Você está na página 1de 206

Índice

Prefeitura Municipal de

SANTOS
Técnico Desportivo
· Gestão Esportiva · Atividades Aquáticas · Atividades Náuticas · Atividades com pessoa com
'H¿FLrQFLDÂ$WLYLGDGHVSDUDDSHVVRD,GRVDÂ$WOHWLVPRÂ%DVTXHWHEROÂ-XG{
Â.DUDWrÂ(VSRUWHVGH3UDQFKDÂ7rQLVÂ)XWHEROÂ)XWVDOÂ*LQiVWLFD$UWtVWLFDH5tWPLFDÂ
+DQGHEROÂ9ROHLEROÂ&RQGLFLRQDPHQWR)tVLFRÂ/D]HUH5HFUHDomR
Edital nº 10/2014 – COFORM/SEGES

ARTIGO DO WILLIAM DOUGLAS

PORTUGUÊS

&RQKHFLPHQWRVGDQRUPDFXOWDQDPRGDOLGDGHHVFULWDGRLGLRPDHDSOLFDomRGDRUWRJUD¿DR¿FLDO 01
$FHQWXDomRJUi¿FD 05
8VRHFRORFDomRGHSURQRPHV 07
Flexão verbal e nominal 11
&RQFRUGkQFLDQRPLQDOHYHUEDO 14
5HJrQFLDQRPLQDOHYHUEDO 19
2FRUUrQFLDGHFUDVH 23
3RQWXDomR 26
Confronto e reconhecimento de frases corretas e incorretas 
,QWHUSUHWDomRGHWH[WRV 34

RACIOCÍNIO LÓGICO

Raciocínio Lógico: Visa avaliar a habilidade do candidato em entender a estrutura lógica das relações arbitrárias entre
SHVVRDVOXJDUHVFRLVDVHYHQWRV¿FWtFLRVGHGX]LUQRYDVLQIRUPDo}HVGDVUHODo}HVIRUQHFLGDVHDYDOLDUDVFRQGLo}HVXVDGDVSDUD
HVWDEHOHFHUDHVWUXWXUDGDTXHODVUHODo}HV 01
As questões desta prova poderão tratar das seguintes áreas: estruturas lógicas, lógica de argumentação, diagramas
OyJLFRV 05

Didatismo e Conhecimento
Índice

CONHECIMENTOS DE INFORMÁTICA

MATÉRIA INCLUSA NO CD-ROM QUE ACOMPANHA ESTA APOSTILA

6RPHQWHSDUDRFDUJRGH7e&1,&2'(63257,92±*(67­2(63257,9$

Sistema Operacional Microsoft Windows01


0LFURVRIW2I¿FH(GLWRUGHWH[WRV:RUGH3ODQLOKD([FHO13
,QWHUQHWHIHUUDPHQWDV0LFURVRIW2I¿FH YHUV}HVH 76

CONHECIMENTOS ESPECÍFICOS

&RPXPDWRGDVDVPRGDOLGDGHV

&RQFHLWRVSULQFtSLRV¿QDOLGDGHVHREMHWLYRVGD(GXFDomR)tVLFD 01
&RQGLFLRQDPHQWRItVLFROHJLVODomRPHWRGRORJLDPpWRGRVJtPQLFRVRUJDQL]DomRHSHGDJRJLD 09
&RQKHFLPHQWRVGH¿VLRORJLDGRH[HUFtFLRWUHLQDPHQWRGHVSRUWLYRGHVHQYROYLPHQWRPRWRU 60
&RQFHLWRVDQDWRPLDELRPHWULDELRPHFkQLFDH¿VLRORJLDGRHVIRUoR 72
/HJLVODomRUHODFLRQDGDDRVHVSRUWHV 97
3ROtWLFD1DFLRQDOGR(VSRUWH 107
'LPHQV}HVELROyJLFDVDSOLFDGDVjHGXFDomRItVLFDHDRHVSRUWH 121
$VPXGDQoDV¿VLROyJLFDVUHVXOWDQWHVGDDWLYLGDGHItVLFD 129
1XWULomRHDWLYLGDGHItVLFD 133
&UHVFLPHQWRHGHVHQYROYLPHQWRPRWRU140
'HVHQYROYLPHQWRGDFULDQoDHGRDGROHVFHQWH 145
3ULQFtSLRVFLHQWt¿FRVGRWUHLQDPHQWRGHVSRUWLYR 149
3ODQHMDPHQWRHSHULRGL]DomRGHWUHLQDPHQWRSDUDPRGDOLGDGHVLQGLYLGXDLVHFROHWLYDV 155
$VSHFWRVLQWHUYHQLHQWHVQDSHUIRUPDQFH159
$YDOLDomRItVLFDHSUHVFULomRGHH[HUFtFLRV163
2UJDQL]DomRHJHVWmRHVSRUWLYD 179
6LVWHPDVGHDYDOLDomR188
9LVmRLQWHUGLVFLSOLQDUHWUDQVYHUVDOGRFRQKHFLPHQWR 191
eWLFDQRWUDEDOKR 195

Didatismo e Conhecimento
CONHECIMENTOS ESPECÍFICOS
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
rer) uma mediação privilegiada, entre os estudantes e entre professo-
Professor Ronaldo Sena e Silva res e estudantes, motivada pelo anelo de desenvolver uma função
social fundamental: transmitir e produzir cultura, oferecer às novas
Mestrando em Ciência Animal pela UNOESTE, Especialis- JHUDo}HVRTXHGHPDLVVLJQL¿FDWLYRSURGX]LXDKXPDQLGDGHDRORQ-
ta em Osteopatia pela EBRAFIM e Fisiologia do Exercício pela go de sua história. Não se trata aqui de desconsiderar ou suprimir a
UNOPAR; Graduado em Fisioterapia pela FAP e em Educação aprendizagem de valores, normas e comportamentos característicos
Física pela ESEFAP. de uma cultura particular, que de fato são também aprendidos/parti-
lhados na instituição escolar. Trata-se de, considerando-os inclusive
pré- requisitos básicos e necessários em termos de relações interin-
CONCEITOS, PRINCÍPIOS, FINALIDADES E GLYLGXDLVJDUDQWLUDHVSHFL¿FLGDGHGDHVFRODQDWUDQVPLVVmRGHFRQ-
OBJETIVOS DA EDUCAÇÃO FÍSICA. WH~GRVFLHQWt¿FRVHODERUDGRVFXOWXUDOPHQWHGHIRUPDDSXUDGDHVLJ-
QL¿FDQWHSRLVHVVDpDVXD¿QDOLGDGHSULQFLSDO(VVDVFRQVWDWDo}HV
UHÀHWHPGHIRUPDJHUDODLPSRUWkQFLDGDHVFRODHQTXDQWRLQVWLWXLomR
social responsável pela transmissão cultural. Contudo, é importante
A educação, apesar de sua amplitude e complexidade, é enfocada ressaltar que os conhecimentos que circulam dentro da escola, ou
na maioria das vezes. Unicamente se atentarmos para este fato, iremos VHMD RV FRQWH~GRV FLHQWt¿FRV VLVWHPDWL]DGRV TXH VH PDWHULDOL]DP
perceber que, cotidianamente lidamos com ela quando nos deparamos em forma de disciplina escolar, e os demais conhecimentos partilha-
com algo novo e que não é de nosso repertorio de conhecimentos. dos no contexto escolar, valores, comportamentos – ambos os sabe-
Trata-se de uma atitude típica de quem aprende aos poucos a utilizar res são igualmente fruto de um longo processo acumulativo que re-
um computador, um celular, a dirigir um automóvel, uma motocicle- ÀHWH R FRQKHFLPHQWR H D H[SHULrQFLD DGTXLULGRV SHODV QXPHURVDV
ta, ou, em exemplos mais simples e corriqueiros, como a criança que gerações que nos antecederam. Esses aspectos podem ser manipula-
aprende com a mãe a se comportar diante dos outros, a conversar ou dos de forma adequada possibilitando inovações e invenções. Po-
YHVWLUVHSDUDLUDGHWHUPLQDGRVORFDLV(Q¿PSRGHUtDPRVOLVWDULQ~- UpPVHPXPHVSDoRSURSLFLRFRP¿QDOLGDGHVHSURSyVLWRVFODURVH
meras ações e atitudes em meio às relações que envolvem educação GH¿QLGRVWHUtDPRVGHFHUWRPRGRTXH³UHGHVFREULU´WRGRFRQKHFL-
dentro de contextos socioculturais distintos. Com isso pretende-se mento acumulado até nossos dias pela Física, pela Matemática, Bio-
alcançar a seguinte idéia: mesmo que não existissem escolas em logia, História, Educação Física entre outras. São conhecimentos
nossa sociedade algum processo de transferência do saber acumula- que dependem de um espaço organizado e de um ensino sistemati-
GRWRUQDULDSRVVtYHOVHUWUDQVPLWLGR,VVRMXVWL¿FDDHGXFDomRFRPR zado para sua transmissão, o que não se torna regra, mas convenha-
algo próximo do inevitável nos grupos organizados, pois ninguém mos que pudesse acontecer de forma lenta, sem as relações necessá-
escapa dessa transferência. Existe um ditado popular que diz: “Edu- ULDVHQWUHRVVDEHUHVQRYRVHRVMiFRQVWUXtGRVHDWpPHVPRLQH¿FLHQ-
cação vem de casa”. É claro que esse ditado refere-se, na maioria tes se fossem aprendidos apenas em outras instancias. Isso sugere
dos casos, à falta de “bons modos sociais”, a comportamentos não que a escola difunde saberes que mantém certa peculiaridade em
aceitáveis, porém a educação não ocorre somente em casa, ela acon- relação às demais instancias que desempenham também um papel
tece: “(...) em casa, na rua, na igreja ou na escola, de algum modo ou educativo direta ou indiretamente na sociedade. Essa “particularida-
de muitos todos nós envolvemos pedaços da vida com ela: para de” da escola tem sido foco de muitas críticas por parte daqueles que
aprender, para ensinar, para aprender e ensinar. Para saber, para fa- reconhecem a educação em uma perspectiva progressista ao longo
zer, para ser ou para conviver, todos os dias misturamos a vida com dos anos e uma série de discussões foram engendradas e apresenta-
a Educação”. Em síntese, nos atenta para o fato de que, a educação, das em diversas obras. Uma delas é “A democratização da escola
de um modo geral, é uma dimensão mais ampla e pode se dar não SXEOLFD SHGDJRJLD FUtWLFR VRFLDO GRV FRQWH~GRV´ H RXWUD WDPEpP
apenas na escola, mas também na família, na igreja, no local de tra- importante e de grande repercussão no território nacional é “Escola
balho, no lazer, entre outros, caracterizando-se por uma forma difusa e democracia”. Consideramos que essas críticas estão intimamente
ou assistemática objetivando transmitir às novas gerações “(...)cren- relacionadas ao foco que estamos discutindo nesse momento, pois
ças , idéias, valores, o saber comum, os modelos de trabalho, as re- buscam de variadas formas discutir e esboçar respostas para a se-
lações entre membros, o modo de vida de cada sociedade ou grupo gunda pergunta feita anteriormente: Qual é a função social da esco-
VRFLDOHQ¿PDIRUPDSDUWLFXODUFRPRHVVHVHQWHQGHPHPDWHULDOL- la? Em seus estudos a questão da cultura como eixo do processo
zam seu dia-a-dia”. Mas, embora educação seja uma prática social- curricular e defendem ainda uma orientação multicultural no con-
comunitária ampla e comum no cotidiano das pessoas é evidente texto escolar, ou seja, “(...) a escola nesse contexto, mais que trans-
que quanto mais discursamos sobre ela atualmente mais se torna missora da cultura, da ‘verdadeira cultura’ passa a ser concebida
HYLGHQWHDGL¿FXOGDGHHPLJQRUDURIDWRGHTXHDLQGDSUHFLVDPRV FRPRXPHVSDoRGHFUX]DPHQWRFRQÀLWRHGLiORJRHQWUHGLIHUHQWHV
UHÀHWLUVREUHD¿QDOLGDGHHIXQomRVRFLDOTXHDHVFRODGHYHGHVHP- FXOWXUDV´$VVLPRVFRQKHFLPHQWRV FRQWH~GRV FXOWXUDLVGHFDUiWHU
penhar, isso quando consideramos que é a partir de certa demanda FLHQWt¿FRWUDQVPLWLGRVQHVVHHVSDoRHQWUDPHPFRQIURQWRFRPIRU-
social que são estabelecidas as diretrizes a serem adotadas no pro- mas divergentes de compreensão da realidade trazidas por crianças
cesso educacional escolarizado. Por isso mesmo torna-se difícil dis- e adolescentes que nele ingressam, o que corresponderia logicamen-
FXWLU XPD HGXFDomR HVFRODUL]DGD GH FXQKR FUtWLFR HUHÀH[LYR VHP te ao surgimento de interpretações acerca desses conhecimentos
antecipadamente rever o papel social que a escola tem representado também divergentes. No entanto, será mesmo que isso tem aconteci-
ao longo das décadas. Neste contexto é interessante perguntar: O do? As crenças depositadas pela sociedade no que considera ser uma
que é escola? Qual sua função social? A escola pode ser considerada ³PLVVmRVDOYDGRUD´GRVFRQWH~GRVHVFRODUHVHQTXDQWRLQVWUXPHQWRV
como uma instituição constituída historicamente no contexto da mo- formadores de seres humanos inteligentes, operantes e capacitados
dernidade e é um espaço no qual ocorre (ou pelo menos deve ocor- para atuar e mudar os rumos da história marcada pela pobreza, pela

Didatismo e Conhecimento 1
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
discriminação e por desigualdades sociais, têm se deparado com em forma de um ambiente propenso às reivindicações liberais que
graves limitações na medida em que é exatamente por meio desse são as escolas: tradicional, renovada não diretiva e a tecnicista. E
“instrumento mágico” que a situação tende a se perpetuar e até mes- ao mesmo tempo podemos perguntar: Mas, e quanto a Educação
PRVHDJUDYDUDLQGDPDLV&RQVLGHUiYHOSDUWHGRVFRQWH~GRVTXHVmR Física, como essa área participou nesses modelos de escola pauta-
ensinados na escola apresenta forte tendência padronizadora e ho- dos no liberalismo? A seguir, veremos como a Educação Física tem
mogeneizadora quanto à formação ofertada por assumirem um cará- VHMXVWL¿FDGR ¿QDOLGDGHVHREMHWLYRV GHQWURGRFRQWH[WRHVFRODUH
ter neutro, desvinculados de um contexto mais amplo, e utilizados como, historicamente, estruturou- se em meio a essas concepções
com a intenção de preparar intelectualmente os alunos. Esses alunos, de escola.
por sua vez, ingressam no ambiente escolar, caracterizados por dife-
renças socioculturais que servirão inevitavelmente de base para as OS MODELOS DE ESCOLA E A EDUCAÇÃO FÍSICA NO
aquisições (ou não) que a escola pretende desenvolver. É, no entan- CONTEXTO ESCOLARIZADO
WRQRVHVWXGRVDFHUFDGDVLQÀXrQFLDVVRFLRSROtWLFDVQDHGXFDomRTXH
a escola tem recebido duras críticas, evidenciadas em trabalhos na- Anteriormente tivemos como objetivo abordar a educação em
cionalmente reconhecidos como os já citados em outro momento seu contexto geral, ou seja, reconhecê-la enquanto prática social e
6DYLDQLH/LEkQHRDOpPGH3DXOR)UHLUH0RDFLU*DGRWWLHQWUHRX- comunitária e assim vimos que a educação se dá em casa, na rua,
tros. Segundo essas criticas, as escolas estariam comprometidas em QDLJUHMDHQ¿PWUDWDVHGHXPDSUHQGL]DGRFRQVWDQWHGHYDORUHV
termos de organização e fundamentação pedagógica com a chamada comportamentos considerados aceitáveis pelo grupo, crenças, co-
doutrina liberal que teve origem na Europa, no século XVIII servin- nhecimentos que são necessários para o convívio social. São formas
GRGHMXVWL¿FDWLYDSDUDRDLPSOHPHQWDomRGHXPDQRYDRUGHPVR- variadas de educação. A educação voltada para o trabalho, no en-
cial e econômica que substituiu o feudalismo concretizando a ascen- tanto, foi sendo transferida aos poucos à competência das escolas/
são burguesa que se fez classe dominante. Podemos caracterizar o professores/aulas. Isso ocorria conforme o processo de industriali-
liberalismo de um modo geral como uma doutrina que defende: [...] zação se acentuava e se sobrepunha ao meio de produção enquan-
a liberdade para o desenvolvimento de atividades intelectuais, reli- to subsistência e fazia, assim, com que o povo do campo migrasse
giosas, políticas, econômicas; a igualdade perante a lei, isto é, a para os grandes centros, no qual a especialização do trabalho exigia
igualdade civil já que individual ou socialmente não é possível; o FRQKHFLPHQWRVTXHQmRSRGHULDPVHUSDVVDGRVGHSDLSDUD¿OKRe
direito natural do indivíduo à propriedade; a convicção de que cada neste contexto que surgiram as instituições de ensino sistematizado
pessoa tem aptidões e talentos próprios (individualismo) que podem que cumpririam com essa tarefa e, historicamente, três modelos de
HGHYHPVHUGHVHQYROYLGRVDR0i[LPRH¿QDOPHQWHDGHPRFUDFLD escola seriam estabelecidas: tradicional, escola nova e escola tecni-
como forma de governo mais adequada e a participação coletiva cista. Apontamos cinco tendências no processo histórico da Educa-
através de representantes de livre escolha de cada um. ção Física: higienista, militarista, pedagogicista, competitivista e po-
8PDFODVVL¿FDomRUHOHYDQWHGDVWHQGrQFLDVSHGDJyJLFDVQDSUi- pular. É possível fazer uma analogia com relação aos períodos desta
tica escolar e alerta para o fato de que grandes partes dos professores IRUPD(VFRODWUDGLFLRQDODWp (G)tVLFDKLJLHQLVWDFRQFHSomR
que atuam nas escolas, implícita ou explicitamente, incorporam em ~QLFDDWp (VFRODQRYDDQRV (G)tVLFDSHGDJRJLFLVWDQR
sua prática diária uma orientação pedagógica que corresponde aos SyVJXHUUD H(VFROD7HFQLFLVWD (G)tVLFDFRPSHWLWLYLV-
ideais liberais. A pedagogia liberal compreende a escola como um WD¿QDOGDGpFDGDGHHGXUDQWHRVDQRV 1mRRFRUUHUDPSH-
espaço de equalização social e preparação individual. Por isso essa ríodos com extrema coincidência, até porque a escola tradicional e a
pedagogia tem o objetivo de inserir o indivíduo no meio social de tendência higienista continuaram existindo mesmo com os ideários
forma pré-determinada, porém essa inserção visa ao ajustamento do da escola nova e do pedagogicismo.
próprio individuo e ao desempenho de papéis sociais. A escola nesse
HQIRTXHFXPSUHVXDVIXQo}HVHVSHFt¿FDV±WUDQVPLVVmRGDFXOWXUD (6&2/$75$',&,21$/('8&$d­2)Ë6,&$+,*,(1,6-
e de modelos de comportamento, formação da cidadania conscien- TA
te e ainda garante a manutenção estrutural da sociedade. Ela passa
a funcionar como um mecanismo de manutenção/preservação da A primeira escola caracterizada pelo
hegemonia da classe burguesa a medida que oferece oportunidades estabelecimento de uma pedagogia pautada em ideais liberais
iguais a todos, independente de classes, crenças ou outros fatores. ¿FRXKLVWRULFDPHQWHFRQKHFLGDFRPRHVFRODWUDGLFLRQDOHGDWDGR
Essas oportunidades, porém não atendem exatamente a todos que século XIX. Com o intuito de construir uma sociedade democrática
nela ingressam. Assim, a escola proporciona oportunidades iguais que corresponderia aos anseios da classe burguesa em ascensão, à
para todos e, ao mesmo tempo, mascara o efeito dos condicionantes HVFRODVHULDFRQ¿DGDDUHVSRQVDELOLGDGHGHIRUPDUFLGDGmRVFXOWRV
socioculturais, ao enfatizar o esforço individual de cada aluno na ³HVFODUHFLGRV´SDUDTXHRVV~GLWRVGRDQWLJRUHJLPHIRVVHPWUDQVIRU-
EXVFDGDFRPSUHHQVmRGHFRQWH~GRVGHVSURYLGRVGHTXDOTXHUYLQ- mados em cidadãos.
FXODomR FRP GHWHUPLQDQWHV VRFLRHVWUXWXUDLV (VVHV FRQWH~GRV VmR 2V FRQWH~GRV D VHUHP WUDQVPLWLGRV VLVWHPDWLFDPHQWH ID]LDP
apropriados às condições das crianças da classe burguesa, levando parte do acervo cultural geral construído pela humanidade e, por
ao fracasso as crianças das classes menos favorecidas e garantin- meio deles é assegurado aos alunos uma formação puramente
do, desta forma, a continuidade da hegemonia dos dominantes. O intelectual e moral e o esforço individual é a chave para o sucesso
fracasso é interpretado nesse sentido como se fosse da escola e não uma vez que as possibilidades são iguais para todos. 2VFRQWH~GRV
dos alunos, pois esta “(...) ignora as efetivas diferenças, principal- além de serem desvinculados da realidade social por seu caráter ex-
mente as sociais, existentes entre as crianças”. Podemos, então, ca- clusivamente intelectual são verdades a serem seguidas). Realizar
UDFWHUL]DUSDUDRV¿QVGHVWHHVWXGRHFRPEDVHHP/LEkQHR   interessante descrição da organização da escola tradicional. Ela as-
três concepções de escola que buscam estruturar-se e estabelecer-se sim descreve:

Didatismo e Conhecimento 2
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
1DHVFRODWUDGLFLRQDODVFULDQoDVVHRUJDQL]DPHP¿ODGHSUH- são a progressista e a não diretiva. A escola não diretiva caracteriza-
ferência em carteiras individuais, todas voltadas para o professor se por uma motivação à descoberta individual do conhecimento,
que se coloca à frente da classe, a par de um quadro negro do qual um autodesenvolvimento que se dá mediante uma ação pedagógica
se serve a maior parte do tempo. As relações essenciais da criança limitada a oferece condições facilitadora de aquisição do conheci-
são com o professor; as atividades grupais, que porventura se desen- mento. O professor, um agente facilitador, buscava oferecer meios
volvam, são utilizadas como processos competitivos e não com o de estimular a mudança intrínseca do indivíduo, pretendendo atingir,
objetivo de desenvolver a colaboração. A escola como um todo tam- com isso, níveis de adaptação/ajustamento às condições ambientais,
bém não foge aos princípios de ordem, de disciplina e competição. sempre ajudando, em um processo de relacionamento interpessoal.
É constituída por classes regidas por professores diferentes, que não A intervenção direta considerada prejudicial a aprendizagem. Na
guardam necessariamente relações de integração ou de colaboração, escola nova: [...] a sala de aula e a escola se organizam no sentido
cada qual à frente de seus alunos, como se sua classe fosse um mun- GHSURSRUFLRQDUDRVDOXQRVP~OWLSODVRSRUWXQLGDGHVGHSHVTXLVDGH
do a parte. expressão e de comunicação. Estes não trabalham mais sozinhos,
Relatando a história da educação no Brasil, apresenta uma críti- mas em grupo, em processo de cooperação. As atividades não são
ca empreendida à escola tradicional pela chamada pedagogia liber- programadas, mas se desenvolvem espontaneamente conforme as
tadora acusando-a de ser uma educação do tipo “bancaria”. Nela: crianças se encaminhem para essa ou para aquela direção, conforme
Em sala de aula, a matéria é exposta verbalmente ou por meio de seu interesse seja despertado para algum objeto ou desejo de desco-
demonstrações pelas quais o aluno deverá fazer uma associação com berta. O material é numeroso e, muitas, vezes, reproduz as condi-
tudo o que já foi ensinado, memorizando conceitos e formulas para ções reais de existência dos alunos.
então aplicar na resolução de exercícios solicitados pelo professor A escola nova não substituiu a escola tradicional: elas atuaram
em forma de atividade de sala ou tarefa a ser entregue. A escola concomitantemente, embora o ideário escolanovista tenha perturba-
tradicional compreendia a educação como um direito igual a todos GRDRUGHPGDHVFRODWUDGLFLRQDODRGHPRQVWUDUVXDVGH¿FLrQFLDV$
e atribuía o fracasso à falta de esforço do aluno. Enquanto na escola escola nova, no entanto, também deixou a desejar pelo fato de exigir
tradicional a preocupação era formar o cidadão para o novo modelo FXVWRV DOWRV ¿FDQGR UHVWULWDV D SHTXHQRV Q~FOHRV EHP HTXLSDGRV
econômico que se instalará, com base em uma formação intelectual, Esse pensamento acerca da escola e sua função propagou-se de for-
a Educação Física tinha “um papel fundamental na formação de ho- ma tal que foi adotado pelos professores. Com isso se enfraqueceu
PHQVHPXOKHUHVVDGLRVIRUWHVGLVSRVWRVjDomR$VD~GHGHYHULD a transmissão de conhecimentos e houve o rebaixamento do nível
ser colocada em primeiro lugar e a Educação Física deveria oferecer GHHQVLQRGHVWLQDGRjVFDPDGDVSRSXODUHV(VWHHUDR~QLFRPHLR
um programa que viabilizasse a aquisição de padrões de conduta de acesso ao conhecimento elaborado, mas o aprimorando incidiu
TXHDVVHJXUDVVHDVD~GH³GRSRYR´HOLYUDVVHDVRFLHGDGHGHYtFLRVH apenas sobre o ensino destinado às elites. Na Educação Física, a
GRHQoDV(VVHSHQVDPHQWRYLJRURXDWpHDFRPSDQKRXDFUHQoD tendência pedagogicista viria a romper com a idéia vigente de que
na educação escolarizada enquanto instancia responsável pela cons- DPHVPDHUDDSHQDVXPPHLRGHSURPRomRGDVD~GHHGLVVHPLQD-
trução de uma sociedade democrática constituída por membros es- ção de hábitos sadios. Embora vinculada ao pensamento liberal,
clarecidos. A pátria necessitava de pessoas inteligentes e saudáveis. essa tendência apresentou um avanço em relação as anteriores por
$¿QDOLGDGHGD(GXFDomR)tVLFDQDHVFRODHUDHQWmRDGLVVHPLQDomR creditar à Educação Física um papel predominantemente educativo.
de hábitos, ou melhor, a educação higiênica do corpo e as “lições” ,QÀXHQFLDGDSHORVLGHDLVGRHVFRODQRYLVPRWDOYH]SRVVDPRVHQFRQ-
eram ensinadas via memorização, correção e avaliação (prova, tes- trar em John Dewey alguns princípios que viriam a nortear as ações
tes, etc.). Outro modelo de escola, caracterizado por contrapor a es- dos professores fundamentados nessa tendência. O pensamento de
cola tradicional, será esboçado a seguir. Dewey, quanto ao próprio currículo escolar estaria centrado na re-
O professor ensina, os alunos são ensinados; O professor sabe OHYkQFLDGHVWLQDGD³DFULDWLYLGDGHDRSODQHMDPHQWRHDH[HFXomRH
tudo, os estudantes nada sabem; O professor pensa, e pensa pelos avaliação do próprio aluno, ou seja, respeitando sua individualidade
estudantes; O professor fala e os estudantes escutam; O professor e intencionalidade”. Visava-se a tão desejada “formação integral”, a
estabelece a disciplina e os alunos são disciplinados. O professor es- formação do cidadão. Dessa forma, a Educação Física contribuiria
colhe, impõe sua opção, os alunos se submetem; O professor traba- QmRVySDUDDSURPRomRGDVD~GHPDVWDPEpPSDUDDIRUPDomRGR
lha e os alunos tem a ilusão de trabalhar graças a ação do professor; caráter e preparação vocacional. Isso exigia do professor um posi-
2SURIHVVRUHVFROKHRFRQWH~GRGRSURJUDPDHRVDOXQRV±TXHQmR cionamento diferente, de não imposição perante os alunos que aos
são consultados – se adaptam; O professor confunde a autoridade poucos descobririam seus talentos em relação ao meio que deveria
GRFRQKHFLPHQWRFRPVXDSUySULDDXWRULGDGHSUR¿VVLRQDOTXHHOH VHUDGHTXDGDPHQWHSURQWL¿FDGRFRPRHVSDoRHRVPDWHULDLVDGH-
opõe à liberdade dos alunos; O professor é sujeito do processo de quados. As atividades propostas seriam de cunho recreativo.
formação, os alunos são simples objetos. A Educação Física pedagogicista estava ligada ao crescimento
GDUHGHGHHQVLQRSXEOLFRQRVDQRVH2GHVHQYROYLPHQWRLQ-
ESCOLA RENOVADA NÃO DIRETIVA/ EDUCAÇÃO FÍSI- dustrial e a urbanização relativamente acelerada no Brasil, acoplada
&$3('$*2*,&,67$ a um regime político que, ainda que formalmente, baseava-se no
voto, trouxe para as elites dirigentes o fenômeno da pressão social
Vale lembrar que a tendência renovada formou-se em oposição em torno de novas oportunidades de ascensão social. Dentro desse
ao modelo tradicional, que não vinha cumprindo satisfatoriamente movimento a escola publica se consubstanciou, sem duvida, numa
sua função de equalização social. Conhecida pelo nome de escola reivindicação constante das classes populares. A democracia popu-
nova (escolanovismo), sua característica principal é a não diretivi- lista, suscetível a tais anseios, viu-se na obrigação de ampliar a rede
dade do ensino. Entretanto, é possível mencionar duas vertentes, que publica de ensino.

Didatismo e Conhecimento 3
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
No entanto, a preocupação da Educação Física com a formação país desenvolvido, o Brasil enquanto potencia. Na Educação Físi-
do sujeito estava atrelada à concepção característica da escola nova, FDDWHFQL]DomRVHGHXHPIXQomRGDDSOLFDomRGHHVWXGRVFLHQWt¿FRV
segundo a qual a escola e a educação eram algo “a parte” da socieda- VREUH¿VLRORJLDHWUHLQDPHQWRGHVSRUWLYRELRPHFkQLFDHWF7XGRR
de, oferecendo uma formação que inviabilizaria a compreensão das TXHUHSUHVHQWDYDPHOKRUGHVHPSHQKRHPDLVH¿FLrQFLDQRUHQGLPHQ-
classes populares sobre o próprio contexto em que viviam. Enquanto to esportivo era acrescentado ao treinamento que se dava na esco-
D~QLFDIRQWHGHDFHVVRDRFRQKHFLPHQWRSRUSDUWHGDVFDPDGDVSRSX- la. Aos poucos, os alunos/atletas tornavam-se ignorantes a respeito
lares, essa tendência distanciou do aluno em demasia o conhecimento das condições sociais em que viviam, pois era a chance de ascensão
HODERUDGRFLHQWL¿FDPHQWH VRFLDOTXHVLJQL¿FDYDUHFRQKHFLPHQWRVXFHVVR,VVRHUDLPSRUWDQWH
na escola por dois motivos: para que fossem conquistadas medalhas
ESCOLA TECNICISTA/EDUCAÇÃO FÍSICA TECNICISTA ROtPSLFDV FRPR VLJQL¿FDGR GH HVIRUoR LQGLYLGXDO GH YLWyULD H SRU
outro lado outro, era de interesse por que, em plena ditadura “fazia-se
Essa tendência entende que a função essencial da escola é o necessário eliminar as críticas internas e deixar transparecer um clima
preparo para o trabalho fabril. Para isso a própria organização da es- de prosperidade, desenvolvimento e calmaria”. Esse entendimento da
cola deve sofre transformações que levem à formação de indivíduos ¿QDOLGDGHGD(GXFDomR)tVLFDQDHVFRODVHDODVWURXSULQFLSDOPHQWH
competentes para o mercado de trabalho e estejam providos de infor- em função da mídia, pois esta divulga a idéia de possível “ascensão
mações precisas objetivas e rápidas. No trabalho fabril, as máquinas social” para aqueles que viviam em situações de pobreza. Além disso,
exigem a adaptação do indivíduo que exerce em um controle que está mostrava-se que a ascensão era possível, embora alguns pudessem
além de sua subjetividade. Assim, cada um é responsável por uma par- alcançar o lugar no podium. O professor, nesse contexto, receberia co-
FHODGRWUDEDOKRTXHUHVXOWDUiQDSURGXomR¿QDOGRREMHWRRXVHMDR nhecimentos de especialistas que os elaboravam e seria sua a tarefa de
produto é decorrente da maneira com que o processo é organizado. A aplicar o treinamento de acordo com eles. Todas elas correspondem
educação é vista como o processo racionalizado, mecanizado e parce- à doutrina liberal que estimula a igualdade, a liberdade e o individua-
lado de acordo com a especialização de diferentes funções, com base lismo, base de sustentação do capitalismo. Dessa forma a escola é
em um planejamento intencional. O ambiente escolar é, de acordo organizada para atingir a mesma meta, mas com contornos diferentes.
com esse enfoque, um espaço de aquisição de habilidades e conheci- Vemos, então, que essas três tendências apresentam como fun-
PHQWRVDSOLFiYHLVDRWUDEDOKR(VVHVFRQKHFLPHQWRV FRQWH~GRV HKD- ção social a manutenção do pensamento liberal, do capitalismo e, em
ELOLGDGHVVmRREMHWLYRVFRPSULQFtSLRVHVWDEHOHFLGRVFLHQWL¿FDPHQWH conseqüência, da divisão de classes antagônicas. A Educação Física,
e ordenados numa seqüência lógica por especialistas que “descobrem” de certa forma, transmitia conhecimentos direcionados a sanar a ig-
e que são aplicados pelos professores. O professor já não é conside- QRUkQFLDGRSRYRSRUPHLRGDDTXLVLomRGHKiELWRVVDXGiYHLV KLJLH-
rado o sujeito dotado do conhecimento a ser transmitido aos alunos, nismo), o estímulo a interesses individuais quanto aos conhecimentos
mas um agente responsável apenas pela transposição do mesmo, que (não diretividade, pedagogicismo), e o conhecimento e aquisição de
pHODERUDGRFLHQWL¿FDPHQWHREHGHFHQGRDFULWpULRVGHUDFLRQDOLGDGHH KDELOLGDGHVHVSRUWLYDVH¿FLHQWHV FRPSHWLWLYLVPR (PJHUDOD(GX-
produtividade. Para o ensino, são utilizadas técnicas e procedimentos cação Física contribui inevitavelmente para o pensamento liberal, o
com base na tecnologia educacional, que tem papel controlador do capitalismo e a divisão entre as camadas favorecidas e desfavorecidas
ensino por meio de princípios comportamentais e tecnológicos que se os alunos não compreendem que seu movimentar-se intencional
promovem mudanças no comportamento e desempenho, aqui um HVWiLQVHULGRQDVFRQGLo}HVHVSHFL¿FDVGRFRQWH[WRVRFLRFXOWXUDODTXH
entendimento de aprendizagem, reforçando respostas controladoras serve. Isso quer dizer que se a Educação Física se fecha entre as quatro
e condicionantes. Pode-se dizer que se trata de um ensino diretivo SDUHGHV GD HVFROD H QmR EXVFD LQWHUUHODFLRQDU RV FRQWH~GRV FRP D
por controlar as condições de aprendizagem com forte intervenção. UHDOLGDGHFRQFUHWDGRVDOXQRVHVWDEHOHFHQGRXPSDGUmRGHFRQWH~GR
Portanto, na escola tecnicista: [...] importa muito a existência de meios HHPFRQVHTrQFLDGHDOXQR VDXGiYHOWDOHQWRVRLQGLYLGXDOLVWDH¿-
DX[LOLDUHVGHHQVLQRFRPRODERUDWyULRVHR¿FLQDVRQGHVHFRPSUR- FLHQWH GL¿FLOPHQWHVHDIDVWDUiGRSHQVDPHQWROLEHUDO$VVLPRHOH-
YDDWHRULDDSUHQGLGDHVHGHVHQYROYHPKDELOLGDGHVPHFkQLFDVFRPR mento desconsiderado não só pela Educação Física, como pela Edu-
aplicação dessa teoria. A escola se organiza também segundo os prin- cação no contexto geral, é a contextualização e, sem esse princípio, ela
FtSLRVGHUDFLRQDOLGDGHHH¿FLrQFLDLVWRpEXURFUDWLFDPHQWHFRPSHV- oferece uma educação sem sentido social. A Educação Física destinou
soal auxiliar e um corpo de especialista que agem junto ao professor, atenção durante todos esses anos ao aspecto biológico de forma pre-
no sentido de fornecer-lhe a tecnologia adequada ao atingimento de dominante e esqueceu-se das outras dimensões que compõem o ser
excelência do ensino e de auxiliá-lo na tarefa pedagógica. humano: psicológica e sociocultural. Com base em tudo que foi dito
&RPDHVFRODWHFQLFLVWDGR¿QDOGDGpFDGDGHDDSUHR- até então, é interessante nos perguntar como será que os professores
FXSDomRVHGiFRPDIRUPDomRGHXPLQGLYLGXRH¿FLHQWHHSURGXWLYR atuantes e também alunos que atualmente ingressam ou estão em fase
para o desenvolvimento econômico. A escola seguia os modelos do GHFRQFOXVmRGRFXUVRGHIRUPDomREiVLFDUHFRQKHFHPD¿QDOLGDGHGD
processo fabril em que o trabalhador não é levado a compreender sua Educação Física na escola e quais consideram ser os objetivos nortea-
função subjetivamente, mas apenas enquanto condutas que são objeti- dores? É o que pretendemos visualizar a seguir.
vadas e impostas pelos meios de produção. Em outros termos, o pró-
prio sujeito tem a se adaptar à função que lhe é designada pelo dono 0(72'2/2*,$
GRVPHLRVGHSURGXomR1HXWUDOLGDGHFLHQWL¿FDVHULDXPDHVSpFLHGH
roupagem da Educação Física competitivista pautada no tecnicismo A pesquisa de cunho qualitativo aqui apresentada foi realizada
que resultaria na imparcialidade de especialistas e docentes. Com em dois momentos: o primeiro foi com professores de Educação
LVVRHODDFHQWXDULDDLPSRUWkQFLDGDVFRPSHWLo}HVGHVSRUWLYDVFRPR )tVLFD DWXDQWHV QD UHGH S~EOLFD H SDUWLFXODU GH HQVLQR GD FLGDGH GH
¿QDOLGDGHSULQFLSDOXPDYH]TXHDFRQTXLVWDGHPHGDOKDVROtPSLFDV /RQGULQD)RUDPHQWUHYLVWDGRVQRWRWDOSURIHVVRUHVTXHHPJH-
representaria para o mundo um indicativo acerca da condição de UDODSUHVHQWDYDPHQWUHDDQRVGHLGDGHFRQFOXtUDPRFXUVR

Didatismo e Conhecimento 4
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
GHJUDGXDomRHQWUHRVDQRVGHDGHOHV¿]HUDPSyV- ‡³'HVHQYROYLPHQWRJOREDOGDFULDQoDLQWHJUDomRUHFUHDomR´
JUDGXDomRHPQtYHOGHHVSHFLDOL]DomRDWXDPQDHGXFDomRLQ- ‡³5HFUHDomRSDUDTXHRDOXQR SULQFLSDOPHQWHQRWXUQR UHOD[H
IDQWLOGHPHVHVDDQRVGRVHQWUHYLVWDGRVDWXDPQRHQVLQR do dia-a- dia, sociabilização dos alunos uns com os outros e promo-
IXQGDPHQWDOGHDQRHFLQFRPHVHVDDQRVHSURIHVVRUHV ção da ação motora”.
GRWRWDOGRVHQWUHYLVWDGRVDWXDPQRHQVLQRPpGLRGHDQRD ‡³5HVSHLWDUUHJUDVRUJDQL]DUVRFLDELOL]DUVH´
anos. Apenas um dos entrevistados fez outro curso de graduação. ‡³6RFLDOL]DomROXGLFLGDGHIRUPDomRPRWUL]´
2VHJXQGRPRPHQWRIRLHQWUHYLVWDUHVWXGDQWHVLQLFLDQWHVGR
curso de Educação Física – licenciatura – cujo currículo segue as PROFESSORES ATUANTES: OS OBJETIVOS DA EDUCA-
RULHQWDo}HV GD UHVROXomR &1(  H ? (VVHV DOXQRV KDYLDP ÇÃO FÍSICA NA ESCOLA
LQJUHVVDGRQRVDQRVGHHHDSUHVHQWDYDPHQWUH
DDQRVGHLGDGH7DPEpPIRUDPHQWUHYLVWDGRVHVWXGDQWHV Quanto aos objetivos da Educação Física na escola, os profes-
que estavam concluindo o curso de acordo com as orientações da VRUHVSDUHFHPHPDOJXQVPRPHQWRVWHUFRQIXQGLGR¿QDOLGDGHFRP
UHVROXomR&)(?QRVDQRVGHHDSUHVHQWDQGRHP função. Entre os objetivos da Educação Física apresentados, pelos
PpGLD GH  D  DQRV GH LGDGH )RL DSOLFDGR XP TXHVWLRQiULR professores entrevistados, os mais freqüentes estavam relaciona-
FRQWHQGR  TXHVW}HV DFHUFD GH DVVXQWRV UHIHUHQWHV D HGXFDomR dos a aspectos motores (desenvolvimento de habilidades motoras,
Educação Física, saberes necessários para a docência, área em DSUHQGL]DJHPPRWRUD VRFLDOL]DomRDLQLFLDomRHVSRUWLYDVD~GH$
HVSHFL¿FRGDGRVSHVVRDLVH[SHULrQFLDVDQWHULRUHVJUDXGHHVFR- relação da área com aspectos sociais e culturais foram pouco men-
larização, para este estudo nos atemos a alguns dados pessoais. FLRQDGDV9HMDPRVHQWmRDOJXQVH[HPSORV‡³$SUHQGL]DJHPPRWR-
Ativemo-nos, porém, a duas questões que pudessem contribuir ra, desenvolvimento de crianças e adolescentes”.
para dar conta de alcançar os objetivos desta pesquisa. As pergun- ‡³0HOKRUDUDVFDSDFLGDGHVItVLFDV IRUoDUHVLVWrQFLD7F PH-
tas selecionadas para análise dos dados foram: A) apresente três lhora das estruturas perceptivas motoras”.
¿QDOLGDGHVSDUDDGRFrQFLDSDUDD(GXFDomR)tVLFDQDHVFROD%  ‡³3URSLFLDURGHVHQYROYLPHQWRGDVTXDOLGDGHVItVLFDVIRUQHFHU
apresente objetivos que considera como gerais para a Educação a socialização, através de atividade físico-recreativas, melhorar a ap-
Física na escola. tidão física por meio da prática de habilidades motora etc”.
‡³'HVHQYROYHUKDELOLGDGHVPRWRUDV´
ANÁLISE DOS DADOS
1R TXHVLWR VD~GH SRGHPRV SHUFHEHU ‡ ³&RQVFLHQWL]DU R HGX-
cando da necessidade da pratica da atividade física para sua ma-
3URIHVVRUHVDWXDQWHVDV¿QDOLGDGHVGD(GXFDomR)tVLFDQDHV-
QXWHQomRGDVD~GH3UHSDUDURHGXFDQGRSDUDRHQIUHQWDPHQWRGR
FROD 4XDQWR jV ¿QDOLGDGHV HQXPHUDGDV SHORV SURIHVVRUHV SDUD D
cotidiano”.
Educação Física na escola, podemos perceber a ênfase destinada à
‡³$FRQVFLrQFLDSHODSUiWLFDGHH[HUFtFLRVYLVDQGRjREWHQomR
SURPRomRGDVD~GHDSUHQGL]DJHPHVSRUWLYDHUHFUHDomRHQWUHRX-
HPDQXWHQomRGDVD~GH´
WUDV¿QDOLGDGHV3DUDVHWHUXPDLGpLDD¿QDOLGDGHVD~GHIRLHOHQFD-
‡³'HVSHUWDURJRVWRSHODSUiWLFDVDXGiYHOGDDWLYLGDGHItVLFDH
GDSRUSURIHVVRUHV$TXLDOJXQVH[HPSORV‡³7UDEDOKDUFRPR
motor e o psicomotor do educando; incutir valores que conduzam VXDFRQWULEXLomRQDSURPRomRGDVD~GHHGREHPHVWDUItVLFRJHUDO´
DRHGXFDQGRKiELWRVVDXGiYHLV H[HUFtFLRVItVLFRV[VD~GH FRQGX- 5HIHUHQWHDVRFLDOL]DomR‡³3URPRYHUDVRFLDELOL]DomRHDFRR-
zir o educando ao conhecimento do próprio corpo”. peratividade”.
‡³(QWHQGHUD(GXFDomRItVLFDFRPRIRUPDGRUDGRHGXFDQGR ‡³6RFLDOL]DomRGDVFULDQoDVOHYDURDOXQRDDXWRGHVFREHUWDH
GHVHQYROYHUDVRFLDELOLGDGHPHOKRUDUDVD~GHItVLFDHPHQWDOGR superação de seus limites
aluno”. ‡3URPRYHUDVRFLDELOL]DomRHDFRRSHUDWLYLGDGH´
‡³6RFLDOL]DomRGLVFLSOLQDHUHVSHLWRDRSUy[LPRPHOKRUDDV ‡ ³)D]HU FRP TXH R DOXQR HQWHQGD R TXH p (GXFDomR )tVLFD
FRQGLo}HVGHVD~GHItVLFDHPHQWDO´ fazer com que o aluno respeite mais o educador físico e promover a
A aprendizagem de aspectos relacionados ao esporte e a des- sociabilização do aluno perante os outros alunos”.
coberta de talentos também parece estar presente na mente dos Quanto aos esportes (iniciação esportiva, aprendizagem de mo-
SURIHVVRUHVDWXDQWHVVHQGRFRJLWDGRVSRUHQWUHYLVWDGRVFRPR dalidades)
VHQGRXPDGDV¿QDOLGDGHVGD(GXFDomR)tVLFDQDHVFROD$OJXQV ‡³,QLFLDomRDRHVSRUWHHGXFDUSDUDRIXWXURSURPRYHULQWHJUD-
H[HPSORVLOXVWUDPLVVR‡³3URYHURVVHXVEHQH¿FLiULRVFRPRGH- ção aos jovens”.
senvolvimento das habilidades motoras, atitudes e conhecimentos, ‡ ³$SUHVHQWDU GLIHUHQWHV SUiWLFDV HVSRUWLYDV´ ‡ ³,QFHQWLYDU D
levando os a uma participação ativa e voluntária em atividades fí- prática do esporte e da atividade física”.
sicas e esportivas ao longo de suas vidas. Detectar jovens talentos ‡³'HVHQYROYHURHVStULWRHVSRUWLYR´2XWURVSURIHVVRUHVHP-
através das aulas e encaminha-los para escolinha de treinamento”. bora correspondam a
‡ ³,QLFLDomR HVSRUWLYD´ ‡ ³5HVJDWDU QR DOXQR LQWHUHVVH SHOD uma pequena parcela do total, demonstram ainda outras preocu-
prática esportiva, recreativa e social”. pações além das já cogitadas. Por isso, eles transcendem e ampliam
‡³3RVVLELOLGDGHGHLGHQWL¿FDomRGHWDOHQWRVSDURHVSRUWHFR- XPSRXFRRkQJXORGHYLVmRTXDQWRDRVREMHWLYRVGD(GXFDomR)t-
nhecimento das diferenças”. VLFDQDHVFRODUHVVDOWDQGRTXHVW}HVVRFLRFXOWXUDLV‡³'HVHQYROYHU
‡ ³,QFHQWLYDU RV DOXQRV i SUiWLFD GH HVSRUWHV ID]HU FRP TXH a criança tanto na parte motora, quanto afetivo-social e cognitiva;
os alunos levem uma vida mais saudável; mostrar aos alunos as Entender e utilizar do exercício físico como fator de promoção da
diferentes modalidades esportivas”. VD~GH(QWHQGHURHVSRUWHFRPRIHQ{PHQRFXOWXUDOSUHVHQWHHPQRV-
$UHFUHDomRHVRFLDOL]DomRWDPEpPVmR¿QDOLGDGHVFRJLWDGDV sa sociedade; Desenvolver o espírito cooperativo nas crianças; De-
pelos professores quanto à Educação Física na escola. Exemplos: senvolver a consciência corporal dos educandos.”

