Você está na página 1de 135

Bioinformática Estrutural

Estrutura de Proteínas

Prof. Dr. Walter F. de Azevedo Jr.

wfdaj.sites.uol.com.br

© 2006 Dr. Walter F. de Azevedo Jr.


Bioinformática Estrutural
Resumo
Simetria
Por que estudar proteínas?
Dicionário molecular das proteínas
Estrutura secundária de proteínas
Estrutura 3D de proteínas
Referências

wfdaj.sites.uol.com.br

© 2006 Dr. Walter F. de Azevedo Jr.


Simetria

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Introdução. O conceito de simetria e sua representação matemática é de grande


utilidade no estudo de macromoléculas biológicas. A simetria está presente na hélice
dupla da molécula de DNA, está presente no tetrâmero da hemoglobina, na hélice alfa
e em diversas estruturas de macromoléculas biológicas. O mundo macroscópico é rico
de exemplos de simetria, o trevo de quatro folhas, o corpo humano (quanto aos seus
aspectos externos), certos tipos de conchas etc. Simetria está presente quando
aplicamos uma operação simples como rotação, reflexão ou translação a um objeto e
trazemos este objeto à uma situação idêntica à original. Vejamos um exemplo simples,
um cubo, ao giramos 90o ao longo de um eixo perpendicular a uma das faces, como
mostrado na figura abaixo, o objeto fica com o mesmo aspecto.

Cubo na posição inicial Cubo na girado 90o

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Elementos de simetria. A simetria, quando presente, pode ser representada por um


operador matemático, ou elemento de simetria. O operador de simetria relaciona pelo
menos dois pontos distintos de um objeto, que pode ser uma macromolécula biológica,
ou um objeto macroscópico. Para mantermos uma abordagem ampla usaremos as
coordenadas cartesianas x, y, z, para indicar um ponto genérico, sob o qual será
aplicado o operador de simetria. Tal abordagem, permite a representação dos
operadores de simetria como matrizes e vetores. Os 4 principais tipos operadores de
simetria são os seguintes.

1) Rotação
2) Espelho
3) Centro de inversão
4) Roto-translação

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Rotações. Num eixo de rotação de ordem n temos uma rotação de 360°/n. Na figura
abaixo temos uma rotação em torno do eixo y, o círculo branco indica um ponto
genérico de coordenadas genéricas x, y, z acima do plano. O círculo preto indica um
ponto abaixo do plano. A aplicação do operador de simetria eixo de ordem 2, ao longo
do eixo y no ponto com coordenadas x, y, z gera o elemento com coordenadas –x, y, -z.
Y

Eixo de ordem 2, rotação de 180°

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Eixo de Ordem 2. Uma rotação de 180o está representada abaixo, na figura temos o
eixo de rotação (eixo z) perpendicular ao plano. Para ilustrar a aplicação do operador
de simetria usamos um ponto genérico de coordenadas x, y, z. Quando girado temos
um ponto de coordenadas –x, -y, z. O símbolo é usado para indicar um eixo de
rotação de ordem 2 perpendicular ao plano. O eixo de ordem 2 também é chamado
eixo binário.
Y

x, y, z

X
2

-x, -y, z

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Eixo de Ordem 2. Na figura abaixo o eixo de rotação é o eixo x, o resultado da


aplicação da rotação ao longo do eixo x é a geração do ponto de coordenadas x, -y,
-z. Podemos tirar uma propriedade geral da aplicação da rotação de 180o, em torno
de um eixo qualquer. As coordenadas mudam de sinal, exceto a coordenada
referente ao eixo de rotação.
Y

x, y, z

2 X

x, -y, -z

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Eixo de Ordem 2. Eixos de ordem 2 são comuns em estruturas de proteínas, a


hemoglobina de mamíferos é um exemplo clássico. Sua estrutura quaternária é
tetramérica, sendo formada por 4 cadeias, duas alfa e duas beta, sua topologia
apresenta um eixo de ordem, que relaciona o dímero alfa1beta1 com o seu
equivalente alfa2beta2, o eixo de ordem 2 está indicado na figura.

Hemoglobina de “Chrysocyum brachiurus”. Código de acesso PDB: 1FHJ

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Eixo de Ordem 3. O operador de simetria ilustrado abaixo representa uma rotação de


120o em torno do eixo. O símbolo indica o eixo de ordem 3 perpendicular ao plano,
este eixo também é chamada de eixo ternário.

X
3

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Eixo de Ordem 3. A figura abaixo é um exemplo interessante do reflexo da simetria


molecular ao nível macroscópico, nela vemos um cristal da proteína Purina
Nucleosídeo Fosforilase (PNP) (à esquerda), esta proteína é um trímero e apresenta
um eixo de ordem 3, que manifesta-se no cristal desta molécula, como podemos ver
claramente na figura. A estrutura da proteína está representada à direita. A dimensão
maior do cristal é da ordem de 1 mm (10-3 m) e a dimensão maior do trímero é 85 Å
( 85 . 10-10 m), ou seja, o cristal é aproximadamente 4 ordens de grandezas maior que
a molécula, mas mantém sua simetria.

1 mm 85 Å

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Eixo de ordem 4. O operador de simetria, eixo de ordem 4, ou eixo quaternário


efetua uma rotação de 90o em torno do eixo z. Na figura à direita temos um cristal da
proteína lisozima, onde vemos claramente a presença de um eixo de ordem 4.

Y
x, y, z

-y, x, z 4 X
y, -x, z

-x, -y, z

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Eixo de ordem 6. Uma rotação de 60o em torno do eixo z caracteriza o operador eixo
de ordem 6 (figura da esquerda). Na figura à direita temos um cristal da proteína InhA,
que exibe um eixo de ordem 6.

X
6

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Eixo de ordem n. Aqui cabe uma observação, representamos eixos de ordem 2, 3, 4


e 6, estes são os eixos possíveis de serem encontrados em cristais, eixos de outras
ordens não são possíveis devidos às exigências de simetria dos cristais, que não
discutiremos os detalhes aqui. Eixos de simetria distintos são observados na natureza,
e mesmo em macromoléculas biológicas, mas estas simetrias não estão presentes
nos cristais dessas moléculas.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Rotação. Podemos representar os operadores de simetria, eixos de rotação, por


matrizes. Vamos analisar o eixo de ordem 2 como exemplo. Consideremos que os
pontos são representados no sistema de eixo cartesianos direito, com eixo z
perpendicular ao plano e os eixo x e y indicados na figura. As coordenadas x’, y’ e z’,
são obtidas a partir da aplicação do operador de simetria eixo de ordem 2.
Y

x, y, z

X
x’, y’, z’

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Rotação. Para gerar as coordenadas x’, y’, z’, a partir das coordenadas x, y, z,
precisamos efetuar a operação algébrica indicada abaixo, onde cada posição x’, y’, z’
está indicada como função de x, y, z. O números aij indicam elementos que devem ser
usados para gerar as coordenadas x’, y’, z’.

x´ = a11x + a12y + a13z


x, y, z y’ = a21x + a22y + a23z
z’ = a31x + a32y + a33z
X
x’, y’, z’

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Rotação. No caso do operador de simetria eixo de ordem 2 os elementos aij são os


seguintes.

x´ = a11x + a12y + a13z


x, y, z y’ = a21x + a22y + a23z
z’ = a31x + a32y + a33z
X
x’, y’, z’
x´ = -x + 0.y + 0.z x´ = -x
y’ = 0.x - y + 0.z y’ = - y
z’ = 0.x + 0.y + z z’ = z

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Rotação. Os elementos aij podem ser representados em uma matriz (R), o número i
indica a linha da matriz e o número j a coluna da matriz, assim o elemento a23 é o
elemento da linha 2 e coluna 3. A matriz referente ao operador de simetria, eixo de
ordem 2, pode ser representada por R2, como indicado abaixo.

Y a11 a12 a13


R = a21 a22 a23
a31 a32 a33
x, y, z

X
x’, y’, z’ -1 0 0
R2 = 0 -1 0
0 0 1

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Rotação. A matriz rotação apresenta uma relação direta com o ângulo rotação (θ) que
representa, como indicado abaixo na matriz R2, onde o ângulo de rotação aparece
explicitamente. Para uma matriz, referente ao operador de simetria eixo de rotação de
ordem n temos a matriz Rn.

