Você está na página 1de 12

diciembre, 2013 Carvajal, M.

: Formación del cancerígeno AFB1 de los alimentos 109

ARTÍCULO DE REVISIÓN
D.R. © TIP Revista Especializada en Ciencias Químico-Biológicas, 16(2):109-120, 2013

TRANSFORMACIÓN DE LA AFLATOXINA B1 DE ALIMENTOS,


EN EL CANCERÍGENO HUMANO, ADUCTO AFB1-ADN

Magda Carvajal
Depto. de Botánica, Instituto de Biología, Universidad Nacional
Autónoma de México. Ciudad Universitaria, Deleg. Coyoacán,
C.P. 04510, México, D.F. E-mail: magdac@ib.unam.mx

RESUMEN
/DVDÁDWR[LQDV $) VRQPHWDEROLWRVVHFXQGDULRVWy[LFRVSULQFLSDOPHQWHGHORVKRQJRV$VSHUJLOOXVÁDYXV
y $SDUDVLWLFXVVRQSRWHQWHVPXWiJHQRV\FDQFHUtJHQRVGHDOLPHQWRV\ODH[SRVLFLyQGHOKRPEUHD
HOODVHVFRQWLQXR/DV$)VHOLJDQDO$'1$51\SURWHtQDVIRUPDQGRDGXFWRV$)%1$'1TXHVHDFXPXODQ
SRUDxRV\GDxDQGHVGHORVYLUXVKDVWDHOKRPEUH(VLPSRUWDQWHLGHQWLÀFDU\FXDQWLÀFDUHVWRVDGXFWRV
FRPR ELRPDUFDGRUHV GH ODUJR WLHPSR GH ULHVJR GH HQIHUPHGDG \D TXH RULJLQDQ PXWDFLRQHV \
FiQFHU\HVWiQYDOLGDGRVHQDQLPDOHV\KXPDQRV/DV$)VHDFWLYDQHQSUHVHQFLDGHOFLWRFURPR3450
FRPRXQDPROpFXODLQHVWDEOHHSy[LGR$)%1TXHVHOLJDDO17GHODJXDQLQD\VHWUDQVIRUPDHQORV
FDQFHUtJHQRVDFWLYRVRDGXFWRV$)%1*XD\ÀQDOPHQWHHQORVDGXFWRV$)%1)$3<\VRQXQDPHGLGD
REMHWLYDGHODH[SRVLFLyQKXPDQDDFDQFHUtJHQRVDPELHQWDOHV/RVDGXFWRVUHSUHVHQWDQODH[SRVLFLyQ
DEVRUFLyQGLVWULEXFLyQPHWDEROLVPRUHSDUDFLyQGHO$'1\FDPELRFHOXODU/RVWHPDVWUDWDGRVDTXt
VRQODIRUPDFLyQGHDGXFWRV$)%1$'1HVWXGLRVLQYLWURHLQYLYRH[SRVLFLyQDXQDGLHWDFRQ$)%1,
HIHFWRVGHVDUUROORGHFiQFHU\PXWDFLRQHVHQHOJHQVXSUHVRUSUXWDVGHH[SRVLFLyQYLWDPLQDV
WLSRVGHDGXFWR$)%1$'1PHWRGRORJtD\VXFRQWURO
Palabras Clave: Aductos de AFB1-ADN, biomarcadores, cáncer, control.

ABSTRACT
$ÁDWR[LQV $) DUHVHFRQGDU\WR[LFPHWDEROLWHVIRUPHGPDLQO\E\WKHPROGV$VSHUJLOOXVÁDYXVDQG
$SDUDVLWLFXVWKH\DUHSRWHQWPXWDJHQVDQGFDUFLQRJHQVRIIRRGVDQGKXPDQH[SRVXUHWRWKHPLV
FRQWLQXRXV$)ELQGWR'1$51$DQGSURWHLQVIRUPLQJ$)%1'1$DGGXFWVWKDWDFFXPXODWHIRU\HDUV
DQGGDPDJHIURPYLUXVHVWRKXPDQV7RLGHQWLI\DQGTXDQWLI\WKHFKHPLFDOUHDFWLRQVDQGPROHFXODU
ELRORJ\RIWKHVHDGGXFWVLVRISULPDU\LPSRUWDQFHEHFDXVHWKH\DUHORQJWHUPELRPDUNHUVYDOLGDWHGDV
DVRXUFHRIPXWDJHQLFLW\DQGULVNRIFDQFHULQDQLPDOVDQGKXPDQV7KHF\WRFKURPH3450DFWLYDWHV$)
DVDQXQVWDEOHPROHFXOHFDOOHG$)%1HSR[LGHWKDWELQGVPDLQO\WRWKH17RIWKHJXDQLQHQXFOHRWLGH
IRUPLQJDGGXFWVWKDWDUHWKHDFWLYHFDUFLQRJHQVWKHPVHOYHVDQGDVELRPDUNHUVDQREMHFWLYHPHDVXUH
RI KXPDQ H[SRVXUH WR HQYLURQPHQWDO FDUFLQRJHQV $GGXFWV UHSUHVHQW DQ LQWHJUDWLRQ RI H[SRVXUH
DEVRUSWLRQGLVWULEXWLRQPHWDEROLVP'1$UHSDLUDQGFHOOWXUQRYHU7KHGLIIHUHQWLVVXHVSUHVHQWHGKHUH
DUH WKH IRUPDWLRQ RI $)%1'1$ DGGXFWV LQ YLWUR DQG LQ YLYR VWXGLHV GLHWDU\ $)%1 H[SRVXUH HIIHFWV
GHYHORSPHQWRIKXPDQFDQFHUDQGPXWDWLRQVLQWKHSWXPRUVXSSUHVVRUJHQHWKHHIIHFWRIGLHWURXWHV
RIH[SRVXUHYLWDPLQVNLQGVRI$)%1'1$DGGXFWVPHWKRGRORJ\XVHGIRUWKHLUVWXG\DQGWKHLUFRQWURO
Key Words:$ÀDWR[LQ'1$DGGXFWVELRPDUNHUVFDQFHUFRQWURO

Nota: Artículo recibido el 29 de abril de 2013 y aceptado el


09 de julio de 2013.
110 TIP Rev.Esp.Cienc.Quím.Biol. Vol. 16, No. 2

INTRODUCCIÓN

L
D SDODEUD DÀDWR[LQD YLHQH GH D  Aspergillus, ESTRUCTURA QUÍMICA Y TIPOS DE AF
ÀD ÀDYXV\WR[LQD YHQHQR/DVDÀDWR[LQDV $)  /DHVWUXFWXUDEiVLFDGHODV$)[6] es un anillo dihidrodifurano o
son metabolitos secundarios que corresponden tetrahidrodifurano unido a una cumarina con un anilllo de cinco
TXtPLFDPHQWHDELVGLKLGURIXUDQRFXPDULQDV/DV RVHLViWRPRVGHFDUERQR )LJXUD /DVGLIXUDQRFXPDULQDV
$)VHGHVFXEULHURQHQ*UDQ%UHWDxDHQGHVSXpVGHODPXHUWH ciclopentanonas de AF de las series B, M, P y Q son las AFB1,
de 100,000 pavos alimentados con cacahuate contaminado con AFB2, AFB2a, AFM1, AFM2, AFM2a, AFQ1, AFP1\$)/
el moho $VSHUJLOOXVÀDYXV y AF provenientes de Brasil.
El segundo subgrupo corresponde a las lactonas difuranocumarinas
HONGOS PRODUCTORES DE AFLATOXINAS Y CONDICIONES de la serie G como son AFG1, AFG2, AFG2a. Hay alrededor de 20
DE PRODUCCIÓN diferentes tipos de AF, las más importantes por su alto potencial
/RVSULQFLSDOHVKRQJRVRPRKRVTXHSURGXFHQDODV$) cancerígeno, mutágeno y teratógeno son: B1 $)%1 %2 $)%2 
son $VSHUJLOOXVIODYXV/LQN$VSHUJLOOXVSDUDVLWLFXV Speare G1 $)*1 *2 $)*2 01 $)01 02 $)02 31 $)31 41
y Aspergillus nomius Kurtzman con propiedades bien $)41 \' $)' HVWH~OWLPRGHULYDGRGHOWUDWDPLHQWRGHOD
conocidas [1,2]/RVFHUHDOHVVHLQYDGHQFRQKRQJRVHQHOFDPSR AFB1 con amonio. Otro metabolito muy tóxico de la AFB1 es
desde la semilla hasta la post-cosecha, transporte y almacén. HODÀDWR[LFRO $)/ [7]. Sólo las AFB1, AFB2, AFG1 y AFG2 se
/RVKRQJRVUHGXFHQODYLDELOLGDGFXDOLGDGHVQXWULFLRQDOHV\ sintetizan naturalmente de la AFB1ODVRWUDV$) 01, M2, P1,
sanitarias de los granos y semillas. Q1, G2a, B2a\$)/ VRQKLGUR[LODGRVSURGXFWRVGHOPHWDEROLVPR
DQLPDORPLFURELDQR/D$)%1 es la más peligrosa y tóxica de
/RV PRKRV DIODWR[LFyJHQRV>@ FUHFHQ GH  D  ž& FRQ todas[7].
WHPSHUDWXUDVySWLPDVGHDž&ODSURGXFFLyQGH$)VH
LQLFLDGHDž&FHVDQGRDPHQRVGHž&RDPiVGHž& PROPIEDADES FISICOQUÍMICAS DE LAS AF
ODSURGXFFLyQySWLPDGH$)YDGHDž&[4]/DSURGXFFLyQ /DV$) VRQ FULVWDOHV VyOLGRV GH FRORU TXH YD GHO EODQFR DO
GH$)VHIDYRUHFHVHJ~QHOVXVWUDWRSRUIDFWRUHVELRTXtPLFRV amarillo, sin olor, sin sabor e incoloros, son insolubles en
biológicos y ambientales a una humedad de 10-20% y a una DJXD\VROXEOHVHQVROYHQWHVRUJiQLFRV PHWDQROFORURIRUPR
KXPHGDGUHODWLYDGHHTXLYDOHQWHDXQFRQWHQLGRGH DFHWRQDDFHWRQLWULOR\GLPHWLOVXOIy[LGR FXDQGRODV$)HVWiQ
KXPHGDGGHOJUDQRGHD/DV$)VHSXHGHQSURGXFLU en cloroformo o benceno son estables por años en refrigeración
en condiciones de campo o almacén al quinto día y disminuyen \ RVFXULGDG /DV $) HQ VROXFLyQ VRQ VHQVLEOHV D OD OX] VH
DORFWDYR/DSUHVHQFLDGHKRQJRVDÀDWR[LFyJHQRVQRVLJQL¿FD descomponen en el aire, oxígeno, soluciones alcalinas o de
la existencia de AF[4] /DV HVSHFLHV SURGXFWRUDV GH $) GH iFLGRVVXDYHV\VHQRPEUDQVHJ~QHOFRORUGHODÀXRUHVFHQFLD
Aspergillus requieren estar en cultivos puros, pues $FKHYDOLHUL, TXHHPDQDFRQOX]89GHRQGDODUJDHQFRORUD]XO% EOXH 
$FDQGLGXV y A. nigerFRPSLWHQHLQWHU¿HUHQFRQHOORV\VH FRQ DQLOOR GH FLFORSHQWDQR R YHUGH *  JUHHQ  FRQ DQLOOR
han usado como control biológico>@. de lactona, lo que permite detectarlas en trazas de 0.5 ng
R PHQRV HQ FURPDWRJUDItD GH FDSD ¿QD /DV$)%2 y AFG2
OCURRENCIA tienen difuranos saturados, y AFB2a y AFG2a tienen una unidad
/RVKRQJRVVRQFDSDFHVGHFRORQL]DU\SURGXFLU$)HQGLIHUHQWHV GLIXUDQRKLGUDWDGD/RVVXEtQGLFHVyGHODV$)WLSR%*
medios como son los alimentos para animales y para humanos. M o P indican la movilidad que tienen en la cromatografía de
/DV$)VRQWR[LQDVGHDOLPHQWRV\ODH[SRVLFLyQGHOKRPEUHD FDSD¿QDVHJ~QVXSHVRPROHFXODUGH $)31 D $)*2
HOODVHVFRQWLQXRHVWiQHQFHUHDOHV PDt]DUUR]WULJRVRUJR y AFM2  TXH GD GLIHUHQWHV FRH¿FLHQWHV GH UHWHQFLyQ 5) 
cebada, avena, milo, centeno y sus productos derivados como TXHODVLGHQWL¿FDQ/RVPi[LPRVSLFRVGHDEVRUEDQFLDGHOX]
WRUWLOODV FHUHDOHV SDUD HO GHVD\XQR KDULQDV SDVWDV HWF  HQ 89VRQGHQPDQPFRQXQDHPLVLyQDQP/D
VHPLOODVROHDJLQRVDV FDFDKXDWHQXHFHVDYHOODQDVSLVWDFKHV 7DEOD,PXHVWUDODVSURSLHGDGHV¿VLFRTXtPLFDVGHODV$)\VXV
SLxRQHVVHPLOODVGHJLUDVROGHDOJRGyQDMRQMROt\DOPHQGUDV  hidroxilados naturales[4].
HQHVSHFLDV FKLOHVFRQGLPHQWRVSDSULNDFRPLQRPRVWD]D
HWF [4]KLJRV\IUXWDVVHFDV/DV$)VRQODVPLFRWR[LQDVPiV /DV$)HQWUDQDORUJDQLVPRFRQODFRPLGDDWUDYpVGHODSLHOR
Wy[LFDV\GDxDQDWRGRVORVDQLPDOHV JDQDGRERYLQRDYLDU VRQLQKDODGDVUHVLVWHQDOWDVWHPSHUDWXUDVGHž& $)*2 D
equino, porcino, peces, ratas y mascotas como perros y gatos, ž& $)31 VHGHVFRPSRQHQGHž&Dž&VHJ~QHO
HWF &RQWDPLQDQORVSURGXFWRVGHULYDGRVFRPRKXHYRVOiFWHRV tiempo de calentamiento, la humedad del alimento y el pH. Así,
OHFKH\RJXUWTXHVRV\FUHPD WDPELpQGHULYDGRVFiUQLFRV las AF no se rompen con la ultrapasteurización, cocción, freido
como salami, jamón, pechugas de pollo, pathés, embutidos y o hervido, fermentación, ni nixtamalización, pero se pueden
cervezas, en alimentos balanceados para animales y humanos[4,5] destruir si se calientan en autoclave con amonio o hipoclorito de
\VyORKD\WUD]DVHQYLQRV/DFRQWDPLQDFLyQSRU$)HQDOLPHQWRV VRGLR$FW~DQHQWUD]DVGHPLOORQpVLPDVGHJUDPR PLFURJUDPRV
se produce en almacenes, especialmente si la cosecha está SRUNLORJUDPR —JNJ-1 RPHQRV[4].
K~PHGDRHQODVFDPDVGHODVDYHV
diciembre, 2013 Carvajal, M.: Formación del cancerígeno AFB1 de los alimentos 111