Didatismo e Conhecimento 5
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
‡ ³3DUWLFLSDU GDV DWLYLGDGHV FRUSRUDLV UHFRQKHFHQGR H UHVSHL- hábitos saudáveis, mas para outros seu papel na escola é ensinar
tando características físicas e de desempenho de si próprio e dos HVSRUWHVHSDUDLVVRHODGHYHWUHLQDUKDELOLGDGHVHVSHFL¿FDVGHFDGD
outros sem discriminar, conhecendo, valorizando, respeitando, e modalidade. Alguns até apresentaram objetivos diferenciados, con-
desfrutando da pluralidade de manifestações da cultura corporal, VLGHUDQGRWRGRVRVFRQWH~GRVFRPRFXOWXUDLVHDFHQWXDQGRDUHÀH-
UHODFLRQDQGRDFRPRVHIHLWRVVREUHSUySULDVD~GHHGDPHOKRULDGD [mR H D FUtWLFD FRPR DVSHFWRV LPSRUWDQWHV D VHUHP HQIDWL]DGRV ‡
VD~GHFROHWLYD´ “Capacitar os indivíduos a entenderem os conceitos da corporeidade
‡³3RVVLELOLWDUDRDOXQRXPDDPSOLDomRVREUHDFXOWXUDFRUSRUDO humana”.
de movimentos desenvolvendo uma prática pessoal e capacidade ‡³(QYROYHUHVWHVLQGLYtGXRVHPTXHVW}HVTXHDEUDQJHPRIRO-
para interferir na sociedade através de atividades esportivas”. clore regional, estadual e nacional”.
6H ¿]HUPRV XPD LQIHUrQFLD D SDUWLU GHVVHV GDGRV SRGHUHPRV ‡ ³&RQVFLHQWL]DU HVWHV LQGLYtGXRV VREUH DV GLIHUHQoDV pWQLFDV
perceber que a preocupação apresentada pelos professores sobre tratando as como importantes para a formação na nossa sociedade”.
Educação Física no contexto escolar pouco se diferencia do que ‡³3URSRUFLRQDURHQVLQRGHYDULDGDVSUiWLFDVFRUSRUDLV MRJR
KLVWRULFDPHQWHVHHVWDEHOHFHXFRPR¿QDOLGDGHVHREMHWLYRV$V¿QD- dança, esporte)”.
OLGDGHVPDLVFRJLWDGDVIRUDPUHODFLRQDGDVDVD~GHLQLFLDomRHVSRU- ‡³'DUVXEVtGLRVFUtWLFRVSDUDDSUiWLFD´‡³&RQWULEXLUSDUDD
tiva ou aprendizagem de modalidades esportivas, recreação/sociali- FRQVFLrQFLDGDLQÀXHQFLDGDVSUiWLFDVFRUSRUDLVSDUDDVD~GHHGH-
zação. Quanto aos objetivos, os mais freqüentes são o desenvolvi- senvolvimento mental”.
PHQWRGHDVSHFWRVPRWRUHVVRFLDOL]DomRHVSRUWHVHVD~GH&RQFHS- Os alunos ingressantes no curso de Licenciatura
o}HVPXLWRDQWLJDVVREUHDiUHDFRQWLQXDPLQÀXHQFLDQGRIRUWHPHQWH GD8(/SHODUHVROXomR&1(HHVWmRSDVVDQGRSRUPR-
R LPDJLQiULR GRV SURIHVVRUHV DWXDOPHQWH VD~GHKiELWRV VDXGiYHLV GL¿FDo}HVQRVLVWHPDIRUPDWLYR1RHQWDQWRpLQWHUHVVDQWHSHUFHEHU
(tendência higienista, escola e tradicional), recreação/socialização como se dá o ciclo entre escola, universidade e docência.
WHQGrQFLD SHGDJRJLFLVWD  PRGHOR GH HVFROD HVFRODQRYLVWD  H $OXQRVLQLFLDQWHV¿QDOLGDGHVGD(GXFDomR)tVLFDQDHVFROD
treinamento de habilidades esportivas/iniciação esportiva/aprendi- ‡³(QVLQDPHQWRGHPRGDOLGDGHVGHHVSRUWHVXPDERDVD~GHH
zagem de modalidades (tendência competitivista, escola tecnicista). atividades em grupo”.
$OXQRV FRQFOXLQWHV DV ¿QDOLGDGHV GD (GXFDomR )tVLFD QD HV- ‡³(QVLQDUSDUDRVDOXQRVSDUDTXHVHUYH(G)tVLFD$OpPGH
cola. proporcionar horas de lazer, ensinar vários esportes diferentes que
Os alunos que estão concluindo o curso, baseado na resolução SRVVDWUD]HUEHQH¿FLRQRIXWXUR´
TXHpXPFXUUtFXORYROWDGRSDUDDiUHDGDVD~GHHEXVFDQ- ‡´,QWHUDomRHQWUHDOXQRVGHGLIHUHQWHVVpULHVHDSUiWLFDGRH[HU-
do colocação no mercado de trabalho, formados pela Universidade cício faz bem para a
(VWDGXDO GH /RQGULQD QRV DQRV GH  H  (OHV DSRQWDP DV VD~GH DOpP GR FRQKHFLPHQWR GH GLYHUVRV HVSRUWHV H WpFQLFDV
VHJXLQWHV ¿QDOLGDGHV GD (GXFDomR )tVLFD QD HVFROD‡ ³$X[LOLR QD esportivas”.
SURPRomRGDVD~GHLQWURGXomRDRVHVSRUWHVHGLPLQXLomRGRQtYHO ‡ ³4XDOLGDGH GH YLGD D DSUHVHQWDomR GR HVSRUWH H D SRVVtYHO
de estresse”. revelação de talentos na prática de esportes de competição”.
‡ ³$SUHQGL]DJHP PRWRUD´ ‡ ³/XGLFLGDGH SUiWLFD HVSRUWLYD H ‡³(QVLQDUXPDSUiWLFDHVSRUWLYDHQVLQDUDMRJDU´
integração”. ‡³$(GXFDomR)tVLFDSRGHIRUPDUDWOHWDVSUR¿VVLRQDLV´
‡³'HVHQYROYHUKDELOLGDGHVHFDSDFLGDGHVPRWRUDVGRHGXFDQ- ‡³5HWLUDURVDOXQRVGRVHGHQWDULVPRPRVWUDUDRVDOXQRVDLP-
do, o aspecto cognitivo e afetivo social”. SRUWkQFLDGDSUiWLFDGRHVSRUWHQDYLGDGHOHVHHQVLQiORVDSUDWLFDU
‡³3URPRomRGDVD~GHSUiWLFDUHJXODUGHH[HUFtFLRVItVLFRV´ esporte.
‡³6D~GHGHVHQYROYLPHQWRPRWRU´‡³&RQVFLHQWL]DomRFRUSR- ‡³(QVLQDUHVSRUWHVFRQVFLHQWL]DURVDOXQRVVREUHDSUiWLFDGR
ral, socialização, iniciação à prática esportiva”. esporte, tornando os grandes cidadãos”.
Alunos concluintes: objetivos da Educação Física na escola. ‡³,QFHQWLYRDRHVSRUWHGHVFREHUWDGHWDOHQWRV(GXFDomRHR
Como objetivos para a área na escola, eles assim consideram movimento geral”.
alguns exemplos ilustram a idéia geral: Alunos iniciantes: objetivos da Educação Física na escola
‡ ³&RQKHFLPHQWR GRV HVSRUWHV KLJLHQH FRUSRUDO KiELWRV VDX- (QWUHRVREMHWLYRVIRUDPFLWDGRV‡³,QFHQWLYDURDOXQRDID]HU
dáveis”. esportes. Ensinar o aluno em relação ao esporte. Mostrar ao aluno
‡³(GXFDomRFRUSRUDOGHVHQYROYLPHQWRGDFRRUGHQDomR´ que Ed. Física não é apenas jogo”.
‡³)LVLROyJLFRPRWRU´‡³3URPRomRVD~GHVRFLDOL]DomRHHV- ‡ ³)D]HU FRP TXH R DOXQR JRVWH GH SUDWLFDU HVSRUWH WRUQDU R
SRUWH´‡³9LYHQFLDPRWRUDLQWHUDomRHFRRSHUDomR´‡³'HVHQYROYL- aluno um cidadão de bem no futuro, relacionamentos de alunos com
mento motor, psico-social, Afetividade”. diferentes classes sociais, raças, etc”.
‡³(GXFDomRFRUSRUDOGHVHQYROYLPHQWRGDFRRUGHQDomR´ ‡³,QFHQWLYDUDSUiWLFDGHDWLYLGDGHVItVLFDVGHVHQYROYHUDFD-
‡³'HVHQYROYHUDVKDELOLGDGHVPRWRUDVFRPRYHORFLGDGHÀH[L- pacidade motora dos alunos, garantir a coletividade nas atividades”.
bilidade, entre tantas outras”. ‡³3DUDDVFULDQoDVFULDUHPKiELWRVGHID]HUHVSRUWHVSDUDTXH
‡³$X[LOLDURGHVHQYROYLPHQWRGDFULDQoD,QVHULUDFULDQoDQR QmR¿TXHPVHGHQWiULDV(QVLQDUDVFULDQoDVTXHDHGXFDomRItVLFDp
meio social, Despertar a criança p/ os esportes”. mais do que só praticar esportes. E para a criança também trabalhar
A maior parte dos entrevistados acredita que a Educação Física sua imaginação com jogos e brincadeiras”.
QDHVFRODWHPHQWUHRXWUDV¿QDOLGDGHVHREMHWLYRVDDSUHQGL]DJHP ‡³2EMHWLYRGRHQVLQRWHyULFRVREUHDKLVWyULDGD(G)tVLFDPR-
HSUiWLFDHVSRUWLYDDSURPRomRGDVD~GHHGHVHQYROYLPHQWRGHDV- GDOLGDGHVHVSRUWLYDVHGDURSo}HVDRDOXQRSDUDXPIXWXURSUR¿V-
SHFWRVPRWRUHVFRPRIUHTHQWHV GHDOXQRVHQWUHYLVWDGRVVH sional”.
enquadram nestes três fatores). Segundo alguns a Educação Física ‡³,QFHQWLYRDRHVSRUWHGHVFREHUWDGHWDOHQWRVH(GXFDomRHR
HVWiQDHVFRODSDUDFXLGDUGDVD~GHHWHPSRUREMHWLYRGLVVHPLQDU movimento”.

Didatismo e Conhecimento 6
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
‡³7UDQVPLWLURVIXQGDPHQWRVGHHVSRUWHGHVHQYROYHUDWLYLGD- PRYLPHQWDUVHTXHJDUDQWHPVXDHVSHFL¿FLGDGH2PRYLPHQWDUVH
des recreativas em humano é provido de intencionalidade, ou seja, nenhum movimento
geral, trabalhar com o equilíbrio e coordenação motora”. é realizado sem motivação, sentido ou intenção seja ele integrante
‡³'HVHQYROYHUDLJXDOGDGHHQWUHRVDOXQRVHGXFDUSDUDDYLGD do esporte, da dança ou de qualquer outra manifestação corporal, e
através do esporte, desenvolver a paixão pelo esporte”. VRIUHLQÀXrQFLDVFXOWXUDLVFRPRSRGHPRVSHUFHEHUGHDFRUGRFRP
‡³&RQVFLHQWL]DURVDOXQRVGHFRPRpLPSRUWDQWHSDUDDVD~GH um clássico no assunto que é a noção de técnica do corpo. Ele con-
a prática de esportes, induzi-los a fazerem parte de algum grupo de siderava técnicas corporais como: “(...) as maneiras pelas quais os
treinamento ou até mesmo individual e ensinar como é bom cuidar homens, de sociedade a sociedade, de uma forma tradicional, sa-
GDVD~GHGHVGHFHGR´ bem servir-se de seu corpo”. Tomemos como exemplo os esportes,
Em geral, os professores e os alunos concluintes entrevistados nos diz que: “Duas seleções de voleibol ou futebol, jogando com as
FLWDUDPSRUGLYHUVDVYH]HVDSURPRomRGDVD~GHDLQLFLDomRHDSUHQ- mesmas regras e técnicas e com sistemas táticos similares, possuem
GL]DJHPGHHVSRUWHVHDUHFUHDomRFRPR¿QDOLGDGHVHREMHWLYRVGD estilos diferentes, um jeito característico de praticar o voleibol ou o
Educação Física na escola, além de outros fatores menos citados. IXWHEROTXHUHÀHWHWUDGLo}HVFXOWXUDLVGLVWLQWDV´3HUFHEHVHFRPLVVR
Isso revela uma coincidência de pensamento em relação às tendên- a necessidade de uma mudança de foco que implica um olhar antro-
cias apresentadas anteriormente que concomitantemente ao modelo pológico por parte do professor atuante, que considere as diferenças
de escola eram meios de contribuir para a reprodução de um mesmo como algo normal como elemento desencadeador da mediação da
modelo social. Os alunos iniciantes também apresentam visão res- cultura do movimentar-se trazida pelo aluno de seu cotidiano (espor-
trita a esses aspectos e recai sobre a formação básica a responsabili- tes, danças lutas, ginástica, jogos, etc.) em sentido ao conhecimento
GDGHGHID]HUFRPTXHRVPHVPRVUHFRQKHoDPTXDLVDV¿QDOLGDGHVH dito erudito, elaborado e sistematizado de forma dialética. Nesse
REMHWLYRVHPYRJDHUHÀLWDPVREUHVXDVLPSOLFDo}HV9DOHSHUJXQWDU VHQWLGR D FRQWH[WXDOL]DomR GRV FRQWH~GRV p GH VXPD LPSRUWkQFLD
então: será que a Educação. FRPRPHLRGHUHVLJQL¿FDomRGRTXHpDSUHQGLGRQD(GXFDomR)t-
Física na posição de componente curricular educacional tem sica no sentido de promover uma transcendência direcionada para
sido compreendida, com base nesses dados, como parte de um pro- o convívio e participação social mais consciente, e isso se dará na
FHVVRHGXFDWLYR"6HUiTXHDLPSRUWkQFLDDWULEXtGDjVD~GHDDSUHQ- medida em que se entenda o processo ensino/aprendizagem como
dizagem esportiva ou a recreação se dá pela crença de que estes LQWHUDWLYR H DWLYR DR LQYpV GH SDVVLYR H UHFHSWLYR (VVHV ~OWLPRV
podem ser considerados educativos “em si mesmos”, ainda mais em aspectos estão fortemente ausentes pelo menos em dois modelos
uma sociedade complexa como a nossa? Em que medida se torna de escola já vistos (tradicional e tecnicista), uma vez que nelas os
educativa? Podemos começar a responder tais questões dizendo que FRQWH~GRVVmRLPSRVLo}HVTXHVHWRUQDPVHPVHQWLGRHDOLHQDQWHV
em se tratando dos três modelos de escola e também das tendências para muitos alunos em função da incoerência entre necessidades
históricas da Educação Física na escola, abordadas anteriormente (motivações) do educando e objetivos pré-estipulados pelo profes-
alguns fatores não são levados em consideração uma vez que não VRU$DSUHQGL]DJHPGRVHVSRUWHVDSURPRomRGDVD~GHDUHFUHDomR
contribuem para o tipo de formação ideal ao mundo capitalista, ou VmR¿QVHPVLPHVPRV$VVLPWDPEpPQDVWHQGrQFLDVKLJLHQLVWDH
melhor, vinculada à doutrina liberal. São eles: contextualização dos competitivista, isso acontece quando o professor impõe um padrão
FRQWH~GRVSURPRomRjUHÀH[mRDFHUFDGRVPHVPRVHQVLQRYHUGD- GHPRYLPHQWRVPHFkQLFRVDVHUHPVHJXLGRVVHPTXHVWLRQDPHQWRV
deiramente democrático que prepare para o exercício da cidadania SDUDSURPRYHUDVD~GHRXDH¿FLrQFLDWpFQLFDRXPHOKRUWHQWDHQ-
e o desenvolvimento do pensamento crítico. É o que passaremos a TXDGUDUXPDGLYHUVLGDGHFXOWXUDOHPXPPRGHOR~QLFRGHID]HUH
DERUGDUHPVHJXLGD$WpRVDQRVD(GXFDomR)tVLFDHUDFDUDFWH- SHQVDUQRPRYLPHQWR(¿FLrQFLDWpFQLFDQRVHVSRUWHVHVD~GHSRGH
rizada como área predominantemente biológica, ou seja, os estudos ser na realidade temas que a serem discutidos pelos alunos, mas
DWpHQWmRGHVWLQDYDVHjPDQXWHQomRGDVD~GHRXDSHUIHLoRDPHQWR não a promoção de um ou de outro por si só. Para fazer a devida
técnico- desportivo. Assim: [...] a crise que começa a se instaurar na contextualização, o posicionamento do professor deverá ser tal que
(GXFDomR%UDVLOHLUDIUXWRGHUHÀH[}HVGRGHEDWHGDVGLVFRUGkQ- coloque o aluno em situações que o perturbe e que o faça relacionar
cias, das frustrações, da confrontação ideológica, dos erros e acertos GHIRUPDUHÀH[LYDRTXHpHQVLQDGRFRPVXDFRQGLomRQRPRPHQWR
de suas teorias e práticas, pouco tem perturbado a Educação Física, tornando-se consciente do processo de elaboração do saber. Por isso,
como se ela não fosse em ultima analise um processo educativo. pLPSRUWDQWHOHPEUDUTXHUHÀH[mRpXPD$omRGHLQWURVSHFomRSHOD
1R HQWDQWR D SDUWLU GRV DQRV  H FRP RV GHEDWHV DFDGrPL- qual o pensamento volta-se sobre si mesmo, investiga a si mesmo,
cos sobre Educação Física tivemos o inicio das discussões de cunho examinando a natureza de sua própria atividade e estabelecendo os
SVLFROyJLFRVRFLRFXOWXUDOH¿ORVy¿FRTXHYLULDPDFRQVLGHUDURVHU princípios que a fundamentam. Caracteriza assim a consciência crí-
KXPDQRRDOXQRHPVXDVP~OWLSODVGLPHQV}HVYLVOXPEUDQGRQRYDV tica, isto é, a consciência na medida em que examina sua própria
possibilidades referentes a participação no processo educativo, o que constituição, seus próprios pressupostos.
parece ter passado despercebido por muitos professores que estão Esse fator é muito importante à medida que a Educação e a
atuando em instituições de ensino. O reconhecimento atual da Edu- (GXFDomR)tVLFDHQWHQGHUHPTXHRHVSDoRSDUDDUHÀH[mRFRPSUR-
cação Física e seu papel parece estar vinculado à idéia de corpo são priedade é reservado aos sujeitos providos de autonomia, pois ape-
mente sã ou a necessidade de o professor atuante nessa área ensinar nas eles podem compreendê-lo em sua totalidade. A tendência peda-
esportes e melhorar aspectos motores. Vimos a exemplo disso, que gogicista parece ter vislumbrado tal possibilidade, embora a crença
os próprios professores e alunos entrevistados reconhecem a área na possibilidade de o aluno aprender consigo mesmo pouco tenha
de tal forma principalmente em relação a aprendizagem esportiva. contribuído para a compreensão de suas reais condições sociais. Ao
Enquanto componente educacional, a Educação Física, como outras contrário disso, um ensino interativo e problematizador pode, por
iUHDVWHPSRU¿QDOLGDGHSULQFLSDODHGXFDomRYLDWUDQVPLVVmRGHFR- H[HPSOR OHYDU R DOXQR D VLWXDo}HV GH UHÀH[mR DFHUFD GR SUySULR
QKHFLPHQWRVTXHVmRFXOWXUDLVPDLVHVSHFL¿FDPHQWHGDFXOWXUDGR FRUSRHPPRYLPHQWRQDLQIkQFLDHDLQGDDVFRQGLo}HVVRFLDLVHLP-

Didatismo e Conhecimento 7
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
posições culturais que, na adolescência e juventude, incidem sobre O que desejamos com a Educação Física, nos nossos dias, é
corpo, eVSRUWHVVD~GH&RQVLGHUDPRVTXHFRQWH[WXDOL]DUPRWLYDQGR contribuir para uma mudança de paradigma social em direção a
RSHQVDUUHÀH[LYRQD(GXFDomR)tVLFDVLJQL¿FDUHFRQKHFHUDDXWR- uma sociedade mais democrática, constituída de sujeitos que par-
nomia daquele que aprende em um ato de esclarecimento gradual, ticipem conjuntamente e posicionem-se criticamente enquanto su-
conquistado por meio de níveis superiores de conhecimento. Assim, jeitos políticos. Estes, partindo da compreensão de sua realidade
ensino democrático é aquele que, considerando as individualidades devem ter possibilidades de atuar nela de forma autônoma e cons-
culturais e a autonomia de pensamento, prepara devidamente para o trutiva e criativa na busca de inovações. Cabe enfatizar ainda a
exercício da democracia por meio do conhecimento dos direitos e cooperação ao invés da individualidade, a busca da real igualdade
GHYHUHVGRFLGDGmRGRH[HUFtFLRGDGHPRFUDFLD(PVtQWHVHD¿UPD de condições e a liberdade de expressão e reivindicação de direi-
que a democracia se baseia em três direitos: tos. Tudo isso tem sido amplamente discutido na educação escolar
‡'LUHLWRVFLYLVFRPRVHJXUDQoDHORFRPRomR HDOLWHUDWXUDpH[WHQVDHSRULVVRDV¿QDOLGDGHVGD(GXFDomR)tVLFD
‡'LUHLWRVVRFLDLVFRPRWUDEDOKRVDOiULRMXVWRVD~GHHGXFDomR GHYHPVHUDVPHVPDVTXHMXVWL¿FDPDSUHVHQoDGD0DWHPiWLFDGD
habitação, etc. *HRJUD¿DGD+LVWRULDVmRWRGDVHGXFDWLYDVHPDQWrPVXDVHVSHFL-
‡'LUHLWRVSROtWLFRVFRPROLEHUGDGHGHH[SUHVVmRGHYRWRGH ¿FLGDGHVHFRQVFLHQWHVGDIXQomRVRFLDOTXHGHYHPGHVHPSHQKDU
participação em partidos políticos e sindicatos, etc. Por isso, o ensino deve ser na Educação Física interativo e pro-
$LJXDOGDGHGRGLUHLWRDHGXFDomRQmRVLJQL¿FDDLJXDOGDGHGH blematizador na produção do conhecimento, incentivando já nas
condições que são socioeconômicas e multiculturais. Quando o co- SULPHLUDV VpULHV D IRUPDomR GH XP SHQVDPHQWR FUtWLFR UHÀH[LYR
nhecimento é tornado igual a todos, ou seja, padronizado, tem senti- por meio do questionamento (alunos para professores e professo-
do para poucos e exclui uma grande maioria é impossível considerar res para alunos). Esse pensamento deveria incidir sobre o movi-
a educação como chave para uma participação política consciente mentar-se, aos poucos abrangendo todas as suas dimensões que o
por parte de todos. Preparar para a cidadania é um processo que envolvem respeitando a individualidade quanto a aprendizagem de
deve ter por pressuposto principal a autonomia na construção do cada um, acrescentando graus diferentes de complexidade.
conhecimento necessariamente contextualizado. (Cabe acrescentar
jUHÀH[mRUHWRUQDUDVLVXDVLWXDomRHPUHODomRDRTXHID]HDRTXH CONSIDERAÇÕES FINAIS
é proposto) o pensamento (posicionamento) crítico acerca do que é
ensinado (ou imposto). Esse aspecto é essencial na “sociedade do
Vimos, anteriormente, que muitos dos professores entrevista-
conhecimento” na qual aceitamos muitas vezes como corretos cer-
dos ainda estão presos a concepções de ensino que são clássicas na
tos fatos ou informações sem a devida analise dos dados por serem
Educação Física, mas que não correspondem, não dão conta das as-
GHDXWRULGDGHV1HVVHVHQWLGRFRQWULEXtUDPVHTXDQGRD¿UPDTXH
pirações e da complexidade de nosso contexto. Essas concepções
o pensamento crítico é evidente quando o individuo “(...) possui a
são fechadas em um modelo padrão que não oferece espaço para
capacidade de analisar e discutir problemas inteligente e racional-
inovações, para a criatividade e atribui papel fundamental somente
mente, sem aceitar de forma automática, suas próprias opiniões ou
DSUiWLFDGRHVSRUWHHjPDQXWHQomRGDVD~GHHQ¿PjGLPHQVmR
opiniões alheias, é um individuo dotado de senso crítico”. Como vi-
mos nos exemplos da escola tradicional e tecnicista, uma das carac- apenas biológica. As perspectivas apresentadas pelos alunos con-
terísticas é a imposição, o autoritarismo representado pelo professor cluintes sobre a área da Educação Física pouco se distanciaram
TXHSXQHHFREUDH¿FLrQFLDPDVTXHDRPHVPRWHPSRLQLEHRSRVL- GDV FRQFHSo}HV GRV SURIHVVRUHV DWXDQWHV TXDQWR jV ¿QDOLGDGHV H
cionamento ativo e crítico, tornando os alunos apáticos e considera- objetivos da área e tendem a perpetuar, no geral, a clássica ênfa-
velmente dependentes dos tutores, do que “vem de cima”. A demo- VHQRELROyJLFRHQTXDQWRP~VFXORVTXHVHPRYLPHQWDPVHJXQGR
cracia neste contexto não passa de um anseio de participação mutua uma ordem. Trata-se de pré-conceitos que foram construídos por
QDVGHFLV}HVGDVRFLHGDGHH¿FDUHVWULWDDDOJXQVUHSUHVHQWDQWHVSUR- eles enquanto freqüentaram aulas de Educação Física na escola e
vidos da fundamentação necessária. Isso se evidencia nas aulas de que, pela falta de ações efetivas no processo formativo em termos
Educação Física quando o professor ensina o movimento como pa- de mudanças nessas concepções, poderão contribuir para a manu-
drão correto do esporte ou outras atividades que inibem tudo o que tenção do nosso modelo social. A formação, neste sentido, pouco
IRLPHQFLRQDGRDWpDTXL,PS}HXPDFXOWXUD~QLFDXPDYHUGDGHD contribuiu para que os alunos compreendessem a Educação Física
ser assimilada e que inviabiliza a manifestação da autonomia, inibe FRPRiUHDTXHWHPIXQomRVRFLDODRWUDWDUGHFRQWH~GRVFXOWXUDLV
DUHÀH[mRQHJOLJHQFLDDRSHQVDPHQWRFUtWLFRQmRUHODFLRQDFRQWH~- (da cultura do movimentar-se) nos quais os alunos devem ser in-
dos com a(s) realidade(s) concreta(s) dos alunos. Forma durante um VHULGRV UHVLJQL¿FDQGRRV DWUDYpV GD FRQWH[WXDOL]DomR GH IRUPD
longo período de escolarização sujeitos apto a esperarem as ordens FUtWLFD H UHÀH[LYD GHQWUR GR DPELHQWH HVFRODU (P IXQomR GLVVR
vindas de “autoridades” de modo passivo e apático, distanciando percebe-se que a formação básica tem papel importante para fazer
a escola de sua função social. A crítica aqui realizada até agora foi com que o futuro docente entenda sua área de atuação. Espera- se
direcionada ao ensino exclusivamente diretivo pautado no modelo que os novos currículos da Licenciatura, baseados nas resoluções
WUDGLFLRQDOWHFQLFLVWDGHHQVLQRUHVWULWRDSURPRomRGDVD~GHRXGR HFRORTXHPWDLVTXHVW}HVDVHUHPSHQVDGDVSHORVIXWX-
esporte em si. No entanto, vale ressaltar que a falta total de interven- ros professores. Que tipo de sociedade desejamos contribuir para
ção é vista, à luz da Educação Física atual, como inatismo pelo qual construção? Para isso, que tipo de cidadão formar? Quais con-
se considera que o aluno vai exteriorizando seus talentos conforme WH~GRV"4XDLVPpWRGRV"3DUD¿QDOL]DUYDOHUHVVDOWDUTXHD/'%
seus graus de maturação. Isso é típico do professor que entrega a UHFRQKHFHTXHDHGXFDomRWHPSRU¿QDOLGDGH$HGXFD-
bola e assiste tudo acontecer. Essa é uma atitude característica do ção, dever da família e do Estado, inspirada nos princípios de li-
escolanovismo/ pedagogicismo que acredita na individualidade na EHUGDGHHQRVLGHDLVGHVROLGDULHGDGHKXPDQDWHPSRU¿QDOLGDGHR
construção do conhecimento, em que a intervenção é ameaçadora e pleno desenvolvimento do educando, seu preparo para o exercício
corrompe o homem que é visto como bom em sua natureza. GDFLGDGDQLDHVXDTXDOL¿FDomRSDUDRWUDEDOKR

Didatismo e Conhecimento 8
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
A Educação Física na escola só vai contribuir para a formação matização externa e, ao mesmo tempo, são desenvolvidas reações
plena do cidadão e para o mundo do trabalho quando cada docente FRQGLFLRQDGDVTXHDX[LOLDPDUHDOL]DomRGRPRYLPHQWR´*REEL9L-
DWXDQWHRXDOXQRHQJDMDGRHPXPFXUVRGHIRUPDomRSUR¿VVLRQDO ODUH=DJR  HQIRFDPRFRQGLFLRQDPHQWRItVLFR &) FRPRXP
revir os valores atribuídos à área atualmente e buscar transformar processo sistematizado que, por meio de estímulos motores, regidos
VHXVFRQFHLWRVSRUPHLRGHXPDIRUPDomRFRQWLQXDSDXWDGDQDUHÀH- SRUSULQFtSLRVFLHQWt¿FRVHUHDOL]DGRVSRUFHUWRSHUtRGRGHWHPSR
xão na/sobre a prática e com estudos constantes que o façam com- proporcionam ou mantêm adaptações morfológicas e funcionais
SUHHQGHUDUHDOLGDGHHRDOXQRHPVXDVP~OWLSODVIDFHV%XVFDVH que provocam o aumento ou a manutenção da capacidade funcional
assim, soluções criativas, a aprender a aprender de forma tal que a através do desempenho motor. De acordo com este conceito, o con-
reconheça sua atuação com um outro olhar rompendo assim com dicionamento físico é um processo estruturado que envolve diversas
VHXVSUySULRVSDUDGLJPDV(Q¿PHOHGHYHFRPSUHHQGHUD(GXFDomR HWDSDVFRPREMHWLYRVHVSHFt¿FRVHPFDGDXPDGHODVPDVLQWHUGH-
Física enquanto ação eminentemente educativa dentro das escolas pendentes, isto é, para se obter o sucesso em uma delas, é necessá-
e isso só irá concretizar-se se sua compreensão a respeito de sua rio estar bem nas demais etapas. Além disso, envolve estímulos e
própria atuação transcender a visão estreita ao predomínio biológi- UHVSRVWDVPRWRUDVFRPRPHLRIXQGDPHQWDOSDUDDVDo}HVD¿PGHVH
FR3RUPHLRGRVFRQWH~GRVTXHOKHVVmRHVSHFt¿FRVSRGHUiSURSRU DWLQJLUSOHQDPHQWHRVREMHWLYRVHVSHFt¿FRVHPFDGDHWDSD
não apenas uma inserção consciente do aluno em seu contexto, mas Outro conceito, que, em certo sentido, está relacionado com o
irá torná-lo apto a parti dele criticamente pelos ideais democráticos. DQWHULRUpRGD$&06TXHGL]R³FRQGLFLRQDPHQWRItVLFRUHOD-
FLRQDGRjVD~GHVHUHIHUHjFDSDFLGDGHRUJkQLFDGHUHVLVWLUjVWDUH-
IDVGLiULDVHRFDVLRQDLVDVVLPFRPRDGHVD¿RVItVLFRVLQHVSHUDGRV
CONDICIONAMENTO FÍSICO, LEGISLAÇÃO, com mínimo de cansaço e desconforto, possuindo reservas de ener-
METODOLOGIA, MÉTODOS GÍMNICOS, JLDVX¿FLHQWHVSDUDUHDOL]DUDTXLORTXHVHGHVHMD´ S &)
ORGANIZAÇÃO E PEDAGOGIA. p D LQWHUDomR GH GLYHUVDV YDOrQFLDV ItVLFDV TXH YLVDP DR PHOKRU
IXQFLRQDPHQWRGRP~VFXORHVTXHOpWLFRHGRPHWDEROLVPRLQGLYL-
GXDO (QWUH RV FRPSRQHQWHV GD DSWLGmR ItVLFD HVVHQFLDLV j VD~GH
estão: a função cardiorrespiratória, a composição corporal, as fun-
O CONDICIONAMENTO FÍSICO:
o}HV P~VFXOR HVTXHOpWLFDV H D UHJLmR ORPEDU GD FROXQD YHUWHEUDO
FRPRSDUWHGDVIXQo}HV¿VLROyJLFDVUHODFLRQDGDVjVD~GH3DUDHVWDU
O termo “condicionamento físico” é frequentemente utilizado
EHPFRQGLFLRQDGR¿VLFDPHQWHpQHFHVViULRWUHLQDUHDSULPRUDUD
QRFRWLGLDQRGDVSHVVRDVSULQFLSDOPHQWHHQWUHSUR¿VVLRQDLVGDVD~-
resistência aeróbica através de exercícios aeróbicos. Para melhorar o
de.
sistema cardiopulmonar, o organismo gradualmente é condicionado
0DVFRPRRVHVSHFLDOLVWDVGH¿QHPHVVHFRQFHLWR"
DDSURYHLWDUPHOKRURR[LJrQLRUHVLVWLQGRGHPDQHLUDH¿FLHQWHDRV
Teóricos de Fisiologia Humana apresentam conceitos relacio-
esforços físicos. O CF enfatiza o vigor e a energia para a realização
QDGRV j REWHQomR GR FRQGLFLRQDPHQWR ItVLFR RULHQWDQGR SUR¿V-
de trabalhos físicos e exercícios. Pode ser mensurado de maneira
sionais e interessados em relação aos quesitos indispensáveis para
alcançarem tal objetivo. O primeiro registro de que se tem notícia subjetiva pela determinação da quantidade de energia que uma pes-
D UHVSHLWR GD ¿VLRORJLD GR H[HUFtFLR GDWD GR ¿QDO GR VpFXOR ;,; soa possui para a realização de coisas agradáveis na vida, dentre as
FRPDSXEOLFDomRHPGROLYURGH)HUQDQG/D*UDQJHGHQR- quais podemos citar as aventuras naturais. De acordo com o autor,
minado Physiology of Bodily Exercise. Vale destacar, contudo, que engajando-se em atividades como esquiar na neve ou na água, es-
DVSULPHLUDVLQGLFDo}HVLPSRUWDQWHVSDUDRFDPSRGD¿VLRORJLDGR FDODUPRQWDQKDVRXPHVPRDQGDUGHELFLFOHWDQR¿QDOGHVHPDQD
H[HUFtFLR IRUDP UHDOL]DGDV DSHQDV QR ¿QDO GD SULPHLUD GpFDGD GR com uma mochila nas costas, as pessoas podem se sentir treinadas,
século XX. Essas indicações estavam associadas aos processos de FRPHQHUJLDHLQWHUHVVHVX¿FLHQWHVSDUDPD[LPL]DURSUD]HUTXHRV
FRQWUDomRPXVFXODUHjSURGXomRGHODFWDWR1DOLWHUDWXUDDWXDOKi recursos naturais lhes oferecem.
consenso de que foi a partir dos estudos sobre o método interva-
ODGRGR¿VLRORJLVWD5HLGHOOUHDOL]DGRVQDGpFDGDGHGRVpFXOR Características do condicionamento físico
passado, que o treinamento esportivo passou a ter uma concepção
FLHQWt¿FD$ SDUWLU GHVVD RFDVLmR ¿VLRORJLVWDV PpGLFRV ¿VLRWHUD- $DWLYLGDGHGHUHVLVWrQFLDDHUyELDSRGHVHUGH¿QLGDFRPRDTXD-
peutas e professores de Educação Física têm se dedicado ao estudo lidade física que permite um esforço por um determinado período
GRFRPSRUWDPHQWRHjLQÀXrQFLDGDVGLYHUVDVYDULiYHLV¿VLROyJLFDV em que há um equilíbrio entre o consumo de oxigênio e a absorção
GXUDQWHDSHUIRUPDQFH'HIRUPDDEUDQJHQWH%DXHU S  do mesmo. Normalmente, esta atividade está associada a exercícios
DSXG:HLQHFN S FRQFHLWXDFRQGLFLRQDPHQWRItVLFRFRPR TXHXVDPJUDQGHVGLVWkQFLDVRXWHPSRVFRPRSRUH[HPSORFDPL-
“um conjunto de todos os fatores de performance: psíquicos, físi- nhar, correr, andar de bicicleta, nadar etc., com intensidades baixas
cos, técnico-táticos, cognitivos e sociais. Pode-se considerar que ou moderadas para praticantes de atividade física e não atletas espe-
HVVDGH¿QLomRH[WUHPDPHQWHDPSODGL¿FXOWDXPDDomRHGXFDWLYD Ft¿FRV3RGHVHGL]HUTXHDVDWLYLGDGHVDHUyELDVWHUmRXPWHPSRVX-
mais objetiva. Nesse sentido, Weineck (Idem), ao focar esse tipo SHULRUDPLQXWRVFRPXPDLQWHQVLGDGHEDL[DRXPRGHUDGDH[HU-
de ação mais objetiva, argumenta que: “as características do condi- cícios de resistência, de baixa intensidade e longa duração utilizam
cionamento físico limitam-se, principalmente, aos fatores físicos da o sistema aeróbio. O sistema aeróbio é ativado em exercícios acima
performance: resistência aeróbica e anaeróbica, força, velocidade e de um minuto. Os exercícios aeróbios são de intensidade média e
ÀH[LELOLGDGH´6WHJHPDQQ S FRQFHLWXDFRQGLFLRQDPHQWR tempo prolongado, através da degradação aeróbia de carboidratos e
físico como a “repetição contínua de movimentos que desenvolve gorduras. A energia necessária para executá-lo é proporcionada pelo
reações novas, denominadas “condicionadas”, resultando em auto- uso do oxigênio, ou seja, o oxigênio funciona como fonte de queima

