Você está na página 1de 26

GABARITO DAS QUESTÕES DE MÚLTIPLA ESCOLHA

BIOMEDICINA
ITEM GABARITO
1 C
2 A
3 C
4 E
5 E
6 A
7 D
8 B
9 DISCURSIVA
10 DISCURSIVA
11 B
12 D
13 A
14 D
15 E
16 D
17 A
18 E
19 D
20 B
21 ANULADA
22 C
23 ANULADA
24 A
25 C
26 D
27 E
28 B
29 A
30 C
31 B
32 A
33 C
34 C
35 B
36 E
37 C
38 DISCURSIVA
39 DISCURSIVA
40 DISCURSIVA
SINAES
Sistema Nacional de Avaliação da Educação Superior
02
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

Novembro / 2010

Prova de

BIOMEDICINA
LEIA COM ATENÇÃO AS INSTRUÇÕES ABAIXO.
1 - Verifique se, além deste caderno, você recebeu o Caderno de Respostas, destinado à transcrição
das respostas das questões de múltipla escolha (objetivas), das questões discursivas e das
respostas do questionário de percepção da prova.
2 - Confira se este caderno contém as questões de múltipla escolha (objetivas) e discursivas de
formação geral e do componente específico da área, e as questões relativas à sua percepção da
prova, assim distribuídas:
Número das Peso das Peso dos
Partes
questões questões componentes
Formação Geral/Múltipla Escolha 1 a 8 60%
25%
Formação Geral/Discursivas 9 e 10 40%

Componente Específico/Múltipla Escolha 11 a 37 85%


75%
Componente Específico/Discursivas 38 a 40 15%

Questionário de percepção da Prova 1 a 9 _ _

3 - Verifique se a prova está completa e se o seu nome está correto no Caderno de Respostas. Caso
contrário, avise imediatamente um dos responsáveis pela aplicação da prova. Você deve assinar
o Caderno de Respostas no espaço próprio, com caneta esferográfica de tinta preta.
4 - Observe as instruções expressas no Caderno de Respostas sobre a marcação das respostas às
questões de múltipla escolha (apenas uma resposta por questão).
5 - Use caneta esferográfica de tinta preta tanto para marcar as respostas das questões objetivas
quanto para escrever as respostas das questões discursivas.
6 - Não use calculadora; não se comunique com os demais estudantes nem troque de material com
eles; não consulte material bibliográfico, cadernos ou anotações de qualquer espécie.
7 - Você terá quatro horas para responder às questões de múltipla escolha e discursivas e ao
questionário de percepção da prova.
8 - Quando terminar, entregue ao Aplicador ou Fiscal o seu Caderno de Respostas.
9 - Atenção! Você só poderá levar este Caderno de Prova após decorridas três horas do início
do Exame.

Ministério
da Educação
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

FORMAÇÃO GERAL
QUESTÃO 1
²6HUiGHWHUUD
tua derradeira camisa:
te veste, como nunca em vida.
²6HUiGHWHUUD
e tua melhor camisa:
te veste e ninguém cobiça.
²7HUiVGHWHUUD
completo agora o teu fato:
e pela primeira vez, sapato.
— Como és homem,
DWHUUDWHGDUiFKDSpX
fosses mulher, xale ou véu.

Painel da série Retirantes, de Cândido Portinari. — Tua roupa melhor


Disponível em: <http://3.bp.blogspot.com>. Acesso em: 24 ago. 2010.
VHUiGHWHUUDHQmRGHID]HQGD
não se rasga nem se remenda.
— Tua roupa melhor
Morte e Vida Severina
(trecho) HWH¿FDUiEHPFLQJLGD
como roupa feita à medida.
$t¿FDUis para sempre,
livre do sol e da chuva, João Cabral de Melo Neto. Morte e Vida Severina. Rio de Janeiro: Objetiva, 2008.
criando tuas saúvas.
Analisando o painel de Portinari apresentado e o trecho
²$JRUDWUDEDOKDUiV destacado de Morte e Vida Severina, conclui-se que
só para ti, não a meias, A ambos revelam o trabalho dos homens na terra,
como antes em terra alheia. com destaque para os produtos que nela podem
ser cultivados.
²7UDEDOKDUiVXPDWHUUD
B ambos mostram as possibilidades de desenvolvi-
da qual, além de senhor, mento do homem que trabalha a terra, com desta-
VHUiVKRPHPGHHLWRHWUDWRU que para um dos personagens.
C DPERVPRVWUDP¿JXUDWLYDPHQWHRGHVWLQRGRVXMHLWR
— Trabalhando nessa terra,
sucumbido pela seca, com a diferença de que a cena
tu sozinho tudo empreitas: GH3RUWLQDULGHVWDFDRVRIULPHQWRGRVTXH¿FDP
VHUiVVHPHQWHDGXERFROKHLWD D o poema revela a esperança, por meio de versos
livres, assim como a cena de Portinari traz uma
²7UDEDOKDUiVQXPDWHUUD perspectiva próspera de futuro, por meio do gesto.
que também te abriga e te veste: E RSRHPDPRVWUDXPFHQiULRSUyVSHURFRPHOHPHQ-
tos da natureza, como sol, chuva, insetos, e, por
embora com o brim do Nordeste.
isso, mantém uma relação de oposição com a cena
de Portinari.

2 BIOMEDICINA
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 2 QUESTÃO 3
De agosto de 2008 a janeiro de 2009, o
desmatamento na Amazônia Legal concentrou-se em
UHJL}HVHVSHFt¿FDV'RSRQWRGHYLVWDIXQGLiULRDPDLRU
parte do desmatamento (cerca de 80%) aconteceu em
iUHDV SULYDGDV RX HP GLYHUVRV HVWiJLRV GH SRVVH 2
restante do desmatamento ocorreu em assentamentos
promovidos pelo INCRA, conforme a política de Reforma
$JUiULD  XQLGDGHVGHFRQVHUYDomR  HHPWHUUDV
indígenas (7%).
Disponível em: <www.imazon.org.br>. Acesso em: 26 ago. 2010.
(com adaptações).

,QIHUHVHGRWH[WRTXHVRERSRQWRGHYLVWDIXQGLiULR
o problema do desmatamento na Amazônia Legal
HVWiFHQWUDGR

Dom Walmor Oliveira de Azevedo. A nos grupos engajados na política de proteção


Disponível em:<http://etica-bioetica.zip.net>. Acesso em: 30 ago. 2010.
ambiental, pois eles não aprofundaram o debate
DFHUFDGDTXHVWmRIXQGLiULD
A charge acima representa um grupo de cidadãos
B QRV SRYRV LQGtJHQDV SRLV HOHV GHVPDWDUDP D iUHD
pensando e agindo de modo diferenciado, frente a
que ocupavam mais do que a comunidade dos
uma decisão cujo caminho exige um percurso ético.
assentados pelo INCRA.
Considerando a imagem e as ideias que ela transmite,
C QRVSRVVHLURVLUUHJXODUHVHSURSULHWiULRVUHJXODUL]DGRV
DYDOLHDVD¿UPDWLYDVTXHVHVHJXHP
que desmataram mais, pois muitos ainda não estão
LQWHJUDGRVDRVSODQRVGHPDQHMRVXVWHQWiYHOGDWHUUD
I. A ética não se impõe imperativamente nem
D nas unidades de conservação, que costumam burlar
XQLYHUVDOPHQWH D FDGD FLGDGmR FDGD XP WHUi
OHLVIXQGLiULDVQHODVRGHVPDWDPHQWRIRLPDLRUTXHR
que escolher por si mesmo os seus valores e realizado pelos assentados pelo INCRA.
ideias, isto é, praticar a autoética. E nos assentamentos regulamentados pelo INCRA,
II. $pWLFDSROtWLFDVXS}HRVXMHLWRUHVSRQViYHO nos quais o desmatamento foi maior que o realizado
por suas ações e pelo seu modo de agir na SHORVGRQRVGHiUHDVSULYDGDVGD$PD]{QLD/HJDO
sociedade.
III. A ética pode se reduzir ao político, do mesmo ÁREA LIVRE
modo que o político pode se reduzir à ética, em
XPSURFHVVRDVHUYLoRGRVXMHLWRUHVSRQViYHO
IV. A ética prescinde de condições históricas e
sociais, pois é no homem que se situa a decisão
ética, quando ele escolhe os seus valores e as
VXDV¿QDOLGDGHV
V. $ pWLFD VH Gi GH IRUD SDUD GHQWUR FRPR
compreensão do mundo, na perspectiva do
fortalecimento dos valores pessoais.

eFRUUHWRDSHQDVRTXHVHD¿UPDHP

A I e II.
B I e V.
C II e IV.
D III e IV.
E III e V.

BIOMEDICINA 3
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 4 QUESTÃO 5
Conquistar um diploma de curso superior não 2PDSDDEDL[RUHSUHVHQWDDViUHDVSRSXODFLRQDLVVHP
garante às mulheres a equiparação salarial com os DFHVVRDRVDQHDPHQWREiVLFR
homens, como mostra o estudo “Mulher no mercado
de trabalho: perguntas e respostas”, divulgado pelo
,QVWLWXWR %UDVLOHLUR GH *HRJUD¿D H (VWDWtVWLFD ,%*( 
nesta segunda-feira, quando se comemora o Dia
Internacional da Mulher.

Segundo o trabalho, embasado na Pesquisa Mensal


de Emprego de 2009, nos diversos grupamentos de
atividade econômica, a escolaridade de nível superior
não aproxima os rendimentos recebidos por homens
H PXOKHUHV 3HOR FRQWUiULR D GLIHUHQoD DFHQWXDVH
No caso do comércio, por exemplo, a diferença de
UHQGLPHQWRSDUDSUR¿VVLRQDLVFRPHVFRODULGDGHGHRQ]H
anos ou mais de estudo é de R$ 616,80 a mais para
os homens. Quando a comparação é feita para o nível
VXSHULRUDGLIHUHQoDpGH5SDUDHOHV
Disponível em: <http://oglobo.globo.com/economia/boachance/
mat/2010/03/08>. Acesso em: 19 out. 2010 (com adaptações).
Philippe Rekacewicz (Le Monde Diplomatique). Organização Mundial da
Considerando o tema abordado acima, analise as Saúde, 2006. Disponível em: <http://www.google.com.br/mapas>.
D¿UPDo}HVVHJXLQWHV Acesso em: 28 ago. 2010.

I. 4XDQWRPDLRURQtYHOGHDQiOLVHGRVLQGLFDGRUHV Considerando o mapa apresentado, analise as


GH JrQHURV PDLRU VHUi D SRVVLELOLGDGH GH D¿UPDo}HVTXHVHVHJXHP
LGHQWL¿FDomRGDUHDOLGDGHYLYLGDSHODVPXOKHUHV
no mundo do trabalho e da busca por uma I. A globalização é fenômeno que ocorre de
SROtWLFDLJXDOLWiULDFDSD]GHVXSHUDURVGHVD¿RV maneira desigual entre os países, e o progresso
das representações de gênero. social independe dos avanços econômicos.
II. Conhecer direitos e deveres, no local de trabalho II. Existe relação direta entre o crescimento
HQDYLGDFRWLGLDQDpVX¿FLHQWHSDUDJDUDQWLUD da ocupação humana e o maior acesso ao
alteração dos padrões de inserção das mulheres VDQHDPHQWREiVLFR
no mercado de trabalho. III. Brasil, Rússia, Índia e China, países pertencentes
ao bloco dos emergentes, possuem percentual
III. No Brasil, a desigualdade social das minorias
da população com acesso ao saneamento
pWQLFDVGHJrQHURHGHLGDGHQmRHVWiDSHQDV
EiVLFRDEDL[RGDPpGLDPXQGLDO
circunscrita pelas relações econômicas, mas
IV. 2 PDLRU DFHVVR DR VDQHDPHQWR EiVLFR RFRUUH
DEUDQJHIDWRUHVGHFDUiWHUKLVWyULFRFXOWXUDO
em geral, em países desenvolvidos.
IV. Desde a aprovação da Constituição de 1988, tem V. Para se analisar o índice de desenvolvimento
havido incremento dos movimentos gerados no humano (IDH) de um país, deve-se diagnosticar
âmbito da sociedade para diminuir ou minimizar
VXDV FRQGLo}HV EiVLFDV GH LQIUDHVWUXWXUD VHX
a violência e o preconceito contra a mulher, a
PIB per capita, a saúde e a educação.
criança, o idoso e o negro.
eFRUUHWRDSHQDVRTXHVHD¿UPDHP eFRUUHWRDSHQDVRTXHVHD¿UPDHP

A I e II. A I e II.
B II e IV. B I e III.
C III e IV. C II e V.
D I, II e III. D III e IV.
E I, III e IV. E IV e V.