'XUDQWHODQL[WDPDOL]DFLyQ S+GHD HODQLOORGHODFWRQD PÉRDIDAS ECONÓMICAS POR CONTAMINACIÓN CON AF


GHOD$)VHDEUH\SLHUGHVXÀXRUHVFHQFLD\VHSXHGHSHQVDUTXH El impacto de la contaminación por AF en cultivos se estima en
HVWiQDXVHQWHVSHURHQFRQWDFWRFRQVROXFLRQHViFLGDV S+GH PLOORQHVGH86GyODUHV/D)$2GHFODUyTXHHOGHWRGRV
D GHOMXJRJiVWULFR\UHJUHVDQGRGHVSXpVDXQS+QHXWUR los cultivos tienen AF, principalmente cereales, oleaginosas
ODV$)VHUHDFWLYDQ\ÀXRUHVFHQRWUDYH]>@. \HVSHFLDV8QDFRQWDPLQDFLyQGHDPJNJ-1 de AF en

)LJXUD(VWUXFWXUDVTXtPLFDVGHODVSULQFLSDOHVDÁDWR[LQDV[7].

$ÀDWR[LQD Fórmula Peso Punto de Absorción ultravioleta (H) Emisión de


molecular molecular fusión (ºC) 265 nm 360-362 nm ÀXRUHVFHQFLD QP

B1 C17H12O6   12,400  425


B2 C17H17O6   12,100 24,000 425
G1 C17H12O7  244-246  17,700 450
G2 C17H14O7    17,100 450
M1 C17H12O   14,150  QP 425
M2 C17H14O7    QP  QP ------
P1 C16H10O6  !  QP  QP ------
Q1 C17H12O7  --------  QP  QP ------
$ÀDWR[LFRO C17H14O6    QP  QP 425

7DEOD,3URSLHGDGHVÀVLFRTXtPLFDVGHODVDÁDWR[LQDV[4].
112 TIP Rev.Esp.Cienc.Quím.Biol. Vol. 16, No. 2

alimentos balanceados para animales bajan su producción, 2GLPHWLODYHUDQWLQD DYHULWULQD \ DFHWDWR YHUVLFRQDO  $)
causan diarrea, vómitos, abortos en bovinos y las vacunas no y parasiticol>@.
sirven. En los humanos los daños por AF causan gastos por
días no laborados, hospitalizaciones, medicinas, abortos, etc.[7] /DV$)VHSURGXFHQSRUKRQJRV¿ODPHQWRVRVFXDQGRODUHGXFFLyQ
de grupos cetónicos se interrumpe y se favorecen las reacciones
BIOSÍNTESIS DE LAS AFLATOXINAS de condensación en la ruta metabólica de la producción de ácidos
/RVSDWURQHVGHIRUPDFLyQGHODV$)\GHOtSLGRVVRQVLPLODUHV grasos. Este proceso trae la síntesis de compuestos policetónicos
YLHQHQ GH XQ DFHWDWR TXH HV HO SUHFXUVRU FRP~Q &XDQGR DÀDWR[LQDV >@ /D UXWD ELRTXtPLFD DFHSWDGD SDUD OD VtQWHVLV
la glucosa C14 se incorpora en posición uno en condiciones GH$)FRPSUHQGHDOUHGHGRUGHUHDFFLRQHVHQ]LPiWLFDV\
anaeróbicas, la vía catabólica de la glucosa Emblem Meyerhoff la mayoría de los genes responsables se han caracterizado y
VH URPSH \ IDYRUHFH OD SURGXFFLyQ GH $) /RV SUHFXUVRUHV DLVODGR )LJXUD [10].
metabólicos de la biosíntesis de AFB1 tienen una estructura
básica C20 poli-E-quétido y pertenecen a diferentes grupos como: EFECTOS TÓXICOS DE LAS AFLATOXINAS EN LA SALUD
[DQWRQDV HVWHULJPDWRFLVWLQD 2PHWLOHVWHULJPDWRFLVWLQD /DV$)VHOLJDQRDGKLHUHQDiFLGRVQXFOHLFRV$'1\$51
DVSHUWR[LQD SROLKLGUR[LDQWUDTXLQRQDV DYHUX¿QD2GLPHWLO y a proteínas, y afectan a todos los seres vivos con ácidos
QLGXUX¿QD iFLGRV VRORUtQLFR \ QRUVRORUtQLFR DYHUDQWLQD nucleicos, desde virus a vegetales y al hombre[11]. El ADN

Figura 2. Ruta de biotransformación de AFB1[10].


diciembre, 2013 Carvajal, M.: Formación del cancerígeno AFB1 de los alimentos 113