Didatismo e Conhecimento 9
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
dos substratos que produzirão a energia a ser transportada para o 8PSURJUDPDDGHTXDGRGH&)GHYHVHJXLUXPDIUHTXrQFLD±D
P~VFXORHPDWLYLGDGH(VVHWLSRGHDWLYLGDGHHVWLPXODVREUHWXGR vezes por semana, intercalados com dias de descanso, com duração
a função dos sistemas cardiorrespiratório e vascular, contribuindo PtQLPDGHPLQXWRVHIUHTXrQFLDFDUGtDFDPi[LPDGHD
para o aumento da capacidade cardíaca e pulmonar do praticante. ou conforme a condição física do indivíduo. Em três meses conse-
-iRH[HUFtFLRDQDHUyELFRRH[HUFtFLRH[WHQXDQWHDGR cutivos, essa programação conduz a resultados satisfatórios para a
92PD[ VRPHQWH VHUi DWHQGLGR SHOR VLVWHPD DQDHUyELR DOiF- obtenção de um bom CF. O condicionamento físico é mensurado, de
WLFR DWp D GHSOHomR GDV UHVHUYDV GH &3 IRVIDWR GH FUHDWLQD  modo particular, por intermédio da capacidade individual na execu-
1RH[HUFtFLRLQWHQVRHQWUHHGR92PD[DHQHUJLDSRGH ção do desempenho físico muscular e na manutenção do equilíbrio
ser fornecida pelo sistema anaeróbio láctico, ressintetizando o ATP cardiocirculatório e respiratório mediante esforços. “A aptidão físi-
(trifosfato de adenosina) para o esforço, e a produção de ácido lác- ca individual só pode ser comparada, verdadeiramente, com tarefas
tico poderá impedir a continuidade da atividade. Basicamente, é um iguais e em condições externas iguais.” Assim, para a execução de
exercício de alta intensidade e de curta duração. ATP e o CP podem tarefas, cada pessoa apresenta uma capacidade física particular que
SURSRUFLRQDUHQHUJLDSDUDRVP~VFXORVSRUXPWHPSRGHDVH- só pode ser avaliada em condições de igualdade, quando se deseja
gundos, durante um exercício forte. TXDQWL¿FDUHDYDOLDUULJRURVDPHQWHDSHUIRUPDQFHLQGLYLGXDO
Podem-se citar como exemplos de exercícios anaeróbios aque-
les de velocidade, curta duração e alta intensidade, como a corrida Condicionamento físico x sedentarismo x estresse
GHPUDVRVRVVDOWRVHRVDUUHPHVVRVGHSHVR2VH[HUFtFLRVUHD-
lizados com muito peso e poucas repetições nas salas de musculação O sedentarismo prejudica seriamente o equilíbrio do organis-
também são considerados uma atividade anaeróbica. Dessa forma, PR SURYRFDQGR YiULRV GLVW~UELRV VREUHWXGR HP SHVVRDV LGRVDV
os exercícios anaeróbios são aqueles que têm efeito mais localiza- Acarreta o surgimento de doenças crônico-degenerativas, transtor-
GRQRVP~VFXORVHQTXDQWRTXHRVH[HUFtFLRVDHUyELRVEHQH¿FLDP QRGHKXPRUGLPLQXLDVIXQo}HV¿VLROyJLFDVHFRJQLWLYDVSLRUDGR
VREUHWXGRDVD~GHGRVLVWHPDFDUGLRUUHVSLUDWyULR2H[HUFtFLRItVLFR SHU¿OOLStGLFRGLPLQXLDDXWRHVWLPDDXPHQWDDDQVLHGDGHSRGHQ-
regular fortalece o coração e permite que ele bombeie uma maior do levar ao estresse. O estresse pode ser considerado a “doença do
quantidade de sangue em cada batimento cardíaco. Deste modo, o século”, resultando do somatório de fatos intrínsecos e extrínsecos
sangue libera mais oxigênio para o organismo, atingindo a quanti- nos indivíduos. Fatores como mudança de casa, casamento, divór-
dade máxima que este consegue obter e utilizar. Essa quantidade, cio, mudanças bruscas de temperatura, traumatismos ósseos , fases
chamada de captação máxima de oxigênio, é geralmente utilizada GHDGDSWDomRRUJkQLFDLQWHUQDomRKRVSLWDODUFLUXUJLDVKHPRUUDJLDV
como medida para determinação do nível de condicionamento de OHV}HVRUJkQLFDVDFRPSDQKDGDVGHFRPSURPHWLPHQWRSVtTXLFR RX
uma pessoa. Para os autores, o CF está ligado à “capacidade de se emocional), induzem ao estresse. Para determinada pessoa uma si-
realizar atividades físicas”. Conforme Fuchs, Moreira e Ribeiro tuação pode induzir ao estresse, enquanto para outras a mesma situa-
 R&)VHGHWHUPLQDSRUPHLRGDLQWHQVLGDGHGRH[HUFtFLRHP ção seria encarada de modo normal, sem qualquer alteração. Para o
vez de sua duração. As séries de exercícios necessitam ser intensas, controle do estresse, tem-se recomendado estratégias como: psicote-
chegando a ponto de a musculatura se tornar dolorida no dia seguin- rapia, técnicas corporais de relaxamento e alívio das tensões, uso de
te. Para que haja o fortalecimento do coração, o exercício deve ser medicamentos homeopáticos ou alopáticos e a prática de exercícios
feito a uma intensidade que eleve a frequência cardíaca de repouso. físicos.
Quanto mais intenso for o exercício realizado, mais rápido o coração &DUXVR  1XQRPXUDHWDO  FRPSDUDUDPRVVLQWRPDV
EDWHUiID]HQGRFRPTXHRPLRFiUGLRVHWRUQHPDLVIRUWH*HUDOPHQ- de estresse e a qualidade de vida entre praticantes regulares e ingres-
te, a frequência cardíaca recomendada para o treinamento é próxima santes sedentários em programas de atividade física supervisionada.
GHGDIUHTXrQFLDFDUGtDFDPi[LPDLQGLYLGXDO(ODSRGHPHQ- O primeiro estudo, desenvolvido com um grupo de condicionamen-
surar a força da musculatura esquelética e, assim, uma pessoa “bem to físico para prevenção cardiológica primária e secundária, deixou
condicionada” e forte poderá apresentar uma frequência cardíaca claro que os praticantes regulares de atividades físicas apresentaram
máxima muito maior do que de uma pessoa jovem e “não-condi- níveis de estresse favoráveis em relação aos participantes sedentá-
FLRQDGD´2&)TXDQGRYROWDGRSDUDDVD~GHSRVVXLXPREMHWLYR rios.
diferente daquele que é voltado para a performance desportiva. A
melhor interação das diversas valências físicas pode contribuir para Condicionamento físico x exercícios físicos x atividades físicas
RERPFRQGLFLRQDPHQWRItVLFRHSDUDDVD~GH$WXDOPHQWHGLYHUVRV
estudos têm demonstrado que o treinamento de várias valências fí- Para obter um bom CF, o indívíduo necessita praticar exercí-
sicas pode contribuir para a prevenção de lesões, para melhorar o cios físicos e/ou atividades físicas. Os exercícios físicos, segundo
gesto desportivo, para o controle da composição corporal e para a 0RQWHLURH*RQoDOYHV  VHUHDOL]DGRVDGHTXDGDPHQWHDWXDP
UHFXSHUDomRELRSVLFRVRFLDOGRVXMHLWR%DUEDQWL  WHPSRQWR como propriedade medicamentosa visto que favorecem o aumen-
de vista similar em relação à diminuição no risco de lesões e a dimi- to da reserva funcional e agem sobre várias condições patológicas
nuição no tempo necessário para uma reabilitação em caso de lesão, PDQLIHVWDV(VVHVDXWRUHVVH¿OLDPjFRUUHQWHPpGLFDTXHGHIHQGH
quando o indivíduo dispõe de um bom condicionamento físico. A os exercícios físicos como forma preventiva, de controle e proce-
caracterização distinta entre condição física e condição atlética. Para GLPHQWR WHUDSrXWLFR HPSUHJDGR HP LQ~PHUDV GRHQoDV KXPDQDV
se obter a condição física torna-se necessário um período completo Do mesmo modo, a aptidão corporal é fator decisivo na prevenção
de preparação física, ao passo que a condição atlética é adquirida por de diversas doenças, tornando-se imprescindível controlar o peso
meio de muitos períodos de treinamento completo. Desse modo, um e manter a pressão arterial mais baixa. Esses autores argumentam
atleta pode apresentar uma condição física desejável para uma com- ainda que exercícios criteriosos trazem benefício adicional de vida
petição e, paradoxalmente, não apresentar boa condição atlética. prolongada e que o índice de mortalidade é três vezes menor entre

Didatismo e Conhecimento 10
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
SHVVRDVQDIDL[DGHDDQRVSUDWLFDQWHVGHJLQiVWLFD$OHUWDP vidade física traz grandes benefícios para o praticante já que reduz
ainda que “a pessoa atleticamente apta tem mais reservas corporais níveis de depressão, melhora a auto-estima, auxilia no relaxamento
FRPDVTXDLVSRGHFRQWDUTXDQGRDGRHFH´ S 'HRXWURPRGR do sono, melhora a disposição, atua no controle de vários fatores de
praticar exercícios físicos inadequados ou em excesso pode resultar risco coronariano, fortalecendo o coração que bombeia mais sangue
VpULRVSUREOHPDVPXVFXODUHVFRPRREVHUYD:HLQHFN   FRPPHQRUQ~PHURGHEDWLPHQWRVGLPLQXLQGRDIUHTXrQFLDFDUGtD-
Existem métodos de treinamento que, por exemplo, levam ao ca e a pressão arterial, melhorando a aptidão física e aumentando a
aumento do coração, mas provocam pouca melhora capilar (capi- DEVRUomRGHR[LJrQLR3DUD)LDWDURQHHWDO  XPSURJUDPDLGHDO
lares são os menores vasos em que a troca metabólica com a célula GHDWLYLGDGHItVLFDSDUDDPHOKRULDGDVD~GHHEHPHVWDUSVLFROyJL-
muscular acontece). Outros métodos de treinamento, por sua vez, FRGRVDGXOWRVPDGXURVGHYHVRPDUIRUoDÀH[LELOLGDGHHTXLOtEULR
WrPIRUWHLQÀXrQFLDVREUHDFDSLODUL]DomR DXPHQWRGRQ~PHURGH coordenação e atividades aeróbias.
capilares), mas menor efeito sobre o tamanho do coração. &RQIRUPH 0D]]HR HW DO   D DWLYLGDGH ItVLFD LQÀXHQFLD
SRVLWLYDPHQWHDVD~GHPHQWDOGRVDGXOWRVPDGXURV3HVTXLVDVUHDOL-
(...) Diversas partes do sistema cardiocirculatório podem ser ]DGDVSRU7KLUODZD\H%HQWRQ  H0DURZODNLH=HUYDV  
GLIHUHQWHPHQWHLQÀXHQFLDGDVSHORVYiULRVPpWRGRVHSURJUDPDVGH DSXG0D]]HRHWDO  UHYHODPTXHDSUiWLFDUHJXODUGHDWLYLGDGH
WUHLQDPHQWR S  ItVLFD WHP HIHLWR VLJQL¿FDWLYR QRV HVWDGRV SVLFROyJLFRV GH KXPRU
tanto nos aspectos positivos quanto nos negativos, proporcionando
As pessoas que praticam exercícios físicos, regularmente, seja bem-estar psicológico e aumentando a resistência diante do estresse
em algum esporte, grupo de dança ou programa de reabilitação car- SVLFRVVRFLDO6HJXQGR0DWVXGDH0DWVXGD  DDWLYLGDGHItVLFD
díaca, fazem-nos porque gostam ou porque necessitam de exercí- é importante no controle do peso e gordura corporal, contribuindo
FLRV(VVHVWUD]HPHQWUHYiULRVEHQHItFLRVSDUDDVD~GHDUHGXomR na prevenção e controle de doenças cardiovasculares, diabetes, hi-
dos níveis de estresse pontuado por ansiedade, depressão, raiva, pertensão, AVC, artrite, apneia do sono e prejuízo da mobilidade. A
HYLWDQGRVHRXVRGHGURJDVDOpPGHLQÀXHQFLDURKXPRUHLQGLUH- maioria dos autores citados considera que a prática regular de exer-
tamente, a vida social das pessoas. cícios físicos e a participação em atividades físicas tornam o indiví-
Outras vantagens relacionadas às atividades físicas têm sido duo mais ativo, mais bem humorado, mais saudável, funcionando
DQXQFLDGDV HP DUWLJRV FLHQWt¿FRV 2 ERP FRQGLFLRQDPHQWR ItVLFR como prevenção além de integrá-lo a vários grupos sociais com os
auxilia nos processos neurológicos, cardiorrespiratórios e nas fun- quais compartilha conhecimento e saberes. Percebe-se que, embo-
ções cognitivas. Além dos benefícios, citados anteriormente, que
ra sem consenso, o conceito de “condicionamento físico” expressa
VmRDVVRFLDGRVjDGRomRGHXPHVWLORGHYLGD¿VLFDPHQWHDWLYRD
uma abordagem biopsicossocial incluindo prevenção e promoção da
prática do exercício físico desperta no sujeito a auto-estima, tor-
VD~GHSUHYHQomRGHOHV}HVSHUIRUPDQFHGHVSRUWLYDOD]HUHDWLYLGD-
QDQGRRPDLVDXWRFRQ¿DQWH)D]HUDWLYLGDGHItVLFDVLJQL¿FDROKDU-
des cotidianas. Esses aspectos, se compartilhados por grupos especí-
VHPDLVSHUFHEHUVHPDLVH[SRUVHPDLVHQ¿P³JRVWDUVH´1HVVH
¿FRVSRGHPFRQVWLWXLUUHSUHVHQWDo}HVVRFLDLVVREUHRWHPD
sentido, a pessoa passa a cuidar mais de si, incorpora o movimento
físico à vida, dá novos rumos a sua existência. Os exercícios físicos
/(*,6/$dÆ2
podem ser trabalhados como procedimento terapêutico também em
doenças das vias aéreas como asma, por exemplo. Em avaliação de
um programa de treinamento físico por quatro meses para crianças /(,1ž'('($*2672'(
asmáticas, pesquisadores revelaram que exercícios físicos reali- 'LVS}HVREUHR'LDGR3UR¿VVLRQDOGH(GXFDomR)tVLFD
]DGRVHPVRORHiJXDGXDVYH]HVSRUVHPDQDFRPVHVV}HVGH O PRESIDENTE DA REPÚBLICA Faço saber que o Congres-
minutos, proporcionaram melhor CF e aumento de força muscular VR1DFLRQDOGHFUHWDHHXVDQFLRQRDVHJXLQWH/HL$UWž)LFDLQVWL-
nessas crianças. WXtGRRGLDRGHVHWHPEURFRPRR'LDGR3UR¿VVLRQDOGH(GXFDomR
2&RQVHOKR/DWLQR$PHULFDQR  DSXG0DUWXV  Yr Física. Art. 2º Esta Lei entra em vigor na data de sua publicação.
no exercício físico uma atividade física planejada e estruturada com %UDVtOLDGHDJRVWRGHRGD,QGHSHQGrQFLDHRGD
o propósito de melhorar ou manter o CF. Segundo Oliveira e Furtado 5HS~EOLFD
 RH[HUFtFLRItVLFRUHJXODUFRQWULEXLSDUDXPHQYHOKHFLPHQ-
to saudável. Exercício físico e atividade física, ao contrário do que /8,=,1È&,2/8/$'$6,/9$2UODQGR6LOYDGH-HVXV-~QLRU
SDUHFHQmRVmRFRQVLGHUDGRVVLQ{QLPRV&DVSHUVHQHWDO  GH- (VWHWH[WRQmRVXEVWLWXLRSXEOLFDGRQR'28GH
¿QHPDWLYLGDGHItVLFDFRPR³TXDOTXHUPRYLPHQWRFRUSRUDOSURGX]L-
GRSHORVP~VFXORVHVTXHOpWLFRVTXHUHVXOWHPHPJDVWRHQHUJpWLFR´ 0HQVDJHP GH YHWR /(, 1R  '( ž '( '(=(0%52
Consideram exercício físico subgrupo das atividades físicas, que é '($OWHUDDUHGDomRGRDUW†žHGRDUWGD
planejado, estruturado e repetitivo, tendo como meta a manutenção /HLQRGHGHGH]HPEURGHTXH³HVWDEHOHFHDV
ou a otimização do CF. A intencionalidade e o planejamento é o diretrizes e bases da educação nacional”, e dá outras providências.
que diferencia exercício físico de atividade física. A aptidão física é O PRESIDENTE DA REPÚBLICA Faço saber que o Congres-
GH¿QLGDSHORVDXWRUHVFRPR³DKDELOLGDGHGRFRUSRGHDGDSWDUVHjV VR1DFLRQDOGHFUHWDHHXVDQFLRQRDVHJXLQWH/HL$UWž2†ž do
demandas do esforço físico que a atividade precisa para níveis mo- DUWGD/HLQRGHGHGH]HPEURGHSDVVDDYLJRUDU
GHUDGRVRXYLJRURVRVVHPOHYDUDFRPSOHWDH[DXVWmR´ S 6H- FRPDVHJXLQWHUHGDomR³$UW
JXQGR*XHGHV  DSWLGmRItVLFDpXPHVWDGRGLQkPLFRGHHQHU- .....................
gia e vitalidade que permite a cada um realizar tarefas do cotidiano, †ž A educação física, integrada à proposta pedagógica da es-
desfrutar ativamente as horas de lazer e enfrentar emergências im- cola, é componente curricular obrigatório da educação básica, sendo
SUHYLVWDVVHPIDGLJDH[FHVVLYD'HDFRUGRFRP*XHGHV  DDWL- sua prática facultativa ao aluno:

Didatismo e Conhecimento 11
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
I – que cumpra jornada de trabalho igual ou superior a seis como prestar serviços de auditoria, consultoria e assessoria, reali-
horas; II – maior de trinta anos de idade; zar treinamentos especializados, participar de equipes multidisci-
III – que estiver prestando serviço militar inicial ou que, em SOLQDUHVHLQWHUGLVFLSOLQDUHVHHODERUDULQIRUPHVWpFQLFRVFLHQWt¿FRV
situação similar, estiver obrigado à prática da educação física; IV e pedagógicos, todos nas áreas de atividades físicas e do desporto.
±DPSDUDGRSHOR'HFUHWR/HLQRGHGHRXWXEURGH $UWž6mRFULDGRVR&RQVHOKR)HGHUDOHRV&RQVHOKRV5HJLR-
V – (VETADO) VI – que tenha prole. QDLVGH(GXFDomR)tVLFD$UWž2VSULPHLURVPHPEURVHIHWLYRVH
...........................................................................” (NR) suplentes do Conselho Federal de Educação Física serão eleitos para
$UWž 9(7$'2 $UWž(VWD/HLHQWUDHPYLJRUQRDQROHWL- um mandato tampão de dois anos, em reunião das associações repre-
YRVHJXLQWHjGDWDGHVXDSXEOLFDomR%UDVtOLDRGHGH]HPEURGH VHQWDWLYDVGH3UR¿VVLRQDLVGH(GXFDomR)tVLFDFULDGDVQRVWHUPRV
RGD,QGHSHQGrQFLDHRGD5HS~EOLFD da Constituição Federal, com personalidade jurídica própria, e das
LUIZ INÁCIO LULA DA SILVA Cristovam Ricardo Caval- LQVWLWXLo}HVVXSHULRUHVGHHQVLQRGH(GXFDomR)tVLFDR¿FLDOPHQWH
cante Buarque autorizadas ou reconhecidas, que serão convocadas pela Federação
(VWHWH[WRQmRVXEVWLWXLRSXEOLFDGRQR'28GH %UDVLOHLUDGDV$VVRFLDo}HVGRV3UR¿VVLRQDLVGH(GXFDomR)tVLFD
FBAPEF, no prazo de até noventa dias após a promulgação desta
/(,1R'('('(=(0%52'( Lei.
Introduz a palavra “obrigatório” após a expressão “curricu- $UWž(VWD/HLHQWUDHPYLJRUQDGDWDGHVXDSXEOLFDomR%UD-
lar”, constante do † ž GR DUW  GD /HL QR  GH  GH GH- VtOLDGHVHWHPEURGHRGD,QGHSHQGrQFLDHRGD5H-
]HPEURGHTXHHVWDEHOHFHDVGLUHWUL]HVHEDVHVGDHGXFDomR S~EOLFD
nacional. FERNANDO HENRIQUE CARDOSO Edward Amadeo
O PRESIDENTE DA REPÚBLICA Faço saber que o Con- (VWHWH[WRQmRVXEVWLWXLRSXEOLFDGRQR'28GH
JUHVVR1DFLRQDOGHFUHWDHHXVDQFLRQRDVHJXLQWH/HL$UWž2§
žGRDUWGD/HLQRGHGHGH]HPEURGHSDVVDD LEI Nº 9.615, DE 24 DE MARÇO DE 1998.
YLJRUDUFRPDVHJXLQWHUHGDomR³$UW
.................................. ............................................................. Regulamento
† ž A educação física, integrada à proposta pedagógica da
Vide Decreto nº 3.659, de 2000
escola, é componente curricular obrigatório da Educação Básica,
Vide Decreto nº 4.201, de 2002
ajustando-se às faixas etárias e às condições da população escolar,
Vide Lei nº 12.876, de 2013
sendo facultativa nos cursos noturnos.
.................................................................................” (NR)
Institui normas gerais sobre desporto e dá outras providên-
Art. 2º Esta Lei entra em vigor na data de sua publicação.
cias.
%UDVtOLDGHGH]HPEURGHRGD,QGHSHQGrQFLDHR
GD5HS~EOLFD O PRESIDENTE DA REPÚBLICA Faço saber que o
FERNANDO HENRIQUE CARDOSO Paulo Renato Souza Congresso Nacional decreta e eu sanciono a seguinte Lei:
(VWHWH[WRQmRVXEVWLWXLRSXEOLFDGRQR'28GH
CAPÍTULO I
/(,1ž'('(6(7(0%52'( DISPOSIÇÕES INICIAIS
'LVS}HVREUHDUHJXODPHQWDomRGD3UR¿VVmRGH(GXFDomR)t-
sica e cria os respectivos Conselho Federal e Conselhos Regionais $UW ž 2 GHVSRUWR EUDVLOHLUR DEUDQJH SUiWLFDV IRUPDLV H QmR-
de Educação Física. -formais e obedece às normas gerais desta Lei, inspirado nos funda-
O PRESIDENTE DA REPÚBLICA Faço saber que o Con- mentos constitucionais do Estado Democrático de Direito.
JUHVVR 1DFLRQDO GHFUHWD H HX VDQFLRQR D VHJXLQWH /HL$UW ž 2 †žA prática desportiva formal é regulada por normas nacio-
exercício das atividades de Educação Física e a designação de Pro- nais e internacionais e pelas regras de prática desportiva de cada
¿VVLRQDOGH(GXFDomR modalidade, aceitas pelas respectivas entidades nacionais de admi-
)tVLFDpSUHUURJDWLYDGRVSUR¿VVLRQDLVUHJXODUPHQWHUHJLVWUD- nistração do desporto.
dos nos Conselhos Regionais de Educação Física. § 2º A prática desportiva não-formal é caracterizada pela liber-
Art. 2º Apenas serão inscritos nos quadros dos Conselhos Re- GDGHO~GLFDGHVHXVSUDWLFDQWHV
JLRQDLVGH(GXFDomR)tVLFDRVVHJXLQWHVSUR¿VVLRQDLV,RVSRV-
VXLGRUHVGHGLSORPDREWLGRHPFXUVRGH(GXFDomR)tVLFDR¿FLDO- CAPÍTULO II
mente autorizado ou DOS PRINCÍPIOS FUNDAMENTAIS
reconhecido; II - os possuidores de diploma em Educação Fí-
sica expedido por instituição de ensino superior estrangeira, re- Art. 2º O desporto, como direito individual, tem como base os
validado na forma da legislação em vigor; III - os que, até a data princípios:
do início da vigência desta Lei, tenham comprovadamente exerci- I - da soberania, caracterizado pela supremacia nacional na or-
GRDWLYLGDGHVSUySULDVGRV3UR¿VVLRQDLVGH(GXFDomR)tVLFDQRV ganização da prática desportiva;
termos a serem estabelecidos pelo Conselho Federal de Educação ,,GDDXWRQRPLDGH¿QLGRSHODIDFXOGDGHHOLEHUGDGHGHSHV-
Física. soas físicas e jurídicas organizarem-se para a prática desportiva;
$UWž&RPSHWHDR3UR¿VVLRQDOGH(GXFDomR)tVLFDFRRUGH- III - da democratização, garantido em condições de acesso às
nar, planejar, programar, supervisionar, dinamizar, dirigir, organi- atividades desportivas sem quaisquer distinções ou formas de dis-
zar, avaliar e executar trabalhos, programas, planos e projetos, bem criminação;

Didatismo e Conhecimento 12
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
IV - da liberdade, expresso pela livre prática do desporto, de ,,GHPRGRQmRSUR¿VVLRQDOLGHQWL¿FDGRSHODOLEHUGDGHGH
acordo com a capacidade e interesse de cada um, associando-se ou prática e pela inexistência de contrato de trabalho, sendo permitido
não a entidade do setor; o recebimento de incentivos materiais e de patrocínio.
V - do direito social, caracterizado pelo dever do Estado em a) (revogada);
fomentar as práticas desportivas formais e não-formais; b) (revogada).
VI - da diferenciação, consubstanciado no tratamento especí-
¿FRGDGRDRGHVSRUWRSUR¿VVLRQDOHQmRSUR¿VVLRQDO CAPÍTULO IV
9,,GDLGHQWLGDGHQDFLRQDOUHÀHWLGRQDSURWHomRHLQFHQWLYR DO SISTEMA BRASILEIRO DO DESPORTO
às manifestações desportivas de criação nacional;
VIII - da educação, voltado para o desenvolvimento integral SEÇÃO I
do homem como ser autônomo e participante, e fomentado por DA COMPOSIÇÃO E DOS OBJETIVOS
PHLRGDSULRULGDGHGRVUHFXUVRVS~EOLFRVDRGHVSRUWRHGXFDFLRQDO
IX - da qualidade, assegurado pela valorização dos resultados $UWž26LVWHPD%UDVLOHLURGR'HVSRUWRFRPSUHHQGH
desportivos, educativos e dos relacionados à cidadania e ao desen- I - o Ministério do Esporte;
volvimento físico e moral; II - (Revogado)
X - da descentralização, consubstanciado na organização e III - o Conselho Nacional do Esporte - CNE;
IV - o sistema nacional do desporto e os sistemas de desporto
funcionamento harmônicos de sistemas desportivos diferenciados
dos Estados, do Distrito Federal e dos Municípios, organizados de
e autônomos para os níveis federal, estadual, distrital e municipal;
forma autônoma e em regime de colaboração, integrados por víncu-
XI - da segurança, propiciado ao praticante de qualquer mo-
ORVGHQDWXUH]DWpFQLFDHVSHFt¿FRVGHFDGDPRGDOLGDGHGHVSRUWLYD
dalidade desportiva, quanto a sua integridade física, mental ou
†žO Sistema Brasileiro do Desporto tem por objetivo garantir
sensorial; a prática desportiva regular e melhorar-lhe o padrão de qualidade.
;,,GDH¿FLrQFLDREWLGRSRUPHLRGRHVWtPXORjFRPSHWrQFLD § 2º A organização desportiva do País, fundada na liberdade
desportiva e administrativa. de associação, integra o patrimônio cultural brasileiro e é conside-
3DUiJUDIR~QLFR$H[SORUDomRHDJHVWmRGRGHVSRUWRSUR¿V- UDGDGHHOHYDGRLQWHUHVVHVRFLDOLQFOXVLYHSDUDRV¿QVGRGLVSRVWR
sional constituem exercício de atividade econômica sujeitando-se, QRVLQFLVRV,H,,,GR$UWžGD/HL&RPSOHPHQWDUQo , GHGH
HVSHFL¿FDPHQWHjREVHUYkQFLDGRVSULQFtSLRV PDLRGH
,GDWUDQVSDUrQFLD¿QDQFHLUDHDGPLQLVWUDWLYD †žPoderão ser incluídas no Sistema Brasileiro de Desporto as
II - da moralidade na gestão desportiva; pessoas jurídicas que desenvolvam práticas não-formais, promovam
III - da responsabilidade social de seus dirigentes; a cultura e as ciências do desporto e formem e aprimorem especia-
IV - do tratamento diferenciado em relação ao desporto não listas.
SUR¿VVLRQDOH
V - da participação na organização desportiva do País. SEÇÃO II
DOS RECURSOS DO MINISTÉRIO DO ESPORTE
CAPÍTULO III (REDAÇÃO DADA PELA LEI Nº 12.395, DE 2011).
DA NATUREZA E DAS FINALIDADES DO DESPORTO
$UW º Os recursos do Ministério do Esporte serão aplicados
$UWž2GHVSRUWRSRGHVHUUHFRQKHFLGRHPTXDOTXHUGDVVH- conforme dispuser o Plano Nacional do Desporto, observado o dis-
guintes manifestações: SRVWRQHVWD6HomR 5HGDomRGDGDSHOD/HLQžGH 
I - desporto educacional, praticado nos sistemas de ensino e †ž(Revogado)
em formas assistemáticas de educação, evitando-se a seletividade, § 2º (Revogado)
D KLSHUFRPSHWLWLYLGDGH GH VHXV SUDWLFDQWHV FRP D ¿QDOLGDGH GH †º Caberá ao Ministério do Esporte, ouvido o CNE, nos termos
alcançar o desenvolvimento integral do indivíduo e a sua formação GRLQFLVR,,GRDUWSURSRUR3ODQR1DFLRQDOGR'HVSRUWRGHFH-
para o exercício da cidadania e a prática do lazer; QDOREVHUYDGRRGLVSRVWRQRDUWGD&RQVWLWXLomR)HGHUDO 5H-
II - desporto de participação, de modo voluntário, compreen- GDomRGDGDSHOD/HLQžGH 
†º 5HYRJDGRSHOD/HLQžGH 
GHQGRDVPRGDOLGDGHVGHVSRUWLYDVSUDWLFDGDVFRPD¿QDOLGDGHGH
contribuir para a integração dos praticantes na plenitude da vida
$UWž&RQVWLWXHPUHFXUVRVGR0LQLVWpULRGR(VSRUWH
VRFLDOQDSURPRomRGDVD~GHHHGXFDomRHQDSUHVHUYDomRGRPHLR
I - receitas oriundas de concursos de prognósticos previstos em
ambiente;
lei;
III - desporto de rendimento, praticado segundo normas gerais II - adicional de quatro e meio por cento incidente sobre cada
desta Lei e regras de prática desportiva, nacionais e internacionais, bilhete, permitido o arredondamento do seu valor feito nos concur-
FRPD¿QDOLGDGHGHREWHUUHVXOWDGRVHLQWHJUDUSHVVRDVHFRPXQL- VRVGHSURJQyVWLFRVDTXHVHUHIHUHR'HFUHWR/HLQžGHGH
dades do País e estas com as de outras nações. PDLRGHHD/HLQo GHGHQRYHPEURGHGHVWLQD-
3DUiJUDIR~QLFR2GHVSRUWRGHUHQGLPHQWRSRGHVHURUJDQL- GRDRFXPSULPHQWRGRGLVSRVWRQRDUWo;
zado e praticado: III - doações, legados e patrocínios;
,GHPRGRSUR¿VVLRQDOFDUDFWHUL]DGRSHODUHPXQHUDomRSDF- IV - prêmios de concursos de prognósticos da Loteria Esportiva
tuada em contrato formal de trabalho entre o atleta e a entidade de Federal, não reclamados;
prática desportiva; V - outras fontes.

Didatismo e Conhecimento 13
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
†žO valor do adicional previsto no inciso II deste artigo não $UWž$QXDOPHQWHDUHQGDOtTXLGDWRWDOGHXPGRVWHVWHVGD
VHUiFRPSXWDGRQRPRQWDQWHGDDUUHFDGDomRGDVDSRVWDVSDUD¿QVGH Loteria Esportiva Federal será destinada ao Comitê Olímpico Brasi-
cálculo de prêmios, rateios, tributos de qualquer natureza ou taxas leiro-COB, para treinamento e competições preparatórias das equi-
de administração. SHVROtPSLFDVQDFLRQDLV 9LGH'HFUHWRQžGH
†ž'RDGLFLRQDOGH TXDWURHPHLRSRUFHQWR GHTXHWUDWD †žNos anos de realização dos Jogos Olímpicos e dos Jogos
RLQFLVR,,GHVWHDUWLJR XPWHUoR VHUiUHSDVVDGRjV6HFUHWDULDV Pan-Americanos, a renda líquida de um segundo teste da Loteria Es-
de Esporte dos Estados e do Distrito Federal ou, na inexistência portiva Federal será destinada ao Comitê Olímpico Brasileiro-COB,
destas, a órgãos que tenham atribuições semelhantes na área do para o atendimento da participação de delegações nacionais nesses
esporte, proporcionalmente ao montante das apostas efetuadas em eventos.
cada unidade da Federação, para aplicação prioritária em jogos § 2º Ao Comitê Paraolímpico Brasileiro serão concedidas as
escolares de esportes olímpicos e paraolímpicos, admitida também rendas líquidas de testes da Loteria Esportiva Federal nas mesmas
sua aplicação nas destinações previstas nos incisos I, VI e VIII do condições estabelecidas neste artigo para o Comitê Olímpico Brasi-
$UWžGHVWD/HL 5HGDomRGDGDSHOD/HLQžGH  leiro-COB.
†ž$SDUFHODUHSDVVDGDDRV(VWDGRVHDR'LVWULWR)HGHUDOQD
forma do § 2º VHUiDSOLFDGDLQWHJUDOPHQWHHPDWLYLGDGHV¿QDOtVWLFDV $UW2VUHFXUVRV¿QDQFHLURVFRUUHVSRQGHQWHVjVGHVWLQDo}HV
GRHVSRUWHVHQGRSHORPHQRV FLQTXHQWDSRUFHQWR LQYHVWLGRV SUHYLVWDVQRLQFLVR,,,GR$UWžHQRFDSXWGR$UWžFRQVWLWXHP
em projetos apresentados pelos Municípios ou, na falta de projetos, UHFHLWDVSUySULDVGRVEHQH¿FLiULRVTXHOKHVVHUmRHQWUHJXHVGLUHWD-
em ações governamentais em benefício dos Municípios. (Reda- PHQWHSHOD&$,;$ 5HGDomRGDGDSHOD/HLQžGH 
omRGDGDSHOD/HLQžGH  †žO direito da entidade de prática desportiva de resgatar os
† ž 7ULPHVWUDOPHQWH D &DL[D (FRQ{PLFD )HGHUDO  &$,;$ UHFXUVRVGHTXHWUDWDRLQFLVR,,,GR$UWžGHVWD/HLGHFDLHP
apresentará balancete ao Ministério do Esporte, com o resultado (noventa) dias, a contar da data de sua disponibilização pela Caixa
da receita proveniente do adicional de que trata o inciso II deste Econômica Federal – CEF.
artigo. 5HGDomRGDGDSHOD/HLQžGH  § 2º Os recursos que não forem resgatados no prazo estipulado
no †ždeste artigo serão repassados ao Ministério do Esporte para
aplicação em programas referentes à política nacional de incentivo e
$UWž2VUHFXUVRVGR0LQLVWpULRGR(VSRUWHWHUmRDVHJXLQWH
desenvolvimento da prática desportiva.
destinação:
†ž(VETADO)
I - desporto educacional;
II - desporto de rendimento, nos casos de participação de enti-
SEÇÃO III
dades nacionais de administração do desporto em competições in-
DO CONSELHO DE DESENVOLVIMENTO DO DESPORTO
ternacionais, bem como as competições brasileiras dos desportos de
BRASILEIRO – CDDB
criação nacional;
III - desporto de criação nacional;
$UW2&1(pyUJmRFROHJLDGRGHQRUPDWL]DomRGHOLEHUDomR
IV - capacitação de recursos humanos: e assessoramento, diretamente vinculado ao Ministro de Estado do
a) cientistas desportivos; Esporte, cabendo-lhe:
b) professores de educação física; e I - zelar pela aplicação dos princípios e preceitos desta Lei;
c) técnicos de desporto; II - oferecer subsídios técnicos à elaboração do Plano Nacional
V - apoio a projeto de pesquisa, documentação e informação; do Desporto;
VI - construção, ampliação e recuperação de instalações espor- III - emitir pareceres e recomendações sobre questões despor-
tivas; tivas nacionais;
9,,DSRLRVXSOHWLYRDRVLVWHPDGHDVVLVWrQFLDDRDWOHWDSUR¿V- IV - propor prioridades para o plano de aplicação de recursos do
VLRQDOFRPD¿QDOLGDGHGHSURPRYHUVXDDGDSWDomRDRPHUFDGRGH Ministério do Esporte;
trabalho quando deixar a atividade; V - exercer outras atribuições previstas na legislação em vigor,
9,,,DSRLRDRGHVSRUWRSDUDSHVVRDVSRUWDGRUDVGHGH¿FLrQFLD relativas a questões de natureza desportiva;
$UWž$DUUHFDGDomRREWLGDHPFDGDWHVWHGD/RWHULD(VSRUWLYD VI - aprovar os Códigos de Justiça Desportiva e suas alterações,
terá a seguinte destinação: com as peculiaridades de cada modalidade; e (Redação dada pela
I - quarenta e cinco por cento para pagamento dos prêmios, in- /HLQžGH 
cluindo o valor correspondente ao imposto sobre a renda; 9,,H[SHGLUGLUHWUL]HVSDUDRFRQWUROHGHVXEVWkQFLDVHPpWR-
II - vinte por cento para a Caixa Econômica Federal - CEF, des- dos proibidos na prática desportiva.
tinados ao custeio total da administração dos recursos e prognósti- 3DUiJUDIR~QLFR20LQLVWpULRGR(VSRUWHGDUiDSRLRWpFQLFRH
cos desportivos; administrativo ao CNE.
III - dez por cento para pagamento, em parcelas iguais, às en-
tidades de práticas desportivas constantes do teste, pelo uso de suas $UW 9(7$'2
GHQRPLQDo}HVPDUFDVHVtPERORV 9LGH/HLQžGH
IV - quinze por cento para o INDESP. $UW $ 2 &1( VHUi FRPSRVWR SRU YLQWH H GRLV PHPEURV
IV - quinze por cento para o Ministério do Esporte. indicados pelo Ministro do Esporte, que o presidirá.
9 GH]SRUFHQWR SDUDD6HJXULGDGH6RFLDO ,QFOXtGR 3DUiJUDIR~QLFR2VPHPEURVGR&RQVHOKRHVHXVVXSOHQWHVVH-
SHOD/HLQžGH  rão indicados na forma da regulamentação desta Lei, para um man-
3DUiJUDIR~QLFR 5HYRJDGRSHOD/HLQžGH  dato de dois anos, permitida uma recondução.