4 BIOMEDICINA
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 6
Levantamento feito pelo jornal Folha de S. Paulo e publicado em 11 de abril de 2009, com base em dados de 2008,
revela que o índice de homicídios por 100 mil habitantes no Brasil varia de 10,6 a 66,2. O levantamento inclui dados
GH  HVWDGRV H GR 'LVWULWR )HGHUDO 'H DFRUGR FRP D 2UJDQL]DomR 0XQGLDO GD 6D~GH 206  iUHDV FRP tQGLFHV
superiores a 10 assassinatos por 100 mil habitantes são consideradas zonas epidêmicas de homicídios.

$QiOLVHGDPRUWDOLGDGHSRUKRPLFtGLRVQR%UDVLO
Disponível em: <KWWSZZZIROKDXROFRPEUIROKDFRWLGLDQRXOWXVKWPO!
Acesso em: 22 ago. 2010.

$SDUWLUGDVLQIRUPDo}HVGRWH[WRHGRJUi¿FRDFLPDFRQFOXLVHTXH

A o número total de homicídios em 2008 no estado da Paraíba é inferior ao do estado de São Paulo.
B os estados que não divulgaram os seus dados de homicídios encontram-se na região Centro-Oeste.
C a média aritmética das taxas de homicídios por 100 mil habitantes da região Sul é superior à taxa média aproximada
do Brasil.
D a taxa de homicídios por 100 mil habitantes do estado da Bahia, em 2008, supera a do Rio Grande do Norte em
mais de 100%.
E Roraima é o estado com menor taxa de homicídios por 100 mil habitantes, não se caracterizando como zona
epidêmica de homicídios.

BIOMEDICINA 
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 7 QUESTÃO 8
Para preservar a língua, é preciso o cuidado de falar Isótopos radioativos estão ajudando a diagnosticar
de acordo com a norma padrão. Uma dica para o bom as causas da poluição atmosférica. Podemos, com
desempenho linguístico é seguir o modelo de escrita dos essa tecnologia, por exemplo, analisar o ar de uma
FOiVVLFRV,VVRQmRVLJQL¿FDQHJDURSDSHOGDJUDPiWLFD região e determinar se um poluente vem da queima do
normativa; trata-se apenas de ilustrar o modelo dado petróleo ou da vegetação.
por ela. A escola é um lugar privilegiado de limpeza
dos vícios de fala, pois oferece inúmeros recursos para Outra utilização dos isótopos radioativos que
o domínio da norma padrão e consequente distância SRGH QR IXWXUR GLPLQXLU D iUHD GH GHVPDWDPHQWR
GD QmR SDGUmR (VVH GRPtQLR p R TXH OHYDUi R VXMHLWR para uso da agricultura é a irradiação nos alimentos. A
D GHVHPSHQKDU FRPSHWHQWHPHQWH DV SUiWLFDV VRFLDLV técnica consiste em irradiar com isótopos radioativos
trata-se do legado mais importante da humanidade. para combater os micro-organismos que causam o
PORQUE apodrecimento dos vegetais e aumentar a longevidade
dos alimentos, diminuindo o desperdício. A irradiação
$ OLQJXDJHP Gi DR KRPHP XPD SRVVLELOLGDGH GH FULDU GH SURGXWRV DOLPHQWtFLRV Mi p XPD UHDOLGDGH SRLV
mundos, de criar realidades, de evocar realidades não grandes indústrias que vendem frutas ou suco utilizam
presentes. E a língua é uma forma particular dessa essa técnica.
faculdade [a linguagem] de criar mundos. A língua,
nesse sentido, é a concretização de uma experiência 1D iUHD PpGLFD DV VROXo}HV QXFOHDUHV HVWmR
KLVWyULFD(ODHVWiUDGLFDOPHQWHSUHVDjVRFLHGDGH HP IHUUDPHQWDV GH GLDJQyVWLFR FRPR D WRPRJUD¿D
XAVIER, A. C. & CORTEZ, S. (orgs.). Conversas com Linguistas: e a ressonância magnética, que conseguem apontar,
virtudes e controvérsias da Linguística. Rio de Janeiro: sem intervenção cirúrgica, mudanças metabólicas em
3DUiEROD(GLWRULDOS FRPDGDSWDo}HV 
iUHDV GR FRUSR 2V H[DPHV FRQVHJXHP LQFOXVLYH
Analisando a relação proposta entre as duas asserções detectar tumores que ainda não causam sintomas,
acima, assinale a opção correta. possibilitando um tratamento precoce do câncer e
maior possibilidade de cura.
A As duas asserções são proposições verdadeiras, e a
Correio Popular de Campinas, 22 ago. 2010, p.B9 (com adaptações).
VHJXQGDpXPDMXVWL¿FDWLYDFRUUHWDGDSULPHLUD
B As duas asserções são proposições verdadeiras, mas
DVHJXQGDQmRpXPDMXVWL¿FDWLYDFRUUHWDGDSULPHLUD A notícia acima
C A primeira asserção é uma proposição verdadeira, e A comenta os malefícios do uso de isótopos radioativos,
a segunda é uma proposição falsa. relacionando-os às causas da poluição atmosférica.
D A primeira asserção é uma proposição falsa, e a
B elenca possibilidades de uso de isótopos radioativos,
segunda é uma proposição verdadeira.
evidenciando, assim, benefícios do avanço
E As duas asserções são proposições falsas.
tecnológico.
ÁREA LIVRE C destaca os perigos da radiação para a saúde,
alertando sobre os cuidados que devem ter a
medicina e a agroindústria.
D propõe soluções nucleares como ferramentas de
diagnóstico em doenças de animais, alertando para
os malefícios que podem causar ao ser humano.
E H[SOLFD FLHQWL¿FDPHQWH DV YiULDV WpFQLFDV GH
tratamento em que se utilizam isótopos radioativos
para matar os micro-organismos que causam o
apodrecimento dos vegetais.

6 BIOMEDICINA
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 9
As seguintes acepções dos termos democracia e ética foram extraídDVGR'LFLRQiULR+RXDLVVGD/tQJXD3RUWXJXHVD
democracia. POL. 1 governo do povo; governo em que o povo exerce a soberania 2 sistema político cujas ações
atendem aos interesses populares 3 governo no qual o povo toma as decisões importantes a respeito das políticas
públicas, não de forma ocasional ou circunstancial, mas segundo princípios permanentes de legalidade 4 sistema
político comprometido com a igualdade ou com a distribuição equitativa de poder entre todos os cidadãos 5 governo
que acata a vontade da maioria da população, embora respeitando os direitos e a livre expressão das minorias

ética. 1 SDUWHGD¿ORVR¿DUHVSRQViYHOSHODLQYHVWLJDomRGRVSULQFtSLRVTXHPRWLYDPGLVWRUFHPGLVFLSOLQDPRXRULHQWDP
R FRPSRUWDPHQWR KXPDQR UHÀHWLQGR HVS D UHVSHLWR GD HVVrQFLD GDV QRUPDV YDORUHV SUHVFULo}HV H H[RUWDo}HV
presentes em qualquer realidade social 2 p.ext. conjunto de regras e preceitos de ordem valorativa e moral de um
indivíduo, de um grupo social ou de uma sociedade
Dicionário Houaiss da Língua Portuguesa. Rio de Janeiro: Objetiva, 2001.

&RQVLGHUDQGRDVDFHSo}HVDFLPDHODERUHXPWH[WRGLVVHUWDWLYRFRPDWpOLQKDVDFHUFDGRVHJXLQWHWHPD

Comportamento ético nas sociedades democráticas.


Em seu texto, aborde os seguintes aspectos:

D FRQFHLWRGHVRFLHGDGHGHPRFUiWLFD YDORUSRQWRV
b) evidências de um comportamento não ético de um indivíduo; (valor: 3,0 pontos)
c) exemplo de um comportamento éticRGHXPIXWXURSUR¿VVLRQDOFRPSURPHWLGRFRPDFLGDGDQLD YDORUSRQWRV

RASCUNHO - QUESTÃO 9
1

10

11

12

13

14



BIOMEDICINA 7
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 10
Para a versão atual do Plano Nacional de Educação (PNE), em vigor desde 2001 e com encerramento previsto
para 2010, a esmagadora maioria dos municípios e estados não aprovou uma legislação que garantisse recursos para
cumprir suas metas. A seguir, apresentam-se alguns indicativos do PNE 2001.
(QWUHHPLOK}HVGHSHVVRDV¿]HUDP
parte de turmas de Educação de Jovens e Adultos
(EJA). Parece muito, mas representa apenas um terço
dos mais de 29 milhões de pessoas que não chegaram
à 4ª série e seriam o público-alvo dessa faixa de
ensino. A inclusão da EJA no Fundo de Manutenção e
'HVHQYROYLPHQWRGD(GXFDomR%iVLFDHGH9DORUL]DomR
GRV3UR¿VVLRQDLVGD(GXFDomR )81'(% UHSUHVHQWRX
uma fonte de recursos para ampliar a oferta, mas não
atacou a evasão, hoje em alarmantes 43%.
Disponível em: <http://revistaescola.abril.com.br/politicas-publicas>.
Acesso em: 31 ago. 2010 (com adaptações).

Com base nos dados do texto acima e tendo em vista que novas diretrizes darão origem ao PNE de 2011 – documento
que organiza prioridades e propõe metas a serem alcançadas nos dez anos seguintes –, redija um único texto
DUJXPHQWDWLYRHPQRPi[LPROLQKDVDFHUFDGDVHJXLQWHDVVHUWLYD

2GHVD¿RKRMHQmRpVyPDWULFXODUPDVPDQWHURVDOXQRVGD(GXFDomRGH-RYHQVH$GXOWRVQDHVFROD
diminuindo a repetência e o abandono.
Em seu texto, contemple os seguintes aspectos:
D DDVVRFLDomRHQWUHHVFRODHWUDEDOKRQDYLGDGRVHVWXGDQWHVGD(-$ YDORUSRQWRV
b) uma proposta de ação que garanta a qualidade do ensino e da aprendizagem e diminua a repetência e a evasão.
YDORUSRQWRV

RASCUNHO - QUESTÃO 10
1

10

11

12

13

14



8 BIOMEDICINA
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

COMPONENTE ESPECÍFICO
QUESTÃO 11 QUESTÃO 12
3DUDDSUHVHQWDUHPJUi¿FRVGDGRVUHIHUHQWHVjGLVWULEXLomR &RQVLGHUH TXH XP HVWXGDQWH GXUDQWH FHUWD DWLYLGDGH
GHIUHTXrQFLDVGHXPJUXSRGHPHGLo}HVSRGHVHDSOLFDU ODERUDWRULDO QHFHVVLWD SUHSDUDU XPD VROXomR GH iFLGR
VXOI~ULFR  PRO/ HP / D SDUWLU GD GLOXLomR GH XPD
XPPRGHORVHPHOKDQWHDRHVWDEHOHFLGRQD¿JXUDDEDL[R
VROXomRGHiFLGRVXOI~ULFRPRO/1HVVDVLWXDomRR
QD TXDO R SHVTXLVDGRU YHUL¿FD D YDULDomR GH DQWLFRUSRV YROXPH QHFHVViULR SDUD SUHSDUDU D VROXomR GH iFLGR
HPUHODomRDXPDFRRUWHSRSXODFLRQDOHVSHFt¿FD VXOI~ULFRPRO/VHULD

Variação dos títulos de anticorpos para doença X A —/


em área endêmica B /
C P/
D /
E —/

QUESTÃO 13
1R %UDVLO DV SHVTXLVDV TXH HQYROYHP VHUHV
KXPDQRV VmR UHJXODPHQWDGDV SRU UHVROXomR
HVSHFt¿FD GR &RQVHOKR 1DFLRQDO GH 6D~GH &16  TXH
DSUHVHQWD SDUWLFXODULGDGHV LQRYDGRUDV H SLRQHLUDV7UDWD
VH GH XP GRFXPHQWR TXH QmR WHP FDUDFWHUtVWLFDV GH
FyGLJRGHFUHWROHLUHJLPHQWRRXHVWDWXWRHQmRVHDSOLFD
GLUHWDPHQWH DR SHVTXLVDGRU 6XD HVVrQFLD H VXD IRUPD
UHPHWHPDXPDUHÀH[mRGHQDWXUH]DpWLFDDOpPGRVLPSOHV
UHVSHLWRDYDORUHVPRUDLVRXHQXQFLDGRVGHRQWROyJLFRV