Y
cos 180o -sen 180o 0
R2 = sen 180o cos 180o 0
0 0 1
x, y, z

X cos θ -sen θ 0
x’, y’, z’
Rn = sen θ cos θ 0
0 0 1

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Rotação. Altenativamente podemos representar a matriz rotação em função da ordem


do eixo de rotação, como indica abaixo.

x’ cos 360o/n -sen 360o/n 0 x


y’ = sen 360o/n cos 360o/n 0 . y
z’ 0 0 1 z

Operacionalmente multiplicamos cada linha da matriz rotação pela coluna do vetor


(x,y,z). Representando de forma reduzida temos, x’ é o vetor (x’,y’,z’), Rn a matriz
rotação e x o vetor (x,y,z).

x’ = Rn.x

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Rotação. A matriz rotação representada anteriormente refere-se a uma rotação em


torno do eixo z. Para rotações em torno dos outros eixos, a distribuição dos elementos
da matriz rotação muda, como podemos ver abaixo, para rotações em torno de outros
eixos.
x’ cos 360o/n -sen 360o/n 0 x
y’ = sen 360 /n
o
cos 360 /n
o
0 . y Rotação em torno de z
z’ 0 0 1 z

x’ cos 360o/n 0 sen 360o/n x


y’ = 0 1 0 . y Rotação em torno de y
z’ -sen 360o/n 0 cos 360 /n
o
z

x’ 1 0 0 x
y’ = 0 cos 360o/n -sen 360o/n . y Rotação em torno de x
z’ 0 sen 360o/n cos 360o/n z

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Rotação. A notação matricial facilita a representação matemática das rotações, no


caso da aplicação sucessiva de rotações, usamos o produto de matrizes para indicar
tal processo. Por exemplo, a aplicação de duas vezes o operador eixo de ordem 4 é
representado como segue.

x’ cos 90o -sen 90o 0 cos 90o -sen 90o 0 x


y’ = sen 00o cos 90o 0 . sen 00o cos 90o 0 . y
z’ 0 0 1 0 0 1 z

Alternativamente na forma algébrica.

x’ = R4.R4. x

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Simetria espelho. Outro operador de simetria descreve a reflexão do espelho.


Consideremos um espelho no plano YZ, como indicado abaixo, um ponto na posição x
será refletido, gerando um objeto na posição –x, as coordenadas y e z permanecem a
inalteradas. O operador de simetria espelho é representado por m, e por uma linha
grossa na posição por ele ocupada.

plano YZ

-x x X

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Simetria espelho. Podemos representar o operador de simetria espelho por um


operador matemático, como no caso dos eixos de rotação, neste caso a matriz que
representa o espelho no plano YZ é indicada abaixo.

-1 0 0
m= 0 1 0
0 0 1

Para aplicar o operador matemático espelho procedemos de forma análoga aos


operadores de rotação.

x’ -1 0 0 x
y’ = 0 1 0 . y ou, x’ = m.x
z’ 0 0 1 z

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Centro de inversão. Este operador de simetria inverte todas as coordenadas da


posição inicial, ou, transforma um ponto genérico de coordenadas x,y,z em um ponto
de coordenadas –x,-y,-z, como mostrado abaixo. O centro de simetria é representado
por 1.
plano YZ
(x,y,z)

1
(-x,-y,-z)

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Centro de inversão. Um centro de inversão, localizado na origem (0,0,0), pode ser


representado por uma matriz, como mostrada a seguir. O símbolo i é usado para
representar o operado de simetria centro de inversão.

-1 0 0
i= 0 -1 0
0 0 -1

Para aplicar o operador matemático centro de inversão procedemos de forma análoga


aos operadores anteriores.

x’ -1 0 0 x
y’ = 0 -1 0 . y ou, x’ = i.x
z’ 0 0 -1 z

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Eixo de roto-translação. O eixo de roto-translação representa a fusão de duas


operações, rotação conjugada a uma translação. Tal operador de simetria é comum
em macromoléculas biológicas, como a hélice dupla do DNA e as hélices alfa
presentes em proteínas. O eixo de roto-translação, mostrado abaixo, representa uma
rotação de 180o, seguida de uma translação de metade (1/2) do eixo de rotação, no
caso metade do eixo X.
plano YZ
(x+1/2,-y,-z)

21 X

(x,y,z)

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Eixo de roto-translação. O eixo que conjuga uma rotação de 180o com uma
translação de metade do eixo é chamado de eixo 21. Esta notação indica a rotação
(eixo de ordem 2) e translação (o inverso do símbolo ½), a translação sempre ocorre
ao longo do eixo de rotação.

plano YZ
(x+1/2,-y,-z)

21 X

(x,y,z)

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Simetria

Eixo de roto-translação. Representamos o operador de simetria eixo de roto-


translação, por uma matriz de rotação e a soma do vetor translação. A translação é
indicada em fração do eixo de rotação, como indicado abaixo.

x’ -1 0 0 x 0
y’ = 0 -1 0 . y + 0
z’ 0 0 1 z ½

ou, x’ = R2.x + t, onde t é o vetor translação ½ ao longo do eixo de


rotação.

De uma forma geral, um eixo de roto-translação Rt indica a aplicação de um eixo de


rotação R, seguida de uma translação de t/R ao longo do eixo de rotação. A translação
é representada como uma fração do eixo de rotação.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Por que estudar proteínas

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Por que estudar proteínas?

1) Identificar mecanismos de funcionamento de proteínas


O estudo da estrutura primária (sequência de aminoácidos de uma
proteína) pode indicar diversas propriedades das proteínas, tais como,
função biológica, estrutura secundária da proteína, motivos estruturais
etc. A função biológica da proteína está fortemente ligada à sua estrutura
3D, e a elucidação dessa estrutura facilita a identificação da função
biológica de uma nova proteína, bem como, serve de base para estudos
da relação entre estrutura 3D e função biológica. O estudo do sítio ativo
de uma enzima permite a identificação de padrões estruturais que
determinam sua atividade enzimática.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Por que estudar proteínas?

2)Protein folding
A estrutura primária de uma proteína determina sua estrutura terciária
(estrutura tridimensional), há um registro implícito de informação na
estrutura primária que permite à proteína identificar entre as diversas
possibilidades de enovelamento qual estrutura esta deve adotar. O
algoritmo implícito, que dita as regras que levam de uma informação
unidimensional (estrutura primária) a uma entidade tridimensional
(estrutura terciária) não é conhecido. Há diversas abordagens teóricas a
este problema, chamado de problema do “folding”, normalmente usando
princípios físicos que regem a estrutura tridimensional de moléculas.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Por que estudar proteínas?

3) Modelagem molecular
Uma alternativa à solução da estrutura tridimensional de proteínas por
métodos experimentais, tais como, cristalografia e ressonância magnética
nuclear é uso de métodos teóricos, como o de modelagem molecular por
homologia. Proteínas que compartilham identidade sequencial superior a
30%, normalmente, compartilham o mesmo enovelamento. O uso de tal
metodologia permite a previsão teórica da estrutura tridimensional de
proteínas, usando-se a estrutura tridimensional de uma proteína (arquivo
PDB) similar com o molde (template) podemos gerar um modelo 3D
teórico, para uma sequência de uma proteína com identidade sequencial
com a proteína que apresenta estrutura 3D.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Por que estudar proteínas?

4) Desenho de drogas
Grande investimento tem sido feito na solução da estrutura tridimensional
de proteínas, que são alvos para o desenho de drogas. A partir da
abordagem, chave-fechadura, podemos usar a estrutura tridimensional
de uma enzima alvo como modelo de uma fechadura, e desenhar
virtualmente, pequenas moléculas que se encaixem no sítio ativo dessa
enzima, o que pode gerar um potencial inibidor, ou até mesmo uma nova
droga. Por exemplo, enzimas da via metabólica do ácido chiquímico, que
são responsáveis pela biossíntese de aminoácidos aromáticos, esta via
metabólica está presente em bactérias, organismos do filo apicomplexa e
plantas, e ausente em mamíferos. Assim, enzimas dessa via metabólica
são alvos em potencial para o desenho de drogas, usando-se a
abordagem de toxidade seletiva, visto que estão ausentes em humanos,
espera-se que inibidores dessas enzimas tenham toxicidade reduzida.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Por que estudar proteínas?

4) Desenho de drogas
A via metabólica do ácido chiquímico é formada por sete passos
enzimáticos, responsáveis pela conversão de eritrose-4-fosfato e
fosfoenolpiruvato em corismato, como mostrado abaixo. O produto dessa
via é usado para biossíntese de aminoácidos aromáticos.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Dicionário molecular das proteínas

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

Introdução. Ao aprendermos a ler começamos com o estudo das letras, das


sílabas, palavras e unimos as palavras formando frases, parágrafos, enfim
lemos. Para aprendermos sobre estrutura de proteínas usaremos uma
abordagem similar. Estudaremos os aminoácidos, que formam o alfabeto das
proteínas, seguiremos com dipeptídeos, tripeptídeos e assim sucessivamente
e teremos as sílabas e as palavras das proteínas. O entendimento das
estruturas secundárias permite a compreensão da “gramática protéica”,
passaremos ao estudo das relações entre palavras e onde elas têm mais
probabilidade de ocorrer, certo tipos de aminoácido apresentam maior
probabilidade de serem encontrados na superfície da proteína, enquanto
outros apresentam tendência a ficarem no interior da proteína.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

Introdução. Por último leremos o “livro protéico”, através da interpretação da


estrutura terciária e quaternária das proteínas. O estudo das proteínas
permite o entendimento, no nível molecular, dos fenômenos mais básicos da
vida. Fenômenos como divisão celular, transporte de oxigênio, fotossíntese,
sinapses, etc. Tais fenômenos só podem ser entendidos profundamente se
conhecermos as proteínas envolvidas nesses fenômenos. Vamos começar a
leitura do “livro das proteínas”.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

A molécula de aminoácido. As letras do alfabeto protéico são os


aminoácidos. A fórmula molecular do aminoácido é mostrada abaixo. O
aminoácido tem um terminal (amino) e outro terminal carboxílico. No centro
temos um carbono tetraédrico, chamado carbono alfa, ligado covalentemente
ao terminais amino (grupo amino NH2) e carboxílico (grupo carboxila, COOH).
O carbono alfa tem mais duas ligações covalentes, uma com hidrogênio e
outra com a cadeia lateral (R). A cadeia lateral é responsável pela identidade
do aminoácido. Há vinte tipos diferentes de aminoácidos, ou seja, temos vinte
tipos possíveis de cadeias laterais. H
O
+ H 3N C C

