal industry and clean energy, including natu- China.
develop more clean energy ral gas and hydropower. “The chemical business will XINHUA
with the help of technology. Enterprises in the sectors of account for a larger part of
Three major goals have coal, electrical generation and Shanxi’s economy by the end
been set, including building
the province into a model of
economic transformation, a
transportation, in particular,
are encouraged to restructure
or introduce cross-sharehold-
of 2025,” Li said. “We will
select firms with conditions
and needs for structural
‘Toxic’ liquor? Group seeks to defend doctor
leader in the energy revolu- ing, which will increase com- reform as partners to develop
tion and a new example of petitiveness. the production base.” By WANG XIAODONG cheng, was toxic. The claim said the health benefits of the Hongmao should try to pro-
opening up to the world, said Over the past two years, a Apart from reforms in the wangxiaodong@ allegedly caused big losses for liquor were exaggerated and tect its rights through civil liti-
Luo Huining, Shanxi’s Party total of 52 coal mines have coal industry, the provincial chinadaily.com.cn the company. that the manufacturer had gation, as there is a lack of
secretary. closed in Shanxi — outdated government is also planning Police detained Tan with been punished by drug super- evidence that Tan has dam-
Over the next five years, the production capacity of about to build a green manufactur- The detention of a doctor sufficient evidence to prove vision authorities in some pla- aged its business reputation.
province will build a solid 46 million tons. ing system, which aims to who said that a liquor product criminal activity damaging ces in China over false “There is no evidence to
foundation for a comprehen- Technology has been a transform traditional indus- was toxic has prompted the the reputation of a business, it advertising. prove the cause-effect rela-
sive economic transforma- leading force in driving the tries into greener and more Chinese Medical Doctor Asso- said. Tan worked as an anesthesi- tionship between Tan’s article
tion. province’s economic trans- environmentally friendly ciation to call for caution in In a statement on Monday, ologist at Third Affiliated Hos- and the loss the company
By 2030, it will set up a formation. modes of operation. the use of the criminal law. the association of doctors said pital of Southern Medical claimed,” he said.
clean, safe and efficient sys- Experts in Shanxi Lu’an To achieve economic trans- The group also said it would it had carefully read the article University, in Guangzhou, Li also said he had read the
tem of modern resources, Group, one of the five largest formation as an energy like to provide the doctor with written by Tan and the state- Guangdong province, and has article thoroughly and found
with support from many oth- coal enterprises in Shanxi, are resource-based economy is a legal assistance. ment given by Liangcheng’s worked at a technology com- it basically consists of academ-
er industries to complete the exploring coal’s potential role big challenge, not only to Tan Qindong, 39, who holds public security bureau. It said pany since 2015, according to ic opinions. Normally in such
transformation of its in making other clean and Shanxi, but also the world, a master’s degree in anesthesi- it is trying to contact Tan’s wife Red Star News in Chengdu, cases companies should sue
resource-based economy. environmentally friendly Luo said. ology, was detained by police with an offer of assistance. Sichuan province. for compensation, he said.
“As a province with the coal alternatives. In February, it “It’s not a mission that can in Liangcheng county, Inner The association also urged Hongmao Pharmaceutical’s Also on Monday, the China
industry as its major econom- founded a coal chemical com- be accomplished by just one Mongolia autonomous region, pharmaceutical companies to advertisements state that the National Drug Administration
ic contributor, Shanxi’s pany. action. But the fear of difficul- on Jan 10 and the case has strictly follow laws and regula- liquor is made from dozens of said in a statement that the
resource transformation “The company will become ties should also be dispelled,” been transferred to prosecu- tions in their advertisements, traditional Chinese medicines liquor is currently an over-the-
experience will provide some a production base of fine he said. “Only with great tors, the county’s public secu- and called on the public secu- and can relieve pain, cure counter drug, but it may cause
reference to many other pla- chemicals and lubrication oil determination and long-term rity bureau said on Sunday. rity bureau of Liangcheng to colds and increase vigor. It is a serious side effects if people
ces,” Luo said. to turn traditional basic fuels effort will the transformation According to the bureau, treat academic opinions and traditional Chinese medicine fail to follow instructions.
China has set a goal of cut- and raw chemical materials become a ‘mission possible’.” Tan claimed in an article he speeches with prudence and product approved by China’s The administration is con-
ting 800 million metric tons into high-end fuels and fine posted online that a liquor avoid treating civil disputes as former Food and Drug Admin- sulting experts to help decide
of coal capacity by 2020. chemicals,” said Li Jinping, Contact the writers at product produced by Hong- crimes. istration in 2015. whether to change the prod-
According to the Govern- chairman of the group and an yangwanli@ mao Pharmaceutical Co, Tan published the article Li Ya, a partner at Zhong- uct’s designation to a prescrip-
ment Work Report released in NPC deputy. chinadaily.com.cn which is located in Liang- online in December. In it he wen Law Firm in Beijing, said tion drug, it said.
CHINA DAILY HONG KONG EDITION Tuesday, April 17, 2018 CHINA 7
Technology

Majority Year’s Day, she sent me a spin-


ning emoji with the Chinese
characters for happy holi-

of elderly days.”
For the National Day holi-
day in October, she sent him
netizens an emoji containing a shiny
character for the mother-
land, followed by two danc-
victims ing characters saying “long
life”.
“Her emojis have always
of fraud been direct and simple, but
also filled with best wishes,”
Chen said.
By LI HONGYANG Chen added that many eld-
lihongyang@chinadaily.com.cn erly love the idea of sharing
articles about health and tra-
As China’s elderly popula- ditional Chinese medicine as
tion grows, the number tar- well as “chicken soup for the
geted by online fraud is also soul” with friends on
increasing, according to a WeChat.
survey released last month For others, like 67-year-old
by internet giant Tencent retiree Yin Yuzhen, using
and the Chinese Academy of internet tools helps make life
Social Sciences. much easier.
It found that just over two- Yin and her husband live
thirds of elderly internet on the fourth floor of a build-
users, most of independent ing in Beijing that has no ele-
financial means, had fallen vator.
victim to an internet scam. “Shopping for heavy items
More than half chose not to like cooking oil and staple
seek help, preferring to treat foodstuffs such as rice and
the experience as a lesson. flour used to be a big head-
“Elderly people need ache,” she said. “Now we have
more support and opportu- delivery of such things to our
nities to connect to the doorstep, sparing us from that
internet,” said Tian Feng, a trouble.”
researcher from the acade- When going out, Yin usually
my. “They should be forgiv- books a car service via an app
en and encouraged during Two elderly women show how they use their smartphones for video chats during an internet class for senior citizens in Taiyuan, Shanxi province. PROVIDED TO CHINA DAILY on the smartphone her son
the process of learning. gave her two years ago as a
“Support from their chil- birthday gift.
dren is very important to
enhance their ability and OLD AND ONLINE: “Nowadays, we cannot live
without the internet and the
prevent them from being mobile phone, particularly

CHINA’S AGING
duped.” when our son is far away from
According to a World us,” she said.
Health Organization report However, every coin has
in 2015, 28 percent of Chi- two sides. As many elderly
na’s population will be 60 become more interested in

INTERNET EXPLORERS
or older by 2040, up from the internet, some of their
12.4 percent in 2010. children have expressed con-
As more elderly people cern.
surf the web, they are also “My father is addicted to
encountering a wider range surfing the internet these
of online functions and days,” Jiang’s daughter said.
increasingly using them,
according to the survey, Those aged 50 or older comprise more than 10% of the online population, “His eyesight is not every
good, and I worry that reply-
which focused on those
aged 50 and older — people making them a growing force in cyberspace, as Xinhua reports. ing to messages on the singing
platform will be bad for his
defined by researchers from health.”

W
the academy as elderly. hen most of his But that might no longer be and I have 442 followers on “I had a video chat with my Liu Jun, an office clerk in
friends are the case, with a report by the WeSing,” Jiang said. “My grandson yesterday,” said Pan Wuhan, Hubei province, also
working in the China Internet Network Infor- daughter said that I use the Xuelan, 60. “He looked fatter expressed concern about the

25 percent fields, 53-year-


old Jiang Licun is living a life
mation Center saying that by
the middle of last year, roughly
app much better than she
does.”
than last time.”
Pan’s daughter bought her a
health effects of her 68-year-
old father’s “internet addic-
of elderly respondents of fame on the internet. 25 percent of China’s 751 mil- I had a video By the end of 2016, more smartphone and taught her tion”.
surveyed by Tencent Putting on a headset, Jiang lion internet users were aged than 230 million Chinese were how to use WeChat. She said he stays online for
use their smartphones records a popular song on a 40 or above. chat with my older than 60, according to the “I chat with my family every an average of four hours a day,
singing app on his mobile Those aged 50 or more Ministry of Civil Affairs. The week on WeChat,” Pan said. and that meant “he doesn’t go
to pay daily fees or use
taxi apps. phone and uploads it. Within a accounted for over one-tenth grandson government predicts the “The internet truly makes life out and engage in physical
few minutes, the song has of the online population, up by country’s elderly will account easier.” exercise as before, which
more than 20 comments and more than 10 percent from the yesterday. ... for about 25 percent of the Elderly WeChat users have might not be good for his
some listeners give him virtual end of 2016, the report said. population by 2030. even created a series of special health”.
The team conducting the flowers as encouragement. That makes the elderly an
I chat with my In an era of information emojis, featuring various big Zhao Jie, a business profes-
survey interviewed more
than 800 elderly people
“I like reading the com-
ments, and I usually reply one
ever-growing force in cyber-
space as they follow news,
family every accessibility, many elderly peo-
ple are beginning to explore the
characters and extremely
bright colors. A report by Ten-
sor at Anhui University who
has conducted research on the
from both urban and rural by one,” said Jiang, who lives search for and share informa- week on internet to enrich their lives, cent said they are usually filled use of micro blogs, said the
areas and analyzed the in eastern China’s Anhui pro- tion, shop, seek entertainment with 98.5 percent using Ten- with “positive energy”. need for emotional communi-
browsing data of 35 mil- vince. and stay connected with fami- WeChat. The cent’s WeChat messaging app. Such emojis, which carry cation and socializing prompt-
lion, which was provided Sharing songs online is ly and friends via the internet. About 70 percent make vid- traditional messages such as ed many elderly to explore the
by Tencent, which operates Jiang’s favorite pastime and his For many, online music plat- internet truly eos to share online, 40 percent “Wish you every success!” internet.
the WeChat messaging app. online activity could be seen as forms such as Tencent’s We- use the internet to pay mobile and “Have a wonderful morn- “Their children should
The survey found that typical of many members of Sing have created a new stage. makes life phone bills and 30 percent ing!”, are considered dated by spend more time with them,
elderly people mainly use China’s vast elderly population, They can find songs released shop online, according to a many young people, but and encourage them to go out
the internet for informa- who have been considered an in the 1980s and ’90s on such
easier.” report by Tencent and the Chi- appeal to some due to their rather than staying at home,”
tion and communication. “unconnected group” in the platforms, connect with other nese Academy of Social Scien- retro feel. Zhao said. “Their lives will
Pan Xuelan, 60
Over 75 percent browse internet age because many singers who share similar tast- ces. Many also know how to “For every holiday, my mom become more abundant with
news and information struggle with the devices and es, and even sing together with give money in virtual red sends me such emojis,” said more companionship, and
online, and more than half processes needed to gain access a complete stranger. envelopes — or hongbao — via Chen Xiaojie, a teacher in Bei- they will rely less on the inter-
can conduct internet to the internet. “I have uploaded 133 songs, WeChat. jing. “For example, for New net.”
searches on their own.
The interviews showed
the elderly are most inter-
ested in political and social
news, with few caring
about entertainment news.
Those who actively search
the web are likely to be
looking for information
about health, travel and
tips about daily life.
Virtually all elderly Chi-
nese know how to use
WeChat and they can also
shoot short videos focusing
on travel, exercise and their
grandchildren. The clips
they share on the app are
mainly humorous.
Almost 70 percent use
WeChat to contact their
partners to arrange dancing
exercises in public spaces,
while more than two-thirds
coordinate travel plans with
friends via the app.
However, when it comes
to more complex transac-
tions, such as shopping and
actually booking tours,
fewer elderly people choose
to use the internet.
The survey found that
about 30 percent can navi-
gate using smartphone
apps. But just 25 percent pay
daily fees online or use taxi
apps, and few use the inter-
net to book tickets or regis- Chen Jiahui, 85, registers and pays for treatment at a hospital in Changsha, Hunan province, using her A woman teaches her 75-year-old grandmother how to use Alipay to buy drinks in Urumqi, Xinjiang
ter at hospitals. smartphone in October. WANG TIANCONG / XINHUA Uygur autonomous region, in October. HU HUHU / XINHUA
8 POLICY REVIEW Tuesday, April 17, 2018 CHINA DAILY HONG KONG EDITION

SHI YU / CHINA DAILY

Zero-tariff step is good medicine


said other measures will be “Prices should be really patients suffering cancer, the copied by domestic pharma-
Anti-cancer drugs will soon be
cheaper after State Council move
carried out to increase the
benefits for cancer patients
and their families.
4.29 reduced for some anti-cancer
drugs that patients are in des-
perate need of to make them
center said. Many of them are
facing long periods of treat-
ment with imported medici-
ceutical factories, he said.
Zheng said the monthly cost
of 5,000 yuan for him was a
A significant level of value-
million and their families to feel the nes. huge burden, but it’s even
By HU YONGQI icines, I also face medical bills added taxes will be reduced Number of new cancer difference.” Tariff rates for imported more difficult for some of his
huyongqi@chinadaily.com.cn generated from other thera- for the production and import diagnoses in China Just two days before the cancer medicines range from 2 friends using targeted drugs.
pies like many other cancer of cancer-treating medicines. each year, accounting meeting, Li visited Shanghai to 8 percent depending on the Shi Lichen, founder of the
Zheng Lei and his friends patients’ families,” Zheng said. Government procurement for one-fourth of the Roche Pharmaceuticals Co, types and their origin. medical assessment agency
were both excited and relieved “So when my friends told and cross-border e-commerce world’s total which focuses on anti-cancer Chen Bo, a professor at the Maisikanglai Technology Co
on Thursday when they heard me the price of drugs from will also be used to eliminate medicines. He said some Cancer Hospital of the Chi- in Beijing, said the move dem-
that the State Council, China’s overseas will probably drop unreasonable prices and sur- drugs can be included in medi- nese Academy of Medical Sci- onstrated the country’s deter-
Cabinet, announced that the when the zero-tariff policy is charges. cal insurance and called on ences, said the no-tariff policy mination to reduce prices of
country would levy no tariffs effective, I was hugely The move was the latest aft- ber equivalent to nearly one pharmaceutical companies is expected to mostly benefit anti-cancer medicines.
on imported cancer-fighting relieved. My medical bills will er the premier pledged the fourth of the world’s new can- like Roche to reduce the prices patients using targeted drugs. “Additional policies should
medicines from next month. shrink,” he said. central government’s determi- cer patients each year, said the of key medicines. These fight the spread of can- also be introduced at the
Over the past 18 months, the The no-tariff policy to nation to levy as few tariffs as National Center for Cancers. According to the National cer by targeting specific mole- same time, including short-
33-year-old engineer in Hefei, reduce the cost for cancer-pa- possible on imported cancer “Apart from the reduction in Center for Cancer, the number cules. ened time for new medicines
capital of Anhui province, has tient families and improve the medicines when he met with tariffs, relevant departments of new cancer patients in Chi- Some patients have to pay to be approved, embrace-
paid out more than 5,000 yuan country’s healthcare system the press in March. should also join in lowering na each year is 4.29 million, up to 50,000 yuan per month ment of cancer medicines
($793) each month on treat- was approved at a State Coun- Experts estimated that the medical prices with integrated with more than 10,000 people for targeted drugs, Chen said. into reimbursement of the
ment, much of it to buy cil executive meeting on tariff-free policy is expected to policies in the process of pro- diagnosed with various For Chinese patients, targeted medical insurance system
imported medicines to tackle Thursday. reduce costs for more than 4 duction, logistics and import- tumors per day. China drugs are all imported and are and measures to reduce costs
his father’s lung cancer. The meeting, presided over million patients suffering dif- ing raw materials,” Li said at accounted for nearly one under patent protection, in the logistics process,” Shi
“In addition to foreign med- by Premier Li Keqiang, also ferent types of cancers, a num- the meeting. fourth of the world’s new which means they cannot be said.

Policy digest POLICY RESPONSE

Government Work Report


implementation targeted
including 5G and new energy cars, to
forge greater manufacturing power.
Overcapacity should be further cut, by
China and the State Council unveiled on
April 14.
According to the guideline, which cov-
Trade, online education and
weeding out 30 million metric tons of
steel and 150 million tons of coal. In
order to establish innovative power, a
ers supporting Hainan’s efforts to deepen
reform and opening up, a free trade port
system will be “basically established” in
AI among key areas addressed
national system should be established to Hainan by 2025. China will also set up an
spur scientists and technical creativity, investment fund to support Hainan’s Trade volume growth remains strong reached 144 million, 120 million of whom use
and to promote mass entrepreneurship development of a free trade port. Exports increased by 7.4 percent year-on-year mobile phones, according to the report, based
and innovation. The document pointed out that a free to 3.54 trillion yuan ($5.63 billion) in the first on the study of more than 200,000 cases.
trade port is the world’s most open form of three months while imports surged by 11.7 per- More than 53 percent of Chinese parents
Improving statistical an economic zone, which has brought cent to 3.21 trillion yuan, Huang Songping, have purchased online classes for their chil-
prosperity to places like Singapore and spokesman for the General Administration of dren, 31.2 percent of them on more than one
The State Council released a circular on measures in financial sector Hong Kong thanks to its broad-based pref- Customs, said at a news conference on Friday. occasion.
April 12 that laid out the work division The State Council will work to promote erential policies on trade and investment. He announced that foreign trade volume reg-
across ministerial departments for carry- comprehensive statistics in the financial China will support the “all-round par- istered a hefty growth of 9.4 percent year-on- Ministry to push AI development
ing out the Government Work Report this sector to enhance services and improve ticipation” of foreign firms in the develop- year to 6.75 trillion yuan in the first quarter of
year. the real economy and the financial regula- ment of the Hainan free trade port, and the year, buoyed by the steady recovery of the
A total of 57 specific tasks, covering 12 tion system and avoid systematic financial multinational companies are encouraged global economy and solid domestic demand.
aspects, were distributed to main minis- risk, according to a guideline issued on to set up international and regional head- China’s trade performance has gotten off to
tries and departments, including the April 9. quarters there, according to the docu- a strong start this year, thanks to the stable
National Development and Reform Com- It was stressed in the guideline that ment. recovery of the world economy, sustained
mission, the Ministry of Finance, the Min- effective statistical coverage of financial President Xi Jinping on April 13 demand in the domestic market and advance-
istry of Industry and Information activities should be enhanced to cover announced a decision by the CPC Central ment of the Belt and Road Initiative, Hang
Technology, and the Ministry of Human industry, markets and governmental Committee to support building Hainan pointed out.
Resources and Social Security. departments. It seeks to tailor statistical into a pilot free trade zone and gradually
The report set out a general target for mechanisms for key financial institutions and steadily into a free trade port with Users of online education grow
economic growth in 2018, including the to detect major potential risks, and for Chinese characteristics. The Ministry of Education said it will push
GDP growing at 6.5 percent, the consum- financial holding companies to be alert to China welcomes investors worldwide to forward artificial intelligence development in
er price index rising 3 percent, newly both intra-group transactions and exter- invest and start business in Hainan and universities.
added employment in urban areas nal risk contagion. participate in the building of a free trade The ministry issued a detailed action plan
reaching more than 11 million, the urban The statements of assets and liabilities port there, Xi said at a celebration mark- saying that Chinese universities should have
unemployment rate under 5.5 percent in the financial sector must be upgraded, ing the 30th anniversary of the establish- optimized systems that fit both scientific inno-
and the urban registered unemployment involving complete statistics on financial ment of Hainan province and the Hainan vation, especially new-generation AI develop-
rate lower than 4.5 percent. At the same capital flow and stock and the monitoring Special Economic Zone. ment and disciplinary growth, by 2020. By
time, fiscal policies should stay positive, of macro-economic leverage ratios, and 2030, they will be the core of the world’s main
said the circular. The fiscal deficit should improve statistics on monetary credit, the ZHANG YUE The number of online education outlets in AI innovation centers, capable of providing
be 2.38 trillion yuan ($380 billion) with circular stated. China will continue to grow by around 5 per- China with technical support and profession-
the central government’s fiscal deficit at cent a year, according to a report released on als. The plan asks for interdisciplinary links of
1.55 trillion yuan and local fiscal deficit China aims for leading free April 13. AI with subjects like computer science, mathe-
at 8.3 trillion yuan. At the same time, the The report, the 2017 White Paper on Online matics, physics, psychology and sociology. It
monetary policy should remain prudent trade port system in Hainan Education in China, complied by the Ministry also calls for strengthened fundamental
and neutral, it said. China aims to make the free trade port of Education, Beijing Normal University and research, the establishment of more AI cen-
To push forward supply-side structural system and operational mode of Hainan Baidu Education, said that the online educa- ters, a high-level think tank as well as interna-
reform, new driving forces, such as big “more mature” by 2035, according to a tion market will grow at over 20 percent tional cooperation.
data and artificial intelligence, should document jointly issued by the Central annually. It was said in the report that the
get a boost, as well as high-end industries Committee of the Communist Party of number of online education users has ZHANG YUE
CHINA DAILY HONG KONG EDITION Tuesday, April 17, 2018
HK | FOCUS 9

Mainland, HKSAR
cheek by jowl in
Bay Area push
Hong Kong, relying on its unique strengths, needs to look to the Chinese
-IQ
High mainland’s technological prowess and vast market to scale new heights
City
in innovation and smart-city development, experts suggest.

By WANG YUKE in Hong Kong Kong, which is home to some of will also seek partnerships with “We’re inclined to get everything
jenny@chinadailyhk.com the world’s top-ranking universi- startups in the SAR to help turn straight and put policies in place
ties, is not short of young talents their ideas into products, said prior to utilizing new technolo-

W
ith the highly-tout- and entrepreneurs although some Zheng. gies, while the mainland goes the
ed Guangdong- innovation and technology com- In Chong’s view, Hong Kong still other way around. They venture to
Hong Kong-Macao panies have found it hard to lure lags behind some mainland cit- try new things and find answers
Greater Bay Area local investors and tap the market. ies like Shenzhen and Shanghai when problems arise,” said Yeung.
poised to roar off on a grand scale, “The markets in mainland cities, in smart-city development. “They Thus, Hong Kong has much to
debate has been raging on how the such as neighboring Shenzhen, are had started five years earlier than learn from the mainland. Among
two special administrative regions massive and people’s consump- us. Hong Kong has run into a the most urgent issues to be
and the nine-city cluster in the tion capacity is competitive,” said shortage of talents, while the tal- addressed is to encourage public
Pearl River Delta can leverage Zheng. ent pool on the mainland is much service providers and privately-
their potential to the fullest and He urged Hong Kong technol- The Guangdong-Hong Kong-Macao larger partly because its educa- owned companies to share data.
“There’re plenty of third parties
make the project exemplary for ogy enterprises and startups to tion scheme supports and bolsters
future national development, and make inroads into the mainland Greater Bay Area will serve as a innovation,” he said. out there trying to develop real-
consolidate the country’s position market and innovate more to cater “Hong Kong has been placing time data-based products for the
in innovation and technology on to the mainland’s needs. He’s con-
bridge, offering Hong Kong easier ac- its development priority on trad- convenience of citizens. But, they
the world stage. vinced that without a vast market, cess to the sizeable mainland market ing and finance for a long time, can do little without reference of
Pundits in Hong Kong’s innova- however exceptional an innova- and it’s only until recently that the statistics and information gener-
tion and technology industry are tion may be, it could hardly sell for its innovative technologies.” city had begun shifting its focus ated from public institutions,” he
unanimous in that the city and the and stand out. Eric Yeung Chuen-sing, convener of Smart City Consortium to innovation and technology said.
Chinese mainland are inseparable under the administrations of for- For example, insurance compa-
in the process, complementing, Business social platform smart-city strategies across the Area in the coming years, accord- mer chief executive Leung Chun- nies need to obtain enough health
and highly dependent on each While research and develop- globe. ing to Eric Chong, president and ying and his successor Carrie Lam data collected from the general
other in the region’s future devel- ment has been in full swing in Yeung noted that internet-of- chief executive officer of Siemens Cheng Yuet-ngor,” Chong noted. public or certain age groups before
opment. Hong Kong in recent years, the things (IoT) connectivity stan- Hong Kong and Macao. Acknowledging Hong Kong’s they can launch new products tar-
“The Guangdong-Hong Kong- city needs to rely on the mainland dards differ in different countries He sees Hong Kong as a starting advantage in accessing inter- geting diseases that have been on
Macao Greater Bay Area will when it comes to manufacturing and that some mainland cities, point and a good testing ground national entrepreneurs, Chong the rise. And the data are readily
serve as a bridge, offering Hong and marketing, explained Yeung. including Shenzhen, are at the for developing innovative tech- insisted that the city should attract available in hospitals and clinics.
Kong easier access to the sizeable Leveraging its role in the Bay forefront in terms of security nologies. “The projects in Hong more talents from the mainland. “It’s not difficult to make institu-
mainland market for its innova- Area, SCC has teamed up with protocols on IoT devices. If the Kong will serve as pilot schemes. “After all, innovation is driven by tions and companies share data,”
tive technologies,” said Eric Yeung its mainland counterpart Chi- protocols can be standardized in We hope to pick up new ideas people.” Yeung argued, by offering some
Chuen-sing, convener of Smart na Smart City Development in other nations, China’s global influ- with great potential and collabo- feasible incentive measures.
City Consortium (SCC) — a profes- launching a business matching ence in the innovative technology rate with cities in the Bay Area to Novel technologies The government could include
sional organization inaugurated social platform LinkedSmart, industry would gain prominence. develop them further.” Yeung agreed, saying that, com- consent to disclose data in the
in Hong Kong some two years ago which aims to help smart city proj- “The country with a say in a cer- Shenzhen-based technology pared with the mainland, Hong requirements for franchising or
to foster the building of a smart ects and promising business pro- tain industry is likely to expand titan Huawei is already collaborat- Kong seems to have stagnated in licensing. In other words, only
city and advise the government on posals from both sides to secure its influence and develop faster,” ing with Hong Kong’s public ser- smart-city development for some companies that agree to share
relevant policies and measures to financial support from interna- Yeung said, suggesting that help- vice departments, property devel- reasons. First and foremost, Hong data can be issued a license or
pursue that objective. tional investors. ing mainland cities lift their pres- opers and enterprises. It’s ready to Kong had already been well devel- hired by the government, he said.
“But, having talked to some Entrepreneurs can pitch busi- ence across the entire industry is help shopping malls equip them- oped with little room for further Zheng welcomed Hong Kong
local entrepreneurs, I realize that ness ideas and showcase their also key to Hong Kong in keeping selves with an intelligent wireless improvement when the mainland companies in cooperating with
many of them are unable to draw innovations that are categorized its global status. network to facilitate notification started building smart cities from Huawei, stressing the tremen-
investment and even make ends in nine areas, including fin-tech, The Bay Area further promis- of sales information to customers scratch for brand new districts. dous opportunities on offer on
meet as they only target Hong retail-tech, health-tech, med-tech es new opportunities for global via mobile apps. “Making our city smarter means the mainland.
Kong customers. It’s still harder and green-tech. technology powerhouse Siemens, undoing the old infrastructures “You might be unfamiliar with
for startups,” he said. SCC has also signed a memo- which aims to co-create an innova- Stock replenishment and replacing aging installations some mainland cities and don’t
His views were echoed by Zheng randum of understanding with tion ecosystem and foster smart- Moreover, Huawei is working with high-tech ones, which is know what to do. You may want to
Zhibin, general manager of Smart industry partners from various city development in a sustainable on aiding supermarkets to build costly,” he argued. On top of that, resort to mainland companies like
City Global Business Department countries, paving the way for the manner. a notification system for stock Hong Kong’s regulations and poli- us,” said Zheng, hoping that Hong
of Huawei Enterprise Business introduction of Made-in-China The German conglomerate, replenishment, plus an alert sys- cies on adopting innovations are Kong enterprises will venture out
Group — an information and com- original innovations and concepts based in Berlin and Munich and tem for waste collection depart- rigid, whereas mainland cities are of their comfort zone, look to the
munications technology solutions to the world. At the same time, currently Europe’s largest indus- ments or an energy-saving system more open to novel technologies mainland and contemplate how
provider based in Shenzhen. Hong Kong can promote main- trial manufacturing group, will for commercial building complex- and, therefore, more willing to to make the best of such a huge
But, he reckons that Hong land cities’ new technologies and prioritize projects within the Bay es, to name a few. The company take risks. market.