Didatismo e Conhecimento 14
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
SEÇÃO IV $UW$VHQWLGDGHVGHSUiWLFDGHVSRUWLYDHDVHQWLGDGHVGH
DO SISTEMA NACIONAL DO DESPORTO administração do desporto, bem como as ligas de que trata o art.
 VmR SHVVRDV MXUtGLFDV GH GLUHLWR SULYDGR FRP RUJDQL]DomR H
$UW26LVWHPD1DFLRQDOGR'HVSRUWRWHPSRU¿QDOLGDGHSUR- IXQFLRQDPHQWR DXW{QRPR H WHUmR DV FRPSHWrQFLDV GH¿QLGDV HP
mover e aprimorar as práticas desportivas de rendimento. seus estatutos. 5HGDomRGDGDSHOD/HLQžGH 
3DUiJUDIR~QLFR26LVWHPD1DFLRQDOGR'HVSRUWRFRQJUHJDDV †žAs entidades nacionais de administração do desporto po-
SHVVRDVItVLFDVHMXUtGLFDVGHGLUHLWRSULYDGRFRPRXVHP¿QVOXFUD- GHUmR ¿OLDU QRV WHUPRV GH VHXV HVWDWXWRV HQWLGDGHV UHJLRQDLV GH
tivos, encarregadas da coordenação, administração, normatização, administração e entidades de prática desportiva.
apoio e prática do desporto, bem como as incumbidas da Justiça § 2º $VOLJDVSRGHUmRDVHXFULWpULR¿OLDUVHRXYLQFXODUVHD
'HVSRUWLYDHHVSHFLDOPHQWH 5HGDomRGDGDSHOD/HLQžGH entidades nacionais de administração do desporto, vedado a estas,
  VRETXDOTXHUSUHWH[WRH[LJLUWDO¿OLDomRRXYLQFXODomR
I - o Comitê Olímpico Brasileiro-COB; † ž e IDFXOWDGD D ¿OLDomR GLUHWD GH DWOHWDV QRV WHUPRV
II - o Comitê Paraolímpico Brasileiro; previstos nos estatutos das respectivas entidades de administração
III - as entidades nacionais de administração do desporto; do desporto.
IV - as entidades regionais de administração do desporto;
V - as ligas regionais e nacionais; $UW 9(7$'2
9,DVHQWLGDGHVGHSUiWLFDGHVSRUWLYD¿OLDGDVRXQmRjTXHODV
referidas nos incisos anteriores. $UW  6RPHQWH VHUmR EHQH¿FLDGDV FRP LVHQo}HV ¿VFDLV H
VII - a Confederação Brasileira de Clubes. (Incluído pela Lei UHSDVVHVGHUHFXUVRVS~EOLFRVIHGHUDLVGDDGPLQLVWUDomRGLUHWDHLQ-
QžGH  GLUHWDQRVWHUPRVGRLQFLVR,,GRDUWGD&RQVWLWXLomR)HGHUDO
as entidades do Sistema Nacional do Desporto que:
$UW2&RPLWr2OtPSLFR%UDVLOHLUR&2%R&RPLWr3DUDR- ,SRVVXtUHPYLDELOLGDGHHDXWRQRPLD¿QDQFHLUDV
límpico Brasileiro - CPB e as entidades nacionais de administração do ,, 5HYRJDGRSHOD/HLQžGH 
GHVSRUWRTXHOKHVVmR¿OLDGDVRXYLQFXODGDVFRQVWLWXHPVXEVLVWHPD
III - atendam aos demais requisitos estabelecidos em lei;
HVSHFt¿FRGR6LVWHPD1DFLRQDOGR'HVSRUWR 5HGDomRGDGDSHOD
,9HVWLYHUHPHPVLWXDomRUHJXODUFRPVXDVREULJDo}HV¿V-
/HLQžGH 
FDLVHWUDEDOKLVWDV 5HGDomRGDGDSHOD/HLQžGH 
†ž$SOLFDVHDRVFRPLWrVHjVHQWLGDGHVUHIHULGDVQRcaput o
V - demonstrem compatibilidade entre as ações desenvolvidas
GLVSRVWRQRLQFLVR,,GRDUWGD&RQVWLWXLomR)HGHUDOGHVGHTXH
para a melhoria das respectivas modalidades desportivas e o Plano
seus estatutos estejam plenamente de acordo com as disposições cons-
1DFLRQDOGR'HVSRUWR 5HGDomRGDGDSHOD/HLQžGH
titucionais e legais aplicáveis. ,QFOXtGRSHOD/HLQžGH 
 
§ 2º Compete ao Comitê Olímpico Brasileiro - COB e ao
Comitê Paraolímpico Brasileiro - CPB o planejamento das atividades 3DUiJUDIR~QLFR$YHUL¿FDomRGRFXPSULPHQWRGDVH[LJrQ-
GRHVSRUWHGHVHXVVXEVLVWHPDVHVSHFt¿FRV(Incluído pela Lei nº cias contidas nos incisos I a V deste artigo será de responsabilidade
GH  GR0LQLVWpULRGR(VSRUWH 5HGDomRGDGDSHOD/HLQž
GH 
$UW$R&RPLWr2OtPSLFR%UDVLOHLUR&2%HQWLGDGHMXUtGLFD
de direito privado, compete representar o País nos eventos olímpicos, $UW$6HPSUHMXt]RGRGLVSRVWRQRDUWDVHQWLGDGHV
pan-americanos e outros de igual natureza, no Comitê Olímpico In- VHP¿QVOXFUDWLYRVFRPSRQHQWHVGR6LVWHPD1DFLRQDOGR'HVSRU-
ternacional e nos movimentos olímpicos internacionais, e fomentar o WR UHIHULGDV QR SDUiJUDIR ~QLFR GR DUW  VRPHQWH SRGHUmR UH-
movimento olímpico no território nacional, em conformidade com as FHEHU UHFXUVRV GD DGPLQLVWUDomR S~EOLFD IHGHUDO GLUHWD H LQGLUHWD
disposições da Constituição Federal, bem como com as disposições FDVR ,QFOXtGRSHOD/HLQžGH 
estatutárias e regulamentares do Comitê Olímpico Internacional e da I - seu presidente ou dirigente máximo tenham o mandato de
Carta Olímpica. DWp TXDWUR DQRVSHUPLWLGD XPD ~QLFDUHFRQGXomR ,QFOXt-
†žCaberá ao Comitê Olímpico Brasileiro-COB representar o GRSHOD/HLQžGH 
ROLPSLVPREUDVLOHLURMXQWRDRVSRGHUHVS~EOLFRV II - atendam às disposições previstas nas alíneas “b” a “e”
§ 2º É privativo do Comitê Olímpico Brasileiro – COB e do Co- do § 2º e no †žGRDUWGD/HLQo GHGHGH]HPEURGH
mitê Paraolímpico Brasileiro – CPOB o uso das bandeiras, lemas,  ,QFOXtGRSHOD/HLQžGH 
hinos e símbolos olímpicos e paraolímpicos, assim como das deno- ,,,GHVWLQHPLQWHJUDOPHQWHRVUHVXOWDGRV¿QDQFHLURVjPDQX-
minações «jogos olímpicos», «olimpíadas», «jogos paraolímpicos» e tenção e ao desenvolvimento dos seus objetivos sociais; (Incluí-
©SDUDROLPStDGDVªSHUPLWLGDDXWLOL]DomRGHVWDV~OWLPDVTXDQGRVHWUD- GRSHOD/HLQžGH 
tar de eventos vinculados ao desporto educacional e de participação. IV - sejam transparentes na gestão, inclusive quanto aos da-
†ž$R&RPLWr2OtPSLFR%UDVLOHLUR&2%VmRFRQFHGLGRVRVGL- GRV HFRQ{PLFRV H ¿QDQFHLURV FRQWUDWRV SDWURFLQDGRUHV GLUHLWRV
reitos e benefícios conferidos em lei às entidades nacionais de admi- de imagem, propriedade intelectual e quaisquer outros aspectos de
nistração do desporto. JHVWmR ,QFOXtGRSHOD/HLQžGH 
†ž6mRYHGDGRVRUHJLVWURHXVRSDUDTXDOTXHU¿PGHVLQDOTXH V - garantam a representação da categoria de atletas das res-
integre o símbolo olímpico ou que o contenha, bem como do hino e SHFWLYDVPRGDOLGDGHVQRkPELWRGRVyUJmRVHFRQVHOKRVWpFQLFRV
dos lemas olímpicos, exceto mediante prévia autorização do Comitê incumbidos da aprovação de regulamentos das competições; (In-
Olímpico Brasileiro-COB. FOXtGRSHOD/HLQžGH 
†žAplicam-se ao Comitê Paraolímpico Brasileiro, no que cou- VI - assegurem a existência e a autonomia do seu conselho
ber, as disposições previstas neste artigo. ¿VFDO ,QFOXtGRSHOD/HLQžGH 

Didatismo e Conhecimento 15
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
VII - estabeleçam em seus estatutos: (Incluído pela Lei nº § 2º As entidades de prática desportiva que organizarem ligas,
GH  na forma do caput deste artigo, comunicarão a criação destas às
D  SULQFtSLRV GH¿QLGRUHV GH JHVWmR GHPRFUiWLFD   ,QFOXtGR entidades nacionais de administração do desporto das respectivas
SHOD/HLQžGH  modalidades.
b) instrumentos de controle social; (Incluído pela Lei nº †žAs ligas integrarão os sistemas das entidades nacionais
GH  de administração do desporto que incluírem suas competições nos
c) transparência da gestão da movimentação de recursos; (In- UHVSHFWLYRVFDOHQGiULRVDQXDLVGHHYHQWRVR¿FLDLV
FOXtGRSHOD/HLQžGH  †žNa hipótese prevista no caput deste artigo, é facultado às
G ¿VFDOL]DomRLQWHUQD ,QFOXtGRSHOD/HLQžGH  entidades de prática desportiva participarem, também, de campeo-
H DOWHUQkQFLDQRH[HUFtFLRGRVFDUJRVGHGLUHomR ,QFOXtGR natos nas entidades de administração do desporto a que estiverem
SHOD/HLQžGH  ¿OLDGDV
f) aprovação das prestações de contas anuais por conselho de † ž e YHGDGD TXDOTXHU LQWHUYHQomR GDV HQWLGDGHV GH DGPL-
nistração do desporto nas ligas que se mantiverem independentes.
GLUHomRSUHFHGLGDSRUSDUHFHUGRFRQVHOKR¿VFDOH ,QFOXtGRSHOD
† ž As ligas formadas por entidades de prática desportiva
/HLQžGH 
HQYROYLGDVHPFRPSHWLo}HVGHDWOHWDVSUR¿VVLRQDLVHTXLSDUDPVH
g) participação de atletas nos colegiados de direção e na elei-
SDUD¿QVGRFXPSULPHQWRGRGLVSRVWRQHVWD/HLjVHQWLGDGHVGH
omRSDUDRVFDUJRVGDHQWLGDGHH ,QFOXtGRSHOD/HLQž
administração do desporto.
GH  †žAs entidades nacionais de administração de desporto se-
9,,,JDUDQWDPDWRGRVRVDVVRFLDGRVH¿OLDGRVDFHVVRLUUHVWUL- rão responsáveis pela organização dos calendários anuais de even-
to aos documentos e informações relativos à prestação de contas, WRVR¿FLDLVGDVUHVSHFWLYDVPRGDOLGDGHV
bem como àqueles relacionados à gestão da respectiva entidade $UW$VHQWLGDGHVGHSUiWLFDGHVSRUWLYDSRGHUmR¿OLDUVH
de administração do desporto, os quais deverão ser publicados na em cada modalidade, à entidade de administração do desporto do
tQWHJUDQRVtWLRHOHWU{QLFRGHVWD ,QFOXtGRSHOD/HLQžGH Sistema Nacional do Desporto, bem como à correspondente enti-
  dade de administração do desporto de um dos sistemas regionais.
†ž$VHQWLGDGHVGHSUiWLFDGHVSRUWLYDHVWmRGLVSHQVDGDVGDV Art. 22. Os processos eleitorais assegurarão:
condições previstas: ,QFOXtGRSHOD/HLQžGH  ,FROpJLRHOHLWRUDOFRQVWLWXtGRGHWRGRVRV¿OLDGRVQRJR]R
I - no inciso V do caput ,QFOXtGRSHOD/HLQžGH de seus direitos, admitida a diferenciação de valor dos seus votos;
  II - defesa prévia, em caso de impugnação, do direito de par-
II - na alínea “g” do inciso VII do caput; e (Incluído pela Lei ticipar da eleição;
QžGH  III - eleição convocada mediante edital publicado em órgão da
III - no inciso VIII do caput, quanto aos contratos comerciais imprensa de grande circulação, por três vezes;
FHOHEUDGRVFRPFOiXVXODGHFRQ¿GHQFLDOLGDGHUHVVDOYDGDVQHVWH IV - sistema de recolhimento dos votos imune a fraude;
FDVRDFRPSHWrQFLDGH¿VFDOL]DomRGRFRQVHOKR¿VFDOHDREULJD- V - acompanhamento da apuração pelos candidatos e meios
ção do correto registro contábil de receita e despesa deles decor- de comunicação.
UHQWH ,QFOXtGRSHOD/HLQžGH  3DUiJUDIR~QLFR1DKLSyWHVHGDDGRomRGHFULWpULRGLIHUHQFLD-
†ž$YHUL¿FDomRGRFXPSULPHQWRGDVH[LJrQFLDVFRQWLGDV do de valoração dos votos, este não poderá exceder à proporção de
nos incisos I a VIII do caput deste artigo será de responsabilidade um para seis entre o de menor e o de maior valor.
GR0LQLVWpULRGR(VSRUWH ,QFOXtGRSHOD/HLQžGH 
†ž3DUD¿QVGRGLVSRVWRQRLQFLVR,GRcaput: (Incluído pela $UW2VHVWDWXWRVGDVHQWLGDGHVGHDGPLQLVWUDomRGRGHV-
/HLQžGH  porto, elaborados de conformidade com esta Lei, deverão obriga-
toriamente regulamentar, no mínimo:
I - será respeitado o período de mandato do presidente ou diri-
I - instituição do Tribunal de Justiça Desportiva, nos termos
gente máximo eleitos antes da vigência desta Lei; (Incluído pela
desta Lei;
/HLQžGH 
II - inelegibilidade de seus dirigentes para desempenho de car-
II - são inelegíveis o cônjuge e os parentes consanguíneos ou
gos e funções eletivas ou de livre nomeação de:
D¿QVDWpRo (segundo) grau ou por adoção. (Incluído pela Lei nº D FRQGHQDGRVSRUFULPHGRORVRHPVHQWHQoDGH¿QLWLYD
GH  E LQDGLPSOHQWHVQDSUHVWDomRGHFRQWDVGHUHFXUVRVS~EOLFRV
†ž$SDUWLUGRo (sexto) mês contado da publicação desta HPGHFLVmRDGPLQLVWUDWLYDGH¿QLWLYD
Lei, as entidades referidas no caput deste artigo somente farão jus c) inadimplentes na prestação de contas da própria entidade;
DRGLVSRVWRQRDUWGD/HLQo GHGHGH]HPEURGH G  DIDVWDGRV GH FDUJRV HOHWLYRV RX GH FRQ¿DQoD GH HQWLGDGH
H QRV DUWV  H  GD 0HGLGD 3URYLVyULD Qo  GH  GH GHVSRUWLYDRXHPYLUWXGHGHJHVWmRSDWULPRQLDORX¿QDQFHLUDLUUH-
DJRVWRGHFDVRFXPSUDPRVUHTXLVLWRVGLVSRVWRVQRVLQFLVRV gular ou temerária da entidade;
I a VIII do caput ,QFOXtGRSHOD/HLQžGH  e) inadimplentes das contribuições previdenciárias e traba-
lhistas;
$UW 9(7$'2 f) falidos.
3DUiJUDIR ~QLFR ,QGHSHQGHQWHPHQWH GH SUHYLVmR HVWDWXWiULD
$UW $V HQWLGDGHV GH SUiWLFD GHVSRUWLYD SDUWLFLSDQWHV GH é obrigatório o afastamento preventivo e imediato dos dirigentes,
competições do Sistema Nacional do Desporto poderão organizar eleitos ou nomeados, caso incorram em qualquer das hipóteses do
ligas regionais ou nacionais. inciso II, assegurado o processo regular e a ampla defesa para a
†ž(VETADO) destituição.

Didatismo e Conhecimento 16
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW$VSUHVWDo}HVGHFRQWDVDQXDLVGHWRGDVDVHQWLGDGHV ,UHDOL]DUWRGRVRVDWRVQHFHVViULRVSDUDSHUPLWLUDLGHQWL¿FD-
de administração integrantes do Sistema Nacional do Desporto omRH[DWDGHVXDVLWXDomR¿QDQFHLUD
serão obrigatoriamente submetidas, com parecer dos Conselhos II - apresentar plano de resgate e plano de investimento;
)LVFDLVjVUHVSHFWLYDVDVVHPEOpLDVJHUDLVSDUDDDSURYDomR¿QDO ,,,JDUDQWLUDLQGHSHQGrQFLDGHVHXVFRQVHOKRVGH¿VFDOL]DomR
3DUiJUDIR~QLFR7RGRVRVLQWHJUDQWHVGDVDVVHPEOpLDVJHUDLV e administração, quando houver;
terão acesso irrestrito aos documentos, informações e comprovan- ,9DGRWDUPRGHORSUR¿VVLRQDOHWUDQVSDUHQWHH
tes de despesas de contas de que trata este artigo. 9DSUHVHQWDUVXDVGHPRQVWUDo}HV¿QDQFHLUDVMXQWDPHQWHFRP
RVUHVSHFWLYRVUHODWyULRVGHDXGLWRULDQRVWHUPRVGH¿QLGRVQRLQFLVR
SEÇÃO V ,GRDUW$GHVWD/HL 5HGDomRGDGDSHOD/HLQžGH
DOS SISTEMAS DO DESPORTO DOS ESTADOS, DO DIS-  
TRITO FEDERAL E DOS MUNICÍPIOS †ž2VUHFXUVRVGR¿QDQFLDPHQWRYROWDGRVjLPSOHPHQWDomRGR
(REDAÇÃO DADA PELA LEI Nº 12.395, DE 2011). plano de resgate serão utilizados:
,SULRULWDULDPHQWHSDUDTXLWDomRGHGpELWRV¿VFDLVSUHYLGHQ-
$UW2V(VWDGRVHR'LVWULWR)HGHUDOFRQVWLWXLUmRVHXVSUy- ciários e trabalhistas; e
prios sistemas, respeitadas as normas estabelecidas nesta Lei e a II - subsidiariamente, para construção ou melhoria de estádio
REVHUYkQFLDGRSURFHVVRHOHLWRUDO SUySULRRXGHTXHVHXWLOL]DPSDUDPDQGRGHVHXVMRJRVFRPD¿-
3DUiJUDIR~QLFR$RV0XQLFtSLRVpIDFXOWDGRFRQVWLWXLUVLVWH- QDOLGDGHGHDWHQGHUDFULWpULRVGHVHJXUDQoDVD~GHHEHPHVWDUGR
mas próprios de desporto, observado o disposto nesta Lei e, no que torcedor.
couber, na legislação do respectivo Estado. (Redação dada pela †žNa hipótese do inciso II do †ž, a entidade de prática des-
/HLQžGH  SRUWLYDGHYHUiDSUHVHQWDUjLQVWLWXLomR¿QDQFLDGRUDRRUoDPHQWRGDV
obras pretendidas.
CAPÍTULO V † ž e IDFXOWDGR jV HQWLGDGHV GHVSRUWLYDV SUR¿VVLRQDLV
DA PRÁTICA DESPORTIVA PROFISSIONAL constituírem-se regularmente em sociedade empresária, segundo
um dos tipos regulados nos DUWVDGD/HLQžGH
GHMDQHLURGH&yGLJR&LYLO
$UW $WOHWDV H HQWLGDGHV GH SUiWLFD GHVSRUWLYD VmR OLYUHV
†  &RQVLGHUDVH HQWLGDGH GHVSRUWLYD SUR¿VVLRQDO SDUD
SDUDRUJDQL]DUDDWLYLGDGHSUR¿VVLRQDOTXDOTXHUTXHVHMDVXDPR-
¿QV GHVWD /HL DV HQWLGDGHV GH SUiWLFD GHVSRUWLYD HQYROYLGDV HP
dalidade, respeitados os termos desta Lei.
FRPSHWLo}HVGHDWOHWDVSUR¿VVLRQDLVDVOLJDVHPTXHVHRUJDQL]DUHP
3DUiJUDIR ~QLFR &RQVLGHUDVH FRPSHWLomR SUR¿VVLRQDO SDUD
HDVHQWLGDGHVGHDGPLQLVWUDomRGHGHVSRUWRSUR¿VVLRQDO
os efeitos desta Lei aquela promovida para obter renda e disputada
†2VDGPLQLVWUDGRUHVGHHQWLGDGHVGHVSRUWLYDVSUR¿VVLRQDLV
SRUDWOHWDVSUR¿VVLRQDLVFXMDUHPXQHUDomRGHFRUUDGHFRQWUDWRGH
respondem solidária e ilimitadamente pelos atos ilícitos praticados,
trabalho desportivo.
de gestão temerária ou contrários ao previsto no contrato social ou
estatuto, nos termos da /HLQžGHGHMDQHLURGH&y-
$UW $V HQWLGDGHV GH SUiWLFD GHVSRUWLYD SDUWLFLSDQWHV GH
GLJR&LYLO 5HGDomRGDGDSHOD/HLQžGH 
FRPSHWLo}HV SUR¿VVLRQDLV H DV HQWLGDGHV GH DGPLQLVWUDomR GH †(VETADO)
desporto ou ligas em que se organizarem, independentemente da †3DUDRV¿QVGH¿VFDOL]DomRHFRQWUROHGRGLVSRVWRQHVWD
forma jurídica adotada, sujeitam os bens particulares de seus diri- /HLDVDWLYLGDGHVSUR¿VVLRQDLVGDVHQWLGDGHVGHTXHWUDWDRFDSXW
JHQWHVDRGLVSRVWRQRDUWGD/HLQo GHGHMDQHLURGH deste artigo, independentemente da forma jurídica sob a qual estejam
DOpPGDVVDQo}HVHUHVSRQVDELOLGDGHVSUHYLVWDVQRcaput do constituídas, equiparam-se às das sociedades empresárias. (Reda-
DUWGD/HLQo GHGHMDQHLURGHQDKLSyWHVH omRGDGDSHOD/HLQžGH 
de aplicarem créditos ou bens sociais da entidade desportiva em
proveito próprio ou de terceiros. $UW$1HQKXPDSHVVRDItVLFDRXMXUtGLFDTXHGLUHWDRXLQ-
†ž SDUiJUDIR~QLFRRULJLQDO  5HYRJDGR  diretamente, seja detentora de parcela do capital com direito a voto
§ 2º A entidade a que se refere este artigo não poderá utilizar ou, de qualquer forma, participe da administração de qualquer en-
seus bens patrimoniais, desportivos ou sociais para integralizar sua WLGDGHGHSUiWLFDGHVSRUWLYDSRGHUiWHUSDUWLFLSDomRVLPXOWkQHDQR
parcela de capital ou oferecê-los como garantia, salvo com a con- capital social ou na gestão de outra entidade de prática desportiva
FRUGkQFLDGDPDLRULDDEVROXWDGDDVVHPEOpLDJHUDOGRVDVVRFLDGRV GLVSXWDQWHGDPHVPDFRPSHWLomRSUR¿VVLRQDO
e na conformidade do respectivo estatuto. †žeYHGDGRTXHGXDVRXPDLVHQWLGDGHVGHSUiWLFDGHVSRUWLYD
†ž(Revogado) GLVSXWHPDPHVPDFRPSHWLomRSUR¿VVLRQDOGDVSULPHLUDVVpULHVRX
†ž(Revogado) divisões das diversas modalidades desportivas quando:
†ž2GLVSRVWRQRDUWDSOLFDVHQRTXHFRXEHUjVHQWLGD- a) uma mesma pessoa física ou jurídica, direta ou indiretamen-
des a que se refere o caput deste artigo. te, através de relação contratual, explore, controle ou administre di-
† ž 6HP SUHMXt]R GH RXWURV UHTXLVLWRV SUHYLVWRV HP OHL DV reitos que integrem seus patrimônios; ou,
entidades de que trata o caput deste artigo somente poderão obter b) uma mesma pessoa física ou jurídica, direta ou indiretamen-
¿QDQFLDPHQWR FRP UHFXUVRV S~EOLFRV RX ID]HU MXV D SURJUDPDV te, seja detentora de parcela do capital com direito a voto ou, de
GH UHFXSHUDomR HFRQ{PLFR¿QDQFHLURV VH FXPXODWLYDPHQWH qualquer forma, participe da administração de mais de uma socie-
atenderem às seguintes condições: (Redação dada pela Lei nº dade ou associação que explore, controle ou administre direitos que
GH  integrem os seus patrimônios.

Didatismo e Conhecimento 17
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
§ 2º A vedação de que trata este artigo aplica-se: $UW$DWLYLGDGHGRDWOHWDSUR¿VVLRQDOpFDUDFWHUL]DGDSRU
a) ao cônjuge e aos parentes até o segundo grau das pessoas remuneração pactuada em contrato especial de trabalho desportivo,
físicas; e ¿UPDGRFRPHQWLGDGHGHSUiWLFDGHVSRUWLYDQRTXDOGHYHUiFRQVWDU
b) às sociedades controladoras, controladas e coligadas das REULJDWRULDPHQWH 5HGDomRGDGDSHOD/HLQžGH 
mencionadas pessoas jurídicas, bem como a fundo de investimento, I - cláusula indenizatória desportiva, devida exclusivamente à
condomínio de investidores ou outra forma assemelhada que resulte entidade de prática desportiva à qual está vinculado o atleta, nas
na participação concomitante vedada neste artigo. VHJXLQWHVKLSyWHVHV ,QFOXtGRSHOD/HLQžGH 
†žExcluem-se da vedação de que trata este artigo os contra- a) transferência do atleta para outra entidade, nacional ou es-
tos de administração e investimentos em estádios, ginásios e pra- trangeira, durante a vigência do contrato especial de trabalho des-
ças desportivas, de patrocínio, de licenciamento de uso de marcas e SRUWLYRRX ,QFOXtGRSHOD/HLQžGH 
símbolos, de publicidade e de propaganda, desde que não importem E SRURFDVLmRGRUHWRUQRGRDWOHWDjVDWLYLGDGHVSUR¿VVLRQDLV
na administração direta ou na co-gestão das atividades desportivas HPRXWUDHQWLGDGHGHSUiWLFDGHVSRUWLYDQRSUD]RGHDWp WULQWD 
SUR¿VVLRQDLV GDV HQWLGDGHV GH SUiWLFD GHVSRUWLYD DVVLP FRPR RV
PHVHVH ,QFOXtGRSHOD/HLQžGH 
contratos individuais ou coletivos que sejam celebrados entre as de-
II - cláusula compensatória desportiva, devida pela entidade de
tentoras de concessão, permissão ou autorização para exploração de
prática desportiva ao atleta, nas hipóteses dos incisos III a V do §
serviços de radiodifusão sonora e de sons e imagens, bem como de
ž ,QFOXtGRSHOD/HLQžGH 
WHOHYLVmRSRUDVVLQDWXUDHHQWLGDGHVGHSUiWLFDGHVSRUWLYDSDUD¿QV
de transmissão de eventos desportivos. †ž2YDORUGDFOiXVXODLQGHQL]DWyULDGHVSRUWLYDDTXHVHUHIHUH
†žA infringência a este artigo implicará a inabilitação da en- o inciso I do caput deste artigo será livremente pactuado pelas partes
tidade de prática desportiva para percepção dos benefícios de que HH[SUHVVDPHQWHTXDQWL¿FDGRQRLQVWUXPHQWRFRQWUDWXDO5HGDomR
WUDWDRDUWGHVWD/HL GDGDSHOD/HLQžGH 
†žAs empresas detentoras de concessão, permissão ou autori- ,DWpROLPLWHPi[LPRGH GXDVPLO YH]HVRYDORUPpGLR
zação para exploração de serviço de radiodifusão sonora e de sons e do salário contratual, para as transferências nacionais; e (Incluído
LPDJHQVEHPFRPRGHWHOHYLVmRSRUDVVLQDWXUD¿FDPLPSHGLGDVGH SHOD/HLQžGH 
patrocinar ou veicular sua própria marca, bem como a de seus canais II - sem qualquer limitação, para as transferências internacio-
e dos títulos de seus programas, nos uniformes de competições das QDLV ,QFOXtGRSHOD/HLQžGH 
entidades desportivas. § 2º São solidariamente responsáveis pelo pagamento da
†žA violação do disposto no †žimplicará a eliminação da cláusula indenizatória desportiva de que trata o inciso I do caput
entidade de prática desportiva que lhe deu causa da competição ou deste artigo o atleta e a nova entidade de prática desportiva
GRWRUQHLRHPTXHDTXHODVHYHUL¿FRXVHPSUHMXt]RGDVSHQDOLGDGHV empregadora. 5HGDomRGDGDSHOD/HLQžGH 
que venham a ser aplicadas pela Justiça Desportiva. , 5HYRJDGRSHOD/HLQžGH 
,, 5HYRJDGRSHOD/HLQžGH 
$UW%6mRQXODVGHSOHQRGLUHLWRDVFOiXVXODVGHFRQWUDWRV ,,, 5HYRJDGRSHOD/HLQžGH 
¿UPDGRVHQWUHDVHQWLGDGHVGHSUiWLFDGHVSRUWLYDHWHUFHLURVRXHQWUH † ž 2 YDORU GD FOiXVXOD FRPSHQVDWyULD GHVSRUWLYD D TXH VH
HVWHVHDWOHWDVTXHSRVVDPLQWHUYLURXLQÀXHQFLDUQDVWUDQVIHUrQFLDV refere o inciso II do caput deste artigo será livremente pactuado
GHDWOHWDVRXDLQGDTXHLQWHU¿UDPQRGHVHPSHQKRGRDWOHWDRXGD entre as partes e formalizado no contrato especial de trabalho
entidade de prática desportiva, exceto quando objeto de acordo ou GHVSRUWLYRREVHUYDQGRVHFRPROLPLWHPi[LPR TXDWURFHQWDV 
FRQYHQomRFROHWLYDGHWUDEDOKR ,QFOXtGRSHOD/HLQžGH vezes o valor do salário mensal no momento da rescisão e, como
  limite mínimo, o valor total de salários mensais a que teria direito o
$UW &  6mR QXORV GH SOHQR GLUHLWR RV FRQWUDWRV ¿UPDGRV atleta até o término do referido contrato. (Redação dada pela Lei
pelo atleta ou por seu representante legal com agente desportivo,
QžGH 
pessoa física ou jurídica, bem como as cláusulas contratuais ou de
† ž $SOLFDPVH DR DWOHWD SUR¿VVLRQDO DV QRUPDV JHUDLV
LQVWUXPHQWRVSURFXUDWyULRVTXH ,QFOXtGRSHOD/HLQžGH
da legislação trabalhista e da Seguridade Social, ressalvadas
 
as peculiaridades constantes desta Lei, especialmente as
,UHVXOWHPYtQFXORGHVSRUWLYR ,QFOXtGRSHOD/HLQž
GH  seguintes: 5HGDomRGDGDSHOD/HLQžGH 
II - impliquem vinculação ou exigência de receita total ou I - se conveniente à entidade de prática desportiva, a concentra-
parcial exclusiva da entidade de prática desportiva, decorrente de omRQmRSRGHUiVHUVXSHULRUD WUrV GLDVFRQVHFXWLYRVSRUVHPDQD
transferência nacional ou internacional de atleta, em vista da exclu- desde que esteja programada qualquer partida, prova ou equivalente,
VLYLGDGHGHTXHWUDWDRLQFLVR,GRDUW ,QFOXtGRSHOD/HLQž DPLVWRVDRXR¿FLDOGHYHQGRRDWOHWD¿FDUjGLVSRVLomRGRHPSUHJD-
GH  dor por ocasião da realização de competição fora da localidade onde
III - restrinjam a liberdade de trabalho desportivo; (Incluído WHQKDVXDVHGH 5HGDomRGDGDSHOD/HLQžGH 
SHOD/HLQžGH  II - o prazo de concentração poderá ser ampliado, independen-
IV - estabeleçam obrigações consideradas abusivas ou despro- temente de qualquer pagamento adicional, quando o atleta estiver
SRUFLRQDLV ,QFOXtGRSHOD/HLQžGH  à disposição da entidade de administração do desporto; (Redação
9LQIULQMDPRVSULQFtSLRVGDERDIpREMHWLYDRXGR¿PVRFLDO GDGDSHOD/HLQžGH 
GRFRQWUDWRRX ,QFOXtGRSHOD/HLQžGH  III - acréscimos remuneratórios em razão de períodos de con-
VI - versem sobre o gerenciamento de carreira de atleta em for- centração, viagens, pré-temporada e participação do atleta em parti-
PDomRFRPLGDGHLQIHULRUD GH]RLWR DQRV ,QFOXtGRSHOD/HL da, prova ou equivalente, conforme previsão contratual; (Redação
QžGH  GDGDSHOD/HLQžGH 

Didatismo e Conhecimento 18
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
,9UHSRXVRVHPDQDOUHPXQHUDGRGH YLQWHHTXDWUR KRUDV †ž$¿OLDomRRXDYLQFXODomRGHDWOHWDDXW{QRPRDHQWLGDGH
ininterruptas, preferentemente em dia subsequente à participação do de administração ou a sua integração a delegações brasileiras
DWOHWDQDSDUWLGDSURYDRXHTXLYDOHQWHTXDQGRUHDOL]DGDQR¿QDOGH partícipes de competições internacionais não caracteriza vínculo
VHPDQD 5HGDomRGDGDSHOD/HLQžGH  empregatício. ,QFOXtGRSHOD/HLQžGH 
9IpULDVDQXDLVUHPXQHUDGDVGH WULQWD GLDVDFUHVFLGDVGR † ž 2 GLVSRVWR QHVWH DUWLJR QmR VH DSOLFD jV PRGDOLGDGHV
abono de férias, coincidentes com o recesso das atividades desporti- desportivas coletivas. ,QFOXtGRSHOD/HLQžGH 
YDV ,QFOXtGRSHOD/HLQžGH  $UW$HQWLGDGHGHSUiWLFDGHVSRUWLYDIRUPDGRUDGRDWOHWD
9,MRUQDGDGHWUDEDOKRGHVSRUWLYDQRUPDOGH TXDUHQWDH WHUiRGLUHLWRGHDVVLQDUFRPHOHDSDUWLUGH GH]HVVHLV DQRVGH
TXDWUR KRUDVVHPDQDLV ,QFOXtGRSHOD/HLQžGH  idade, o primeiro contrato especial de trabalho desportivo, cujo pra-
†ž2YtQFXORGHVSRUWLYRGRDWOHWDFRPDHQWLGDGHGHSUiWLFD ]RQmRSRGHUiVHUVXSHULRUD FLQFR DQRV 5HGDomRGDGDSHOD
desportiva contratante constitui-se com o registro do contrato /HLQžGH 
especial de trabalho desportivo na entidade de administração 3DUiJUDIR~QLFR 9(7$'2
do desporto, tendo natureza acessória ao respectivo vínculo § 2º É considerada formadora de atleta a entidade de prática
empregatício, dissolvendo-se, para todos os efeitos legais: (Reda- desportiva que: 5HGDomRGDGDSHOD/HLQžGH 
omRGDGDSHOD/HLQžGH  I - forneça aos atletas programas de treinamento nas categorias
I - com o término da vigência do contrato ou o seu distra- de base e complementação educacional; e (Incluído pela Lei nº
WR ,QFOXtGRSHOD/HLQžGH  GH 
II - com o pagamento da cláusula indenizatória desportiva ou da II - satisfaça cumulativamente os seguintes requisitos: (Incluído
FOiXVXODFRPSHQVDWyULDGHVSRUWLYD ,QFOXtGRSHOD/HLQž SHOD/HLQžGH 
GH  a) estar o atleta em formação inscrito por ela na respectiva enti-
III - com a rescisão decorrente do inadimplemento salarial, de GDGHUHJLRQDOGHDGPLQLVWUDomRGRGHVSRUWRKiSHORPHQRV XP 
responsabilidade da entidade de prática desportiva empregadora, DQR ,QFOXtGRSHOD/HLQžGH 
QRVWHUPRVGHVWD/HL ,QFOXtGRSHOD/HLQžGH  b) comprovar que, efetivamente, o atleta em formação está
IV - com a rescisão indireta, nas demais hipóteses previstas na LQVFULWR HP FRPSHWLo}HV R¿FLDLV ,QFOXtGR SHOD /HL Qž  GH
OHJLVODomRWUDEDOKLVWDH ,QFOXtGRSHOD/HLQžGH 
 
V - com a dispensa imotivada do atleta. (Incluído pela Lei nº
c) garantir assistência educacional, psicológica, médica e odon-
GH 
tológica, assim como alimentação, transporte e convivência fami-
†ž(Revogado)
OLDU ,QFOXtGRSHOD/HLQžGH 
† ž $ HQWLGDGH GH SUiWLFD GHVSRUWLYD SRGHUi VXVSHQGHU R
d) manter alojamento e instalações desportivas adequados, so-
FRQWUDWR HVSHFLDO GH WUDEDOKR GHVSRUWLYR GR DWOHWD SUR¿VVLRQDO
bretudo em matéria de alimentação, higiene, segurança e salubrida-
¿FDQGR GLVSHQVDGD GR SDJDPHQWR GD UHPXQHUDomR QHVVH SHUtRGR
GH ,QFOXtGRSHOD/HLQžGH 
quando o atleta for impedido de atuar, por prazo ininterrupto
VXSHULRUD QRYHQWD GLDVHPGHFRUUrQFLDGHDWRRXHYHQWRGHVXD H  PDQWHU FRUSR GH SUR¿VVLRQDLV HVSHFLDOL]DGRV HP IRUPDomR
exclusiva responsabilidade, desvinculado da DWLYLGDGHSUR¿VVLRQDO WHFQLFRGHVSRUWLYD ,QFOXtGRSHOD/HLQžGH 
conforme previsto no referido contrato. (Redação dada pela Lei f) ajustar o tempo destinado à efetiva atividade de formação
QžGH  GRDWOHWDQmRVXSHULRUD TXDWUR KRUDVSRUGLDDRVKRUiULRVGR
†ž2FRQWUDWRHVSHFLDOGHWUDEDOKRGHVSRUWLYRGHYHUiFRQWHU FXUUtFXORHVFRODURXGHFXUVRSUR¿VVLRQDOL]DQWHDOpPGHSURSLFLDU-
cláusula expressa reguladora de sua prorrogação automática na -lhe a matrícula escolar, com exigência de frequência e satisfatório
RFRUUrQFLDGDKLSyWHVHSUHYLVWDQR†ž deste artigo. (Incluído pela DSURYHLWDPHQWR ,QFOXtGRSHOD/HLQžGH 
/HLQžGH  g) ser a formação do atleta gratuita e a expensas da entidade de
†ž4XDQGRRFRQWUDWRHVSHFLDOGHWUDEDOKRGHVSRUWLYRIRUSRU SUiWLFDGHVSRUWLYD ,QFOXtGRSHOD/HLQžGH 
SUD]RLQIHULRUD GR]H PHVHVRDWOHWDSUR¿VVLRQDOWHUiGLUHLWR h) comprovar que participa anualmente de competições organi-
por ocasião da rescisão contratual por culpa da entidade de prática zadas por entidade de administração do desporto em, pelo menos, 2
desportiva empregadora, a tantos doze avos da remuneração mensal (duas) categorias da respectiva modalidade desportiva; e (Incluído
quantos forem os meses da vigência do contrato, referentes a férias, SHOD/HLQžGH 
DERQRGHIpULDVHR GpFLPRWHUFHLUR VDOiULR(Incluído pela Lei i) garantir que o período de seleção não coincida com os horá-
QžGH  ULRVHVFRODUHV ,QFOXtGRSHOD/HLQžGH 
†1mRVHDSOLFDPDRFRQWUDWRHVSHFLDOGHWUDEDOKRGHVSRUWLYR † ž $ HQWLGDGH QDFLRQDO GH DGPLQLVWUDomR GR GHVSRUWR
os DUWVHGD&RQVROLGDomRGDV/HLVGR7UDEDOKR&/7DSUR- FHUWL¿FDUi FRPR HQWLGDGH GH SUiWLFD GHVSRUWLYD IRUPDGRUD DTXHOD
YDGDSHOR'HFUHWR/HLQžGHžGHPDLRGH ,QFOXtGR que comprovadamente preencha os requisitos estabelecidos nesta
SHOD/HLQžGH  Lei. 5HGDomRGDGDSHOD/HLQžGH 
$UW$&DUDFWHUL]DVHFRPRDXW{QRPRRDWOHWDPDLRUGH †ž2DWOHWDQmRSUR¿VVLRQDOHPIRUPDomRPDLRUGHTXDWRU]H
(dezesseis) anos que não mantém relação empregatícia com enti- HPHQRUGHYLQWHDQRVGHLGDGHSRGHUiUHFHEHUDX[tOLR¿QDQFHLURGD
dade de prática desportiva, auferindo rendimentos por conta e por entidade de prática desportiva formadora, sob a forma de bolsa de
PHLRGHFRQWUDWRGHQDWXUH]DFLYLO ,QFOXtGRSHOD/HLQž aprendizagem livremente pactuada mediante contrato formal, sem
GH  que seja gerado vínculo empregatício entre as partes.
†ž2YtQFXORGHVSRUWLYRGRDWOHWDDXW{QRPRFRPDHQWLGDGHGH † ž $ HQWLGDGH GH SUiWLFD GHVSRUWLYD IRUPDGRUD IDUi MXV D
prática desportiva resulta de inscrição para participar de competição YDORU LQGHQL]DWyULR VH ¿FDU LPSRVVLELOLWDGD GH DVVLQDU R SULPHLUR
e não implica reconhecimento de relação empregatícia. (Incluído contrato especial de trabalho desportivo por oposição do atleta,
SHOD/HLQžGH  ou quando ele se vincular, sob qualquer forma, a outra entidade de