O -
R
wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.
Aminoácidos

Quiralidade. Os aminoácidos são moléculas quirais, ou seja, admitem duas


formas, sendo uma a imagem espelhada da outra. Uma característica
interessante sobre a quiralidade dos aminoácidos, todos aminoácidos
naturais são da forma L (levógiro), chamados aminoácidos L. Uma
consequência da quiralidade dos aminoácidos é o fato de todos os cristais de
proteínas não apresentam simetria espelho ou centro de inversão, o que
reduz o número de grupos espaciais possíveis a 64. A distribuição dos
átomos em torno do carbono alfa nos aminoácidos L segue uma regra
mnemônica simples, chamada regra do “CORN”, olhe o diagrama
esquemático da representação do aminoácido L. Neste diagrama estamos
olhando para o carbono alfa ao longo da ligação covalente com o átomo de
hidrogênio. Nesta situação temos três ligações covalentes restantes seguindo
a regra do CORN, o CO para a carboxila, o R para a cadeia lateral e o N para
o grupo amino.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

Regra do “CORN”. A regra do “CORN” indica a distribuição das ligações


covalentes ao redor do carbono alfa. O estado de protonação tanto do grupo
amino quanto do grupo carboxílico dependem do pH do meio, e podem
apresentar-se protonado como desprotonado. O estado mostrado na fórmula
molecular e na estrutura tridimensional é o predominante nas condições
fisiológicas.
COO R
H
O
+ H 3N C C

O -
R

NH3
wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.
Aminoácidos
Glicina Gly G Tirosina* Tyr Y
Alanina Ala A Metionina Met M
Serina* Ser S Triptofano* Trp W
Treonina* Thr T Asparagina* Asn N
Cisteina Cys C Glutamina* Gln Q
Valina Val V Histidina* His H
Isoleucina Ile I Aspartato* Asp D
Leucina Leu L Glutamato* Glu E
Prolina Pro P Lisina* Lys K
Fenilalanina Phe F Arginina* Arg R

* podem formar ligações de H

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos
H H
O O
+ H3N
+
H3N C C C C
Aminoácidos alifáticos. - O -
O
Entre os 20 aminoácidos H CH 2
Glicina
naturais 6 apresentam cadeias
CH
laterais alifáticas: glicina, H
O H 3C CH
alanina, valina, leucina, 3
+ Leucina
H3N C C
isoleucina, e prolina. Essas
cadeias laterais são apolares, CH
O - H
3 O
e as maiores são hidrofóbicas. Alanina + H 3 N C C
H H
O O O -
CH CH 3
HN C C +
H3N C C

- - CH 2
O O
CH 2 CH 2 CH
CH 3
H 3C CH 3
CH 2 Prolina Valina Isoleucina

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

Aminoácidos alifáticos
H
hidroxilados. Os aminoácidos H
O O
serina e treonina apresentam + +
H3N C C
H 3 N C C
hidroxilas alifáticas, que são
O -
polares. Podemos pensar na CH 2
O -
HO CH
serina como uma alanina
CH
hidroxilada e a treonina como OH 3

uma valina onde uma metila Serina Treonina

foi trocada por uma hidroxila.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos
H
O H
O
+ H3N C C + H3 N C C
Aminoácidos aromáticos. Há O -
CH -
3 aminoácidos naturais que 2
CH 2
O

apresentam anéis aromáticos


nas cadeias: fenilalanina,
tirosina e triptofano.
Fenilalanina e triptofano são Fenilalanina

mais hidrofóbicos, e são H


O OH
normalmente encontrados no +
H3N C C
Tirosina

interior das proteínas. A


-
tirosina é uma versão CH 2
O

hidroxilada da fenilalanina.
CH
N
H
Triptofano

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

Aminoácidos ácidos. O H H
aspartado e glutamato O O

apresentam carboxilas nas + H3N C C + H3N C C

cadeias laterais. O - O -
CH 2 CH 2

CH CH 2

O O -
CH
Aspartato
O O -

Glutamato

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

Aminoácidos polares H
H
derivados dos aminoácidos O O

ácidos. A asparagina e a + H3N C C


+ H3N C C

glutamina as hidroxilas das - O -


O CH
cadeias laterais são trocadas CH 2
2

por grupos NH2. CH


CH 2

O NH 2 CH
Asparagina
O NH 2
Glutamina

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

Aminoácidos básicos. Os
aminoácidos lisina, arginina, H H
O O
histidina apresentam cadeias
+ +
H3N C C H3N C C
laterais básicas.
H - -
O O
O CH 2 CH 2
+
H3N C C
CH 2 CH 2
O -
CH 2
CH 2 CH 2

C CH
CH 2 N H

+ HN NH
NH + C NH +
3 2

C
H NH 2
Histidina Lisina
Arginina

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

Aminoácidos com enxofre.


Dois aminoácidos apresentam H
H O
enxofre na cadeia lateral, são O
+
H3N C C
eles, cisteína e metionina. A + H 3 N C C
cisteína apresenta uma CH 2
O -

O -
sufidrila que permite a CH 2

formação de pontes CH 2
SH
dissulfetos em proteínas.
Cisteína
Essas pontes são ligações S

covalentes entre cisteínas, CH 3


formando uma cistina que é a
ligação de duas cisteínas.
Metionina

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

Alifáticos
Thr
Gly Gln
Aromáticos
Ser
Val Asn
Phe Trp Tyr
Ala Ácidos
Ile Com enxofre Asp Glu
Polares
Cys Pro Básicos
Leu Met Lys
His
Arg
Hidrofóbicos

Diagrama de Venn p/ Aminoácidos

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

Massa atômica. Além das diferenças na carga, hidrofobicidade, polaridade


os aminoácidos apresentam variação quanto sua massa atômica.
Normalmente usamos a unidade Dálton (D) para medir a massa atômica de
aminoácidos e moléculas biológicas em geral. Um dálton equivale
aproximadamente à massa atômica de um hidrogênio. Para proteínas
usamos com frequência o kilodálton (kD). Considerando-se a massa atômica
de cada resíduo de aminoácido natural temos uma massa atômica média de
118,89 D. Este valor médio é útil na estimativa da massa molecular
aproximada de proteínas e peptídeos, a partir do conhecimento do número de
resíduos de aminoácidos presentes na molécula, como representado na
equação abaixo.
MW = 118,89 . Naa

Onde MW é a massa molecular e Naa o número de resíduos de aminoácidos


presentes na molécula.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

Ocorrência média de aminoácidos. O sequenciamento de milhões de


proteínas, proporcionado pelos projetos de sequenciamento de genomas
identificou que os aminoácidos apresentam padrões de ocorrência distintos.
Há aminoácidos mais comuns de serem encontrados, como a Leucina, e
outros mais raros, como o triptofano. Uma análise feita por Doolitle (1989), a
partir de uma base de dados com 300688 resíduos, estabeleceu uma taxa de
ocorrência relativa para os aminoácidos naturais, uma tabela com esses
dados é mostrada a seguir. H
H
O
O
+ H3N C C + H3N C C

O -
CH 2 O -
CH 2

CH
CH
H 3C CH 3
N
H
Leucina (9,1 %) Triptofano (1,4 %)

Fonte: Doolitle, R. F. in Fasman, G. D. (Ed.), Predictions of Protein Structure and the Principles of Protein Conformation Plenun Press (1989)

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos
Ocorrência média de aminoácidos em percentagem (%)

Glicina 7,2 Tirosina 3,2


Alanina 7,8 Metionina 2,2
Serina 6,8 Triptofano 1,4
Treonina 5,9 Asparagina 4,3
Cisteina 1,9 Glutamina 4,3
Valina 6,6 Histidina 2,3
Isoleucina 5,3 Aspartato 5,3
Leucina 9,1 Glutamato 6,3
Prolina 5,2 Lisina 5,9
Fenilalanina 3,9 Arginina 5,1
Fonte: Doolitle, R. F. in Fasman, G. D. (Ed.), Predictions of Protein Structure and the Principles of Protein Conformation Plenun
Press (1989)

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

Hidropatia. Os aminoácidos são caracterizados por suas cadeias laterais,


sendo separados em dois grandes grupos: hidrofóbicos e hidrofílicos. Grande
parte das proteínas apresentam características anfipáticas, ou seja, parte
hidrofóbica e parte hidrofílica. Os aminoácidos hidrofóbicos tendem a evitar o
contato com a água, escondendo-se no interior da proteína, enquanto os
aminoácidos hidrofílicos procuram o contato com o solvente. O
particionamento dos aminoácidos entre ambiente aquoso e não-aquoso
conduz ao efeito hidrofóbico que conduz o enovelamento das proteínas.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

Hidropatia. Para quantificar a contribuição de cada aminoácido ao efeito


hidrofóbico (a hidropatia de um aminoácido), medimos explicitamente o
particionamento da molécula entre a água e solvente orgânicos, como o
octanol. A hidropatia de uma molécula de aminoácido é representada pelo
coeficiente de partição P, que é medido como a fração molar das moléculas
na fase aquosa (χaq) relativa à fração molar na fase orgânica no equilíbrio (χ
nonaq), como segue:

P = χaq/χnonaq

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Aminoácidos

Hidropatia. Análise da Hidropatia


hidropatia dos aminoácidos
indica uma variação de -4,5 5
4
(hidrofílico) (aminoácido
3
arginina) até 4,5 (hidrofóbico) 2
(aminoácido isoleucina). 1
Valores positivos indicam 0 Hidropatia
I V L F C M A G T S W Y P H N Q D E K R
aminoácido hidrofóbico, -1
-2
valores negativos indicam
-3
aminoácido hidrofílico. -4
-5

Fonte: Kyte, J. & Doolitle, R. F. J. Mol. Biol. 157: 105-132 (1982)

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Distância interatômica (PDB)

Ångstrom. Na nossa viagem pelo universo protéico, começamos com as


definições dos aminoácidos, veremos agora diversos parâmetros
geométricos, que nos ajudam a entender a estrutura tridimensional de
aminoácidos e posteriormente as proteínas. Para definirmos os parâmetros
geométricos do universo protéico precisamos de uma régua. As unidades de
comprimento são expressas em metros no Sistema Internacional (SI), o que
não é conveniente, devido às dimensões envolvidas, podemos usar
submúltiplos do metro, o mais adequado para as dimensões protéicas é o
nanômetro, que é 10-9 m. Esta unidade é comum de ser encontrada em textos
de biofísica molecular, mas a mais comum, para ser utilizada no estudo de
proteínas, é o Ångstrom (Å), 1 Å = 10-10m, ou alternativamente 1 Å = 0,1 nm .
As informações estruturais sobre proteínas estão disponíveis numa base de
dados chamada Protein Data Bank (PDB), disponível em www.rcsb.org/pdb.
O PDB apresenta um formato rígido que será descrito ao longo do curso.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Distância interatômica (PDB)

A figura da estrutura tridimensional do aminoácido alanina foi gerada a partir


das coordenadas atômicas armazenadas num arquivo PDB. Para cada átomo
mostrado na figura temos uma posição atômica no arquivo PDB.
Arquivo PDB para o aminoácido alanina.
HETATM 1 N ALA 001 -0.541 1.336 -2.425
HETATM 2 CA ALA 001 0.178 0.132 -2.236
HETATM 3 C ALA 001 1.399 0.101 -3.155
HETATM 4 O ALA 001 2.606 -0.060 -2.668
HETATM 5 H ALA 001 -0.396 1.923 -1.614
HETATM 6 O ALA 001 1.116 0.235 -4.429
HETATM 7 H ALA 001 -1.557 1.207 -2.555
HETATM 8 H ALA 001 0.597 0.213 -1.219
HETATM 9 CB ALA 001 -0.751 -1.285 -2.203
HETATM 10 H ALA 001 -1.525 -1.287 -1.557
HETATM 11 H ALA 001 -0.255 -2.141 -2.003
HETATM 12 H ALA 001 -1.166 -1.414 -3.112
HETATM 13 H ALA 001 -0.173 1.800 -3.246
END

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Distância interatômica (PDB)

Temos uma relação biunívoca, para cada átomo no arquivo PDB temos um
átomo na estrutura. A figura abaixo mostra as coordenadas atômicas para os
átomos da figura, exceto os hidrogênios.
HETATM 9 CB ALA 001 -0.751 -1.285 -2.203

HETATM 4 O ALA 001 2.606 -0.060 -2.668

HETATM 3 C ALA 001 1.399 0.101 -3.155

HETATM 6 O ALA 001 1.116 0.235 -4.429

HETATM 2 CA ALA 001 0.178 0.132 -2.236

HETATM 1 N ALA 001 -0.541 1.336 -2.425

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Distância interatômica (PDB)

Distância interatômica. As coordenadas atômicas, apresentadas nos


arquivos PDB, permitem a determinação direta de diversos parâmetros
estruturais, tais como, distâncias, ângulos e ângulos de torção. Para o cálculo
da distância entre dois átomos (interatômica), i e j, de coordenadas (X, Y, Z)
usamos a seguinte equação:

D = [ (Xj – Xi )2 + (Yj – Yi )2 + (Zj – Zi )2 ]1/2

Usando-se as coordenadas atômicas de um arquivo PDB para um par de


átomos teremos a distância em Å (10-10 m).

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Distância interatômica (PDB)

Como aplicação consideremos a distância entre o N e o CA da estrutura


abaixo.

D = [ (Xj – Xi )2 + (Yj – Yi )2 + (Zj – Zi )2 ]1/2

HETATM 2 CA ALA 001 0.178 0.132 -2.236

HETATM 1 N ALA 001 -0.541 1.336 -2.425

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Distância interatômica (PDB)

Substituindo-se os valores temos:


D = [ (-0,541 – 0,178 )2 + (1,336 – 0,132 )2 + (-2,425 – (-2,236) )2 ]1/2

D = [ (-0,719 )2 + (1,204 )2 + (-0,189 )2 ]1/2


D = [ 0,517 + 1,450 + 0,036 ]1/2
D = [ 2,003 ]1/2 = 1,42 Å

HETATM 2 CA ALA 001 0.178 0.132 -2.236

HETATM 1 N ALA 001 -0.541 1.336 -2.425

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulo interatômico (PDB)

Ângulo de ligação. O ângulo de ligação (θ), entre as ligações AB e AC,


mostrado na figura abaixo, pode ser determinado a partir da seguinte
equação:
θ = arccos [(AB) 2
+ (AC) 2
- (BC) 2
]
2(AB)(AC)
Onde AB, AC e BC são distâncias interatômicas, determinadas usando-se a
equação da distância interatômica, descrita anteriormente.
B

BC

θ
A C
AC

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulo interatômico (PDB)

Vamos usar a equação anterior para determinar o ângulo de ligação (θ), entre
as ligações N(CA) e (CA)C, mostrada na figura abaixo. As distâncias
interatômicas N(CA), (CA)C e NC, são determinadas como descrito
anteriormente, omitiremos seu cálculo aqui e usaremos os seus resultados.
N(CA) = 1,42 Å, (CA)C = 1,53 Å, e NC = 2,41 Å, aplicando-se esses valores
na equação do ângulo temos:
C

θ = arccos [ (1,42) + (1,53) - (2,41) ]


2 2 2
CA
2(1,42)(1,53) θ

N
θ = 109,5o

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ligação peptídica

A estrutura ao lado indica a ligação


entre dois resíduos de aminoácido CA
consecutivos, onde somente os
átomos da cadeia principal são 1,51 Å
1,32 Å N
mostrados (omitindo os hidrogênios).
1,24 Å
Esses quatro átomos estão num C 1,46 Å

plano, e a ligação covalente entre o


carbono da carbonila (C) e o O CA
nitrogênio (N) é uma ligação
parcialmente dupla, o que deixa esta
ligação sem liberdade de torção. Este
ângulo de torção é chamado ângulo
ômega, e discutiremos com mais
detalhes posteriormente.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Cadeia peptídica

Abaixo temos uma cadeia peptídica de 6 resíduos de aminoácido, onde


lemos a sequência do N para o C terminal, essa convenção é usada para
numerar os resíduos na sequência. Tal procedimento facilita a análise de
diversas características das sequências de aminoácidos, tais como,
conservação de resíduos de aminoácido em determinada posição, identidade
sequencial entre diversas proteínas, identificação de sítios ativos, no caso de
enzimas, entre outros aspectos. No próximo slide temos o alinhamento
sequencial de 6 CDKs, onde as sequências começam no N-terminal e
finalizam no C-terminal. R2 R4 R6

N-terminal C-terminal

R1 R3 R4

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Alinhamento de seqüências
CDK2 1 ---------MENFQKVEKIGEGTYGVVYKARNKLTG-EVVALKKIRLDTET---EGVPST 47AIREISLLKELN---HP
CDK3 1 ---------MDMFQKVEKIGEGTYGVVYKAKNRETG-QLVALKKIRLDLEM---EGVPST 47AIREISLLKELK---HP
CDK1 1 ---------MEDYTKIEKIGEGTYGVVYKGRHKTTG-QVVAMKKIRLESEE---EGVPST 47AIREISLLKELR---HP
CDK5 1 ---------MQKYEKLEKIGEGTYGTVFKAKNRETH-EIVALKRVRLDDDD---EGVPSS 47ALREICLLKELK---HK
CDK4 1 -------MATSRYEPVAEIGVGAYGTVYKARDPHSG-HFVALKSVRVPNGGGGGGGLPIS 52TVREVALLRRLEAFEHP
CDK6 1 MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGE---EGMPLS 57TIREVAVLRHLETFEHP

CDK2 62 NIVKLLDVIHT-----ENKLYLVFEFLHQDLKKFMDASA-LTG 98IPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQN


CDK3 62 NIVRLLDVVHN-----ERKLYLVFEFLSQDLKKYMDSTP-GSE 98LPLHLIKSYLFQLLQGVSFCHSHRVIHRDLKPQN
CDK1 62 NIVSLQDVLMQ-----DSRLYLIFEFLSMDLKKYLDSIPPGQY 99MDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQN
CDK5 62 NIVRLHDVLHS-----DKKLTLVFEFCDQDLKKYFDSCN--GD 97LDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQN
CDK4 70 NVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAP-PPG 111LPAETIKDLMRQFLRGLDFLHANCIVHRDLKPE
CDK6 75 NVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVP-EPG 116VPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQ

CDK2 133 LLINTEGAIKLADFGLARAFGVPVRT 158YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTR-RALFPGDS


CDK3 133 LLINELGAIKLADFGLARAFGVPLRT 158YTHEVVTLWYRAPEILLGSKFYTTAVDIWSIGCIFAEMVTR-KALFPGDS
CDK1 134 LLIDDKGTIKLADFGLARAFGIPIRV 159YTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATK-KPLFHGDS
CDK5 132 LLINRNGELKLADFGLARAFGIPVRC 157YSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGND
CDK4 145 NILVTSGGTVKLADFGLARIYSYQM-A 170LTPVVVTLWYRAPEVLLQST-YATPVDMWSVGCIFAEMFRR-KPLFCGN
CDK6 150 NILVTSSGQIKLADFGLARIYSFQM-A 175LTSVVVTLWYRAPEVLLQSS-YATPVDLWSVGCIFAEMFRR-KPLFRGS

CDK2 208 EIDQLFRIFR 217TLGTPDEVVWPGVTSMPDYKPSFPKWARQ-DFSKVVPPLDEDGRSLLSQMLHYDPNKRIS 276AK


CDK3 208 EIDQLFRIFR 217MLGTPSEDTWPGVTQLPDYKGSFPKWTRK-GLEEIVPNLEPEGRDLLMQLLQYDPSQRIT 276AK
CDK1 209 EIDQLFRIFR 218ALGTPNNEVWPEVESLQDYKNTFPKWKPG-SLASHVKNLDENGLDLLSKMLIYDPAKRIS 277GK
CDK5 208 VDDQLKRIFR 217LLGTPTEEQWPSMTKLPDYKP-YPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRIS 276AE
CDK4 218 SEADQLGKIFD 228LIGLPPEDDWPRDVSLP--RGAFPPRGPR-PVQSVVPEMEESGAQLLLEMLTFNPHKRIS 285A
CDK6 223 SDVDQLGKILD 233VIGLPGEEDWPRDVALP--RQAFHSKSAQ-PIEKFVTDIDELGKDLLLKCLTFNPAKRIS 290A

CDK2 279 AALAHPFFQDVTKPVPHLRL-------------- 298


CDK3 279 TALAHPYFSSP-EPSPAARQYVLQRFRH------ 305
CDK1 280 MALNHPYFNDLDNQIKKM---------------- 297
CDK5 279 EALQHPYFSDFCPP-------------------- 292
CDK4 287 FRALQHSYLHKDEGNPE------------------ 303
CDK6 292 YSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA 326
Ângulos de torção

Um dos parâmetros usados para a avaliação da qualidade de um modelo


estrutural de proteína é o gráfico de Ramachandram, discutido na aula
anterior. O cálculo dos ângulos de torção fi e psi da cadeia principal permite
avaliar a qualidade estereoquímica da proteína, identificando regiões
problemáticas, que podem ser melhoradas durante o refinamento
cristalográfico. Discutiremos o algoritmo para o cálculo do ângulo de torção
usado pelo programa PROCHECK, bem como em outros programas de
visualização de macromoléculas biológicas, depois ilustraremos o uso do
webserver PARMODEL para análise da qualidade estereoquímica de
proteínas. Frequentemente nos deparamos na análise da geometria da
estrutura tridimensional de macromoléculas biológicas com sistemas
envolvendo 4 átomos. Em tal situação a medida do ângulo de torção é uma
parâmetro importante para a análise do enovelamento da proteína.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

O ângulo de torção é medido


considerando-se duas ternas de
átomos, como no sistema de 4
átomos mostrado ao lado, átomos A, D
B, C e D. Os átomos A, B e C
definem um plano, e os átomos B, C
e D um segundo plano. O ângulo de A θ θ
torção envolvendo os átomos B e C é
definido como o ângulo formado entre
os planos ABC e BCD. B C

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

Para entendermos a equação do


ângulo de torção (θ) necessitamos de
y
alguns conceitos básicos de
geometria analítica. Usaremos o D
conceito de vetor, para
determinarmos a interação entre os
átomos no sistema. O vetor é uma
entidade que apresenta direção e A θ θ

magnitude, e pode ser representado rA


rB
em coordenadas cartesianas. Por C
exemplo, o vetor que indica a posição
j B
do átomo A, pode ser indicado por: i
k x
rA = xAi + yAj + zAk,
onde i, j e k são vetores unitários
(tamanho igual 1) ao longo das direções
z x, y e z.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

O vetor entre os átomos A e B, aqui


chamado de vetor r1 é definido em
y
coordenadas cartesianas como
segue: D
r1 = (xB - xA )i + (yB - yA )j + (zB – zA )k . r3
A θ θ
De forma análoga temos os vetores r2 r1
e r3, como segue: rA
rB
r2 C
j B
r2 = (xC - xB )i + (yC - yB )j + (zC – zB )k
i
k x
r3 = (xD - xC )i + (yD - yC )j + (zD – zC )k
z

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

Para determinarmos o ângulo de


torção precisamos de mais duas
y
definições relacionadas a vetores,
são elas, produto vetorial (x) e D
produto escalar (.). O produto vetorial
entre os vetores r1 e r2 é um terceiro r3
vetor perpendicular ao plano definido
por estes dois vetores, assim, na A θ p1 θ
r1
figura ao lado, temos que o vetor p1 é rA
rB
perpendicular aos vetores r1 e r2 e α r2 C
j B
apresenta magnitude dada pela
i
equação abaixo: k x

|p1| = |r1| |r2| sen α, as barras em volta dos vetores indicam


z seu módulo, ou seja, seu tamanho.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

Uma forma alternativa de


representarmos o produto vetorial é a y
forma cartesiana, definida como
segue: p1 = r1x r2 = D
= (ai + b j + c k) x (d i + e k + f k)
O “x” indica o produto vetorial. r3
Podemos obter o produto vetorial a A θ p1 θ
r1
partir do determinante da matriz rA
abaixo. rB
α r2 C
j B
i j k
i
k x
a b c

d e f z

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

Calculamos o determinante da
seguinte forma: y
i j k
D
a b c
r3
d e f
A θ p1 θ
r1
rA
rB
α r2 C
j B
p1 = r1x r2 = i ( b f - ec) i
k x
+ j (d c - af)
+ k (a e - bd) z

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

O produto escalar entre dois vetores


p1 e p2 é dado por: y
p1 . p2 = |p1||p2| cos θ
D
Onde p1 é o vetor perpendicular ao p2
r3
plano ABC, e p2 é o vetor perpendicular θ
ao plano BCD (indicados na figura), o A θ p1 θ
r1
ângulo de torção (θ) é igual ao ângulo rA
rB
entre os vetores p1 e p2, pois os vetores j α r2 C
B
p1 e p2 são perpendiculares aos planos
i
ABC e BCD, respectivamente, assim o k x
ângulo o ângulo entre os vetores é θ.
z

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

Em coordenadas cartesianas o
produto escalar entre dois vetores p1 y
e p2 é dado por:
D
p1 . p2 = (ai + bj + ck ). (di + ej + fk ) p2
r3
θ
Onde a, b e c são as coordenadas A θ p1 θ
r1
cartesianas do vetor p1 e d, e, f são as rA
rB
coordenadas do vetor p2. α r2 C
j B
i
k x

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

Assim temos que para calcular o


ângulo de torção (θ) definidos por
conjuntos de 4 átomos, como
representado na figura ao lado, usamos D
as seguintes equações. O ângulo θ é o p2
mesmo ângulo entre os vetores p1 e p2 . r3
θ
p1 = r 1 x r 2 A θ p1 θ
r1
p2 = r 2 x r 3
r2 C
B
p1 . p2 = |p1||p2| cos θ

θ = arccos[ p1 . p2 ]
|p1||p2|

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

Usaremos esta equação para o calcular


o ângulo de torção entre os átomos C e CA
N, indicados ao lado.
r1
r2 N
p1 = r 1 x r 2
C r2
p2 = r 2 x r 3
O CA
p1 . p2 = |p1||p2| cos θ

p1 . p2
θ = arccos[ ]
|p1||p2|

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

Para determinar o ângulo de torção 8.326 10.351 0.000


precisamos inicialmente determinarmos A
os vetores r (indicados ao lado), como
10.325 9.000 0.000
segue: r1
r2 C
9.000 9.000 0.000
r1 = (xB – xA )i + (yB – yA)j + (zB – zA)k B
r2

11.096 7.766 0.000 D

r2 = (xC – xB )i + (yC – yB)j + (zC – zB)k

r3 = (xD – xC )i + (yD – yC)j + (zD – zC)k

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

Para determinar o ângulo de torção 8.326 10.351 0.000


precisamos inicialmente determinarmos A
os vetores r (indicados ao lado), como
10.325 9.000 0.000
segue: r1
r2 C
9.000 9.000 0.000
r1 = (0,674)i + (– 1,351)j + (0)k B
r2