PORQUE

$ UHVROXomR GR &16 p HVVHQFLDOPHQWH YROWDGD


SDUD D SURWHomR GR VXMHLWR GD SHVTXLVD HQIDWL]DQGR R
'LVSRQtYHOHPKWWSWHFQRORJLDHJHVWDRZRUGSUHVVFRP! UHVSHLWRjGLJQLGDGHGRVHUKXPDQRHRXGDFROHWLYLGDGH
$FHVVRHPDJR DGDSWDGR 
DVVHJXUDQGRRGLUHLWRjSULYDFLGDGHjFRQ¿GHQFLDOLGDGH
EsVDUHSUHVHQWDomRJUi¿FDpXPPRGHORGH DRVLJLORHjQmRHVWLJPDWL]DomR GHTXDOTXHUQDWXUH]D
RXWLSR $RPHVPRWHPSRSRVVLELOLWDjVSHVVRDVRXjV
A JUi¿FR GH VHWRUHV TXH GHPRQVWUD D YDULDomR SRSXODo}HVHPFRQGLo}HVGHYXOQHUDELOLGDGHDOLEHUGDGH
jDXWRGHWHUPLQDomR
GH DQWLFRUSRV QD DEVFLVVD < H GH SRSXODomR QD
RUGHQDGD; +2661(:63HVTXLVD(QYROYHQGR6HUHV+XPDQRV
Medicina FRPDGDSWDo}HV 
B KLVWRJUDPDTXHGHPRQVWUDYDULDo}HVGHDQWLFRUSRV
$QDOLVDQGRDUHODomRSURSRVWDHQWUHDVGXDVDVVHUo}HV
QDDEVFLVVD;HGHSRSXODomRQDRUGHQDGD< DFLPDDVVLQDOHDDOWHUQDWLYDFRUUHWD
C JUi¿FR GH WHQGrQFLD FHQWUDO TXH GHPRQVWUD
A $VGXDVDVVHUo}HVVmRSURSRVLo}HVYHUGDGHLUDVHD
YDULDo}HV GH DQWLFRUSRV QD DEVFLVVD ; H GH
VHJXQGDpXPDMXVWL¿FDWLYDFRUUHWDGDSULPHLUD
SRSXODomRQDRUGHQDGD< B $V GXDV DVVHUo}HV VmR SURSRVLo}HV YHUGDGHLUDV
D JUi¿FR GH GLVSHUVmR TXH GHPRQVWUD D WHQGrQFLD PDV D VHJXQGD QmR p XPD MXVWL¿FDWLYD FRUUHWD GD
FHQWUDOGDVPpGLDVGHFRQFHQWUDomRGRVYDORUHVGH SULPHLUD
DQWLFRUSRVQDSRSXODomR C $SULPHLUDDVVHUomRpXPDSURSRVLomRYHUGDGHLUDH
DVHJXQGDpXPDSURSRVLomRIDOVD
E JUi¿FR GH OLQKDV TXH GHPRQVWUD D WHQGrQFLD D $ SULPHLUD DVVHUomR p XPD SURSRVLomR IDOVD H D
FHQWUDOEDVHDGDQDPHGLDQDGDVFRQFHQWUDo}HVGH VHJXQGDpXPDSURSRVLomRYHUGDGHLUD
DQWLFRUSRVQDSRSXODomR E $VGXDVDVVHUo}HVVmRSURSRVLo}HVIDOVDV

BIOMEDICINA 9
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 14 QUESTÃO 16
8P GRV JUDQGHV SUREOHPDV HFROyJLFRV QD DWXDOLGDGH 0LFURUJDQLVPRVFRPRDEDFWpULDHelicobacter pyloriVmR
p R ODQoDPHQWR DR DPELHQWH GH SURGXWRV TXtPLFRV XVDGRVFRPRPDUFDGRUHVGHPLJUDomRGHSRSXODo}HV
SHULJRVRV GH IRUPD LQDGHTXDGD UHVXOWDQGR WDQWR HP HDQFHVWUDOLGDGHGHGLYHUVRVSRYRVSRUSRVVXtUHPDOWDV
ULVFRDRDPELHQWHTXDQWRHPULVFRjVD~GHS~EOLFD$V WD[DVGHPXWDomRHPVHXVHouseKeeping genes JHQHV
SURSULHGDGHVTXHFRQIHUHPSHULFXORVLGDGHDRVUHVtGXRV HVVHQFLDLV 2UHJLVWURGHVVDVDOWHUDo}HVSRGHLQGLFDU
TXtPLFRVDSUHVHQWDPTXDWURSDUkPHWURVGH¿QLGRVSRUOHL RtQGLFHGHDQFHVWUDOLGDGHHRSDGUmRGHPLJUDomRGH
LQÀDPDELOLGDGHWR[LFLGDGHFRUURVLYLGDGHHUHDWLYLGDGH
SRSXODo}HV
&RQVLGHUDQGR WDLV SDUkPHWURV R JHUHQFLDPHQWR GH
UHVtGXRVTXtPLFRVLQFOXL $WpFQLFDGHELRORJLDPROHFXODUGHPDLRUYDORUFLHQWt¿FR
,PDQXVHLR GRV SURGXWRV TXtPLFRV YROiWHLV HP SDUDRUHFRQKHFLPHQWRGDVYDULDo}HVJHQpWLFDVQHVVHV
ÀX[RVODPLQDUHV PLFURUJDQLVPRV SRU SRVVLELOLWDU D FRPSDUDomR HQWUH
,,UHGXomR GH UHVtGXRV JHUDGRV SRU PHLR GR HVSpFLHV LVRODGDV GH GLIHUHQWHV IRQWHV H RIHUHFHU
SODQHMDPHQWRQDDTXLVLomRGHSURGXWRVTXtPLFRV UHVXOWDGRV¿QDLVLQHTXtYRFRVp
,,,GHVFDUWH GH UHVtGXRV TXtPLFRV SHULJRVRV HP
A DDQiOLVHGHGLIHUHQWHVIUDJPHQWRVJHUDGRVSRUHQ]LPDV
DWHUURVLQGXVWULDLVRXSRU,QFLQHUDomR
GHUHVWULomRHVHSDUDGRVSRUHOHWURIRUHVH 5)/3 
,9DFRQGLFLRQDPHQWR FRUUHWR GR SURGXWR GHVGH D
URWXODJHP GRV IUDVFRV GH UHDJHQWHV DWp D VXD B D DPSOL¿FDomR GH IUDJPHQWRV GH '1$ GH IRUPD
HVWRFDJHPHPDQLSXODomR UDQG{PLFD 5$3' SDUDFRPSDUDomRGRVVHJPHQWRV
9GHVDWLYDomRGRVUHVtGXRVTXtPLFRVSRUGLOXLomR SURGX]LGRVDRWpUPLQRGDUHDomR
HP iJXD WRPDQGR R FXLGDGR DR PDQXVHDU C DUHDomRHPFDGHLDSHODSROLPHUDVH 3&5 TXHDP
iFLGRV IRUWHV TXH GHYHP UHFHEHU TXDQWLGDGHV
SOL¿FDVHTXrQFLDVSDVVtYHLVGHVHUHPFRQIURQWDGDV
FUHVFHQWHVGHiJXDSDUDVXDWRWDOGHVDWLYDomR
HQWUHHVSpFLHV
(VWmRGHDFRUGRFRPRVSDGU}HVGHJHUHQFLDPHQWRGH
D RVHTXHQFLDPHQWRGH'1$TXHSRVVLELOLWDDLGHQWL
UHVtGXRVTXtPLFRVDSHQDVRVLWHQV
¿FDomR GD VHTXrQFLD GDV EDVHV QLWURJHQDGDV GDV
A ,,,H,,, PROpFXODVIDYRUHFHQGRDVDQiOLVHVFRPSDUDWLYDV
B ,,,,H9
E DFLWRPHWULDGHÀX[RTXHSRVVLELOLWDDVHSDUDomRGH
C ,,9H9
D ,,,,,H,9 IUDo}HVHVSpFLHHVSHFt¿FDVIDFLOLWDQGRDFRPSDUD
E ,,,9H9 omRHQWUHHVSpFLHV

QUESTÃO 15 QUESTÃO 17
$V UDGLDo}HV LRQL]DQWHV FRPSUHHQGHP XP DPSOR
$OJXQV QHPDWHOPLQWRV FRPR SRU H[HPSOR RV
HVSHFWUR HOHWURPDJQpWLFR FRP GHVWDTXH SDUD DV
UDGLDo}HV JDPD ȖHRVUDLRV;TXHSRVVXHPHQHUJLD Strongyloides stercoralis, DSUHVHQWDP FLFOR SXOPRQDU
VX¿FLHQWH SDUD LRQL]DU DV PROpFXODV 'HVVH PRGR D 7RVVH GLVSQpLD H HRVLQR¿OLD VmR VLQWRPDV DVVRFLDGRV
LRQL]DomR SURGX]LGD SHORV UDLRV Ȗ H RV UDLRV ; SRGHP DHVVDSDUDVLWRVH(PFDVRVDVVLPDOpPGRVH[DPHV
FDXVDU GDQRV FHOXODUHV TXDQGR HVWHV UDLRV VmR FRSURVFySLFRVpLQGLFDGDWDPEpPGRVDJHP
DEVRUYLGRVSHORWHFLGRHOLEHUDPHQHUJLD
A GH ,J( H HRVLQy¿ORV GHYLGR D UHVSRVWD 7+ H
+(1(,1(,)Biofísica BásicaS FRPDGDSWDo}HV 
SHVTXLVDGHODUYDVQDVHFUHomREU{QTXLFD
2VUDLRV;TXHVmRH[HPSORVGHUDGLDo}HVLRQL]DQWHV B GH,J$HLQ¿OWUDGRFHOXODUFRPSRVWRSRUPDFUyIDJRV
VmRSURGX]LGRV
GHYLGR D UHVSRVWD 7+ H SHVTXLVD GH ODUYDV QD
A DSDUWLUGHSDUWtFXODVEHWD ȕ FDUUHJDGDVQHJDWLYDPHQWH VHFUHomREU{QTXLFD
B SRU HPLVVmR GH UDGLDo}HV JDPD Ȗ  GHULYDGDV GR
C GH ,J0 H HRVLQy¿ORV GHYLGR D UHVSRVWD 7+ H
Q~FOHRDW{PLFR
C DSyVDHPLVVmRGHSDUWtFXODVDOID Į HPLWLGDVSHOR SHVTXLVDGHODUYDVQDVHFUHomREU{QTXLFD
Q~FOHRDW{PLFR D GH ,J* H HRVLQy¿ORV GHYLGR D UHVSRVWD 7+ H
D D SDUWLU GD HPLVVmR VLPXOWkQHD GH SDUWtFXODV DOID SHVTXLVDGHODUYDVQDVHFUHomREU{QTXLFD
Į HEHWD ȕ SHORQ~FOHRDW{PLFR
E SRU HMHo}HV GRV HOpWURQV RUELWDLV RX FKRTXH GH E GH ,J( H HRVLQy¿ORV  GHYLGR D UHVSRVWD FHOXODU
HOpWURQVDFHOHUDGRVFRQWUDREVWiFXORV LQGHSHQGHQWHHSHVTXLVDGHRYRVQRWHFLGRKHSiWLFR