Tech park going all out to woo talent Hong Kong


Science Park
By WANG YUKE and Chiu-fun, chairperson of Hong lure such talents, Law told Chi- out. “That’s part of how we is kicking off
a streamlined
WILLA WU in Hong Kong Kong Science and Technology na Daily in an interview. define talents.”
recruiting scheme
Parks Corporation (HKSTPC), The new model will speed up After all, she said, it’s much to lure overseas
Hong Kong Science Park — which runs the facility at Pak the talent-importing process for easier for the community to talents to take up
the SAR’s premier tech park — is Shek Kok in the New Territories. companies at Science Park as accept talents from the world’s jobs in the city.
to push forward a streamlined SenseTime has established long as they can prove that over- best educational institutions. PROVIDED TO CHINA
DAILY
recruiting scheme to allow itself as a leader among Chinese seas talents or professionals are Law said the new process will
local companies easier access mainland artificial intelligence needed to realize their business change the whole mechanism seek talents beyond Hong Kong ness plans and verifying the light, it will create a precedent
to overseas talents and invigo- technology companies over the plans, she said. of talent recruitment in Hong after it has failed to hire anyone backgrounds of potential job that other local businesses can
rate the city’s entrepreneurial years, experiencing a fast-track HKSTPC will review the Kong. At present, the procedure locally after three months. Even candidates will be shifted from follow,” she said, adding that
ecosystem. development in applications for qualifications of applicants and is cumbersome and lengthy, so, the possibility of an appli- the Immigration Department to Science Park is doing its part
And, the park is likely to dupli- facial recognition, video analysis set various criteria for selection. which is a common complaint cant being turned down by the HKSTPC. It’s a simplified and in preparing SenseTime for the
cate the success of Beijing and and autonomous driving. One criterion is a sound aca- among local entrepreneurs. Immigration Department is fast alternative to the existing expansion, including renting
Hong Kong-based deep learn- However, AI talents are scarce demic record, with potential Normally, a company would very high, Law said. process, she said. workplaces.
ing startup SenseTime Group, in Hong Kong and this explains employees having an academic need to take out a job adver- In essence, under the new Law hoped the plan could be
which was founded at the park the rationale behind the cre- background at the world’s top tisement in the print media, model, the responsibility of approved by the government. “If Contact the writers at
in 2014, says Fanny Law Fan ation of a new mechanism to 100 universities, Law pointed and it would only be allowed to assessing and screening busi- the government gives the green jenny@chinadailyhk.com
10 PHOTO | HK Tuesday, April 17, 2018 CHINA DAILY HONG KONG EDITION

Xie Feng (fourth right), commissioner of the Ministry of Foreign Affairs of the People’s Republic of China in the HKSAR, joins delegation members for a group photo in front of the Leshan Giant Buddha in Leshan, Sichuan province, on April 11. The 71-meter-
high Buddha statue, listed as a UNESCO World Heritage Site in 1996, is carved into a cliff and overlooks three converging rivers. It was built over a 90-year period starting in the year 713 during the Tang Dynasty (618-907). PHOTOS BY LI YINZE / CHINA DAILY

Sichuan here we come! By LI YINZE in Hong Kong


yinzeli@chinadailyhk.com
representatives of foreign consular
missions and business chambers, as
mainland authorities and business
communities,” he said.
well as media professionals from the Among the business leaders in the

A
33-strong delegation from SAR. Its mission was to strengthen delegation was Jack Lange, chairman
the Hong Kong Special communication, understanding and of the American Chamber of Com-
Administrative Region, cooperation with Sichuan. merce in Hong Kong — one of the
led by the central govern- Xie said the central government largest American chambers outside
ment’s top foreign affairs official in the is willing to further promote tripar- the United States and the largest inter-
SAR, ended a five-day visit to Sichuan tite cooperation among the Chinese national chamber in Hong Kong.
province on April 12 aimed at boost- mainland, Hong Kong and foreign Members of the delegation were
ing economic ties and exploring the countries. upbeat about the business prospects
investment climate in the southwest- “China attaches great importance in Chengdu, particularly the opportu-
ern province. to international cooperation. My nities offered by the Tianfu New Area,
The team, headed by Xie Feng, office will continue to offer maximum saying they were very impressed by
commissioner of the Ministry of For- support to facilitate communication the rapid and wide-ranging economic
Peng Qinghua (right), secretary of the Sichuan Provincial Committee of the Communist Party of China, meets with eign Affairs of the People’s Repub- between foreign enterprises and development that has taken place on
the delegation on April 8. Peng described the visit as a good opportunity for deepening exchanges and expanding lic of China in the HKSAR, included organizations in Hong Kong and the the mainland.
cooperation in trade, technology, education, culture, art, tourism, finance and other areas with relevant parties.

Uncle Liu, 68, a resident of Meiwan Village, Danling Town in Danling The Hong Kong team toured the Chengdu Research Base of Giant
County, Meishan City, shows off his a home-grown orange. He told Panda Breeding, where giant pandas, golden monkeys and other wild
China Daily his five-member family is reaping abundant supply and and endangered animal species live and are bred.
enjoying a moderately-prosperous life.

The delegation visit Sanxingdui Museum, located by the banks of the Yazi River in Guanghan city, where
eye-catching cultural relics from the ancient state of Shu and dating back some 3,000 years ago, are
showcased. The Sanxingdui Ruins site welcomes about 800,000 visitors from home and abroad each year.

The Chengdu International Railway Port, which was also on the


delegation’s tour list, links China with 15 international stations. The delegation gets a taste of the vibrant commercial life in Chengdu,
By the end of last month, the port had cumulatively handled 2.22 Sichuan’s provincial capital, touring a busy shopping street.
million tons of cargo valued at $10.1 billion.

At the University of Electronic Science and Technology of China A member the delegation poses in front of the statue of Su Dongpo, originally known as Su Shi — one The Hong Kong visitors call on BOE Technology Group — a supplier
in Chengdu, team members played badminton with a sports robot of the major poets of the Song Dynasty (960-1127). of display products and solutions.
designed by the university.
Tuesday, April 17, 2018 11

COMMENT C H I N A DA I LY H O N G KO N G E D I T I O N

Tai’s assertions attack TO T H E P O I N T


S TA F F W R I T E R

Basic Law at its root Security threats anything but remote


The chief executive, along with senior central
government and local officials and political
that aim at splitting up the country. National
security and territorial integrity is a bottom line
The Justice Department may seek heavyweights, attended the first National Secu-
rity Education Day symposium in Hong Kong
that must be defended at whatever cost and not
be crossed under whatever excuse.
on Sunday, organized by two local think tanks. China is now strong enough to protect itself
an injunction to stop Benny Tai from Traditionally Hong Kong residents have from outright military attacks but it is clandes-
attached little importance to the issue of tine attempts to drive a wedge between ethnic
spreading separatist views openly Ho Lok-sang
national security. Chief Executive Carrie Lam
Cheng Yuet-ngor pinpointed the reason for
or social groups in the country that the central
authorities are most alert to. In Hong Kong
or in class, Ho Lok-sang writes The author is dean of business at Chu this relative apathy in her speech at the sym- such groups have been taking advantage of the

S
Hai College of Higher Education. posium — Hong Kong people have always lack of national security law here to instigate
thought “national security” concerns only the sit-ins and riots and corrupt young people’s
ome “pan-democrats” the revenue intake as given, and to military aspect. As there is a People’s Liberation minds by spreading sophistry on “Hong Kong
took issue with a state- spend based on the constraint of the (Benny) Tai’s invita- Army garrison in the special administrative independence” and “self-determinism”.
ment made by the given revenues. This should not be. region, what else could the local populace do to And there is no lack of local support to
current chief executive The revenues of governments are not tion for different enhance national security? Nothing is further such destructive causes. The recent separatist
in 2016 to the effect given. Of course, there is a cost in rais-
ing revenue. But if the social benefit
regional interests from the truth. remarks by Benny Tai Yiu-ting, the main engi-
that one need not Most of the offensive activities conducted neer of the illegal “Occupy Central” protests
fully agree with every of extra spending is bigger than the to seek statehood between countries nowadays are not outright in 2014, made at a seminar held in Taipei and
clause in the Basic Law, saying that cost of the additional revenue raised, warfare but covert operations. Hong Kong has attended by separatists from different parts of
this contradicts the requirement that it does make sense to raise that extra
separate from China long been called the “Casablanca of the East” China, are a perfect example of what could hap-
officials and legislators are supposed revenue to support that extra spend- “upon the crumbling — an international spy center in Asia. Taking pen if we are not prepared, including legally, to
to espouse the Basic Law. In that ing. This apparent “deviation” from advantage of its free-wheeling entrepot status, deal with this kind of treacherous action.
2016 statement, Carrie Lam Cheng the literal interpretation of Article 107 of the authoritarian many foreign forces have used Hong Kong as Also speaking at the Sunday symposium,
Yuet-ngor said that she did not agree does not constitute abandoning or a platform for collecting intelligence, staging Wang Zhimin, director of the Liaison Office of
with Article 107, which says that the opposing the Basic Law.
state” undermines coup d’etats overseas and even plotting interna- the Central People’s Government in the Hong
government should spend based on Civic Party legislator Jeremy Jansen national unity and tional terrorism. These activities actually go on Kong Special Administrative Region, rightly
its revenue intake. Responding to Tam Man-ho challenged the chief every day without the knowledge of the aver- emphasized that safeguarding national secu-
the query whether she had deviated executive’s “deviation” from the Basic the interests of Hong age citizens, that is, not until something goes rity is the shared responsibility of Hong Kong
from espousing the Basic Law, she
said that: “There are 160 articles in
Law, asking whether officials have the
right to say things that deviate from
Kong. wrong, as with the suspected link of certain
South Asian elements in the city to serious ter-
people.
The nickname “Casablanca of the East” may
the Basic Law. Some are statements the Basic Law without legal conse- rorist attacks thousands of miles away in India. sound romantic but being called that is actu-
about basic principles and policy, such quences, while a man-in-the-street One kind of activity would particularly ally a wake-up call for the city to enact national
as those asserting that Hong Kong is like Benny Tai Yiu-ting is held legally mainland, but seeking to replace irritate the central government, and that is security legislation in line with Article 23 of the
an inalienable part of China; but there accountable. the national political system with an activities backed by hostile, anti-China forces Basic Law.
are others for which you could have Tam has confused the issue. Tai’s alternative system or seeking Hong
other views…” invitation for different regional Kong’s independence will not serve
The chief executive is right. Of interests to seek statehood separate Hong Kong’s best interests, nor those
course, it is possible that one espouses
the Basic Law and yet one may not
agree with some clauses in the Basic
from China “upon the crumbling of
the authoritarian state” undermines
national unity and the interests of
of the country as a whole.
The fact Tai is a professor of law at
the University of Hong Kong makes
Time ripe to fix narrow tax base
A
Law and wish to improve them, so Hong Kong. He is not seeking to his pro-national-disintegration speech
that the interests of Hong Kong and improve the Basic Law to make it bet- particularly worrying. He wields influ- bout a month after Financial Secretary
that of the motherland can be better ter serve Hong Kong’s and the moth- ence beyond that of most people in Paul Chan Mo-po announced his second
served. The Basic Law has not been erland’s interests, and he expressed Hong Kong and his influence on his budget, he finally accepted the commu-
formally amended but it has been these views in a forum organized by students could create more problems nity’s suggestion to hand out HK$4,000
clarified or interpreted a few times; a group that explicitly challenges the down the road. Given that he is a in cash to each qualified person. Most if not all
the national Constitution has been legitimacy of the Communist Party tenured professor of law, it is unlikely political parties and commentators applauded the
amended a few times. Each time the of China’s rule. If he cannot see the that he will be sacked because of his decision.
Basic Law or Constitution is interpret- difference he does not have the intel- speech. But given the grave conse- After all, who does not want free cash? Many of David Wong
ed or changed, it is in order to move ligence to serve as a legislator. quences of pro-national-disintegration us could surely remember when the government The author is an executive member of the New
forward, to meet the needs of the Under the “one country, two sys- views by a law professor, the Depart- handed out HK$6,000 in cash to everyone in Hong People’s Party and former civil servant.
times, to take advantage of the new tems” framework, of course Hong ment of Justice may seek an injunc- Kong back in 2011 and the positive effect it had
knowledge gained, etc. The objective Kong people enjoy freedom of speech. tion for spreading such views openly on the local economy and community mood. The
remains the same, however, which is But there are limits to freedom of or in class. He will say that this con- amount to be handed out later this year is less than
to serve Hong Kong’s best interests speech. In particular speech that chal- stitutes an infringement on freedom that of 2011 but is more concentrated and focused
When times are tough and
and to serve the motherland’s best lenges the “one country, two systems” of speech but if the court agrees that to help those who really need the extra cash. people’s incomes decline,
interests. framework will hurt the interests of this has gone beyond the limits of free Despite the similarities mentioned above, there
In August 2016, Lam stated that Hong Kong. Under the “one country, speech, an injunction would establish is a marked difference between the handouts it would be even harder to
since the government had HK$800 two systems” framework, Hong Kong clearly that there are limits to free of 2011 and 2018. The HK$6,000 in 2011 went
billion of reserves, it could spend as people should not seek independence speech. An injunction that comes to everyone without any means-testing. On the
broaden the tax base. More-
appropriate, implying that the govern- from the motherland, nor should from an independent court and not other hand, the HK$4,000 this year has a rather over, Hong Kong has an
ment need not be bound by the literal Hong Kong people challenge the from the administration would also high threshold. According to the government’s
interpretation of Article 107. As it hap- country’s political system. Hong Kong command authority and credibility. If announcement, applicants must fulfill all the fol- aging population and the
pens, I myself had taken issue with
Article 107, which appeared to imply
people as Hong Kong citizens can
of course criticize policies in Hong
he contravenes the injunction order,
then action against him by the univer-
lowing criteria: be aged 18 or above with a Hong
Kong identity card, have no property, do not ben-
percentage of working popu-
that the government should take Kong and even those on the Chinese sity can be taken. efit from tax rebates and are not recipients of any lation who pay taxes will
form of social welfare. In other words, this is an
anti-poverty scheme funded by the government’s continue to decline.
community care fund. It is designed to support
Final flare those who did not benefit from the other “goodies”
announced in this year’s budget speech. This is an stamp duties from property and stock transactions.
important improvement over that in 2011, where These revenues fluctuate widely when we are in
Editor’s note: people shared their experiences on social media on different parts of the economic cycle. To stabilize
China Daily Hong how they had “wasted” the free money from the government tax revenues, we need to broaden our
Kong Edition has government on travel, new gadgets, clothing and tax base. Previous attempts to launch a goods and
launched a photo- other non-essential expenditure. services tax did not even go past the consultation
sharing campaign Another noteworthy point is that there are ris- phase because any tax increase is clearly politically
at Instagram. You ing populist calls from a public no longer satisfied unpopular. Introducing new taxes will always be
can share your with the standard “goodies” such as tax rebates, controversial to say the least but we cannot afford
photos by tagging additional welfare payments, rates concessions and to delay broadening the narrow tax base problem
#hk24hr, and we’ll other fee reductions. Hong Kong is one of the few indefinitely. When times are tough and people’s
choose the best developed economies in the world where the gov- incomes decline, it would be even harder to broad-
ones to publish in ernment has a repeated budget surplus with no net en the tax base. Moreover, Hong Kong has an aging
the newspaper.
public debt. It is a privilege living in Hong Kong population and the percentage of working popula-
and being able to enjoy world-class public services tion who pay taxes will continue to decline. Previ-
while paying a very low tax rate. We really should ous government studies have shown we may face
not take for granted that the government could structural deficits beginning in the next few years.
hand out free money, rebate taxes and increase Therefore, it is now time to act. Unfortunately,
social welfare every year. Unfortunately, for the the government is too busy countering the opposi-
government, the biggest problem does not lie in tion’s incessant bickering. At the same time, the
insufficient wealth giveaways but in its perceived public’s focus is firmly on the cash handout and
unequal distribution. To be fair, it is impossible to now that the government has already given out
completely balance the needs of all sectors of soci- money directly to the people twice, it is virtually
ety and give out “goodies” in a way that everyone impossible not to do so for a third time. Unless
is happy. The government has years of relevant there is a major economic slowdown and huge
experience but there seems to be no way to please budget deficit next year, the political cost of not
everyone. giving money again will further rise significantly.
An airliner I believe that the government’s reluctance to The public now has even higher expectations on
appears jet- simply hand out free cash is not only because the budget speech, which are even harder to meet.
black against this is unfocused and cannot target those who In order to prevent the job of financial secretary
high orange really need it, but also because it is not financially becoming even tougher, there should be public
clouds catching sustainable. We have enjoyed massive budget debate and consultation on broadening the tax
the last rays of a surpluses in recent years but should not forget the base soon. The annual budget speech should not
sinking sun over be an occasion for the public to discuss how much
tough time of budget deficits in the early 2000s.
Ap Lei Chau.
@SNAKEWWWW / The problem with government revenue is that it money they receive this year but should be about
INSTAGRAM is unstable since it mainly relies on land sales and investing in the future and saving for a rainy day.
12 Tuesday, April 17, 2018

COMMENT
*%("öLö%&$%$

China Daily Hong Kong Edition

EDITORIAL

Neighbors must make Cai Meng

the most of new start

A
visit by a Chinese foreign minister to a neigh-
boring country and an economic dialogue ses-
sion between China and a next-door neighbor
should not be a big deal. It would not be were
that neighbor not Japan, and such visits and
dialogues not been respectively postponed for
nine and eight years.
That such a visit and conversation have finally taken place
means a lot to both Beijing and Tokyo, as this year marks the 40th
anniversary of the China-Japan Peace and Friendship Treaty.
That the two parties have chosen to repair ties and reopen high-
level economic dialogue after such a long hiatus has naturally
inspired high hopes in both countries that substantial improve-
ments in broader ties will materialize.
Trade is a fitting starting point for any serious attempt at restor-
ing the China-Japan relationship. It has long served as the “ballast
and propeller” of bilateral political relations, as well as overall
state-to-state relations. The high-level economic dialogue is the
highest intergovernmental mechanism for economic cooperation,
and it is supposed to facilitate corresponding policy communica-
tion and coordination.
In spite of their previous exchanges of tough rhetoric, Beijing
and Tokyo know their economies are indispensable to each other.
However, that they are most important trading partner to each
other is only a relatively small, and increasingly smaller, part of
their mutual significance. Recent changes in the global economic
landscape, especially the rise of anti-globalization, protectionist
tendencies, reveal increasing common interests between the two
countries. Their shared reliance on overseas resources and mar-
kets determines a keenly felt shared interest in safeguarding free
trade and economic globalization.
And despite the troubles brewed by history and their territorial
dispute, the two governments appear to converge on the need to
denuclearize the Korean Peninsula. Chinese Foreign Minister
Wang Yi said he is eager to brief his host on the “very positive
important changes” in the situation on the peninsula. Such an OPINION LINE
encouraging sign of bilateral communication is crucial for retain-
ing the current momentum toward peaceful engagement with the
Democratic People’s Republic of Korea.
Wang’s visit will be conducive to positive interaction at higher US and its allies highhanded action Double jeopardy
levels, especially his meeting with Japanese Prime Minister Shin-
of doctors being
zo Abe. But, despite this, the “substantial upgrade” in bilateral ties
well-wishers anticipate may not come easily.
Wang was correct in reminding his Japanese counterpart of
in disregard of multinational system too many hours
“complex and sensitive factors” that have to be overcome to
improve the China-Japan relationship. The relationship has dem- THE UNITED STATES, the United Kingdom and France carried out military strikes against Syria “FINALLY, the operations are over.” A
onstrated special vulnerability and the two governments will have without the authorization of the United Nations Security Council. Beijing Youth Daily commented on doctor in Huaian, East China’s Jiangsu
to work hard to manage their differences. Monday: province, shared this sentence on her
It is to be hoped the shared desire to improve relations is based social network app WeChat having
on sound foresight rather than merely blind hopes. The action of the US and its allies drives home the chemical weapons. worked continuously for 26 hours. Faw-
message that their advocating of a multilateral sys- The US and its allies are antagonist toward Russia an.com comments:
tem is only lip service to disguise the law of the jun- and Iran, which support the Syrian government,
gle that they truly act upon. and they hate the multilateral system. Their efforts Within 26 hours, the doctor had carried
TO THE POINT Even before the investigation into the suspected to contain Russia have been stepped up since the out 26 gynecological operations. As the
chemical weapons attack in Syria, which the three crisis in Ukraine broke out in 2013. photos she shared on social media show,
National security awareness countries said they supported, the US and its
allies have judged the Syrian government to be
The Syrian civil war has evolved into a proxy
war between the West and Russia over the past
she had been standing for so long that her
feet had swollen and she could not wear

C
the culprit. seven years, although they have common inter- her shoes.
hina celebrated its National Security Education Day on As the Syrian government seems so close to ests in the fight against the Islamic State group. She deserves praise and respect for her
Sunday. Various kinds of activities aimed at enhancing defeating the rebels, it is irrational for it to resort Therefore, the war in Syria will not come to its dedication. However, the workload she
people’s national security awareness were organized in to chemical weapons, which it knows will definite- end until relations between Russia and the West faces is already too heavy for any normal
recent days. ly give the US an excuse to intervene in its civil are reconciled. human being to bear. Working for 26 suc-
This is the third such education day since the National Security war. The US and its allies should realize military cessive hours could do irreparable harm
Law was enacted in July 2015. As a matter of fact, no evidence related to chem- attacks only make the situation more complicated, to a person’s health, even cause death.
Peace and prosperity are people’s most basic and universal aspi- ical weapons has been found in the ruins of a sci- and they should come together with the interna- Besides, such a heavy workload for doc-
rations. Safeguarding national security is thus in the fundamental entific institute that was attacked by missiles, tional community to seek political solutions to the tors can also be risky for their patients.
interests of all Chinese people. The Central Committee of the which the US alleges was a major R&D center for Syrian crisis. Medical operations require skill, experi-
Communist Party of China with Xi Jinping as the core has accu- ence, and concentration; tiredness could
rately grasped the characteristics of the country’s security situa- result in a doctor making a mistake.
tion and made a series of significant policy arrangements aimed
at maintaining national security. China has embarked on a
national security road under the absolute leadership of the Party.
Joint actions to end job discrimination However, many doctors commonly
work extra hours. According to a white
paper issued by the Chinese Medical Doc-
This will offer more solid security guarantees for the country to tor Association, doctors in Class A hospi-
realize national rejuvenation and ensure Chinese people can live ABOUT 8.2 MILLION STUDENTS will graduate from college in China this year, a record high. Peo- tals work 51.05 hours on average a week,
peaceful and better lives. ples’ Daily commented on Monday: and those in Class B hospitals 51.13 hours
History tells us that a flourishing age does not inevitably mean a week on average. Both are much higher
peace. Therefore, we must bear national security in mind at all Hundreds of thousands of students will also dents from the countryside. than the standard of 40 hours. The paper
times. The security risks and challenges we now face will under- return to China after graduating from universities And some companies directly say that they do not also shows that less than 25 percent of the
mine the nation’s interests if not effectively tackled. China must overseas. Cutthroat competition in the job market recruit graduating students born in certain places doctors enjoyed their legal annual leave.
strengthen the social foundation for national security and prevent is predictable, as understandably, employers will without explaining why. It is urgent to change this situation. If a
and resolve various kinds of security risks. It must promote become more picky. But some openly demon- The Employment Promotion Law, enforced in majority of doctors face a work overload,
strate strong employment discrimination, which 2007, explicitly outlaws employment discrimina- then not only is their own health at risk
national security education and cultivate national security aware-
should be addressed by the labor rights depart- tion. But over the past 10 years, no employers have so too is the health of their patients.
ness among the public.
ments. been punished for discriminating against job candi- To remedy this situation, at least two
As the most basic public good, national security is by no means
Gender discrimination is the most common. dates. measures should be taken. First, the
an abstract concept. When it comes to national security, nobody
Although relevant laws and regulations strictly ban The legislature and labor rights departments Labor Law must be more strictly imple-
can remain an outsider or onlooker. This means that all of us mented, so as to prevent doctors from
gender discrimination, some employers clearly say should not sit idle any more. They should make it
should view safeguarding national security as our duty and that they only accept male candidates, even if the easier for the employees and job hunters to collect working too many hours. Second, medical
responsibility. We should all make efforts to a build a solid wall of jobs can be done by men or women. evidence and sue employers if they are discriminat- majors in colleges should be enlarged so
national security. And we should remember that the more secure Regional discrimination is the other problem. ed against. there is more medical talent for the
a country is, the more sense of security its people will have. Some companies, particularly those in big cities, If people keep silent over it, employers will con- nation. Only with ample medical staff will
— PEOPLE’S DAILY prefer local urban candidates to graduating stu- tinue to discriminate against candidates. the situation improve.