11.096 7.766 0.000 D

r2 = (1,325)i + (0)j + (0)k

r3 = (0,771)i + (-1,234)j + (0)k

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

Agora com os vetores r determinados 8.326 10.351 0.000


podemos calcular os produtos vetoriais A
como segue:
10.325 9.000 0.000
r1
r2 C
r1 = 0,674i – 1,351j
9.000 9.000 0.000
r2 = 1,325i B
r2
r3 = 0,771i - 1,234j
11.096 7.766 0.000 D
p1 = r1 x r2 = ( 0,674i – 1,351j ) x (1,325i ) =

= 1,790k Regra do produto vetorial:


ixi=0 jxj=0 kxk=0
p2 = r2 x r3 = (1,325i )x (0,771i – 1,234j) = ixj=k jxk=i kxi=j
i x k = - j j x i = -k k x j = -i
= - 1,635 k

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

Passaremos agora ao cálculo do ângulo de


8.326 10.351 0.000
torção, como segue: A
p1 = 1,790k
p2 = - 1,635 k r1 10.325 9.000 0.000
r2 C
p1. p2 = (1,790k).(-1,635k) = - 2,927
9.000 9.000 0.000
|p1| = 1,790 |p2| = 1,635 B
r2
p1 . p2
θ = arccos[ ] 11.096 7.766 0.000 D
|p1||p2|
-2,927
θ = arccos[ ]
1,79.1,635
Regra do produto escalar
θ = arccos[ -1 ] = 180o i.i=1 j.j=1 k.k=1
i.j=0 j.k=0 k.i=0
Ou seja o ângulo de torção é 180o. i.k=0 j.i=0 k.j=0

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

Na cadeia polipetídica a definição do


enovelamento da proteína depende dos
ângulos de torção anterior ao carbono
alfa, chamado de ângulo fi (phi em
inglês) (φ), e do ângulo de torção após o i+2
carbono alfa, chamado ângulo psi (ψ). A
análise da rotação desses ângulos CA
N
levou à identificação de regiões O i+1
permitidas, onde não há choques entre C ω
N
CA ψ
os átomos, e regiões não-permitidas,
onde há choque entre os átomos. CB
C φ CB i
O
CA
N i-1

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

Graficando-se para cada resíduo de


aminoácido o ângulo fi e psi temos um
diagrama bidimensional, onde as
regiões permitidas e proibidas são
identificáveis, tal diagrama é chamado i+2
de diagrama de Ramachandran, visto
anteriormente. A cadeia principal CA
N
apresenta um terceiro ângulo de torção, O i+1
envolvendo a ligação parcialmente C ω
N
CA ψ
dupla entre o carbono da carbonila do
resíduo de aminoácido i com o CB
C φ CB i
nitrogênio do aminoácido i+1, ou seja, a CA
O
ligação peptíca. N i-1

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Ângulos de torção

Devido ao caráter parcialmente duplo


desta ligação não há a liberdade
conformacional observada para os
ângulos fi e psi. Este ângulo é chamado
ângulo ômega, e admite duas situações, i+2
trans, onde seu valor é 180o e cis, onde
seu valore é 0o. CA
N
O i+1
C ω
N
CA ψ

CB
C φ CB i
O
CA
N i-1

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Lista de exercícios(Parte 1)
1) Determine a matriz de rotação eixo de ordem 4 ao longo dos eixo y e z. Determine a
posição de todos os pontos gerados a partir de um ponto geral de coordenadas x,y,z.
2) Aplique o operador de simetria 41 ao longo do eixo z. Determine as coordenadas
obtidas a partir da aplicação sucessiva do operador sobre coordenadas x,y,z.
3) Desenhe a estrutura química dos tripeptídeos (a) Ala-Leu-Phe, (b) Ser-Pro-Asn, (c)
Met-Trp-Gly.
4) Identifique entre os vinte aminoácidos naturais aqueles que na cadeia lateral diferem
um do outro por um grupo metileno.
5) Determine o número possível de tetrapeptídeos que apresentem os aminoácidos Ala,
Gly, Lys e Val.
6) Identifique na cadeia lateral da asparagina os grupos doadores e aceitadores de
ligação de hidrogênio.
7) Uma proteína apresenta massa atômica de 29.722,5 D. Determine o número
aproximado de resíduos de aminoácidos.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Diagrama de Ramachandran

Os eixos, fi (φ) e psi (ψ), no


diagrama de Ramachandran, variam
de -180o a +180o, as regiões no
interior das áreas demarcadas no
gráfico são regiões permitidas. Fica
claro, a partir da análise do gráfico,

ψ(o)
que a área não permitida é maior do
que a permitida. As regiões, não
permitidas são possíveis de
ocupação para a glicina, pois sua
cadeia lateral restringe-se a um
átomo de hidrogênio, permitindo
mais liberdade para os ângulos fi e
psi. φ(o)

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Diagrama de Ramachandran

Em 1993 Laskowski e col. elaboraram


o programa PROCHECK que define
4 regiões no diagrama de
Ramachandran, são elas: região
permitida (indicada em vermelho),
região adicionalmente permitida
(amarelo), região generosamente
permitida (amarelo claro) e região
proibida (branco). O programa
PROCHECK usa dados da estrutura
cristalográfica de 118 proteínas
resolvidas a uma resolução melhor
Referência:Laskowski, R.A.; MacArthur, M.W., Moss, D.S.,
que 2,0 Å, para definir as regiões Thornton, J.M. PROCHECK: a program to check the
permitidas e proibidas do diagrama. stereochemical quality of protein structures. J. of Appl. Cryst.
26(2), 283-291, (1993).

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Diagrama de Ramachandran

O programa PROCHECK indica as


glicinas como triângulos, e estas
podem ocupar qualquer região do
diagrama de Ramachandran, visto
que sua cadeia lateral restringe-se a
um hidrogênio, que permite maior
flexibilidade da cadeia principal. Os
resíduos localizados nas regiões
generosamente permitida e proibida
são indicados em vermelho. Na
figura ao lado o resíduo Val116 está
na região generosamente perimitida
do gráfico.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Diagrama de Ramachandran

O PROCHECK oferece diversas


informações, em outros gráficos, ou
mesmo no gráfico principal. Uma delas
é a estatística geral dos ângulos fi e
psi, indicando a porcentagem de
resíduos de aminoácido em cada
região, na estrutura 1WE2 (Pereira et
al., 2004) temos 92,7 % dos resíduos
da região permitida, 6,6 % na região
adicionalmente permitida, e 0,7 % na
região adicionalmente permitida. Para
estruturas resolvidas a resolução acima
de 2,0 Å espera-se acima de 90 % dos
resíduos nas regiões permitidas.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Diagrama de Ramachandran

A análise da qualidade estereoquímica


de modelos de proteínas é uma
ferramenta poderosa na análise
estrutural, sejam obtidos
experimentalmente ou obtidos por
modelagem molecular. O Programa
PROCHECK facilita a análise dos
modelos estruturais. Há versões do
PROCHECK para windows e linux,
bem como, sites dedicados a análise
on-line de proteínas, como o
PARMODEL (Uchoa et al., 2004)

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Diagrama de Ramachandran

Como exemplo do uso do programa PROCHECK na análise da qualidade


estereoquímica de modelos estruturais de proteínas, considere a proteína
humana Purina Nucleosídeo Fosforilase (PNP, EC. 2.4.2.1). A PNP foi
resolvida inicialmente em 1990 por Ealick et al. 1990 (código de acesso no
PDB: 1ULA), a 2,75 Å de resolução. Uma nova estrutura foi refinada a 2,3 Å
(Azevedo et al., 2003) (Código de acesso PDB: 1M73). Usaremos uma
versão on-line do PROCHECK, chamada PARMODEL para analisar ambas
estruturas.
Referências: Pereira, J.H., Oliveira, J. S., Canduri, F., Dias, M.V.B., Palma, M. S., Basso, L. A., Santos, D. S., & De Azevedo,
W.F. Structure of shikimate kinase from Mycobacterium tuberculosis reveals the binding of shikimic acid. Acta Crystallogr. Sect.
D.-Biol. Crystallogr. 60 , 2310-2319, 2004.
Uchoa, H. B., Jorge, G. E., Freitas da Silveira, N. J., Camera, J. C. Jr., Canduri, F., De Azevedo, W. F.Biochem. Biophys. Res.
Commun. 2004;325(4):1481-1486.
De Azevedo, W. F., Canduri, F., Santos, D. M., Silva, R. G., Oliveira, J. S., Carvalho, L. P. S., Basso, L. A., Mendes, M. A., Palma,
M. S., and Santos, D. S. Crystal structure of human purine nucleoside phosphorylase at 2.3 A resolution. Biochem. Biophys. Res.
Commun., 308(3), 545-552, 2003.
Ealick, S. E., Rule, S. A., Carter, D. C., Greenhough, T. J., Babu, Y. S., Cook, W. J., Habash, J., Helliwell, J. R., Stoeckler, J. D.,
Parks, R. E., Jr., Chen, S, -F., and Bugg, C. E. (1990). Three-dimensional structure of human erythrocytic purine nucleoside
phosphorylase at 3.2Å resolution. J. Biol. Chem. 265(3), 1812-1820.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Diagrama de Ramachandran

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Diagrama de Ramachandran

A análise dos dois diagramas de Ramachandran indica claramente que a


estrutura de coordenadas atômica 1M73 apresenta melhor estatística
estereoquímica. Na realidade uma análise detalhada da estrutura, resolvida
de 2,3 Å, indicou que a estrutura 1ULA apresentava diversos erros, inclusive
no sítio ativo. A estrutura 1ULA previa a participação de Lys244 no sítio ativo
da enzima, a estrutura a mais alta resolução revelou que esta lisina estava a
mais de 9 Å da posição inicialmente prevista. A análise do gráfico de
Ramachandran, por si só, não valida a estrutura de uma proteína, mas é uma
ferramenta valiosa na análise da estrutura 3D.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Diagrama de Ramachandran

Ramachandran on-line. O servidor


web PARMODEL apresenta um
interface para gerar diagramas de
Ramachandran on-line, bastando-se
para isto que o usuário forneça as
coordenadas atômicas da proteína a
ser analisada, no formato PDB. O
PARMODEL está disponível no site:
www.biocristalografia.df.ibice.unesp.br .