afectado puede almacenar las moléculas de AFB1 por años, y Han sido reportados diferentes tumores cancerosos por la
al tratar de regenerarse corta la porción de nucleótidos donde exposición a AF: HCC, de colon, recto, estómago, glándulas
se pegó la AFB1 y la elimina por orina, leche o heces fecales. lagrimales, lengua y esófago. Hay una relación directa entre
/DV$)VRQFRPSXHVWRVSHOLJURVRV\PX\Wy[LFRVVRQORVPiV la ingestión de AF y estudios de HCC en Tailandia, Kenia,
potentes cancerígenos biológicos para animales y el hombre[12], Mozambique y Suazilandia, más agudos en hombres que en
son mutágenos y teratógenos, de acuerdo al siguiente orden: PXMHUHV/DSUHVHQFLDGHODLQIHFFLyQSRU9+%HVXQFRIDFWRU
AFB1 > AFG1 > AFB2> AFG2/D$)%1 es la más tóxica con importante en la etiología del HCC. El hígado humano parece
/'50 bajo, junto con la AFM1\HODÀDWR[LFRO $)/ \OD$)%2 VHUPiVUHVLVWHQWHDGHVDUUROODUFiQFHUSRU$)TXHHOGHUDWD/D
es 10 veces menos mutágena que la AFB1[7]. Cuando se ingieren IRUPDFLyQUHYHUVLEOHGHO$)/FRQVWLWX\HXQDUHVHUYDPHWDEyOLFD
altas concentraciones de AF en los alimentos, se producen de AF relacionada con una alta susceptibilidad al HCC[16]/DV$)
HIHFWRVDJXGRVDFRUWRSOD]R YyPLWRVGLDUUHDVKHPRUUDJLDV en células embrionarias del pulmón humano inhiben la síntesis
QHFURVLVDERUWRVGHIHFWRVHQFRDJXODFLyQ\PXHUWH HQEDMDV de ADN en la mitosis causando vacuolas y células gigantes.
concentraciones por largo tiempo sus efectos son crónicos /DVSDUWtFXODVGHSROYR\WDPRGHJUDQRVGHPDt]SXHGHQWHQHU
WHUDWRJpQHVLV LQPXQRGHSUHVLyQ PXWDJpQHVLV KHSDWLWLV AF y al inhalarlas causar cáncer de pulmón[22].
FLUURVLVDSODVLDGHOWLPR\FiQFHUHVGLYHUVRV \VHKDQDVRFLDGR
FRQHO6tQGURPHGH5H\H>@, con encefalitis y degeneración grasa $~QVHGHVFRQRFHQWRGDVODVIXHQWHVGHH[SRVLFLyQGHOKRPEUH
de las vísceras de los niños, amarillamiento, inmunosupresión, DODV$)\HOKtJDGRQRHVHO~QLFRyUJDQREODQFRDXQTXHVt
IDOODUHQDOQHXURWy[LFDRJiVWULFDNZDVKLRUNRU\PDUDVPR[14]. HO PiV DIHFWDGR /D GHWHUPLQDFLyQ SUHFLVD GH ORV GDxRV SRU
/DV $) DIHFWDQ OD DEVRUFLyQ \ HO PHWDEROLVPR GH OtSLGRV AF requiere de la medición de biomarcadores de largo tiempo
carbohidratos, proteínas, vitaminas y minerales, y su toxicidad de consumo, que predigan el estado de salud e inmunología
afecta el transporte electrónico de la cadena respiratoria y las humana>@. Muy pocos biomarcadores de largo plazo se han
PHPEUDQDVFHOXODUHV\VXEFHOXODUHV/DV$)LQJHULGDVFRQORV YDOLGDGRHQDQLPDOHVH[SHULPHQWDOHV\HQHOKRPEUH/DV$)
alimentos se absorben por la mucosa intestinal, pasando de la VRQ FDQFHUtJHQRV TXtPLFRV H LQLFLDGRUHV GH FiQFHU \ DFW~DQ
sangre al hígado, riñón, conductos biliares y sistema nervioso. sobre el ADN por un mecanismo genotóxico que requiere una
/RVFDPELRVFLWROyJLFRVFDXVDGRVSRUODV$)HQODVFpOXODV FRQYHUVLyQPHWDEyOLFDKDFLDIRUPDVUHDFWLYDV HOHFWURItOLFDV 
vegetales y animales son similares: nucléolos en forma de para transformarse en aductos mutágenos, acumularse y producir
anillo con capas diferenciadas, numerosos cuerpos lipídicos, sus efectos[24]. El daño al ADN por oxidación o por radiación
mitocondrias con cisternas alargadas, retículo endoplásmico afecta al metabolismo celular[25]. El monitoreo de aductos en
GHVJUDQXODGRQ~FOHRVDODUJDGRVHLUUHJXODUHV\FURPDWLQDFRQ tejido humano informa sobre la exposición a AF, su relación
muchos gránulos[11]/D$)%1DFW~DFRPRXQDQWLPHWDEROLWR con el VHB, exposición a una dieta con AFB1 y al HCC[26].
TXHVHOLJDDO$'1HLQWHU¿HUHFRQHO$51\ODVtQWHVLVGH
proteínas[4,15]. /D$)%1 causa aberraciones cromosómicas, ruptura del ADN
en células vegetales y animales y mutaciones genómicas en
En China, África y Asia hay evidencias epidemiológicas que prueba de Ames[11,27].
relacionan la ingestión de AFB1 con un aumento de cáncer
KHSDWRFHOXODUSULPDULR +&& [16]/RVSDtVHVGRQGHVHFRQVXPHQ /DDFWLYDFLyQPHWDEyOLFDGH$)%1 inicia la formación de aductos
alimentos enmohecidos tienen mayor incidencia de HCC. En TXHRULJLQDQDOFiQFHU/D$)%1 se liga a proteínas como la
India[17]WXYLHURQPDtFHVFRQDPJGH$)SRUNJTXH DOE~PLQDRYDOE~PLQD$'1\$51IRUPDQGRFRQMXJDGRVR
FDXVDURQGDxRKHSiWLFR(QVHSUHVHQWDURQFDVRVGH aductos que se pueden detectar en sangre, orina y tejidos del
niños que comieron maíz con AF y todos desarrollaron cirrosis organismo que las ingirió[24]/RVDGXFWRVGHORVWHMLGRVVRQOD
hepática. En Tailandia>@ las AF son endémicas, y se han aislado PHGLGDGHODH[SRVLFLyQFUyQLFDDODV$)\UHÀHMDQHOERPEDUGHR
AFB1, AFG1 y AFB2 de hígado humano y sus metabolitos AFP1 y TXHHO$'1VXIUHHQDxRVGHH[SRVLFLyQ/DSUHVHQFLDGHXQ
AFQ1VHFXDQWL¿FDURQ\UHODFLRQDURQFRQFiQFHUGHFRORQ7RGRV aducto en 1,000,000 de nucleótidos es medida de malignidad
los compuestos hidroxilados de AF se han asociado al cáncer en tumores en rata alimentada con AFB1[21]. Tan pronto como
humano. En Guangxi, China>@, hubo HCC por la ingestión una persona envejece, su ADN acumula más aductos capaces
diaria de 1 a 2 PJ$)NJGHSHVRFRUSRUDO6HFRUUHODFLRQyOD de producir una mutación o iniciar un cáncer>@.
susceptibilidad a AF con infecciones de SIDA y con presencia
GHYLUXVGHODKHSDWLWLV% 9+% (QPHUFDGRVGH.HQLD ACTIVACIÓN DEL PROTO-ONCOGÉN
DSDUHFLHURQ  PDtFHV FRQ$) GH  D  —J NJ-1  TXH /RVDGXFWRV$)%1-FAPY se acumulan y con el tiempo, pueden
FDXVDURQKHSDWRWR[LFLGDGDSHUVRQDV\PXHUWHV[20]/D producir mutaciones que inician el proceso canceroso pues son
ingestión diaria en el sureste y noroeste de Estados Unidos es activadores del proto-oncogén H-UDV>@/RVSURWRRQFRJHQHV
GH\—J$)SRUNJGLDULRV[21]. celulares de la familia UDVFRGL¿FDQODSURWHtQDSTXHWLHQH
XQDD¿QLGDGSRUHOJXDQLGtQWULIRVIDWR *73 TXHHVLPSRUWDQWH
en la traducción de proteínas. Estas proteínas p21 se activan
114 TIP Rev.Esp.Cienc.Quím.Biol. Vol. 16, No. 2

al asociarse a GTP y se inactivan al hidrolizarse en presencia la apoptosis, que son mecanismos de defensa contra el estrés
GHODVHQ]LPDV*73DVDV *$3 >@/RVSURWRJHQHVUDV sufren genotóxico>@.
mutaciones puntuales y los oncogenes resultantes están activos y
producen proteínas que disminuyen la actividad de las enzimas /RVFDPELRVHQHOFRGyQUHSHUFXWHQHQODSURWHtQDS\
GAP, con menos capacidad para inducir hidrólisis de la GTP se induce un crecimiento agresivo en el hepatocito mutante del
en el complejo activo. Es probable que la continua transmisión hígado crónicamente infectado con el VHB, que incrementan
de las formas mutadas contribuya a la transformación maligna, las mutaciones en tumores avanzados>@ /D LPSRUWDQFLD GH
así como el papel de los genes UDV en la hepatocarcinogénesis ODVPXWDFLRQHVHQHOJHQSFRGyQSRUODWR[LFLGDGGHODV
por AFB1>@. El desarrollo de zonas transformadas en el hígado AF es controversial>@, ya que otros cancerígenos diferentes
y las células transfectadas originan células tumorales cuando de la AFB1 produjeron mutaciones en este codón>@. Cuando
se inyectan en nódulos hepáticos de ratones sin timo. Hay se compararon tumores de pacientes que vivían en áreas con
oncogenes en muestras de ADN que vienen de HCC, hay riesgos alto y bajo de daño por AF, la frecuencia de mutaciones
K-UDV activados en algunos tumores>@/RVWXPRUHVFRQ.UDV HQHOFRGyQJHQSQRVHFRUUHODFLRQDURQFRQODIUHFXHQFLD
activados tienen sustituciones G-C a T-A o G-C a A-T en el de aductos AFB1-ADN>@.
codón 12 que coinciden con las producidas cuando la guanina
es blanco de AF>@. TIPOS DE ADUCTOS DE AFB1-ADN
([RHSy[LGR$)%1
De los más de 100 genes relacionados con el cáncer, la mutación /DV$)%1 y AFB2 no son mutagénicas en sí mismas, requiren
HQHOJHQSHVODDOWHUDFLyQJHQpWLFDPiVIUHFXHQWHDVRFLDGD GHELRDFWLYDFLyQSDUDWUDQVIRUPDUVHHQH[RHSy[LGR$)%1
a neoplasias>@ /DV IXQFLRQHV GH OD SURWHtQD GHO JHQ S RH[RHSy[LGR$)%2>@. Estos epóxidos no se han aislado
incluyen: control del ciclo celular, síntesis y reparación del ADN, debido a su alta reactividad e inestabilidad para ligarse al ADN
diferenciación celular, plasticidad genómica y muerte celular y ser cancerígenos>@ /D $)%1GLFORUR $)%1-Cl2  VH
SURJUDPDGD/RVHIHFWRVVHDVRFLDQFRQODPRGXODFLyQGHOD VLQWHWL]yFRPRXQDQiORJRHOHFWUyQLFRGHOHSy[LGR$)%1[25].
WUDQVFULSFLyQPHGLGDSRUHOJHQSRWURVJHQHVVXSUHVRUHV\ /DWR[LFLGDG\SRWHQFLDFDQFHUtJHQDGHODV$)%1 y AFB2 es por
a proto-oncogenes relacionados con el control del crecimiento VXELRDFWLYDFLyQ )LJXUD 
celular>@/DDOWDIUHFXHQFLDGHODPXWDFLyQHVSHFt¿FD*D
7HQHOFRGyQGHOJHQSHQ+&&KXPDQRVGHFKLQRV\ 2. Aducto AFB1*XD
africanos, por la ingestión de altas concentraciones de AF, es /D$)%1VHDFWLYDHQHOKtJDGRFRPRHSy[LGR$)%1 que
de gran interés pues otros cánceres humanos tienen mutaciones VHOLJDDO$'1$51RSURWHtQDVSULPHURVHOLJDDO17 de la
HQHOJHQS>@. guanina del ADN, sitio de unión y mutación preferente, para
IRUPDU DO DGXFWR GLKLGUR 17JXDQLO KLGUR[L$)%1
/DLQIHFFLyQFUyQLFDSRUKHSDWLWLV%OLJDGDDODSURWHtQDDXPHQWD abreviado como AFB1*XDTXHUHSUHVHQWDDOGHOWRWDOGH
la mutación del hepatocito por AFB1 o por su epóxido, quizá aductos formados en roedores y en el hígado humano>@,
por alteración del equilibrio entre la reparación del ADN y ya sea a partir de la AFB1 o la AFB2>@, con ayuda de la enzima