C O N TA C T U S
China Daily HOT WORDS
15 Huixin Dongjie Chaoyang, Beijing 100029
News: +86 (0) 10 6491-8366; editor@chinadaily.com.cn vice. To use the facilities customers scan their intelligence will help banks achieve high-
Subscription:+86 400-699-0203; subscribe@chinadaily.com.cn
Unstaffed bank branch faces to confirm their identity and gain access tech transformation.
Advertisement:+86 (0) 10 6491-8631; ads@chinadaily.com.cn to complete the facilities to their business. Meanwhile, the
Phone app: chinadaily.com.cn/iphone 无人银行(wúrén yínháng) It is expected other banks will also launch application of artificial
China Daily USA China Daily UK similar unmanned branches nationwide, as intelligence also poses
1500 Broadway, Suite 2800, New 90 Cannon Street London EC4N 6HA China Construction Bank recently opened the banking sector steps into the artificial a threat to bank
York, NY 10036 +1 212 537 8888 +44 (0) 207 398 8270 an unstaffed branch in Huangpu district, intelligence era. employees. If artificial
editor@chinadailyusa.com editor@chinadailyuk.com Shanghai, which is China's first fully auto- To some extent, the launch of the intelligence is widely
China Daily Asia Pacific China Daily Africa mated bank branch. unstaffed branch will force the banking applied, many bank
China Daily Hong Kong P.O.Box 27281-00100, Nairobi, Kenya There are no tellers or other members of industry to accelerate reform. All financial staff will lose their jobs.
Room 1818, Hing Wai Centre 7 Tin Wan +254 (0) 20 522 3498 (Nairobi) staff, not even security staff. All the facilities institutions, including domestic banks, face The entire industry,
Praya Road Aberdeen, Hong Kong editor@chinadailyafrica.com in the branch, including the two robots, the challenges brought by artificial intelli- including bank staff, Online
+852 2518 5111 enquiries@chinadailyafrica.com ATMs, foreign exchange machine and an gence. But artificial intelligence also offers should prepare for Scan it for
editor@chinadailyhk.com subscription@chinadailyafrica.com assortment of multimedia tools are self-ser- opportunities as the application of artificial this. more hot words.
editor@chinadailyasia.com
CHINA DAILY HONG KONG EDITION Tuesday, April 17, 2018 VIEWS 13
Zheng Zhijie

China doesn’t face a debt-default risk


T
Fu Jing
he ratio of outstanding tial debt risk, the first thing to do that fail to reduce debt. There is The author is deputy chief of China Daily
government debt by the is to deepen institutional reform European Bureau.
end of a year to that
The author is
the president of
... the continued to curb debt growth. There are
also a need to set up a financial
bankruptcy system for the local fujing@chinadaily.com.cn
year’s GDP is a key indi- China Develop- increase in lever- four specific suggestions for governments to curb debt.
cator of whether a government
faces a debt-default risk. The debt
ment Bank.
age has led to ris-
achieving the desired results:
First, the authorities should Contingency plan to control Hainan reflects the
ratio can reflect an economy’s further promote market-oriented local governments’ debt
ability to repay its debts. Studies
show China’s overall debt is example, in 2015, China’s net
ing debt since the bond issuance to check the rise of
local governments’ debt. Actually,
Local authorities are responsi-
ble for repaying their respective
fruits of reform
global financial
under control, as its debt ratio is
within safety limits and sover-
asset value was 101.8 trillion yuan
($16.21 trillion), the country had
crisis in 2008, but
the local governments’ bond
market has greatly improved in
local governments’ debts, and the
central government is not obli- and opening-up

T
eign balance sheet is quite sound sovereign assets totaling 241.4 terms of marketization in recent gated to bail them out, says the
— the total debt ratio of China’s trillion yuan, and a debt of 139.6 years, although there is still room contingency plan to deal with the he past four decades have seen China
central and local governments trillion yuan. So, given the low
correspondingly for improvement, especially in local governments’ debt released perform a development miracle,
was 38.8 percent at the end of
2016, far lower than the 60 per-
liquidity of State assets of admin-
istrative organs and limited
the country’s sov- the bond issuance pricing mech-
anism. The low bond spread indi-
on Nov 14, 2016. The plan also
says the ability to control the
which is reflected in its regional and
local successes. Among the regions to
cent red line set by the Maas- transfer of land rights, China’s ereign assets have cates the existing pricing debt risk should be incorporated have tasted economic success is China’s
tricht Treaty signed by European sovereign net assets will remain mechanism doesn’t reflect the in the performance and promo- youngest province of Hainan, which this year
Community members in 1992 to positive even after deducting 16.2 also expanded, true market value of some local tion of local government officials. marks its 30th anniversary as a province.
integrate Europe. trillion yuan from State assets government bonds and their cost Holding the local municipal and I spent last week in the province talking
China’s liability ratio, too, is and replacing 68.5 trillion yuan yielding a high of risk. county administrations responsi- with veteran politicians at the annual Boao
lower than the ratios of major land assets with 3.1 trillion yuan The authorities therefore ble for debt restructuring, based Forum for Asia, as well as chatting with taxi
economies and some emerging worth of land-transferring fees. level of net value should establish a market-orient- on the cause and time period of drivers, waiters and even pedestrians. Those
market economies, and even low- ed pricing mechanism with less their debt risks, will be a serious inspiring conversations showed how the
er than the members of the Orga- Important guarantees for the Chinese administrative intervention — warning to those local govern- right policies and their implementation can
nization for Economic for debt repayment government. this is also important to increase ments that have run up huge bring about positive economic and social
Cooperation and Development. State assets, including operat- the marketization of local debts debts. change. For example, Hainan’s per captia
China’s debt ratio is 52.97 per- ing assets and some natural and realize differential pricing After the provincial govern- GDP soared from less than $200 in 1988 to
centage points lower than the resources, are important guaran- regionally. ments start shouldering more $7,179 last year.
average of the OECD members — tees for debt repayment. Although Second, a sound credit rating responsibilities for municipal Thanks to reform and opening-up, Hainan
the central government’s debt China has sufficient sovereign likely to be much higher. system should be established for and county administrations in is now home to a number of dazzling villas
ratio is 62.68 percentage points assets to cover the liabilities, it China’s high net asset value the issuance of local bonds, while terms of financial management, and high-rise holiday apartments, offers jobs
lower than the OECD members’, may sometimes face difficulties in structure is very different from promoting information disclo- the central government should and a better life to its residents, and draws
though the local governments’ repaying some debts. It should be those of major developed coun- sure and market supervision on distance itself from the local hundreds of thousands of travelers from home
ratio is 9.71 percentage points noted, however, that the State tries, because its resident sector, local loans can increase the local governments on debt repay- and abroad.
higher than the OECD average. assets may be underestimated private enterprises and govern- governments’ financial transpar- ment so that the latter can inde- But despite the rapid development, they feel
and the debt overestimated. ment departments (including ency and make them more self- pendently establish their credit proud that the island province is still one of
Size of economy makes Since the State assets’ value State-owned enterprises) account disciplined. rating system and curb oppor- the cleanest places in China while many other
a big difference was measured using historical- for about one-third each of the Third, a capital budget system tunism. regions in the country are suffering from vari-
Besides, whether a govern- cost accounting, the net value of total net assets while in devel- should be established immedi- The central government ous degrees of environmental woes because of
ment faces a debt risk should be the assets and the government’s oped economies, the resident sec- ately to tighten regulations espe- should also further diversify rapid industrialization and urbanization,
judged not only in terms of debt ability to repay could increase if it tor accounts for 70-80 percent of cially on State financing. And to bond investors — for example, although China has now taken strict measures
expansion, but also by the size of is measured in terms of market net assets, with the public sector minimize the debt risk from the stock exchanges and commercial to correct the situation.
the economy, that is, whether it value or fair value. And debt having a small share. Hence, with very beginning and make fund banks can issue some enterprise-
has enough resources at its dis- could be overestimated, because sufficient stock assets and other allocation more efficient, it is and individual-oriented bonds,
posal to pay down the debt in the by simply adding up certain lia- available resources, China’s debt necessary to work out a mid-term or explore better ways to issue
face of a financial risk. bilities and contingent liabilities, would be less risky. financing plan for major infra- bonds for institutional investors ... how to quicken the pace
In-depth research into China’s and using different probability structure construction projects, with social insurance funds,
sovereign balance sheet in recent methods for transferring contin- Practical measures aimed at extending it later to cover all housing provident fund or sup- of its development and
years shows the continued gent liabilities will lead to differ- controlling debt risks infrastructure projects. This plan plementary pension. The reform
increase in leverage has led to ris- ent outcomes. Also, except for However, China’s debt prob- should cover all sources of fund- can also help solve the problem
make it inclusive should
ing debt since the global financial
crisis in 2008, but correspond-
losses in contingent liabilities,
other non-performing debts such
lem, especially the local govern-
ments’ debt problem, deserves
ing from all levels of government,
such as financial subsidies, equi-
of almost all investors flocking
to commercial banks, by pro-
top the province’s agenda
ingly the country’s sovereign as subordinate loans and doubt- special attention, and the author- ties and debt financing. moting financial liquidity in the ... Hainan must try to turn
assets have also expanded, yield- ful loans, in fact, can be partly ities should not ignore the root And fourth, a regulation is secondary market and attracting
ing a high level of net value for repaid. Therefore, the real cause of what could be a systemic required to impose severe penal- locals to supervise government itself into a regional center
the Chinese government. For amount of sovereign net assets is problem. To prevent any poten- ties on the local governments finances.
and prepare a blueprint
for the next three decades
Attack on Confucius Institutes motivated
Editor’s note: Recently several US senators including Marco Rubio, Tom Cotton and Joe Wilson have appealed to the US Congress to list Confucius Institutes as “foreign agents”
of development.

according to the Foreign Agents Registration Act. Two experts share their views on the issue with China Daily’s Liu Jianna. Excerpts follow:
In addition to the tangible successes of its
Hardliners have hijacked special economic zone, Hainan has also con-
the US’ trade policies tributed to China’s accumulating soft power.
The latest assault on Confuci- The Boao Forum for Asia has already
us Institutes in the United become a platform for the exchange of eco-
States is part of concerted nomic thoughts and ideas for Asian people
efforts to limit the engagement in less than two decades, similar to the
and exchanges with China by World Economic Forum in Davos, Switzer-
forces hostile to China. Even the land.
US-China Economic and Securi- Apart from the annual forum, the tiny, tran-
ty Review Commission affiliated quil town of Boao also attracts thousands of
to the US Congress, in its annual people from around the world to other meet-
report issued in November, has ings throughout the year. The debates and the
demanded that Chinese media ideas exchanged at those events play an
outlets in the US be listed as important role in China’s efforts to promote
“foreign agents”. regional cooperation and integration, as well
The Foreign Agents Registra- as globalization and free trade.
tion Act was enacted in 1938 to Besides, the universities, institutions con-
restrict political propaganda by ducting research in reform policies, agricul-
Nazi Germany. According to the ture and especially hybrid rice are also
US Department of Justice, the blossoming in the province.
act requires people acting as On Friday, I attended a book launch at the
agents of foreign powers in a 26-year-old Haikou-based China Institute for
political or quasi-political Reform and Development and was impressed
capacity to disclose their rela- to see the think tank, headed by scholar Chi
tionship with the foreign gov- Fulin, has built such a wide network of inter-
ernment, and their related national academics, published so many influ-
activities, including receipts ential books and reports, and has been
and disbursements of funds. making efforts to turn its proposals into Chi-
However, the wanton or dubi- na’s reform practices. Following his proposal
ous use of FARA will create seri- to build Hainan into an international tourist
ous problems for even normal attraction, Chi is also making sincere efforts to
cultural and civil exchanges ensure the about 10 million residents in the
between China and the US. province use only clean energy by 2025, and
This raises the question: Why encouraging vocational and healthcare educa-
some US politicians are target- tion.
ing cultural programs and These measures will prove critical in the
exchanges organized by China? SONG CHEN / CHINA DAILY coming decades, because providing better air
The fact is, what we see today is and clean water for the people has become a
the inevitable development of US has no reason to Wang Lili, depu- ures should be taken. priority for the government, and China’s dem-
the debate on China’s policies Li Haidong, a doubt Chinese culture ty dean of Natio- First, public diplomacy ographic changes and industrial restructuring
in the US from 2014 to 2016, professor at Certain US politicians and nal Academy of should be diversified to fully demand a well-educated workforce.
which gave US hardliners the China Foreign opinion leaders have increasing- Development and mobilize the non-governmental Still, while considering its future develop-
upper hand in bilateral rela- Affairs Univer- ly labeled China’s cultural pro- Strategy, and an forces, including think tanks, ment strategy, Hainan should keep in mind
tions. The debate also revealed sity grams in and exchanges with associate profes- mass media and business enter- that it is relatively less developed as its current
the Trump administration is the US states as activities aimed sor at Renmin prises. Second, the importance per capita GDP is about $1,000 less than the
reducing its engagement and at exporting authoritarianism, University of of Chinese culture should be country’s average — and its gap with Shenz-
increasing its efforts to contain with Confucius Institutes bear- China explained. And third, new hen and Shanghai is shockingly wide.
China. ing the brunt. Some of them media should be wisely and Therefore, how to quicken the pace of its
New fronts have opened up in is only following the trend, have even used a concocted con- the bugle call for battle. This extensively used to better con- development and make it inclusive should top
the “anti-China war” thanks to which incidentally he also cept of “sharp power” to ques- should explain why Chinese duct public diplomacy and the province’s agenda. And while making
the efforts of the hardliners. Giv- helped start. tion China’s overseas cultural overseas cultural exchange pro- spread Chinese culture. efforts to achieve this goal, Hainan must try to
en these facts, the targeting of Despite the US’ confrontation- activities. grams, including those through The peaceful rise of China is turn itself into a regional center and prepare a
Chinese cultural and exchange al moves, however, China can Reflecting the Cold-War Confucius Institutes, have been an irreversible trend. So, the US blueprint for the next three decades of devel-
programs by certain US politi- still take some measures to ease mentality and double standard, targeted. should abandon its prejudices opment.
cians is not hard to explain. Poli- tensions on this front. For it can be seen as part of the Yet China urgently needs to against China and properly Hainan can become the gateway connect-
cies unfavorable to China and instance, it can encourage non- China-containment strategy conduct public diplomacy and evaluate China’s public diplo- ing the rest of Asia with China through the
Sino-US relations are being governmental exchanges to adopted by some Western strengthen cultural exchanges macy and cultural exchange 21st Century Maritime Silk Road — one of the
introduced because there are no clear the US’ doubts over gov- countries. Voices in favor of with other countries, including programs. Only through all-em- two routes of the Belt and Road — as it neigh-
political elements to effectively ernment-funded programs. But containing China and engaging the US, as these are major chan- bracing cultural exchanges that bors several Asian countries. Therefore Hain-
counter the hardliners’ assault more dexterity and agility in strategic competition with it nels to improve soft power and seek harmony in diversity can an needs to use this special advantage to
on China. This shows the tide should be applied when dealing have taken hold in the US the national image, build trust we make the world a better, become a leading player in the Belt and Road
has turned in Sino-US relations with Sino-US ties in these media and other fields, with and promote peace. To achieve more diverse and colorful place Initiative and China’s further reform and
and US President Donald Trump gloomy times. some anti-China hawks giving this goal, the following meas- for future generations. opening-up.
14

WORLD
Tuesday, April 17, 2018

CHINA DAILY HONG KONG EDITION

‘Global chaos’ if West hits Syria again


Briefly

UNITED STATES
7 killed, 17 injured
in prison riot
In Damascus and Baghdad, people US communication channels still in
Seven inmates were killed
and 17 others injured in a
protest against US-led airstrikes operation, Russian diplomat says riot at a maximum-security
prison in South Carolina,
the state’s department of
By CHINA DAILY Rouhani condemned the air- Channels of communi- municated with Moscow corrections said on Mon-
strikes over phone, agreeing cation between Russia and before taking action in day. It said the riot erupted
Russian President Vladimir that the “illegal action serious- the United States allowing order to reduce the danger on Sunday evening at the
Putin warned on Sunday that ly damages the prospects for a for a better understanding of any civilian casualties Lee Correctional Institu-
further Western attacks on Syr- political settlement” in the of what is going on are still and that it is still open for tion in Bishopville, South
ia would bring chaos to world war-torn country, according to open, Russian Deputy For- cooperation with the latter Carolina and was brought
affairs, following the US-led a Kremlin statement. eign Minister Sergei Ryab- on the Syrian issue. under control at 2:55 am on
tripartite military attacks on “Putin in particular stressed Monday. “The incident at
kov said on Sunday. Nevertheless, Ryabkov
alleged chemical weapons that if such actions, carried Lee CI resulted in 17
“I don’t know how the said it would be rather dif-
facilities in the nation. out in violation of the UN inmates requiring outside
American colleagues ficult for Russia and the
The strikes, launched by the Charter, continue, it will inevi- medical attention and 7
interpret the word ‘coordi- West to reach a consensus
United States along with its tably lead to chaos in interna- Syrians wave Iranian, Russian and Syrian flags during a protest against inmates were killed,” the
nation’. Channels of com- on a draft resolution of the department said.
allies Britain and France before tional relations,” the US-led airstrikes in Damascus on Saturday. OMAR SANADIKI / REUTERS munication and United Nations Security
daybreak on Saturday, followed statement said. information exchange that Council as both sides have
reports of suspected chemical On Monday, hundreds gath- Barbara Bush
make it possible to get a their own red lines.
weapons use in Douma district ered in a square in Syria’s capi- noon, raising Iraqi and Syrian to build lasting peace, one
on the outskirts of Syrian capi- tal, Damascus, rallying in flags in solidarity with the peo- needs to dialogue with Iran,
better picture of what is “We will critically look at in failing health
happening and, hopefully, the proposals of the West- Former first lady Barbara
tal Damascus on April 7. support of their armed forces, ple of Syria and chanting slo- Russia and Turkey. France’s
to more accurately assess ern troika. ... It would be Bush is in “failing health”
The Syrian government which they said succeeded in gans condemning the policy is to talk with everyone.
had strongly denied the alle- confronting the unprecedent- It’s the condition to have each other’s plans, are still extremely difficult to and won’t seek additional
bombing against Syria.
gation, calling for the Organi- ed joint airstrikes by the West peace,” Macron told French functioning,” Ryabkov was reach any reasonable medical treatment, a Bush
zation for the Prohibition of over the weekend. Trump ‘convinced’ news outlets on Sunday. quoted by Tass news compromise or decision. family spokesman said.
Chemical Weapons to send a State TV broadcast the rally Jabra al-Taei, a female civil- Macron said on Sunday agency as saying. ... We have to understand “Following a recent series of
fact-finding mission for inves- live from the central Omayyad ian activist, said: “Syria is a that he had convinced Trump, US Ambassador to Rus- that we have well-known hospitalizations, and after
tigations. However, the three Square. Protesters waved Syri- brother and has been exposed who previously said he want- sia Jon Huntsman said in a red lines,” he said. consulting her family and
nations carried out the strike an flags at the demonstration, to an aggression by the United ed to take US forces out of statement on the same doctors, Mrs Bush, now age
on the day the mission just dubbed a “salute to the States, Britain and France. But Syria, to stay for “the long day that Washington com- XINHUA 92, has decided not to seek
arrived in Damascus. achievements of the Arab Syr- unfortunately they forgot that term”. additional medical treat-
The United Nations Securi- ian Army”, set off fireworks such bombing could threat the But the White House push- ment and will instead focus
ty Council on the same day and unleashed celebratory lives of civilians.” ed back against Macron’s com- on comfort care,” spokes-
held an emergency meeting gunfire. Meanwhile, French Presi- ments about Trump’s Also on Monday, British ment that the strikes were “in man Jim McGrath said.
over the missile attacks at Rus- On Sunday in Baghdad, dent Emmanuel Macron said intentions for US forces. Prime Minister Theresa May Britain’s national interest” Bush has been treated for
sia’s request, but failed to thousands of Iraqis and civil he was ready to talk to all, “The US mission has not was scheduled to face angry and were carried out to stop decades for Graves’ disease,
approve a resolution con- rights activists rallied in including Russia and Iran, to changed — the president has lawmakers for authorizing the further suffering from chemi- which is a thyroid condition,
demning the bombardment. downtown to protest against pave the way for inclusive been clear that he wants US for- strikes without a vote in Par- cal weapons attacks. had heart surgery in 2009
On Sunday, Russian Presi- the US-led attacks on Syria. political transition in the war- ces to come home as quickly as liament. for a severe narrowing of
dent Vladimir Putin and his The demonstrators rallied torn Syria. possible,” White House spokes- Her office said she planned Xinhua, AP and Reuters her main heart valve.
Iranian counterpart Hassan in Tahrir Square in the after- “I say it from the beginning, woman Sarah Sanders said. to tell critics of the govern- contributed to this story.
SOUTH KOREA
‘Nut rage’ sister
Facebook takes out suspended
Korean Air Lines said it has

ads to tout new EU suspended one of its chair-


man’s daughters from work
after she threw a tantrum

data protection law at a business meeting, trig-


gering public outrage and a
police investigation. The
daughter, Emily Cho, is the
BERLIN — Facebook took Facebook admitted earlier younger sister of another
out full-page ads in European this month that up to 87 mil- Korean Air executive
newspapers on Monday to lion users may have had their whose onboard “nut rage”
trumpet tough new EU legisla- data hijacked by British con- outburst delayed a flight in
tion that promises “more data sultancy Cambridge Analyti- 2014. Cho allegedly hurled
protection for you”, as the ca, which worked for US a cup of water at an ad
company seeks to win back President Donald Trump dur- agency official during a
trust following a damaging ing his 2016 campaign. meeting last month. She
privacy scandal. Facebook founder Mark later apologized.
The new law, set to come Zuckerberg, who has repeat-
into effect on May 25, aims to edly apologized for the mas- INDIA
give users more control over sive data breach, last week told Wall between
how their personal informa- the US Congress that the more
tion is stored and used online, stringent EU rules could serve Arab leaders pose for a group photograph ahead of the 29th Arab Summit in Dhahran, Saudi Arabia, on Sunday. BANDAR ALGALOUD VIA REUTERS
Delhi, Mumbai
with big fines for firms that as a rough model globally. The Indian Railways has