10 BIOMEDICINA
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 18 QUESTÃO 19
$V FLWRFLQDV VmR SURWHtQDV UHJXODWyULDV SURGX]LGDV $FRPSUHHQVmRGD¿VLRORJLDGDH[FUHomRGDELOLUUXELQD
H VHFUHWDGDV SRU YiULRV WLSRV FHOXODUHV (QWUH HODV SHOR ItJDGR H D XWLOL]DomR GH DOJXQV WHVWHV VLPSOHV
GHVWDFDPVH RV LQWHUIHURQV ,)1Į ,)1ȕ H ,)1Ȗ  WRUQDPSRVVtYHORGLDJQyVWLFRGLIHUHQFLDOGDVLFWHUtFLDV
$ FORQDJHP GRV JHQHV TXH FRGLILFDP RV WUrV WLSRV $V FDXVDV GH LFWHUtFLD SRGHP VHU SUpKHSiWLFDV LQWUD
GH LQWHUIHURQV SRVVLELOLWRX D SURGXomR GHVVDV
KHSiWLFDVHSyVKHSiWLFDV
FLWRFLQDV SHODV LQG~VWULDV GH ELRWHFQRORJLD R TXH
UHGX]LX VXEVWDQFLDOPHQWH RV FXVWRV GH SURGXomR H 2TXDGURDVHJXLUFRQWpPGDGRVDFHUFDGDVDOWHUDo}HV
WHP SRVVLELOLWDGR R XVR FOtQLFR GHVVDV FLWRFLQDV HP GRV QtYHLV GH ELOLUUXELQD QR SODVPD VDQJXtQHR H GD
YiULDVGRHQoDV
SUHVHQoDRXDXVrQFLDGHELOLUUXELQDHXURELOLQRJrQLRQD
&RQVLGHUDQGR DV FpOXODV SURGXWRUDV DV Do}HV GRV XULQDGRVLQGLYtGXRVHLFWpULFRV
LQWHUIHURQV H DV SRVVLELOLGDGHV GH XVR FOtQLFR GHVVDV
FLWRFLQDVDYDOLHDVD¿UPDWLYDVDVHJXLU Indivíduos Ictéricos
,2V LQWHUIHURQV VmR SURGX]LGRV SRU PDFUyIDJRV 1 2 3
LQGX]HPDGLPLQXLomRGDH[SUHVVmRGHPROpFXODV
GH0+&,H0&+,,DXPHQWDPDDWLYLGDGHGDV %LOLUUXELQDWRWDO Ĺ Ĺ Ĺ
FpOXODV 1. H SRGHP VHU HPSUHJDGRV FRPR
WUDWDPHQWRGDVKHSDWLWHV %LOLUUXELQDLQGLUHWD
Ĺ 1RXĹ N
,,,)1Į ,)1ȕ H ,)1Ȗ VmR VHFUHWDGRV SRU QmRFRQMXJDGD
PDFUyIDJRV H FpOXODV 7K LQGX]HP R HVWDGR %LOLUUXELQDGLUHWD
DQWLYLUDO HP FpOXODV QXFOHDGDV H SRGHP N Ĺ Ĺ
VHU XVDGRV FOLQLFDPHQWH QDV GRHQoDV  FRQMXJDGD
JUDQXORPDWRVDVFU{QLFDV
,,,,)1Į ,)1ȕ H ,)1Ȗ VmR VHFUHWDGRV SRU %LOLUUXELQDQD
DXVHQWH presente presente
GLIHUHQWHV WLSRV FHOXODUHV H DXPHQWDP D XULQD
H[SUHVVmR GH PROpFXODV GH 0+& , VHQGR TXH
,)1Į SRGH VHU XWLOL]DGR SDUD R WUDWDPHQWR GH 8URELOLQRJrQLRQD
presente presente DXVHQWH
YiULRVWLSRVGHQHRSODVLDVPDOLJQDV XULQD
,92,)1ȖpVHFUHWDGRSRUFpOXODV7KPHOKRUDD
1 YDORUHVQRUPDLV Ĺ YDORUHVDXPHQWDGRV
FDSDFLGDGHGDVFpOXODVIDJRFtWLFDVQDHOLPLQDomR
GHSDWyJHQRVHSRGHVHUXWLOL]DGRQRWUDWDPHQWR 2VUHVXOWDGRVDSUHVHQWDGRVQRTXDGURDFLPDSHUPLWHP
GDGRHQoDJUDQXORPDWRVDFU{QLFD FRQFOXLUHPUHODomRjFDXVDGDLFWHUtFLDTXH
eFRUUHWRDSHQDVRTXHVHD¿UPDHP
A RLQGLYtGXRDSUHVHQWDFDXVDLQWUDKHSiWLFDSRLV
A ,H,, R XURELOLQRJrQLR QmR HVWi VHQGR VLQWHWL]DGR QR
B ,H,,, ItJDGR
C ,H,9 B RLQGLYtGXRDSUHVHQWDFDXVDLQWUDKHSiWLFDSRLV
D ,,H,9 RItJDGRQmRSURGX]ELOLUUXELQDSDUDVHUH[FUHWDGD
E ,,,H,9 QDXULQD
C RLQGLYtGXRDSUHVHQWDFDXVDSyVKHSiWLFDSRLV
ÁREA LIVRE D ELOLUUXELQD H R XURELOLQRJrQLR HVWmR SUHVHQWHV
QDXULQD
D RLQGLYtGXRDSUHVHQWDFDXVDSyVKHSiWLFDSRLVD
ELOLUUXELQDFRQMXJDGDHVWiDXPHQWDGDRTXHLQGLFD
TXHQmRpH[FUHWDGDQDELOH
E R LQGLYtGXR  DSUHVHQWD FDXVD SUpKHSiWLFD
SRLV D ELOLUUXELQD FRQMXJDGD HVWi DXPHQWDGD H R
XURELOLQRJrQLRpVLQWHWL]DGRQRItJDGR

BIOMEDICINA 11
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 20

*5,)),7+6et alIntrodução à genéticaHG*XDQDEDUD.RRJDQ

2JUi¿FRDFLPDUHÀHWHDLQFLGrQFLDGHXPDGDVDQHXSORLGLDVPDLVIUHTXHQWHVHQWUHRVVHUHVKXPDQRVTXHGHWHUPLQD
DRFRUUrQFLDGDVtQGURPHGH'RZQ2VSRUWDGRUHVGHVVDVtQGURPHSRVVXHPFpOXODVTXHFRQWrPXPDDOWHUDomRQR
Q~PHURGHFURPRVVRPRVGHFRUUHQWHGHXPHUURGXUDQWHRSURFHVVRGHPHLRVH1DDWXDOLGDGHPXLWRVFDVDLVEXVFDP
FOtQLFDV GH DFRQVHOKDPHQWR JHQpWLFR FRP R LQWXLWR GH FRQKHFHU R SDGUmR FURPRVV{PLFR GH VHXV ¿OKRV DQWHV GR
QDVFLPHQWRFRPEDVHQRVUHVXOWDGRVREWLGRVSRUPRGHUQDVWpFQLFDVGHDQiOLVHFURPRVV{PLFD

$SDUWLUGHVVDVLQIRUPDo}HVDVVLQDOHDDOWHUQDWLYDFRUUHWD

A $DYDOLDomRGRVFURPRVVRPRVIHWDLVSRUH[DPHVHVSHFt¿FRVHPFpOXODVREWLGDVSRUDPQLRFHQWHVHFRUGRFHQWHVH
RXSXQomRGHYLORVLGDGHVFRUL{QLFDVSRGHUHYHODUDWULVVRPLDGRFURPRVVRPRHpUHFXUVRDVHUVXJHULGRSHORV
PpGLFRVJHQHWLFLVWDVDPXOKHUHVFRPLGDGHDYDQoDGDTXHVLQWDPQHFHVVLGDGHGHVVHWLSRGHDYDOLDomRSUpQDWDOGH
VHXV¿OKRVPDVQmRDPXOKHUHVMRYHQVTXHQmRDSUHVHQWDPIHQ{PHQRVGHQmRGLVMXQomR
B $DYDOLDomRGRVFURPRVVRPRVIHWDLVSRUH[DPHVHVSHFt¿FRVHPFpOXODVREWLGDVSRUDPQLRFHQWHVHFRUGRFHQWHVH
RXSXQomRGHYLORVLGDGHVFRUL{QLFDVSRGHUHYHODUDWULVVRPLDGRFURPRVVRPRHpUHFXUVRDVHUVXJHULGRSHORV
PpGLFRVJHQHWLFLVWDVDPXOKHUHVMRYHQVRXFRPLGDGHDYDQoDGDTXHVLQWDPQHFHVVLGDGHGHVVHWLSRGHDYDOLDomR
SUpQDWDOGHVHXV¿OKRV
C $VHJUHJDomRFURPRVV{PLFDDQRUPDOREVHUYDGDQDVtQGURPHGH'RZQpLQÀXHQFLDGDSRVLWLYDPHQWHSHODLGDGH
DYDQoDGD GD PmH PDV QHVVDV PXOKHUHV VmR REVHUYDGRV RXWURV IDWRUHV GH ULVFR SDUD D VtQGURPH TXH Mi VH
HQFRQWUDP EHP HVWDEHOHFLGRV FRPR R PHWDEROLVPR DQRUPDO GR IRODWR H D PXWDomR  &o7  QR JHQH GD
PHWLOHQRWHWUDKLGURIRODWR UHGXWDVH$ VRPDWyULD GHVVHV GRLV IDWRUHV p FRQGLomR QHFHVViULD SDUD D RFRUUrQFLD GD
DOWHUDomRFURPRVV{PLFD
D $ VHJUHJDomR FURPRVV{PLFD DQRUPDO REVHUYDGD QD VtQGURPH GH 'RZQ QmR p LQÀXHQFLDGD SRVLWLYDPHQWH SHOD
LGDGH DYDQoDGD GD PmH SRLV RXWURV IDWRUHV GH ULVFR SDUD D VtQGURPH TXH Mi VH HQFRQWUDP EHP HVWDEHOHFLGRV
FRPRRPHWDEROLVPRDQRUPDOGRIRODWRHDPXWDomR &o7 QRJHQHGDPHWLOHQRWHWUDKLGURIRODWRUHGXWDVHVmR
IXQGDPHQWDLVQDLQGXomRGRHUURPHLyWLFRTXHGHWHUPLQDDDOWHUDomRFURPRVV{PLFD
E $ DYDOLDomR GRV FURPRVVRPRV IHWDLV SDUD UHYHODU D WULVVRPLD GR FURPRVVRPR  SRU H[DPHV HVSHFt¿FRV HP
FpOXODVREWLGDVSRUDPQLRFHQWHVHFRUGRFHQWHVHRXSXQomRGHYLORVLGDGHVFRUL{QLFDVUHTXHUDDQiOLVHVLPXOWkQHD
GRPHWDEROLVPRGRIRODWRSRLVDDOWHUDomRGHVVDYLDPHWDEyOLFDpGHWHUPLQDQWHGDQmRGLVMXQomRFURPRVV{PLFD

12 BIOMEDICINA
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 21 QUESTÃO 22
2VOLVRVVRPRVHVWmRSUHVHQWHVHPSUDWLFDPHQWHWRGDV
$QDWRPLFDPHQWHRGXFWRGRFROpGRFRXQHVHDRGXFWR DV FpOXODV HXFDULRQWHV VXD RULJHP p R FRPSOH[R GH
SDQFUHiWLFR IRUPDQGR XPD GLODWDomR GHQRPLQDGD *ROJL H HOHV VmR GRWDGRV GH YiULRV WLSRV GLIHUHQWHV GH
HQ]LPDV GLJHVWLYDV 8PD GDV SULQFLSDLV FDUDFWHUtVWLFDV
DPSRODGH9DWHU(VVDSRUVXDYH]pHQYROYLGDSRUWHFLGR
GHVVD RUJDQHOD p D DXWRIDJLD SURFHVVR HP TXH Ki
PXVFXODUFRPIRUPDWRFLUFXODWyULRTXH¿VLRORJLFDPHQWH DXWRGLJHVWmRFHOXODU(PDOJXPDVVLWXDo}HVTXDQGRXP
RUJDQLVPRpSULYDGRGHDOLPHQWRHDVUHVHUYDVGHVHX
UHJXOD D VDtGD GR VXFR ELOLDU H SDQFUHiWLFR SDUD D
FRUSRVHHVJRWDPDVFpOXODVSDVVDPDGLJHULUSDUWHVGH
VHJXQGDSRUomRGRGXRGHQR VLPHVPDVFRPRHVWUDWpJLDGHVREUHYLYrQFLD