Figura 3. Activación de la AFB1SDUDIRUPDUHODGXFWR$)%1HSy[LGR(VWUXFWXUDSDUFLDOGHORVGRVDGXFWRVPiVDEXQGDQWHV[15].


diciembre, 2013 Carvajal, M.: Formación del cancerígeno AFB1 de los alimentos 115

CYP1A2>@, eliminado en un 70% por la orina o leche, o puede 4. Aductos de AFB1SURWHtQDV


quedarse en tejidos tumorales, indicando exposición reciente a. Aductos de hemoglobina
y la medida de reparación del ADN>@, además se comporta /RVDGXFWRVGHSURWHtQDHQODVDQJUHVHXVDQSDUDFDOFXODUOD
como biomarcador de riesgo de enfermedad[10] /D GRVLV GH H[SRVLFLyQDFDQFHUtJHQRVHOHFWURItOLFRV/DKHPRJORELQDHV
AF excretada en orina no es indicativa de la cantidad que se abundante y el tiempo de vida de los eritrocitos humanos es de
queda adentro, los aductos de orina dan datos complementarios GtDV/RVDGXFWRVGHKHPRJORELQDVRQHVWDEOHV\VHSXHGHQ
DORVDGXFWRVGHWHMLGRV/DIRUPDFLyQGHODGXFWR$)%1-Gua detectar varias semanas después de la exposición, facilitando un
GHSHQGHGHODVEDVHVTXHÀDQTXHDQODJXDQLQDKD\XQDEDMD monitoreo retrospectivo. En exposiciones crónicas, los aductos
H¿FDFLD GH OD XQLyQ FXDQGR OD JXDQLQD HVWi ÀDQTXHDGD SRU de aminoácidos se acumulan en la hemoglobina y se pueden
VHFXHQFLDV ULFDV HQ DGHQLQD $ WLPLQD 7  PLHQWUDV TXH medir en los eritrocitos>@.
FXDQGR HVWi ÀDQTXHDGD SRU RWUD JXDQLQD OD H¿FDFLD GH OD
ligadura aumenta>@. El aducto AFB1-Gua es un isómero E$GXFWRVGHDOE~PLQD
electrofílico muy inestable y puede zafarse del ADN dando /DDOE~PLQDHVXQDSURWHtQDDEXQGDQWHHQODVDQJUHUHFRQRFLGD
un sitio apurínico. No se han detectado aductos estables con la como medidor de dosis ingerida y que se sintetiza en los
adenina, citosina o timina>@/DXQLyQGHOHSy[LGR$)%>@ hepatocitos, sitio donde muchos cancerígenos se metabolizan
con ADN es por una intercalación covalente entre la doble DVXVIRUPDVUHDFWLYDV\FRQXQDYLGDGHGtDV/D$)%1 se
cadena de ADN y el AFB1H[RHSy[LGR[40]. OLJDPiVDODDOE~PLQDTXHDODKHPRJORELQD/DDOE~PLQDHVXQ
FRPSRQHQWHGHOÀXLGRLQWHUVWLFLDOTXHURGHDDODVFpOXODV\TXH
Otros aductos N7 menores pueden formarse de la oxidación puede reaccionar con los metabolitos electrofílicos de cualquier
enzimática de AFP1, AFM1 y de otros metabolitos insaturados WHMLGR/RVDGXFWRVIRUPDGRVHQHOVXHURGHODDOE~PLQDWLHQHQ
de AFB1HQODSRVLFLyQ[41]. No todas las AFs con doble enlace una dosimetría similar a la hemoglobina, indican exposición
 IRUPDQ DGXFWRV GLUHFWDPHQWH (O$)/ HV XQ PHWDEROLWR HLGHQWL¿FDQULHVJRV(OVXHURGHODDOE~PLQDHVXQPHGLGRU
DOWDPHQWHFDQFHUtJHQRTXHDFW~DFRPRXQUHVHUYRULRTXHH[WLHQGH más efectivo que la hemoglobina respecto a cancerígenos de
la cancerogenicidad de AFB1 en algunas especies, especialmente alimentos.
en trucha[42]$OPHQRVHOGHO$)/VHUHFRQYLHUWHD$)%1
antes de formar el aducto>@0iVGHOGHORVDGXFWRVGH /RVDGXFWRVXQLGRVDODSURWHtQDQRVHUHSDUDQ\SXHGHQGDU
$)/$'1SURGXFLGRVLQYLYR son idénticos a los producidos lugar a moléculas inestables que pueden desestabilizarla[51].
por AFB1[44].
c. Aductos de AFB1- lisina
3. Aducto AFB1)$3< /RVDGXFWRVGHOD$)%1DOE~PLQDLQGLFDQODH[SRVLFLyQGH$)
El aducto AFB1-Gua es muy inestable y puede zafarse del en sangre, donde la AFB1-lisina es el producto de la digestión de
ADN dando un sitio apurínico o bien el anillo imidazol se la AFB1DOE~PLQDXVDGDHQHVWXGLRVDQLPDOHV\KXPDQRV(VWH
abre, se hidroliza y forma al aducto ligado a las pirimidinas aducto muestra la exposición a AF y las relaciones del aducto
GLKLGUR 15-formil-2,5,6-triamino-4-oxo-N5SLULPLGLO  interno en humanos[51]. El promedio diario de exposición a las
KLGUR[LODÀDWR[LQD%1, abreviado como AFB1-FAPY, que se $)HQ*UDQ%UHWDxDHVGH—JGH$)%1 y el promedio interno
DFXPXODQSRUDxRV\FDXVDQPXWDFLRQHVHQHOJHQS\VHDVRFLDQ HQ$'1GHKtJDGRHVGHDGXFWRV7 nucleótidos[51]. Para
IUHFXHQWHPHQWHDQHRSODVLDVVHJ~QORVIDFWRUHVKHUHGLWDULRVGHO facilitar el estudio de aductos de AFB1-lisina, se desarrollaron
organismo[24,45]. El aducto AFB1-FAPY se libera del ADN con anticuerpos monoclonales de ratón que detectarán al conjugado
ácido fórmico>@. Después de una exposición aguda o crónica, GH DOE~PLQD GH VXHUR ERYLQR GH$)%1-lisina sintética[52]. El
los aductos AFB1)$3<TXHGDQ¿MDGRVDO$'1GHORVWHMLGRV LVRWLSRGHXQRGHHVWRVDQWLFXHUSRV,,$%VHKDFODVL¿FDGR
de especies animales susceptibles y tienen cromatogramas como inmunoglobulina G1 O ODPEGD  /DV D¿QLGDGHV GH
complejos de los aductos[41,46,47]. ,,$%SRUOD$)%1 y sus aductos asociados y metabolitos son:
AFB1-lisina > AFB1-FAPY > AFB1 > AFM1 > AFQ1. Un método
/D DFXPXODFLyQ GHO DGXFWR $)%1-FAPY persiste mucho DQDOtWLFREDVDGRHQUDGLRLQPXQRHQVD\RFRPSHWLWLYRFRQ,,$%
más tiempo en el ADN, y es más importante en los estudios y [H]-AFB1-lisina se validó con un límite de detección de 10
oncológicos aunque es menos frecuente. El mayor nivel de fmol de aducto de AFB1-lisina[52]. Se correlacionaron los niveles
DGXFWRVXQLGRVDO$'1IXHDODVKGHDSOLFDU—JNJ-1 de GHDGXFWRVGHODDOE~PLQDGHVXHURFRQORVQLYHOHVGHDGXFWR
AFB1DXQDVUDWDV$ODVKHOQLYHOGHFUHFLyOLJHUDPHQWHVLQ de AFB1-ADN en hígado de diferentes especies de roedores
embargo los aductos AFB1-FAPY ahora representaron el 50% UDWDVHQVLEOHDKiPVWHU\UDWyQUHVLVWHQWHV SDUDYHUVLSXHGH
de las AF hidrolizadas[41,47]. El metabolismo y formación de servir como biomarcador de cualquier especie y conocer las
aductos AF-ADN en trucha arcoiris y en salmón han servido diferentes susceptibilidades a la inducción de tumores por AFB1
para establecer una dosimetría molecular para comparar en cualquier especie y en el hombre>@. Se puede usar este aducto
diferentes susceptibilidades y predecir tumores de cáncer como biomarcador en estudios de exposición humana a AF y
entre especies>@. da además el riesgo de alteraciones genéticas consecuentes[54].
116 TIP Rev.Esp.Cienc.Quím.Biol. Vol. 16, No. 2

5. Aductos de AFB1 adenosina y citosina aductos AFB1-ADN, y hay una relación entre los micronutrientes
Se ha reportado menor aducción de AFB1 a adenina[55] y del plasma y el riesgo de AFB1-relacionada con HCC[62].
citosina>@ en ADN LQYLWUR y falta evidencia de su importancia Otros datos contrarios reportan que el ß-caroteno controló la
en la producción de cáncer LQYLYR. Otros biomarcadores son formación de aductos de AFB1>@. Con respecto a las vitaminas
aductos de AFB1HQ$'1GHOLQIRFLWRV\GHDOE~PLQDGHVXHUR y carotenoides[64], en la carcinogénesis del hígado por AFB1, el
licopeno y un exceso de vitamina A no tuvieron efecto, pero el
/RVIDFWRUHVUHODFLRQDGRVDODIRUPDFLyQGHDGXFWRV$)%1-ADN ‰DSR
FDURWHQDOFDQWD[DQWLQD\ODDVWD[DQWLQDUHGXMHURQHO
son la edad, tabaquismo, alcoholismo, susceptibilidad del órgano tamaño de focos preneoplásticos>@.
SDUDIRUPDUDGXFWRV HMFpOXODVSDUHQTXLPDOHVKHSiWLFDVWHMLGR
pulmonar, intestino delgado, cultivo traqueal, placenta, radicales 5XWDVGHH[SRVLFLyQSDUDODIRUPDFLyQGHDGXFWRVHQ$'1
LQWHUPHGLRVGHODELOLVHWF \PRGXODFLyQGHODWHPSHUDWXUD /DLQKDODFLyQGH$)%1 es una ruta efectiva de exposición en
del metabolismo hepático de AFB1. Con respecto a la edad y ratas y hámsters que produce daño genotóxico en el hígado[65].
a la susceptibilidad de diferentes órganos a formar aductos, la /DDGPLQLVWUDFLyQLQWUDWUDTXHDOGH$)%1 aumentó un poco su
glutatión transferasa disminuye cuando hay muchos aductos SUHVHQFLDHQ$'1KHSiWLFRHQFRQWUDVWHFRQODJUDQ¿MDFLyQ
AFB1-ADN en el hígado y se correlacionan con el aumento de observada con animales que recibieron la AFB1 en forma
tumores por AFB1 en ratones recién nacidos[15]/DKLGUyOLVLV LQWUDSHULWRQHDO /RV SXOPRQHV VRQ HO VHJXQGR yUJDQR HQ
de los aductos AFB1-ADN es mayor en ratones recién nacidos importancia en retener un 66% de [H] AFB1 WULWLDGD /RV
y contribuye a remover más rápido los aductos. Hay factores PDFUyIDJRVDOYHRODUHVSRVHHQXQDIXQFLyQR[LGDWLYDHVSHFt¿FD
endógenos que afectan, como la edad, el hábito de fumar tabaco para activar la AFB1 y formar epóxido[66]/DPXFRVDQDVDOFRQ
o tomar alcohol y se asocian a un mayor porcentaje de aductos las enzimas de la familia P450 del gen 2A de algunos mamíferos
AFB1-Gua excretados, indicando más actividad de la AFB1. No FRQHMRUDWD\KXPDQR ORVKDFHVXVFHSWLEOHVDODIRUPDFLyQ
hubo relación entre aductos AFB1-ADN y el antígeno al VHB, del aducto AFB1*XD/DIRUPDFLyQGHDGXFWRVGH$)%1-ADN
nivel educacional o raza[14]. por microsomas nasales decrece con la nicotina[67].