Arab summit concludes with strong


break the rules. Brussels has welcomed the decided to construct a 500-
“New EU legislation means unexpected spotlight on its kilometer boundary wall
more data protection for you,” upcoming legislation. along the train tracks
the Silicon Valley giant said in “I was really desperate between Delhi and Mumbai,
the blue-and-white ad, which
appeared in German dailies
including Handelsblatt, Sued-
deutsche Zeitung and the best-
about thinking how to make
the best possible campaign
for GDPR so now this is well
done, so thank you Mr Zuck-
appeal for regional peace and unity officials said on Monday.
“The aim of the boundary
wall is to stop people and
stray animals entering into
selling Bild. erberg,” the EU’s justice and the railway tracks that often
It also appeared in Belgian consumer affairs commis- DHAHRAN, Saudi Arabia create a chance for people to there such as famine and the brings down the speed of
newspapers, as well as in sioner Vera Jourova said last — The yearly Arab League build an independent Syria. outbreak of cholera. express trains traveling
France’s Journal du dimanche, week. Summit concluded with The AL also denounced the The one-day summit was between the two cities,” an
or JDD, newspaper on Sunday. Under the new rules, com- unwavering stands for pre- use of chemical weapons and held on Sunday in the eastern official said. Currently,
Ahead of the introduction of panies will need explicit con- serving regional peace and called for an international We stress our Saudi city of Dhahran. Tunisia trains travel at a maximum
the European Union’s sent from users to share their unity, especially the problems investigation in accordance is scheduled to hold the 30th speed of 130 km/h on this
so-called General Data Protec- data with third parties and related to Jerusalem, Syria, with global regulations into absolute condem- AL Summit. route. But once the wall is
tion Regulation, Facebook people will have the right to Yemen and Iran. any such case. The African Union Com- erected, express trains will
said it would be asking users know what information is According to an official “We stress our absolute
nation of the use mission on Sunday also called be able to keep an average
speed of 160 km/h.
to check their privacy settings
and tell the firm how “we may
stored about them and to ask
for it to be deleted.
announcement released by
Saudi Press Agency after the
condemnation of the use of
chemical weapons against the
of chemical weap- on world powers to under-
take international efforts to
use your data”. Breaches can lead to fines of summit, the Palestinian-Israeli Syrian people and we ons against the find lasting solutions to the UNITED KINGDOM
“You will also have the up to 4 percent of a company’s conflict is the “core issue” con- demand an independent Syrian civil war that respect Mona Lisa’s
opportunity to access your global turnover. cerning the entire Arab world, international investigation to Syrian people.” the country’s territorial integ- secret unveiled
data at any time, download it which firmly insists that East guarantee the application of rity and serves the interests of
or delete it,” the ad went on. REUTERS Jerusalem is the capital of the international law against any- Arab League statement Syrian people. Scientists have discovered
State of Palestine. one proven to have used In a statement, it said “Africa the secret of the mysterious
The AL strongly opposes the chemical weapons,” it said. expects the United Nations expression of the Mona
US administration’s recogni- At the meeting, Jordanian an issue, saying Kuwait will Security Council members, Lisa: Whether she is smiling
at you depends on how you
Final sprint tion of Jerusalem as the Israeli
capital and decision to move
King Abdullah II said the Syr-
ian crisis should be resolved
not hesitate to offer humani-
tarian aid to ease the agony of
especially those that are per-
manent, to put aside their dif- feel, the Guardian reported.
its embassy from Tel Aviv to through political negotiation Syrian people. ferences and spare no efforts in New research has found that
Jerusalem, and urged all coun- rather than any military Referring to the Yemen cri- the pursuit of global peace and people experience faces dif-
tries not to follow the US meas- action which could escalate sis, the AL applied stern words humanity’s common good, in ferently based on their own
ures to harm Arab states’ regional conflicts. to accuse Iran of supporting line with the responsibilities feelings. The team thinks
sovereignty. In this regard, the Astana the Shiite Houthi rebels who conferred upon them by the that how we perceive a new
UN resolutions shall be the talks involving Russia, Iran ousted Yemen’s government United Nations Charter”. face, as happy, sad, or neu-
only norms in negotiating the and Turkey, which brokered and frequently launched mis- “Any response” to the alleged tral, is largely decided by the
conflict, and Israel’s unilateral last year for a political settle- sile attacks on Saudi Arabia. poison gas attack “ought to be feelings we are carrying
actions could only tamper the ment of the Syrian conflict, It voiced support for the based on incontrovertible evi- around when we greet it
facts and hamper the peace cannot replace the UN-backed Saudi-led Arab coalition’s dence gathered by a compe- rather than the expression
process, it said. Geneva talks which include operations in Yemen to pre- tent, independent and credible on that particular face. This
Meanwhile, the summit reit- more global parties, he added. serve the country’s sovereignty entity and comply strictly with means if we subconsciously
erated that political solution is Also at the meeting, the and integrity, and demanded international law, including experience a smiling face,
A portion of a field of about 1,500 runners reaches the top of the the only path for Syria to real- Kuwaiti Emir Sheikh Sabah opening key ports and air- the primacy of the UNSC for we are more likely to regard
Florida Keys Overseas Highway’s longest bridge during the Seven ize peace. Only eliminating ter- al-Ahmad al-Jaber al-Sabah ports for aids to enter Yemen any recourse to force”, it said. a neutral face as happy.
Mile Bridge Run on Saturday near Marathon, Florida. rorist groups and cutting off regretted that a double stan- so as to ease the world’s most
FLORIDA KEYS NEWS BUREAU VIA AFP world powers’ meddling could dard was applied in the Syri- serious humanitarian crisis XINHUA—REUTERS AFP—AP—XINHUA
CHINA DAILY HONG KONG EDITION Tuesday, April 17, 2018 WORLD 15

Indonesia slum kids


eye youth World Cup
JAKARTA, Indonesia — Somad Off the pitch, the kids will take
rarely ventures beyond his impover- part in art lessons, workshops and
ished Jakarta neighborhood, but the there is a conference focused on dis-
14-year-old is now gearing for a trip advantaged youth.
to Russia next month as a player in “I want to help Indonesia win the
the 2018 Street Child World Cup. competition. But if we do win, I
It’s the journey of a lifetime for the don’t want to show off,” says striker
aspiring striker and eight other Bayu, picked for the Indonesian
Indonesian kids set to compete contingent from among more than
against teams of other disadvan- 90 children.
taged children from two dozen “I want to share the experience
nations. with my friends when I’m back.”
The event’s third edition in Mos- In 2014, the boy’s team from Tan-
cow is a long way from Bekasi on the zania won the tournament while the
outskirts of Indonesia’s teeming girl’s trophy was claimed by hosts
capital where Somad’s father sorts Brazil.
through foul trash heaps to find and The inaugural 2010 event, started
sell usable goods. by British charity Street Child Unit-
Along with his food-seller mother, ed, was played in South Africa.
the teen lives in a 45-square-meter But the tournament is about more
makeshift home shared with four than just sports — it’s to give a voice
other families. to marginalized children.
“Not many kids can be as lucky as “Achievement in the tournament
I am,” said Somad, who like many is not our main priority, it’s a bonus,”
Indonesians goes by one name. said Jessica Hutting from Kampus
“I want to make my parents and Diakoneia Modern, a children’s
friends proud so we can have better rights NGO that selected the Indo-
lives and have no need to be scaven- nesian players.
Han Min-ja and Yang Won-ju dance at the New Hyundai Core colatec in Seoul, South Korea, on April 10. The dance halls are increasingly providing a lifeline for gers anymore.” “We use soccer as a tool to bring
the country’s seniors. KIM HONG-JI / REUTERS More than 200 children are par- street-connected children together
ticipating in the seven-a-side soccer in a safe space where their voices
tournament, which was scheduled can be heard.”

S. Korea’s elderly find escape


to kick off ahead of this year’s Rus-
sia-hosted World Cup. AGENCE FRANCE-PRESSE

from anxiety in daytime discos


Older generation among poorest and selves after decades of hard work.
Some are here because they sim-
there are few post-retirement jobs,
or even cheap leisure, available for
most depressed in developed countries ply don’t feel welcome at home.
“My wife yaps at me for breath-
the elderly.
At the New Hyundai Core colatec,
ing if I stay home. I love this music a dance instructor walked around
SEOUL — A discotheque hidden and no one minds me here,” a grey- the hall searching for dancers who
among the back alleys of eastern
Seoul is packed with hundreds of
grey-haired couples on a Monday
1,000 haired man who identified himself
only as ‘white boots’ said, after pay-
ing an entrance fee of 1,000 won
looked lost or lonely. Three full-
time matchmakers helped dancers
who were too shy to find a partner.
afternoon, dancing to local hits such facilities, known as (90 cents) — a fraction of what But Song-ah, a dance instructor, Indonesia’s street children soccer team Garuda Baru gather on the training
from the 1960s in a basketball colatecs, have opened across clubs in Seoul’s affluent Gangnam said she is always on the lookout for field in Bekasi, on the outskirts of Jakarta. The team is set to embark on a
court-sized hall. South Korea. charge their youthful clientele. dating-related fraud at colatecs. journey of a lifetime as they participate in the 2018 Street Child World Cup in
Kim Sa-gyu, 85, calls it his “play- The generation that helped “Sometimes I see young cougars Moscow next month. ELISABETTA ZAVOLI / AGENCE FRANCE-PRESSE
ground”. rebuild Asia’s fourth-largest econo- in their 50s asking really old grand-
“What else would I do all day? My retiring as a hospital administer 20 my after the 1950-53 Korean War is pas out for a dance. I report them to
family is busy with work. I hate
going to senior centers cause all
they do there is smoking,” said Kim,
years ago, is among about 1,000
customers each weekday at the
disco, called a colatec. It is one of
now the poorest and most depressed
among member countries of the
Organization for Economic Cooper-
the owner and separate them,” she
said, adding that lonely seniors can
be taken advantage of by strangers.
Vietnam stirs US coffee
wearing a beret as he sat on a bench
at the edge of a dance floor decorat-
ed with fairy lights and mirror balls.
nearly 1,000 such facilities around
the country.
Almost 2,000 people visit on a
ation and Development.
The relative poverty rate of South
Korea’s elderly stood at 49.6 per-
But for the most part, colatecs do
more good than harm, said Joo
Won, an economist at the Hyundai
aficionado into action
Seven days a week, he gets up at 5 weekend day, said owner Choi cent in 2013, four times the OECD Research Institute.
am, has breakfast with his son and Jung-eun. average, according to the latest “We have one unhappy aging HANOI — For Will Frith, born in “What keeps me engaged in the
two grandchildren, gets an hour of Colatecs, a portmanteau of cola available data. The elderly suicide society that needs support both the United States to a US father and country (Vietnam) is its potential
massage therapy to relieve knee and discotheque, have arisen to serve rate rose from 35 per 100,000 per- from the public and the govern- Vietnamese mother, a visit to Viet- for producing great coffee and a fas-
pain, then hops on a bus. His desti- South Korea’s rapidly aging popula- sons in 2000 to 82 in 2010, also far ment. Places like colatecs need to nam in 2004 ignited a passion for cinating coffee culture that is grow-
nation is the daytime disco for the tion, as a growing number of lonely, above the OECD average of 22. be nurtured,” Joo said. coffee that would change his life. ing quickly,” said Frith.
elderly in New Hyundai Core. impoverished and ailing people South Korea is aging faster than His mission on that first trip was In 2013 he moved to HCM City on
Kim, who has been jobless since rediscover ways to entertain them- any other developed country, yet REUTERS to see his grandmother. But along a mission to find high-quality arabi-
the way, he had the chance to experi- ca in Da Lat and over the past few
ence the Vietnamese coffee culture, years has worked with specialty

Abused Filipinas pin hopes on legalized divorces “sitting in the small plastic stool,
watching the world go by while
slowly sipping the ca phe da (iced
cafes and organizations.
Frith focused mostly on roaster
training, barista training, quality
coffee)”, he recalls. control and product development.
MANILA — Although her hus- be in school because I was not — couples is to seek a legal separation, of the Solicitor General. He describes the now-familiar fla- Frith has became part of a small,
band nearly killed her, Krista and because I want to earn money which does not allow either party The influential Catholic Church vor as “nutty chocolate and caramel young community of producers,
Dador cannot get a divorce as the to pay for my annulment.” to remarry, or a civil annulment, said the government should never ice cream with a bitter aftertaste”. processors, green coffee buyers and
Philippines is one of only two states The Philippines took a step which rights groups say is lengthy offer divorce as an option but use “Everything I heard, smelled, saw roasters who are trying to “make
— along with the Vatican — without toward making divorce legal in and costly — as Dador found out. other laws to stop abuse instead. and tasted was familiar thanks to Vietnamese coffee something legit
a divorce law. March with the lower house of Con- Marriage can only be annulled Journalist Mar-Vic Cagurangan my early exposure to the sounds of and worthy of attention”.
The prohibitive cost of an annul- gress passing a law allowing people on limited grounds, such as insani- said she worked day and night to the language, the food and customs. “People must be patient, with the
ment means that Dador, who has to dissolve marriages, in the face of ty or contracting a sexually trans- raise $2,000 for her annulment, I couldn’t quite understand why it ability to take some risks, because it’s
received no financial support from opposition from bishops in the mitted disease. Abuse and infidelity while also paying her two children’s was so familiar, but it felt something a slow process requiring a long-term
her husband since they separated mainly Roman Catholic country. are not valid reasons. school fees. The average income in like ‘home’,” said Frith. approach. They must have a good
eight years ago, is looking to work Even though thousands of wom- A 2017 survey by independent the Philippines is just over $3,500, The passion for Vietnamese cof- attitude, and be willing to collaborate
as a maid in the Middle East, leav- en want to end failed and abusive pollster Social Weather Stations according to the World Bank. fee, combined with his experiences with others — even their competi-
ing their two children behind with relationships, the bill is unlikely to found that 53 percent favored legal- “Everybody deserves to be hap- working as a roaster in Washington tors. We all need to work together to
her mother. receive the support it needs from ization of divorce in the Philippines. py,” she said. “People deserve to after graduating from college, led grow the high-quality segment of the
“This is a risk I’m taking,” said the upper house Senate, which has The number of annulment cases move on — romantically, mentally Frith to a career in coffee consulta- coffee industry. No single entity can
the 28-year-old, who makes a living to draft and pass what is known as a increased to more than 8,000 in and legally.” tion. While working in the US, he do it alone,” said Frith.
washing neighbors’ laundry in counterpart bill, campaigners said. 2017 from about 1,000 in 2008, maintained an interest in his moth-
Quezon City. “I want my children to The only option for unhappy according to figures from the Office REUTERS er’s country and its coffee. VIET NAM NEWS/ANN

Albania’s pelicans return after wetland protections


TIRANA, Albania — With feath- environmental issues. 1960s, we arrived at 17 in 2000-01. construction of a tourist complex in
ers on its head that make it look like “The king has returned this win- We returned to 52 pairs and 57 Divjaka.
it is wearing a wig, it does not go ter,” said fisherman Fatos Jolla. births in 2017.” It cautioned that the planned
unnoticed — the Dalmatian pelican Since the 1980s, Europe’s bird A small island of 22 square kilo- development could “destroy the nat-
is back with a flourish in the Divjaka population has declined by several meters, in the middle of the lagoon, ural wealth and biological diversity
Lagoon in western Albania. tens of millions, according to orni- has been crucial to helping lure back of the area”.
The expansive site is one of the thologists. the birds. Noting that 70 percent of the Bal-
most important wetlands in the The International Union for Con- The nesting sites were raised so as kan country’s wetlands have already
Adriatic basin, key for migratory servation of Nature has included the not to be threatened by the rising been destroyed, ornithologists and
wildlife and as a breeding area for Dalmatian pelican (Pelecanus cris- water, barbed wire has been placed environmental activists wrote to
the large elegant pelican. pus) on its red list as it believes that to prevent tourists from accessing Prime Minister Edi Rama asking
But like other spots in Europe, the 80 percent of its breeding sites in and hunting was banned in 2016. him to veto the project.
picturesque lagoon has suffered Europe have disappeared. A pelican was shot in mid-Februa- It was suspended, but the activists
extensive damage at the hands of At the Divjaka Lagoon, the peli- ry, but the hunters were identified fear that the halt may only be tem-
man and the Dalmatian pelican cans had almost completely aban- and face two to four years in prison. porary.
came close to deserting it. doned their nests, although However, the recovery is fragile. “It would mean the disappear-
Now a return in force of the bird, previously “the Divjaka-Karavasta The Mediterranean Wetlands Alli- ance of the Dalmatian pelican and
This photo taken on March 11 shows pelicans wading in the Karavasta lagoon, whose wingspan reaches up to 3 National Park was considered its ance, a gathering of some 20 associ- other species that make the diversi-
part of the Divjake Karavasta National Park. Almost 4 years after Albania meters, is down to a proactive poli- kingdom”, said its head, Adrian ations from 12 countries for the ty of this park,” said Koci.
instituted a moratorium on hunting, the population of species has started to cy by Albanian authorities, often Koci. protection of wetlands, last year
stabilize again. GENT SHKULLAKU / AGENCE FRANCE-PRESSE criticized for being passive on “From 250 breeding pairs in the voiced concerns over the possible AGENCE FRANCE-PRESSE
16

SPORTS
Tuesday, April 17, 2018

CHINA DAILY HONG KONG EDITION

Digest SWIMMING

SURFING
Shark attack stops
Aussie competition
A professional surfing event
off Western Australia was
Sun taking his cue from Kobe
briefly suspended on Monday
after a shark attack in the area. NBA superstar’s training regimen
The Margaret River Pro
competition, part of the World an inspiration for Chinese pool ace
Surf Tour, was put on hold for
an hour after the attack at Gra- By SUN XIAOCHEN “I haven’t set a goal to win
cetown, about 15 kilometers in Taiyuan, Shanxi all the events in Tokyo. It’s
away. sunxiaochen@chinadaily.com.cn unrealistic, but I know I have
A man in his 30s, who was to recover my aerobic endur-
surfing at Cobblestones Beach Sun Yang is taking inspira- ance to maintain my lead in
near Gracetown, was bitten on tion from Kobe Bryant in his strength events — the 200
the leg but managed to make it quest for Olympic history. and 400 — and to try to win
to shore, where bystanders A picture posted on Weibo more at the longer distances.”
used a rope from his surfboard in February of Sun training at The likes of reigning 400
to apply a tourniquet. an open-air pool in Sydney Olympic champion Mack
The victim was still con- was accompanied by the mes- Horton of Australia, Lithuani-
scious when flown to Royal sage: “What are you guys an 200 specialist Danas
Perth Hospital by air ambu- doing at 5 am every day?” Rapsys and Italian duo Gabri-
lance. A four-meter shark was It was a testament to the ele Detti and Gregorio Paltrin-
later spotted nearby. 26-year-old Chinese super- ieri in the distance events
star’s dedication. pose major threats to Sun’s
BASEBALL Speaking at the national dream.
Red Sox roar to championships in Taiyuan on However, the nine-time
the weekend, Sun revealed his world champion remains
best-ever start training ritual involved a 3:50 bullish about his chances
Mitch Moreland and am alarm call, mirroring the despite less-than-convincing
Andrew Benintendi each punishing early-morning results so far at the six-day
pounded out three hits as the gym starts that NBA legend meet in Taiyuan.
Boston Red Sox extended the Bryant was renowned for. “The intensity and quality
best start in their 118-year his- “If Kobe knows what it of the training I completed in
tory by beating the Baltimore looked like in Los Angeles at 4 Australia made me confident
Orioles 3-1 on Sunday at frigid am, then I know what Austra- that I still have what it takes
Fenway Park. lia looked like as well,” said to extend my dominance, as World and Olympic champion Sun Yang acknowledges the crowd after winning the 800 meter freestyle final in 7:50.47 at the China
Mitch Moreland also had Sun, whose daily regimen long as I work hard and in the National Swimming Championships in Taiyuan, Shanxi province, on Saturday. PHOTOS BY XINHUA
three hits for the Red Sox, who Down Under involved four right way,” Sun said.
completed a three-game sweep hours in the water and two on His winning time of 1 min
of the shortened series and land over the course of six 46.07 sec in the 200 free on “I hope he can regain his style prowess.”
improved to an MLB-best 13-2 weeks. Friday only ranked fifth in the exceptional stamina for long- Having experienced some
under new manager Alex Cora. Having won the 200m, world this season while his distance races, so I am putting choppy waters outside the
Manny Machado had an 400m and 1,500m freestyle winning time of 7:50.47 in the an emphasis on his 1,500 pool, including an arrest in
RBI double for Baltimore, golds at the 2012 and 2016 800 ranked fourth. training,” said 60-year-old 2013 for driving without a
which has lost five of six. Olympics, Sun is aiming to Sun’s reunion with Zhu Zhi- Zhu, who helped Sun claim license, Sun has learned to
Boston ace Chris Sale gave add the 800 to his collection gen, though, has provided two golds and set the still- appreciate Zhu’s methods
up one run and two hits in five in its debut at Tokyo 2020 and him with a timely boost. standing world 1,500 record more.
innings, striking eight and become the first swimmer to After falling out over (14:31.02) at the London 2012 “We now understand each
walking two. win over the four distances at management issues in 2014, Games. other better in a relationship
the Games. the pair put their differen- “He’s a much more mature that is more like between
BASKETBALL “If everything goes well I ces behind them to reunite athlete now but remains friends, rather than teacher/
Liaoning off to will compete in four events in in February, and, together aggressive in training. My job student,” said Sun. “Hopefully
Tokyo,” said Sun, who signed with Aussie coach Denis is to help him make up for his we can have the perfect end-
CBA Finals flier up for all five free events, Cotterell, Zhu guided Sun’s decline in endurance and to ing to each other’s careers
The Liaoning Flying Leop- including the 100m, here. training in Sydney. go beyond the limit in free- together.” Coach Zhu Zhigen talks with Sun Yang during a training session.
ards clinched a 120-108 away
victory over regular-season

Fu finds a reason to restore her winning smile


champion the Zhejiang
Guangsha Lions to take a 1-0
lead in the best-of-seven CBA
Finals on Sunday.
In the league’s 22-year histo-
ry, Liaoning has lost all six of By SUN XIAOCHEN er the event if I can’t make the has to pay for her own rehab, for the Asiad in an event she
the Finals it has contested. in Taiyuan, Shanxi Asian Games. I am serious,” which is proving a strain. won four years ago in South
Forward Brandon Bass led sunxiaochen@chinadaily.com.cn Fu said after failing to qualify “Simply, I just don’t have Korea.
the way for Liaoning with 28 from the 200m backstroke enough money to hire a new The winning mark was just
points and 10 rebounds. Point With injury casting a shad- heats on the opening day of physio and a fitness trainer 0.01 sec shy of her silver-win-
guard Guo Ailun and Lester ow over her career, Fu Yuan- the nationals, a trial for for the long term,” she said. ning time at last year’s worlds
Hudson added 27 and 23 hui was not her usual chirpy August’s Asiad in Indonesia. “I don’t want to give up yet, in Budapest and 0.1 sec slower
points respectively. self at the start of the national Missing out on the final of but the fact that I am not in than the world record held by
championships in Taiyuan. the 200, a warm-up for her control of this has made it her retired compatriot, Zhao
MOTOR SPORTS The 22-year-old has strength events (50m and more frustrating than the Jing.
Rossi reigns on become a celebrity in China 100m), was no disaster, how- injury itself.” “I didn’t expect I could
after her emotional post-race ever the look of frustration The Zhejiang provincial swim this fast at all because I
Long Beach streets interviews at the Rio Olym- on Fu’s face told a different swimming administrative still felt the pain in my shoul-
Pole-sitter Alexander Rossi, pics stole the nation’s heart, story. center, however, said it will der all the way through the
a former Indianapolis 500 and with her colorful personality, “So much has happened, offer Fu quality support in her race,” a cheerier-looking Fu
Formula 1 race winner, domi- witty social-media posts and not just the injury, and I feel recovery, the Hangzhou- said on Sunday.
nated Sunday’s Long Beach reality show appearances like I can’t swim at my best based Youth Times reported, “To manage to deliver on
Grand Prix for his third career building her a huge following ability or even train hard any quoting an official, Wang Wei. my worst condition serves as
IndyCar triumph and the sea- outside the sport. more. I am so disappointed,” “I don’t think she means it really encouraging. It took a
son points lead. However, the beaming said Fu, who won bronze in when she says she is going to lot of weight off my mind now
The 26-year-old American smiles from Brazil were the 100m backstroke at the retire,” said Wang. “The new that I am on the Asian Games
only trailed in refuel stops and replaced by a heavyhearted 2016 Rio Games. National Games cycle has just roster.
held off Australian Will Power demeanor on Friday at the According to a report on begun and we are still in the “I still don’t know what
at the finish of the 85-lap fea- ongoing nationals thanks to a 163.com, Fu’s Zhejiang team middle of resetting the man- happens next (regarding
ture on the streets of Long nagging left shoulder injury. dispensed with her long-term agement and support sys- retirement), but I am now
Beach. The 2015 50m backstroke physiotherapist about a tems.” determined to work on my
It was the sixth podium fin- world champion said on the month ago during a training Even with the shoulder recovery first with full effort.
ish in the past nine races for weekend that the problem, stint in Australia in a bid to pain affecting her stroke “I don’t mind the grueling
Rossi, who seized a 22-point which she first felt at the 2013 readjust her recovery pro- power, Fu won the 50m back- work as long as I see the light
lead in the driver standings Injury-plagued Fu Yuanhui, who on Friday said she was pondering worlds, had pushed her to the gram. stroke in Taiyuan on Sunday to get back to my full strength
after three races in front of a retirement, rediscovered her trademark smile after winning the brink of retirement. Fu refused to elaborate on in a world-leading 27.16 sec- and to continue to win glory
crowd that included 60 friends national 50m backstroke title on Sunday. XINHUA “I would probably retire aft- the details, but said she now onds this year, qualifying her for my country.”
and family in his home state of
California.
MOTOR SPORTS manager, Euan Jeffery, is con- Shanghai-born Ma Qing-
SOCCER fident that the sport will catch hua, the first Chinese to drive
Juventus stretches
lead over Napoli
Juventus took a major step
toward a seventh straight Serie
Kids getting their karting kicks on here.
“China has a massive popu-
lation. At this moment in
time, only a small fraction of
an F1 car and win an FIA
World Championship race,
began karting when he was
just 8 years old.
the people know of karting,” “Karting is like a rite of pas-
A championship on Sunday as By ALYWIN CHEW the Grand Prix Kart Scholar- grams. Hong Kong-UK joint venture said the Scot. sage into pro racing. It’s about
it beat Sampdoria 3-0 after in Shanghai ship Series (GPKS). The series is backed by the that has competed in events “It’s going to take some helping the kids gain an ini-
Napoli was held to a 0-0 draw alywin@chinadaily.com.cn This year’s series includes Federation of Automobile and such as the World Touring Car time for the scene here to tial skill set and technical
at AC Milan. five races across four cities: Motorcycling Sports of China Championship, is the main improve, but a platform like understanding about the
Douglas Costa changed the As Formula 1 speedsters Shanghai, Beijing, Wenzhou and Shanghai-based J&P consultant for the series. Also GPKS will be very good for sport,” said Jeffery.
game when he came on for the tore up the track in the Chi- and Zhengzhou. The winner Event Management, which is on board is CRG, one of the raising awareness of karting “In fact, kids get to learn a
injured Miralem Pjanic, pro- nese Grand Prix over the will get to compete in the X30 helmed by Mo Xiaohan, a vet- world’s leading manufactur- and motor sports in general.” lot about life, and they mature
viding assists for Mario Mand- weekend, a bunch of children karting finals in Le Mans, eran in the China motorsport ers of karting equipment. Jeffery said the series during the process as well.
zukic, Benedikt Hoewedes and were following suit just a few France, later this year. industry who was previously Founded in 1986, the Ital- would also help with Chinese When they get to a higher lev-
Sami Khedira goals. hundred meters away at the GPKS, which claims to be the director and general man- ian company has a racing ambitions to have a driver el of karting, they will need to
Juventus moved six points Shanghai International Cir- the only competitive junior ager of the Shanghai Interna- team that has won over 30 compete on the world stage. be responsible to their team
clear of Napoli with six match- cuit’s karting arena. karting series in China, said tional Circuit. karting titles. After all, many F1 drivers and be able to communicate
es remaining. The title rivals Donning helmets as big as that it is planning to work The series also boasts a While competitive karting such as Lewis Hamilton, Nico professionally with their
face each other on Sunday. their torsos, children aged with schools in the country to number of high-profile part- is still be in its infancy in Chi- Rosberg and Ayrton Senna mechanics and managers.
7-15 took part in the opening raise awareness of the sport ners. na, CRG’s commercial started their careers in kart- “Karting is much more
AGENCIES race of the second season of through scholarship pro- Craft Bamboo Racing, a research and development ing. than just driving a circuit.”
ROSY OUTLOOK DBS upbeat on foreign bank access expansion p18 CULTURAL