Didatismo e Conhecimento 19
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
prática desportiva, sem autorização expressa da entidade de prática II - a entidade proponente deverá dar conhecimento da propos-
desportiva formadora, atendidas as seguintes condições: (Redação ta à correspondente entidade regional de administração; e (Incluído
GDGDSHOD/HLQžGH  SHOD/HLQžGH 
I - o atleta deverá estar regularmente registrado e não pode ter III - a entidade de prática desportiva formadora poderá, no pra-
sido desligado da entidade de prática desportiva formadora; (Incluí- ]RPi[LPRGH TXLQ]H GLDVDFRQWDUGRUHFHELPHQWRGDSURSRV-
GRSHOD/HLQžGH  ta, comunicar se exercerá o direito de preferência de que trata o §
II - a indenização será limitada ao montante correspondente a žQDVPHVPDVFRQGLo}HVRIHUHFLGDV ,QFOXtGRSHOD/HLQž
 GX]HQWDV YH]HVRVJDVWRVFRPSURYDGDPHQWHHIHWXDGRVFRPD GH 
IRUPDomR GR DWOHWD HVSHFL¿FDGRV QR FRQWUDWR GH TXH WUDWD R † ž †$HQWLGDGHGHDGPLQLVWUDomRGRGHVSRUWRGHYHUiSXEOLFDU
GHVWHDUWLJR ,QFOXtGRSHOD/HLQžGH  RUHFHELPHQWRGDVSURSRVWDVGHTXHWUDWDPRV††žHžQRVVHXV
III - o pagamento do valor indenizatório somente poderá ser PHLRVR¿FLDLVGHGLYXOJDomRQRSUD]RGH FLQFR GLDVFRQWDGRVGD
efetuado por outra entidade de prática desportiva e deverá ser efeti- data do recebimento. ,QFOXtGRSHOD/HLQžGH 
vado diretamente à entidade de prática desportiva formadora no pra- †&DVRDHQWLGDGHGHSUiWLFDGHVSRUWLYDIRUPDGRUDRIHUWHDV
]RPi[LPRGH TXLQ]H GLDVFRQWDGRVGDGDWDGDYLQFXODomRGR mesmas condições, e, ainda assim, o atleta se oponha à renovação
atleta à nova entidade de prática desportiva, para efeito de permitir do primeiro contrato especial de trabalho desportivo, ela poderá
novo registro em entidade de administração do desporto. (Incluído exigir da nova entidade de prática desportiva contratante o valor
SHOD/HLQžGH  LQGHQL]DWyULRFRUUHVSRQGHQWHDQRPi[LPR GX]HQWDV YH]HVR
†ž2FRQWUDWRGHIRUPDomRGHVSRUWLYDDTXHVHUHIHUHR†ž valor do salário mensal constante da proposta. (Incluído pela Lei nº
deste artigo deverá incluir obrigatoriamente: (Redação dada pela Lei GH 
QžGH  †$FRQWUDWDomRGRDWOHWDHPIRUPDomRVHUiIHLWDGLUHWDPHQWH
,LGHQWL¿FDomRGDVSDUWHVHGRVVHXVUHSUHVHQWDQWHVOHJDLV 5H- pela entidade de prática desportiva formadora, sendo vedada a sua
GDomRGDGDSHOD/HLQžGH  realização por meio de terceiros. ,QFOXtGR SHOD /HL Qž  GH
,,GXUDomRGRFRQWUDWR 5HGDomRGDGDSHOD/HLQžGH  
  †   $ HQWLGDGH GH SUiWLFD GHVSRUWLYD IRUPDGRUD GHYHUi
III - direitos e deveres das partes contratantes, inclusive garantia registrar o contrato de formação desportiva do atleta em formação na
de seguro de vida e de acidentes pessoais para cobrir as atividades entidade de administração da respectiva modalidade desportiva. (In-
GRDWOHWDFRQWUDWDGRH 5HGDomRGDGDSHOD/HLQžGH  FOXtGRSHOD/HLQžGH 
,9  HVSHFL¿FDomR GRV LWHQV GH JDVWR SDUD ¿QV GH FiOFXOR GD $UW$6HPSUHTXHRFRUUHUWUDQVIHUrQFLDQDFLRQDOGH¿QLWL-
indenização com a formação desportiva. (Redação dada pela Lei nº YDRXWHPSRUiULDGHDWOHWDSUR¿VVLRQDODWp FLQFRSRUFHQWR GR
GH  valor pago pela nova entidade de prática desportiva serão obrigato-
†ž$HQWLGDGHGHSUiWLFDGHVSRUWLYDIRUPDGRUDHGHWHQWRUDGR riamente distribuídos entre as entidades de práticas desportivas que
primeiro contrato especial de trabalho desportivo com o atleta por contribuíram para a formação do atleta, na proporção de: (Incluído
HOD SUR¿VVLRQDOL]DGR WHUi R GLUHLWR GH SUHIHUrQFLD SDUD D SULPHLUD SHOD/HLQžGH 
UHQRYDomR GHVWH FRQWUDWR FXMR SUD]R QmR SRGHUi VHU VXSHULRU D  , XPSRUFHQWR SDUDFDGDDQRGHIRUPDomRGRDWOHWDGRV
(três) anos, salvo se para equiparação de proposta de terceiro. (Re-  TXDWRU]H DRV GH]HVVHWH DQRVGHLGDGHLQFOXVLYHH ,QFOXt-
GDomRGDGDSHOD/HLQžGH  GRSHOD/HLQžGH 
, 5HYRJDGRSHOD/HLQžGH  ,, PHLRSRUFHQWR SDUDFDGDDQRGHIRUPDomRGRV
,, 5HYRJDGRSHOD/HLQžGH  GH]RLWR DRV GH]HQRYH DQRVGHLGDGHLQFOXVLYH ,QFOXtGRSHOD
,,,  5HYRJDGRSHOD/HLQžGH  /HLQžGH 
,9 5HYRJDGRSHOD/HLQžGH  † ž &DEHUi j HQWLGDGH GH SUiWLFD GHVSRUWLYD FHVVLRQiULD GR
9 5HYRJDGRSHOD/HLQžGH  atleta reter do valor a ser pago à entidade de prática desportiva
† ž 3DUD DVVHJXUDU VHX GLUHLWR GH SUHIHUrQFLD D HQWLGDGH GH FHGHQWH FLQFRSRUFHQWR GRYDORUDFRUGDGRSDUDDWUDQVIHUrQFLD
prática desportiva formadora e detentora do primeiro contrato distribuindo-os às entidades de prática desportiva que contribuíram
HVSHFLDOGHWUDEDOKRGHVSRUWLYRGHYHUiDSUHVHQWDUDWp TXDUHQWD para a formação do atleta. ,QFOXtGRSHOD/HLQžGH 
e cinco) dias antes do término do contrato em curso, proposta ao †ž&RPRH[FHomRjUHJUDHVWDEHOHFLGDQR†ž deste artigo,
DWOHWDGHFXMRWHRUGHYHUiVHUFLHQWL¿FDGDDFRUUHVSRQGHQWHHQWLGDGH caso o atleta se desvincule da entidade de prática desportiva de for-
regional de administração do desporto, indicando as novas condições ma unilateral, mediante pagamento da cláusula indenizatória des-
contratuais e os salários ofertados, devendo o atleta apresentar SRUWLYDSUHYLVWDQRLQFLVR,GRDUWGHVWD/HLFDEHUijHQWLGDGHGH
resposta à entidade de prática desportiva formadora, de cujo teor prática desportiva que recebeu a cláusula indenizatória desportiva
GHYHUiVHUQRWL¿FDGDDUHIHULGDHQWLGDGHGHDGPLQLVWUDomRQRSUD]R GLVWULEXLU FLQFRSRUFHQWR GHWDOPRQWDQWHjVHQWLGDGHVGHSUi-
GH TXLQ]H GLDVFRQWDGRVGDGDWDGRUHFHELPHQWRGDSURSRVWD tica desportiva responsáveis pela formação do atleta. (Incluído pela
sob pena de aceitação tácita. ,QFOXtGRSHOD/HLQžGH  /HLQžGH 
†ž1DKLSyWHVHGHRXWUDHQWLGDGHGHSUiWLFDGHVSRUWLYDUHVROYHU † ž 2 SHUFHQWXDO GHYLGR jV HQWLGDGHV GH SUiWLFD GHVSRUWLYD
oferecer proposta mais vantajosa a atleta vinculado à entidade de formadoras do atleta deverá ser calculado sempre de acordo com
prática desportiva que o formou, deve-se observar o seguinte: (In- certidão a ser fornecida pela entidade nacional de administração
FOXtGRSHOD/HLQžGH  do desporto, e os valores distribuídos proporcionalmente em
I - a entidade proponente deverá apresentar à entidade de prá- DWp  WULQWD  GLDV GD HIHWLYD WUDQVIHUrQFLD FDEHQGROKH H[LJLU R
tica desportiva formadora proposta, fazendo dela constar todas as cumprimento do que dispõe este parágrafo. (Incluído pela Lei nº
FRQGLo}HVUHPXQHUDWyULDV ,QFOXtGRSHOD/HLQžGH  GH 

Didatismo e Conhecimento 20
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW2FRQWUDWRGHWUDEDOKRGRDWOHWDSUR¿VVLRQDOWHUiSUD]R GHVSRUWLYDFHGHQWHSDUDTXHUHQGRSXUJDUDPRUDQRSUD]RGH
determinado, com vigência nunca inferior a três meses nem superior (quinze) dias, não se aplicando, nesse caso, o disposto no caput do
a cinco anos. DUWGHVWD/HL 5HGDomRGDGDSHOD/HLQžGH 
3DUiJUDIR~QLFR1mRVHDSOLFDDRFRQWUDWRHVSHFLDOGHWUDEDOKR † ž 2 QmR SDJDPHQWR DR DWOHWD GH VDOiULR H FRQWULEXLo}HV
GHVSRUWLYRGRDWOHWDSUR¿VVLRQDORGLVSRVWRQRVDUWVHGD previstas em lei por parte da entidade de prática desportiva
Consolidação das Leis do Trabalho - CLT, aprovada pelo Decreto- cessionária, por 2 (dois) meses, implicará a rescisão do contrato de
/HL Qž  GH ž GH PDLR GH  5HGDomR GDGD SHOD /HL Qž empréstimo e a incidência da cláusula compensatória desportiva
GH  nele prevista, a ser paga ao atleta pela entidade de prática desportiva
$UW$HQWLGDGHGHSUiWLFDGHVSRUWLYDHPSUHJDGRUDTXHHV- cessionária. ,QFOXtGRSHOD/HLQžGH 
WLYHUFRPSDJDPHQWRGHVDOiULRGHDWOHWDSUR¿VVLRQDOHPDWUDVRQR †ž2FRUUHQGRDUHVFLVmRPHQFLRQDGDQR†žGHVWHDUWLJRR
WRGRRXHPSDUWHSRUSHUtRGRLJXDORXVXSHULRUD WUrV PHVHVWHUi atleta deverá retornar à entidade de prática desportiva cedente para
o contrato especial de trabalho desportivo daquele atleta rescindido, cumprir o antigo contrato especial de trabalho desportivo. (Incluído
¿FDQGRRDWOHWDOLYUHSDUDVHWUDQVIHULUSDUDTXDOTXHURXWUDHQWLGDGH SHOD/HLQžGH 
de prática desportiva de mesma modalidade, nacional ou interna- $UW1DFHVVmRRXWUDQVIHUrQFLDGHDWOHWDSUR¿VVLRQDOSDUD
cional, e exigir a cláusula compensatória desportiva e os haveres entidade de prática desportiva estrangeira observar-se-ão as instru-
GHYLGRV 5HGDomRGDGDSHOD/HLQžGH  ções expedidas pela entidade nacional de título.
† ž São entendidos como salário, para efeitos do previsto † ž  $V FRQGLo}HV SDUD WUDQVIHUrQFLD GR DWOHWD SUR¿VVLRQDO
no caputRDERQRGHIpULDVRGpFLPRWHUFHLURVDOiULRDVJUDWL¿FD- para o exterior deverão integrar obrigatoriamente os contratos de
ções, os prêmios e demais verbas inclusas no contrato de trabalho. trabalho entre o atleta e a entidade de prática desportiva brasileira
§ 2º A mora contumaz será considerada também pelo não reco- que o contratou. (Renumerado do Parágrafo Único para †žpela
OKLPHQWRGR)*76HGDVFRQWULEXLo}HVSUHYLGHQFLiULDV /HLQžGH
†ž 5HYRJDGRSHOD/HLQžGH  § 2º O valor da cláusula indenizatória desportiva internacional
†ž ,QFOXtGRHYHWDGRSHOD/HLQžGH originalmente pactuada entre o atleta e a entidade de prática
$UWeOtFLWRDRDWOHWDSUR¿VVLRQDOUHFXVDUFRPSHWLUSRUHQ- desportiva cedente, independentemente do pagamento da cláusula
tidade de prática desportiva quando seus salários, no todo ou em indenizatória desportiva nacional, será devido a esta pela entidade
parte, estiverem atrasados em dois ou mais meses; de prática desportiva cessionária caso esta venha a concretizar
$UW 5HYRJDGRSHOD/HLQžGH  WUDQVIHUrQFLDLQWHUQDFLRQDOGRPHVPRDWOHWDHPSUD]RLQIHULRUD
$UW6mRGHYHUHVGDHQWLGDGHGHSUiWLFDGHVSRUWLYDHPSUH- (três) meses, caracterizando o conluio com a entidade de prática
gadora, em especial: desportiva estrangeira. 5HGDomRGDGDSHOD/HLQžGH 
I - registrar o contrato especial de trabalho desportivo do atleta
SUR¿VVLRQDOQDHQWLGDGHGHDGPLQLVWUDomRGDUHVSHFWLYDPRGDOLGDGH $UW$SDUWLFLSDomRGHDWOHWDVSUR¿VVLRQDLVHPVHOHo}HVVHUi
GHVSRUWLYD 5HGDomRGDGDSHOD/HLQžGH  estabelecida na forma como acordarem a entidade de administração
II - SURSRUFLRQDUDRVDWOHWDVSUR¿VVLRQDLVDVFRQGLo}HVQHFHV- convocante e a entidade de prática desportiva cedente.
sárias à participação nas competições desportivas, treinos e outras † žA entidade convocadora indenizará a cedente dos encar-
atividades preparatórias ou instrumentais; gos previstos no contrato de trabalho, pelo período em que durar a
,,,VXEPHWHURVDWOHWDVSUR¿VVLRQDLVDRVH[DPHVPpGLFRVHFOt- convocação do atleta, sem prejuízo de eventuais ajustes celebrados
nicos necessários à prática desportiva. entre este e a entidade convocadora.
§ 2º O período de convocação estender-se-á até a reintegração
$UW6mRGHYHUHVGRDWOHWDSUR¿VVLRQDOHPHVSHFLDO do atleta à entidade que o cedeu, apto a exercer sua atividade.
I - participar dos jogos, treinos, estágios e outras sessões prepa-
ratórias de competições com a aplicação e dedicação corresponden- $UW3HUWHQFHjVHQWLGDGHVGHSUiWLFDGHVSRUWLYDRGLUHLWRGH
tes às suas condições psicofísicas e técnicas; arena, consistente na prerrogativa exclusiva de negociar, autorizar
II - preservar as condições físicas que lhes permitam participar RXSURLELUDFDSWDomRD¿[DomRDHPLVVmRDWUDQVPLVVmRDUHWUDQV-
das competições desportivas, submetendo-se aos exames médicos e missão ou a reprodução de imagens, por qualquer meio ou processo,
tratamentos clínicos necessários à prática desportiva; de espetáculo desportivo de que participem. (Redação dada pela Lei
,,,H[HUFLWDUDDWLYLGDGHGHVSRUWLYDSUR¿VVLRQDOGHDFRUGRFRP QžGH 
as regras da respectiva modalidade desportiva e as normas que re- † ž 6DOYR FRQYHQomR FROHWLYD GH WUDEDOKR HP FRQWUiULR 
gem a disciplina e a ética desportivas. (cinco por cento) da receita proveniente da exploração de direitos
desportivos audiovisuais serão repassados aos sindicatos de atletas
$UW 5HYRJDGRSHOD/HLQžGH SUR¿VVLRQDLV H HVWHV GLVWULEXLUmR HP SDUWHV LJXDLV DRV DWOHWDV
SUR¿VVLRQDLVSDUWLFLSDQWHVGRHVSHWiFXORFRPRSDUFHODGHQDWXUH]D
$UW 5HYRJDGRSHOD/HLQžGH civil. 5HGDomRGDGDSHOD/HLQžGH 
†ž2GLVSRVWRQHVWHDUWLJRQmRVHDSOLFDjH[LELomRGHÀDJUDQWHV
$UW4XDOTXHUFHVVmRRXWUDQVIHUrQFLDGHDWOHWDSUR¿VVLRQDO GH HVSHWiFXOR RX HYHQWR GHVSRUWLYR SDUD ¿QV H[FOXVLYDPHQWH
RXQmRSUR¿VVLRQDOGHSHQGHGHVXDIRUPDOHH[SUHVVDDQXrQFLD jornalísticos, desportivos ou educativos, respeitadas as seguintes
condições: 5HGDomRGDGDSHOD/HLQžGH 
$UW2DWOHWDFHGLGRWHPSRUDULDPHQWHDRXWUDHQWLGDGHGH ,DFDSWDomRGDVLPDJHQVSDUDDH[LELomRGHÀDJUDQWHGHHV-
prática desportiva que tiver os salários em atraso, no todo ou em petáculo ou evento desportivo dar-se-á em locais reservados, nos
SDUWHSRUPDLVGH GRLV PHVHVQRWL¿FDUiDHQWLGDGHGHSUiWLFD estádios e ginásios, para não detentores de direitos ou, caso não

Didatismo e Conhecimento 21
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
disponíveis, mediante o fornecimento das imagens pelo detentor de $UW$$VOLJDVGHVSRUWLYDVDVHQWLGDGHVGHDGPLQLVWUDomR
GLUHLWRVORFDLVSDUDDUHVSHFWLYDPtGLD ,QFOXtGRSHOD/HLQž de desporto e as de prática desportiva envolvidas em qualquer com-
GH  SHWLomRGHDWOHWDVSUR¿VVLRQDLVLQGHSHQGHQWHPHQWHGDIRUPDMXUtGL-
,,DGXUDomRGHWRGDVDVLPDJHQVGRÀDJUDQWHGRHVSHWiFXORRX FDDGRWDGD¿FDPREULJDGDVD
HYHQWRGHVSRUWLYRH[LELGDVQmRSRGHUiH[FHGHU WUrVSRUFHQWR  ,HODERUDUVXDVGHPRQVWUDo}HV¿QDQFHLUDVVHSDUDGDPHQWHSRU
do total do tempo de espetáculo ou evento; (Incluído pela Lei nº atividade econômica, de modo distinto das atividades recreativas e
GH  sociais, nos termos da lei e de acordo com os padrões e critérios es-
III - é proibida a associação das imagens exibidas com base nes- tabelecidos pelo Conselho Federal de Contabilidade, e, após terem
te artigo a qualquer forma de patrocínio, propaganda ou promoção sido submetidas a auditoria independente, providenciar sua publi-
FRPHUFLDO ,QFOXtGRSHOD/HLQžGH  FDomRDWpR~OWLPRGLD~WLOGRPrVGHDEULOGRDQRVXEVHTXHQWHSRU
† ž O espectador pagante, por qualquer meio, de espetáculo SHUtRGRQmRLQIHULRUD WUrV PHVHVHPVtWLRHOHWU{QLFRSUySULRHGD
ou evento desportivo equipara-se, para todos os efeitos legais, ao respectiva entidade de administração ou liga desportiva; (Redação
FRQVXPLGRUQRVWHUPRVGRDUWžGD/HLQžGHGHVHWHPEUR GDGDSHOD/HLQžGH 
GH II - apresentar suas contas juntamente com os relatórios da audi-
toria de que trata o inciso I ao Conselho Nacional do Esporte - CNE,
$UWeYHGDGDDSDUWLFLSDomRHPFRPSHWLo}HVGHVSRUWLYDV VHPSUHTXHIRUHPEHQH¿FLiULDVGHUHFXUVRVS~EOLFRVQDIRUPDGR
SUR¿VVLRQDLVGHDWOHWDVQmRSUR¿VVLRQDLVFRPLGDGHVXSHULRUDYLQWH regulamento.
anos. †žSem prejuízo da aplicação das penalidades previstas na le-
gislação tributária, trabalhista, previdenciária, cambial, e das conse-
$UWeYHGDGDDSUiWLFDGRSUR¿VVLRQDOLVPRHPTXDOTXHU qüentes responsabilidades civil e penal, a infringência a este artigo
modalidade, quando se tratar de: implicará:
I - desporto educacional, seja nos estabelecimentos escolares de I - para as entidades de administração do desporto e ligas des-
žHžJUDXVRXVXSHULRUHV portivas, a inelegibilidade, por dez anos, de seus dirigentes para o
II - desporto militar; desempenho de cargos ou funções eletivas ou de livre nomeação,
HPTXDLVTXHUGDVHQWLGDGHVRXyUJmRVUHIHULGRVQRSDUiJUDIR~QLFR
III - menores até a idade de dezesseis anos completos.
GRDUWGHVWD/HL
II - para as entidades de prática desportiva, a inelegibilidade,
$UW$VHQWLGDGHVGHSUiWLFDGHVSRUWLYDVmRREULJDGDVDFRQ-
por cinco anos, de seus dirigentes para cargos ou funções eletivas
tratar seguro de vida e de acidentes pessoais, vinculado à atividade
ou de livre nomeação em qualquer entidade ou empresa direta ou
GHVSRUWLYDSDUDRVDWOHWDVSUR¿VVLRQDLVFRPRREMHWLYRGHFREULURV
LQGLUHWDPHQWHYLQFXODGDjVFRPSHWLo}HVSUR¿VVLRQDLVGDUHVSHFWLYD
ULVFRVDTXHHOHVHVWmRVXMHLWRV 5HGDomRGDGDSHOD/HLQž
modalidade desportiva.
GH 
§ 2º $V HQWLGDGHV TXH YLRODUHP R GLVSRVWR QHVWH DUWLJR ¿FDP
†ž$LPSRUWkQFLDVHJXUDGDGHYHJDUDQWLUDRDWOHWDSUR¿VVLRQDO ainda sujeitas:
RXDREHQH¿FLiULRSRUHOHLQGLFDGRQRFRQWUDWRGHVHJXURRGLUHLWRD I - ao afastamento de seus dirigentes; e
indenização mínima correspondente ao valor anual da remuneração II - à nulidade de todos os atos praticados por seus dirigentes
pactuada. ,QFOXtGRSHOD/HLQžGH  em nome da entidade, após a prática da infração, respeitado o direito
§ 2º A entidade de prática desportiva é responsável pelas GHWHUFHLURVGHERDIp 5HGDomRGDGDSHOD/HLQžGH 
despesas médico-hospitalares e de medicamentos necessários †žOs dirigentes de que trata o § 2º serão sempre:
DR UHVWDEHOHFLPHQWR GR DWOHWD HQTXDQWR D VHJXUDGRUD QmR ¿]HU R I - o presidente da entidade, ou aquele que lhe faça as vezes; e
SDJDPHQWRGDLQGHQL]DomRDTXHVHUHIHUHR†ž deste artigo. (In- II - o dirigente que praticou a infração ainda que por omissão.
FOXtGRSHOD/HLQžGH  †ž ,QFOXtGRHYHWDGRSHOD/HLQžGH
$UW$RHVWUDQJHLURDWOHWDSUR¿VVLRQDOGHPRGDOLGDGHGHV- CAPÍTULO VI
SRUWLYDUHIHULGRQRLQFLVR9GRDUWGD/HLQžGHGH DA ORDEM DESPORTIVA
DJRVWRGHSRGHUiVHUFRQFHGLGRYLVWRREVHUYDGDVDVH[LJrQ-
FLDVGDOHJLVODomRHVSHFt¿FDSRUSUD]RQmRH[FHGHQWHD FLQFR  $UW1RkPELWRGHVXDVDWULEXLo}HVRV&RPLWrV2OtPSLFRH
DQRVHFRUUHVSRQGHQWHjGXUDomR¿[DGDQRUHVSHFWLYRFRQWUDWRHVSH- Paraolímpico Brasileiros e as entidades nacionais de administração
FLDOGHWUDEDOKRGHVSRUWLYRSHUPLWLGDXPD~QLFDUHQRYDomR 5HGD- do desporto têm competência para decidir, de ofício ou quando lhes
omRGDGDSHOD/HLQžGH  IRUHPVXEPHWLGDVSHORVVHXV¿OLDGRVDVTXHVW}HVUHODWLYDVDRFXP-
† ž e YHGDGD D SDUWLFLSDomR GH DWOHWD GH QDFLRQDOLGDGH primento das normas e regras de prática desportiva.
estrangeira como integrante de equipe de competição de entidade de
SUiWLFDGHVSRUWLYDQDFLRQDOQRVFDPSHRQDWRVR¿FLDLVTXDQGRRYLVWR $UW&RPRREMHWLYRGHPDQWHUDRUGHPGHVSRUWLYDRUHV-
de trabalho temporário recair na hipótese do LQFLVR,,,GRDUWGD peito aos atos emanados de seus poderes internos, poderão ser apli-
/HLQžGHGHDJRVWRGH 5HGDomRGDGDSHOD/HLQž cadas, pelas entidades de administração do desporto e de prática
GH  desportiva, as seguintes sanções:
§ 2º A entidade de administração do desporto será obrigada a I - advertência;
exigir da entidade de prática desportiva o comprovante do visto de II - censura escrita;
trabalho do atleta de nacionalidade estrangeira fornecido pelo Mi- III - multa;
nistério do Trabalho e Emprego, sob pena de cancelamento da ins- IV - suspensão;
FULomRGHVSRUWLYD 5HGDomRGDGDSHOD/HLQžGH  9GHV¿OLDomRRXGHVYLQFXODomR

Didatismo e Conhecimento 22
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
†žA aplicação das sanções previstas neste artigo não prescin- $UW1R6XSHULRU7ULEXQDOGH-XVWLoD'HVSRUWLYDSDUDMXO-
de do processo administrativo no qual sejam assegurados o contra- gamento envolvendo competições interestaduais ou nacionais, e
ditório e a ampla defesa. nos Tribunais de Justiça Desportiva, funcionarão tantas Comissões
§ 2º As penalidades de que tratam os incisos IV e V deste arti- 'LVFLSOLQDUHVTXDQWDVVH¿]HUHPQHFHVViULDVFRPSRVWDVFDGDTXDO
JRVRPHQWHSRGHUmRVHUDSOLFDGDVDSyVGHFLVmRGH¿QLWLYDGD-XVWLoD GH FLQFR PHPEURVTXHQmRSHUWHQoDPDRVUHIHULGRVyUJmRVMXGL-
Desportiva. cantes, mas sejam por estes escolhidos. (Redação dada pela Lei nº
GH 
CAPÍTULO VII †ž(VETADO)
DA JUSTIÇA DESPORTIVA § 2º A Comissão Disciplinar aplicará sanções em procedimento
sumário, assegurados a ampla defesa e o contraditório.
$UW$-XVWLoD'HVSRUWLYDDTXHVHUHIHUHPRV††že 2o do †žDas decisões da Comissão Disciplinar caberá recurso ao
DUWGD&RQVWLWXLomR)HGHUDOHRDUWGD/HLQo GHGH Tribunal de Justiça Desportiva e deste ao Superior Tribunal de Jus-
DEULOGHUHJXODVHSHODVGLVSRVLo}HVGHVWH&DStWXOR tiça Desportiva, nas hipóteses previstas nos respectivos Códigos de
Justiça Desportiva.
$UW$RUJDQL]DomRRIXQFLRQDPHQWRHDVDWULEXLo}HVGD †žO recurso ao qual se refere o parágrafo anterior será recebi-
Justiça Desportiva, limitadas ao processo e julgamento das infra- do e processado com efeito suspensivo quando a penalidade exceder
o}HVGLVFLSOLQDUHVHjVFRPSHWLo}HVGHVSRUWLYDVVHUmRGH¿QLGRVQRV de duas partidas consecutivas ou quinze dias.
Códigos de Justiça Desportiva, facultando-se às ligas constituir seus
próprios órgãos judicantes desportivos, com atuação restrita às suas $UW  2 PHPEUR GR7ULEXQDO GH -XVWLoD 'HVSRUWLYD H[HUFH
FRPSHWLo}HV 5HGDomRGDGDSHOD/HLQžGH  IXQomRFRQVLGHUDGDGHUHOHYDQWHLQWHUHVVHS~EOLFRHVHQGRVHUYLGRU
† žAs transgressões relativas à disciplina e às competições S~EOLFRWHUiDERQDGDVVXDVIDOWDVFRPSXWDQGRVHFRPRGHHIHWLYR
desportivas sujeitam o infrator a: exercício a participação nas respectivas sessões.
I - advertência;
II - eliminação; $UW  2 6XSHULRU 7ULEXQDO GH -XVWLoD 'HVSRUWLYD H RV 7UL-
III - exclusão de campeonato ou torneio;
bunais de Justiça Desportiva serão compostos por nove membros,
IV - indenização;
sendo:
V - interdição de praça de desportos;
I - dois indicados pela entidade de administração do desporto;
VI - multa;
II - dois indicados pelas entidades de prática desportiva que par-
VII - perda do mando do campo;
WLFLSHPGHFRPSHWLo}HVR¿FLDLVGDGLYLVmRSULQFLSDO
VIII - perda de pontos;
III - dois advogados com notório saber jurídico desportivo, in-
IX - perda de renda;
dicados pela Ordem dos Advogados do Brasil;
X - suspensão por partida;
XI - suspensão por prazo. ,9 XP UHSUHVHQWDQWHGRViUELWURVLQGLFDGRSHODUHVSHFWLYD
§ 2º As penas disciplinares não serão aplicadas aos menores de HQWLGDGHGHFODVVH 5HGDomRGDGDSHOD/HLQžGH 
quatorze anos. V - 2 (dois) representantes dos atletas, indicados pelas respecti-
† žAs penas pecuniárias não serão aplicadas a atletas não- YDVHQWLGDGHVVLQGLFDLV 5HGDomRGDGDSHOD/HLQžGH 
SUR¿VVLRQDLV †ž(Revogado).
†žCompete às entidades de administração do desporto pro- § 2º O mandato dos membros dos Tribunais de Justiça Des-
mover o custeio do funcionamento dos órgãos da Justiça Desportiva portiva terá duração máxima de quatro anos, permitida apenas uma
que funcionem junto a si. recondução.
† ž e YHGDGR DRV GLULJHQWHV GHVSRUWLYRV GDV HQWLGDGHV GH
$UW2GLVSRVWRQHVWD/HLVREUH-XVWLoD'HVSRUWLYDQmRVH administração e das entidades de prática o exercício de cargo ou
aplica aos Comitês Olímpico e Paraolímpico Brasileiros. função na Justiça Desportiva, exceção feita aos membros dos
conselhos deliberativos das entidades de prática desportiva.
$UW2VyUJmRVLQWHJUDQWHVGD-XVWLoD'HVSRUWLYDVmRDXW{QR- †žOs membros dos Tribunais de Justiça Desportiva poderão
mos e independentes das entidades de administração do desporto de ser bacharéis em Direito ou pessoas de notório saber jurídico, e de
cada sistema, compondo-se do Superior Tribunal de Justiça Despor- conduta ilibada.
tiva, funcionando junto às entidades nacionais de administração do †ž 9(7$'2  ,QFOXtGRSHOD/HLQžGH 
desporto; dos Tribunais de Justiça Desportiva, funcionando junto às
entidades regionais da administração do desporto, e das Comissões CAPÍTULO VIII
Disciplinares, com competência para processar e julgar as questões DOS RECURSOS PARA O DESPORTO
previstas nos Códigos de Justiça Desportiva, sempre assegurados a
ampla defesa e o contraditório. $UW2VUHFXUVRVQHFHVViULRVDRIRPHQWRGDVSUiWLFDVGHV-
†ž6HPSUHMXt]RGRGLVSRVWRQHVWHDUWLJRDVGHFLV}HV¿QDLV SRUWLYDVIRUPDLVHQmRIRUPDLVDTXHVHUHIHUHRDUWGD&RQVWL-
dos Tribunais de Justiça Desportiva são impugnáveis nos termos tuição Federal serão assegurados em programas de trabalho especí-
gerais do direito, respeitados os pressupostos processuais estabele- ¿FRVFRQVWDQWHVGRVRUoDPHQWRVGD8QLmRGRV(VWDGRVGR'LVWULWR
cidos nos ††žHžGRDUWGD&RQVWLWXLomR)HGHUDO. Federal e dos Municípios, além dos provenientes de:
§ 2º O recurso ao Poder Judiciário não prejudicará os efeitos I - fundos desportivos;
desportivos validamente produzidos em conseqüência da decisão II - receitas oriundas de concursos de prognósticos;
proferida pelos Tribunais de Justiça Desportiva. III - doações, patrocínios e legados;

Didatismo e Conhecimento 23
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
IV - prêmios de concursos de prognósticos da Loteria Esportiva ,RVSURJUDPDVHSURMHWRVGHVHQYROYLGRVSRUHQWLGDGHEHQH¿-
Federal não reclamados nos prazos regulamentares; FLDGD ,QFOXtGRSHOD/HLQžGH 
9LQFHQWLYRV¿VFDLVSUHYLVWRVHPOHL ,,RVYDORUHVJDVWRV ,QFOXtGRSHOD/HLQžGH 
VI – dois por cento da arrecadação bruta dos concursos de prog- ,,,RVFULWpULRVGHHVFROKDGHFDGDEHQH¿FLiULRHVXDUHVSHFWLYD
nósticos e loterias federais e similares cuja realização estiver sujeita SUHVWDomRGHFRQWDV ,QFOXtGRSHOD/HLQžGH 
a autorização federal, deduzindo-se este valor do montante destina- †ž2VUHFXUVRVFLWDGRVQR†žVHUmRJHULGRVGLUHWDPHQWHSHOR
GRDRVSUrPLRV 9LGH'HFUHWRQžGH Comitê Olímpico Brasileiro - COB e pelo Comitê Paraolímpico
9,,RXWUDVIRQWHV 5HQXPHUDGRSHOD/DLQžGH Brasileiro - CPB, ou de forma descentralizada em conjunto com as
9,,, XPVH[WR GRVUHFXUVRVGHVWLQDGRVDR0LQLVWpULRGRV entidades nacionais de administração ou de prática do desporto. (In-
(VSRUWHVDTXHVHUHIHUHRLQFLVR,,GRDUWžGHVWD/HLFDOFXODGR FOXtGRSHOD/HLQžGH 
após deduzida a fração prevista no § 2º do referido artigo. (Incluído †2VUHFXUVRV¿QDQFHLURVGHTXHWUDWDRLQFLVR9,,,VHUmR
SHOD/HLQžGH  repassados à Confederação Brasileira de Clubes - CBC e destinados
†ž'RWRWDOGHUHFXUVRV¿QDQFHLURVUHVXOWDQWHVGRSHUFHQWXDOGH ~QLFD H H[FOXVLYDPHQWH SDUD D IRUPDomR GH DWOHWDV ROtPSLFRV H
TXHWUDWDRLQFLVR9,GRFDSXW RLWHQWDHFLQFRSRUFHQWR VHUmR paraolímpicos, devendo ser observado o conjunto de normas
GHVWLQDGRV DR &RPLWr 2OtPSLFR %UDVLOHLUR  &2% H  TXLQ]H aplicáveis à celebração de convênios pela União. (Incluído pela Lei
por cento) ao Comitê Paraolímpico Brasileiro - CPB, devendo ser QžGH 
observado, em ambos os casos, o conjunto de normas aplicáveis $UW$eFRQGLomRSDUDRUHFHELPHQWRGRVUHFXUVRVS~EOL-
à celebração de convênios pela União. (Redação dada pela Lei nº cos federais que as entidades nominadas nos incisos I, II e III do pa-
GH  UiJUDIR~QLFRGRDUWGHVWD/HLFHOHEUHPFRQWUDWRGHGHVHPSHQKR
§ 2º Dos totais dos recursos correspondentes ao Comitê com o Ministério do Esporte, na forma do regulamento. (Incluído
Olímpico Brasileiro - COB, ao Comitê Paraolímpico Brasileiro - SHOD/HLQžGH 
CPB e à Confederação Brasileira de Clubes - CBC: (Redação dada † ž (QWHQGHVH SRU FRQWUDWR GH GHVHPSHQKR R LQVWUXPHQWR
SHOD/HLQžGH  ¿UPDGRHQWUHR0LQLVWpULRGR(VSRUWHHDVHQWLGDGHVGHTXHWUDWDR
, GH]SRUFHQWR VHUmRGHVWLQDGRVDRGHVSRUWRHVFRODU FDSXWFRPYLVWDVQRIRPHQWRS~EOLFRHQDH[HFXomRGHDWLYLGDGHV
relacionadas ao Plano Nacional do Desporto, mediante cumprimento
HPSURJUDPDomRGH¿QLGDFRQMXQWDPHQWHFRPD&RQIHGHUDomR%UD-
de metas de desempenho. ,QFOXtGRSHOD/HLQžGH 
sileira do Desporto Escolar - CBDE;
§ 2º São cláusulas essenciais do contrato de desempenho: (In-
,, FLQFRSRUFHQWR VHUmRGHVWLQDGRVDRGHVSRUWRXQLYHUVL-
FOXtGRSHOD/HLQžGH 
WiULRHPSURJUDPDomRGH¿QLGDFRQMXQWDPHQWHFRPD&RQIHGHUDomR
,DGRREMHWRTXHFRQWHUiDHVSHFL¿FDomRGRSURJUDPDGHWUD-
Brasileira do Desporto Universitário - CBDU.
EDOKRSURSRVWRSHODHQWLGDGH ,QFOXtGRSHOD/HLQžGH 
† ž 2V UHFXUVRV D TXH VH UHIHUH R LQFLVR 9, VHUmR H[FOXVLYD
II - a de estipulação das metas e dos resultados a serem atingi-
e integralmente aplicados em programas e projetos de fomento,
dos e dos respectivos prazos de execução ou cronograma; (Incluído
desenvolvimento e manutenção do desporto, de formação de
SHOD/HLQžGH 
recursos humanos, de preparação técnica, manutenção e locomoção III - a de previsão expressa dos critérios objetivos de avaliação
de atletas, bem como sua participação em eventos desportivos. (Re- de desempenho a serem utilizados, mediante indicadores de resulta-
GDomRGDGDSHOD/HLQžGH  GR ,QFOXtGRSHOD/HLQžGH 
, 5HYRJDGRSHOD/HLQžGH  IV - a que estabelece as obrigações da entidade, entre as quais
,, 5HYRJDGRSHOD/HLQžGH  a de apresentar ao Ministério do Esporte, ao término de cada exercí-
†ž2VUHFXUVRVGHTXHWUDWDR†žVHUmRGLVSRQLEL]DGRVDRV cio, relatório sobre a execução do seu objeto, contendo comparativo
EHQH¿FLiULRV QR SUD]R GH  GH]  GLDV ~WHLV D FRQWDU GD GDWD GH HVSHFt¿FRGDVPHWDVSURSRVWDVFRPRVUHVXOWDGRVDOFDQoDGRVDFRP-
ocorrência de cada sorteio, conforme disposto em regulamento. (Re- panhado de prestação de contas dos gastos e receitas efetivamente
GDomRGDGDSHOD/HLQžGH  UHDOL]DGRV ,QFOXtGRSHOD/HLQžGH 
† ž 'RV SURJUDPDV H SURMHWRV UHIHULGRV QR † ž VHUi GDGD V - a que estabelece a obrigatoriedade de apresentação de regu-
ciência ao Ministério da Educação e ao Ministério do Esporte. (Re- lamento próprio contendo os procedimentos que adotará para a con-
GDomRGDGDSHOD/HLQžGH  tratação de obras e serviços, bem como para compras com emprego
†ž&DEHDR7ULEXQDOGH&RQWDVGD8QLmR¿VFDOL]DUDDSOLFDomR GHUHFXUVRVSURYHQLHQWHVGRSRGHUS~EOLFRREVHUYDGRVRVSULQFtSLRV
dos recursos repassados ao Comitê Olímpico Brasileiro - COB, ao HVWDEHOHFLGRVQRLQFLVR,GRDUW%GHVWD/HL ,QFOXtGRSHOD/HL
Comitê Paraolímpico Brasileiro - CPB e à Confederação Brasileira QžGH 
de Clubes - CBC em decorrência desta Lei. (Redação dada pela Lei 9,DGHSXEOLFDomRQR'LiULR2¿FLDOGD8QLmRGHVHXH[WUDWRH
QžGH  GHGHPRQVWUDWLYRGDVXDH[HFXomRItVLFDH¿QDQFHLUDFRQIRUPHPR-
†ž20LQLVWpULRGR(VSRUWHGHYHUiDFRPSDQKDURVSURJUDPDV GHORVLPSOL¿FDGRHVWDEHOHFLGRQRUHJXODPHQWRGHVWD/HLFRQWHQGR
H SURMHWRV UHIHULGRV QR † ž GHVWH DUWLJR H DSUHVHQWDU DQXDOPHQWH os dados principais da documentação obrigatória referida no inciso
relatório da aplicação dos recursos, que deverá ser aprovado pelo V, sob pena de não liberação dos recursos nele previstos. (Incluído
&RQVHOKR1DFLRQDOGR(VSRUWHVRESHQDGHDHQWLGDGHEHQH¿FLDGD SHOD/HLQžGH 
não receber os recursos no ano subsequente. (Incluído pela Lei nº † ž$ FHOHEUDomR GR FRQWUDWR GH GHVHPSHQKR FRQGLFLRQDVH
GH  à aprovação do Ministério do Esporte quanto ao alinhamento e à
†ž2UHODWyULRDTXHVHUHIHUHR†žGHVWHDUWLJRVHUiSXEOLFDGR compatibilidade entre o programa de trabalho apresentado pela
no sítio do Ministério do Esporte na internet, do qual constarão: (In- entidade e o Plano Nacional do Desporto. (Incluído pela Lei nº
FOXtGRSHOD/HLQžGH  GH 