2WURVIDFWRUHVGHOKXpVSHGSXHGHQPRGL¿FDUORVHIHFWRVWy[LFRV METODOLOGÍA
de las AF, principalmente hormonas relacionadas con el sexo, la /RV PpWRGRV SDUD HVWXGLDU D ORV DGXFWRV GH $)%1-ADN,
cantidad de alimento ingerido y otras interacciones ambientales. son un muestreo representativo del lote con muestras bien
Hay estudios[56]DFHUFDGHODLQÀXHQFLDGHODJUDVDGHODGLHWD homogeneizadas. En el caso de alimentos balanceados o
en la bioactivación hepática de AFB1 en ratas. Dietas altas en JUDQRVXQDVXEPXHVWUDGHJVHOLF~DFRQVROYHQWHVRUJiQLFRV
D]~FDUHV\EDMDVHQJUDVDUHGXFHQORVPLFURVRPDV\IDYRUHFHQOD PHWDQROFORURIRUPRRDFHWRQLWULOR SDUDH[WUDHUDODV$)\
epoxidación de AFB1, más que las dietas altas en grasa. El daño VH ¿OWUD /D FRQFHQWUDFLyQ \ SXUL¿FDFLyQ GH$) GHO ¿OWUDGR
en ADN se relaciona con la aparición de tumores malignos[57]. El GLOXLGRHQDPRUWLJXDGRUGHIRVIDWRV 3%6 YYDS+VH
ayuno y la restricción calórica reducen la activación metabólica, UHDOL]DXWLOL]DQGRFROXPQDVGHLQPXQRD¿QLGDGSDUD$)WRWDOHV
\EDMDQWDQWRODFDQWLGDGGHDGXFWRV XQ FRPRHOULHVJR SUHYLDPHQWHDFWLYDGDVFRQP/GH3%6DS+/DFROXPQD
de cáncer>@. GHEHUHFLELUJGHPXHVWUDVHHOX\HFRQP/GHPHWDQRO
ACN o cloroformo.
/DOX]ULERÀDYLQD\FDURWHQRVDIHFWDQODUHVSXHVWDGHODUDWD
DODWR[LFLGDGDJXGDSRU$)\VHGHVFRQRFHODLQÀXHQFLDGH En el caso de aductos de AFB1-ADN la muestra de tejido, orina,
las hormonas y de la nutrición en el cáncer inducido por AF. OHFKHRVDQJUHDQLPDORKXPDQDVHKRPRJHQHL]DVHSXUL¿FD
/DVUDWDVWUDWDGDVFRQIHQREDUELWDO\DODVTXHVHOHVH[WUDMROD HO$'1FRQSURWHDVD\VHHOLPLQDDO$51FRQQXFOHDVDVVH
KLSy¿VLVSUHVHQWDQFDPELRVHQHOPHWDEROLVPRGHOD$)%1 y hidroliza hirviéndolo con HCl hasta depurinarlo para romper
muy pocos aductos AFB1-ADN unidos a las macromoléculas HO $'1 \ VH SDVD SRU XQD FROXPQD GH LQPXQRD¿QLGDG
en los hepatocitos. )LQDOPHQWHVHDSOLFDHOPpWRGRGH(/,6$,QKLELWRULR,QGLUHFWR
que detecta desde picogramos hasta fentogramos de aducto>@,
Enzimas./DVOLSR[LJHQDVDV\ODSURVWDJODQGLQD+VLQWHWDVDVRQ o sea una molécula de aducto de AFB1-ADN en un universo de
enzimas que juegan un papel importante en la bioactivación de  -15 QXFOHyWLGRVGH$'1
la AFB1 en tejidos hepático y extra-hepático[61]. Vitaminas. Hay
una asociación entre la presencia del aducto de orina AFB1-Gua /RV PpWRGRV SDUD DQDOL]DU DGXFWRV GH $)%1$'1 VRQ D 
con los niveles de DWRFRIHURO YLWDPLQD( OLFRSHQR SLJPHQWR FURPDWRJUDItD GH OtTXLGRV +3/&  D DOWD SUHVLyQ \ IDVH
YHJHWDODQWLR[LGDQWHURMR FRQD\‰FDURWHQR SUHFXUVRUHVGH reversa>@  E  +3/& FRQ GHWHFFLyQ GH ÀXRUHVFHQFLD>@ F 
ODYLWDPLQD$ \FROHVWHUROHQHOSODVPDVDQJXtQHRDGLIHUHQWHV +3/&FRQHOHFWURVSUD\\HVSHFWURPHWUtDGHPDVDV /&(6,
niveles de exposición de AFB1. No hubo asociación entre la 0606 [70]G UHDFFLyQGHSROLPHUDVDHQFDGHQD 3&5 FRQ
presencia de aductos y los niveles de retinol, testosterona, radioinmunoensayo competitivo[51]H PpWRGRVUDGLRDFWLYRVFRQ
vitamina E y ß-caroteno, los cuales aumentaron la formación de ADN marcado con C14 >@I HVSHFWURVFRStDGHUHVRQDQFLDHOHFWUR
diciembre, 2013 Carvajal, M.: Formación del cancerígeno AFB1 de los alimentos 117

spin[71]J (/,6$FRQDQWLFXHUSRVPRQRFORQDOHV[72]K DQiOLVLV WUDTXHREURQTXLDOGHUDWD\KXPDQR(OFDIHVWRO\HONDKZHRO


GHLQPXQRÀXRUHVFHQFLDLQGLUHFWR>@L SUXHEDGH$PHV[74,75]. son diterpenos quimioprotectores y anticancerígenos de granos
/RVPpWRGRVDQWHVPHQFLRQDGRVMXQWRFRQODHVSHFWURPHWUtD de café verdes y tostados>@/RVPRQRWHUSHQRVUHGXMHURQOD
89HVSHFWURVFRStDGHUHVRQDQFLDPDJQpWLFDQXFOHDU 105  formación de aductos en ratas expuestas a AFB1>@. El jugo de
\HVSHFWURPHWUtDGHPDVDV 06 IXHURQFRQVLVWHQWHVDOSUREDU toronja suprime el daño al ADN por AFB1[100]. El ß-caroteno
que el fotoaducto AFB1-N7-guanina es el más frecuente y se no protegió al ADN de las alteraciones producidas por AFB1
encuentra en mayor cantidad. y causaron cambios menores en su metabolismo>@. El efecto
protector del ácido ascórbico fue ligero en los animales con
CONTROL toxicidad aguda por AFB1[101].
Hay una tasa de reparación natural y remoción de aductos[76] que
reducen la unión a ácidos nucleicos con resistencia a la AFB1, o 2OGHQODQGLDGLIIXVD y 6FXWHOODULDEDUEDWD son plantas usadas
bien con preexposición a AFM1>@/RVDGXFWRVSUHH[LVWHQWHV en medicina tradicional china para tratar tumores de hígado,
modulan la formación de aductos AFB1-ADN[26]. SXOPyQ \ UHFWR HOODV LQKLEHQ OD PXWDJpQHVLV OD ¿MDFLyQ DO
ADN y el metabolismo de AFB1 bioactivado por Aroclor 1254
/D DFWLYLGDG GH ODV HQ]LPDV GHVWR[LILFDQWHV JOXWDWLyQ en S en rata [102].
WUDQVIHUDVD *76 VHLQFUHPHQWDHQDQLPDOHVTXHLQJLHUHQ$)%1
crónicamente en los alimentos, y reduce la unión de la AFB1 a las /DFORUR¿ODHVXQSURGXFWRQDWXUDO~WLOSDUDUHGXFLUORVDGXFWRV
macromoléculas>@. En trucha, la enzima inhibitoria de aductos de AF-ADN>@ /DV EDFWHULDV SURELyWLFDV SXHGHQ IRUPDU
HVOD‰QDIWRÀDYRQD %1) >@/D3450 2A5 es un citocromo complejos con la AFB1, bloquear su absorción intestinal y
de ratones que cataliza la oxidación de la AFB1DOHSy[LGR reducir la excreción de AFB1-Gua asociados con aumento de
AFB1>@, para ello se usan levaduras recombinantes>@. riesgo de desarrollar HCC[104].