BUSINESS
GROWTH PAINS Vandalism a bump in road for bike-sharing p19 CAPITAL
UK art exports to
China on the rise
p20

CHINA DAILY HONG KONG EDITION Tuesday, April 17, 2018

Hainan plans good


news for free trade
Efforts showcase desire to strengthen development,” Wei said.
“Economies around the
globalization, defend multilateralism world are encouraged to seek
enhanced cooperation in
By JING SHUIYU development developing Hainan. In this
jingshuiyu@chinadaily.com.cn of China’s way the island can become a
inland prov- new engine to fuel global eco-
The grand plan to build inces and nomic growth.”
Hainan into an international coastal areas, Xu Hongcai, an economist
free-trade zone will not only but also offer with the China Center for
boost South China’s develop- a model for International Economic
ment, but also catalyze eco- Wei Jianguo, the develop- Exchanges, said the new plan
nomic growth in the Asia- former vice- ment of for Hainan will boost the
Pacific region and the rest of minister of Southeast island’s international status
the world, said one of the commerce Asian regions and turn it into an economic
nation’s top experts in inter- that are hub with the ability to attract
national trade. mainly agricultural and port- international capital and tal-
The move is one of the based economies,” Wei told ent, Xu said.
nation’s concrete steps to fur- China Daily. More policies and improved
ther facilitate global trade This endeavor showcases institutional systems are A business aircraft on display during the annual Asian Business Aviation Conference & Exhibition starting on Tuesday in Shanghai.
and investment, and concen- China’s conviction to needed to make this grand GAO ERQIANG / CHINA DAILY
trated efforts are needed to strengthen globalization and vision a reality, analysts said.
make this vision a reality, said
Wei Jianguo, a former vice-
minister of commerce.
safeguard multilateralism,
said Wei.
“It lays a foundation for the
“To support Hainan’s
development, more policies
are likely to be carried out in
Bizav sector cashing in on China demand
His comments came short- country to effectively oppose the future. That may
ly after China announced rising trade protectionism, include not only wider By WANG YING in Shanghai Laxton, president of Boeing maker, said thanks to the
plans to support Hainan by
developing the entire island
into a pilot free trade zone,
speed up the flow of global
trade and facilitate interna-
tional investment.”
opening-up policies, but
also broader reform meas-
ures in fields like law formu-
wang_ying@chinadaily.com.cn

About 30 aircraft across the


Business Jets.
According to Laxton, Boe-
ing Business Jets expects the
328 growing support from the
government, China’s busi-
ness aviation sector is grow-
number of business jets in
and building it into a free According to a detailed lation, investment spectrum of business aircraft Chinese market to grow at an ing steadily, and Dassault
service in China
trade port by 2025. official guideline released on guideline, financial systems are being showcased in Shang- increasingly rapid rate, which Aviation expects to benefit
“In the next half century, Saturday, the central authori- and visa policy,” Wei said. hai during the annual three- will generate more demand significantly from this trend.
the tropical island province ties will invite foreign firms Xia Feng, deputy director day Asian Business Aviation for ultra-large business jets as For the past seven years,
of Hainan is expected to stay and multinational compa- of the China Institute for Conference & Exhibition Chinese operators travel with are 328 business jets in service ABACE has developed into a
at the forefront of China’s nies to set up international Reform and Development, starting from Tuesday. larger teams and for greater in China. But there are more must-attend event, not only
next round of opening-up, and regional headquarters in agreed. “The development The stellar cast of more than distances. than 320 billionaires in China for industry stakeholders in
and become an international Hainan. of islands like Hainan is 170 exhibitors and their latest Similarly, Airbus Corporate at the moment, and every five China and throughout the
port with the soundest busi- The free-trade zone in more dependent on open- products attest to China’s Jets notices the trend in Chi- days there will be one new bil- Asia-Pacific, but also for the
ness environment,” said Wei, Hainan will serve as a new ing-up policies than inland great growth potential in the na’s bizav market requiring lionaire, which points to global bizav community.
who is also vice-president of window for China to contrib- areas,” Xia was quoted as business aviation (bizav) mar- bigger and more modern air- greater business jet demand As an early member of ABA-
the China Center for Inter- ute more in solidifying saying by National Business ket, analysts said. craft in China. Around 20 Air- in China. CE, Donald Freeman Jr, chair-
national Economic regional economic integra- Daily. “A slew of comprehen- “The Boeing Business Jet bus Corporate Jets currently Dassault Aviation currently man of the Freeman Co, said
Exchanges, a top govern- tion and injecting vitality to sive measures are needed to market in China is very operate across China, com- has more than $30 million events like ABACE offer good
ment think tank. the world economy, Wei said. ensure the free flow of strong. There are 30 Boeing pared with 30 in the Asia-Pa- worth of business jet compo- opportunities to see products,
“Not only can the plan pro- “It is a Chinese proposal, resources such as capital Business Jet aircraft in the cific region. nents and parts in stock in Chi- and can educate people on
vide guidance to promote the which is applicable to global and skills.” China market. We have seen David Velupillai, marketing na, enabling the company to what’s happening in a particu-
tremendous success in China director of Airbus Corporate quickly meet customer lar industry.
and are very optimistic Jets, said China’s business jet demand. “China clearly has incredi-

Southern island set to about the future of business


aviation in China,” said Greg
fleet grew by 30 percent over
the past five years, and there
Eric Trappier, chairman
and CEO of the French jet
ble potential for all kinds of
exhibitions,” said Freeman.

be international player Exporters to boost brand-building efforts


By LI XIANG in Beijing and By QIU QUANLIN seas Sales Co, a subsidiary of tions … But Chinese exporters Refrigeration Exhibition, is
MA ZHIPING in Haikou in Guangzhou home appliance giant Gree have already introduced meas- also on display during the fair.
qiuquanlin@chinadaily.com.cn Electric Appliances Inc. ures to tackle the problem by The GMV6, which has several
The development of Hain- The White House threaten- optimizing product structure functions — such as low ener-
an into an international free- Chinese exporters will ed to impose tariffs on $100 and opening more overseas gy consumption on standby
trade port heralds a new increase efforts in brand billion worth of Chinese prod- markets,” Xu said. status, positioning self-reac-
stage of the reform and open- building and product struc- ucts early in April, in addition According to Xu, the US is tion and self-diagnosis — is
ing-up of the Chinese econo- ture adjustment to avoid to a $50 billion tariff package traditionally the second-largest incorporated with its innova-
my as the island boasts the potential future business loss- previously proposed, which source of foreign buyers at the tive G-WFC technology, which
potential to compete with es brought about by an ongo- provoked China to slap 25 per- China Import and Export Fair. is based on weather forecast
other international ports ing trade dispute between cent tariffs on imports of soy- Gree displays a wide variety and control strategy of com-
such as Hong Kong and Sing- China and the United States. beans, corn, airplanes and of products during the China pressor refrigerant transfer.
apore, experts said on Mon- “Only through more efforts automobiles from the US. Import and Export Fair, or the “We are sharing the techno-
day. in brand building and innova- Xu Bing, spokesman of the Canton Fair, which opened in logical achievement of artifi-
China’s central authorities tion can Chinese manufactur- China Import and Export Fair, Guangzhou, Guangdong prov- cial intelligence technology
has announced a grand plan ers avoid potential business said the dispute made the ince, on Saturday. into the air conditioning field.
to build the country’s tropical losses that will possibly result number of US buyers to the Gree’s latest innovative We believe that technological
resort island into a pilot from the dispute in the long fair uncertain. product AI multi VRF unit breakthrough will help us gain
international free-trade zone term,” said Oyang Jun, vice “It may result in some uncer- GMV6, which just had its more international market
and a major port with the Tourists buy perfume at a duty-free shop in Sanya, Hainan prov- general manager of Gree Over- tainties in terms of transac- world debut at the Beijing share,” Oyang said.
new policies that are expect- ince. XINHUA
ed to boost investment and
growth in a wide range of sec-
tors including agriculture,
tourism, finance, sports and
Hainan enjoyed advantages
such as the island’s large geo-
ment of Hainan has strategic
importance for the country’s
Farmers want win-win end to Sino-US ‘spat’
entertainment. graphic area and abundant overall development and the
The country also intends to local resources that no other new plan embodies policy By PAUL WELITZKIN the agricultural economy. US and China that need to be
experiment with new busi- existing free-trade zones on innovation that is necessary in Des Moines, Iowa China has slapped a 25 per- discussed, but he added that,
nesses such as horse racing
and sports lotteries on the
island, with hopes of turning
the Chinese mainland can
compare to.
“Compared with Hong
for the next round of reform
and opening-up.
paulwelitzkin@
chinadailyusa.com
cent tariff on pork and other
agriculture products
response to the US imposing
in 30 percent “China is a big market, and
we have spent years building
“It is an updated version of the amount of Iowa’s up the relationship. It’s
it into a top international Kong and Singapore, Hainan the country’s reform and For Rick Hawbaker, who tariffs on Chinese aluminum soybeans that are sent something we don’t want to
tourism destination and con- will utilize its own resources opening-up, and some of the runs a John Deere dealership and steel exports. to China lose.”
sumption hub. to develop. I think it will have measures are far bolder than in Nevada, Iowa, the current That caused the US to He said that he hopes China
The new measures will also a late-mover advantage with previous policies,” Xu said. trade disagreement between threaten 25 percent tariffs and the US can work it out.
support the development of a relatively faster develop- Xie Xiangxiang, an associ- the US and China is like a mar- on $50 billion worth of Chi- “We know that is what’s best
international cruise opera- ment pace,” Chi said. ate professor at the School of ital spat. nese imports, and China Kimberley, who is also for both China and the US. It’s
tion, and will loosen yacht The development of Hain- Tourism of Hainan Universi- “We have been married to responded with a tariff employed by the Iowa Soy- a great relationship and we
regulation and allow foreign an’s free-trade port will focus ty, said that turning the entire China for a while, and we have threat on US products bean Association, said a tar- just want that to continue,” he
investors to set up show busi- on service trade, which is in island into a free-trade zone had a spat. Now it’s time to kiss including a 25 percent tariff iff on US soybeans would added.
ness agencies in Hainan. line with the country’s ser- is a powerful starting point and make up,” he said in an on soybean exports. also probably mean an Kimberley’s son Grant
Experts said that there is vice and consumption-drive for Hainan to become a lead- interview on Thursday Rick Kimberley is a fifth- increase in the price to pur- said he would tell Trump
much to expect from Hainan growth model, and the new ing international tourism Hawbaker is not alone in generation farmer who grows chase soybeans from South that China is extremely
as a free-trade port repre- policies will encourage inno- and consumption center. wanting the “spat” to end, as corn and soybeans on 4,000 America for Chinese pro- important for US agricul-
sents the highest level of vation and entrepreneurship, Xie pointed out that the big- more than 30 percent of Iowa’s acres near Nevada with his ducers and ultimately for ture trade. “Let’s make sure
opening by international which will create more jobs, gest challenge currently facing soybeans are sent to China, son Grant. Chinese consumers. “So we do no harm to that and
standards and it would mean increase incomes and bring Hainan is a lack of talent, so and the state is a major hog “We are hopeful that they nobody is going to win in make sure we continue to
that most goods and services tangible benefits to local resi- the province needs to boost its producer. (China and the US) can work this situation,” he added. negotiate,” he said. “There is
are subject to very low or dents, he added. education and training quality A potential trade war that this out. If the (soybean) tariff If he could talk to US Presi- more to gain by working
even zero tariffs. Xu Hongcai, an economist in order to catch up. includes two of the state’s lasts, that would affect the dent Donald Trump, Kim- together than if we dig in
Chi Fulin, president of the with the China Center for most important products has farm economically and the berley said he would tell him our heels. I want to make
China Institute for Reform International Economic Contact the writers at lixi- created angst among those community,” Rick Kimberley that he understands there sure that both sides are
and Development, said that Exchanges, said the develop- ang@chinadaily.com.cn whose livelihoods depend on said in an interview. are some issues between the working together.’’
18 BUSINESS Tuesday, April 17, 2018 CHINA DAILY HONG KONG EDITION

DBS CEO upbeat on foreign bank access expansion


By JIANG XUEQING open on several fronts,” said ful. It allows us to be a little the range of impact (on) the many busi- and different provinces, you uses its local knowledge of the
in Shanghai Gupta on the sidelines of the more thoughtful about our activities per- nesses that we would like to start running into road Association of Southeast
jiangxueqing@ DBS Asian Insights Confer- distribution requirements,” he mitted to for- do at scale and speed in Chi- blocks. It is my hope and belief Asian Nations and its foot-
chinadaily.com.cn ence China 2018 in Shanghai said. eign banks na, but in the past it was not that this time around you will print in its member countries
on Thursday. “The ability to be able to will be sub- possible. I think this might see the execution trickle to help Chinese companies in
China has shown a strong He was impressed with the own a majority of a securities stantially be a game changer,” Gupta through to the levels that real- terms of partner selection and
desire to further open up and quick follow-up from China’s company and then within increased. said. ly matter.” in terms of negotiating local
the intent of policy improve- central bank Governor Yi three years, to be able to get up “In the “The real issue is that you He noted that there are spe- rules and local regulatory
ment is expected to follow Gang, who, in his speech, pro- to a 100 percent ownership, is Piyush Gupta, past, even have to make sure that the cific areas where DBS, a Singa- environments.
through in execution, said Piy- vided specific details for the helpful because that obviously CEO of DBS though we intent of these policy changes pore-based financial services Last year, the deal value of
ush Gupta, CEO of DBS Group. financial services sector. allows us to think differently Group had a full actually follows through in group, enjoys expertise it can Chinese mergers and acquisi-
“The most important thing “The idea that foreign banks about establishing securities banking execution across provinces bring to China’s domestic mar- tions in ASEAN surged to
about President Xi Jinping’s can have not only no owner- vehicles within the country,” license, there were always and across different agencies,” ket. These areas include the $34.1 billion, rising by 268
speech (in Boao this month) is ship caps, but, more impor- he added. limitations and restrictions he stressed. “In the past, it has TMT and commodities and percent year-on-year and rep-
the statement of intent. It is tantly, the freedom to open What is even more encour- on what we were really often been the case that while trading sectors. resenting 77 percent of the
consistent with his speech in branches and subsidiaries aging than market access is allowed to do. Therefore, the policy intent is positive, by Benefiting from the advan- total value of Chinese M&As
Davos last year, but it indicates nationwide without having to the statement by Yi saying that opening up the range of what the time you get to execution tage of Singapore as an impor- in Asia, according to a recent
a strong desire to continue to get specific approval, is help- by the second half of this year, a bank can do will have a big across different regulators tant financing center, DBS EY report.

What’s news

— we’re not going to get rich that based on advance esti-


selling to ourselves,” Anne Rus- mates, the country’s gross
One small step for ethnic tourism ... ton, Australia’s assistant minis- domestic product for the first
ter for agriculture and water quarter of 2018 grew 4.3 per-
resources, said in a media cent year-on-year. That was
release on Monday. “It makes higher than the GDP growth
sense that we export our wine of 3.6 percent for the fourth
when the world’s largest mar- quarter of 2017 and also 3.6
GOVT AND POLICIES
ket is right on our doorstep.” percent for the whole year. On
a quarter-on-quarter season-
Local govt debt well Vietnam reins in ally-adjusted annualized
within official limit digital currencies
basis, Singapore’s economy
expanded by 1.4 percent in the
China’s local government debt
The Vietnamese prime minis- first quarter, lower than the
balance stood at 16.61 trillion
ter has signed a directive call- 2.1 percent growth in the pre-
yuan ($2.64 trillion) at the end
ing for stronger measures to vious quarter. In a breakdown,
of March, well within the offi-
rein in Bitcoin and other digi- Singapore’s manufacturing
cial limit, according to the
tal currencies amid fear that sector grew 10.1 percent year-
Ministry of Finance. The coun-
they could destabilize the on-year in the first quarter,
try’s top legislative body has
financial market and hurt compared to the 4.8 percent
decided that the upper limit
traders, local media reported. growth in the fourth quarter
for local government debt this
Under the directive, credit of last year.
year should be 20.99 trillion
yuan. China issued local gov- institutions in Vietnam are
ernment bonds worth 191 bil- not allowed to carry out digi- Uber apologizes
lion yuan in March and 219.5 tal currency-related transac-
tions and must swiftly report
for data breach
billion yuan in the first three
any suspicious activities, the Uber has apologized to its
months of this year, all for debt
Vietnam Financial Times 156,000 users in Brazil, whose
swaps. China has made bond
newspaper reported. Public personal information was
issuance the sole legal way for
companies, brokerages, fund leaked in a major data breach
local governments to raise
management companies and in 2016. In an email to them,
debt amid the nation’s efforts
investment funds are banned the ride-sharing company
to forestall systemic financial
from any illegal activities admitted that their names,
crisis, the nation’s finance min-
related to digital currencies emails and cellphone num-
ister said last month.
and are required to comply bers had been seized by hack-
ers in the incident. However, it
Landmark for China with the anti-money launder-
Villagers in traditional dress of the She ethnic group perform a bamboo pole dance as part of the activities presented to visiting added that the specialists
ing rules.
iron ore futures tourists to Quanzhou, Fujian province, on Saturday. XINHUA hired to investigate the data
breach had found no evidence
China will allow foreign
investors to trade in domestic
Opposite trends in that records of journeys, credit
iron ore futures from May 4, Tunisian economy card numbers, bank accounts
or birth dates had been seized.
according to the nation’s The Tunisian economy is
lar on Monday, according to Industrial and Commercial first 63 sales centers next companies. It said that the It also said it had not found
securities regulator. The iron characterized by opposite
the China Foreign Exchange Bank of China (ICBC Singapo- week. The company hopes to new company’s credit assess- any fraud or illicit use of the
ore futures are traded on the trends in early 2018 and risks
Trade System. In China’s re) on Monday launched its establish 100-plus such deal- ment tool harnesses the pow- data.
Dalian Commodity to macroeconomic stability
spot foreign exchange mar- investment banking services erships by the end of this year, er of artificial intelligence,
Exchange, which rolled out have also risen, though eco-
ket, the yuan is allowed to after it had received accredi- covering almost all provincial machine learning and anti- Harare seeks deal
rules in late March to guide nomic growth is picking up,
rise or fall by 2 percent from tation as an issue manager capitals and major cities in fraud algorithms to deter-
foreign investors to partici- the central parity rate each from Singapore Exchange. the country. The figure is mine an applicant’s credit said the International Mone- for electric buses
pate in the market. Introduc- trading day. The central pari- According to a statement expected to reach 170 by the quality within seconds. tary Fund. “Opposite trends Zimbabwe’s capital Harare is
ing foreign investors to the ty rate of the yuan against from the bank, ICBC Singapo- end of 2020. continue to characterize the seeking a deal with an Ameri-
domestic iron ore futures the US dollar is based on a re was awarded with Qualify- Tunisian economy in early can company to introduce
market will help develop a weighted average of prices ing Full Bank License by the 2018. Economic growth is intra-city electric buses to
widely accepted price bench- offered by market makers Monetary Authority of Singa-
PINTEC, UOB set picking up, led by a good agri- provide efficient and cost-ef-
mark and boost the global before the opening of the pore in 2012, which enables it up joint venture cultural season, increases in fective public transport to res-
iron ore trade, according to interbank market each busi- to offer corporate banking, Pintec Technology Holdings investment and an early idents. The firm, Concept
the Dalian Commodity ness day. financial institutional bank- Ltd, a Chinese fintech com- recovery in exports,” the IMF Media Group, plans to intro-
Exchange. ing, global cash management, pany, and Singapore’s United AROUND THE WORLD said in a statement. “On the duce the electricity-powered
private banking as well as Overseas Bank announced on other hand, risks to macroe- buses for intra-city commut-
JD gains 33 percent retail banking products and Monday the establishment of conomic stability have risen: ing on a pilot basis, the state-
stake in Allianz their joint venture, which
Australian wine inflation has risen rapidly to controlled Herald newspaper
services.
China e-commerce giant JD will launch its next-genera- exports up 16% 7.6 percent in March, interna- reported. “The introduction
has invested 537 million yuan tion digital credit assessment The value of Australia’s wine tional reserves remain below of such a transport system
($85.5 million) in Allianz Chi-
FAW Group to open solution in Southeast Asia. exports has hit the highest 90 days of import cover, and would pave way for a cleaner,
na General Insurance Co Ltd more sales centers The new company, named mark in a decade, said a report public and external debts environmentally friendly,
COMPANIES AND MARKETS to obtain a 33.33 percent Chinese automaker FAW Avatec.ai (S) Pte Ltd, aims to released on Monday. Wine have reached 71 percent and cost-effective and easily man-
stake in the company, becom- Group plans to open more help banks and finance com- Australia’s latest Export Report 80 percent of GDP respective- ageable intra-city passenger
Yuan strengthens ing its second-largest share- than 100 dealerships for panies to be more efficient revealed that the value of wine ly,” the IMF mission also said. transportation that echoes
holder. Hongqi (Red Flag), the coun- and more accurate when exports from Australia the Harare City Council’s mot-
against greenback try’s iconic sedan brand, this assessing credit quality of increased 16 percent in the 12 to as a clean and beautiful
The central parity rate of the
Singapore’s Q1 GDP
year in China. In order to pro- potential customers, includ- months to March 2018 to sunshine city by 2025,” said
renminbi, or the yuan,
ICBC expands vide better sales, maintenance ing those who are new to A$2.65 billion ($2.06 billion). grows 4.3% y-o-y the Council.
strengthened 14 basis points in the Lion City and repair services for cus- credit, according to a news “Regional Australia continues Singapore’s Ministry of Trade
to 6.2884 against the US dol- The Singapore branch of tomers, Hongqi will open the release from the two parent to benefit from higher exports and Industry has announced CHINA DAILY — AGENCIES