Didatismo e Conhecimento 24
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
† ž 2 FRQWUDWR GH GHVHPSHQKR VHUi DFRPSDQKDGR GH SODQR $UW&$VHQWLGDGHVLQWHUHVVDGDVHP¿UPDURFRQWUDWRGH
estratégico de aplicação de recursos, considerando o ciclo olímpico desempenho deverão formular requerimento escrito ao Ministério
RXSDUDROtPSLFRGH TXDWUR DQRVHPTXHGHYHUmRconstar a estra- do Esporte, instruído com cópias autenticadas dos seguintes docu-
tégia de base, as diretrizes, os objetivos, os indicadores e as metas a PHQWRV ,QFOXtGRSHOD/HLQžGH 
VHUHPDWLQJLGDV ,QFOXtGRSHOD/HLQžGH  ,HVWDWXWRUHJLVWUDGRHPFDUWyULR ,QFOXtGRSHOD/HLQž
† ž 3DUD HIHLWR GHVWD /HL FLFOR ROtPSLFR H SDUDROtPSLFR p R GH 
SHUtRGR GH  TXDWUR  DQRV FRPSUHHQGLGR HQWUH D UHDOL]DomR GH  II - ata de eleição de sua atual diretoria; (Incluído pela Lei nº
(dois) Jogos Olímpicos ou 2 (dois) Jogos Paraolímpicos, de verão GH 
ou de inverno, ou o que restar até a realização dos próximos Jogos III - balanço patrimonial e demonstração do resultado do exer-
Olímpicos ou Jogos Paraolímpicos. ,QFOXtGRSHOD/HLQžGH FtFLR ,QFOXtGRSHOD/HLQžGH 
  ,9LQVFULomRQR&DGDVWUR*HUDOGH&RQWULEXLQWHVH ,QFOXtGR
†ž$YHUL¿FDomRGRFXPSULPHQWRGRVWHUPRVGRFRQWUDWRGH SHOD/HLQžGH 
desempenho será de responsabilidade do Ministério do Esporte. (In- 9  FRPSURYDomR GD UHJXODULGDGH MXUtGLFD H ¿VFDO ,QFOXtGR
FOXtGRSHOD/HLQžGH  SHOD/HLQžGH 
†ž20LQLVWpULRGR(VSRUWHSRGHUiGHVLJQDUFRPLVVmRWpFQLFD $UW&RQVWLWXLUmRUHFXUVRVSDUDDDVVLVWrQFLDVRFLDOHHGX-
de acompanhamento e avaliação do cumprimento dos termos do FDFLRQDODRVDWOHWDVSUR¿VVLRQDLVDRVH[DWOHWDVHDRVDWOHWDVHPIRU-
contrato de desempenho, que emitirá parecer sobre os resultados PDomRRVUHFROKLGRV 5HGDomRGDGDSHOD/HLQžGH 
DOFDQoDGRVHPVXEVtGLRDRVSURFHVVRVGH¿VFDOL]DomRHSUHVWDomRGH I - diretamente para a federação das associações de atletas pro-
contas dos resultados do contrato sob sua responsabilidade perante ¿VVLRQDLV)$$3HTXLYDOHQWHVD 5HGDomRGDGDSHOD/HLQž
os órgãos de controle interno e externo do Poder Executivo. (Incluí- GH 
GRSHOD/HLQžGH  D  FLQFRGpFLPRVSRUFHQWR GRYDORUFRUUHVSRQGHQWHj
†ž2GHVFXPSULPHQWRLQMXVWL¿FDGRGDVFOiXVXODVGRFRQWUDWR parcela ou parcelas que compõem o salário mensal, nos termos do
de desempenho é condição para a sua rescisão por parte do Ministério FRQWUDWRGRDWOHWDSUR¿VVLRQDOSHUWHQFHQWHDR6LVWHPD%UDVLOHLURGR
do Esporte, sem prejuízo das medidas administrativas cabíveis. (In- Desporto, a serem pagos mensalmente pela entidade de prática des-
FOXtGRSHOD/HLQžGH 
SRUWLYDFRQWUDWDQWHH ,QFOXtGRSHOD/HLQžGH 
†ž&ySLDVDXWrQWLFDVLQWHJUDLVGRVFRQWUDWRVGHGHVHPSHQKR
E  RLWRGpFLPRVSRUFHQWR GRYDORUFRUUHVSRQGHQWHjV
celebrados entre o Ministério do Esporte e as entidades nominadas
transferências nacionais e internacionais, a serem pagos pela enti-
QRVLQFLVRV,,,H,,,GRSDUiJUDIR~QLFRGRDUWGHVWD/HLVHUmR
GDGHGHSUiWLFDGHVSRUWLYDFHGHQWHH ,QFOXtGRSHOD/HLQž
GLVSRQLELOL]DGDVQDSiJLQDHOHWU{QLFDR¿FLDOGDTXHOH0LQLVWpULR(In-
GH 
FOXtGRSHOD/HLQžGH 
,,GLUHWDPHQWHSDUDD)HGHUDomR1DFLRQDOGRV$WOHWDV3UR¿V-
$UW%6HPSUHMXt]RGHRXWUDVQRUPDVDSOLFiYHLVDUHSDV-
VLRQDLVGH)XWHERO)(1$3$)HTXLYDOHQWHVD GRLVGpFLPRV
se de recursos para a assinatura do contrato de desempenho será
H[LJLGRGDVHQWLGDGHVEHQH¿FLDGDVTXHVHMDPUHJLGDVSRUHVWDWXWRV por cento) do valor correspondente às transferências nacionais e in-
cujas normas disponham expressamente sobre: (Incluído pela Lei nº ternacionais de atletas da modalidade de futebol, a serem pagos no
GH  ato do recebimento pela entidade de prática desportiva cedente; (Re-
,  REVHUYkQFLD GRV SULQFtSLRV GD OHJDOLGDGH LPSHVVRDOLGDGH GDomRGDGDSHOD/HLQžGH 
PRUDOLGDGHSXEOLFLGDGHHFRQRPLFLGDGHHGDH¿FLrQFLD ,QFOXtGR ,,, 5HYRJDGRSHOD/HLQžGH 
SHOD/HLQžGH  ,9 5HYRJDGRSHOD/HLQžGH 
II - adoção de práticas de gestão administrativa, necessárias e † ž $ HQWLGDGH UHVSRQViYHO SHOR UHJLVWUR GH WUDQVIHUrQFLDV
VX¿FLHQWHVDFRLELUDREWHQomRGHIRUPDLQGLYLGXDORXFROHWLYDGH GH DWOHWD SUR¿VVLRQDO GH HQWLGDGH GH SUiWLFD GHVSRUWLYD SDUD RXWUD
benefícios ou vantagens pessoais, em decorrência da participação deverá exigir, sob pena de sua não efetivação, além dos documentos
QRUHVSHFWLYRSURFHVVRGHFLVyULR ,QFOXtGRSHOD/HLQžGH QHFHVViULRV R FRPSURYDQWH GR UHFROKLPHQWR GRV YDORUHV ¿[DGRV
  neste artigo. ,QFOXtGRSHOD/HLQžGH 
,,,FRQVWLWXLomRGHFRQVHOKR¿VFDORXyUJmRHTXLYDOHQWHGRWD- § 2º Os recursos de que trata este artigo serão integralmente
do de competência para opinar sobre os relatórios de desempenho aplicados em conformidade com programa de assistência social e
¿QDQFHLURHFRQWiELOHVREUHDVRSHUDo}HVSDWULPRQLDLVUHDOL]DGDV educacional, previamente aprovado pelas entidades de que tratam
emitindo pareceres para os organismos superiores da entidade; (In- os incisos I e II deste artigo, nos termos dos seus estatutos. (Incluído
FOXtGRSHOD/HLQžGH  SHOD/HLQžGH 
IV - prestação de contas a serem observadas pela entidade, que
GHWHUPLQDUmRQRPtQLPR ,QFOXtGRSHOD/HLQžGH  $UW 9(7$'2
D  D REVHUYkQFLD GRV SULQFtSLRV IXQGDPHQWDLV GH FRQWDELOLGD-
de e das normas brasileiras de contabilidade; (Incluído pela Lei nº CAPÍTULO IX
GH  DO BINGO
E TXHVHGrSXEOLFLGDGHSRUTXDOTXHUPHLRH¿FD]QRHQFHUUD-
PHQWRGRH[HUFtFLR¿VFDODRUHODWyULRGHDWLYLGDGHVHGDVGHPRQV- $UW 5HYRJDGR
WUDo}HV¿QDQFHLUDVGDHQWLGDGHLQFOXLQGRVHDVFHUWLG}HVQHJDWLYDV $UW 5HYRJDGR
de débitos com o Instituto Nacional do Seguro Social - INSS e com $UW 5HYRJDGR
R)XQGRGH*DUDQWLDGR7HPSRGH6HUYLoR)*76FRORFDQGRRVj $UW 5HYRJDGR
disposição para exame de qualquer cidadão. (Incluído pela Lei nº $UW 5HYRJDGR
GH  $UW 5HYRJDGR

Didatismo e Conhecimento 25
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW 5HYRJDGR 3DUiJUDIR~QLFR$VHPSUHVDVGHWHOHYLVmRGHFRPXPDFRUGR
$UW 5HYRJDGR ou por rodízio, ou por arbitramento, resolverão como cumprir o dis-
$UW 5HYRJDGR posto neste artigo, caso nenhuma delas se interesse pela transmis-
$UW 5HYRJDGR são. O órgão competente fará o arbitramento.
$UW 5HYRJDGR
$UW 5HYRJDGR $UW2VVLVWHPDVGHHQVLQRGD8QLmRGRV(VWDGRVGR'LV-
$UW 5HYRJDGR trito Federal e dos Municípios, bem como as instituições de ensino
$UW 5HYRJDGR VXSHULRUGH¿QLUmRQRUPDVHVSHFt¿FDVSDUDYHUL¿FDomRGRUHQGLPHQ-
$UW 5HYRJDGR to e o controle de freqüência dos estudantes que integrarem repre-
$UW 5HYRJDGR sentação desportiva nacional, de forma a harmonizar a atividade
$UW 5HYRJDGR desportiva com os interesses relacionados ao aproveitamento e à
$UW 5HYRJDGR promoção escolar.
$UW 5HYRJDGR
$UW 5HYRJDGR $UWeLQVWLWXtGRR'LDGR'HVSRUWRDVHUFRPHPRUDGRQR
$UW 5HYRJDGR GLDGHMXQKR'LD0XQGLDOGR'HVSRUWR2OtPSLFR
$UW 5HYRJDGR
$UW 5HYRJDGR $UW $ GHQRPLQDomR H RV VtPERORV GH HQWLGDGH GH DGPL-
nistração do desporto ou prática desportiva, bem como o nome ou
CAPÍTULO X DSHOLGRGHVSRUWLYRGRDWOHWDSUR¿VVLRQDOVmRGHSURSULHGDGHH[FOX-
DISPOSIÇÕES GERAIS siva dos mesmos, contando com a proteção legal, válida para todo
o território nacional, por tempo indeterminado, sem necessidade de
$UW2VGLULJHQWHVXQLGDGHVRXyUJmRVGHHQWLGDGHVGHDG- registro ou averbação no órgão competente.
ministração do desporto, inscritas ou não no registro de comércio, 3DUiJUDIR~QLFR$JDUDQWLDOHJDORXWRUJDGDjVHQWLGDGHVHDRV
QmRH[HUFHPIXQomRGHOHJDGDSHOR3RGHU3~EOLFRQHPVmRFRQVLGH- atletas referidos neste artigo permite-lhes o uso comercial de sua
UDGDVDXWRULGDGHVS~EOLFDVSDUDRVHIHLWRVGHVWD/HL denominação, símbolos, nomes e apelidos.

$UW$$VHQWLGDGHVGHSUiWLFDGHVSRUWLYDGHSDUWLFLSDomR $UW$2GLUHLWRDRXVRGDLPDJHPGRDWOHWDSRGHVHUSRU
RX GH UHQGLPHQWR SUR¿VVLRQDO RX QmR SUR¿VVLRQDO SURPRYHUmR ele cedido ou explorado, mediante ajuste contratual de natureza ci-
REULJDWRULDPHQWHH[DPHVSHULyGLFRVSDUDDYDOLDUDVD~GHGRVDWOH- YLO H FRP ¿[DomR GH GLUHLWRV GHYHUHV H FRQGLo}HV LQFRQIXQGtYHLV
WDVQRVWHUPRVGDUHJXODPHQWDomR ,QFOXtGRSHOD/HLQžGH com o contrato especial de trabalho desportivo. (Incluído pela Lei
 QžGH 

$UW$VHQWLGDGHVGHVSRUWLYDVLQWHUQDFLRQDLVFRPVHGHSHU- $UW2ViUELWURVHDX[LOLDUHVGHDUELWUDJHPSRGHUmRFRQVWL-
PDQHQWH RX WHPSRUiULD QR 3DtV UHFHEHUmR GRV SRGHUHV S~EOLFRV R tuir entidades nacionais, estaduais e do Distrito Federal, por moda-
mesmo tratamento dispensado às entidades nacionais de adminis- lidade desportiva ou grupo de modalidades, objetivando o recruta-
tração do desporto. mento, a formação e a prestação de serviços às entidades de admi-
QLVWUDomRGRGHVSRUWR 5HGDomRGDGDSHOD/HLQžGH 
$UW  6HUi FRQVLGHUDGR FRPR HIHWLYR H[HUFtFLR SDUD WRGRV 3DUiJUDIR~QLFR,QGHSHQGHQWHPHQWHGDFRQVWLWXLomRGHVRFLH-
RV HIHLWRV OHJDLV R SHUtRGR HP TXH R DWOHWD VHUYLGRU S~EOLFR FLYLO dade ou entidades, os árbitros e seus auxiliares não terão qualquer
RXPLOLWDUGD$GPLQLVWUDomR3~EOLFDGLUHWDLQGLUHWDDXWiUTXLFDRX vínculo empregatício com as entidades desportivas diretivas onde
fundacional, estiver convocado para integrar representação nacional atuarem, e sua remuneração como autônomos exonera tais entida-
em treinamento ou competição desportiva no País ou no exterior. des de quaisquer outras responsabilidades trabalhistas, securitárias
† ž 2 SHUtRGR GH FRQYRFDomR VHUi GH¿QLGR SHOD HQWLGDGH e previdenciárias.
nacional de administração da respectiva modalidade desportiva,
cabendo a esta ou aos Comitês Olímpico ou Paraolímpico Brasileiros $UW  (P FDPSHRQDWRV RX WRUQHLRV UHJXODUHV FRP PDLV GH
fazer a devida comunicação e solicitar ao Ministério do Esporte a uma divisão, as entidades de administração do desporto determi-
competente liberação do afastamento do atleta, árbitro e assistente, narão em seus regulamentos o princípio do acesso e do descenso,
cabendo ao referido Ministério comunicar a ocorrência ao órgão de observado sempre o critério técnico.
origem do servidor ou militar. 5HGDomRGDGDSHOD/HLQž
GH  $UW$$VHQWLGDGHVUHVSRQViYHLVSHODRUJDQL]DomRGHFRP-
§ 2º 2GLVSRVWRQHVWHDUWLJRDSOLFDVHWDPEpPDRVSUR¿VVLRQDLV SHWLo}HV GHVSRUWLYDV SUR¿VVLRQDLV GHYHUmR GLVSRQLELOL]DU HTXLSHV
especializados e dirigentes, quando indispensáveis à composição da para atendimento de emergências entre árbitros e atletas, nos termos
delegação. GDUHJXODPHQWDomR ,QFOXtGRSHOD/HLQžGH

$UW$7RGRVRVMRJRVGDVVHOHo}HVEUDVLOHLUDVGHIXWHERO $UWeYHGDGRDRVDGPLQLVWUDGRUHVHPHPEURVGHFRQVHOKR
HPFRPSHWLo}HVR¿FLDLVGHYHUmRVHUH[LELGRVSHORPHQRVHPXPD ¿VFDOGHHQWLGDGHGHSUiWLFDGHVSRUWLYDRH[HUFtFLRGHFDUJRRXIXQ-
rede nacional de televisão aberta, com transmissão ao vivo, inclu- ção em entidade de administração do desporto.
sive para as cidades brasileiras nas quais os mesmos estejam sendo
realizados. $UW$ ,QFOXtGRHYHWDGRSHOD/HLQžGH

Didatismo e Conhecimento 26
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW% ,QFOXtGRHYHWDGRSHOD/HLQžGH $UW6mRUHYRJDGRVDSDUWLUGDYLJrQFLDGRGLVSRVWRQR§
2 o GRDUWGHVWD/HLRVLQFLVRV,,H9HRV††žHžGRDUWž
$UW&$VSDUWHVLQWHUHVVDGDVSRGHUmRYDOHUVHGDDUELWUD- RVDUWVžžHR§ 2ºGRDUWRSDUiJUDIR~QLFRGRDUW
gem para dirimir litígios relativos a direitos patrimoniais disponí- HRVDUWVHGD/HLQo GHGHVHWHPEURGHVmR
veis, vedada a apreciação de matéria referente à disciplina e à com- revogadas, a partir da data de publicação desta Lei, as Leis noV
SHWLomRGHVSRUWLYD ,QFOXtGRSHOD/HLQžGH  GHGHMXOKRGHHGHGHGH]HPEURGH
3DUiJUDIR~QLFR$DUELWUDJHPGHYHUiHVWDUSUHYLVWDHPDFRUGR %UDVtOLDGHPDUoRGHo GD,QGHSHQGrQFLDHo da
ou convenção coletiva de trabalho e só poderá ser instituída após a 5HS~EOLFD
FRQFRUGkQFLDH[SUHVVDGHDPEDVDVSDUWHVPHGLDQWHFOiXVXODFRP- FERNANDO HENRIQUE CARDOSO
SURPLVVyULDRXFRPSURPLVVRDUELWUDO ,QFOXtGRSHOD/HLQž Iris Rezende
GH  Pedro Malan
Paulo Renato Souza
$UW'2VDWOHWDVSUR¿VVLRQDLVSRGHUmRVHUUHSUHVHQWDGRV Paulo Paiva
em juízo por suas entidades sindicais em ações relativas aos contra- Reinhold Stephanes
tos especiais de trabalho desportivo mantidos com as entidades de Edson Arantes do Nascimento
SUiWLFDGHVSRUWLYD ,QFOXtGRSHOD/HLQžGH  (VWHWH[WRQmRVXEVWLWXLRSXEOLFDGRQR'28GH

$UW(2GLVSRVWRQR†žGRDUWTXDQGRKRXYHUYtQFXOR LEI Nº 9.394, DE 20 DE DEZEMBRO DE 1996.


empregatício aplica-se aos integrantes da comissão técnica e da área (Vide Adin 3324-7, de 2005)
GHVD~GH ,QFOXtGRSHOD/HLQžGH  (Vide Decreto nº 3.860, de 2001)
(Vide Lei nº 10.870, de 2004)
$UW)2VSUR¿VVLRQDLVFUHGHQFLDGRVSHODV$VVRFLDo}HVGH (Vide Lei nº 12.061, de 2009)
Cronistas Esportivos quando em serviço têm acesso a praças, está- Estabelece as diretrizes e bases da educação nacional.
dios e ginásios desportivos em todo o território nacional, obrigando-
O PRESIDENTE DA REPÚBLICA Faço saber que o Con-
-se a ocupar locais a eles reservados pelas respectivas entidades de
gresso Nacional decreta e eu sanciono a seguinte Lei:
DGPLQLVWUDomRGRGHVSRUWR ,QFOXtGRSHOD/HLQžGH 
TÍTULO I
CAPÍTULO XI
DA EDUCAÇÃO
DISPOSIÇÕES TRANSITÓRIAS
$UWž$HGXFDomRDEUDQJHRVSURFHVVRVIRUPDWLYRVTXHVHGH-
$UW$WpDHGLomRGRV&yGLJRVGD-XVWLoDGRV'HVSRUWRV3UR-
senvolvem na vida familiar, na convivência humana, no trabalho,
¿VVLRQDLVH1mR3UR¿VVLRQDLVFRQWLQXDPHPYLJRURVDWXDLV&yGL- nas instituições de ensino e pesquisa, nos movimentos sociais e or-
gos, com as alterações constantes desta Lei. ganizações da sociedade civil e nas manifestações culturais.
†ž(VWD/HLGLVFLSOLQDDHGXFDomRHVFRODUTXHVHGHVHQYROYH
$UW2VDWXDLVDWOHWDVSUR¿VVLRQDLVGHIXWHEROGHTXDOTXHU predominantemente, por meio do ensino, em instituições próprias.
idade, que, na data de entrada em vigor desta Lei, estiverem com § 2º A educação escolar deverá vincular-se ao mundo do
passe livre, permanecerão nesta situação, e a rescisão de seus con- trabalho e à prática social.
WUDWRVGHWUDEDOKRGDUVHiQRVWHUPRVGRVDUWVHGD&/7
TÍTULO II
$UW2GLVSRVWRQRDUW§ 2º, desta Lei somente produzirá DOS PRINCÍPIOS E FINS DA EDUCAÇÃO NACIONAL
HIHLWRV MXUtGLFRV D SDUWLU GH  GH PDUoR GH  UHVSHLWDGRV RV
direitos adquiridos decorrentes dos contratos de trabalho e vínculos Art. 2º A educação, dever da família e do Estado, inspirada nos
GHVSRUWLYRVGHDWOHWDVSUR¿VVLRQDLVSDFWXDGRVFRPEDVHQDOHJLVOD- princípios de liberdade e nos ideais de solidariedade humana, tem
ção anterior. SRU¿QDOLGDGHRSOHQRGHVHQYROYLPHQWRGRHGXFDQGRVHXSUHSDUR
3DUiJUDIR~QLFR 9(7$'2  SDUDRH[HUFtFLRGDFLGDGDQLDHVXDTXDOL¿FDomRSDUDRWUDEDOKR

$UW2GLVSRVWRQžVDUWV$$ $UWž2HQVLQRVHUiPLQLVWUDGRFRPEDVHQRVVHJXLQWHVSULQ-
HQž†žGRDUWGHVWD/HLVHUiREULJDWyULRH[FOXVLYDPHQWHSDUD cípios:
DWOHWDV H HQWLGDGHV GH SUiWLFD SUR¿VVLRQDO GD PRGDOLGDGH GH IXWH- I - igualdade de condições para o acesso e permanência na es-
bol. 5HGDomRGDGDSHOD/HLQžGH  cola;
3DUiJUDIR~QLFReIDFXOWDGRjVGHPDLVPRGDOLGDGHVGHVSRUWL- II - liberdade de aprender, ensinar, pesquisar e divulgar a cultu-
vas adotar os preceitos constantes dos dispositivos referidos no ca- ra, o pensamento, a arte e o saber;
put deste artigo. III - pluralismo de idéias e de concepções pedagógicas;
,9UHVSHLWRjOLEHUGDGHHDSUHoRjWROHUkQFLD
$UW$23RGHU([HFXWLYRUHJXODPHQWDUiRGLVSRVWRQHVWD 9FRH[LVWrQFLDGHLQVWLWXLo}HVS~EOLFDVHSULYDGDVGHHQVLQR
Lei, inclusive a distribuição dos recursos, gradação das multas e os 9,JUDWXLGDGHGRHQVLQRS~EOLFRHPHVWDEHOHFLPHQWRVR¿FLDLV
procedimentos de sua aplicação. 9,,YDORUL]DomRGRSUR¿VVLRQDOGDHGXFDomRHVFRODU
9,,,JHVWmRGHPRFUiWLFDGRHQVLQRS~EOLFRQDIRUPDGHVWD/HL
$UW(VWD/HLHQWUDHPYLJRUQDGDWDGHVXDSXEOLFDomR e da legislação dos sistemas de ensino;

Didatismo e Conhecimento 27
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
IX - garantia de padrão de qualidade; ,,ID]HUOKHVDFKDPDGDS~EOLFD
X - valorização da experiência extra-escolar; III - zelar, junto aos pais ou responsáveis, pela freqüência à es-
XI - vinculação entre a educação escolar, o trabalho e as práti- cola.
cas sociais. † ž (P WRGDV DV HVIHUDV DGPLQLVWUDWLYDV R 3RGHU 3~EOLFR
XII - consideração com a diversidade étnico-racial. (Incluído assegurará em primeiro lugar o acesso ao ensino obrigatório, nos
SHOD/HLQžGH termos deste artigo, contemplando em seguida os demais níveis e
modalidades de ensino, conforme as prioridades constitucionais e
TÍTULO III legais.
DO DIREITO À EDUCAÇÃO E DO DEVER DE EDUCAR †ž4XDOTXHUGDVSDUWHVPHQFLRQDGDVQRcaput deste artigo tem
legitimidade para peticionar no Poder Judiciário, na hipótese do § 2º
$UWž2GHYHUGR(VWDGRFRPHGXFDomRHVFRODUS~EOLFDVHUi GRDUWGD&RQVWLWXLomR)HGHUDO, sendo gratuita e de rito sumário
efetivado mediante a garantia de: a ação judicial correspondente.
,HGXFDomREiVLFDREULJDWyULDHJUDWXLWDGRV TXDWUR DRV † ž &RPSURYDGD D QHJOLJrQFLD GD DXWRULGDGH FRPSHWHQWH
(dezessete) anos de idade, organizada da seguinte forma: (Redação para garantir o oferecimento do ensino obrigatório, poderá ela ser
GDGDSHOD/HLQžGH imputada por crime de responsabilidade.
D SUpHVFROD ,QFOXtGRSHOD/HLQžGH †ž3DUDJDUDQWLURFXPSULPHQWRGDREULJDWRULHGDGHGHHQVLQR
E HQVLQRIXQGDPHQWDO ,QFOXtGRSHOD/HLQžGH R3RGHU3~EOLFRFULDUiIRUPDVDOWHUQDWLYDVGHDFHVVRDRVGLIHUHQWHV
F HQVLQRPpGLR ,QFOXtGRSHOD/HLQžGH níveis de ensino, independentemente da escolarização anterior.
,,HGXFDomRLQIDQWLOJUDWXLWDjVFULDQoDVGHDWp FLQFR DQRV
GHLGDGH 5HGDomRGDGDSHOD/HLQžGH $UWž É dever dos pais ou responsáveis efetuar a matrícula
III - atendimento educacional especializado gratuito aos edu- GDV FULDQoDV QD HGXFDomR EiVLFD D SDUWLU GRV  TXDWUR  DQRV GH
FDQGRV FRP GH¿FLrQFLD WUDQVWRUQRV JOREDLV GR GHVHQYROYLPHQWR idade. 5HGDomRGDGDSHOD/HLQžGH
e altas habilidades ou superdotação, transversal a todos os níveis,
etapas e modalidades, preferencialmente na rede regular de ensi- $UWž2HQVLQRpOLYUHjLQLFLDWLYDSULYDGDDWHQGLGDVDVVHJXLQ-
QR 5HGDomRGDGDSHOD/HLQžGH tes condições:
,9DFHVVRS~EOLFRHJUDWXLWRDRVHQVLQRVIXQGDPHQWDOHPpGLR I - cumprimento das normas gerais da educação nacional e do
para todos os que não os concluíram na idade própria; (Redação respectivo sistema de ensino;
GDGDSHOD/HLQžGH II - autorização de funcionamento e avaliação de qualidade pelo
V - acesso aos níveis mais elevados do ensino, da pesquisa e da 3RGHU3~EOLFR
criação artística, segundo a capacidade de cada um; ,,,  FDSDFLGDGH GH DXWR¿QDQFLDPHQWR UHVVDOYDGR R SUHYLVWR
VI - oferta de ensino noturno regular, adequado às condições QRDUWGD&RQVWLWXLomR)HGHUDO
do educando;
VII - oferta de educação escolar regular para jovens e adultos, TÍTULO IV
com características e modalidades adequadas às suas necessidades e DA ORGANIZAÇÃO DA EDUCAÇÃO NACIONAL
disponibilidades, garantindo-se aos que forem trabalhadores as con-
dições de acesso e permanência na escola; $UWž$8QLmRRV(VWDGRVR'LVWULWR)HGHUDOHRV0XQLFtSLRV
VIII - atendimento ao educando, em todas as etapas da educa- organizarão, em regime de colaboração, os respectivos sistemas de
ção básica, por meio de programas suplementares de material didá- ensino.
WLFRHVFRODUWUDQVSRUWHDOLPHQWDomRHDVVLVWrQFLDjVD~GH 5HGDomR † ž &DEHUi j 8QLmR D FRRUGHQDomR GD SROtWLFD QDFLRQDO GH
GDGDSHOD/HLQžGH educação, articulando os diferentes níveis e sistemas e exercendo
,;SDGU}HVPtQLPRVGHTXDOLGDGHGHHQVLQRGH¿QLGRVFRPRD função normativa, redistributiva e supletiva em relação às demais
variedade e quantidade mínimas, por aluno, de insumos indispensá- LQVWkQFLDVHGXFDFLRQDLV
veis ao desenvolvimento do processo de ensino-aprendizagem. § 2º Os sistemas de ensino terão liberdade de organização nos
;±YDJDQDHVFRODS~EOLFDGHHGXFDomRLQIDQWLORXGHHQVLQR termos desta Lei.
fundamental mais próxima de sua residência a toda criança a partir
GRGLDHPTXHFRPSOHWDU TXDWUR DQRVGHLGDGH ,QFOXtGRSHOD/HL $UWž$8QLmRLQFXPELUVHiGH
QžGH  I - elaborar o Plano Nacional de Educação, em colaboração com
os Estados, o Distrito Federal e os Municípios;
$UWž2DFHVVRjHGXFDomREiVLFDREULJDWyULDpGLUHLWRS~EOLFR ,,RUJDQL]DUPDQWHUHGHVHQYROYHURVyUJmRVHLQVWLWXLo}HVR¿-
subjetivo, podendo qualquer cidadão, grupo de cidadãos, associação ciais do sistema federal de ensino e o dos Territórios;
comunitária, organização sindical, entidade de classe ou outra ,,,SUHVWDUDVVLVWrQFLDWpFQLFDH¿QDQFHLUDDRV(VWDGRVDR'LV-
OHJDOPHQWH FRQVWLWXtGD H DLQGD R 0LQLVWpULR 3~EOLFR DFLRQDU R trito Federal e aos Municípios para o desenvolvimento de seus siste-
SRGHUS~EOLFRSDUDH[LJLOR 5HGDomRGDGDSHOD/HLQžGH mas de ensino e o atendimento prioritário à escolaridade obrigatória,
 exercendo sua função redistributiva e supletiva;
†ž2SRGHUS~EOLFRQDHVIHUDGHVXDFRPSHWrQFLDIHGHUDWLYD IV - estabelecer, em colaboração com os Estados, o Distrito Fe-
deverá: 5HGDomRGDGDSHOD/HLQžGH deral e os Municípios, competências e diretrizes para a educação
I - recensear anualmente as crianças e adolescentes em idade es- infantil, o ensino fundamental e o ensino médio, que nortearão os
colar, bem como os jovens e adultos que não concluíram a educação FXUUtFXORVHVHXVFRQWH~GRVPtQLPRVGHPRGRDDVVHJXUDUIRUPDomR
EiVLFD 5HGDomRGDGDSHOD/HLQžGH básica comum;

Didatismo e Conhecimento 28
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
V - coletar, analisar e disseminar informações sobre a educação; mente as necessidades de sua área de competência e com recursos
VI - assegurar processo nacional de avaliação do rendimento acima dos percentuais mínimos vinculados pela Constituição Fe-
escolar no ensino fundamental, médio e superior, em colaboração deral à manutenção e desenvolvimento do ensino.
FRPRVVLVWHPDVGHHQVLQRREMHWLYDQGRDGH¿QLomRGHSULRULGDGHVH VI - assumir o transporte escolar dos alunos da rede munici-
a melhoria da qualidade do ensino; pal.
VII - baixar normas gerais sobre cursos de graduação e pós- 3DUiJUDIR~QLFR2V0XQLFtSLRVSRGHUmRRSWDUDLQGDSRUVH
-graduação; integrar ao sistema estadual de ensino ou compor com ele um sis-
VIII - assegurar processo nacional de avaliação das instituições WHPD~QLFRGHHGXFDomREiVLFD
de educação superior, com a cooperação dos sistemas que tiverem
responsabilidade sobre este nível de ensino; $UW2VHVWDEHOHFLPHQWRVGHHQVLQRUHVSHLWDGDVDVQRUPDV
IX - autorizar, reconhecer, credenciar, supervisionar e avaliar, comuns e as do seu sistema de ensino, terão a incumbência de:
respectivamente, os cursos das instituições de educação superior e I - elaborar e executar sua proposta pedagógica;
os estabelecimentos do seu sistema de ensino. (Vide Lei nº
,,DGPLQLVWUDUVHXSHVVRDOHVHXVUHFXUVRVPDWHULDLVH¿QDQ-
GH
ceiros;
†ž1DHVWUXWXUDHGXFDFLRQDOKDYHUiXP&RQVHOKR1DFLRQDO
III - assegurar o cumprimento dos dias letivos e horas-aula
de Educação, com funções normativas e de supervisão e atividade
estabelecidas;
permanente, criado por lei.
§ 2° Para o cumprimento do disposto nos incisos V a IX, a IV - velar pelo cumprimento do plano de trabalho de cada
União terá acesso a todos os dados e informações necessários de docente;
todos os estabelecimentos e órgãos educacionais. V - prover meios para a recuperação dos alunos de menor ren-
† ž $V DWULEXLo}HV FRQVWDQWHV GR LQFLVR ,; SRGHUmR VHU dimento;
delegadas aos Estados e ao Distrito Federal, desde que mantenham VI - articular-se com as famílias e a comunidade, criando pro-
instituições de educação superior. cessos de integração da sociedade com a escola;
9,,  LQIRUPDU SDL H PmH FRQYLYHQWHV RX QmR FRP VHXV ¿-
$UW2V(VWDGRVLQFXPELUVHmRGH lhos, e, se for o caso, os responsáveis legais, sobre a frequência e
,RUJDQL]DUPDQWHUHGHVHQYROYHURVyUJmRVHLQVWLWXLo}HVR¿- rendimento dos alunos, bem como sobre a execução da proposta
ciais dos seus sistemas de ensino; pedagógica da escola;
,,GH¿QLUFRPRV0XQLFtSLRVIRUPDVGHFRODERUDomRQDRIHUWD 9,,, ± QRWL¿FDU DR &RQVHOKR 7XWHODU GR 0XQLFtSLR DR MXL]
do ensino fundamental, as quais devem assegurar a distribuição pro- competente da Comarca e ao respectivo representante do Minis-
porcional das responsabilidades, de acordo com a população a ser WpULR3~EOLFRDUHODomRGRVDOXQRVTXHDSUHVHQWHPTXDQWLGDGHGH
DWHQGLGDHRVUHFXUVRV¿QDQFHLURVGLVSRQtYHLVHPFDGDXPDGHVVDV faltas acima de cinqüenta por cento do percentual permitido em lei.
HVIHUDVGR3RGHU3~EOLFR
III - elaborar e executar políticas e planos educacionais, em $UW2VGRFHQWHVLQFXPELUVHmRGH
FRQVRQkQFLDFRPDVGLUHWUL]HVHSODQRVQDFLRQDLVGHHGXFDomRLQWH- I - participar da elaboração da proposta pedagógica do estabe-
grando e coordenando as suas ações e as dos seus Municípios; lecimento de ensino;
IV - autorizar, reconhecer, credenciar, supervisionar e avaliar, II - elaborar e cumprir plano de trabalho, segundo a proposta
respectivamente, os cursos das instituições de educação superior e pedagógica do estabelecimento de ensino;
os estabelecimentos do seu sistema de ensino; III - zelar pela aprendizagem dos alunos;
V - baixar normas complementares para o seu sistema de en- IV - estabelecer estratégias de recuperação para os alunos de
sino; menor rendimento;
VI - assegurar o ensino fundamental e oferecer, com prioridade, V - ministrar os dias letivos e horas-aula estabelecidos, além
o ensino médio a todos que o demandarem, respeitado o disposto no
de participar integralmente dos períodos dedicados ao planejamen-
DUWGHVWD/HL
WRjDYDOLDomRHDRGHVHQYROYLPHQWRSUR¿VVLRQDO
VII - assumir o transporte escolar dos alunos da rede estadual.
VI - colaborar com as atividades de articulação da escola com
3DUiJUDIR~QLFR$R'LVWULWR)HGHUDODSOLFDUVHmRDVFRPSHWrQ-
as famílias e a comunidade.
cias referentes aos Estados e aos Municípios.

$UW2V0XQLFtSLRVLQFXPELUVHmRGH $UW2VVLVWHPDVGHHQVLQRGH¿QLUmRDVQRUPDVGDJHVWmR
,RUJDQL]DUPDQWHUHGHVHQYROYHURVyUJmRVHLQVWLWXLo}HVR¿- GHPRFUiWLFDGRHQVLQRS~EOLFRQDHGXFDomREiVLFDGHDFRUGRFRP
ciais dos seus sistemas de ensino, integrando-os às políticas e planos as suas peculiaridades e conforme os seguintes princípios:
educacionais da União e dos Estados; ,SDUWLFLSDomRGRVSUR¿VVLRQDLVGDHGXFDomRQDHODERUDomR
II - exercer ação redistributiva em relação às suas escolas; do projeto pedagógico da escola;
III - baixar normas complementares para o seu sistema de en- II - participação das comunidades escolar e local em conse-
sino; lhos escolares ou equivalentes.
IV - autorizar, credenciar e supervisionar os estabelecimentos
do seu sistema de ensino; $UW2VVLVWHPDVGHHQVLQRDVVHJXUDUmRjVXQLGDGHVHVFR-
V - oferecer a educação infantil em creches e pré-escolas, e, ODUHV S~EOLFDV GH HGXFDomR EiVLFD TXH RV LQWHJUDP SURJUHVVLYRV
com prioridade, o ensino fundamental, permitida a atuação em ou- JUDXVGHDXWRQRPLDSHGDJyJLFDHDGPLQLVWUDWLYDHGHJHVWmR¿QDQ-
tros níveis de ensino somente quando estiverem atendidas plena- FHLUDREVHUYDGDVDVQRUPDVJHUDLVGHGLUHLWR¿QDQFHLURS~EOLFR

Didatismo e Conhecimento 29
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW2VLVWHPDIHGHUDOGHHQVLQRFRPSUHHQGH CAPÍTULO II
I - as instituições de ensino mantidas pela União; DA EDUCAÇÃO BÁSICA
II - as instituições de educação superior criadas e mantidas pela
iniciativa privada; SEÇÃO I
III - os órgãos federais de educação. DAS DISPOSIÇÕES GERAIS

$UW2VVLVWHPDVGHHQVLQRGRV(VWDGRVHGR'LVWULWR)HGHUDO $UW$HGXFDomREiVLFDWHPSRU¿QDOLGDGHVGHVHQYROYHUR
compreendem: educando, assegurar-lhe a formação comum indispensável para o
I - as instituições de ensino mantidas, respectivamente, pelo Po- exercício da cidadania e fornecer-lhe meios para progredir no traba-
GHU3~EOLFRHVWDGXDOHSHOR'LVWULWR)HGHUDO lho e em estudos posteriores.
II - as instituições de educação superior mantidas pelo Poder
3~EOLFRPXQLFLSDO
$UW  $ HGXFDomR EiVLFD SRGHUi RUJDQL]DUVH HP VpULHV
III - as instituições de ensino fundamental e médio criadas e
mantidas pela iniciativa privada; DQXDLVSHUtRGRVVHPHVWUDLVFLFORVDOWHUQkQFLDUHJXODUGHSHUtRGRV
IV - os órgãos de educação estaduais e do Distrito Federal, res- de estudos, grupos não-seriados, com base na idade, na competência
pectivamente. e em outros critérios, ou por forma diversa de organização, sempre
3DUiJUDIR~QLFR1R'LVWULWR)HGHUDODVLQVWLWXLo}HVGHHGXFD- que o interesse do processo de aprendizagem assim o recomendar.
ção infantil, criadas e mantidas pela iniciativa privada, integram seu †ž$HVFRODSRGHUiUHFODVVL¿FDURVDOXQRVLQFOXVLYHTXDQGRVH
sistema de ensino. tratar de transferências entre estabelecimentos situados no País e no
exterior, tendo como base as normas curriculares gerais.
$UW2VVLVWHPDVPXQLFLSDLVGHHQVLQRFRPSUHHQGHP § 2º O calendário escolar deverá adequar-se às peculiaridades
I - as instituições do ensino fundamental, médio e de educação locais, inclusive climáticas e econômicas, a critério do respectivo
LQIDQWLOPDQWLGDVSHOR3RGHU3~EOLFRPXQLFLSDO VLVWHPDGHHQVLQRVHPFRPLVVRUHGX]LURQ~PHURGHKRUDVOHWLYDV
II - as instituições de educação infantil criadas e mantidas pela previsto nesta Lei.
iniciativa privada;
III – os órgãos municipais de educação. $UW $ HGXFDomR EiVLFD QRV QtYHLV IXQGDPHQWDO H PpGLR
será organizada de acordo com as seguintes regras comuns:
$UW$VLQVWLWXLo}HVGHHQVLQRGRVGLIHUHQWHVQtYHLVFODVVL¿- I - a carga horária mínima anual será de oitocentas horas, distri-
cam-se nas seguintes categorias administrativas:
buídas por um mínimo de duzentos dias de efetivo trabalho escolar,
,S~EOLFDVDVVLPHQWHQGLGDVDVFULDGDVRXLQFRUSRUDGDVPDQ-
H[FOXtGRRWHPSRUHVHUYDGRDRVH[DPHV¿QDLVTXDQGRKRXYHU
WLGDVHDGPLQLVWUDGDVSHOR3RGHU3~EOLFR
II - privadas, assim entendidas as mantidas e administradas por ,,DFODVVL¿FDomRHPTXDOTXHUVpULHRXHWDSDH[FHWRDSULPHLUD
pessoas físicas ou jurídicas de direito privado. do ensino fundamental, pode ser feita:
a) por promoção, para alunos que cursaram, com aproveitamen-
$UW$VLQVWLWXLo}HVSULYDGDVGHHQVLQRVHHQTXDGUDUmRQDV to, a série ou fase anterior, na própria escola;
seguintes categorias: b) por transferência, para candidatos procedentes de outras es-
I - particulares em sentido estrito, assim entendidas as que são colas;
instituídas e mantidas por uma ou mais pessoas físicas ou jurídicas c) independentemente de escolarização anterior, mediante ava-
de direito privado que não apresentem as características dos incisos OLDomRIHLWDSHODHVFRODTXHGH¿QDRJUDXGHGHVHQYROYLPHQWRHH[-
abaixo; periência do candidato e permita sua inscrição na série ou etapa ade-
II - comunitárias, assim entendidas as que são instituídas por quada, conforme regulamentação do respectivo sistema de ensino;
grupos de pessoas físicas ou por uma ou mais pessoas jurídicas, in- III - nos estabelecimentos que adotam a progressão regular por
FOXVLYHFRRSHUDWLYDVHGXFDFLRQDLVVHP¿QVOXFUDWLYRVTXHLQFOXDP série, o regimento escolar pode admitir formas de progressão par-
na sua entidade mantenedora representantes da comunidade; cial, desde que preservada a seqüência do currículo, observadas as
III - confessionais, assim entendidas as que são instituídas por normas do respectivo sistema de ensino;
grupos de pessoas físicas ou por uma ou mais pessoas jurídicas que IV - poderão organizar-se classes, ou turmas, com alunos de sé-
DWHQGHPDRULHQWDomRFRQIHVVLRQDOHLGHRORJLDHVSHFt¿FDVHDRGLV- ries distintas, com níveis equivalentes de adiantamento na matéria,
posto no inciso anterior;
para o ensino de línguas estrangeiras, artes, ou outros componentes
,9¿ODQWUySLFDVQDIRUPDGDOHL
curriculares;
TÍTULO V 9DYHUL¿FDomRGRUHQGLPHQWRHVFRODUREVHUYDUiRVVHJXLQWHV
DOS NÍVEIS E DAS MODALIDADES DE EDUCAÇÃO critérios:
E ENSINO a) avaliação contínua e cumulativa do desempenho do aluno,
com prevalência dos aspectos qualitativos sobre os quantitativos e
CAPÍTULO I dos resultados ao longo do período sobre os de eventuais provas
DA COMPOSIÇÃO DOS NÍVEIS ESCOLARES ¿QDLV
b) possibilidade de aceleração de estudos para alunos com atra-
$UW$HGXFDomRHVFRODUFRPS}HVHGH so escolar;
I - educação básica, formada pela educação infantil, ensino fun- c) possibilidade de avanço nos cursos e nas séries mediante ve-
damental e ensino médio; UL¿FDomRGRDSUHQGL]DGR
II - educação superior. d) aproveitamento de estudos concluídos com êxito;