/DHWR[LTXLQD (4 DQWLR[LGDQWH\ODUHGXFWDVDDOGHKtGR$)%1 /DLQIRUPDFLyQSUHVHQWDGDDTXtHQJOREDDOJXQRVDVSHFWRVGH


$)%1$5 SURWHJHQFRQWUDODIRUPDFLyQGHDGXFWRVXQLGRVD ORV DGXFWRV TXH VRQ LQWHUHVDQWHV SDUD ORV FLHQWt¿FRV \ RWUDV
proteína>@ e inhiben las lesiones por AFB1. especialidades, esperamos haber dado datos de vanguardia
acerca de estos importantes biomarcadores.
Hay compuestos químicos protectores que retrasan o curan el
FiQFHUFRPRORVDQWLHVWUyJHQRVDQWLLQÀDPDWRULRVDQWLR[LGDQWHV AGRADECIMIENTOS
y otros agentes de la dieta>@/DLQGRPHWDFLQD[22], ditioletiona $*HRUJLQD2UWHJD/HLWH\*HUDUGR$UpYDORSRUVXDSR\RHQOD
GH GLHWD '77 >@ KLGUR[LWROXHQR EXWLODGR %+7 >@, ácido REWHQFLyQGHELEOLRJUDItD\D-RHO9LOODYLFHQFLR-RUJH/ySH]\
nordihidroguaiarético>@ y selenio>@ son potentes protectores Alfredo Wong por su apoyo en computación, todos del Instituto
contra HCC por AFB1, que redujeron los aductos AFB1-N7-Gua de Biología, UNAM.
SRULQGXFFLyQGH*6+6WUDQVIHUDVDV/DGRVLVDOWDGH%+7
causa efectos patológicos. REFERENCIAS
1. Asao, T. HWDO$ÀDWR[LQV%DQG*-$P&KHP6RF85, 1706-
Alimentos como las crucíferas contienen ditioletionas que   
inhiben al cáncer>@, las coles de Bruselas disminuyeron un 2. %XWOHU:+$ÀDWR[LQVLQ0\FRWR[LQV HG3XUFKDVH,)+ 
50-60% la unión AFB1-ADN del aducto y aumentaron las (OVHYLHU$PVWHUGDP 
actividades hepáticas e intestinales de la GST>@(OLQGRO  'LHQHU8/ 'DYLV1'LQ$ÀDWR[LQLQ0DL]H$SURFHHGLQJV
RIWKH:RUNVKRS HGV=XEHU06/LOOHKRM(% 5HQIUR
FDUELQRO ,& GHODVFUXFtIHUDVLQKLELHURQLQYLYR la formación
%/  &<00<781'386'$(O%DWiQ0p[LFR
de aductos AFB1$'1XQ\FRPELQDGRFRQ%1)LQKLELHURQ ') 
51% >@. El brócoli tiene glucorafanina que es un glucosinolato 4. OPS-OMS. Micotoxinas. Criterios de la salud ambiental 11:
TXHVHKLGUROL]DFRPRVXOIRUDIDQRSRUODPLFURÀRUDLQWHVWLQDO\ 0LFRWR[LQDV 2UJDQL]DFLyQ0XQGLDOGHOD6DOXG3XEOLFDFLyQ
HVXQLQGXFWRUGHHQ]LPDVGHVWR[L¿FDQWHV>@. El oltipraz>@ es &LHQWt¿FD:DVKLQJWRQ86$ 
un derivado sintético del brócoli, previamente usado en humanos 5. 0DQRQPDQL +.$QDQG 6 &KDQGUDVKHNDU$  5DWL (5
FRPRPHGLFDPHQWRDQWLVFKLVWRVRPD~WLOSDUDFRQVXPLGRUHV 'HWHFWLRQRIDÀDWR[LJHQLFIXQJLLQVHOHFWHGIRRGFRPPRGLWLHV
de comida con AFB1, en regiones con alta incidencia de E\3&53URFHVV%LRFKHP 40  
cáncer de hígado>@, es un potente inductor de la GST, enzima 6. &KDQJ 6% $EGHO.DGHU 00 :LFN (/  :RJDQ *1
$ÀDWR[LQ%2: Chemical identity and biological activity. 6FLHQFH
GHVWR[L¿FDGRUDGHOD)DVH,,TXHLQKLEHHOFiQFHUGHYHMLJDFRORQ
142  
pecho, estómago y piel, pero no ha sido relevante en poblaciones 7. Soriano del Castillo, J.M. HWDO0LFRWR[LQDVHQDOLPHQWRV (GLFLRQHV
humanas>@/DFXPDULQD>@ protege contra el origen del cáncer 'tD]GH6DQWRV(VSDxD SS
hepático por AFB1 en rata. El ácido elágico[75] es un fenol vegetal  3ULFH5/ -RUJHQVHQ.9(IIHFWVRISURFHVVLQJRQDÀDWR[LQV
de varias frutas y nueces que inhibe la mutación por AFB1, y levels and on mutagenic potential of tortillas made from
reduce los aductos AFB1- ADN y el daño en ADN en tejido naturally contaminated corn. -)RRG6FL 50  
118 TIP Rev.Esp.Cienc.Quím.Biol. Vol. 16, No. 2

 6ZHHQH\0- 'REVRQ$':0ROHFXODUELRORJ\RIP\FRWR[LQ  


biosynthesis. )(060LFURELRO /HWW 175    6KXSH7 6HOO6/RZKHSDWLFJOXWDWKLRQH6WUDQVIHUDVHDQG
(DWRQ ', 5DPVGHOO +6  1HDO *( LQ 7KH WR[LFRORJ\ increased hepatic DNA adduction contribute to increased
RI DÀDWR[LQV +XPDQ +HDOWK 9HWHULQDU\ DQG $JULFXOWXUDO WXPRULJHQLFLW\ RI $ÀDWR[LQ %1 LQ QHZERUQ DQG SDUWLDOO\
6LJQL¿FDQFH HG (DWRQ '/  *URRSPDQ --   hepatectomized mice. 7R[LFRO/HWW 148  
$FDGHPLF3UHVV,QF6DQ'LHJR86$  (VVLJPDQQ-0HWDO6WUXFWXUDO,GHQWL¿FDWLRQRIWKHPDMRU'1$
 :\OOLH7' 0RUHKRXVH/*0\FRWR[LQ)XQJL0\FRWR[LQV DGGXFWIRUPHGE\$ÀDWR[LQ%1 LQYLWUR. 3URF1DWO$FDG6FL
0\FRWR[LFRVHV $Q (QF\FORSHGLF +DQGERRRN  0HUFHO USA 74  
'HNNHU,QF1HZ<RUN86$   <X)/+XDQJ-;%HQGHU::X= &KDQJ-&6(YLGHQFH
2OVHQ-+'UDJVWHG, $XWUXS+&DQFHUULVNDQGRFFXSDWLRQDO IRUWKHFRYDOHQWELQGLQJRIDÀDWR[LQ%1-dichloride to cytosine
H[SRVXUHWRDÀDWR[LQVLQ'HQPDUN%U-&DQFHU58 in DNA. &DUFLQRJHQHVLV 12  
  &KHOFKHOHK0 $OODPHK$,QYLYR biotransformation of AFB1
5H\H5'.0RUJDQ* %DUDO-(QFHSKDORSDWK\DQGIDWW\ DQGLWVLQWHUDFWLRQZLWKFHOOXODUPDFURPROHFXOHVLQQHRQDWDO
degeneration of the viscera: A disease entity in childhood. rats. 0HFK$JHLQJ'HY 78  
/DQFHW 2   )XMLPRWR<+DPSWRQ///XR/':LUWK3- 7KRUJHLUVVRQ
$SHDJ\HL)/DPSOXJK60+HQGULFNVH5*$IIUDP\.  66/RZIUHTXHQF\RISJHQHPXWDWLRQLQWXPRUVLQGXFHG
/XFDV6$ÀDWR[LQVLQWKHOLYHURIFKLOGUHQZLWKNZDVKLRUNRU by AFB1 in nonhuman primates. &DQFHU5HV 52, 1044-1046
in Ghana. 7URS*HRJU0HG+RPH    
15. -HIIUH\$0 :LOOLDPV*05LVNDVVHVVPHQWRI'1$UHDFWLYH +VLHK '3+  $WNLQVRQ '1 5HFHQW DÀDWR[LQ H[SRVXUH
carcinogens in food. 7R[LFRO$SSO3KDUPDFRO 20766 DQGPXWDWLRQDWFRGRQRIWKHKXPDQSJHQHODFNRI
  association. )RRG$GGLW&RQWDP 12  
:RJDQ*1$ÀDWR[LQVDVULVNIDFWRUVIRUSULPDU\KHSDWRFHOOXODU ,UYLQ75 :RJDQ*14XDQWLWDWLRQRI$)%1DGGXFWLRQZLWKLQ
FDUFLQRPD LQ KXPDQV 3HQQLQJWRQ &HQWHU 1XWULWLRQ 6HULHV WKHULERVRPDO51$JHQHVHTXHQFHVRIUDWOLYHU'1$3URF
/RXLVLDQD6W86$  1DWO$FDG6FL86$ 81  
.ULVKQDPDFKDUL .$ %KDW 59 1DUDJDMDQ9 7LODN7%  /LQ-.0LOOHU-$ 0LOOHU(&GLK\GUR JXDQ\O 
+HSDWLWLVGXHWRDÀDWR[LFRVLV$QRXWEUHDNLQ:HVWHUQ,QGLD K\GUR[\DÀDWR[LQ %1, a major acid hydrolysis product of
/DQFHW 1   AFB1'1$ RU ULERVRPDO 51$ DGGXFWV IRUPHG LQ KHSDWLF
 Sornmayura, P. HW DO Dysplastic nodules and small primary microsome-mediated reactions and in rat liver LQYLYR. &DQFHU
carcinoma of the liver: A study detecting the early morphological 5HV 37  
changes during hepatocarcinogenesis. -0HG$VVRF7KDLODQG %HQDVXWWL0(MDGL6:KLWORZ0' /RHFKOHU(/0DSSLQJ
90   WKHELQGLQJVLWHRI$ÀDWR[LQ%1 in DNA: Systematic analysis
*URRSPDQ-'HWDO0ROHFXODUGRVLPHWU\RIXULQDU\DÀDWR[LQ RI WKH UHDFWLYLW\ RI$ÀDWR[LQ %1 ZLWK JXDQLQHV LQ GLIIHUHQW
DNA adducts in people living in Guangxi autonomous region, DNA sequences. %LRFKHPLVWU\ 27  
3HRSOH
V5HSXEOLFRI&KLQD&DQFHU5HV 52    6KDXOVN\ * -RKQVRQ 5/ 6KRFNFRU -3 7D\ORU /&( 
20. /HZLV / HW DO$ÀDWR[LQ FRQWDPLQDWLRQ RI FRPPHUFLDO PDL]H 6WDUN$$3URSHUWLHVRIDÀDWR[LQ'1$DGGXFWVIRUPHGE\
SURGXFWVGXULQJDQRXWEUHDNRIDFXWHDÀDWR[LFRVLVLQHDVWHUQ photoactivation and characterization of the major photoadduct
and central Kenya. (QYLURQ+HDOWK3HUVS 113 DVDÀDWR[LQ17-guanine. &DUFLQRJHQHVLV 11  
   7UR[HO &0 %XKOHU '5 +HQGULFNV -'  %DLOH\ *6
3KLOOLSV-&'DYLHV6 /DNH%*'RVHUHVSRQVHUHODWLRQVKLSV CYP1A induction by EQDSKWKR ÀDYRQH$URFORU  DQG
IRUKHSDWLFDÀDWR[LQ%1-DNA adduct formation in the rat in WHWUDFKORURGLEHQ]RSGLR[LQDQGLWVLQÀXHQFHRQ$)%
YLYR and LQYLWUR: the use of immunoslot blotting for adduct PHWDEROLVPDQG'1$DGGXFWLRQLQ]HEUD¿VK 'DQLRUHULR 
quantitation. 7HUDWRJ&DUFLQRJ0XWDJHQ 19   7R[LFRO$SSO3KDUPDFRO 146  
22. Donnelly, P.J. HWDO%LRWUDQVIRUPDWLRQRIDÀDWR[LQ%1 in human  $XWUXS+ :DNKLVL-LQ0HWKRGVIRUGHWHFWLQJ'1$GDPDJLQJ
lung.&DUFLQRJHQHVLV 17   agents in humans: applications in cancer epidemiology and
 %URQVRQ 5 %LUW '  0H\GDQL 61 %LRPDUNHUV DV HDUO\ SUHYHQWLRQ HGV%DUWVFK++HPPLQNL. 21HLOO,. 
predictors of long-term health status and human immune  ,QWHUQDWLRQDO$JHQF\IRU5HVHDUFKRQ&DQFHU6FLHQWL¿F
function. 1XWU5HY 5766   3XEOLFDWLRQV1R/\RQ)UDQFH 
24. (VVLJPDQQ -0 &UR\ 5* %HQQHWW 5$  :RJDQ *1 *RSDODNULVKQDQ6+DUULV70 6WRQH03,QWHUFDODWLRQRI
0HWDEROLFDFWLYDWLRQRIDÀDWR[LQ%1: Patterns of DNA adduct DÀDWR[LQ%1LQWZRROLJRGHR[\QXFOHRWLGHDGGXFWVFRPSDUDWLYH
formation, removal, and excretion in relation to carcinogenesis. + 105 DQDO\VLV RI G $7&$)%*$7  G $7&*$7  DQG
'UXJ0HWDE5HY 13   G $7$)%*&$7 %LRFKHPLVWU\ 29  
-DFREVHQ -6 5HIROR /0 &RQOH\ 03 6DPEDPXUWL .  41. &UR\5* :RJDQ*1,GHQWL¿FDWLRQRIDQ$)31-DNA adduct
+XPD\XQ 0= '1$ UHSOLFDWLRQEORFNLQJ SURSHUWLHV RI formed LQYLYR in rat liver. 3URF$P$VVRF&DQFHU5HV 20,
DGGXFWVIRUPHGE\DÀDWR[LQ%1GLFKORULGHDQGDÀDWR[LQ   
%R[LGH0XWDW5HV 179   42. 6FKRHQKDUG */ HW DO $ÀDWR[LFROLQGXFHG KHSDWRFHOOXODU
5RVV0.6DLG% 6KDQN5&'1$GDPDJLQJHIIHFWVRI FDUFLQRPD LQ UDLQERZ WURXW 6DOPR JDLUGQHUL  DQG WKH
genotoxins in mixture: modulation of covalent binding to synergistic effects of cyclopropenoid fatty acids. &DQFHU5HV
DNA. 7R[LFRO6FL 53   41  
27. Ames, B.N. Dietary carcinogens and anticarcinogens. Oxygen /RYHODQG30HWDO AFB1DQGDÀDWR[LFROPHWDEROLVPLQUDLQERZ
radicals and degenerative diseases. 6FLHQFHV 221, 1256-1264 WURXW 6DOPRJDLUGQHUL DQGWKHHIIHFWVRIGLHWDU\F\FORSURSHQH
diciembre, 2013 Carvajal, M.: Formación del cancerígeno AFB1 de los alimentos 119