McKinsey sees country topping world’s autonomous car market by 2030


By CHENG YU nation is playing an increas- ness to pay as much as $4,600
chengyu@chinadaily.com.cn ingly crucial role in the pas- Compared with consumers in as a premium for purchasing
senger vehicle market an autonomous vehicle, while
China will become the globally, with its shares in the other countries, Chinese con- customers from the US and
world’s largest market for global market rising from 9 Germany are willing to pay
autonomous cars, with reve- percent in 2007 to 30 percent
sumers are considering purchasing $3,900 and $2,900, respec-
nue from sales of such new
cars and mobility services
last year.
Currently in China, a large
autonomous vehicles, especially in the tively.
However, the study suggest-
expected to exceed $500 bil- number of companies are premium segment.” ed that the driving environ-
lion by 2030, according to the beefing up efforts in develop- ment for autonomous driving
latest report from global man- ing technology concerning Ting Wu, partner in McKinsey’s Shanghai office is more complicated than in
agement consulting firm autonomous driving, includ- other economies and it may
McKinsey & Company. ing lidar, cameras, processors take an additional two or three
According to McKinsey, the and software, as well as maps autonomous vehicles,” said “Compared with consumers years for software algorithms
market for autonomous vehi- and location-based services. Ting Wu, partner in McKin- in other countries, Chinese to adapt to the country’s traffic
cle is potentially “very huge” in Chinese autonomous vehi- sey’s Shanghai office and consumers are considering environment.
China if settled. It predicted cles technology companies co-author of the report. purchasing autonomous vehi- Christopher Thomas, part- Engineers take an autonomous car on a test drive in the Beijing
that by 2030, the total sales have attracted a total of $7 bil- The move also marks the cles, especially in the premium ner in McKinsey’s Beijing office Economic-Technological Development Area on March 22.
volume of autonomous vehi- lion venture funding between launch of the McKinsey Center segment. In fact, compared and co-author of the report, KAI CHENG GONG / FOR CHINA DAILY
cles is expected to hit $230 bil- 2012 and 2017, which roughly for Future Mobility in China, a with consumers elsewhere, pointed out that both China
lion and autonomous vehicle- equals to the investments in think tank and adviser in the Chinese car buyers aggressive- and other parts of the world including deciding where to He added that companies
based services will generate a US startups in the same period. mobility industry. The center ly seek autonomous driving require same technologies that play, developing a road map to should also improve their stra-
gross booking of around $260 “Current indicators suggest will provide perspectives on features,” he added. autonomous driving need. access the tech stack and decid- tegic agility to update their
billion. China is especially suited for the future of the industry and Chinese consumers sur- “Chinese companies need to ing the right alliance and eco- approach as soon as new data
The report came as the widespread adoption of deliver related client service. veyed have shown a willing- make essential moves now system strategy,” Thomas said. come into the market.
CHINA DAILY HONG KONG EDITION Tuesday, April 17, 2018 Focus | BUSINESS 19

One of Mobike’s shared bicycles stands in London’s Islington neighborhood. PROVIDED TO CHINA DAILY

Vandalism a bump in
road for bike-sharing
Ofo and Mobike remain on course for UK expansion while smaller
operators hit by thieves and vandals call for industry regulation
By ANGUS MCNEICE in London Mobike’s general manager. Newcastle, Oxford and London. Newcastle
angus@mail.chinadailyuk.com When Mobike launched in Man- “We have 35,000 downloads of CHINESE
chester last summer, the scheme our app every month in the UK. We BIKE-SHARING
When a Chinese dockless bike- lost 8 percent of its fleet to theft and are very bullish about the future of COMPANIES
sharing scheme was launched by damage. The company’s UK manag- this business,” Seal-Driver said.
Mobike in the Northern English er, Steve Pyer, said once the novelty Both companies operate their
IN THE UK
Number
town of Stockport in March, resi- of the scheme has worn of, vandal- fleets without docks, and users lock of bikes 950
dents took to social media to voice ism decreases sharply. and unlock bikes using a mobile
their approval. “About 80 bikes have been dam- app. Manchester
“Really great to see Mobike
launching in Stockport,” a Twitter
aged in Manchester. Everywhere
else is minimal, a couple of bikes
For many Londoners who live on
Shefield 350
the outskirts of the city center, the
user wrote. “Hopefully, it will take here and there,” Pyer said. “We scheme offers an alternative to Lon- 1,200 Norwich
off.” haven’t had a repeat of Manchester don’s docked bike-sharing system.
Days later, however, a second in Oxford or London. We’ve got “I use both Ofo and Mobike, and Cambridge
wave of commenters rose up, this about 1,200 bikes in Manchester the key reason is convenience,” said
time to lament the suspension of the and the level of vandalism has Adam Silver, a bike-sharing user 1,000 Oxford
scheme due to widespread reports dropped off a cliff.” who lives in Southeast London. London
of vandalism — “So sad that a few
spoil this for the majority,” one user
Joseph Seal-Driver, UK manager
for Ofo, said that cases of vandalism
“These bikes stretch far into my
area and are incredibly easy to use. I Total number
550
said. are well publicized, but have had go all over town with them, from an
Beijing-based Mobike rolled out minimal impact on the company’s evening restaurant booking to a of bikes
200 of its silver and orange bikes on operations in Britain. simple errand.”
March 12 in Stockport, 8 kilometers “You get the first issue of a small Silver said that he does have con- 100 650
southeast of Manchester, promising
800 more in the coming weeks. On
but noticeable amount of vandalism
— a bike in a river or something like
cerns over data privacy, as the apps
record location information and 4,550 BRETT DIETRICH / CHINA DAILY
2,000 2,000
March 24, though, Mobike suspend- that — and the press picks up on it,” access contacts.
ed the service in order to “protect he said. “And then eventually, the “I always worry about data con-
our bikes and our team”.
The company, which has since
bikes become part of everyday life,
people start using them every day.
cerns, I do with every app but, for
better or worse, those concerns are
4,250
resumed its service in the town, has Vandalism just peters out.” overridden by the convenience of
not disclosed how many bikes were Dublin-based dockless operator the scheme,” he said.
stolen or damaged, though there are
anecdotal reports that more than a
Urbo, which operates in London
and Ipswich, said that maintaining
Both Ofo and Mobike say they
only share GPS data with councils, 35,000
third of the fleet was vandalized in a dedicated on-the-ground team is and do so for free. Ofo app UK
the first 10 days of operation. key to controlling the threat of van- “The data is very valuable,” said downloads
It’s been a year since Ofo — Mob- dalism. Pyer. “We don’t keep anything about per month
ike’s biggest rival — brought the first “Our level has been low — only the person. It’s all about cycling
dockless bike-sharing scheme to the about 5 percent of our fleet have routes, cycling infrastructure,
UK from China, and the industry been vandalized or stolen. Credit where the bikes are going. They can
has developed rapidly, with several goes to our operations team,” said see exactly which roads they take, a
new operators rolling out in cities Urbo co-founder Tom McGovern. really rich data set straight away.”
across Europe. “It’s a bit like the broken window For now, both companies say that
But the issue of vandalism is not effect — if one window in a house is data will remain with local authori-
confined to Stockport, and for some broken, more will be broken soon. If ties.
smaller companies it can be crip- you leave a vandalized bike laying “We’re not about to start advertis-
pling. around for a long period, you’re ing on bikes, we are not about to 1.7 km
In January, Hong Kong bike-shar- increasing the chances of more of start monetizing the data,” Pyer Mobike
ing company GoBee pulled out of your fleet getting stolen.” said. average ride Ofo bikes line a street in Norwich, the United Kingdom.
the Belgian city of Brussels, and Lille Like Urbo, both Ofo and Mobike As was the case in China when distance in UK ANGUS MCNEICE / CHINA DAILY
and Reims in France, because 80 to have teams that move bikes to dockless bike-sharing first started, a
90 percent of its fleet in those cities high-use areas, perform general number of smaller operators have
had been damaged or stolen. GoBee repairs, and respond to cases of begun to compete for riders across ensure that rules were in place to now control 90 percent of the mar- should allow businesses that aren’t
is continuing to supply a service in vandalism. the UK. ensure that predatory pricing ket in China. heavily financially backed to be sus-
Paris, and the Italian cities of Flor- The European Cyclists Federation Singapore-based operator oBike doesn’t occur.” “Regulation is going to be key to tainable, and not damaged by pro-
ence, Turin and Rome, where only 1 estimates that these teams account runs in Oxford, having withdrawn In China, analysts have long ensuring healthy competition in longed promotions or extremely
to 6 percent of the fleet has suffered for 30 percent of an operator’s costs. its bikes from London following an warned that the bike-sharing sector this market,” McGovern said. “We low pricing and free offers,” Roberts
from vandalism. “The question many people ask is ill-fated launch last year when it did is a bubble, with a surplus of opera- don’t want to see any predatory pric- said.
“We must face up to the sad reali- how does each city treat shared not inform councils of rollouts. tors backed by too much funding ing like we’ve seen in China, where Pyer said that Mobike welcomes
ty that a minority bent on destruc- assets, what kind of a society is it? British company YoBike operates competing for too little profit. some operators were giving free regulation in the UK following the
tion does not share our vision on Can people share things? I’m not more than 300 dockless bikes in Ofo recently raised $866 million rides for as long as six months, turbulent beginnings of the bike-
mobility, and we can no longer sup- sure if that is a good question,” Seal- Bristol, while Dublin-headquar- in a financing round led by Alibaba meaning smaller, less-funded opera- sharing industry in Asia.
port the financial and moral costs Driver said. “It’s actually often about tered Urbo runs 500 bikes across Group, having already raised $700 tors go out of business.” “With the benefit of hindsight, in
of the repairs,” GoBee said in a the execution of the service — how three London boroughs and 100 in million in 2017. Last year, Mobike Dockless bike-sharing is not yet China there should have been more
statement. it’s managed, how robust the bikes Ipswich. raised $600 million in a funding regulated by the UK government, regulation to start with,” Pyer said.
But the world’s largest bike-shar- are. And that’s why we’ve done a McGovern says Urbo’s primary round led by Tencent. though most operators including “In the UK, you’ve seen images
ing operators Ofo and Mobike dis- good job in the UK.” concern is not vandalism, but By comparison, Urbo is currently Ofo and Mobike have signed up to from China of massive bike moun-
miss vandalism as a manageable Since launching in Cambridge in competition from operators with looking to raise 5 million euros ($6.2 Bikeplus, an informal governing tains, and there was a bit of hysteria
growing pain. April 2017, Ofo has spread to Lon- much larger financial clout. Both million) to fund planned expan- body for bike-sharing operators in a year ago. But we’ve gone the other
“As with many new launches don, Norwich, Sheffield and Urbo and Ofo compete for riders sions in the UK and Ireland, and Britain. way — we’ve started with strict regu-
there can be teething problems, Oxford, and will soon be available in the borough of Redbridge in GoBee managed to raise $9 million Bikeplus director Antonia Rob- lation, and everyone is now seeing
but we are working closely with in Leeds. East London. in its last financing round. erts estimates ride fares account for the benefit.”
the council, the police and local The bike-sharing company has “In Redbridge, we sat around the Over the last year, four of China’s around one third of an operator’s Going forward, Mobike plans to
stakeholders to address any issues about 4,500 bikes on British roads table with the council and Ofo to 30-plus bike-sharing operators, income. expand to 15 cities in the UK by the
and make the scheme a success in — around the same as Mobike, make sure we’re on the same page,” including the third-largest, Bluego- “It’s important that we find a way end of the year, while Ofo wants to
Stockport,” said Darryl Evans, which operates in Manchester, McGovern said. “We needed to go, have gone bust. Mobike and Ofo in order to collectively agree that we build its London fleet to 150,000.
20 BUSINESS Tuesday, April 17, 2018 CHINA DAILY HONG KONG EDITION

TV firms
Beidou system to rush into
AI-ready
expand into HK sector
Move paves way for navigation service Zhang said. “To bolster Hong
Kong’s smart city vision, the
By FAN FEIFEI
fanfeifei@chinadaily.com.cn
to access overseas markets in future Chinese mainland has what it
takes to export its expertise. Watching television in
This is where the Beidou net- the digital era has just got a
By LUO WEITENG work could come in.” lot easier. Chinese TV man-
in Hong Kong The newly established ufacturers have ushered in
sophia@chinadailyhk.com company has joined hands the era of intelligent TVs as
with the Hong Kong Observa- more and more affluent
Hong Kong marks the first The selling points tory, a weather forecast agen- A member of staff displays a work of art at London-based auction house Christie’s auction preview consumers are pursuing a
stop on the road to expand- cy of the SAR government, to held in Shanghai. XINHUA smarter, high-end lifestyle.
ing the Chinese mainland’s of the Beidou net- offer Beidou standard time Industry insiders said
self-developed Beidou Navi- services for local citizens, in a speech recognition tech-
gation Satellite System into a
worldwide network, said a
top executive of the company.
work are accuracy
and reliability.”
pilot project that will get off
the ground in no more than
two months, Zhang noted.
British art exports to China nology plays a vital role in
boosting the development
of artificial intelligence-en-
“The Asian financial center
stands as the bridgehead and
incubator to bolster the sys-
tem’s ‘going global’ vision,”
Zhang Zuxin, chairman of Hong
Kong-based BD International
Technology Group Ltd
Such a project, he said,
will put Hong Kong citizens
on course to have GPS time
and Beidou time work in
surge 350 percent in 2017 abled TV sets, and the com-
petition will be fiercer with
technological
ments and innovation.
advance-

Zhang Zuxin, chairman of tandem. By BO LEUNG in London Sotheby’s Important Chinese Baofeng Group Co Ltd,
Hong Kong-based BD Inter- house’s answer to the domi- “The selling points of the boleung@mail.chinadailyuk.com Art sale made $10.7 million, a Beijing-based internet
national Technology Group
Ltd, told China Daily in Hong
Kong on Thursday. “What’s
nance of the US Global
Positioning System.
The massive engineering
Beidou network are accuracy
and reliability. It is also a
hedge against vulnerability
Art exports from the United
Kingdom to China rose more
115.90 and Bonhams took in $15 mil-
lion during their Fine Chinese
Art sale.
entertainment and tech-
nology company, is bet-
ting big on the AI-enabled
million pounds
going on in Hong Kong will project, jointly established by from the overreliance on any than 350 percent in 2017, Many of the art buyers were TV. Feng Xin, its chief
essentially add flesh to the hundreds of government one single system,” Zhang according to newly released 2017 art exports from the Chinese but because the buy- executive officer, said the
bones of the mega plan for the departments since the late said. “From the outset, the figures from the UK tax United Kingdom to China ers are anonymous, it is company will concentrate
global venture of the system.” 1990s, has been widely Beidou network is designed authorities. impossible to know how many on its TV business in the
The Hong Kong-based com- applied for civilian use across to be completely compatible In 2016, exports were valued of the artifacts sold were next year, which means its
pany has been built with the
goal of applying the Beidou
system for civilian use first in
169 sectors of the world’s sec-
ond-largest economy, cover-
ing the Chinese mainland
with the US GPS, Russia’s
GLONASS service and the
EU’s Galileo system. Behind
at 25.5 million pounds ($36.2
million); last year, that figure
surged to 115.9 million
21 percent exported to China.
Meanwhile, UK export fig-
ures reveal an overall decline
previous investments in
virtual reality and online
video markets will slow
China’s market share of
Hong Kong and then other and more than 30 neighbor- our going global push is the pounds. of 2.2 percent to 4.84 billion down.
global art sales last year
overseas markets in the future. ing countries, Zhang said. pursuit of making the Beidou The figures measure the val- pounds. Baofeng has launched its
As outer space becomes Hailed as a poster child of network an alternative to US, ue of goods crossing UK bor- Import traffic from the UK’s latest AI-enabled TV7 at
part of the Belt and Road Ini- how indigenous innovation Russian and European servi- ders rather than sales, so can main European Union trading 2,999 yuan ($477). TV7 can
tiative, countries and regions makes the Chinese mainland ces, giving countries the free- include works of art being partners was down almost 60 be turned on immediately
involved in this initiative are
on track to be among the first
in line to plug into the Chi-
less dependent on foreign
technology, the Beidou net-
work fits in well with Hong
dom of choice to have more
than one system operate in
tandem in the near future.”
moved for exhibition.
The recent Global Art Mar-
ket Report co-published by the
$11.1 percent year-on-year.
According to Ivan Macquis-
ten, an art market consultant
when the user calls the
name of its AI assistant —
Baofeng Big Ears — instead
nese mainland’s homegrown Kong’s ambition to become a Known as an international Art Basel contemporary art
million and writer who analyzed the of using the remote control.
satellite navigation services world-class smart city over metropolis, Hong Kong is a show and UBS found that in amount of Christie’s sale of figures from the British gov- The 55-inch TV can listen
by the year end. This paves the next five years, which was natural choice to test the 2017, China became the sec- Chinese art in London last ernment’s taxation depart- to and understand users’
the way for the system to underscored by a long list of huge potential of the Beidou ond-biggest art market in the November ment Her Majesty’s Revenue commands using its speech
deliver global coverage in innovation initiatives rolled system, he noted. world after the United States, and Customs, this could be the recognition capacity, and
2020, when some 35 satellites out by a local government “If we can make the city a accounting for 21 percent of “result of simple reluctance to recommend TV programs
will be in operation. blueprint released in Decem- showpiece of the network’s $63.7 billion worth of global send art and antiques there for according to users’ age,
Beidou, which literally ber last year, he noted. great benefits to the local sales. in the sale of Chinese artifacts. sale” following Britain’s deci- gender and preference.
means Northern Dipper, the “Satellite-based navigation economy and people’s liveli- The report noted that one Auction house Christie’s sale sion to leave the European “We have carried out
Chinese name for the constel- and positioning services hoods, we can clear up some reason was because of the rise of Chinese art in London last Union. strategic cooperation with
lation known in the West as proved to be an indispensable deep-rooted misunderstand- in the number of wealthy Chi- November achieved a total He said the fall in sterling, iQiyi.com, a Chinese
the Big Dipper or the Plough, part of making almost every ings and dispel doubt the nese individuals. amount of $11.1 million. Also especially in the first half of online streaming video
is the Asian economic power- sector of the economy smarter,” world over,” he added. There is also greater activity in London last November, 2017, could also be a factor. service provider, to pur-
chase its video content,”
said Liu Yaoping, CEO of
Baofeng TV, the TV arm of

Education company Baofeng Group, adding


users could enjoy more
than 12,000 films and over

employs more tech


2,400 TV series.
Experts said as the scale
of AI-enabled TVs continu-
ously expands, Al function
By CHENG YU and Xiang He Capital among is becoming a standard
chengyu@chinadaily.com.cn investors. configuration in TV
Steven Ji, co-founder of domain.
Chinese online education Sequoia Capital, said: “We are “After two years of fast
company Zuoyebang aims to optimistic about the prospect development, the AI-pow-
incorporate more technology of Chinese online education ered TV industry has
into its products this year to and we think that the country stepped into a mature peri-
benefit not only students from is expected to generate a group od and human-machine
major Chinese cities but third of education companies val- interaction has become
and fourth-tier ones as well. ued at several billion dollars.” more important. Along
“Online education is the According to a report by iiMe- with more TV makers
best way of promoting high- dia Research, the market scale jumping into the industry,
quality resources to cities of China’s online education is the competition will con-
across the country including expected to hit 348 billion yuan tinue and be more intense,”
third and fourth-tier cities as ($55.4 billion) this year. said Liu Buchen, an inde-
internet and advanced tech- “It’s not an easy task to grab pendent researcher in the
nologies can traverse time, users from the huge cake,” Ji home appliances sector.
space and region,” said Hou said, adding that Zuoyebang is China sold 47.52 million
Jianbin, founder and CEO of strong at gaining users and television sets last year,
Zuoyebang, in an exclusive that’s why they invest in the down 6.6 percent year-on-
interview with China Daily. company. year, the biggest decrease
“We cannot ignore that His words align with Zuoye- since 2003, according to a
teachers gather in major Chi- bang’s own figures, which show report from domestic
nese cities and students from that the company has accumu- home appliance market
third and fourth-tier cities lated 300 million registered monitor All View Cloud.
find it hard to access high- users as of now, meaning that AVC said the TV industry is
quality education resources,” two in three primary and mid- expected to rebound this
Hou said, adding that this bot- dle students online is using the year, with sales ascending
tleneck is what their products company’s products. to 48.98 million units, up
are scrambling to tackle. To further improve its servi- 3.1 percent year-on-year.
The company, as an after- ces, the company is expanding Traditional TV manufac-
school mentoring platform, its businesses to products such turers such as TCL Corp,
allows students to take a pic- as livestreaming courses and Sichuan Changhong Elec-
ture of their questions and one-on-one mentoring cover- tronic Co Ltd and Hisense
search for answers as well as ing almost every procedure of Group have stepped up
mentoring. It now opens a studying including teaching, efforts to enter the AI-pow-
new chapter by launching its learning, testing, exercising ered TV market.
latest livestreaming course and grading, Changhong has pro-
product Zuoyebang Yike. “We will put livestreaming duced TVs that can com-
While it usually takes eight courses at the top of the agenda prehend semantic nuances
or nine seconds for a common this year where we invite not and distinct features of
system to capture and search only teachers but also celebri- each voice, memorize
for the engine, it takes Zuoye- ties from a variety of fields to users’ preferences and
bang’s products less than one join in teaching online,” he said. viewing habits, and then
second to do the same thing. Hou added that the cost of come up with recommen-
The Beijing-based company Zuoyebang’s live classes is dations to suit the users at
has also made considerable much lower than that of other any given time.
investments in establishing livestreaming courses in the The TV giant is focusing
its own database — China’s market. on the deep integration of
first online education plat- “Imagine there are some AI and TV. “Robotics,
form where all questions and thousands of students taking machine learning,
answers have been well con- classes in front of their com- human-machine interac-
sidered and proved by puters at home and some tion and computing appli-
experts. classes cost one yuan, which cations have been part of
The company raised $150 will provide great conve- our focus. Artificial intel-
million in its latest round of nience for students, especially ligence is just the tip of
financing last year, with H. those from third and fourth- the iceberg,” said Li Jin,
Capital, Sequoia Capital, Tiger tier cities. Isn’t it a good general manager of
Fund, Legend Capital, GGV thing?” Hou asked. Changhong.
CHINA DAILY HONG KONG EDITION Tuesday, April 17, 2018 BUSINESS 21

Hanergy unveils next generation thin-film tile


By ZHAO TINGTING
Hainan plan
zhaott@chinadaily.com.cn

Hanergy Thin Film Power


Group Ltd launched the sec-
ond generation of its flagship
The technology
gives related
product Hantile, a thin-film
rooftop PV product, in Beijing
on Sunday.
The single-
glass curved-
upgrade reduces
limits of product
applications and
firms a boost
shape thin-
film solar tile solves the energy 20 listed companies see surge in share
combines flex-
ible solar pan- problem.” prices, with 17 soaring by 10% daily limit
els with high-
transmittance Zhang Ying, a professor at By SHI JING in Shanghai the local economy to grow at a
Li Hejun, glass. Peking University’s Guanghua shijing@chinadaily.com.cn faster pace.
chairman of “Designed School of Management Investors should watch
Hanergy with various Share prices of Hainan-re- closely companies related to
Holding shapes and lated companies rallied on ecological landscaping, tour-
Group colors, the culture and modern technolo- Monday in response to Presi- ism, construction materials,
Hantile has gy, paving the way for further dent Xi Jinping’s speech on Fri- transportation and favorable
all the functions of the tradi- development of traditional day supporting the building of tax policies, analysts from Hua
tional tile and can fully Chinese architectural forms.” the whole island into a pilot Chuang Securities suggested.
replace traditional roofing Founded in 1994, Hanergy free trade zone and a free port Regarding the central
tiles,” said Li Hejun, chairman Visitors check single-glass curved-shape thin-film solar tiles manufactured by Hanergy Thin Film runs the largest private- with Chinese characteristics. authorities’ plan on Hainan’s
of Hanergy Holding Group, at Power Group Ltd in Beijing last Sunday. PROVIDED TO CHINA DAILY owned hydropower station in According to Wind Info, a reform, analysts from Ping An
the launch ceremony. the world and has become a Shanghai-based financial infor- Securities said that investors
“Hantile can also provide global leader of thin-film solar mation service provider, compa- should keep an eye on compa-
users with unique values in “The new Hantile was based Hantile features a single layer peratures ranging from -40 C power generation. It has regis- nies related to the Hainan nies specializing in high-tech,
investment, society and cul- on improvement of the under- of glass, and each tile weighs to 85 C, and humidity up to 85 tered more than 2,300 patents development plan showed the digitalization, high-end manu-
ture,” Li added. “The power lying technology,” said Zhang only 5.2 kilograms, which percent. worldwide. most robust increase of 7.15 per- facturing and consumption.
generated by 100 square Ying, a professor at Peking greatly eases the cost of trans- “Solar panels used to be Hanergy Thin Film Power cent on average on Monday, Analysts from TF Securities
meters of Hantile in 30 years is University’s Guanghua School portation and installation. installed on rooftops, which Group Ltd, the conglomerate’s while the benchmark Shanghai wrote in a note that horse rac-
equivalent to that of 123 met- of Management. “The technol- The ultra-white tempered affected the appearance of the Hong Kong-listed arm, report- Composite Index fell 1.53 percent ing and large international
ric tons of coal, and the envi- ogy upgrade reduces limits of glass used in Hantile has a architecture and restricted the ed a net profit of HK$261 mil- to close at 3,110.65 and the Shenz- sports events should be the
ronmental protection value product applications and transmittance level of 91.5 design,” said Liu Qian, land- lion ($33 million) and a revenue hen Component Index dropped two areas that are likely to see
created by 100 square meters solves the energy problem.” percent. The new roof tile can scape designer for the Hong- of HK$6.15 billion in 2017, up 37 0.61 percent to close at 10,621.79. rapid development following
of Hantile is equivalent to the Based on the firm’s thin- withstand high winds and Kong-Zhuhai-Macao Bridge. percent year-on-year, according A total of 20 Hainan-related the announcement of the cen-
planting of 340 trees.” film solar technology, the new can generate power at tem- “Hantile integrated Chinese to the company’s annual report. companies reported price tral authorities’ plan. While
increases on Monday, with 17 of taking Shanghai (China) Pilot
them soaring by the daily 10 Free Trade Zone — the first of

Online fashion retailer eyes US public offering so Meilishuo could get a lot of
resources and help,” said Li
Yujie, an analyst at RHB
percent limit, including Hai-
kou-based manufacturing com-
pany Sundiro Holding, Hainan
its kind in China — as an
example, Hainan still lags
behind in terms of the contri-
Research Institute Sdn in Shennong Gene Technology, bution of wholesaling and
BEIJING — Meilishuo, a rival Mogujie in 2016 to form sions about a Hong Kong IPO Hong Kong. “It still depends and Haima Automobile Group. retailing to local GDP. In this
Chinese online fashion retail- a company with $3 billion in at a valuation of at least $60 on how the overall market Public information shows that sense, companies related to
er backed by Tencent Hold-
ings Ltd, is in talks with
sales, and was said to have
been valued at $3 billion at
$4 billion billion, media reported.
Statistics showed that 58.3
performs, it would be a good
year to fetch good valuation
there are 30 Hainan-based com-
panies listed on China’s A-share
these two sectors in Hainan
will have much room to grow,
several investment banks the time of that deal. total valuation that Meilishuo percent of Meilishuo’s users for e-commerce sector.” market. By the end of the third according to the note.
about a US initial public offer- The company, whose name plans to reach via the listing are ages 23 to 30, while the Furthermore, JD and Meili quarter of 2017, these companies’ The Central Committee of
ing that could value the start- means “Beauty Talk,” is one of on the US stock market family monthly income of Inc, the parent company of total assets came to 434.5 billion the Communist Party of China
up at about $4 billion, the more popular fashion and more than 75 percent of users Meilishuo, announced the yuan ($69.2 billion). and the State Council jointly
according to people familiar cosmetics retailers online, a was between 10,000 yuan establishment of a new joint Hua Chuang Securities released a document on Satur-
with the matter. niche it’s clung to despite the ($1591.4) and 20,000 yuan. venture in January, as JD wrote in a note that Hainan is day, saying that China is aiming
The women-focused dominance of Alibaba Group to sell shares to the public. As of 2016, the company hopes to tap more female home to a number of impor- to establish a free trade system
online retailer hosted a Holding Ltd and JD. Smartphone maker Xiaomi had about 15,000 merchants shoppers to compete with Ali- tant port cities such as Haikou in Hainan by 2025 and make
meeting to discuss the Meilishuo’s envisioned $4 Corp is seeking a valuation of on its website and a mobile baba’s Tmall. and Sanya. The number of the free port system more
prospects of an initial public billion valuation is an initial as much as $100 billion in a application that had been The new company will build port cities will help Hainan mature in the province by 2035.
offering with potential advis- target and could change if a much-anticipated offering, downloaded 100 million and operate a social commerce achieve rapid development in Information technology,
ers and underwriters, the deal proceeds, the people people familiar with the mat- times. That year, it merged platform leveraging JD’s cur- terms of logistics, transporta- deep-sea science and technolo-
people said, asking not to be said. The company didn’t ter have said, while Meituan with Mogujie, founded in 2011 rent level-one entry point on tion and services. Therefore, gy, tourism, ecological environ-
identified because they were respond to requests for com- Dianping, the mainland’s larg- with about 130 million regis- WeChat, Tencent’s popular resources such as commodi- ment and resource conservation
talking about private negoti- ment. est provider of on-demand tered users. social media platform. ties, technologies and raw will be the major areas concern-
ations. This is another Chinese online services also backed by “Tencent wants to develop materials will be allocated in a ing Hainan’s reform, according
Meilishuo merged with technology company looking Tencent, has begun discus- e-commerce via its partners, BLOOMBERG — CHINA DAILY more reasonable way, helping to the document.