Didatismo e Conhecimento 30
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
e) obrigatoriedade de estudos de recuperação, de preferência $UW$1RVHVWDEHOHFLPHQWRVGHHQVLQRIXQGDPHQWDOHGH
paralelos ao período letivo, para os casos de baixo rendimento es- HQVLQRPpGLRS~EOLFRVHSULYDGRVWRUQDVHREULJDWyULRRHVWXGRGD
colar, a serem disciplinados pelas instituições de ensino em seus história e cultura afro-brasileira e indígena.
regimentos; † ž  2 FRQWH~GR SURJUDPiWLFR D TXH VH UHIHUH HVWH DUWLJR
9,RFRQWUROHGHIUHTrQFLD¿FDDFDUJRGDHVFRODFRQIRUPH incluirá diversos aspectos da história e da cultura que caracterizam a
o disposto no seu regimento e nas normas do respectivo sistema de formação da população brasileira, a partir desses dois grupos étnicos,
ensino, exigida a freqüência mínima de setenta e cinco por cento do tais como o estudo da história da África e dos africanos, a luta dos
total de horas letivas para aprovação; negros e dos povos indígenas no Brasil, a cultura negra e indígena
VII - cabe a cada instituição de ensino expedir históricos esco- brasileira e o negro e o índio na formação da sociedade nacional,
ODUHVGHFODUDo}HVGHFRQFOXVmRGHVpULHHGLSORPDVRXFHUWL¿FDGRV resgatando as suas contribuições nas áreas social, econômica e
GHFRQFOXVmRGHFXUVRVFRPDVHVSHFL¿FDo}HVFDEtYHLV política, pertinentes à história do Brasil.
†ž2VFRQWH~GRVUHIHUHQWHVjKLVWyULDHFXOWXUDDIUREUDVLOHLUD
$UW6HUiREMHWLYRSHUPDQHQWHGDVDXWRULGDGHVUHVSRQViYHLV H GRV SRYRV LQGtJHQDV EUDVLOHLURV VHUmR PLQLVWUDGRV QR kPELWR GH
DOFDQoDUUHODomRDGHTXDGDHQWUHRQ~PHURGHDOXQRVHRSURIHVVRUD todo o currículo escolar, em especial nas áreas de educação artística
carga horária e as condições materiais do estabelecimento. e de literatura e história brasileiras.
3DUiJUDIR~QLFR&DEHDRUHVSHFWLYRVLVWHPDGHHQVLQRjYLVWD
das condições disponíveis e das características regionais e locais, $UW2VFRQWH~GRVFXUULFXODUHVGDHGXFDomREiVLFDREVHUYD-
HVWDEHOHFHUSDUkPHWURSDUDDWHQGLPHQWRGRGLVSRVWRQHVWHDUWLJR rão, ainda, as seguintes diretrizes:
I - a difusão de valores fundamentais ao interesse social, aos di-
$UW2VFXUUtFXORVGDHGXFDomRLQIDQWLOGRHQVLQRIXQGD- reitos e deveres dos cidadãos, de respeito ao bem comum e à ordem
mental e do ensino médio devem ter base nacional comum, a ser democrática;
complementada, em cada sistema de ensino e em cada estabeleci- II - consideração das condições de escolaridade dos alunos em
PHQWRHVFRODUSRUXPDSDUWHGLYHUVL¿FDGDH[LJLGDSHODVFDUDFWHUtV- cada estabelecimento;
ticas regionais e locais da sociedade, da cultura, da economia e dos III - orientação para o trabalho;
HGXFDQGRV 5HGDomRGDGDSHOD/HLQžGH IV - promoção do desporto educacional e apoio às práticas des-
† ž 2V FXUUtFXORV D TXH VH UHIHUH R caput devem abranger, portivas não-formais.
obrigatoriamente, o estudo da língua portuguesa e da matemática,
o conhecimento do mundo físico e natural e da realidade social e $UW1DRIHUWDGHHGXFDomREiVLFDSDUDDSRSXODomRUXUDO
política, especialmente do Brasil. os sistemas de ensino promoverão as adaptações necessárias à sua
§ 2º O ensino da arte, especialmente em suas expressões adequação às peculiaridades da vida rural e de cada região, espe-
regionais, constituirá componente curricular obrigatório nos diversos cialmente:
níveis da educação básica, de forma a promover o desenvolvimento ,FRQWH~GRVFXUULFXODUHVHPHWRGRORJLDVDSURSULDGDVjVUHDLV
cultural dos alunos. 5HGDomRGDGDSHOD/HLQžGH necessidades e interesses dos alunos da zona rural;
†žA educação física, integrada à proposta pedagógica da es- II - organização escolar própria, incluindo adequação do calen-
cola, é componente curricular obrigatório da educação básica, sendo dário escolar às fases do ciclo agrícola e às condições climáticas;
sua prática facultativa ao aluno: III - adequação à natureza do trabalho na zona rural.
I – que cumpra jornada de trabalho igual ou superior a seis ho-
ras; SEÇÃO II
II – maior de trinta anos de idade; DA EDUCAÇÃO INFANTIL
III – que estiver prestando serviço militar inicial ou que, em
situação similar, estiver obrigado à prática da educação física; $UW$HGXFDomRLQIDQWLOSULPHLUDHWDSDGDHGXFDomREiVL-
IV – amparado pelo Decreto-Lei no GHGHRXWXEURGH FDWHPFRPR¿QDOLGDGHRGHVHQYROYLPHQWRLQWHJUDOGDFULDQoDGH
 DWp FLQFR DQRVHPVHXVDVSHFWRVItVLFRSVLFROyJLFRLQWHOHFWXDO
V – (VETADO) e social, complementando a ação da família e da comunidade. (Re-
VI – que tenha prole. GDomRGDGDSHOD/HLQžGH
† ž 2 HQVLQR GD +LVWyULD GR %UDVLO OHYDUi HP FRQWD DV
contribuições das diferentes culturas e etnias para a formação do $UW$HGXFDomRLQIDQWLOVHUiRIHUHFLGDHP
povo brasileiro, especialmente das matrizes indígena, africana e I - creches, ou entidades equivalentes, para crianças de até três
européia. anos de idade;
† ž 1D SDUWH GLYHUVL¿FDGD GR FXUUtFXOR VHUi LQFOXtGR ,,SUpHVFRODVSDUDDVFULDQoDVGH TXDWUR D FLQFR DQRV
obrigatoriamente, a partir da quinta série, o ensino de pelo menos GHLGDGH 5HGDomRGDGDSHOD/HLQžGH
XPD OtQJXD HVWUDQJHLUD PRGHUQD FXMD HVFROKD ¿FDUi D FDUJR GD
comunidade escolar, dentro das possibilidades da instituição. $UW  $ HGXFDomR LQIDQWLO VHUi RUJDQL]DGD GH DFRUGR FRP
† ž  $ P~VLFD GHYHUi VHU FRQWH~GR REULJDWyULR PDV QmR DVVHJXLQWHVUHJUDVFRPXQV 5HGDomRGDGDSHOD/HLQžGH
exclusivo, do componente curricular de que trata o § 2º deste artigo. 
†ž2VFXUUtFXORVGRHQVLQRIXQGDPHQWDOHPpGLRGHYHPLQFOXLU I - avaliação mediante acompanhamento e registro do desen-
os princípios da proteção e defesa civil e a educação ambiental de volvimento das crianças, sem o objetivo de promoção, mesmo para
IRUPDLQWHJUDGDDRVFRQWH~GRVREULJDWyULRV(Incluído pela Lei nº R DFHVVR DR HQVLQR IXQGDPHQWDO ,QFOXtGR SHOD /HL Qž  GH
GH 

Didatismo e Conhecimento 31
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
,,FDUJDKRUiULDPtQLPDDQXDOGH RLWRFHQWDV KRUDVGLVWUL- †ž2VVLVWHPDVGHHQVLQRUHJXODPHQWDUmRRVSURFHGLPHQWRV
EXtGDSRUXPPtQLPRGH GX]HQWRV GLDVGHWUDEDOKRHGXFDFLR- SDUDDGH¿QLomRGRVFRQWH~GRVGRHQVLQRUHOLJLRVRHHVWDEHOHFHUmRDV
QDO ,QFOXtGRSHOD/HLQžGH normas para a habilitação e admissão dos professores.
,,,  DWHQGLPHQWR j FULDQoD GH QR PtQLPR  TXDWUR  KRUDV § 2º Os sistemas de ensino ouvirão entidade civil, constituída
GLiULDVSDUDRWXUQRSDUFLDOHGH VHWH KRUDVSDUDDMRUQDGDLQWH- SHODV GLIHUHQWHV GHQRPLQDo}HV UHOLJLRVDV SDUD D GH¿QLomR GRV
JUDO ,QFOXtGRSHOD/HLQžGH FRQWH~GRVGRHQVLQRUHOLJLRVRª
IV - controle de frequência pela instituição de educação pré-
HVFRODUH[LJLGDDIUHTXrQFLDPtQLPDGH VHVVHQWDSRUFHQWR  $UW$MRUQDGDHVFRODUQRHQVLQRIXQGDPHQWDOLQFOXLUiSHOR
GRWRWDOGHKRUDV ,QFOXtGRSHOD/HLQžGH menos quatro horas de trabalho efetivo em sala de aula, sendo pro-
V - expedição de documentação que permita atestar os proces- gressivamente ampliado o período de permanência na escola.
sos de desenvolvimento e aprendizagem da criança. (Incluído pela †ž6mRUHVVDOYDGRVRVFDVRVGRHQVLQRQRWXUQRHGDVIRUPDV
/HLQžGH alternativas de organização autorizadas nesta Lei.
§ 2º O ensino fundamental será ministrado progressivamente
em tempo integral, a critério dos sistemas de ensino.
SEÇÃO III
DO ENSINO FUNDAMENTAL
SEÇÃO IV
DO ENSINO MÉDIO
$UW2HQVLQRIXQGDPHQWDOREULJDWyULRFRPGXUDomRGH
QRYH DQRVJUDWXLWRQDHVFRODS~EOLFDLQLFLDQGRVHDRV VHLV DQRV $UW2HQVLQRPpGLRHWDSD¿QDOGDHGXFDomREiVLFDFRP
de idade, terá por objetivo a formação básica do cidadão, mediante: GXUDomRPtQLPDGHWUrVDQRVWHUiFRPR¿QDOLGDGHV
I - o desenvolvimento da capacidade de aprender, tendo como I - a consolidação e o aprofundamento dos conhecimentos ad-
meios básicos o pleno domínio da leitura, da escrita e do cálculo; quiridos no ensino fundamental, possibilitando o prosseguimento de
II - a compreensão do ambiente natural e social, do sistema po- estudos;
lítico, da tecnologia, das artes e dos valores em que se fundamenta II - a preparação básica para o trabalho e a cidadania do educan-
a sociedade; do, para continuar aprendendo, de modo a ser capaz de se adaptar
III - o desenvolvimento da capacidade de aprendizagem, tendo FRP ÀH[LELOLGDGH D QRYDV FRQGLo}HV GH RFXSDomR RX DSHUIHLoRD-
em vista a aquisição de conhecimentos e habilidades e a formação mento posteriores;
de atitudes e valores; III - o aprimoramento do educando como pessoa humana, in-
IV - o fortalecimento dos vínculos de família, dos laços de so- cluindo a formação ética e o desenvolvimento da autonomia intelec-
OLGDULHGDGHKXPDQDHGHWROHUkQFLDUHFtSURFDHPTXHVHDVVHQWDD tual e do pensamento crítico;
vida social. ,9  D FRPSUHHQVmR GRV IXQGDPHQWRV FLHQWt¿FRWHFQROyJLFRV
† ž e IDFXOWDGR DRV VLVWHPDV GH HQVLQR GHVGREUDU R HQVLQR dos processos produtivos, relacionando a teoria com a prática, no
fundamental em ciclos. ensino de cada disciplina.
§ 2º Os estabelecimentos que utilizam progressão regular por
série podem adotar no ensino fundamental o regime de progressão $UW2FXUUtFXORGRHQVLQRPpGLRREVHUYDUiRGLVSRVWRQD
continuada, sem prejuízo da avaliação do processo de ensino- Seção I deste Capítulo e as seguintes diretrizes:
aprendizagem, observadas as normas do respectivo sistema de I - destacará a educação tecnológica básica, a compreensão do
ensino. VLJQL¿FDGRGDFLrQFLDGDVOHWUDVHGDVDUWHVRSURFHVVRKLVWyULFRGH
†ž2HQVLQRIXQGDPHQWDOUHJXODUVHUiPLQLVWUDGRHPOtQJXD transformação da sociedade e da cultura; a língua portuguesa como
portuguesa, assegurada às comunidades indígenas a utilização de instrumento de comunicação, acesso ao conhecimento e exercício
suas línguas maternas e processos próprios de aprendizagem. da cidadania;
† ž 2 HQVLQR IXQGDPHQWDO VHUi SUHVHQFLDO VHQGR R HQVLQR D II - adotará metodologias de ensino e de avaliação que estimu-
lem a iniciativa dos estudantes;
GLVWkQFLDXWLOL]DGRFRPRFRPSOHPHQWDomRGDDSUHQGL]DJHPRXHP
III - será incluída uma língua estrangeira moderna, como disci-
situações emergenciais.
plina obrigatória, escolhida pela comunidade escolar, e uma segun-
†ž2FXUUtFXORGRHQVLQRIXQGDPHQWDOLQFOXLUiREULJDWRULD-
da, em caráter optativo, dentro das disponibilidades da instituição.
PHQWH FRQWH~GR TXH WUDWH GRV GLUHLWRV GDV FULDQoDV H GRV DGROHV-
,9±VHUmRLQFOXtGDVD)LORVR¿DHD6RFLRORJLDFRPRGLVFLSOLQDV
FHQWHVWHQGRFRPRGLUHWUL]D/HLQRGHGHMXOKRGH obrigatórias em todas as séries do ensino médio.
que institui o Estatuto da Criança e do Adolescente, observada a †ž2VFRQWH~GRVDVPHWRGRORJLDVHDVIRUPDVGHDYDOLDomR
produção e distribuição de material didático adequado. VHUmR RUJDQL]DGRV GH WDO IRUPD TXH DR ¿QDO GR HQVLQR PpGLR R
†ž2HVWXGRVREUHRVVtPERORVQDFLRQDLVVHUiLQFOXtGRFRPR educando demonstre:
tema transversal nos currículos do ensino fundamental. (Incluído ,GRPtQLRGRVSULQFtSLRVFLHQWt¿FRVHWHFQROyJLFRVTXHSUHVL-
SHOD/HLQžGH  dem a produção moderna;
,,FRQKHFLPHQWRGDVIRUPDVFRQWHPSRUkQHDVGHOLQJXDJHP
$UW2HQVLQRUHOLJLRVRGHPDWUtFXODIDFXOWDWLYDpSDUWHLQ- III (Revogado)
tegrante da formação básica do cidadão e constitui disciplina dos § 2º (Revogado)
KRUiULRVQRUPDLVGDVHVFRODVS~EOLFDVGHHQVLQRIXQGDPHQWDODVVH- † ž 2V FXUVRV GR HQVLQR PpGLR WHUmR HTXLYDOrQFLD OHJDO H
gurado o respeito à diversidade cultural religiosa do Brasil, vedadas habilitarão ao prosseguimento de estudos.
quaisquer formas de proselitismo. †ž 5HYRgado)

Didatismo e Conhecimento 32
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
SEÇÃO IV-A †ž2VVLVWHPDVGHHQVLQRDVVHJXUDUmRJUDWXLWDPHQWHDRVMR-
DA EDUCAÇÃO PROFISSIONAL TÉCNICA DE vens e aos adultos, que não puderam efetuar os estudos na idade
NÍVEL MÉDIO regular, oportunidades educacionais apropriadas, consideradas as
características do alunado, seus interesses, condições de vida e de
$UW$6HPSUHMXt]RGRGLVSRVWRQD6HomR,9GHVWH&DStWX- trabalho, mediante cursos e exames.
lo, o ensino médio, atendida a formação geral do educando, poderá †ž23RGHU3~EOLFRYLDELOL]DUiHHVWLPXODUiRDFHVVRHDSHU-
SUHSDUiORSDUDRH[HUFtFLRGHSUR¿VV}HVWpFQLFDV manência do trabalhador na escola, mediante ações integradas e
3DUiJUDIR~QLFR$SUHSDUDomRJHUDOSDUDRWUDEDOKRHIDFXOWD- complementares entre si.
WLYDPHQWHDKDELOLWDomRSUR¿VVLRQDOSRGHUmRVHUGHVHQYROYLGDVQRV †ž$HGXFDomRGHMRYHQVHDGXOWRVGHYHUiDUWLFXODUVHSUH-
próprios estabelecimentos de ensino médio ou em cooperação com IHUHQFLDOPHQWHFRPDHGXFDomRSUR¿VVLRQDOQDIRUPDGRUHJXOD-
LQVWLWXLo}HVHVSHFLDOL]DGDVHPHGXFDomRSUR¿VVLRQDO mento.

$UW%$HGXFDomRSUR¿VVLRQDOWpFQLFDGHQtYHOPpGLRVHUi $UW2VVLVWHPDVGHHQVLQRPDQWHUmRFXUVRVHH[DPHVVX-
desenvolvida nas seguintes formas: pletivos, que compreenderão a base nacional comum do currículo,
I - articulada com o ensino médio; habilitando ao prosseguimento de estudos em caráter regular.
II - subseqüente, em cursos destinados a quem já tenha concluí- †ž2VH[DPHVDTXHVHUHIHUHHVWHDUWLJRUHDOL]DUVHmR
do o ensino médio. I - no nível de conclusão do ensino fundamental, para os maio-
3DUiJUDIR~QLFR$HGXFDomRSUR¿VVLRQDOWpFQLFDGHQtYHOPp- res de quinze anos;
dio deverá observar: II - no nível de conclusão do ensino médio, para os maiores de
,RVREMHWLYRVHGH¿QLo}HVFRQWLGRVQDVGLUHWUL]HVFXUULFXODUHV dezoito anos.
nacionais estabelecidas pelo Conselho Nacional de Educação; § 2º Os conhecimentos e habilidades adquiridos pelos educandos
II - as normas complementares dos respectivos sistemas de en- por meios informais serão aferidos e reconhecidos mediante exames.
sino;
III - as exigências de cada instituição de ensino, nos termos de CAPÍTULO III
seu projeto pedagógico. DA EDUCAÇÃO PROFISSIONAL
DA EDUCAÇÃO PROFISSIONAL E TECNOLÓGICA
$UW&$HGXFDomRSUR¿VVLRQDOWpFQLFDGHQtYHOPpGLRDU-
ticulada, prevista no inciso I do caput GRDUW%GHVWD/HLVHUi $UW   $ HGXFDomR SUR¿VVLRQDO H WHFQROyJLFD QR FXPSUL-
desenvolvida de forma: mento dos objetivos da educação nacional, integra-se aos diferentes
I - integrada, oferecida somente a quem já tenha concluído o níveis e modalidades de educação e às dimensões do trabalho, da
ensino fundamental, sendo o curso planejado de modo a conduzir ciência e da tecnologia.
RDOXQRjKDELOLWDomRSUR¿VVLRQDOWpFQLFDGHQtYHOPpGLRQDPHVPD †ž2VFXUVRVGHHGXFDomRSUR¿VVLRQDOHWHFQROyJLFDSRGHUmR
LQVWLWXLomRGHHQVLQRHIHWXDQGRVHPDWUtFXOD~QLFDSDUDFDGDDOXQR ser organizados por eixos tecnológicos, possibilitando a construção
II - concomitante, oferecida a quem ingresse no ensino médio de diferentes itinerários formativos, observadas as normas do
ou já o esteja cursando, efetuando-se matrículas distintas para cada respectivo sistema e nível de ensino.
curso, e podendo ocorrer: † ž  $ HGXFDomR SUR¿VVLRQDO H WHFQROyJLFD DEUDQJHUi RV
a) na mesma instituição de ensino, aproveitando-se as oportuni- seguintes cursos:
dades educacionais disponíveis; ,±GHIRUPDomRLQLFLDOHFRQWLQXDGDRXTXDOL¿FDomRSUR¿VVLR-
b) em instituições de ensino distintas, aproveitando-se as opor- nal;
tunidades educacionais disponíveis; ,,±GHHGXFDomRSUR¿VVLRQDOWpFQLFDGHQtYHOPpGLR
c) em instituições de ensino distintas, mediante convênios de ,,,±GHHGXFDomRSUR¿VVLRQDOWHFQROyJLFDGHJUDGXDomRHSyV-
intercomplementaridade, visando ao planejamento e ao desenvolvi- -graduação.
PHQWRGHSURMHWRSHGDJyJLFRXQL¿FDGR † ž  2V FXUVRV GH HGXFDomR SUR¿VVLRQDO WHFQROyJLFD GH
graduação e pós-graduação organizar-se-ão, no que concerne a
$UW'2VGLSORPDVGHFXUVRVGHHGXFDomRSUR¿VVLRQDOWpF- objetivos, características e duração, de acordo com as diretrizes
nica de nível médio, quando registrados, terão validade nacional e curriculares nacionais estabelecidas pelo Conselho Nacional de
habilitarão ao prosseguimento de estudos na educação superior. Educação.
3DUiJUDIR ~QLFR  2V FXUVRV GH HGXFDomR SUR¿VVLRQDO WpFQLFD
de nível médio, nas formas articulada concomitante e subseqüente, $UW$HGXFDomRSUR¿VVLRQDOVHUiGHVHQYROYLGDHPDUWLFXOD-
quando estruturados e organizados em etapas com terminalidade, ção com o ensino regular ou por diferentes estratégias de educação
SRVVLELOLWDUmRDREWHQomRGHFHUWL¿FDGRVGHTXDOL¿FDomRSDUDRWUD- continuada, em instituições especializadas ou no ambiente de tra-
balho após a conclusão, com aproveitamento, de cada etapa que ca- balho.
UDFWHUL]HXPDTXDOL¿FDomRSDUDRWUDEDOKR $UW2FRQKHFLPHQWRDGTXLULGRQDHGXFDomRSUR¿VVLRQDOH
tecnológica, inclusive no trabalho, poderá ser objeto de avaliação,
SEÇÃO V UHFRQKHFLPHQWRHFHUWL¿FDomRSDUDSURVVHJXLPHQWRRXFRQFOXVmRGH
DA EDUCAÇÃO DE JOVENS E ADULTOS estudos.
$UW$VLQVWLWXLo}HVGHHGXFDomRSUR¿VVLRQDOHWHFQROyJLFD
$UW$HGXFDomRGHMRYHQVHDGXOWRVVHUiGHVWLQDGDjTXHOHV além dos seus cursos regulares, oferecerão cursos especiais, abertos
que não tiveram acesso ou continuidade de estudos no ensino funda- à comunidade, condicionada a matrícula à capacidade de aproveita-
mental e médio na idade própria. mento e não necessariamente ao nível de escolaridade.

Didatismo e Conhecimento 33
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
CAPÍTULO IV † ž $SyV XP SUD]R SDUD VDQHDPHQWR GH GH¿FLrQFLDV
DA EDUCAÇÃO SUPERIOR HYHQWXDOPHQWH LGHQWL¿FDGDV SHOD DYDOLDomR D TXH VH UHIHUH HVWH
artigo, haverá reavaliação, que poderá resultar, conforme o caso, em
$UW$HGXFDomRVXSHULRUWHPSRU¿QDOLGDGH desativação de cursos e habilitações, em intervenção na instituição,
I - estimular a criação cultural e o desenvolvimento do espírito em suspensão temporária de prerrogativas da autonomia, ou em des
FLHQWt¿FRHGRSHQVDPHQWRUHÀH[LYR credenciamento. 9LGH/HLQžGH
II - formar diplomados nas diferentes áreas de conhecimento, † ž 1R FDVR GH LQVWLWXLomR S~EOLFD R 3RGHU ([HFXWLYR
DSWRVSDUDDLQVHUomRHPVHWRUHVSUR¿VVLRQDLVHSDUDDSDUWLFLSDomR responsável por sua manutenção acompanhará o processo de
no desenvolvimento da sociedade brasileira, e colaborar na sua for- saneamento e fornecerá recursos adicionais, se necessários, para a
mação contínua; VXSHUDomRGDVGH¿FLrQFLDV
,,,LQFHQWLYDURWUDEDOKRGHSHVTXLVDHLQYHVWLJDomRFLHQWt¿FD
visando o desenvolvimento da ciência e da tecnologia e da criação $UW1DHGXFDomRVXSHULRURDQROHWLYRUHJXODULQGHSHQGHQ-
e difusão da cultura, e, desse modo, desenvolver o entendimento do
te do ano civil, tem, no mínimo, duzentos dias de trabalho acadêmi-
homem e do meio em que vive;
FRHIHWLYRH[FOXtGRRWHPSRUHVHUYDGRDRVH[DPHV¿QDLVTXDQGR
IV - promover a divulgação de conhecimentos culturais, cientí-
houver.
¿FRVHWpFQLFRVTXHFRQVWLWXHPSDWULP{QLRGDKXPDQLGDGHHFRPX-
nicar o saber através do ensino, de publicações ou de outras formas †ž$VLQVWLWXLo}HVLQIRUPDUmRDRVLQWHUHVVDGRVDQWHVGHFDGD
de comunicação; período letivo, os programas dos cursos e demais componentes
V - suscitar o desejo permanente de aperfeiçoamento cultural e FXUULFXODUHV VXD GXUDomR UHTXLVLWRV TXDOL¿FDomR GRV SURIHVVRUHV
SUR¿VVLRQDOHSRVVLELOLWDUDFRUUHVSRQGHQWHFRQFUHWL]DomRLQWHJUDQ- recursos disponíveis e critérios de avaliação, obrigando-se a cumprir
do os conhecimentos que vão sendo adquiridos numa estrutura inte- as respectivas condições.
lectual sistematizadora do conhecimento de cada geração; § 2º Os alunos que tenham extraordinário aproveitamento nos
VI - estimular o conhecimento dos problemas do mundo pre- estudos, demonstrado por meio de provas e outros instrumentos de
sente, em particular os nacionais e regionais, prestar serviços es- DYDOLDomR HVSHFt¿FRV DSOLFDGRV SRU EDQFD H[DPLQDGRUD HVSHFLDO
pecializados à comunidade e estabelecer com esta uma relação de poderão ter abreviada a duração dos seus cursos, de acordo com as
reciprocidade; normas dos sistemas de ensino.
VII - promover a extensão, aberta à participação da população, †žeREULJDWyULDDIUHTrQFLDGHDOXQRVHSURIHVVRUHVVDOYR
visando à difusão das conquistas e benefícios resultantes da criação QRVSURJUDPDVGHHGXFDomRDGLVWkQFLD
FXOWXUDOHGDSHVTXLVDFLHQWt¿FDHWHFQROyJLFDJHUDGDVQDLQVWLWXLomR †ž$VLQVWLWXLo}HVGHHGXFDomRVXSHULRURIHUHFHUmRQRSHUtRGR
noturno, cursos de graduação nos mesmos padrões de qualidade
$UW$HGXFDomRVXSHULRUDEUDQJHUiRVVHJXLQWHVFXUVRVH mantidos no período diurno, sendo obrigatória a oferta noturna nas
programas: LQVWLWXLo}HVS~EOLFDVJDUDQWLGDDQHFHVViULDSUHYLVmRRUoDPHQWiULD
I - cursos seqüenciais por campo de saber, de diferentes níveis
de abrangência, abertos a candidatos que atendam aos requisitos es- $UW2VGLSORPDVGHFXUVRVVXSHULRUHVUHFRQKHFLGRVTXDQ-
tabelecidos pelas instituições de ensino, desde que tenham concluí- do registrados, terão validade nacional como prova da formação re-
do o ensino médio ou equivalente; cebida por seu titular.
II - de graduação, abertos a candidatos que tenham concluído † ž 2V GLSORPDV H[SHGLGRV SHODV XQLYHUVLGDGHV VHUmR SRU
RHQVLQRPpGLRRXHTXLYDOHQWHHWHQKDPVLGRFODVVL¿FDGRVHPSUR- elas próprias registrados, e aqueles conferidos por instituições não-
cesso seletivo; universitárias serão registrados em universidades indicadas pelo
III - de pós-graduação, compreendendo programas de mestra-
Conselho Nacional de Educação.
do e doutorado, cursos de especialização, aperfeiçoamento e outros,
§ 2º Os diplomas de graduação expedidos por universidades
abertos a candidatos diplomados em cursos de graduação e que aten-
HVWUDQJHLUDV VHUmR UHYDOLGDGRV SRU XQLYHUVLGDGHV S~EOLFDV TXH
dam às exigências das instituições de ensino;
IV - de extensão, abertos a candidatos que atendam aos requisi- tenham curso do mesmo nível e área ou equivalente, respeitando-se
tos estabelecidos em cada caso pelas instituições de ensino. os acordos internacionais de reciprocidade ou equiparação.
3DUiJUDIR~QLFR2VUHVXOWDGRVGRSURFHVVRVHOHWLYRUHIHULGRQR † ž 2V GLSORPDV GH 0HVWUDGR H GH 'RXWRUDGR H[SHGLGRV
inciso II do caputGHVWHDUWLJRVHUmRWRUQDGRVS~EOLFRVSHODVLQVWLWXL- por universidades estrangeiras só poderão ser reconhecidos por
ções de ensino superior, sendo obrigatória a divulgação da relação universidades que possuam cursos de pós-graduação reconhecidos
QRPLQDOGRVFODVVL¿FDGRVDUHVSHFWLYDRUGHPGHFODVVL¿FDomREHP e avaliados, na mesma área de conhecimento e em nível equivalente
como do cronograma das chamadas para matrícula, de acordo com ou superior.
os critérios para preenchimento das vagas constantes do respectivo
edital. $UW$VLQVWLWXLo}HVGHHGXFDomRVXSHULRUDFHLWDUmRDWUDQV-
IHUrQFLDGHDOXQRVUHJXODUHVSDUDFXUVRVD¿QVQDKLSyWHVHGHH[LV-
$UW$HGXFDomRVXSHULRUVHUiPLQLVWUDGDHPLQVWLWXLo}HVGH tência de vagas, e mediante processo seletivo.
HQVLQRVXSHULRUS~EOLFDVRXSULYDGDVFRPYDULDGRVJUDXVGHDEUDQ- 3DUiJUDIR~QLFR$VWUDQVIHUrQFLDVH[RI¿FLR dar-se-ão na forma
gência ou especialização. da lei.

$UW$DXWRUL]DomRHRUHFRQKHFLPHQWRGHFXUVRVEHPFRPR $UW$VLQVWLWXLo}HVGHHGXFDomRVXSHULRUTXDQGRGDRFRU-
o credenciamento de instituições de educação superior, terão prazos rência de vagas, abrirão matrícula nas disciplinas de seus cursos a
limitados, sendo renovados, periodicamente, após processo regular alunos não regulares que demonstrarem capacidade de cursá-las
de avaliação. 9LGH/HLQžGH com proveito, mediante processo seletivo prévio.

Didatismo e Conhecimento 34
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW  $V LQVWLWXLo}HV GH HGXFDomR VXSHULRU FUHGHQFLDGDV † ž 1R H[HUFtFLR GD VXD DXWRQRPLD DOpP GDV DWULEXLo}HV
como universidades, ao deliberar sobre critérios e normas de sele- DVVHJXUDGDV SHOR DUWLJR DQWHULRU DV XQLYHUVLGDGHV S~EOLFDV
ção e admissão de estudantes, levarão em conta os efeitos desses poderão:
critérios sobre a orientação do ensino médio, articulando-se com I - propor o seu quadro de pessoal docente, técnico e adminis-
os órgãos normativos dos sistemas de ensino. trativo, assim como um plano de cargos e salários, atendidas as nor-
mas gerais pertinentes e os recursos disponíveis;
$UW$VXQLYHUVLGDGHVVmRLQVWLWXLo}HVSOXULGLVFLSOLQDUHVGH II - elaborar o regulamento de seu pessoal em conformidade
IRUPDomRGRVTXDGURVSUR¿VVLRQDLVGHQtYHOVXSHULRUGHSHVTXLVD com as normas gerais concernentes;
de extensão e de domínio e cultivo do saber humano, que se ca- III - aprovar e executar planos, programas e projetos de investi-
racterizam por: mentos referentes a obras, serviços e aquisições em geral, de acordo
I - produção intelectual institucionalizada mediante o estudo com os recursos alocados pelo respectivo Poder mantenedor;
sistemático dos temas e problemas mais relevantes, tanto do ponto IV - elaborar seus orçamentos anuais e plurianuais;
GHYLVWDFLHQWt¿FRHFXOWXUDOTXDQWRUHJLRQDOHQDFLRQDO 9DGRWDUUHJLPH¿QDQFHLURHFRQWiELOTXHDWHQGDjVVXDVSHFX-
II - um terço do corpo docente, pelo menos, com titulação liaridades de organização e funcionamento;
acadêmica de mestrado ou doutorado; 9,  UHDOL]DU RSHUDo}HV GH FUpGLWR RX GH ¿QDQFLDPHQWR FRP
III - um terço do corpo docente em regime de tempo integral. aprovação do Poder competente, para aquisição de bens imóveis,
3DUiJUDIR~QLFReIDFXOWDGDDFULDomRGHXQLYHUVLGDGHVHVSH- instalações e equipamentos;
cializadas por campo do saber. VII - efetuar transferências, quitações e tomar outras providên-
FLDVGHRUGHPRUoDPHQWiULD¿QDQFHLUDHSDWULPRQLDOQHFHVViULDVDR
$UW  1R H[HUFtFLR GH VXD DXWRQRPLD VmR DVVHJXUDGDV jV seu bom desempenho.
universidades, sem prejuízo de outras, as seguintes atribuições: § 2º Atribuições de autonomia universitária poderão ser
I - criar, organizar e extinguir, em sua sede, cursos e progra- HVWHQGLGDV D LQVWLWXLo}HV TXH FRPSURYHP DOWD TXDOL¿FDomR SDUD R
mas de educação superior previstos nesta Lei, obedecendo às nor- ensino ou para a pesquisa, com base em avaliação realizada pelo
mas gerais da União e, quando for o caso, do respectivo sistema 3RGHU3~EOLFR
de ensino;
,,¿[DURVFXUUtFXORVGRVVHXVFXUVRVHSURJUDPDVREVHUYD- $UW&DEHUij8QLmRDVVHJXUDUDQXDOPHQWHHPVHX2UoD-
das as diretrizes gerais pertinentes; PHQWR *HUDO UHFXUVRV VX¿FLHQWHV SDUD PDQXWHQomR H GHVHQYROYL-
III - estabelecer planos, programas e projetos de pesquisa mento das instituições de educação superior por ela mantidas.
FLHQWt¿FDSURGXomRDUWtVWLFDHDWLYLGDGHVGHH[WHQVmR
,9  ¿[DU R Q~PHUR GH YDJDV GH DFRUGR FRP D FDSDFLGDGH $UW$VLQVWLWXLo}HVS~EOLFDVGHHGXFDomRVXSHULRUREHGHFH-
institucional e as exigências do seu meio; rão ao princípio da gestão democrática, assegurada a existência de
V - elaborar e reformar os seus estatutos e regimentos em con- órgãos colegiados deliberativos, de que participarão os segmentos
VRQkQFLDFRPDVQRUPDVJHUDLVDWLQHQWHV da comunidade institucional, local e regional.
VI - conferir graus, diplomas e outros títulos; 3DUiJUDIR~QLFR(PTXDOTXHUFDVRRVGRFHQWHVRFXSDUmRVH-
9,,¿UPDUFRQWUDWRVDFRUGRVHFRQYrQLRV tenta por cento dos assentos em cada órgão colegiado e comissão,
VIII - aprovar e executar planos, programas e projetos de LQFOXVLYHQRVTXHWUDWDUHPGDHODERUDomRHPRGL¿FDo}HVHVWDWXWiULDV
investimentos referentes a obras, serviços e aquisições em geral, e regimentais, bem como da escolha de dirigentes.
bem como administrar rendimentos conforme dispositivos insti-
tucionais; $UW1DVLQVWLWXLo}HVS~EOLFDVGHHGXFDomRVXSHULRURSUR-
IX - administrar os rendimentos e deles dispor na forma pre- IHVVRU¿FDUiREULJDGRDRPtQLPRGHRLWRKRUDVVHPDQDLVGHDXODV
vista no ato de constituição, nas leis e nos respectivos estatutos;
X - receber subvenções, doações, heranças, legados e coope- CAPÍTULO V
UDomR¿QDQFHLUDUHVXOWDQWHGHFRQYrQLRVFRPHQWLGDGHVS~EOLFDVH DA EDUCAÇÃO ESPECIAL
privadas.
3DUiJUDIR~QLFR3DUDJDUDQWLUDDXWRQRPLDGLGiWLFRFLHQWt¿FD $UW(QWHQGHVHSRUHGXFDomRHVSHFLDOSDUDRVHIHLWRVGHVWD
das universidades, caberá aos seus colegiados de ensino e pesquisa Lei, a modalidade de educação escolar oferecida preferencialmente
decidir, dentro dos recursos orçamentários disponíveis, sobre: QDUHGHUHJXODUGHHQVLQRSDUDHGXFDQGRVFRPGH¿FLrQFLDWUDQVWRU-
,FULDomRH[SDQVmRPRGL¿FDomRHH[WLQomRGHFXUVRV nos globais do desenvolvimento e altas habilidades ou superdota-
II - ampliação e diminuição de vagas; omR 5HGDomRGDGDSHOD/HLQžGH
III - elaboração da programação dos cursos; †ž+DYHUiTXDQGRQHFHVViULRVHUYLoRVGHDSRLRHVSHFLDOL]DGR
IV - programação das pesquisas e das atividades de extensão; na escola regular, para atender às peculiaridades da clientela de
V - contratação e dispensa de professores; educação especial.
VI - planos de carreira docente. § 2º O atendimento educacional será feito em classes, escolas
ou serviços especializados, sempre que, em função das condições
$UW$VXQLYHUVLGDGHVPDQWLGDVSHOR3RGHU3~EOLFRJR]D- HVSHFt¿FDVGRVDOXQRVQmRIRUSRVVtYHODVXDLQWHJUDomRQDVFODVVHV
rão, na forma da lei, de estatuto jurídico especial para atender às comuns de ensino regular.
SHFXOLDULGDGHVGHVXDHVWUXWXUDRUJDQL]DomRH¿QDQFLDPHQWRSHOR † ž $ RIHUWD GH HGXFDomR HVSHFLDO GHYHU FRQVWLWXFLRQDO GR
3RGHU3~EOLFRDVVLPFRPRGRVVHXVSODQRVGHFDUUHLUDHGRUHJLPH Estado, tem início na faixa etária de zero a seis anos, durante a
jurídico do seu pessoal. educação infantil.

Didatismo e Conhecimento 35
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW2VVLVWHPDVGHHQVLQRDVVHJXUDUmRDRVHGXFDQGRVFRP $UW$IRUPDomRGHGRFHQWHVSDUDDWXDUQDHGXFDomREiVLFD
de¿FLrQFLDWUDQVWRUQRVJOREDLVGRGHVHQYROYLPHQWRHDOWDVKDELOLGD- far-se-á em nível superior, em curso de licenciatura, de graduação
GHVRXVXSHUGRWDomR 5HGDomRGDGDSHOD/HLQžGH plena, em universidades e institutos superiores de educação, admiti-
I - currículos, métodos, técnicas, recursos educativos e organi- da, como formação mínima para o exercício do magistério na edu-
]DomRHVSHFt¿FRVSDUDDWHQGHUjVVXDVQHFHVVLGDGHV FDomRLQIDQWLOHQRV FLQFR SULPHLURVDQRVGRHQVLQRIXQGDPHQWDO
,,  WHUPLQDOLGDGH HVSHFt¿FD SDUD DTXHOHV TXH QmR SXGHUHP a oferecida em nível médio na modalidade normal. (Redação dada
atingir o nível exigido para a conclusão do ensino fundamental, em SHOD/HLQžGH
YLUWXGHGHVXDVGH¿FLrQFLDVHDFHOHUDomRSDUDFRQFOXLUHPPHQRU †º A União, o Distrito Federal, os Estados e os Municípios,
tempo o programa escolar para os superdotados; em regime de colaboração, deverão promover a formação inicial, a
III - professores com especialização adequada em nível médio FRQWLQXDGDHDFDSDFLWDomRGRVSUR¿VVLRQDLVGHPDJLVWpULR
ou superior, para atendimento especializado, bem como professores § 2º$IRUPDomRFRQWLQXDGDHDFDSDFLWDomRGRVSUR¿VVLRQDLV
do ensino regular capacitados para a integração desses educandos de magistério poderão utilizar recursos e tecnologias de educação a
nas classes comuns; GLVWkQFLD
IV - educação especial para o trabalho, visando a sua efetiva in- † º $ IRUPDomR LQLFLDO GH SUR¿VVLRQDLV GH PDJLVWpULR GDUi
tegração na vida em sociedade, inclusive condições adequadas para preferência ao ensino presencial, subsidiariamente fazendo uso de
os que não revelarem capacidade de inserção no trabalho competi- UHFXUVRVHWHFQRORJLDVGHHGXFDomRDGLVWkQFLD
WLYRPHGLDQWHDUWLFXODomRFRPRVyUJmRVR¿FLDLVD¿QVEHPFRPR †ž$8QLmRR'LVWULWR)HGHUDORV(VWDGRVHRV0XQLFtSLRV
para aqueles que apresentam uma habilidade superior nas áreas ar- adotarão mecanismos facilitadores de acesso e permanência em
tística, intelectual ou psicomotora; cursos de formação de docentes em nível superior para atuar na
V - acesso igualitário aos benefícios dos programas sociais su- HGXFDomREiVLFDS~EOLFD ,QFOXtGRSHOD/HLQžGH
plementares disponíveis para o respectivo nível do ensino regular. †ž$8QLmRR'LVWULWR)HGHUDORV(VWDGRVHRV0XQLFtSLRV
LQFHQWLYDUmR D IRUPDomR GH SUR¿VVLRQDLV GR PDJLVWpULR SDUD DWXDU
$UW2VyUJmRVQRUPDWLYRVGRVVLVWHPDVGHHQVLQRHVWDEH- QD HGXFDomR EiVLFD S~EOLFD PHGLDQWH SURJUDPD LQVWLWXFLRQDO GH
OHFHUmRFULWpULRVGHFDUDFWHUL]DomRGDVLQVWLWXLo}HVSULYDGDVVHP¿QV bolsa de iniciação à docência a estudantes matriculados em cursos
de licenciatura, de graduação plena, nas instituições de educação
lucrativos, especializadas e com atuação exclusiva em educação es-
superior. ,QFOXtGRSHOD/HLQžGH
SHFLDOSDUD¿QVGHDSRLRWpFQLFRH¿QDQFHLURSHOR3RGHU3~EOLFR
†ž20LQLVWpULRGD(GXFDomRSRGHUiHVWDEHOHFHUQRWDPtQLPD
3DUiJUDIR ~QLFR  2 SRGHU S~EOLFR DGRWDUi FRPR DOWHUQDWLYD
em exame nacional aplicado aos concluintes do ensino médio como
SUHIHUHQFLDODDPSOLDomRGRDWHQGLPHQWRDRVHGXFDQGRVFRPGH¿-
pré-requisito para o ingresso em cursos de graduação para formação
ciência, transtornos globais do desenvolvimento e altas habilidades
de docentes, ouvido o Conselho Nacional de Educação - CNE. (In-
RXVXSHUGRWDomRQDSUySULDUHGHS~EOLFDUHJXODUGHHQVLQRLQGHSHQ-
FOXtGRSHOD/HLQžGH
dentemente do apoio às instituições previstas neste artigo. (Redação
†ž 9(7$'2  ,QFOXtGRSHOD/HLQžGH
GDGDSHOD/HLQžGH
$UW$$IRUPDomRGRVSUR¿VVLRQDLVDTXHVHUHIHUHRLQFLVR
TÍTULO VI ,,,GRDUWIDUVHiSRUPHLRGHFXUVRVGHFRQWH~GRWpFQLFRSHGD-
DOS PROFISSIONAIS DA EDUCAÇÃO gógico, em nível médio ou superior, incluindo habilitações tecnoló-
JLFDV ,QFOXtGRSHOD/HLQžGH
$UW&RQVLGHUDPVHSUR¿VVLRQDLVGDHGXFDomRHVFRODUEiVL- 3DUiJUDIR ~QLFR  *DUDQWLUVHi IRUPDomR FRQWLQXDGD SDUD RV
ca os que, nela estando em efetivo exercício e tendo sido formados SUR¿VVLRQDLVDTXHVHUHIHUHRFDSXWQRORFDOGHWUDEDOKRRXHPLQVWL-
em cursos reconhecidos, são: tuições de educação básica e superior, incluindo cursos de educação
I – professores habilitados em nível médio ou superior para a SUR¿VVLRQDOFXUVRVVXSHULRUHVGHJUDGXDomRSOHQDRXWHFQROyJLFRVH
docência na educação infantil e nos ensinos fundamental e médio; GHSyVJUDGXDomR ,QFOXtGRSHOD/HLQžGH
II – trabalhadores em educação portadores de diploma de peda-
gogia, com habilitação em administração, planejamento, supervisão, $UW2VLQVWLWXWRVVXSHULRUHVGHHGXFDomRPDQWHUmR
inspeção e orientação educacional, bem como com títulos de mes- ,FXUVRVIRUPDGRUHVGHSUR¿VVLRQDLVSDUDDHGXFDomREiVLFD
trado ou doutorado nas mesmas áreas; inclusive o curso normal superior, destinado à formação de docentes
III – trabalhadores em educação, portadores de diploma de cur- para a educação infantil e para as primeiras séries do ensino funda-
VRWpFQLFRRXVXSHULRUHPiUHDSHGDJyJLFDRXD¿P mental;
3DUiJUDIR~QLFR$IRUPDomRGRVSUR¿VVLRQDLVGDHGXFDomRGH II - programas de formação pedagógica para portadores de di-
PRGRDDWHQGHUjVHVSHFL¿FLGDGHVGRH[HUFtFLRGHVXDVDWLYLGDGHV plomas de educação superior que queiram se dedicar à educação
bem como aos objetivos das diferentes etapas e modalidades da edu- básica;
cação básica, terá como fundamentos: ,,,SURJUDPDVGHHGXFDomRFRQWLQXDGDSDUDRVSUR¿VVLRQDLVGH
I – a presença de sólida formação básica, que propicie o conhe- educação dos diversos níveis.
FLPHQWRGRVIXQGDPHQWRVFLHQWt¿FRVHVRFLDLVGHVXDVFRPSHWrQFLDV
de trabalho; $UW$IRUPDomRGHSUR¿VVLRQDLVGHHGXFDomRSDUDDGPLQLV-
II – a associação entre teorias e práticas, mediante estágios su- tração, planejamento, inspeção, supervisão e orientação educacional
pervisionados e capacitação em serviço; para a educação básica, será feita em cursos de graduação em pe-
III – o aproveitamento da formação e experiências anteriores, dagogia ou em nível de pós-graduação, a critério da instituição de
em instituições de ensino e em outras atividades. ensino, garantida, nesta formação, a base comum nacional.