-(QYLURQ3DWKRO7R[LFRO 2   /LX/ 0DVVH\7(%LRDFWLYDWLRQRI$)%1 by lipoxygenases,


44. Bailey, G.S. HWDO Quantitative carcinogenesis and dosimetry in prostaglandin H synthase and cytochrome P450 monooxygenase
UDLQERZ WURXW IRU$)%1 DQG DÀDWR[LFRO WZR DÀDWR[LQV WKDW in guinea-pig tissues. &DUFLQRJHQHVLV 13  
form the same DNA adduct. 0XWDW5HV 313   <X0:&KLDQJ<&/LHQ-3 &KHQ&-3ODVPDDQWLR[LGDQW
45. 0DUWLQ &1  *DUQHU 5& $ÀDWR[LQ% R[LGH JHQHUDWHG E\ vitamins, chronic hepatitis B virus infection and urinary AFB1-
chemical or enzymatic oxidation of AFB1 causes guanine DNA adducts in healthy males. &DUFLQRJHQHVLV 18
substitution in nucleic acids. 1DWXUH 267    
&UR\5* :RJDQ*17HPSRUDOSDWWHUQVRIFRYDOHQW'1$  *UDGHOHW6/H%RQ$0%HUJHV56XVFKHWHW0 $VWRUJ
DGGXFWVLQUDWOLYHUDIWHUVLQJOHDQGPXOWLSOHGRVHVRIDÀDWR[LQ 3 'LHWDU\ FDURWHQRLGV LQKLELW DÀDWR[LQ %1-induced liver
B1. &DQFHU5HV 41   preneoplastic foci and DNA damage in the rat: role of the
47. /HH +6 6DURVL ,  9\DV *1 $ÀDWR[LQ %1 formamido modulation of AFB1 metabolism. &DUFLQRJHQHVLV 19
pyrimidine adducts in human hepatocarcinogenesis: a  
preliminary report. *DVWURHQWHURORJ\ 97   64. 5HGG\ / 2GKDY %  %KRROD . $)%1-induced toxicity in
 'DVKZRRG 5+ HW DO LQ +DQGERRN RI $SSOLHG 0\FRORJ\ HepG2 cells inhibited by carotenoids: morphology, apoptosis
0\FRWR[LQVLQ(FRORJLFDO6\VWHPV9RO HGV%KDWQDJDU' and DNA damage. %LRO&KHP 387  
/LOOHKRM(% $URUD'.  0DUFHO'HNNHU,QF 65. =DUED $ +PLHOHVNL 5 +HPHQZD\ '5 -DNDE *- 
1HZ<RUN86$  *URRSPDQ -'$ÀDWR[LQ %1-DNA adduct formation in rat
2VWHUPDQ*RONDU6(KUHQEHUJ/6HJHUElFN' +DOOVWURP OLYHUIROORZLQJH[SRVXUHE\DHURVROLQKDODWLRQ&DUFLQRJHQHVLV
,(YDOXDWLRQRIWKHJHQHWLFULVNVRIDON\ODWLQJDJHQWV0XWDW 13  
5HV 34   66. %LVZDV * HW DO &RPSDUDWLYH NLQHWLF VWXGLHV RQ DÀDWR[LQ %1
50. 6HJHUElFN ' &DOOHPDQ &- (KUHQEHUJ / /RIU|WK *  binding to pulmonary and hepatic DNA of rat and hamster
2VWHUPDQ*RONDU6(YDOXDWLRQRIJHQHWLFULVNVRIDON\ODWLQJ receiving the carcinogen intratracheally. 7HUDWRJ&DUFLQRJ
DJHQWV,94XDQWLWDWLYHGHWHUPLQDWLRQRIDON\ODWLQJDPLQRDFLGV 0XWDJHQ 13  
in hemoglobin as measure of the dose after treatment of mice 67. 3XWW'$'LQJ;&RRQ0- +ROOHQEHUJ3)0HWDEROLVP
ZLWKPHWK\OPHWKDQHVXOIRQDWH0XWDW5HV 49   RIDÀDWR[LQ%1 by rabbit and rat nasal mucosa microsomes and
7XUQHU3&'LQJOH\.+&R[KHDG-5XVVHOO6 *DUQHU SXUL¿HGF\WRFKURPH3450, including isoforms 2A10 and 2A11.
&5'HWHFWDEOHOHYHOVRIVHUXP$)%1-albumin adducts in the &DUFLQRJHQHVLV 16  
United Kingdom population: implications for AFB1 exposure +DUULVRQ-&&DUYDMDO0 *DUQHU5&LQ+XPDQ&DUFLQRJHQ
in the United Kingdom. &DQFHU(SLGHPLRO%LRPDUN3UHY 7, ([SRVXUH%LRPRQLWRULQJDQG5LVN$VVHVVPHQW HGV*DUQHU
   5&)DUPHU3%6WHOO*7 :ULJKW$6  ,5/
52. Wang, J.S. HW DO 'HYHORSPHQW RI $ÀDWR[LQ %1-lysine adduct 3UHVV2[IRUG8QLYHUVLW\3UHVV 
monoclonal antibody for human exposure studies. $SSOLHG  6RWRPD\RU5(HWDO Effects of intermittent exposure to AFB1 on
(QYLURQ0LFURELRO 67   '1$DQG51$DGGXFWIRUPDWLRQLQUDWOLYHU'RVHUHVSRQVH
:LOG&3HWDO$ÀDWR[LQDOEXPLQDGGXFWVDEDVLVIRUFRPSDUDWLYH and temporal patterns. 7R[LFRO6FL 73  
FDUFLQRJHQHVLV EHWZHHQ DQLPDOV DQG KXPDQV &DQFHU 70. Walton, M. HW DO /LTXLG FKURPDWRJUDSK\ HOHFWURVSUD\PDVV
(SLGHPLRO%LRPDUN3UHY 5   VSHFWURPHWU\RIXULQDU\$)ELRPDUNHUVFKDUDFWHUL]DWLRQDQG
54. $QZDU:$.KDOLO00 :LOG&30LFURQXFOHLFKURPRVRPDO application to dosimetry and chemoprevention in rats. &KHP
aberrations and AF-albumin adducts in experimental animals 5HV7R[LFRO 14  
after exposure to AFB1. 0XWDW5HV 322   7RZQHU5$4LDQ6<.DGLLVND0% 0DVRQ53,QYLYR
55. '$QGUHD$' +DVVHOWLQH:$0RGL¿FDWLRQRI'1$E\$)%1 LGHQWL¿FDWLRQRIDÀDWR[LQLQGXFHGIUHHUDGLFDOVLQUDWELOHFree
FUHDWHVDONDOLODELOHOHVLRQVLQ'1$DWSRVLWLRQVRIJXDQLQHDQG 5DGLF%LRO0HG 35  
adenine. 3URF1DWO$FDG6FL86$ 75   +VLHK//+VX6:&KHQ'6 6DQWHOOD50,PPXQRORJLFDO
56. +DVOHU-$'XEH11\DWKL&%)XKUPDQQ+ 6DOOPDQQ detection of AFB1-DNA adducts formed LQYLYR.&DQFHU5HV
+37KHLQÀXHQFHRIGLHWDU\IDWRQKHSDWLFELRDFWLYDWLRQRI 48  
AFB1 in rats. 5HV&RPPXQ&KHP3DWKRO3KDUPDFRO 83, =KDQJ<-HWDO4XDQWLWDWLRQRI$)%'1$DGGXFWVLQZRRGFKXFN
   KHSDWRF\WHVDQGUDWOLYHUWLVVXHE\LQGLUHFWLPPXQRÀXRUHVFHQFH
6FKUDJHU7)1HZEHUQH303LNXO$+ *URRSPDQ-' analysis. &DQFHU5HV 51  
$ÀDWR[LQ'1$DGGXFWIRUPDWLRQLQFKURQLFDOO\GRVHGUDWVIHG &KRL0-/HH-: /HH%0&RPSDUDWLYHDVVHVVPHQWRI'1$
DFKROLQHGH¿FLHQWGLHW&DUFLQRJHQHVLV 11   adduct formation, 6DOPRQHOODmutagenicity, and chromosome
&KRX0: &KHQ:)RRGUHVWULFWLRQUHGXFHV$ÀDWR[LQ%1 aberration assays as short-term tests for DNA damage. J.
$)%1 '1$DGGXFWIRUPDWLRQ$)%1-glutathione conjugation 7R[LFRO(QYLURQ+HDOWK 49  
and DNA damage in AFB1WUHDWHGPDOH)UDWVDQG%&) 75. Mandal, S. HWDO,QKLELWLRQRIDÀDWR[LQ%1 mutagenesis in 6DOPRQHOOD
mice. -1XWU 127   W\SKLPXULXP and DNA damage in cultured rat and human
&KRX0:6KDGGRFN-*.RQJ-+DUW5: &DVFLDQR'$ tracheobronchial tissues by ellagic acid. &DUFLQRJHQHVLV 8,
Effect of dietary restriction on partial hepatectomy-induced   
OLYHUUHJHQHUDWLRQRIDJHG)UDWV&DQFHU/HWW 91 'HQLVVHQNR 0) &DKLOO - .RXGULDNRYD 7% *HUEHU 1 
  Pfeifer, G.P. Quantitation and mapping of AFB1-induced
60. *DR 3  &KRX 0: (IIHFW RI FDORULF UHVWULFWLRQ RQ KHSDWLF DNA damage in genomic DNA using AFB1HSR[LGHDQG
QXFOHDU'1$GDPDJHLQPDOH)LVFKHUUDWVWUHDWHGZLWK microsomal activation systems. 0XWDW 5HV 425, 205-211
$ÀDWR[LQ%1. 7R[LFRO/HWW 61    
120 TIP Rev.Esp.Cienc.Quím.Biol. Vol. 16, No. 2