TOWN PLANNING ORDINANCE (Chapter 131)


APPLICATION FOR PLANNING PERMISSION
SUBMISSION OF FURTHER INFORMATION
Pursuant to section 16(2D)(b) of the Town Planning Ordinance (the Ordinance), the Town Planning Board (the Board) has published newspaper notice(s) of the planning application(s) made under section 16(1) of the Ordinance as set out in the Schedule
below. Pursuant to section 16(2K) of the Ordinance, the Board has accepted further information from the applicant(s) to supplement the information included in the application(s). The further information is now available for public inspection during
QRUPDORI¿FHKRXUVDWWKHIROORZLQJORFDWLRQV
(i) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJDQG
(ii) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU6KD7LQ*RYHUQPHQW2I¿FHV6KHXQJ:R&KH5RDG6KD7LQ1HZ7HUULWRULHV
In accordance with sections 16(2K)(c) and 16(2F) of the Ordinance, any person may make comment to the Board in respect of the further information. The comment should state the application number to which the comment relates and should be
PDGHWRWKH6HFUHWDU\7RZQ3ODQQLQJ%RDUGE\KDQGSRVW WK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJ ID[ RU RUHPDLO WSESG#SODQGJRYKN RUWKURXJKWKH%RDUG¶VZHEVLWH KWWS
ZZZLQIRJRYKNWSE QRWODWHUWKDQWKHGDWHVSHFL¿HGLQWKH6FKHGXOH
$Q\SHUVRQZKRLQWHQGVWRPDNHFRPPHQWLVDGYLVHGWRUHDGWKH³7RZQ3ODQQLQJ%RDUG*XLGHOLQHVRQ3XEOLFDWLRQRI$SSOLFDWLRQVIRU$PHQGPHQWRI3ODQ3ODQQLQJ3HUPLVVLRQDQG5HYLHZDQG6XEPLVVLRQRI&RPPHQWVRQ9DULRXV$SSOLFDWLRQV
XQGHUWKH7RZQ3ODQQLQJ2UGLQDQFH´ WKH*XLGHOLQHV IRUGHWDLOV7KH*XLGHOLQHVDUHDYDLODEOHDWWKHDERYHORFDWLRQVWKH6HFUHWDULDWRIWKH%RDUG WK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJ DVZHOODVWKH
%RDUG¶VZHEVLWH KWWSZZZLQIRJRYKNWSE 
,QDFFRUGDQFHZLWKVHFWLRQV . F DQG , RIWKH2UGLQDQFHDQ\FRPPHQWPDGHWRWKH%RDUGZLOOEHDYDLODEOHIRUSXEOLFLQVSHFWLRQGXULQJQRUPDORI¿FHKRXUVDWORFDWLRQV L DQG LL DERYHXQWLOWKH%RDUGKDVFRQVLGHUHGWKHDSSOLFDWLRQLQ
TXHVWLRQXQGHUVHFWLRQ  
7KHJLVWVRIWKHDSSOLFDWLRQV LQFOXGLQJORFDWLRQSODQV FDQEHYLHZHGDWWKHDERYHORFDWLRQVWKH6HFUHWDULDWRIWKH%RDUGDQGWKH%RDUG¶VZHEVLWH
7KHWHQWDWLYHGDWHRIWKH%RDUGWRFRQVLGHUWKHDSSOLFDWLRQKDVEHHQXSORDGHGWRWKH%RDUG¶VZHEVLWH KWWSZZZLQIRJRYKNWSE 7KHPHHWLQJIRUFRQVLGHULQJSODQQLQJDSSOLFDWLRQVH[FHSWWKHGHOLEHUDWLRQSDUWVZLOOEHRSHQWRWKHSXEOLF)RU
REVHUYDWLRQRIWKHPHHWLQJUHVHUYDWLRQRIVHDWFDQEHPDGHZLWKWKH6HFUHWDULDWRIWKH%RDUGE\WHOHSKRQH  ID[ RU RUHPDLO WSESG#SODQGJRYKN DWOHDVWRQHGD\EHIRUHWKHPHHWLQJ6HDWVZLOOEHDOORFDWHGRQD¿UVW
FRPH¿UVWVHUYHGEDVLV
7KHSDSHUIRUFRQVLGHUDWLRQRIWKH%RDUGLQUHODWLRQWRWKHDSSOLFDWLRQZLOOEHDYDLODEOHIRUSXEOLFLQVSHFWLRQDIWHULVVXHWRWKH%RDUG0HPEHUVDWWKH3ODQQLQJ(QTXLU\&RXQWHUVRIWKH3ODQQLQJ'HSDUWPHQW +RWOLQH DQGDWWKH3XEOLF9LHZLQJ
5RRPRQWKHGD\RIPHHWLQJ
$IWHUWKH%RDUGKDVFRQVLGHUHGWKHDSSOLFDWLRQHQTXLU\DERXWWKHGHFLVLRQPD\EHPDGHDWWHOQRRURUWKHJLVWRIWKHGHFLVLRQFDQEHYLHZHGDWWKH%RDUG¶VZHEVLWHDIWHUWKHPHHWLQJ
Statement on Personal Data
7KHSHUVRQDOGDWDVXEPLWWHGWRWKH%RDUGLQDQ\FRPPHQWZLOOEHXVHGE\WKH6HFUHWDU\RIWKH%RDUGDQG*RYHUQPHQWGHSDUWPHQWVIRUWKHIROORZLQJSXUSRVHV
D  WKHSURFHVVLQJRIWKHDSSOLFDWLRQZKLFKLQFOXGHVPDNLQJDYDLODEOHWKHQDPHRIWKHSHUVRQPDNLQJWKHFRPPHQW KHUHDIWHUNQRZQDV³FRPPHQWHU´ IRUSXEOLFLQVSHFWLRQZKHQPDNLQJDYDLODEOHWKHFRPPHQWIRUSXEOLFLQVSHFWLRQDQG
E  IDFLOLWDWLQJFRPPXQLFDWLRQEHWZHHQWKH³FRPPHQWHU´DQGWKH6HFUHWDU\RIWKH%RDUG*RYHUQPHQWGHSDUWPHQWV
in accordance with the provisions of the Ordinance and the relevant Town Planning Board Guidelines.
Schedule
Deadline for Making
Applied Use/ Further
Application No. Location Comment on the
Development Information
Further Information
$1(7./ /RW53LQ''6KD7DX.RN5RDG0D0HL Proposed Temporary Open Storage of 7KH DSSOLFDQW VXEPLWWHG IXUWKHU LQIRUPDWLRQ LQFOXGLQJ 5HVSRQVH WR &RPPHQWV 7DEOH 7UDI¿F ,PSDFW $SULO
+D1HZ7HUULWRULHV Construction Equipment and Machineries Assessment, Drainage Impact Assessment and landscape proposal to respond the comments of various
IRUD3HULRGRI<HDUV Government departments.
$7:: /RWV536$ 3URSRVHG+RXVH'HYHORSPHQWDW3ORW5DWLR The applicant provided responses to departmental comments with revised master plan, master landscape $SULO
53   DQG  LQ ''  DQG DGMRLQLQJ RI SODQDQGVHFWLRQSODQVWRDGGUHVV0HWUR3ODQQLQJ&RPPLWWHH¶VFRQFHUQRQSRVVLEOHYLVXDOLPSDFWEURXJKW
*RYHUQPHQW/DQG7LQJ.DX7VXHQ:DQ about by the proposed development on the surrounding area.
$+ 1R*DJH6WUHHW6KHXQJ:DQ+RQJ.RQJ 3URSRVHG2I¿FH6KRSDQG6HUYLFHV(DWLQJ The applicant provided responses to departmental comments, revised Drainage & Sewerage Impact 0D\
Place $VVHVVPHQWDQGDGGLWLRQDOWHFKQLFDOGHWDLOVRQ7UDI¿F,PSDFW$VVHVVPHQW
$70 *) RI 7DL +DN 7LQ 7HPSOH ZLWKLQ /LQ &KL &KLQJ Proposed Columbarium The applicant provided responses to departmental comments enclosing revised Sewerage Impact 0D\
<XHQ/RW SDUW LQ''7VLQJ6KDQ7VXHQ $VVHVVPHQW7UDI¿FDQG&URZG0DQDJHPHQW3ODQUHYLVHG0DVWHU/D\RXW3ODQDQGDPHQGHGSDJHVLQWKH
Tuen Mun Planning Statement.

17 $SULO                   7RZQ3ODQQLQJ%RDUG
22 ANNOUNCEMENT Tuesday, April 17, 2018 C H I N A DA I LY H O N G KO N G E D I T I O N

TOWN PLANNING ORDINANCE (Chapter 131)


APPLICATION FOR PLANNING PERMISSION
Pursuant WRVHFWLRQ ' RIWKH7RZQ3ODQQLQJ2UGLQDQFH WKH2UGLQDQFH WKHSODQQLQJDSSOLFDWLRQVPDGHXQGHUVHFWLRQ  RIWKH2UGLQDQFHDVVHWRXWLQWKH6FKHGXOHEHORZDUHDYDLODEOHIRUSXEOLFLQVSHFWLRQGXULQJQRUPDORI¿FHKRXUVDWWKHIROORZLQJ
locations -
(i) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJDQG
(ii) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU6KD7LQ*RYHUQPHQW2I¿FHV6KHXQJ:R&KH5RDG6KD7LQ1HZ7HUULWRULHV
,QDFFRUGDQFHZLWKVHFWLRQ ) RIWKH2UGLQDQFHDQ\SHUVRQPD\PDNHFRPPHQWWRWKH7RZQ3ODQQLQJ%RDUG WKH%RDUG LQUHVSHFWRIWKHDSSOLFDWLRQV7KHFRPPHQWVKRXOGVWDWHWKHDSSOLFDWLRQQXPEHUWRZKLFKWKHFRPPHQWUHODWHVDQGVKRXOG
EHPDGHWRWKH6HFUHWDU\7RZQ3ODQQLQJ%RDUGE\KDQGSRVW WK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJ ID[ RU RUHPDLO WSESG#SODQGJRYKN RUWKURXJKWKH%RDUG¶VZHEVLWH KWWS
ZZZLQIRJRYKNWSE QRWODWHUWKDQWKHGDWHVSHFL¿HGLQWKH6FKHGXOH
$Q\SHUVRQZKRLQWHQGVWRPDNHFRPPHQWLVDGYLVHGWRUHDGWKH³7RZQ3ODQQLQJ%RDUG*XLGHOLQHVRQ3XEOLFDWLRQRI$SSOLFDWLRQVIRU$PHQGPHQWRI3ODQ3ODQQLQJ3HUPLVVLRQDQG5HYLHZDQG6XEPLVVLRQRI&RPPHQWVRQ9DULRXV$SSOLFDWLRQV
XQGHUWKH7RZQ3ODQQLQJ2UGLQDQFH´ WKH*XLGHOLQHV IRUGHWDLOV7KH*XLGHOLQHVDUHDYDLODEOHDWWKHDERYHORFDWLRQVWKH6HFUHWDULDWRIWKH%RDUG WK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJ DVZHOODVWKH
%RDUG¶VZHEVLWH KWWSZZZLQIRJRYKNWSE 
,QDFFRUGDQFHZLWKVHFWLRQ , RIWKH2UGLQDQFHDQ\FRPPHQWPDGHWRWKH%RDUGZLOOEHDYDLODEOHIRUSXEOLFLQVSHFWLRQGXULQJQRUPDORI¿FHKRXUVDWORFDWLRQV L DQG LL DERYHXQWLOWKH%RDUGKDVFRQVLGHUHGWKHDSSOLFDWLRQLQTXHVWLRQXQGHU
VHFWLRQ  
7KHJLVWVRIWKHDSSOLFDWLRQV LQFOXGLQJORFDWLRQSODQV FDQEHYLHZHGDWWKHDERYHORFDWLRQVWKH6HFUHWDULDWRIWKH%RDUGDQGWKH%RDUG¶VZHEVLWH
7KHWHQWDWLYHGDWHRIWKH%RDUGWRFRQVLGHUWKHDSSOLFDWLRQKDVEHHQXSORDGHGWRWKH%RDUG¶VZHEVLWH KWWSZZZLQIRJRYKNWSE 7KHPHHWLQJIRUFRQVLGHULQJSODQQLQJDSSOLFDWLRQVH[FHSWWKHGHOLEHUDWLRQSDUWVZLOOEHRSHQWRWKHSXEOLF)RU
REVHUYDWLRQRIWKHPHHWLQJUHVHUYDWLRQRIVHDWFDQEHPDGHZLWKWKH6HFUHWDULDWRIWKH%RDUGE\WHOHSKRQH  ID[ RU RUHPDLO WSESG#SODQGJRYKN DWOHDVWRQHGD\EHIRUHWKHPHHWLQJ6HDWVZLOOEHDOORFDWHGRQD¿UVW
FRPH¿UVWVHUYHGEDVLV
7KHSDSHUIRUFRQVLGHUDWLRQRIWKH%RDUGLQUHODWLRQWRWKHDSSOLFDWLRQZLOOEHDYDLODEOHIRUSXEOLFLQVSHFWLRQDIWHULVVXHWRWKH%RDUG0HPEHUVDWWKH3ODQQLQJ(QTXLU\&RXQWHUVRIWKH3ODQQLQJ'HSDUWPHQW +RWOLQH DQGDWWKH3XEOLF9LHZLQJ
5RRPRQWKHGD\RIPHHWLQJ
$IWHUWKH%RDUGKDVFRQVLGHUHGWKHDSSOLFDWLRQHQTXLU\DERXWWKHGHFLVLRQPD\EHPDGHDWWHOQRRURUWKHJLVWRIWKHGHFLVLRQFDQEHYLHZHGDWWKH%RDUG¶VZHEVLWHDIWHUWKHPHHWLQJ
Statement on Personal Data
7KHSHUVRQDOGDWDVXEPLWWHGWRWKH%RDUGLQDQ\FRPPHQWZLOOEHXVHGE\WKH6HFUHWDU\RIWKH%RDUGDQG*RYHUQPHQWGHSDUWPHQWVIRUWKHIROORZLQJSXUSRVHV
D  WKHSURFHVVLQJRIWKHDSSOLFDWLRQZKLFKLQFOXGHVPDNLQJDYDLODEOHWKHQDPHRIWKHSHUVRQPDNLQJWKHFRPPHQW KHUHDIWHUNQRZQDV³FRPPHQWHU´ IRUSXEOLFLQVSHFWLRQZKHQPDNLQJDYDLODEOHWKHFRPPHQWIRUSXEOLFLQVSHFWLRQDQG
(b) IDFLOLWDWLQJFRPPXQLFDWLRQEHWZHHQWKH³FRPPHQWHU´DQGWKH6HFUHWDU\RIWKH%RDUG*RYHUQPHQWGHSDUWPHQWV
LQDFFRUGDQFHZLWKWKHSURYLVLRQVRIWKH2UGLQDQFHDQGWKHUHOHYDQW7RZQ3ODQQLQJ%RDUG*XLGHOLQHV
Schedule
Deadline for
Application No. Location Applied Use / Development Making Comment
on the Application
$+6. /RW 3DUW LQ''+D7VXHQ<XHQ/RQJ 3URSRVHG7HPSRUDU\2SHQ6WRUDJHRI&RQVWUXFWLRQ0DWHULDOVDQG/RJLVWLFV&HQWUHIRUD3HULRGRI<HDUV $SULO
$1()7$ /RWV5353535353DQG53LQ''DQG$GMRLQLQJ 3URSRVHG 7HPSRUDU\ ([KLELWLRQ DQG &RQYHQWLRQ +DOO ZLWK 6KRS DQG 6HUYLFHV DQG (DWLQJ 3ODFH IRU D $SULO
Government Land, Sheung Shui, New Territories 3HULRGRI<HDUV
$1(/7 /RWV6$53DQG6$VV53LQ''+D7LQ/LX+D7VXHQ/DP7VXHQ7DL3R1HZ 3URSRVHG+RXVH 1HZ7HUULWRULHV([HPSWHG+RXVH6PDOO+RXVH $SULO
Territories
$1(083 /RW6$LQ''7DL7RQJ:X6KD7DX.RN1HZ7HUULWRULHV 3URSRVHG+RXVH 1HZ7HUULWRULHV([HPSWHG+RXVH6PDOO+RXVH $SULO
$1(083 /RW6%LQ''7DL7RQJ:X6KD7DX.RN1HZ7HUULWRULHV 3URSRVHG+RXVH 1HZ7HUULWRULHV([HPSWHG+RXVH6PDOO+RXVH $SULO
$1(7. /RW53LQ''3R6DP3DL9LOODJH7DL3R1HZ7HUULWRULHV 7HPSRUDU\3ULYDWH&DU3DUNIRUD3HULRGRI<HDUV $SULO
$67 8QLW% 3RUWLRQ *)%ORFN.LQ+R,QGXVWULDO%XLOGLQJ$X3XL:DQ6WUHHW)R7DQ6KD 3URSRVHG6KRSDQG6HUYLFHV 5HWDLO6KRS $SULO
7LQ17
$67 8QLW& 3RUWLRQ *)%ORFN.LQ+R,QGXVWULDO%XLOGLQJ$X3XL:DQ6WUHHW)R7DQ6KD 5HQHZDORI3ODQQLQJ$SSURYDOIRU7HPSRUDU\6KRSDQG6HUYLFHV 5HDO(VWDWH$JHQF\DQG5HWDLO6KRS  $SULO
7LQ17 IRUD3HULRGRI<HDUV
$67 7KHZHVWHUQSDUWRI1R3DX7DX6WUHHW6KD7LQ 0LQRU5HOD[DWLRQRI*URVV)ORRU$UHDDQG6LWH&RYHUDJH5HVWULFWLRQVIRU3HUPLWWHG&ROXPEDULXP8VH $SULO
$70/7<< /RW53LQ''6XQ)XQJ:DL7XHQ0XQ1HZ7HUULWRULHV 5HQHZDORI3ODQQLQJ$SSURYDOIRU7HPSRUDU\6KRSDQG6HUYLFHV 5HDO(VWDWH$JHQF\ IRUD3HULRGRI $SULO
<HDUV
$</+7) /RWV 3DUW  3DUW  3DUW DQGLQ''DQG$GMRLQLQJ 3URSRVHG7HPSRUDU\3ODVWLF%RWWOH5HF\FOLQJ&HQWUHZLWK:RUNVKRSDQG$QFLOODU\2I¿FHIRUD3HULRG $SULO
*RYHUQPHQW/DQG/DX)DX6KDQ<XHQ/RQJ RI<HDUV
$</.71 /RWV6$6%6&6'6(6) 3URSRVHG7HPSRUDU\7HQW&DPSLQJ*URXQGIRUD3HULRGRI<HDUV $SULO
6*6+6,DQGLQ'')XQJ.DW+HXQJ.DP7LQ<XHQ/RQJ
$</.71 /RW6%LQ''.DP7LQ5RDG<XHQ/RQJ 7HPSRUDU\2SHQ6WRUDJHRI3ULYDWH&DUVDQG/LJKW*RRGV9HKLFOHVIRUD3HULRGRI<HDUV $SULO
$</.71 /RW53 3DUW LQ''.DP7LQ<XHQ/RQJ 3URSRVHG8WLOLW\,QVWDOODWLRQIRU3ULYDWH3URMHFW (OHFWULF0HWHU5RRP $SULO
$<//)6 /RW6$LQ''0RQJ7VHQJ:DL/DX)DX6KDQ<XHQ/RQJ 3URSRVHG)ODWDQG0LQRU5HOD[DWLRQRI%XLOGLQJ+HLJKW5HVWULFWLRQV $SULO
$</03 /RW6%VV6&53 3DUW LQ''DQG$GMRLQLQJ*RYHUQPHQW/DQG0DL3R<XHQ/RQJ 5HQHZDO RI 3ODQQLQJ $SSURYDO IRU 7HPSRUDU\ 6KRS DQG 6HUYLFHV +DUGZDUH *URFHU\ 6KRS DQG 5HDO $SULO
(VWDWH$JHQF\ IRUD3HULRGRI<HDUV
$</67 /RW6'53 3DUW LQ''DQG$GMRLQLQJ*RYHUQPHQW/DQG6DQ7LQ<XHQ/RQJ 5HQHZDORI3ODQQLQJ$SSURYDOIRU7HPSRUDU\3XEOLF9HKLFOH3DUN )RU3ULYDWH&DUVDQG/RN0D&KDX $SULO
 +XDQJJDQJ &URVV %RXQGDU\ 6KXWWOH %XVHV 2QO\  ZLWK $QFLOODU\ )DFLOLWLHV ,QFOXGLQJ D 5HIUHVKPHQW
.LRVN IRUD3HULRGRI<HDUV
$</77 /RWV6$DQG53LQ''6KDP&KXQJ7VXHQ<XHQ/RQJ1HZ7HUULWRULHV 5HQHZDORI3ODQQLQJ$SSURYDOIRU7HPSRUDU\3ULYDWH6ZLPPLQJ3RROIRUD3HULRGRI<HDUV $SULO
$1(.76 /RW6$LQ''&KDQ8N3R7VLX.HQJ6KHXQJ6KXL1HZ7HUULWRULHV 3URSRVHG+RXVH 1HZ7HUULWRULHV([HPSWHG+RXVH6PDOO+RXVH 0D\
$1(/<7 /RW6&LQ''/HQJ7VXL9LOODJH)DQOLQJ1HZ7HUULWRULHV 3URSRVHG+RXVH 1HZ7HUULWRULHV([HPSWHG+RXVH6PDOO+RXVH 0D\
$1(/<7 /RWV6'DQG6&VVLQ''/HQJ7VXL9LOODJH)DQOLQJ1HZ7HUULWRULHV 3URSRVHG+RXVH 1HZ7HUULWRULHV([HPSWHG+RXVH6PDOO+RXVH 0D\
$1(/<7 /RW6%LQ''.DQ7DX7VXHQ)DQOLQJ1HZ7HUULWRULHV 3URSRVHG+RXVH 1HZ7HUULWRULHV([HPSWHG+RXVH6PDOO+RXVH 0D\
$1(/<7 /RW6&LQ''.DQ7DX7VXHQ)DQOLQJ1HZ7HUULWRULHV 3URSRVHG+RXVH 1HZ7HUULWRULHV([HPSWHG+RXVH6PDOO+RXVH 0D\
$1(/<7 /RW6'LQ''.DQ7DX7VXHQ)DQOLQJ1HZ7HUULWRULHV 3URSRVHG+RXVH 1HZ7HUULWRULHV([HPSWHG+RXVH6PDOO+RXVH 0D\
$</.71 /RWV53 3DUW DQG 3DUW LQ''.DP7LQ<XHQ/RQJ 7HPSRUDU\3XEOLF9HKLFOH3DUN ([FOXGLQJ&RQWDLQHU9HKLFOH IRUD3HULRGRI<HDUV 0D\
$</03 /RWV6$DQG6$LQ''0DL3R6DQ7VXHQ<XHQ/RQJ1HZ7HUULWRULHV 3URSRVHG)LOOLQJRI/DQG P IRU3HUPLWWHG+RXVH 1HZ7HUULWRULHV([HPSWHG+RXVH 0D\
$</7<67 /RW 3DUW LQ''7RQJ<DQ6DQ7VXHQ<XHQ/RQJ1HZ7HUULWRULHV 5HQHZDORI3ODQQLQJ$SSURYDOIRU7HPSRUDU\:DUHKRXVHIRU6WRUDJHRI&RQVWUXFWLRQ0DWHULDOV&DUSHWV 0D\
DQG3RUFHODLQVZLWK$QFLOODU\2I¿FHIRUD3HULRGRI<HDUV
$1(67. /RWV6%VV 3DUW 6%VV 3DUW 6%53 3DUW 6(53 3DUW 60 3URSRVHG([FDYDWLRQRI/DQG IRU*URXQG,QYHVWLJDWLRQ:RUNVIRU$VVHVVLQJWKH6WDELOLW\RI6ORSHV 0D\
53 3DUW 6(VV 3DUW 6(VV6(VV 3DUW 6(VV 3DUW 
6(53 3DUW 6$VV 3DUW 6$53 3DUW 6%VV 3DUW 6%53 3DUW 
6&VV 3DUW 6-VV 3DUW 6-VV 3DUW 6-53 3DUW 53 3DUW 
6( 3DUW 6) 3DUW 6. 3DUW 6) 3DUW DQG 3DUW LQ''7RQJ
7R6KD7DX.RN1HZ7HUULWRULHV
$1(7./ /RWV 3DUW DQG 3DUW LQ''6KD7DX.RN5RDG0D0HL+D)DQOLQJ1HZ7HUULWRULHV 7HPSRUDU\ 3ULYDWH 9HKLFOH 3DUN IRU /LJKW *RRGV 9HKLFOH DQG +HDY\ *RRGV 9HKLFOH DQG /RDGLQJ 0D\
8QORDGLQJ$UHDIRUD3HULRGRI<HDUV
$6.3. *)$3R7XQJ5RDG/RW 3DUW LQ''6DL.XQJ1HZ7HUULWRULHV 7HPSRUDU\(DWLQJ3ODFH 5HVWDXUDQW IRUD3HULRGRI<HDUV 0D\
$67 3DUW&RI:RUNVKRS/HYHO/:DK<LX,QGXVWULDO&HQWUH$X3XL:DQ6WUHHW)R7DQ6KD 6KRSDQG6HUYLFHV 5HDO(VWDWH$JHQF\ 0D\
7LQ17
$<//)6 /RW 3DUW LQ''7VLP%HL7VXL/DX)DX6KDQ<XHQ/RQJ 3URSRVHG7HPSRUDU\3ODQW1XUVHU\IRUD3HULRGRI<HDUVDQG$VVRFLDWHG)LOOLQJRI/DQG 0D\
$<//)6 /RWLQ''/DX)DX6KDQ<XHQ/RQJ1HZ7HUULWRULHV 3URSRVHG7HPSRUDU\3XEOLF9HKLFOH3DUN 3ULYDWH&DUDQG&RDFK IRUD3HULRGRI<HDUV 0D\
$</3+ /RWV6- 3DUW 6$53 3DUW 6(53 3DUW DQG6' 6) 6* 6, 3DUW LQ 5HQHZDORI3ODQQLQJ$SSURYDOIRU7HPSRUDU\2SHQ6WRUDJHRI*RRGV9HKLFOHVIRU6DOHIRUD3HULRGRI 0D\
''DQG$GMRLQLQJ*RYHUQPHQW/DQG3DW+HXQJ<XHQ/RQJ <HDUV
$</3+ /RWV53 3DUW  3DUW  3DUW  3DUW  3DUW  3DUW DQG 3DUW  5HQHZDORI3ODQQLQJ$SSURYDOIRU7HPSRUDU\2SHQ6WRUDJHRI&RQVWUXFWLRQ0DWHULDOVIRUD3HULRGRI 0D\
LQ''3DW+HXQJ<XHQ/RQJ <HDUV
$</36 /RWV  3DUW     3DUW   3DUW  DQG  53 3DUW  LQ ''  DQG $GMRLQLQJ 7HPSRUDU\3XEOLF9HKLFOH3DUN 3ULYDWH&DUVDQG/LJKW*RRGV9HKLFOHV IRUD3HULRGRI<HDUV 0D\
*RYHUQPHQW/DQG6KHXQJ&KHXQJ:DL3LQJ6KDQ<XHQ/RQJ1HZ7HUULWRULHV
$</67 /RWV53DQG6&53LQ''DQG$GMRLQLQJ*RYHUQPHQW/DQGLQ6DQ7LQ<XHQ/RQJ 7HPSRUDU\ 6KRS DQG 6HUYLFHV 6DOH RI 9HKLFOH 3DUWV DQG $FFHVVRULHV  ZLWK $QFLOODU\ )DFLOLWLHV IRU D 0D\
3HULRGRI<HDUV
$</77 /RWLQ''7DL7RQJ<XHQ/RQJ1HZ7HUULWRULHV 3URSRVHG7HPSRUDU\2SHQ6WRUDJHRI6WDWXHVIRUD3HULRGRI<HDUV 0D\
$</77 /RWV53 3DUW DQG 3DUW LQ''DQG$GMRLQLQJ*RYHUQPHQW/DQG7DL7RQJ<XHQ 7HPSRUDU\6KRSDQG6HUYLFHV 5HDO(VWDWH$JHQF\ DQG(DWLQJ3ODFHIRUD3HULRGRI<HDUV 0D\
Long, New Territories