&RQVLGHUDQGRDVGLIHUHQWHVDWLYLGDGHVFHOXODUHVHPTXH
HVWmRHQYROYLGRVRVOLVRVVRPRVDYDOLHDVD¿UPDWLYDVD
VHJXLU

,$ DXWRIDJLD QmR p XP HYHQWR HVVHQFLDO j


VREUHYLGDGDFpOXODXPDYH]TXHDFODVPRFLWRVH
WHPSDSHOVLPLODUFRPRSRUH[HPSORDIXQomR
GHGHVFDUWDURUJDQHODVGHVJDVWDGDVHLQYLiYHLV
¿VLRORJLFDPHQWH SDUD R PHLR H[WHULRU SRU PHLR
GHXPYDF~RORUHVLGXDO
,,$ DWLYLGDGH HQ]LPiWLFD OLVRVVRPDO p HVVHQFLDO
SDUD D FpOXOD SRLV SHUPLWH R UHDSURYHLWDPHQWR
GH PROpFXODV SDUD DV DWLYLGDGHV ELRVVLQWpWLFDV
HLPSHGHRDF~PXORSUHMXGLFLDOGHVXEVWkQFLDV
FRPRSRUH[HPSORQDGH¿FLrQFLDGHJOLFRVLGDVH
OLVRVVRPDOTXHUHVXOWDQRDF~PXORGHJOLFRJrQLR
QDFpOXODFDXVDQGRDGRHQoDGH3RPSH
,,,$OJXQV OLVRVVRPRV VmR HVSHFLDOL]DGRV
QD GHJUDGDomR GH SURWHtQDV FLWRVyOLFDV
FDUERLGUDWRVHOLStGLRVTXHTXDQGRGDQL¿FDGRV
GHVHVWUXWXUDGRVRXR[LGDGRVVmRFDWDEROL]DGRV
QR GXWR FHQWUDO GR SURWHRVVRPD H QRV
SHUR[LVVRPRV
,9$OJXQVOLVRVVRPRVVmRDOWDPHQWHHVSHFLDOL]DGRV
HP IXQomR GR WLSR GH HQ]LPDV TXH FRQWrP
FRPR SRU H[HPSOR RV SHUR[LVVRPRV (VVH
WLSR GH OLVRVVRPRV HOLPLQD DJHQWHV TXtPLFRV
Wy[LFRV DR PHWDEROLVPR FHOXODU FHUWDV GURJDV
1(77(5)UDQN+Atlas de Anatomia Humana
HG(G(OVHYLHU
H PHGLFDPHQWRV R HWDQRO R SHUy[LGR GH
KLGURJrQLR R XUDWR RV 'DPLQRiFLGRV HWF 
&RPRVHGHQRPLQDHVVHHVItQFWHU" DOpP GH FRQVWUXLU XPD IRUPD GH GHIHVD LPXQH
LQHVSHFt¿FDDRGHVWUXLUFHUWRVPLFURUJDQLVPRV
A 9DWHU eFRUUHWRDSHQDVRTXHVHD¿UPDHP
B 'XRGHQDO A ,H,,
C %XOERELOLDU B ,H,,,
C ,,H,9
D *iVWULFR D ,,,,H,9
E 2GGL E ,,,,,H,9

BIOMEDICINA 
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 23 QUESTÃO 25
8PDIHUUDPHQWDLPSRUWDQWHSDUDRFRQWUROHLQWHUQR
GHTXDOLGDGHHPXPODERUDWyULRFOtQLFRpDFRQVWUXomR
GH JUi¿FRV GH /HYH\-HQQLQJV $ LQWHUSUHWDomR
GHVVHV JUi¿FRV SRGH VHU UHDOL]DGD D SDUWLU GDV UHJUDV
P~OWLSODV GH :HVWJDUG TXH SHUPLWHP D GHWHFomR GH
HUURV DOHDWyULRV H VLVWHPiWLFRV FRQIRUPH DOJRULWPR
DSUHVHQWDGRDVHJXLU

2JUi¿FRDFLPDPRVWUDDFXUYDFRQFHQWUDomRUHVSRVWDGH
XPDJRQLVWD $JRQLVWD HDFXUYDFRQFHQWUDomRUHVSRVWD
GR PHVPR DJRQLVWD QD SUHVHQoD GH XP DQWDJRQLVWD
$JRQLVWD $QWDJRQLVWD  UHIHUHQWH D FRPSRUWDPHQWRV
REVHUYDGRVHPFRQGLo}HVLGHDLVHPXPPHVPRWHFLGR
1HVVDVLWXDomRRDQWDJRQLVPRpGRWLSR
'LVSRQtYHOHPKWWSZZZFRQWUROODEFRPEUHVSGIZHVWJDUGBRBTXHBVDRSGI!
$FHVVRHPDJR A QmRFRPSHWLWLYRUHYHUVtYHOSRLVFRPRDXPHQWRGD
FRQFHQWUDomRGRDJRQLVWDREWpPVHRHIHLWRPi[LPR
$ SDUWLU GD YLRODomR GD UHJUD GH DYLVR 2s RV HUURV
VLVWHPiWLFRV H DOHDWyULRV SRGHP VHU GHWHFWDGRV B QmRFRPSHWLWLYRLUUHYHUVtYHOSRLVFRPRDXPHQWRGD
UHVSHFWLYDPHQWHSHODYLRODomRGRVSDUHVGHUHJUDV FRQFHQWUDomRGRDJRQLVWDREWpPVHRHIHLWRPi[LPR
A V1s H [5V  C FRPSHWLWLYR UHYHUVtYHO SRLV FRP R DXPHQWR GD
B V5V H 1s[  FRQFHQWUDomRGRDJRQLVWDREWpPVHRHIHLWRPi[LPR
C V[ H 1s5V 
D FRPSHWLWLYR LUUHYHUVtYHO SRLV PHVPR FRP R DX
D 1s[ H V5V  PHQWRGDFRQFHQWUDomRGRDJRQLVWDQmRVHREWpP
E 1s5V H V[  RHIHLWRPi[LPR
QUESTÃO 24 E QmRFRPSHWLWLYRUHYHUVtYHOSRLVPHVPRFRPRDX
PHQWRGDFRQFHQWUDomRGRDJRQLVWDQmRVHREWpP
)XQJRV GR JrQHUR Malassezia HVWmR UHODFLRQDGRV DR RHIHLWRPi[LPR
GHVHQYROYLPHQWR GH GHUPDWRPLFRVH FDUDFWHUL]DGD SHOR
DSDUHFLPHQWR GH PDQFKDV GH FRORUDomR YDULiYHO EHP ÁREA LIVRE
GHOLPLWDGDV ORFDOL]DGDV SULQFLSDOPHQWH QD SDUWH VXSHULRU
GR WyUD[ H EUDoRV SLWLUtDVH YHUVLFRORU  $QWLJDPHQWH DV
OHYHGXUDVGRJrQHURMalasseziaQmRHUDPFXOWLYiYHLVHP
PHLRVGHFXOWXUDDUWL¿FLDLV$WXDOPHQWHVDEHVHTXHHVVHV
PLFURUJDQLVPRV VmR GHSHQGHQWHV QXWULFLRQDLV GH XP VX
SOHPHQWRTXHGHYHVHUDGLFLRQDGRjIRUPXODomRGHPHLRV
GHFXOWXUDFRQYHQFLRQDLV
1HVVH VHQWLGR SDUD R FXOWLYR GH XPD DPRVWUD ELROyJLFD
FRP VXVSHLWD GH Malassezia 63 R PHLR GH FXOWXUD GHYH
VHUVXSOHPHQWDGRFRP
A IRQWHOLStGLFD
B IRQWHGHQLWURJrQLR
C VDQJXHGHFDUQHLUR
D SURWHtQDVDEDVHGHVRMD
E IDWRU9HIDWRU;GHULYDGRVGDKHPRJORELQD

 BIOMEDICINA
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 26 QUESTÃO 27
2WHVWHODERUDWRULDOUHDOL]DGRSRUPHLRGHXPHTXLSDPHQWR
2VOLStGLRVFRQVWLWXHPXPJUXSRGHPROpFXODVLQVRO~YHLV
VLWXDGR ¿VLFDPHQWH IRUD GD iUHD GH XP ODERUDWyULR
HP iJXD H VmR WUDQVSRUWDGRV QR SODVPD QD IRUPD GH FOtQLFR p GHVLJQDGR GH WHVWH ODERUDWRULDO UHPRWR ±7/5
OLSRSURWHtQDV(VVDVVmRFODVVL¿FDGDVGHDFRUGRFRPR WDPEpP FKDPDGR WHVWH ODERUDWRULDO SRUWiWLO ± 7/3 GR
LQJOrVPoint-of-care testing±32&7 (VWLPDWLYDVDWXDLV
WDPDQKRHDGHQVLGDGHHPTXLORPtFURQVOLSRSURWHtQDV SUHYHHP TXH QRV SUy[LPRV GH] DQRV FHUFD GH 
GH GHQVLGDGH PXLWR EDL[D 9/'/  OLSRSURWHtQDV GH GRV WHVWHV ODERUDWRULDLV VHUmR UHDOL]DGRV IRUD GH XP
ODERUDWyULRFHQWUDORTXHFRQ¿JXUDUiXPPRYLPHQWRGH
EDL[DGHQVLGDGH /'/ HOLSRSURWHtQDVGHGHQVLGDGHDOWD GHVFHQWUDOL]DomR TXH GHYH VHU LQFRUSRUDGR SRU YiULDV
+'/ (PUHODomRjVOLSRSURWHtQDVDYDOLHDVD¿UPDWLYDV HQWLGDGHVSUR¿VVLRQDLV$$19,6$GLVFLSOLQDDPDWpULD
GH¿QLQGR DV UHJUDV D VHUHP REVHUYDGDV SHOR JHVWRU
TXHVHJXHP ODERUDWRULDO SDUD D LPSODQWDomR GH 7/5 HP HPSUHVDV
GLDJQyVWLFDV
,2VTXLORPtFURQVOLEHUDGRVSHODPXFRVDLQWHVWLQDO
VmRFRQYHUWLGRVGLUHWDPHQWHHP9/'/QRSODVPD &RQVLGHUDQGR D WHQGrQFLD GH GHVFHQWUDOL]DomR H
D UHJXODPHQWDomR GD $19,6$ DYDOLH DV VHJXLQWHV
VDQJXtQHR D¿UPDWLYDV
,,$VOLSRSURWHtQDVVmRFRQVWLWXtGDVSRUXPQ~FOHR ,2 ODERUDWyULR FOtQLFR QmR p UHVSRQViYHO SHOD
GH OLStGLRV QHXWURV HQYROYLGR SRU XPD FDPDGD SURPRomR H PDQXWHQomR GH UHJLVWURV GRV
DQ¿SiWLFD GH DSROLSRSURWHtQDV IRVIROLStGLRV H SURFHVVRV GH HGXFDomR SHUPDQHQWH SDUD
RV XVXiULRV GRV HTXLSDPHQWRV GH WHVWH
FROHVWHUROOLYUH
ODERUDWRULDOUHPRWR 7/5 VHQGRHVWDIXQomRGH
,,,$IXQomRGDVDSROLSRSURWHtQDVpIRUQHFHUVtWLRVGH UHVSRQVDELOLGDGHGRVSUySULRVSUR¿VVLRQDLVTXH
UHFRQKHFLPHQWR SDUD UHFHSWRUHV QDV VXSHUItFLHV H[HFXWDP7/5
,,2 UHVSRQViYHO WpFQLFR SHOR ODERUDWyULR FOtQLFR
FHOXODUHV H VHUHP DWLYDGRUDV RX LQLELGRUDV
SRGH VH UHVSRQVDELOL]DU WHFQLFDPHQWH SRU
GH HQ]LPDV HQYROYLGDV QR PHWDEROLVPR GH WRGRV RV 7/5 UHDOL]DGRV GHQWUR GD LQVWLWXLomR
OLSRSURWHtQDV H HP TXDOTXHU ORFDO RX SRGH GHOHJDU D
UHVSRQVDELOLGDGH WpFQLFD D RXWURV SUR¿VVLRQDLV
,9$ /'/ WHP DOWD FRQFHQWUDomR GH FROHVWHURO H SDUD RV DWHQGLPHQWRV HP KRVSLWDOGLD HP
pVWHUHV GH FROHVWHURO OLJDVH QD VXSHUItFLH GD GRPLFtOLRV H FROHWD ODERUDWRULDO HP XQLGDGH
PHPEUDQD FHOXODU DWUDYpV GR UHFRQKHFLPHQWR PyYHO
,,,$ H[HFXomR GRV 7/5 Point-of-care  GHYH
GDDSRSURWHtQD%
HVWDU YLQFXODGD D XP ODERUDWyULR FOtQLFR
92 FROHVWHURO FDSWDGR GD /'/ SHODV FpOXODV SRVWR GH FROHWD RX VHUYLoR GH VD~GH S~EOLFD
DJH DXPHQWDQGR D VtQWHVH GH FROHVWHURO H GH DPEXODWRULDO RX KRVSLWDODU PHVPR TXH HVWD
SUiWLFDHVWHMDDSRLDGDQD¿ORVR¿DGHJHVWmRSRU
UHFHSWRUHVVHQGRTXHRFROHVWHUROHPH[FHVVRp
GHVFHQWUDOL]DomR
FRQYHUWLGRHPpVWHUGHFROHVWHUROHDUPD]HQDGR ,92 ODERUDWyULR FOtQLFR GHYH PDQWHU UHJLVWURV GRV
FRQWUROHVGDTXDOLGDGHGH7/5EHPFRPRGRV
(VWiFRUUHWRDSHQDVRTXHVHD¿UPDHP
SURFHGLPHQWRVSDUDDUHDOL]DomRGRVPHVPRV
A ,,,H,,, eFRUUHWRDSHQDVRTXHVHD¿UPDHP
B ,,,H9 A ,H,,
C ,,9H9 B ,H,,,
C ,,H,,,
D ,,,,,H,9
D ,,H,9
E ,,,,9H9 E ,,,H,9