/RXU\'1 +VLHK'3(IIHFWVRIFKURQLFH[SRVXUHWR$)%1  6DOEH $'  %MHOGDQHV /) (IIHFW RI GLHW DQG URXWH RI
and AFM1 on the LQYLYR covalent binding of AFB1 to hepatic administration on the DNA binding of AFB1 in the rat.
macromolecules. - 7R[LFRO (QYLURQ +HDOWK 13  &DUFLQRJHQHVLV 10  
  6WUHVVHU '0:LOOLDPV '( 0F/HOODQ /, +DUULV70 
 .QLJKW /3 3ULPLDQR 7 *URRSPDQ -' .HQVOHU 7:  %DLOH\*6,QGROHFDUELQROLQGXFHVDUDWOLYHUJOXWDWKLRQH
6XWWHU75F'1$FORQLQJH[SUHVVLRQDQGDFWLYLW\RIDVHFRQG WUDQVIHUDVHVXEXQLW <F ZLWKKLJKDFWLYLW\WRZDUG$)%1 exo-
human AFB1PHWDEROL]LQJPHPEHURIWKHDOGRNHWRUHGXFWDVH HSR[LGH$VVRFLDWLRQZLWKUHGXFHGOHYHOVRIKHSDWLF$)'1$
VXSHUIDPLO\$.5$&DUFLQRJHQHVLV 20   adducts LQYLYR. 'UXJ0HWDE'LVSRV 22  
 Urban, J.D. HW DO Functional selectivity and classical concepts .HQVOHU7:HWDO Effects of glucosinolate-rich broccoli sprouts
of quantitative pharmacology. -3KDUPDFRO([S7KHU 320, on urinary levels of AF-DNA adducts and phenanthrene tetraols
   LQDUDQGRPL]HGFOLQLFDOWULDOLQ+H=XR7RZQVKLS4LGRQJ
7DNDKDVKL 1 +DUWWLJ 8 :LOOLDPV '(  %DLOH\ *6 7KH 3HRSOH
V5HSXEOLFRI&KLQD&DQFHU(SLGHPLRO%LRPDUNHUV
PRGHO$KUHFHSWRUDJRQLVW‰QDSKWKRÀDYRQHLQKLELWVDÀDWR[LQ 3UHY 14  
B1-DNA binding LQYLYRLQUDLQERZWURXWDWGLHWDU\OHYHOVWKDW  Kensler, T.W. Chemoprevention by inducers of carcinogen
do not induce CYP1A enzymes. &DUFLQRJHQHVLV 17  detoxication enzymes. (QYLURQ+HDOWK3HUVSHFW 105 Suppl,
    
 ,P6+%ROW0:6WHZDUW5. 0DVVH\7(0RGXODWLRQ %ROWRQ0*HWDO7UDQVLHQWLQWHUYHQWLRQZLWKROWLSUD]SURWHFWV
of AFB1 ELRWUDQVIRUPDWLRQ E\ ‰QDSKWKRÀDYRQH LQ LVRODWHG DJDLQVWDÀDWR[LQLQGXFHGKHSDWLFWXPRULJHQHVLV&DQFHU5HV
rabbit lung cells. $UFK7R[LFRO 71   53  
 3HONRQHQ 3 /DQJ 0$ 1HJLVKL 0:LOG &3  -XYRQHQ  2
'Z\HU3-HWDO Modulation of gene expression in subjects at
52,QWHUDFWLRQRI$)%1ZLWKF\WRFKURPH3450 2A5 and its ULVNIRUFRORUHFWDOFDQFHUE\WKHFKHPRSUHYHQWLYHGLWKLROHWKLRQH
PXWDQWVFRUUHODWLRQZLWKPHWDEROLFDFWLYDWLRQDQGWR[LFLW\ Oltipraz. -&OLQ,QYHVWLJ 98  
&KHP5HV7R[LFRO 10    Kelly, V.P. HWDO Chemoprevention of AFB1 hepatocarcinogenesis
3HONRQHQ3/DQJ0:LOG&31HJLVKL0 -XYRQHQ52 by coumarin, a natural benzopyrone that is a potent inducer
Activation of AFB1 by mouse CYP2A enzymes and cytotoxicity of AFB1-aldehyde reductase, the glutathione S-transferase A5
in recombinant yeast cells. (XU - 3KDUPDFRO 292  DQG3VXEXQLWVDQG1$' 3 +TXLQRQHR[LGRUHGXFWDVHLQ
  rat liver. &DQFHU5HV 60  
 +D\HV -' -XGDK '-  1HDO *( 5HVLVWDQFH WR $)%1 is  &DYLQ&+RO]KDXVHU'&RQVWDEOH$+XJJHWW$& 6FKLOWHU
DVVRFLDWHGZLWKWKHH[SUHVVLRQRIDQRYHODOGRNHWRUHGXFWDVH %7KHFRIIHHVSHFL¿FGLWHUSHQHVFDIHVWRODQGNDKZHROSURWHFW
ZKLFK KDV FDWDO\WLF DFWLYLW\ WRZDUGV D F\WRWR[LF DOGHK\GH against AFB1-induced genotoxicity through a dual mechanism.
containing metabolite of the toxin. &DQFHU5HV 53 &DUFLQRJHQHVLV 19  
  (OHJEHGH -$  *RXOG 01 0RQRWHUSHQHV UHGXFHG DGGXFWV
 7DPLPL 50 /DJLRX 3 $GDPL +2  7ULFKRSRXORV ' formation in rats exposed to AFB1. $IULFDQ-%LRWHFK$FDG
Prospects for chemoprevention of cancer. -,QWHUQ0HG 251, J. 1  
   100. 0L\DWD07DNDQR+*XR/41DJDWD. <DPD]RH<
 (JQHU3$'H0DWRV3*URRSPDQ-' .HQVOHU7:(IIHFW *UDSHIUXLWMXLFHLQWDNHGRHVQRWHQKDQFHEXWUDWKHUSURWHFWV
RIGLWKLROHWKLRQHDPRQRIXQFWLRQDOHQ]\PHLQGXFHU against AFB1-induced liver DNA damage through a reduction
RQ$ÀDWR[LQ'1$DGGXFWIRUPDWLRQLQUDWOLYHU3URF$QQXDO LQKHSDWLF&<3$DFWLYLW\&DUFLQRJHQHVLV 25  
0HHWLQJRIWKH$P$VVRF&DQF5HV 31   101. 1HWNH635RRPL0:7VDR& 1LHG]ZLHFNL$$VFRUELF
 $OODPHK$&RPSDULVRQRIWKHHIIHFWRIORZDQGKLJKGRVHGLHWDU\ DFLGSURWHFWVJXLQHDSLJVIURPDFXWHDÀDWR[LQWR[LFLW\7R[LFRO
butylated hydroxy toluene on microsome-mediated AFB1-DNA $SSO3KDUPDFRO 143  
binding. &DQFHU/HWW 114   102. :RQJ %< /DX %+<DPDVDNL7  7HHO 5: ,QKLELWLRQ
 6DORFNV &% +VLHK '3  %\DUG -/ (IIHFWV RI EXW\ODWHG of dexamethasone-induced cytochrome P450-mediated
hydroxytoluene pretreatment on the metabolism and mutagenicity and metabolism of AFB1 by Chinese medicinal
genotoxicity of AFB1 in primary cultures of adult rat herbs. (XU-&DQFHU3UHY 2  
hepatocytes: selective reduction of nucleic acid binding.  Egner, P.A. HWDO Chlorophyllin intervention reduces AF-DNA
7R[LFRO$SSO3KDUPDFRO 76   DGGXFWVLQLQGLYLGXDOVDWKLJKULVNIRUOLYHUFDQFHU3URF1DWO
 6KL&<&KXD6&/HH+3 2QJ&1,QKLELWLRQRI$)%1- $FDG6FL86$ 98  
DNA binding and adduct formation by selenium in rats. &DQFHU 104. El-Nezami, H.S. HW DO Probiotic supplementation reduces a
/HWW 29   ELRPDUNHUIRULQFUHDVHGULVNRIOLYHUFDQFHULQ\RXQJPHQIURP
%HQVRQ$%2OWLSUD]DODERUDWRU\DQGFOLQLFDOUHYLHZJ. Cell. Southern China. $P-&OLQ1XWU$PHU6RF&OLQ1XW 83,
%LRFKHP6XSSO 17F