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Diagrama de Ramachandran

Ramachandran on-line. O
PARMODEL apresenta diversos
recursos para modelagem molecular
por homologia, que serão discutidos
adiante. Para gerar gráfico de
Ramachandran basta selecionarmos a
opção Procheck, como indicado na
figura ao lado.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Diagrama de Ramachandran

Ramachandran on-line. A interface


do Procheck do PARMODEL
apresenta diversas opções de
gráficos, usaremos a opção de gerar
o gráfico de Ramachandram, indicada
ao lado. O usuário precisa indicar o
arquivo pdb a ser analisado, e depois
clicar “Generate Ramachandran Plot”.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Diagrama de Ramachandran

Ramachandran on-line. O
PARMODEL gera o gráfico de
Ramachandran no formato PDF, e
apresenta a opção de download.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Diagrama de Ramachandran

Ângulos da cadeia lateral. Além dos ângulos de torção da cadeia principal,


temos, para a maioria do aminoácidos a possibilidade de ângulos de torção
para a cadeia lateral. Obviamente tais ângulos só existem para os
aminoácidos de cadeia lateral média e longa. No exemplo abaixo temos uma
lisina, com 5 ângulos de torção possíveis.

χ5 χ4 χ3 χ2
χ1

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Área acessível ao solvente

ASA. As proteínas em solução permitem a interação de moléculas de água


com sua estrutura. Um dos parâmetros geométricos, usados para analisar a
interação de moléculas de água, bem como outros ligantes, com a proteína é
a área acessível ao solvente (ASA). O conceito desse parâmetro é
relativamente simples. Imagine uma molécula de água deslizando sobre a
superfície da proteína, uma molécula com um raio 1,4 Å com formato
esférico.

Molécula de água

Superfície acessível ao solvente


Esferas representado átomos

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Área acessível ao solvente

ASA. Tal forma não é realista, mas é uma boa aproximação para nossos
propósitos. Na figura temos uma representação de uma parte da proteína,
onde os átomos são representados como esferas com o raio de van der
Waals e a molécula de água rolando sobre os átomos, a linha tracejada
representa a superfície acessível ao solvente traçada pelo centro da esfera
que representa a água.

Molécula de água

Superfície acessível ao solvente


Esferas representado átomos

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Área acessível ao solvente

A superfície de van der Waals é definida pela área contínua das superfícies
esféricas, entre as esferas com os raios de van der Waals, representada em
cinza na figura abaixo. Há uma equação simples que relaciona a massa
molecular de uma proteína monomérica, com sua área acessível ao solvente,
esta equação é uma aproximação, mas pode ser usada para termos uma
idéia preliminar da ASA,
ASA = 11,1 (MW)2/3

Molécula de água

Superfície acessível ao solvente


Esferas representado átomos

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Estrutura secundária de proteínas

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice alfa

A estrutura da hélice alfa foi prevista


teoricamente por Linus Pauling em
1950. Vale a pena lembrar, que
naquela data, não havia informação
estrutural sobre proteínas, e sua
previsão foi baseada na estrutura
cristalográfica de aminoácidos,
dipeptídeos e tripeptídeos,
determinados a partir de cristalografia
por difração de raios X. A estrutura de
hélice alfa foi posteriormente
confirmada, quando a estrutura
cristalográfica da mioglobina foi
determinada em 1959.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice alfa

O enovelamento da hélice alfa leva a


uma estrutura onde as cadeias
laterais ficam voltadas para fora da
estrutura, criando uma estrutura
cilíndrica compacta. Uma análise das
preferências dos resíduos de
aminoácido indicou que Leu, Glu, Met
e Ala, são encontrados
preferencialmente em hélices alfa, e
os resíduos Pro, Ile, Gly e Ser,
dificilmente são encontrados em
hélices alfa.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice alfa

A figura da direita ilustra uma visão


de hélice alfa ao longo do seu eixo,
indicando as cadeias laterais voltadas
para o lado de fora da hélice, tal
estrutura tem um diâmetro
aproximado de 5 Å. Se
desconsiderarmos as cadeias
laterais, podemos representar a
hélice alfa como um cilindro, muitos
programas usam esta representação
gráfica.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice alfa

A estrutura tridimensional das hélices


alfa são estabilizadas por um padrão
de ligações de hidrogênio,
envolvendo o oxigênio da carbonila
do resíduo i com o nitrogênio do
resíduo i+4, como ilustrado na figura
ao lado com linhas tracejadas.
Ligação de hidrogênio

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice alfa

Há várias representações possíveis


das hélices. A representação CPK faz
uso de esferas para cada átomo, e
bastões para as ligações covalentes,
como mostrada na figura ao lado. Tal
representação permite a identificação
de detalhes estruturais, possibilitando
Ligação de hidrogênio
a identificações de características
estruturais, tais como, ligações de
hidrogênio, orientação espacial e
conectividade da estrutura, contudo,
tal representação torna-se pesada ao
olharmos para estruturas completas,
como a do próximo slide.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice alfa

Na figura ao lado temos a


representação em CPK da estrutura
C
da mioglobina, uma proteína rica em
hélices alfa. A presença da hélices
fica de difícil visualização, devido a
grande quantidade de átomos. A
proteína, representada ao lado, tem
1260 átomos representados, ou seja, N
uma esfera para cada átomo, o que
dificulta a identificação das hélices.

Representação gráfica: CPK


Código de acesso PDB: 1VXA

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice alfa

Uma forma alternativa é


representação estilizada da hélice,
C
onde usamos somente os átomos da
cadeia principal, ou somente os
carbonos alfa, para geramos uma
representação gráfica da estrutura, tal
representação omite a participação
dos átomos da cadeia lateral. N

Representação gráfica: CPK


Código de acesso PDB: 1VXA

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice alfa

A representação ao lado conecta os


carbonos alfa da estrutura, o que
C
facilita a visualização das hélices.
Vemos na estrutura diversas hélices,
num total de 8. Usamos o programa
VMD com a opção trace. O programa
representa as hélices alfa em rosa.
N

Representação gráfica: trace


Código de acesso PDB: 1VXA

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice alfa

Programas de visualização gráfica de


macromoléculas biológicas, como o
C
VMD (Visual Molecular Dynamics)
apresentam opções de representação
em cartoons, que perde os detalhes
mas facilita a identificação de
aspectos gerais sobre a estrutura
tridimensional da proteína, como na N
figura ao lado, gerada com o VMD,
com opção de representação gráfica
new cartoons.
Representação gráfica: new cartoon
Código de acesso PDB: 1VXA

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice alfa

Os laços que conectam a estrutura


não apresentam o formato helicoidal
C
das hélices, sendo representado por
um tubo contínuo mais fino que a fita
usada nas representações das
hélices.

Representação gráfica: new cartoon


Código de acesso PDB: 1VXA

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice alfa

Outra representação gráfica possível


para as hélices e a representação em
C
cilindro, onde cada hélice é indicada
como um cilindro. A figura ao lado
representa a estrutura das hélice da
mioglobina como cilindros.

Representação gráfica: cartoon


Código de acesso PDB: 1VXA

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice alfa
Eixo da hélice alfa

A distância, ao longo do eixo da


hélice alfa, entre dois carbonos alfa
de resíduos de aminoácidos 1,5 Å
consecutivos é de 1,5 Å. Cada volta
de uma hélice alfa apresenta 3,6
resíduos, assim temos que uma volta
5,4 Å
completa na hélice alfa leva a um
deslocamento de 5,4 Å, ao longo do
eixo da hélice alfa.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice alfa (3,613)
Ligação de hidrogênio

1 13
4 10
6 8 11 12
2 3 7 9
5

A hélice alfa envolve ligações de hidrogênio entre o resíduo i e o resíduo i + 4, a


análise do padrão de ligação de hidrogênio indica que o mesmo envolve um número
fixo de átomos da cadeia principal, ou seja, numerando-se a partir do oxigênio da
carbonila até o hidrogênio da amida da cadeia principal temos 13 átomos, como
mostrado na figura acima. Tal característica fixa da hélice alfa cria uma notação
alternativa para representá-la, a hélice alfa é uma hélice 3,613, tal notação indica que
temos 3,6 resíduos por volta e 13 átomos entre as ligações de hidrogênio.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice 310
Ligação de hidrogênio