BIOMEDICINA 
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 28 QUESTÃO 29
&RQVLGHUH TXH XP ELRPpGLFR VHMD UHVSRQViYHO SHOD 6HJXQGR GDGRV GH  GD 2UJDQL]DomR 0XQGLDO GH
HODERUDomR GRV 3URFHGLPHQWRV 2SHUDFLRQDLV 3DGUmR 6D~GH DV DQHPLDV FDUHQFLDLV FRQVWLWXHP XP SUREOHPD
323  GR VHWRU GH SDUDVLWRORJLD GH VHX ODERUDWyULR PXQGLDO GH VD~GH S~EOLFD 6mR IUHTXHQWHV HP SDtVHV HP
2EVHUYDQGRDVGLYHUVDVWpFQLFDVXVDGDVSDUDWULDJHPGH GHVHQYROYLPHQWR RQGH D DOLPHQWDomR p LQDGHTXDGD H
HQWHURSDUDVLWDVHRSHU¿OHSLGHPLROyJLFRGDSRSXODomR FDUDFWHUL]DGDSHODIDOWDGHQXWULHQWHVHYLWDPLQDVHVVHQFLDLV
TXH XVXIUXL RV VHUYLoRV GR ODERUDWyULR HOH FKHJRX DRV 3RU PHLR GD DQiOLVH GR HVIUHJDoR GH VDQJXH FRUDGR p
SRVVtYHOREWHULQIRUPDo}HVDFHUFDGDPRUIRORJLDGRWDPDQKR
VHJXLQWHVGDGRV
H GD FRORUDomR GRV HULWUyFLWRV VHQGR R FRPSURPHWLPHQWR
‡ DOWDSUHYDOrQFLDGHAscaris lumbricóides; GRV PHVPRV LQGLFDGR FRPR FRQVHTXrQFLD GD IDOWD GHVVHV
QXWULHQWHV'HVVDIRUPDDDQHPLDFDUHQFLDOPDLVSUHYDOHQWH
‡ DOWDSUHYDOrQFLDGHSchistosoma mansoni; QRVGLDVDWXDLVpFDXVDGDSHODGH¿FLrQFLDGH

‡ EDL[DSUHYDOrQFLDGHEnterobius vermicularis. A IHUUR H SRGH VHU GLDJQRVWLFDGD SHOD SUHVHQoD GH


KHPiFLDVPLFURFtWLFDVHKLSRFU{PLFDVQRHVIUHJDoR
/HYDQGRHPFRQWDDFDUDFWHUtVWLFDGDVIRUPDVLPDWXUDV GHVDQJXH
GHVVHVKHOPLQWRVREVHUYDGDVQDVIH]HVSRUTXDOPpWRGR B IRODWRV H SRGH VHU GLDJQRVWLFDGD SHOD SUHVHQoD
R ELRPpGLFR GHYH RSWDU SDUD DXPHQWDU D VHQVLELOLGDGH GH KHPiFLDV PDFURFtWLFDV H QRUPRFU{PLFDV QR
GRVH[DPHVSDUDVLWROyJLFRVIHFDLVHPVHXODERUDWyULR" HVIUHJDoRGHVDQJXH
C JOLFRVHIRVIDWRGHVLGURJHQDVH H SRGH VHU
A TpFQLFD GH )DXVW TXH VH EDVHLD QD IOXWXDomR GLDJQRVWLFDGD SRU PHLR GR HVIUHJDoR VDQJXtQHR
HPVXOIDWRGH]LQFRGHIRUPDVLPDWXUDVOHYHVGH FRUDGRSHODSUHVHQoDGHKHPiFLDVQRUPRFtWLFDV
DOJXQVSDUDVLWDV KLSRFU{PLFDVDOpPGRFRUS~VFXORGH+HLQ]
B 7pFQLFDGH+RIIPDQ3RQVH-DQHUWDPEpPFRQKHFLGD D YLWDPLQD%HSRGHVHUGLDJQRVWLFDGDSRUPHLRGR
FRPRWpFQLFDGH/XW]TXHVHEDVHLDQRSURFHVVRGH HVIUHJDoR VDQJXtQHR SHOD SUHVHQoD GH KHPiFLDV
VHGLPHQWDomRGHRYRVSHVDGRV PDFURFtWLFDVHKLSRFU{PLFDV
E YLWDPLQD&TXHFRPSURPHWHDDEVRUomRGHGLYHUVRV
C ([DPH GLUHWR TXH p IHLWR D IUHVFR H LQGLFDGR SDUD
QXWULHQWHV UHVXOWDQGR QD SUHVHQoD GH KHPiFLDV
SHVTXLVDGHIRUPDVLPDWXUDVHPIH]HVGLDUUHLFDVRX PDFURFtWLFDVHKLSRFU{PLFDV
GHVLQWpULFDVGHIRUPDUiSLGDHIiFLO
QUESTÃO 30
D 0pWRGRGH%DHUPDQQ0RUDHVTXHXWLOL]DRSULQFtSLR
GR WHUPRWURSLVPR HP FiOLFH GH VHGLPHQWDomR SDUD $ KHPRJORELQD JOLFDGD p XP FRQMXQWR GH VXEVWkQFLDV
GHWHFomRGHIRUPDVLPDWXUDVODUYDLV IRUPDGR D SDUWLU GH UHDo}HV HQWUH D KHPRJORELQD ³$´
+E$  H DOJXQV Do~FDUHV VHQGR TXH D IUDomR $F
E &RORUDomRGDVDPRVWUDVGHIH]HVSRUKHPDWR[LOLQD OLJDGD HVSHFL¿FDPHQWH FRP D JOLFRVH UHSUHVHQWD 
IpUULFD TXH p XVDGD SDUD GHWDOKDU D PRUIRORJLD GH GDKHPRJORELQD$WRWDO
WURIR]RtWRVHFLVWRVGHSURWR]RiULRVLQWHVWLQDLV PORQUE
$ TXDQWLGDGH GH JOLFRVH OLJDGD j KHPRJORELQD p
ÁREA LIVRE GLUHWDPHQWH SURSRUFLRQDO j FRQFHQWUDomR PpGLD GH
JOLFRVH QR VDQJXH TXH SHUPDQHFH DVVRFLDGD GH IRUPD
LUUHYHUVtYHO j FDGHLD DOID GD KHPRJORELQD SRU PHLR GH
UHDomR PHGLDGD SRU XP VLVWHPD HQ]LPiWLFR SHUPLWLQGR
XPD DYDOLDomR GR FRQWUROH JOLFrPLFR PpGLR QR SHUtRGR
HQWUHDGLDVTXHSUHFHGHPRH[DPH
$FHUFDGHVVDVDVVHUo}HVDVVLQDOHDRSomRFRUUHWD
A $VGXDVDVVHUo}HVVmRSURSRVLo}HVYHUGDGHLUDVHD
VHJXQGDpXPDMXVWL¿FDWLYDFRUUHWDGDSULPHLUD
B $VGXDVDVVHUo}HVVmRSURSRVLo}HVYHUGDGHLUDVPDV
DVHJXQGDQmRpXPDMXVWL¿FDWLYDFRUUHWDGDSULPHLUD
C $SULPHLUDDVVHUomRpXPDSURSRVLomRYHUGDGHLUDH
DVHJXQGDpXPDSURSRVLomRIDOVD
D $ SULPHLUD DVVHUomR p XPD SURSRVLomR IDOVD H D
VHJXQGDpXPDSURSRVLomRYHUGDGHLUD
E $VGXDVDVVHUo}HVVmRSURSRVLo}HVIDOVDV

 BIOMEDICINA
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 31

2H[DPHPLFURVFySLFRGRVHGLPHQWRXULQiULRSRGHFRQWULEXLUSDUDRGLDJQyVWLFRGHYiULDVGRHQoDVGRWUDWRJHQLWRXULQiULR
H VXD UHDOL]DomR UHTXHU KDELOLGDGHV HVSHFt¿FDV UHVXOWDQWHV GD IRUPDomR H GR H[HUFtFLR SUR¿VVLRQDO GR DQDOLVWD
ODERUDWRULDO$VLPDJHQVQDV¿JXUDVDVHJXLUUHSUHVHQWDPDYLVmRPLFURVFySLFDGRVHGLPHQWRXULQiULR

)LJXUD )LJXUD

)LJXUD )LJXUD

675$6,1*(56.8ULQiOLVHHÀXLGRVFRUSRUDLV/LYUDULD0pGLFD3DXOLVWDHG

(PRUGHPFUHVFHQWHHGHDFRUGRFRPDLQGLFDomRGDVVHWDVDV¿JXUDVGHDFRUUHVSRQGHPD

A KHPiFLDVFULVWDLVGHiFLGR~ULFRFpOXODVWXEXODUHVOHXFyFLWRV

B KHPiFLDVFULVWDLVGHiFLGR~ULFRFpOXODVHSLWHOLDLVOHXFyFLWRV

C OHXFyFLWRVFULVWDLVGHiFLGR~ULFRFpOXODVHSLWHOLDLVKHPiFLDV

D KHPiFLDVFULVWDLVGHR[DODWRGHFiOFLRFpOXODVWXEXODUHVOHXFyFLWRV

E OHXFyFLWRVFULVWDLVGHR[DODWRGHFiOFLRFpOXODVWXEXODUHVKHPiFLDV

BIOMEDICINA 
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 32
(PXPDSDQGHPLDGHFyOHUDWHYHLQtFLRQR3HUXHVHGLVVHPLQRXSRUYiULRVSDtVHVGD$PpULFD&HQWUDOHGD
$PpULFDGR6XOLQFOXVLYHR%UDVLOH[LJLQGRDWHQomRGRVyUJmRVGHVD~GHSDUDDUHDOL]DomRGRGLDJQyVWLFRSUHFLVR
PDQHMRDGHTXDGRGRSDFLHQWHHIRUWDOHFLPHQWRGHPHGLGDVGHSUHYHQomR
1RTXHVHUHIHUHDRGLDJQyVWLFRRVPLFURUJDQLVPRVGRJrQHURVibrioSRVVXHPVLPLODULGDGHVPRUIROyJLFDVFRPRV
JrQHURVSHUWHQFHQWHVjIDPtOLDEnterobacteriaceaeXPDYH]TXH VmREDVWRQHWHV*UDPQHJDWLYRVQmRIRUPDGRUHV
GH HVSRURV 1R HQWDQWR QR FDVR GR FUHVFLPHQWR GH FRO{QLDV VXVSHLWDV GH Vibrio cholerae HP PHLRV GH FXOWXUD
HVSHFt¿FRVHVVHVPLFURUJDQLVPRVVmRGLVWLQJXLGRVGDVHQWHUREDFWpULDVGHIRUPDH¿FD]SRUTXH
A RVVibrio choleraeVmRR[LGDVHSRVLWLYRVHDVHQWHUREDFWpULDVVmRR[LGDVHQHJDWLYDV
B DVHQWHUREDFWpULDVVmRIHUPHQWDGRUDVGDVDFDURVHHRVVibrio choleraeQmRIHUPHQWDPVDFDURVH
C RVVibrio choleraeFUHVFHPHPSUHVHQoDGHVDLVELOLDUHVHDVHQWHUREDFWpULDVQmRFUHVFHPHPSUHVHQoDGHVDLVELOLDUHV
D RVVibrio choleraeIHUPHQWDPJOLFRVHFRPSURGXomRGHJiVHDVHQWHUREDFWpULDVIHUPHQWDPJOLFRVHVHPSURGXomRGHJiV
E DVHQWHUREDFWpULDVXWLOL]DPDJOLFRVHFRPR~QLFDIRQWHGHFDUERQRHRVVibrio choleraeXWLOL]DPRFLWUDWRFRPR~QLFD
IRQWHGHFDUERQR