17$SULO Town Planning Board


CHINA DAILY HONG KONG EDITION Tuesday, April 17, 2018 Culture | LIFE 23

FIELD STUDY
Dutch architect Rem Koolhaas hosts a marathon talk session on China’s rural development
as part of the 2018 Wuzhen International Architecture Forum. Deng Zhangyu reports.

A
fter focusing on cit-
ies and skyscrapers
for the past 40
years, Rem Kool- A sculpture of Laozi, the great Chinese thinker, by Wu Weishan,
haas, the Pritzker Prize winner director of the National Art Museum of China, is on show in
and one of the most important Beijing. JIANG DONG / CHINA DAILY
architects of his generation,
has shifted his attention
toward “the rural”, a field he
has repeatedly described as
holding the key to the world’s
BRICS thread runs
future.
To explore the subject more
deeply, the 74-year-old held a
through art display
six-hour talk on Thursday
with 17 Chinese experts on By LIN QI as Qi Baishi and Pan Tian-
rural issues. The Dutch archi- linqi@chinadaily.com.cn shou.
tect says China highlights its Wu Weishan, director of
countryside more than others The late Indian landscape the National Art Museum,
in the world. artist Bireswar Sen centered says the paintings, which
The dialogue titled Coun- his creation on portraying are themed on the lotus
tryside Marathon, part of the the splendor of the Himala- flower, represent an impor-
Wuzhen International Archi- yas, although he approached tant symbol of visual arts in
tecture Forum 2018, saw houses clean and tidy. it on a small scale. He com- China, while the Mandarin
Koolhaas hold discussions “As an architect, I spend my posed a poem of colors by pronunciation of lotus, he, is
from his apartment in time more on communication depicting the changing views similar to that for the word
Amsterdam via the internet rather than design. It’s more of the mountain peaks, val- “peace”, and the flower is
with scholars, officials, archi- important to change people’s leys and cascades of the also a metaphor in Chinese
tects, artists, writers and way of thinking and create mighty range in four seasons. culture for innocence and
independent musicians who sustainable development,” he But he worked on a piece integrity. That is why the
actively take part in China’s adds. of paper that is no more than museum picked these works
rural reconstruction, in Wuz- Every month, Lyu brings 10 centimeters in length and for the exhibition, although
hen, a water town in East Chi- students and teachers from width. they have been shown sever-
na’s Zhejiang province. The the CAFA’s rural development When a collection of his al times in earlier decades.
architect was unable to attend course he co-founded with miniature watercolors For the local audience, the
the forum in person due to Koolhaas to tour the country- debuted at the National Art exhibition unveils the variety
health reasons. side and offer practical solu- Museum of China in Beijing and dynamism of the creation
Koolhaas says that he tions to their problems, on April 12, the audience of unfamiliar artists in the
believes the impact of urbani- joining the new wave of urban needed magnifying glasses other four BRICS countries.
zation on rural areas is an intellectuals who are engag- to appreciate the Himalayan
issue that affects the entire ing in rural development in landscape that Sen hailed
world, not only China. But the China. with dancing lines and If you go
architect also says he finds Karl Ellefsen, a professor at rhythmic colors. The works
China’s situation interesting, the Oslo School of Architec- are from the collection of the 9 am-5 pm, Mondays
especially since the country’s ture and Design, who is also a National Gallery of Modern closed. 1 Wusi Dajie,
planners are putting it firmly teacher in Lyu’s team, says: Art in New Delhi. Dongcheng district,
at the top of their agenda. “Few people in Europe have Gallery head Adwaita Beijing. 010-6400-1476.
The architect, who has noticed that China is experi- Gadanayak says Sen’s land-
designed many iconic build- encing huge changes in terms scape artworks evoke a
ings in major cities around the of rural development and how divine feeling for nature and Collections from the Iziko
world, is perhaps best known it is investing heavily in its that he often depicted a Museums of South Africa, an
in China for his design of the countryside.” monk or a poet walking institution comprising of 11
CCTV headquarters in Beijing, The Norwegian professor alone in the extensive moun- museums and galleries, cele-
a landmark in the capital. stays in China for a week every tains, which suggests his brate the diverse ancient tra-
When he visited China ahead month and has traveled to attempts to escape into a ditions of South Africa, for
of Spring Festival in February, several villages in remote spiritual space from the cha- example, a stone engraved
he says he was impressed by rural areas. With these trips, os of the world and immerse with an ostrich dated back
how quick people were able to he looks to draw comparisons himself in nature. 2,000 years ago is on show,
move from the cities to the between China’s rural issues Gadanayak says that in says the museum group’s
countryside to celebrate Chi- with those in Europe, where India, people’s thoughts are CEO Rooksana Omar.
nese New Year, leaving some the problem of food security related to nature, as it is the She says meanwhile, these
cities almost empty. arising from the agricultural universal root of all living on cultural aspects have
In fact, Koolhaas began his industrialization process is Earth, despite the differen- inspired modern artists, and
engagement with China’s being faced by many. ces in culture and history. several works on display
rural regeneration last year by Like Ellefsen, Koolhaas “As long as we connect our show how they have revised
joining forces with the Central wants to undertake a compar- roots through artistic motifs from archaic rock
Academy of Fine Arts to set up ative study, but expand its expressions, we can under- paintings in paintings and
a one-year course for 13 stu- scope to cover the entire globe. stand each other, ... and we wood cuts.
dents working in areas related Next year, he will present an can together face a common A cultural diversity
to rural development, includ- exhibition at the Guggenheim future, and stand up to the because of the melting of
ing several architects and a Top: A bird’s eye view of Wu village near Wuzhen, from where Chinese intellectuals discuss rural China Museum in New York titled challenges,” he says. immigrants from across the
city mayor. over the internet with Dutch architect Rem Koolhaas. Middle and above: The Banwan Primary School Countryside: Future of the Gadanayak’s words also world defines the works
Lyu Pinjing, the director of in a village in Guizhou province is being redesigned by architect Lyu Pinjing, who is also helping to World, which will include vid- define the motif of a current loaned from Brazil’s Nation-
the academy’s architecture repair an ancestral temple (above) in another village in the province. PHOTOS PROVIDED TO CHINA DAILY eos and documents from the exhibition at the National al Museum of Fine Arts in
school and a speaker at the Wuzhen forum that saw Kool- Art Museum of China. Rio. It shows seven artists
Countryside Marathon forum, haas discuss China’s rural Uniqueness and Conver- who are now active both at
introduced the one-year revitalize an entire village,” tional houses, rebuilt village resources I have to help them issues from cultural, architec- gence brings together 61 home and in the internation-
course he developed with the says Lyu, who has devoted schools, set up weaving work- revitalize the village,” Lyu says. tural and economical perspec- works of art, including Sen’s al art community. Their
help of several foreign experts much of his time in rural shop and porcelain-making Last year, Lyu helped find tives with Chinese academics landscapes, from several works explore not only the
including Koolhaas, explain- development in Guizhou prov- studio by transforming ruined college teachers to train more and practitioners. public and private collec- links between Brazil and the
ing that its aim was not to ince, which is home to many houses in Banwan, a remote than 400 female village arti- The Wuzhen International tions in Brazil, Russia, India, West but also the influence
teach students specific skills ethnic groups. village surrounded by moun- sans who make their living Architecture Forum 2018 will China and South Africa, the of Asian migrants.
but instead to enlighten them Lyu has been involved in the tains that is inhabited by the from weaving and embroidery hold another two forums later BRICS members. Alexander Sedov, director-
with a global perspective. rural reconstruction of at least ethnic Buyi people. to adapt their homemade this year, discussing the The ongoing exhibition general of the State Museum
“China is in great need of three villages in Guizhou prov- Lyu will showcase his archi- products to suit a wider mar- concepts of home, and the runs through Sunday. of Oriental Art of Russia, says
people who excel at rural ince, like many other archi- tectural works at the village at ket. He will return to another countryside. The National Art Museum its collection of paintings
development. But it’s not as tects who have worked in rural the Venice Biennale of Archi- village in Guizhou later this of China is presenting its and sculptures on show dis-
simple as just building or China to help design or rede- tecture in May. month to help promote a Contact the writer at own collection of Chinese play a rising interest among
transforming houses in the velop rural areas. “It’s more than just a job for healthier lifestyle through bet- dengzhangyu@ ink-and-water paintings by Russian artists in Asian cul-
countryside. It’s about how to In 2016, he repaired tradi- an architect. I had to use all the ter hygiene and keeping their chinadaily.com.cn 20th century masters, such tures in the 20th century.

Thematic show gives artists


a comprehensive platform
By DENG ZHANGYU her dead son in white.
dengzhangyu@chinadaily.com.cn If you go The artist’s choice of rich
colors to present the universal
Many artists are not well 10 am-9 pm, through Nov concept of life and death
understood through their 20, Parkview Museum, 9 shows a “basic humanity”,
works, says curator Lorand Dongdaqiao Road, which is what Hegyi wants
Hegyi, who got an idea four Chaoyang district, Beijing. viewers to feel and The Artist’s Voice at Beijing’s Parkview Museum, curated by Lorand Hegyi (left) features artworks by 29 established artists across the
years ago to hold a series of 010-5662-8568 understand. world, including Liu Xiaodong’s Chinatown (right). PHOTOS PROVIDED TO CHINA DAILY
thematic exhibitions to let The curator explains that
their voices be heard. contemporary art is not
Entitled The Artist’s Voice, difficult to understand. Chinatown in Italy and home- focus on these subjects. discussions with the curator, was brought up by Wong four
the first of the series of four artist has a vision of the Just like literature, history less people depicted by artists The four exhibitions over and some are from Parkview years ago with Hegyi. And the
exhibitions — to be held over world, life, history, values, and music, artworks send such as Chinese oil painter Liu two years involve about 200 Museum’s own collection, a works will be displayed both
two years — opened at Bei- fears, hopes and love. We messages to viewers to Xiaodong and Hungarian artists from across the world: huge private art trove owned at the Parkview Museum in
jing’s Parkview Museum on should listen to them and explore basic emotions and painter Laszlo Feher. Asia, the Middle East, Africa by Hong Kong collector Beijing and its branch in
Sunday. understand the message.” values. And they also reflect Explaining the idea behind and Latin America. George Wong, who passed Singapore.
It features paintings, sculp- At the entrance of the show how artists see the world, the exhibition, Hegyi says that And when all the four away in December. The second show will be
tures, installations, photos hangs a photo by American adds Hegyi. though we live in a very uncer- shows are put together, it will It’s believed that Wong’s col- about artists’ manuscripts, for
and videos by 29 established artist Marina Abramovic In one room, all the works tain world now, confronting cover the entire contempo- lection includes 45 of Salvador which the curator has spent
artists from 17 countries. taken in 1983 to document depict migrants. various problems, the basic rary art world, says the cura- Dali’s works, dozens of Bud- the past four years visiting
Speaking about the exhibi- her performance work Soul of There are images of values and subjects such as tor. dha statues and thousands of artists.
tion, its Hungarian curator the World. migrants in Europe, migrant love and life do not change. Some of the works on show contemporary art pieces. “It’s a huge project, but it is
and art historian, says: “Each In it, a mother in red holds Chinese workers in Prato’s That’s why all the artworks were provided by artists after The idea of the exhibition worth it,” Hegyi says.
24

LIFE
Tuesday, April 17, 2018

CHINA DAILY HONG KONG EDITION

The 200-meter-long ink


painting, Ten Thousand
Li of Yangtze River, a
collaboration of some 50
painters, is displayed at
the National Museum of
China in Beijing. The
scroll features
landscapes along the
Yangtze River.
PHOTOS PROVIDED TO
CHINA DAILY

RIVER AS MUSE
A textile company funds a painting project that aims to present a modern view of the Yangtze’s landscapes. Lin Qi reports.

T
he landscapes along the Jiangyin, Jiangsu province. The “Many places along the Yang-
Yangtze, the world’s textile company had commis- tze seemed familiar to many of
third-longest river, have sioned the project. us, but we were still over-
recurred as a motif in the Traditionally, the production of whelmed by such massive world-
works of Chinese painters for cen- a classic mountain-and-water class projects as the Three
turies. painting has centered on the idea Georges Dam,” says Liu of the
We depicted the
Notable artists who have
depicted the panoramic scenery
of wo you, which literally means
“wondering while lying down”.
power station.
Shi Jiangcheng, another par-
dam with carefree
include Xia Gui of the Song The expression suggests that ticipating painter, says trying to brushwork,
Dynasty (960-1279); Wang Hui, painters depict scenery in a way blend the beauty of the Three
one of the four great mountain- that allows the audience to imag- Georges — a highlight of Ten instead of giving
and-water masters of the early ine traveling mentally through a Thousand Li of Yangtze River —
Qing Dynasty (1644-1911); and canvas, surrounding themselves with the natural landscape was a attention to all the
pioneers of modern art in China, with nature, even when indoors. different process as the ancient
such as Zhang Daqian and Wu For Ten Thousand Li of Yangtze masters didn’t have to include details.”
Guanzhong. River, the painters from the Soci- the modern infrastructure in
Most of the earlier artists paint- ety of Classic Chinese Painting in their works. Shi Jiangcheng, painter
ed alone. But a recent project Beijing adopted a realistic “We depicted the dam with
brought together some 50 paint- approach since they began work- carefree brushwork, instead of
ers to complete a new work ing on the scroll last year. giving attention to all the details, country it runs through.
depicting the river’s scenery. They intended to celebrate not so that it doesn’t look like an Zhou Jianping, the founder of
Ten Thousand Li of Yangtze only the river’s scenic grandeur industrial label but appears more Heilan, says many painters
River, the 200-meter-long ink but also man-made symbols, natural in its surroundings,” says involved in the creation are in
painting, was displayed at the such as dams, which have added Liu Dawei (front), chairman of the China Artists Association, who Shi. their 70s and 60s.
National Museum of China in elements to the Yangtze land- participated in the painting project, exchanges ideas with the director of the The painting deviates from “It (depicting the Yangtze) was
Beijing recently. The river flows scape, so that the audience is able National Museum of China, Wang Chunfa, about the scroll at the exhibition. the traditional tendency of pre- a shared dream,” he says, adding
for some 6,300 kilometers, and to view changes brought about by senting the Yangtze’s landscape that his company wanted to
a li — as a traditional Chinese the country’s reform and open- as extensive but the river soli- share its admiration of Chinese
unit of distance — equals 500 ing-up over the past four decades. esque towns along the river’s low- economic and cultural develop- tary, according to Zhang Fuxing, culture by funding the painting
meters. Participating painters have er stretches. When conceiving the ments, according to Liu Dawei, another painter on the team. He project.
The painting is expected to be traveled to the landmark spots painting’s layout, they again visit- chairman of the China Artists says the painting shows a
on permanent display at the along the Yangtze, such as the ed some of these locations to Association, who participated in “rejoicing and vigorous” river as Contact the writer at
Heilan Group’s headquarters in Three Georges Dam and pictur- brush up their knowledge of the the painting project. an indicator of the energy of the linqi@chinadaily.com.cn

A visual tribute to an overseas Chinese legend


By WANG KAIHAO including manuscripts, per- from different social strata. became the China Zhi Gong
wangkaihao@chinadaily.com.cn sonal belongings and pub- Besides, he joined Chee Party, and its headquarters
lished books, besides photos, Kong Tong, the biggest organi- was moved from San Francis-
Once upon a time in the give a glimpse of this legend’s zation bringing together over- co to Hong Kong.
United States, he was an icon life. seas Chinese communities, Situ served as the head of
in China towns. Situ Meitang Speaking about Situ, Qi
He chose the which was also leading an the party branch in the Ameri-
(1868-1955) was born in a
small village in Kaiping,
Degui, vice-director of the
museum, says: “He was a flag
progressive anti-Qing campaign.
In 1904, Situ met revolu-
cas.
The Zhi Gong Party is now
Guangdong province. Howev-
er, he sponsored Sun Yat-sen’s
bearer among Chinese com-
munities abroad.
position each tionary leader Sun Yat-sen. one of the eight non-Commu-
Sun lived with Situ when he nist parties on the Chinese
revolution to topple the Qing “And this exhibition is to time, and set an was in San Francisco. mainland. It’s mainly com-
(1644-1911) court, befriended pay homage to overseas Chi- Later, when Sun could not posed of overseas Chinese
Franklin Roosevelt, who later nese with patriotic hearts and example for future make ends meet after failed returning to the motherland.
became the US president, and strong emotional attachments uprisings against the Qing in During the War of Resist-
led overseas Chinese against to the homeland.” generations.” 1911, Situ mortgaged four Chee ance Against Japanese Aggres-
Japanese aggression. Kaiping was home to Kong Tong properties in Cana- sion (1931-45), he quit all his
When he returned to his numerous emigrants to the Qi Degui, vice-director of the da to sponsor him. business positions to focus on
motherland after seven dec- United States in the late 19th Overseas Chinese History Situ moved to New York City fundraising in the Americas to
ades abroad, he was invited to and early 20th centuries. Museum of China in 1905, and Franklin Roosev- support the fight to defend the
attend the founding ceremony There, the migrants often built elt, then a young lawyer, was motherland.
of the People’s Republic of Chi- diaolou — structures blending hired as his consultant. A donation check written by
na in 1949, and later became a Chinese and Western styles — daughter, says: “He was “Roosevelt was a legal con- him during the war is on dis- Clockwise from top: Visitors at the ongoing exhibition that marks the
deputy to the first session of which are now inscribed on insulted by white hooligans sultant for my grandfather for play at the exhibition, which 150th anniversary of Situ Meitang’s birth; a portrait of Situ; a coat present-
the National People’s Congress the UNESCO World Heritage immediately after landing. about a decade, and they had a runs until May 3. ed by Premier Zhou Enlai to Situ. PHOTOS BY WANG KAIHAO / CHINA DAILY
standing committee. list. Discrimination against Chi- close friendship at that time,” In the later Chinese civil
Now, as the country marks Some yellowing blueprints nese immigrants was com- says Situ Yuegui. war, Situ chose to side with the
the 150th anniversary of his of the diaolou are also on dis- mon at that time.” “Perhaps that explains why Communist Party against with Communist leaders. future generations,” Qi says.
birth, a special exhibition is on play at the exhibition. Then, from working at a res- president Roosevelt actively Kuomintang rule. “Situ experienced many “We admire his contribu-
at the Overseas Chinese Histo- Situ arrived in San Francisco taurant, he became a butler, campaigned to abolish the Also on display at the exhi- crucial moments in recent tions and overseas Chinese
ry Museum of China in Bei- at the age of 12 looking for job. and later a chef in the US Navy, Chinese Exclusion Law in bition is a coat presented to Chinese history. But he chose efforts will continue to con-
jing. And describing his early which gave him a chance to 1943.” him by Premier Zhou Enlai, the progressive position each tribute to the rejuvenation of
There, dozens of artifacts, years, Situ Yuegui, his grand- make friends with people In 1925, the Chee Kong Tong showing his close friendship time and set an example for the Chinese nation.”

Você também pode gostar