1
4
6 8
2 3 7 9
5
10

Além da hélice alfa temos duas outras hélices possíveis, uma com três voltas, e 10
átomos da cadeia principal entre as ligações de hidrogênio. Essa hélice é chamada de
hélice 310, sendo bem menos comum que as hélices alfa. A ligação de hidrogênio
envolve uma carbonila do resíduo i com o nitrogênio do resíduo i+3.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélice pi (4,416)
Ligação de hidrogênio

1
4 10 14
6 8 11 12
2 3 7 9
5 13 15 16

A terceira hélice possível apresenta 4,4 resíduos por volta e 16 átomos entre as
ligações de hidrogênio. Essa hélice chamada de hélice Pi, apresenta notação 4,416. A
ligação de hidrogênio envolve uma carbonila do resíduo i com o nitrogênio do resíduo
i+5.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélices

Podemos pensar a hélice alfa como uma


mola em equilíbrio, onde não aplicam-se
forças. Se comprimirmos a mola que
representa a hélice alfa teremos um
encolhimento da mola, resultando na
hélice Pi (representado em vermelho). O
estiramento da hélice alfa resulta na
hélice 310, (representado em rosa). A
representação ao lado usa a
representação CPK para os átomos e
desenha uma hélice imaginária passando
pelo átomos da cadeia principal. Tal Hélice Pi
representação gráfica auxilia da abstração Hélice Alfa
do conceito de hélice e é comumente
usada em programas gráficos para
visualização de proteínas. Hélice 310

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélices

A tabela ao lado sintetiza as


principais características geométricas Estrutura φ(°) ψ(°) n d(Å) p(Å)

das hélices. Para uma hélice alfa Hélice α -57 -47 3,6 1,5 5,4

ideal temos que os aminoácidos terão Hélice 310 -49 -26 3,0 2,0 6,0

ângulos de torção fi e psi de -57o e Hélice π -57 -70 4,4 1,1 5,0

-47o, com 3,6 aminoácidos por volta


(n = 3,6), e um deslocamento ao
longo do eixo helicoidal de 1,5 Å e
passo de 5,4 Å, as características
geométricas das hélices 310 e pi estão
listadas também. n: número de resíduos de aminoácido por volta da hélice
d(Å) = delocamento ao longo do eixo da hélice
p(Å) = passo da hélice (delocamento total de uma volta da hélice)

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Hélices

A região indicada por α no gráfico ao


lado indica a posição preferencial de
hélices alfa no gráfico de
Ramachandran. Proteína com grande
concentração de resíduos de
aminoácido na região α indica grande
percentagem de hélice alfa na
estrutura. As regiões preferenciais 310

para hélices 310 e π também são α


π
indicadas no gráfico. ψ(o)

φ(o)
wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.
Hélices

A análise do gráfico de Ramachandran da estrutura cristalográfica da mioglobina de


cachalote (código de acesso no PDB: 1VXA) gerada pelo programa PARMODEL está
mostrada abaixo. O gráfico indica grande quantidade resíduos na região A.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Fita beta
N
As fitas beta apresentam uma cadeia
distendida, não havendo hélices em
sua topologia. Uma cadeia peptídica
distendida, como mostrada na figura
ao lado, não possibilita a existência
de ligações de hidrogênio, como
observadas nas hélices, contudo, tal
arranjo, libera o oxigênio da carbonila
e o nitrogênio da cadeia principal para
fazerem ligações de hidrogênio, com
partes distantes da cadeia peptídica,
ou mesmo, com outras cadeias
peptídicas. A condição necessária é a
proximidade do par doador-aceitador. C

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Folha beta paralela
N
N
A disposição próxima da fitas beta i j
possibilita ligações de hidrogênio que
fortalecem a estrutura tridimensional i+1
j+1
da proteína. O arranjo mostrado ao
lado é base para a montagem de uma i+2 j+2
folha beta, com várias fitas beta.
Quando as fitas que formam a folha i+3 j+3
apontam todas na mesma direção
temos um folha beta paralela. Se i+4 j+4
chamarmos a fica da esquerda de i e
a da direita de j, teremos um padrão i+5 j+5
da ligações de hidrogênio i/j+1,
j+1/i+2, i+2/j+3, j+3/i+4, i+4/j+5, e C C
assim sucessivamente.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Folha beta paralela
N
N
Se chamarmos a fica da esquerda de i j
i e a da direita de j, teremos um
padrão da ligações de hidrogênio i+1
j+1
i/j+1, j+1/i+2, i+2/j+3, j+3/i+4, i+4/j+5,
e assim sucessivamente. Este é o i+2 j+2
padrão característico das ligações de
hidrogênio presentes nas folhas beta. i+3 j+3

i+4 j+4

i+5 j+5

C C
Ligação de hidrogênio

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Folha beta paralela
N
N N
Colocando-se uma terceira fita beta i j
(fita k) temos a repetição do padrão k
de ligação de hidrogênio. i+1
j+1
Considerando-se a ligação da fita j k+1
com a fita k temos, j/k+1, k+1/j+2, i+2 j+2
j+2/k+3, k+3/j+4, j+4/k+5, e assim k+2
sucessivamente. i+3 j+3
k+3
i+4 j+4
k+4
i+5 j+5
k+5
C C C
Ligação de hidrogênio

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Folha beta paralela

Para simplificar a representação N


gráfica, normalmente usamos N
vetores, como os indicados ao lado, N
para representar a fitas que formam a
folha. A cabeça do vetor indica o C-
terminal e o início do vetor o N-
terminal.

C C C

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Folha beta anti-paralela

Outra possibilidade de formarmos


folhas beta e com fitas betas
alternadas, como mostrado na figura
ao lado. Na folha ao lado temos 3
fitas beta, onde a primeira segue com
o N-terminal na parte superior, a
segunda com o C-terminal na parte
superior, e assim vão alternando-se,
num padrão anti-paralelo de fitas.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Folha beta anti-paralela

Na figura ao lado temos 3 fitas,


chamadas i, j e k. As ligações de
i j k
hidrogênio entre as fitas beta i e j
seguem o padrão i/j, i+2/j+2, i+4/j+4,
e assim sucessivamente. Entre as i+1 j+1 k+1
fitas j e k, o padrão é j+1/k+1, j+3/k+3,
i+2 j+2 k+2
...

i+3 j+3 k+3

i+4 j+4 k+4

k+5
i+5

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Folha beta anti-paralela

Na representação com vetores fica


claro a alternância do sentido das
fitas beta.

C
N

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Laços

As estruturas das proteínas


apresentam uma riqueza de formas.
Para atingir um espectro tão amplo de
topologias as proteínas necessitam
de liberdade espacial, que não pode
ser obtida a partir da estrutura de
hélices e fitas sozinhas. A conexão
entre hélices e fitas não é possível
sem a presença de um elemento
estrutural que confira tal liberdade.
Esta estrutura recebe uma
denominação geral de laço (loop). Na estrutura acima os laços são mostrados em azul e
branco, conectando as hélice e fitas.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Laços

Numa proteína globular


aproximadamente 1/3 da estrutura
protéica é formada de laços, os 2/3
restantes são compostos pelas
hélices e fitas. Os laços estão
presentes no sítio ativo de enzimas.

Na estrutura acima os laços são mostrados em azul e


branco, conectando as hélice e fitas.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Laços

A enzima chiquimato quinase, Ácido chiquímico

mostrada ao lado, passa por


mudanças estruturais devido à
ligação do ácido chiquímico, indicado
com uma seta. O laço, devido à sua
flexibilidade, é levado de uma
conformação aberta para uma
conformação fechada, causada
provavelmente, pela ligação do ácido
chiquímico. A estrutura da chiquimato
quinase sem o ácido chiquímico
apresenta o laço na conformação Código de acesso PDB: 1WE2.
aberta, ou seja, afastada do sítio de
ligação do ácido chiquímico.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Lista de exercícios(Parte 2)
8) A poli-L-leucina em um solvente orgânico como o dioxano apresenta
estrutura secundária em hélice α, mas não a poli-L-isoleucina. Por que esses
aminoácidos similares e com os mesmos números e tipos de átomos têm
diferentes tendências de formação de hélice?
9) A tropomiosina, uma proteína muscular de 70 kD, é uma superfície
bifilamentar de hélices α. Qual é o comprimento dessa molécula? Considere
que a translação por aminoácido em uma hélice α é de 1,5 Å.
10) Sabendo-se que as hélices α, 310 e π possuem translações de 5,4; 6 e 5,0
Å por volta, respectivamente, determine: a) comprimento de uma hélice α de
18 resíduos de aminoácidos, b) comprimento de uma hélice 310 de 15 resíduos
de aminoácidos e c) comprimento de uma hélice π de 22 resíduos de
aminoácidos. Dados: as hélices α, 310 e π possuem 3,6; 3 e 4,4 resíduos de
aminoácido por volta, respectivamente.
11) Determine a ASA de uma proteína com 289 resíduos de aminoácido.
12) A proteína do exemplo anterior forma um homodímero, faça uma
estimativa da área escondida com a formação do dímero.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.


Referências

ALBERTS, B. et al. Biologia Molecular da Célula. 4a edição. Artmed editora,


Porto Alegre, 2004 (Capítulo 3).

LESK, A. M. Introduction to Protein Architecture. Oxford University Press, New


York, 2001.

wfdaj.sites.uol.com.br © 2006 Dr. Walter F. de Azevedo Jr.