QUESTÃO 33
2FRQWUROHGDTXDOLGDGHGDiJXDSDUDFRQVXPRKXPDQRpFUXFLDOSDUDRPDSHDPHQWRGHiUHDVGHULVFRSDUDHYLWDU
TXHDSUHVHQoDGHPLFURUJDQLVPRVHSROXHQWHVSRVVDRFDVLRQDUHQIHUPLGDGHVjSRSXODomR$iJXDSRWiYHOGHYHVHU
LVHQWDGHEDFWpULDVLQGLFDGRUDVGHFRQWDPLQDomRIHFDODVVRFLDGDVDGRHQoDVFRPRJDVWURHQWHULWHDJXGDHGLDUUHLD
$VEDFWpULDVDVVRFLDGDVDHVVDVSDWRORJLDVHTXHVmRFRPXPHQWHSHVTXLVDGDVQDiJXDVmRRVFROLIRUPHVIHFDLV
%UDVLO)XQGDomR1DFLRQDOGH6D~GHManual prático de análise de águaHGUHY%UDVtOLD)XQGDomR1DFLRQDOGH6D~GH

$UD]mRGDHVFROKDGRVFROLIRUPHVIHFDLVFRPRLQGLFDGRUHVGHFRQWDPLQDomRGDiJXDGHYHVH
,jSUHVHQoDGHVVDVEDFWpULDVQDVIH]HVGHDQLPDLVHGHVHUHVKXPDQRV
,,DRPHQRUWHPSRGHYLGDGHVVDVEDFWpULDVQDiJXDGRTXHRGDVGHPDLVEDFWpULDVSDWRJrQLFDVLQWHVWLQDLV
,,,DRIiFLOFXOWLYRGHVVHVPLFURUJDQLVPRVHPDPELHQWHODERUDWRULDOSRUVHUHPPHQRVH[LJHQWHVHPWHUPRVQXWULFLRQDLV
,9jPDLRUUHVLVWrQFLDGHVVDVEDFWpULDVjDomRGRVDJHQWHVGHVLQIHWDQWHVGRTXHjGRVPLFURUJDQLVPRVSDWRJrQLFRV
eFRUUHWRDSHQDVRTXHVHD¿UPDHP
A ,H,,
B ,H9
C ,,,,H,9
D ,,,,,H,9
E ,,,9H9
QUESTÃO 34
$V FpOXODV GR HSLWpOLR HVFDPRVR HQFRQWUDGDV QR HVIUHJDoR YDJLQDO VmR GLYLGLGDV HP WUrV WLSRV VXSHU¿FLDLV
LQWHUPHGLiULDV H SDUDEDVDLV (VVDV FpOXODV SRVVXHP GHVHQYROYLPHQWR KRUP{QLRGHSHQGHQWH H GHVVH PRGR R
DVSHFWR GR HVIUHJDoR YDJLQDO DSUHVHQWD DOWHUDo}HV FtFOLFDV HP FRQVRQkQFLD FRP RV FLFORV PHQVWUXDO H RYDULDQR
&RQVLGHUDQGR R SURFHVVR GH PDWXUDomR GDV FpOXODV GR HSLWpOLR HVFDPRVR H VXD FRUUHODomR FRP RV KRUP{QLRV
VH[XDLVIHPLQLQRVDQDOLVHDVD¿UPDo}HVTXHVHVHJXHP
,2VHVWUyJHQRVLQGX]HPjPDWXUDomRFRPSOHWDGDVFpOXODVGRHSLWpOLRHVFDPRVRUHVXOWDQGRQRSUHGRPtQLRGH
FpOXODVLQWHUPHGLiULDVHSDUDEDVDLVQRHVIUHJDoRYDJLQDO
,,(PFRQGLo}HVGHEDL[DSURGXomRGHHVWUyJHQRVREVHUYDVHSUHGRPtQLRGHFpOXODVSDUDEDVDLVQRHVIUHJDoRYDJLQDO
,,,/RJRDSyVRQDVFLPHQWRRHVIUHJDoRYDJLQDOGDODFWDQWHDSUHVHQWDDVSHFWRLGrQWLFRDRREVHUYDGRQRHVIUHJDoR
PDWHUQRFDUDFWHUL]DGRSHORSUHGRPtQLRGHFpOXODVLQWHUPHGLiULDVHVXSHU¿FLDLV
,92SUHGRPtQLRGHFpOXODVVXSHU¿FLDLVQRHVIUHJDoRFpUYLFRYDJLQDOpREVHUYDGRGXUDQWHDJHVWDomRHQDIDVH
SURJHVWDFLRQDOGRFLFORPHQVWUXDO
eFRUUHWRDSHQDVRTXHVHD¿UPDHP
A I e ,,
B ,H,,,
C ,,H,,,
D ,,H,9
E ,,,H,9

 BIOMEDICINA
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 35
2 FLWRPHJDORYtUXV &09  PHPEUR GD IDPtOLD Herpesviridae, p DOWDPHQWH SUHYDOHQWH QD SRSXODomR KXPDQD e
FDUDFWHUL]DGR SHOD ODWrQFLD TXH p REVHUYDGD DSyV D SULPHLUD LQIHFomR H SRVVLELOLWD D UHDWLYDomR YLUDO WDUGLD HP
SRUWDGRUHVGHDOJXPWLSRGHLPXQRGHSUHVVmR$WUDQVPLVVmRGHVVHYtUXVRFRUUHSRUGLIHUHQWHVYLDVLQFOXVLYHWUDQVIXVmR
VDQJXtQHDHWUDQVPLVVmRYHUWLFDO

&RQVLGHUDQGR HVVDV YLDV GH WUDQVPLVVmR GR FLWRPHJDORYtUXV DV SRVVLELOLGDGHV GLDJQyVWLFDV H DV HVWUDWpJLDV GH
SUHYHQomRDYDOLHDVD¿UPDWLYDVDVHJXLU

,$ SHVTXLVD GH DQWLFRUSRV DQWLFLWRPHJDORYtUXV GD FODVVH ,J0 HP QHRQDWRV p XPD ERD HVWUDWpJLD GLDJQyVWLFD
SDUDDGHWHUPLQDomRGDLQIHFomRFRQJrQLWDHPERUDVHMDPHQRVVHQVtYHOTXHRLVRODPHQWRGRYtUXVHPOtTXLGRV
FRUSRUDLVQDVGXDVSULPHLUDVVHPDQDVGHYLGD
,,$SUHVHQoDGHDQWLFRUSRVPDWHUQRVDQWLFLWRPHJDORYtUXVGDFODVVH,J*DQWHVGDFRQFHSomRSUHYLQHDWUDQVPLVVmR
GDGRHQoDDRIHWRSRLVHVVDLPXQRJOREXOLQDDWUDYHVVDDSODFHQWD
,,,$ OHXFRUUHGXomR p XPD HVWUDWpJLD TXH SUHYLQH D WUDQVPLVVmR GH &09 SRU WUDQVIXVmR VDQJXtQHD HP UHFpP
QDVFLGRVFRPSHVRLQIHULRUDJ
,9$ VRURORJLD SDUD &09 p REULJDWyULD HP WUDQVIXVmR GH UHFpPQDVFLGRV FDVR VHMD WUDQVIXQGLGR VDQJXH
GHVOHXFRFLWDGR
eFRUUHWRDSHQDVRTXHVHD¿UPDHP

A ,H,,
B ,H,,,
C ,H,9
D ,,H,,,
E ,,,H,9

QUESTÃO 36
$UXEpRODpXPDGRHQoDGHSRXFDJUDYLGDGHTXHIUHTXHQWHPHQWHHYROXLFRPVLQWRPDVLQHVSHFt¿FRVGL¿FXOWDQGRR
GLDJQyVWLFRHPEDVHVFOtQLFDV3RUHVVDUD]mRpQHFHVViULDDFRQ¿UPDomRODERUDWRULDO2VPpWRGRVVRUROyJLFRVVmR
RVSURFHGLPHQWRVPDLV~WHLVSDUDRGLDJQyVWLFRGDLQIHFomRSHORYtUXVGDUXEpRODVHMDHPPXOKHUHVVHMDHPUHFpP
QDWRVHODFWDQWHV(QWUHHVVHVPpWRGRVRVHQVDLRVLPXQRHQ]LPiWLFRV (/,6$ SDUDGHWHFWDUDQWLFRUSRV,J0H,J*
DQWLUUXEpRODHRVWHVWHVGHDYLGH]SDUD,J*DQWLUUXEpRODVmRRVPDLVXWLOL]DGRVQDDWXDOLGDGH

&RQVLGHUDQGRRVSRVVtYHLVUHVXOWDGRVGDVRURORJLDSDUDUXEpRODDYDOLHDVD¿UPDWLYDVDVHJXLU

,$GHWHFomRGH,J0FRQWUDUXEpRODQRVRURGHUHFpPQDVFLGRVLQGLFDSURWHomRWUDQVSODFHQWiULD
,,$SUHVHQoDGH,J*HVSHFt¿FDDQWLYtUXVGDUXEpRODFRPDOWDDYLGH]HPDPRVWUDGHVRURGDSDFLHQWHGHPRQVWUD
LPXQLGDGHSDUDDUXEpROD
,,,$ LQIHFomR DJXGD GH UXEpROD p GLDJQRVWLFDGD SHOD SUHVHQoD GH ,J0 HVSHFt¿FD DQWLYtUXV GD UXEpROD QXPD
DPRVWUDGHVRURGDSDFLHQWH
,97tWXORVGHDQWLFRUSRV,J*HVSHFt¿FRVDQWLYtUXVGDUXEpRODLQGHSHQGHQWHPHQWHGDDYLGH]SURJUHVVLYDPHQWH
DXPHQWDGRVQRVODFWDQWHVLQGLFDPSURWHomRjLQIHFomR
9$LQIHFomRDJXGDGHUXEpRODpGLDJQRVWLFDGDSHORDXPHQWRGRVWtWXORVGH,J*HVSHFt¿FDDQWLYtUXVGDUXEpROD
FRPEDL[DDYLGH]HPDPRVWUDVFRQVHFXWLYDVGHVRURGDPHVPDSDFLHQWH
eFRUUHWRDSHQDVRTXHVHD¿UPDHP

A ,H,,
B ,H9
C ,,,,H,9
D ,,,,,H,9
E ,,,,,H9

BIOMEDICINA 19
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 37
2FRQWUROHGDVHSLGHPLDVpHPEDVDGRHPPHGLGDVTXHYLVDPFRQWHURÀX[RHDGLQkPLFDGHGRHQoDVWUDQVPLVVtYHLV
RXQmR&RQKHFHUDFDUDFWHUtVWLFDGDHSLGHPLDpSDSHOGRELRPpGLFRRXGHRXWURVSUR¿VVLRQDLVGDiUHDTXHHVWHMDP
DWXDQGRHPVHUYLoRVGHYLJLOkQFLDHPVD~GH
&RQVLGHUDQGRDVFDUDFWHUtVWLFDVGDVHSLGHPLDVDVVLQDOHDRSomRFRUUHWD
A (PXPDHSLGHPLDH[SORVLYDQmRVHUHJLVWUDDRFRUUrQFLDGHFDVRVVLPXOWkQHRVPDVDFXUDGDVSHVVRDVSRGH
RFRUUHUDRPHVPRWHPSRFRPDUHGXomRGRSHUtRGRSUpSDWHQWH
B (PXPDHSLGHPLDH[SORVLYDUHJLVWUDVHDRFRUUrQFLDGHFDVRVVLPXOWkQHRVHDFXUDGDVSHVVRDVQmRRFRUUHDR
PHVPRWHPSR
C (PFDVRVGHHSLGHPLDSURJUHVVLYDGHXPDGRHQoDWUDQVPLVVtYHOQmRVHVDEHRQ~PHURWRWDOGHFDVRVHQWUHRV
LQIHFWDGRVDVVLQWRPiWLFRVHDFXUDGDVSHVVRDVQmRpVLPXOWkQHD
D (PFDVRVGHHSLGHPLDSURJUHVVLYDGHXPDGRHQoDWUDQVPLVVtYHOpSRVVtYHOSUHYHURQ~PHURWRWDOGHFDVRVHQWUH
RVLQIHFWDGRVDVVLQWRPiWLFRVHDFXUDGDVSHVVRDVRFRUUHDRPHVPRWHPSR
E 8PD HSLGHPLD H[SORVLYD QmR DSUHVHQWD Q~PHUR GH FDVRV VLPXOWkQHRV H D FXUD GDV SHVVRDV LQIHFWDGDV QmR p
VLPXOWkQHDGHYLGRjYDULDomRGRSHUtRGRSUpSDWHQWH

QUESTÃO 38
1RVGLDVGHKRMHREVHUYDVHFUHVFHQWHSUHRFXSDomRFRPDLGHQWL¿FDomRHDURWXODJHPGHGHWHUPLQDGRVPDWHULDLV
WDLVFRPRDOLPHQWRVHVXESURGXWRVTXHFRQWHQKDPRUJDQLVPRVJHQHWLFDPHQWHPRGL¿FDGRV 2*0V PDLVSHODyWLFD
GR GLUHLWR GR FRQVXPLGRU ¿QDO j LQIRUPDomR GR TXH SRU XPD SUHRFXSDomR PDLV HVSHFt¿FD TXDQWR j VHJXUDQoD +i
TXHVHFRQVLGHUDURVUHTXLVLWRVWpFQLFRVTXHGHYHPVHUFXPSULGRVSHORVFHQWURVUHVSRQViYHLVSHORDUPD]HQDPHQWR
PDQXWHQomRHGLVWULEXLomRGHPDWHULDOELROyJLFREHPFRPRDQHFHVVLGDGHGHTXHRVPpWRGRVHSURFHVVRVGHPHGLomR
DVVRFLDGRVjVDWLYLGDGHVGHPDQLSXODomRHSURGXomRVHMDPHVWDEHOHFLGRVFRPULJRUWpFQLFR
%5$6,/0LQLVWpULRGD&LrQFLDH7HFQRORJLDSistema de Avaliação da Conformidade de Material Biológico%UDVtOLD6(1$,'1S FRPDGDSWDo}HV 

7HQGRFRPRUHIHUrQFLDRWH[WRDFLPDIDoDRTXHVHSHGHQRVLWHQVDVHJXLU
D (PUHODomRDSRVVtYHLVLPSDFWRVDPELHQWDLVHHIHLWRVVREUHVHUHVYLYRVTXDLVPRWLYRVMXVWL¿FDPDSUHRFXSDomR
GDSRSXODomRFRPDVHJXUDQoDQDSURGXomRHGLVWULEXLomRGH2*0V" YDORUSRQWRV
E 4XDLVRVSRVVtYHLVEHQHItFLRVTXHDXWLOL]DomRGH2*0VSRGHWUD]HUjSRSXODomRKXPDQD" YDORUSRQWRV 
RASCUNHO - QUESTÃO 38
1

10

11

12







20 BIOMEDICINA
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 39
$GHILFLrQFLDGHIHUURpDFDXVDPDLVFRPXPGHDQHPLDHHPJHUDORGLDJQyVWLFRODERUDWRULDOpIHLWRVHPJUDQGHV
GLILFXOGDGHV$LQWHUSUHWDomRGRVUHVXOWDGRVQRHQWDQWRGHYHVHUIHLWDFXLGDGRVDPHQWHWHQGRVHHPPHQWHDV
OLPLWDo}HVHLQWHUIHUHQWHVGHFDGDUHDomR&RQILUPDGRRGLDJQyVWLFRLQLFLDVHRWUDWDPHQWRHDLQYHVWLJDomRGDV
FDXVDVGDDQHPLD$¿JXUDDVHJXLULQGLFDDFRUUHODomRGDVSULQFLSDLVDOWHUDo}HVODERUDWRULDLVQRGHFRUUHUGDVIDVHV
HYROXWLYDVGDGHSULYDomRGHIHUUR

*52772+HOHQD=:)LVLRORJLDHPHWDEROLVPRGRIHUURRev. Bras. Hematol. Hemoter6mR3DXOR

$SDUWLUGDVLQIRUPDo}HVDSUHVHQWDGDVUHGLMDXPWH[WRGLVVHUWDWLYRTXHFRQWHPSOHDVUHVSRVWDVjVTXHVW}HVDVHJXLU

D 4XDLVDVDOWHUDo}HVODERUDWRULDLVYHUL¿FDGDVQDVIDVHVGHGHSOHomRGHHVWRTXHHHULWURSRHVHGH¿FLHQWHGH
IHUUR"-XVWL¿TXHVXDUHVSRVWD YDORUSRQWRV 

E &RPRRTXDGURGHDQHPLDIHUURSULYDSRGHVHUUHYHUWLGR" YDORUSRQWRV 

BIOMEDICINA 21
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

RASCUNHO - QUESTÃO 39

10

11

12







ÁREA LIVRE

22 BIOMEDICINA
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTÃO 40
2GLDJQyVWLFRSUHFLVRGHGRHQoDVLQIHFFLRVDVHSDUDVLWiULDVQHFHVViULRSDUDDVROXomRGHGLYHUVRVFDVRVFOtQLFRVH
SUHYHQomRGHGRHQoDVWUDQVPLWLGDVSRUWUDQVIXVmRVDQJXtQHDWHYHXPJUDQGHLPSXOVRSRUYROWDGRVDQRVHDSDUWLU
GHTXDQGRIRLGHVHQYROYLGRRWHVWHGH(/,6$ enzyme linked immunosorbent assayHQVDLRLPXQRHQ]LPiWLFR H
HVVHSDVVRXDVHUGLIXQGLGRFRPHUFLDOPHQWH7UDWDVHGHXPLPXQRHQVDLRIUHTXHQWHPHQWHXWLOL]DGRHPODERUDWyULRV
GLDJQyVWLFRVGHSHVTXLVDHEDQFRVGHVDQJXH3DUDDPDLRULDGDVGRHQoDVSDVVtYHLVGHVHUHPGLDJQRVWLFDGDVSRU
(/,6$ R WHVWH DSUHVHQWD VHQVLELOLGDGH H HVSHFL¿FLGDGH HOHYDGDV 'H DFRUGR FRP R REMHWLYR SUHWHQGLGR R WHVWH GH
(/,6$ SRGH VHU SDGURQL]DGR SULYLOHJLDQGRVH D VHQVLELOLGDGH RX D HVSHFL¿FLGDGH $ H¿FLrQFLD GR WHVWH SRUWDQWR
GHSHQGHUiGDSDGURQL]DomRDGHTXDGDGHFDGDXPDGDVHWDSDVHGRVUHDJHQWHVGRWHVWHSDUDRSURSyVLWRGRHQVDLR
9$=$-7$.(,.%8(12(&Imunoensaios, Fundamentos e Aplicações.5LRGH-DQHLUR*XDQDEDUD.RRJDQ

$SDUWLUGHVVDVLQIRUPDo}HVUHVSRQGDjVTXHVW}HVDSUHVHQWDGDVQRVLWHQVDVHJXLU

D &RQVLGHUDQGRDSDGURQL]DomRGR(/,6$SDUDDGHWHFomRGHGRHQoDVLQIHFFLRVDVTXHGHYHPVHUFRQWURODGDV
QDWULDJHPGHGRDGRUHVHPEDQFRGHVDQJXHGHYHUiVHUSULYLOHJLDGDDVHQVLELOLGDGHRXDHVSHFL¿FLGDGHGR
WHVWH" YDORUSRQWRV 

E  (P DOJXPDV VLWXDo}HV FRPR SRU H[HPSOR QD SHVTXLVD GH DQWLFRUSRV FRQWUD R YtUXV +,9 HP GRDGRUHV GH
VDQJXHRVUHVXOWDGRVSRVLWLYRVGRVWHVWHVGH(/,6$GHYHPVHUUHDYDOLDGRVSRURXWURVPpWRGRVTXHSHUPLWDP
FRQ¿UPDUVHVmRYHUGDGHLURSRVLWLYRVRXIDOVRSRVLWLYRV1HVVHFDVRTXDOPpWRGRLPXQROyJLFRpXVXDOPHQWH
HPSUHJDGRSDUDDFRQ¿UPDomRGHYHUGDGHLURSRVLWLYRVRXIDOVRSRVLWLYRVHTXDOpDFDUDFWHUtVWLFDGHVVHPpWRGR
TXHSRVVLELOLWDDREWHQomRGRUHVXOWDGRFRQ¿UPDWyULR" YDORUSRQWRV 

RASCUNHO - QUESTÃO 40

10

11

12







BIOMEDICINA 
2010
EXAME NACIONAL DE DESEMPENHO DOS ESTUDANTES

QUESTIONÁRIO DE PERCEPÇÃO DA PROVA

$VTXHVW}HVDEDL[RYLVDPOHYDQWDUVXDRSLQLmRVREUHDTXDOLGDGHHDDGHTXDomRGDSURYD
TXHYRFrDFDERXGHUHDOL]DU$VVLQDOHDVDOWHUQDWLYDVFRUUHVSRQGHQWHVjVXDRSLQLmRQRV
HVSDoRVDSURSULDGRVGR&DGHUQRGH5HVSRVWDV

Agradecemos sua colaboração.

QUESTÃO 1 QUESTÃO 6
4XDO R JUDX GH GL¿FXOGDGH GHVWD SURYD QD SDUWH GH $VLQIRUPDo}HVLQVWUXo}HVIRUQHFLGDVSDUDDUHVROXomR
)RUPDomR*HUDO" GDVTXHVW}HVIRUDPVX¿FLHQWHVSDUDUHVROYrODV"
A 0XLWRIiFLO
B )iFLO A 6LPDWpH[FHVVLYDV
C 0pGLR B 6LPHPWRGDVHODV
D 'LItFLO C 6LPQDPDLRULDGHODV
E 0XLWRGLItFLO D 6LPVRPHQWHHPDOJXPDV
QUESTÃO 2 E 1mRHPQHQKXPDGHODV
4XDO R JUDX GH GL¿FXOGDGH GHVWD SURYD QD SDUWH GH QUESTÃO 7
&RPSRQHQWH(VSHFt¿FR"
A 0XLWRIiFLO 9RFrVHGHSDURXFRPDOJXPDGL¿FXOGDGHDRUHVSRQGHU
B )iFLO jSURYD4XDO"
C 0pGLR
D 'LItFLO A 'HVFRQKHFLPHQWRGRFRQWH~GR
E 0XLWRGLItFLO B )RUPDGLIHUHQWHGHDERUGDJHPGRFRQWH~GR
C (VSDoRLQVX¿FLHQWHSDUDUHVSRQGHUjVTXHVW}HV
QUESTÃO 3
D )DOWDGHPRWLYDomRSDUDID]HUDSURYD
&RQVLGHUDQGR D H[WHQVmR GD SURYD HP UHODomR DR
E 1mRWLYHTXDOTXHUWLSRGHGL¿FXOGDGHSDUDUHVSRQGHU
WHPSRWRWDOYRFrFRQVLGHUDTXHDSURYDIRL
jSURYD
A PXLWRORQJD
B ORQJD QUESTÃO 8
C DGHTXDGD
D FXUWD &RQVLGHUDQGR DSHQDV DV TXHVW}HV REMHWLYDV GD SURYD
E PXLWRFXUWD YRFrSHUFHEHXTXH

QUESTÃO 4 A QmRHVWXGRXDLQGDDPDLRULDGHVVHVFRQWH~GRV
2V HQXQFLDGRV GDV TXHVW}HV GD SURYD QD SDUWH GH B HVWXGRX DOJXQV GHVVHV FRQWH~GRV PDV QmR RV
)RUPDomR*HUDOHVWDYDPFODURVHREMHWLYRV" DSUHQGHX
A 6LPWRGRV C HVWXGRX D PDLRULD GHVVHV FRQWH~GRV PDV QmR RV
B 6LPDPDLRULD DSUHQGHX
C $SHQDVFHUFDGDPHWDGH D HVWXGRXHDSUHQGHXPXLWRVGHVVHVFRQWH~GRV
D 3RXFRV E HVWXGRXHDSUHQGHXWRGRVHVVHVFRQWH~GRV
E 1mRQHQKXP
QUESTÃO 5 QUESTÃO 9
2V HQXQFLDGRV GDV TXHVW}HV GD SURYD QD SDUWH GH 4XDOIRLRWHPSRJDVWRSRUYRFrSDUDFRQFOXLUDSURYD"
&RPSRQHQWH(VSHFt¿FRHVWDYDPFODURVHREMHWLYRV"
A 0HQRVGHXPDKRUD
A 6LPWRGRV
B (QWUHXPDHGXDVKRUDV
B 6LPDPDLRULD
C $SHQDVFHUFDGDPHWDGH C (QWUHGXDVHWUrVKRUDV
D 3RXFRV D (QWUHWUrVHTXDWURKRUDV
E 1mRQHQKXP E 4XDWURKRUDVHQmRFRQVHJXLWHUPLQDU

 BIOMEDICINA

Você também pode gostar