Didatismo e Conhecimento 36
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW$IRUPDomRGRFHQWHH[FHWRSDUDDHGXFDomRVXSHULRU †ž$SDUFHODGDDUUHFDGDomRGHLPSRVWRVWUDQVIHULGDSHOD8QLmR
incluirá prática de ensino de, no mínimo, trezentas horas. aos Estados, ao Distrito Federal e aos Municípios, ou pelos Estados
aos respectivos Municípios, não será considerada, para efeito do cál-
$UW$SUHSDUDomRSDUDRH[HUFtFLRGRPDJLVWpULRVXSHULRU culo previsto neste artigo, receita do governo que a transferir.
far-se-á em nível de pós-graduação, prioritariamente em programas § 2º Serão consideradas excluídas das receitas de impostos men-
de mestrado e doutorado. cionadas neste artigo as operações de crédito por antecipação de recei-
3DUiJUDIR~QLFR2QRWyULRVDEHUUHFRQKHFLGRSRUXQLYHUVLGDGH ta orçamentária de impostos.
FRPFXUVRGHGRXWRUDGRHPiUHDD¿PSRGHUiVXSULUDH[LJrQFLDGH †ž3DUD¿[DomRLQLFLDOGRVYDORUHVFRUUHVSRQGHQWHVDRVPtQL-
título acadêmico. mos estatuídos neste artigo, será considerada a receita estimada na lei
do orçamento anual, ajustada, quando for o caso, por lei que autorizar
$UW2VVLVWHPDVGHHQVLQRSURPRYHUmRDYDORUL]DomRGRV a abertura de créditos adicionais, com base no eventual excesso de
SUR¿VVLRQDLV GD HGXFDomR DVVHJXUDQGROKHV LQFOXVLYH QRV WHUPRV arrecadação.
†ž$VGLIHUHQoDVHQWUHDUHFHLWDHDGHVSHVDSUHYLVWDVHDVHIHWL-
GRVHVWDWXWRVHGRVSODQRVGHFDUUHLUDGRPDJLVWpULRS~EOLFR
vamente realizadas, que resultem no não atendimento dos percentuais
,LQJUHVVRH[FOXVLYDPHQWHSRUFRQFXUVRS~EOLFRGHSURYDVH
mínimos obrigatórios, serão apuradas e corrigidas a cada trimestre do
títulos;
H[HUFtFLR¿QDQFHLUR
,,DSHUIHLoRDPHQWRSUR¿VVLRQDOFRQWLQXDGRLQFOXVLYHFRPOL-
† ž 2 UHSDVVH GRV YDORUHV UHIHULGRV QHVWH DUWLJR GR FDL[D GD
FHQFLDPHQWRSHULyGLFRUHPXQHUDGRSDUDHVVH¿P União, dos Estados, do Distrito Federal e dos Municípios ocorrerá
,,,SLVRVDODULDOSUR¿VVLRQDO imediatamente ao órgão responsável pela educação, observados os
IV - progressão funcional baseada na titulação ou habilitação, e seguintes prazos:
na avaliação do desempenho; I - recursos arrecadados do primeiro ao décimo dia de cada mês,
V - período reservado a estudos, planejamento e avaliação, in- até o vigésimo dia;
cluído na carga de trabalho; II - recursos arrecadados do décimo primeiro ao vigésimo dia de
VI - condições adequadas de trabalho. cada mês, até o trigésimo dia;
†žA experiência docente é pré-requisito para o exercício pro- ,,,UHFXUVRVDUUHFDGDGRVGRYLJpVLPRSULPHLURGLDDR¿QDOGH
¿VVLRQDOGHTXDLVTXHURXWUDVIXQo}HVGHPDJLVWpULRQRVWHUPRVGDV cada mês, até o décimo dia do mês subseqüente.
normas de cada sistema de ensino. †ž2DWUDVRGDOLEHUDomRVXMHLWDUiRVUHFXUVRVDFRUUHomRPR-
†ž3DUDRVHIHLWRVGRGLVSRVWRQR†žGRDUW e no †ž do netária e à responsabilização civil e criminal das autoridades compe-
DUWGD&RQVWLWXLomR)HGHUDOVmRFRQVLGHUDGDVIXQo}HVGHPD- tentes.
gistério as exercidas por professores e especialistas em educação no
desempenho de atividades educativas, quando exercidas em esta- $UW&RQVLGHUDUVHmRFRPRGHPDQXWHQomRHGHVHQYROYL-
belecimento de educação básica em seus diversos níveis e moda- mento do ensino as despesas realizadas com vistas à consecução dos
lidades, incluídas, além do exercício da docência, as de direção de objetivos básicos das instituições educacionais de todos os níveis,
unidade escolar e as de coordenação e assessoramento pedagógico. compreendendo as que se destinam a:
†ž$8QLmRSUHVWDUiDVVLVWrQFLDWpFQLFDDRV(VWDGRVDR'LVWULWR I - remuneração e aperfeiçoamento do pessoal docente e demais
)HGHUDOHDRV0XQLFtSLRVQDHODERUDomRGHFRQFXUVRVS~EOLFRVSDUD SUR¿VVLRQDLVGDHGXFDomR
SURYLPHQWRGHFDUJRVGRVSUR¿VVLRQDLVGDHGXFDomR(Incluído pela II - aquisição, manutenção, construção e conservação de insta-
/HLQžGH lações e equipamentos necessários ao ensino;
III – uso e manutenção de bens e serviços vinculados ao ensino;
TÍTULO VII IV - levantamentos estatísticos, estudos e pesquisas visando
precipuamente ao aprimoramento da qualidade e à expansão do en-
DOS RECURSOS FINANCEIROS
sino;
V - realização de atividades-meio necessárias ao funcionamen-
$UW6HUmRUHFXUVRVS~EOLFRVGHVWLQDGRVjHGXFDomRRVRUL-
to dos sistemas de ensino;
ginários de:
9,FRQFHVVmRGHEROVDVGHHVWXGRDDOXQRVGHHVFRODVS~EOLFDV
I - receita de impostos próprios da União, dos Estados, do Dis- e privadas;
trito Federal e dos Municípios; VII - amortização e custeio de operações de crédito destinadas
II - receita de transferências constitucionais e outras transfe- a atender ao disposto nos incisos deste artigo;
rências; VIII - aquisição de material didático-escolar e manutenção de
III - receita do salário-educação e de outras contribuições so- programas de transporte escolar.
ciais;
,9UHFHLWDGHLQFHQWLYRV¿VFDLV $UW1mRFRQVWLWXLUmRGHVSHVDVGHPDQXWHQomRHGHVHQYROYL-
V - outros recursos previstos em lei. mento do ensino aquelas realizadas com:
I - pesquisa, quando não vinculada às instituições de ensino, ou,
$UW$8QLmRDSOLFDUiDQXDOPHQWHQXQFDPHQRVGHGH]RLWR quando efetivada fora dos sistemas de ensino, que não vise, preci-
e os Estados, o Distrito Federal e os Municípios, vinte e cinco por puamente, ao aprimoramento de sua qualidade ou à sua expansão;
FHQWRRXRTXHFRQVWDQDVUHVSHFWLYDV&RQVWLWXLo}HVRX/HLV2UJkQL- ,,VXEYHQomRDLQVWLWXLo}HVS~EOLFDVRXSULYDGDVGHFDUiWHUDV-
cas, da receita resultante de impostos, compreendidas as transferên- sistencial, desportivo ou cultural;
cias constitucionais, na manutenção e desenvolvimento do ensino ,,,IRUPDomRGHTXDGURVHVSHFLDLVSDUDDDGPLQLVWUDomRS~EOL-
S~EOLFR ca, sejam militares ou civis, inclusive diplomáticos;

Didatismo e Conhecimento 37
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
IV - programas suplementares de alimentação, assistência mé- ,FRPSURYHP¿QDOLGDGHQmROXFUDWLYDHQmRGLVWULEXDPUHVXO-
dico-odontológica, farmacêutica e psicológica, e outras formas de tadosGLYLGHQGRVERQL¿FDo}HVSDUWLFLSDo}HVRXSDUFHODGHVHXSD-
assistência social; trimônio sob nenhuma forma ou pretexto;
9REUDVGHLQIUDHVWUXWXUDDLQGDTXHUHDOL]DGDVSDUDEHQH¿FLDU ,,DSOLTXHPVHXVH[FHGHQWHV¿QDQFHLURVHPHGXFDomR
direta ou indiretamente a rede escolar; III - assegurem a destinação de seu patrimônio a outra escola
VI - pessoal docente e demais trabalhadores da educação, quan- FRPXQLWiULD¿ODQWUySLFDRXFRQIHVVLRQDORXDR3RGHU3~EOLFRQR
do em desvio de função ou em atividade alheia à manutenção e de- caso de encerramento de suas atividades;
senvolvimento do ensino. ,9SUHVWHPFRQWDVDR3RGHU3~EOLFRGRVUHFXUVRVUHFHELGRV
†ž2VUHFXUVRVGHTXHWUDWDHVWHDUWLJRSRGHUmRVHUGHVWLQDGRV
$UW$VUHFHLWDVHGHVSHVDVFRPPDQXWHQomRHGHVHQYROYL- a bolsas de estudo para a educação básica, na forma da lei, para os
mento do ensino serão apuradas e publicadas nos balanços do Poder TXHGHPRQVWUDUHPLQVX¿FLrQFLDGHUHFXUVRVTXDQGRKRXYHUIDOWDGH
3~EOLFRDVVLPFRPRQRVUHODWyULRVDTXHVHUHIHUHR†žGRDUW YDJDVHFXUVRVUHJXODUHVGDUHGHS~EOLFDGHGRPLFtOLRGRHGXFDQGR
da Constituição Federal. ¿FDQGR R 3RGHU 3~EOLFR REULJDGR D LQYHVWLU SULRULWDULDPHQWH QD
expansão da sua rede local.
$UW2VyUJmRV¿VFDOL]DGRUHVH[DPLQDUmRSULRULWDULDPHQWH § 2º As atividades universitárias de pesquisa e extensão poderão
QDSUHVWDomRGHFRQWDVGHUHFXUVRVS~EOLFRVRFXPSULPHQWRGRGLV- UHFHEHU DSRLR ¿QDQFHLUR GR 3RGHU 3~EOLFR LQFOXVLYH PHGLDQWH
SRVWRQRDUWGD&RQVWLWXLomR)HGHUDOQRDUWGR$WRGDV'LV- bolsas de estudo.
posições Constitucionais Transitórias e na legislação concernente.
TÍTULO VIII
$UW$8QLmRHPFRODERUDomRFRPRV(VWDGRVR'LVWULWR DAS DISPOSIÇÕES GERAIS
Federal e os Municípios, estabelecerá padrão mínimo de oportuni-
dades educacionais para o ensino fundamental, baseado no cálculo $UW26LVWHPDGH(QVLQRGD8QLmRFRPDFRODERUDomRGDV
do custo mínimo por aluno, capaz de assegurar ensino de qualidade. agências federais de fomento à cultura e de assistência aos índios,
3DUiJUDIR~QLFR2FXVWRPtQLPRGHTXHWUDWDHVWHDUWLJRVHUi desenvolverá programas integrados de ensino e pesquisa, para oferta
FDOFXODGRSHOD8QLmRDR¿QDOGHFDGDDQRFRPYDOLGDGHSDUDRDQR de educação escolar bilingüe e intercultural aos povos indígenas,
com os seguintes objetivos:
subseqüente, considerando variações regionais no custo dos insu-
I - proporcionar aos índios, suas comunidades e povos, a recu-
mos e as diversas modalidades de ensino.
SHUDomRGHVXDVPHPyULDVKLVWyULFDVDUHD¿UPDomRGHVXDVLGHQWLGD-
des étnicas; a valorização de suas línguas e ciências;
$UW$DomRVXSOHWLYDHUHGLVWULEXWLYDGD8QLmRHGRV(VWDGRV
II - garantir aos índios, suas comunidades e povos, o acesso
será exercida de modo a corrigir, progressivamente, as disparidades
jVLQIRUPDo}HVFRQKHFLPHQWRVWpFQLFRVHFLHQWt¿FRVGDVRFLHGDGH
de acesso e garantir o padrão mínimo de qualidade de ensino.
nacional e demais sociedades indígenas e não-índias.
†ž$DomRDTXHVHUHIHUHHVWHDUWLJRREHGHFHUiDIyUPXODGH
GRPtQLRS~EOLFRTXHLQFOXDDFDSDFLGDGHGHDWHQGLPHQWRHDPHGLGD
$UW$8QLmRDSRLDUiWpFQLFDH¿QDQFHLUDPHQWHRVVLVWHPDV
GR HVIRUoR ¿VFDO GR UHVSHFWLYR (VWDGR GR 'LVWULWR )HGHUDO RX GR
de ensino no provimento da educação intercultural às comunidades
Município em favor da manutenção e do desenvolvimento do ensino. indígenas, desenvolvendo programas integrados de ensino e pesqui-
†ž$FDSDFLGDGHGHDWHQGLPHQWRGHFDGDJRYHUQRVHUiGH¿QLGD sa.
pela razão entre os recursos de uso constitucionalmente obrigatório † ž 2V SURJUDPDV VHUmR SODQHMDGRV FRP DXGLrQFLD GDV
na manutenção e desenvolvimento do ensino e o custo anual do comunidades indígenas.
aluno, relativo ao padrão mínimo de qualidade. § 2º Os programas a que se refere este artigo, incluídos nos
† ž &RP EDVH QRV FULWpULRV HVWDEHOHFLGRV QRV †† ž H ž Planos Nacionais de Educação, terão os seguintes objetivos:
a União poderá fazer a transferência direta de recursos a cada I - fortalecer as práticas sócio-culturais e a língua materna de
HVWDEHOHFLPHQWR GH HQVLQR FRQVLGHUDGR R Q~PHUR GH DOXQRV TXH cada comunidade indígena;
efetivamente freqüentam a escola. II - manter programas de formação de pessoal especializado,
†ž$DomRVXSOHWLYDHUHGLVWULEXWLYDQmRSRGHUiVHUH[HUFLGD destinado à educação escolar nas comunidades indígenas;
em favor do Distrito Federal, dos Estados e dos Municípios se ,,,GHVHQYROYHUFXUUtFXORVHSURJUDPDVHVSHFt¿FRVQHOHVLQ-
estes oferecerem vagas, na área de ensino de sua responsabilidade, FOXLQGR RV FRQWH~GRV FXOWXUDLV FRUUHVSRQGHQWHV jV UHVSHFWLYDV FR-
FRQIRUPHRLQFLVR9,GRDUWHRLQFLVR9GRDUWGHVWD/HLHP munidades;
Q~PHURLQIHULRUjVXDFDSDFLGDGHGHDWHQGLPHQWR IV - elaborar e publicar sistematicamente material didático es-
SHFt¿FRHGLIHUHQFLDGR
$UW$DomRVXSOHWLYDHUHGLVWULEXWLYDSUHYLVWDQRDUWLJRDQ- † ž No que se refere à educação superior, sem prejuízo de
WHULRU ¿FDUi FRQGLFLRQDGD DR HIHWLYR FXPSULPHQWR SHORV (VWDGRV outras ações, o atendimento aos povos indígenas efetivar-se-á, nas
Distrito Federal e Municípios do disposto nesta Lei, sem prejuízo de XQLYHUVLGDGHVS~EOLFDVHSULYDGDVPHGLDQWHDRIHUWDGHHQVLQRHGH
outras prescrições legais. assistência estudantil, assim como de estímulo à pesquisa e desen-
volvimento de programas especiais. ,QFOXtGR SHOD /HL Qž 
$UW2VUHFXUVRVS~EOLFRVVHUmRGHVWLQDGRVjVHVFRODVS~EOL- GH
cas, podendo ser dirigidos a escolas comunitárias, confessionais ou
¿ODQWUySLFDVTXH $UW$ 9(7$'2

Didatismo e Conhecimento 38
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW%2FDOHQGiULRHVFRODULQFOXLUiRGLDGHQRYHPEUR TÍTULO IX
como ‘Dia Nacional da Consciência Negra’. DAS DISPOSIÇÕES TRANSITÓRIAS

$UW23RGHU3~EOLFRLQFHQWLYDUiRGHVHQYROYLPHQWRHD $UWeLQVWLWXtGDD'pFDGDGD(GXFDomRDLQLFLDUVHXP
YHLFXODomRGHSURJUDPDVGHHQVLQRDGLVWkQFLDHPWRGRVRVQtYHLV ano a partir da publicação desta Lei.
e modalidades de ensino, e de educação continuada. †ž$8QLmRQRSUD]RGHXPDQRDSDUWLUGDSXEOLFDomRGHVWD
† ž $ HGXFDomR D GLVWkQFLD RUJDQL]DGD FRP DEHUWXUD H Lei, encaminhará, ao Congresso Nacional, o Plano Nacional de
UHJLPH HVSHFLDLV VHUi RIHUHFLGD SRU LQVWLWXLo}HV HVSHFL¿FDPHQWH Educação, com diretrizes e metas para os dez anos seguintes, em
credenciadas pela União. sintonia com a Declaração Mundial sobre Educação para Todos.
§ 2º A União regulamentará os requisitos para a realização †ž 5HYRJDGRSHODOHLQžGH
de exames e registro de diploma relativos a cursos de educação a † ž  2 'LVWULWR )HGHUDO FDGD (VWDGR H 0XQLFtSLR H
GLVWkQFLD supletivamente, a União, devem:
† ž $V QRUPDV SDUD SURGXomR FRQWUROH H DYDOLDomR GH I 5HYRJDGRSHODOHLQžGH
SURJUDPDV GH HGXFDomR D GLVWkQFLD H D DXWRUL]DomR SDUD VXD a) (Revogado)
implementação, caberão aos respectivos sistemas de ensino, b) (Revogado)
podendo haver cooperação e integração entre os diferentes c) (Revogado)
sistemas. ,,SURYHUFXUVRVSUHVHQFLDLVRXDGLVWkQFLDDRVMRYHQVHDGXO-
†ž$HGXFDomRDGLVWkQFLDJR]DUiGHWUDWDPHQWRGLIHUHQFLDGR WRVLQVX¿FLHQWHPHQWHHVFRODUL]DGRV
que incluirá: III - realizar programas de capacitação para todos os profes-
I - custos de transmissão reduzidos em canais comerciais de sores em exercício, utilizando também, para isto, os recursos da
radiodifusão sonora e de sons e imagens; HGXFDomRDGLVWkQFLD
I - custos de transmissão reduzidos em canais comerciais de IV - integrar todos os estabelecimentos de ensino fundamental
radiodifusão sonora e de sons e imagens e em outros meios de do seu território ao sistema nacional de avaliação do rendimento
comunicação que sejam explorados mediante autorização, conces- escolar.
VmRRXSHUPLVVmRGRSRGHUS~EOLFR 5HGDomRGDGDSHOD/HLQž †ž 5HYRJDGRSHODOHLQžGH
GH
† ž 6HUmR FRQMXJDGRV WRGRV RV HVIRUoRV REMHWLYDQGR D
,,FRQFHVVmRGHFDQDLVFRP¿QDOLGDGHVH[FOXVLYDPHQWHHGX-
SURJUHVVmR GDV UHGHV HVFRODUHV S~EOLFDV XUEDQDV GH HQVLQR
cativas;
fundamental para o regime de escolas de tempo integral.
,,,UHVHUYDGHWHPSRPtQLPRVHP{QXVSDUDR3RGHU3~EOLFR
†ž$DVVLVWrQFLD¿QDQFHLUDGD8QLmRDRV(VWDGRVDR'LVWULWR
pelos concessionários de canais comerciais.
Federal e aos Municípios, bem como a dos Estados aos seus
$UWeSHUPLWLGDDRUJDQL]DomRGHFXUVRVRXLQVWLWXLo}HVGH
0XQLFtSLRV¿FDPFRQGLFLRQDGDVDRFXPSULPHQWRGRDUWGD
ensino experimentais, desde que obedecidas as disposições desta
Constituição Federal e dispositivos legais pertinentes pelos gover-
Lei.
QRVEHQH¿FLDGRV
$UW2VVLVWHPDVGHHQVLQRHVWDEHOHFHUmRDVQRUPDVGH
realização de estágio em sua jurisdição, observada a lei federal $UW$ 9(7$'2  ,QFOXtGRSHODOHLQžGH
sobre a matéria.
$UW$8QLmRRV(VWDGRVR'LVWULWR)HGHUDOHRV0XQLFt-
$UW2HQVLQRPLOLWDUpUHJXODGRHPOHLHVSHFt¿FDDGPL- pios adaptarão sua legislação educacional e de ensino às disposi-
WLGDDHTXLYDOrQFLDGHHVWXGRVGHDFRUGRFRPDVQRUPDV¿[DGDV ções desta Lei no prazo máximo de um ano, a partir da data de sua
pelos sistemas de ensino. publicação.
$UW2VGLVFHQWHVGDHGXFDomRVXSHULRUSRGHUmRVHUDSUR- † ž$V LQVWLWXLo}HV HGXFDFLRQDLV DGDSWDUmR VHXV HVWDWXWRV H
veitados em tarefas de ensino e pesquisa pelas respectivas institui- regimentos aos dispositivos desta Lei e às normas dos respectivos
ções, exercendo funções de monitoria, de acordo com seu rendi- sistemas de ensino, nos prazos por estes estabelecidos.
mento e seu plano de estudos. § 2º O prazo para que as universidades cumpram o disposto
QRVLQFLVRV,,H,,,GRDUWpGHRLWRDQRV
$UW4XDOTXHUFLGDGmRKDELOLWDGRFRPDWLWXODomRSUySULD
SRGHUi H[LJLU D DEHUWXUD GH FRQFXUVR S~EOLFR GH SURYDV H WtWXORV $UW$VFUHFKHVHSUpHVFRODVH[LVWHQWHVRXTXHYHQKDPD
SDUD FDUJR GH GRFHQWH GH LQVWLWXLomR S~EOLFD GH HQVLQR TXH HVWL- ser criadas deverão, no prazo de três anos, a contar da publicação
ver sendo ocupado por professor não concursado, por mais de seis desta Lei, integrar-se ao respectivo sistema de ensino.
DQRVUHVVDOYDGRVRVGLUHLWRVDVVHJXUDGRVSHORVDUWVGD&RQVWL-
WXLomR)HGHUDOHGR$WRGDV'LVSRVLo}HV&RQVWLWXFLRQDLV7UDQ- $UW $V TXHVW}HV VXVFLWDGDV QD WUDQVLomR HQWUH R UHJLPH
sitórias. anterior e o que se institui nesta Lei serão resolvidas pelo Con-
selho Nacional de Educação ou, mediante delegação deste, pelos
$UW  $V LQVWLWXLo}HV GH HGXFDomR VXSHULRU FRQVWLWXtGDV órgãos normativos dos sistemas de ensino, preservada a autonomia
como universidades integrar-se-ão, também, na sua condição de universitária.
instituições de pesquisa, ao Sistema Nacional de Ciência e Tecno-
ORJLDQRVWHUPRVGDOHJLVODomRHVSHFt¿FD $UW(VWD/HLHQWUDHPYLJRUQDGDWDGHVXDSXEOLFDomR

Didatismo e Conhecimento 39
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW5HYRJDPVHDVGLVSRVLo}HVGDV/HLVQžVGH $UWƒ1DLQWHUSUHWDomRGHVWD/HLOHYDUVHmRHPFRQWDRV
dHGH]HPEURGHHGHGHQRYHPEURGHQmR ¿QVsociais e a que ela se dirige, as exigências do bem comum, os
DOWHUDGDVSHODV/HLVQžVGHGHQRYHPEURGHH direitos e deveres individuais e coletivos, e a condição peculiar da
GHGHGH]HPEURGHHDLQGDDV/HLVQžVGHGH criança e do adolescente como pessoas em desenvolvimento.
DJRVWRGHHGHGHRXWXEURGHHDVGHPDLVOHLV
HGHFUHWRVOHLTXHDVPRGL¿FDUDPHTXDLVTXHURXWUDVGLVSRVLo}HV TÍTULO II - DOS DIREITOS FUNDAMENTAIS
em contrário. CAPÍTULO I - DO DIRIETO À VIDA E À SAÚDE
%UDVtOLDGHGH]HPEURGHžGD,QGHSHQGrQFLDH
žGD5HS~EOLFD $UWƒ$FULDQoDHRDGROHVFHQWHWrPGLUHLWRDSURWHomRjYLGD
FERNANDO HENRIQUE CARDOSO HjVD~GHPHGLDQWHDHIHWLYDomRGHSROtWLFDVVRFLDLVS~EOLFDVTXH
Paulo Renato Souza permitam o nascimento e o desenvolvimento sadio e harmonioso,
(VWHWH[WRQmRVXEVWLWXLRSXEOLFDGRQR'28GH em condições dignas de existência.

LEI N° 8.069, DE 13 DE JULHO DE 1990 $UWƒeDVVHJXUDGRjJHVWDQWHDWUDYpVGR6LVWHPDÒQLFRGH


6D~GHRDWHQGLPHQWRSUpHSHULQDWDO
Dispõe sobre o Estatuto da Criança e do Adolescente, e dá † ƒ $ JHVWDQWH VHUi HQFDPLQKDGD DRV GLIHUHQWHV QtYHLV GH
outras providências. DWHQGLPHQWRVHJXQGRFULWpULRVPpGLFRVHVSHFt¿FRVREHGHFHQGRVH
aos princípios de regionalização e hierarquização do Sistema.
LIVRO I - PARTE GERAL § 2° - A parturiente será atendida preferencialmente pelo mesmo
TÍTULO I - DAS DISPOSIÇÕES PRELIMINARES médico que a acompanhou na fase pré-natal.
†ƒ,QFXPEHDR3RGHU3~EOLFRSURSLFLDUDSRLRDOLPHQWDUj
$UWƒ(VWD/HLGLVS}HVREUHDSURWHomRLQWHJUDOjFULDQoDH gestante e à nutriz que dele necessitem.
ao adolescente.
$UW ƒ  2 3RGHU 3~EOLFR DV LQVWLWXLo}HV H RV HPSUHJDGRUHV
Art. 2° - Considera-se criança, para os efeitos desta Lei, a pes- propiciarão condições adequadas ao aleitamento materno, inclusive
soa até doze anos de idade incompletos, e adolescente aquela entre DRV¿OKRVGHPmHVVXEPHWLGDVDPHGLGDSULYDWLYDGHOLEHUGDGH
doze e dezoito anos de idade.
Parágrafo Único - Nos casos expressos em lei, aplica-se ex- $UW2VKRVSLWDLVHGHPDLVHVWDEHOHFLPHQWRVGHDWHQomRj
cepcionalmente este Estatuto às pessoas entre dezoito e vinte e um VD~GHGHJHVWDQWHVS~EOLFRVHSDUWLFXODUHVVmRREULJDGRVD
anos de idade. I - manter registro das atividades desenvolvidas, através de
prontuários individuais, pelo prazo de dezoito anos;
$UWƒ$FULDQoDHRDGROHVFHQWHJR]DPGHWRGRVRVGLUHLWRV ,,LGHQWL¿FDURUHFpPQDVFLGRPHGLDQWHRRUHJLVWURGHVXDLP-
fundamentais inerentes à pessoa humana, sem prejuízo da proteção pressão plantar e digital e da impressão digital da mãe, sem prejuízo
integral de que trata esta Lei, assegurando-se-lhes, por lei ou por de outras formas normatizadas pela autoridade administrativa com-
RXWURVPHLRVWRGDVDVRSRUWXQLGDGHVHIDFLOLGDGHVD¿PGHOKHV petente;
facultar o desenvolvimento físico, mental, moral, espiritual e so- III - proceder a exames visando ao diagnóstiico e terapêutica de
cial, em condições de liberdade e de dignidade. anormalidades no metabolismo do recém-nascido, bem como pres-
tar orientação aos pais;
$UW ƒ  e GHYHU GD IDPtOLD GD FRPXQLGDGH GD VRFLHGDGH IV - fornecer declaração de nascimento onde constem necessa-
HPJHUDOHGR3RGHU3~EOLFRDVVHJXUDUFRPDEVROXWDSULRULGDGH riamente as intercorrências do parto e do desenvolvimento do neo-
DHIHWLYDomRGRVGLUHLWRVUHIHUHQWHVjYLGDjVD~GHjDOLPHQWDomR nato;
j HGXFDomR DR HVSRUWH DR OD]HU j SUR¿VVLRQDOL]DomR j FXOWXUD V - manter alojamento conjunto, possibilitando ao neonato a
à dignidade, ao respeito, à liberdade e à convivência familiar e permanência junto à mãe.
comunitária.
Parágrafo Único - A garantia de prioridade compreende: $UWeDVVHJXUDGRDWHQGLPHQWRPpGLFRjFULDQoDHDRDGR-
a) primazia de receber proteção e socorro em quaisquer cir- OHVFHQWH DWUDYpV GR 6LVWHPD ÒQLFR GH 6D~GH JDUDQWLGR R DFHVVR
FXQVWkQFLDV universal e igualitário às ações e serviços para promoção, proteção
E  SUHFHGrQFLD GR DWHQGLPHQWR QRV VHUYLoRV S~EOLFRV RX GH HUHFXSHUDomRGDVD~GH
UHOHYkQFLDS~EOLFD † ƒ  $ FULDQoD H R DGROHVFHQWH SRUWDGRUHV GH GH¿FLrQFLD
e) preferência na formulação e na execução das políticas so- receberão atendimento especializado.
FLDLVS~EOLFDV †ƒ,QFXPEHDR3RGHU3~EOLFRIRUQHFHUJUDWXLWDPHQWHjTXHOHV
G GHVWLQDomRSULYLOHJLDGDGHUHFXUVRVS~EOLFRVQDViUHDVUHOD- que necessitarem os medicamentos, próteses e outros recursos
FLRQDGDVFRPDSURWHomRjLQIkQFLDHjMXYHQWXGH relativos ao tratamento, habilitação ou reabilitação.

$UWƒ1HQKXPDFULDQoDRXDGROHVFHQWHVHUiREMHWRGHTXDO- $UW2VHVWDEHOHFLPHQWRVGHDWHQGLPHQWRjVD~GHGHYHUmR
quer forma de negligência, discriminação, exploração, violência, proporcionar condições para a permanência em tempo integral de
crueldade e opressão, punido na forma da lei qualquer atentado, um dos pais ou responsável, nos casos de internação de criança ou
por ação ou omissão, aos seus direitos fundamentais. adolescente.

Didatismo e Conhecimento 40
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW   2V FDVRV GH VXVSHLWD RX FRQ¿UPDomR GH PDXVWUDWRV Art. 22 - Aos pais incumbe o dever de sustento, guarda e edu-
contra criança ou adolescente serão obrigatoriamente comunicados FDomRGRV¿OKRVPHQRUHVFDEHQGROKHVDLQGDQRLQWHUHVVHGHVWHV
ao Conselho Tutelar da respectiva localidade, sem prejuízo de outras a obrigação de cumprir e fazer cumprir as determinações judiciais.
providências legais.
$UW$IDOWDRXDFDUrQFLDGHUHFXUVRVPDWHULDLVQmRFRQV-
$UW26LVWHPDÒQLFRGH6D~GHSURPRYHUiSURJUDPDVGH WLWXLPRWLYRVX¿FLHQWHSDUDDSHUGDRXDVXVSHQVmRGRSiWULRSRGHU
assistência médica e odontolóógica para a prevenção das enfermida- Parágrafo Único - Não existindo outro motivo que por si só
des que ordinariamente afetam a população infantil, e campanhas de autorize a decretação da medida, a criança ou o adolescente será
educação sanitária para pais, educadores e alunos. PDQWLGRHPVXDIDPÀLDGHRULJHPDTXDOGHYHUiREULJDWRULDPHQWH
Parágrafo Único - É obrigatória a vacinação das crianças nos ca- VHULQFOXtGDHPSURJUDPDVR¿FLDLVGHDX[tOLR
sos recomendados pelas autoridades sanitárias.
$UW$SHUGDHDVXVSHQVmRGRSiWULRSRGHUVHUmRGHFUHWDGDV
judicialmente, em procedimento contraditório, nos casos previstos
CAPÍTULO II - DO DIREITO À LIBERDADE, AO RESPEITO
na legislação civil, bem como na hipótese de descumprimento injus-
E À DIGNIDADE
WL¿FDGRGRVGHYHUHVHREULJDo}HVDTXHDOXGHRDUW
$UW$FULDQoDHRDGROHVFHQWHWrPGLUHLWRjOLEHUGDGHDR
SEÇÃO II - DA FAMÍLIA NATURAL
respeito e à dignidade como pessoas humanas em processo de de-
senvolvimento e como sujeitos de direitos civis, humanos e sociais $UW(QWHQGHVHSRUIDPtOLDQDWXUDODFRPXQLGDGHIRUPDGD
garantidos na Constituição e nas leis. pelos pais ou qualquer deles e seus descendentes.
$UW2GLUHLWRjOLEHUGDGHFRPSUHHQGHRVVHJXLQWHVDVSHFWRV $UW2V¿OKRVKDYLGRVIRUDGRFDVDPHQWRSRGHUmRVHUUHFR-
,LUYLUHHVWDUQRVORJUDGRXURVS~EOLFRVHHVSDoRVFRPXQLWiULRV nhecidos pelos pais, conjunta ou separadamente, no próprio termo
ressalvadas as restrições legais; de nascimento. Por testamento, mediante escritura ou outro docu-
II - opinião e expressão;> PHQWRS~EOLFRTXDOTXHUTXHVHMDDRULJHPGD¿OLDomR
III - crença e culto religioso; Parágrafo Único - O reconhecimento pode preceder o nasci-
IV - brincar, praticar esportes e divertir--se; PHQWRGR¿OKRRXVXFHGHUOKHDRIDOHFLPHQWRVHGHL[DUGHVFHQGHQ-
V - participar da vida familiar e comunitária, sem discriminação; tes.
VI - participar da vida política, na forma da lei;
9,,EXVFDUUHI~JLRDX[LOLRHRULHQWDomR $UW2UHFRQKHFLPHQWRGRHVWDGRGH¿OLDomRpGLUHLWRSHU-
sonalíssimo, indisponível e imprescritível, podendo ser exercitado
$UW2GLUHLWRDRUHVSHLWRFRQVLVWHQDLQYLRODELOLGDGHGDLQ- contra os pais ou seus herdeiros, sem qualquer restrição, observado
sanidade física, psíquica e moralda criança e do adolescente, abran- o segredo de Justiça.
gendo a preservação da imagem, da identidade, da autonomia, dos
valores, idéias e crenças, dos espaços e objetos pessoais. SEÇÃO III - DA FAMÍLIA SUBSTITUTA
SUBSEÇÃO I - DISPOSIÇÕES GERAIS
$UW(GHYHUGHWRGRVYHODUSHODGLJQLGDGHGDFULDQoDHGR
adolescente, pondo-os a salvo de qualquer tratamento desumano, vio- $UW$FRORFDomRHPIDPtOLDVXEVWLWXWDIDUVHiPHGLDQWH
lento, aterrorizante, vexatório ou constrangedor. guarda, tutela ou adoção, independentemente da situação jurídica da
criança ou adolescente, nos termos desta Lei.
†ƒ6HPSUHTXHSRVVtYHODFULDQoDRXDGROHVFHQWHGHYHUiVHU
CAPÍTULO III - DO DIREITO À CONVIVÊNCIA FAMILIAR
previamente ouvido e a sua opinião devidamente considerada.
E COMUNITÁRIA
§ 2° - Na apreciação do pedido levar-se-á em conta o grau de
SDUHQWHVFRHDUHODomRGDD¿QLGDGHRXGHDIHWLYLGDGHD¿PGHHYLWDU
SEÇÃO I - DISPOSIÇÕES GERAIS
ou minorar as conseqüências decorrentes da medida.
$UW7RGDFULDQoDRXDGROHVFHQWHWHPGLUHLWRDVHUFULDGRH $UW1mRVHGHIHULUiFRORFDomRHPIDPtOLDVXEVWLWXWDDSHV-
educado no seio da sua família e excepcionalmente, em família substi- soa que revele, por qualquer modo, incompatibilidade com a nature-
tuta, assegurada a convivência familiar e comunitária, em ambiente li- za da medida ou não ofereça ambiente familiar adequada.
YUHGDSUHVHQoDGHSHVVRDVGHSHQGHQWHVGHVXEVWkQFLDVHQWRUSHFHQWHV
$UW$FRORFDomRHPIDPtOLDVXEVWLWXWDQmRDGPLWLUiWUDQV-
$UW2V¿OKRVKDYLGRVRXQmRGDUHODomRGRFDVDPHQWRRX ferência da criança ou adolescente a terceiros ou a entidades gover-
SRUDGRomRWHUmRRVPHVPRVGLUHLWRVHTXDOL¿FDo}HVSURLELGDVTXDLV- namentais ou não-governamentais, sem autorização judicial.
TXHUGHVLJQDo}HVGLVFULPLQDWyULDVUHODWLYDVj¿OLDomR
$UW$FRORFDomRHPIDPÀLDVXEVWLWXWDHVWUDQJHLUDFRQVWLWXL
$UW2SiWULRSRGHUVHUiH[HUFLGRHPLJXDOGDGHGHFRQGL- medida excepcional, somente admissível na modalidade de adoção.
ções, pelo pai e pela mãe, na forma do que dispuser a legislação civil,
assegurado a qualquer deles o direito de, em caso de discorGkQFLD $UW$RDVVXPLUDJXDUGDRXDWXWHODRUHVSRQViYHOSUHVWDUi
recorrer à autoridade judiciária competente para a solução da diver- FRPSURPLVVRGHEHPH¿HOPHQWHGHVHPSHQKDURHQFDUJRPHGLDQWH
gência. termo nos autos.

Didatismo e Conhecimento 41
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
SUBSEÇÃO II - DA GUARDA § 2° - É recíproco o direito sucessório entre o adotado, seus des-
cendentes, o adotante, seus ascendentes, descendentes e colaterais
$UW$JXDUGDREULJDjSUHVWDomRGHDVVLVWrQFLDPDWHULDO DWpRƒJUDXREVHUYDGDDRUGHPGHYRFDomRKHUHGLWiULD
moral e educacional à criança ou adolescente, conferindo a seu de-
tentor o direito de opor-se a terceiros, inclusive aos pais. $UW3RGHPDGRWDURVPDLRUHVGHYLQWHHXPDQRVLQGHSHQ-
†ƒ$JXDUGDGHVWLQDVHDUHJXODUL]DUDSRVVHGHIDWRSRGHQGR dentemente de estado civil.
ser deferida, liminar ou incidentaimente, nos procedimentos de † ƒ  1mR SRGHP DGRWDU RV DVFHQGHQWHV H RV LUPmRV GR
tutela e adoção, exceto no de adoção por estrangeiros. adotando.
§ 2° - Excepcionalmente, deferir-se-á a guarda, fora dos casos § 2° - A adoção por ambos os cônjuges ou concubinos poderá
de tutela e adoção, para atender a situações peculiares ou suprir a ser formalizada, desde que um deles tenha completado vinte e um
falta eventual dos pais ou responsável, podendo ser deferido o anos de idade, comprovada a estabilidade da família.
direito de representação para a prática de atos determinados. †ƒ2DGRWDQWHKiGHVHUSHORPHQRVGH]HVVHLVDQRVPDLV
† ƒ $ JXDUGD FRQIHUH j FULDQoD RX DGROHVFHQWH D FRQGLomR velho do que o adotando.
GH GHSHQGHQWH SDUD WRGRV RV ¿QV H HIHLWRV GH GLUHLWR LQFOXVLYH † ƒ  2V GLYRUFLDGRV H RV MXGLFLDOPHQWH VHSDUDGRV SRGHUmR
previdenciários. adotar conjuntamente, contanto que acordem sobre a guarda e o
regime de visitas, e desde que o estágio de convivência tenha sido
$UW23RGHU3~EOLFRHVWLPXODUiDWUDYpVGHDVVLVWrQFLDMX- LQLFLDGRQDFRQVWkQFLDGDVRFLHGDGHFRQMXJDO
UtGLFDLQFHQWLYRV¿VFDLVHVXEVtGLRVRDFROKLPHQWRVREDIRUPDGH † ƒ  $ DGRomR SRGHUi VHU GHIHULGD DR DGRWDQWH TXH DSyV
guarda, de criança ou adolescente órfão ou abandonado. inequívoca manifestação de vontade, vier a falecer no curso do
procedimento, antes de prolatada a sentença.
$UW$JXDUGDSRGHUiVHUUHYRJDGDDTXDOTXHUWHPSRPH-
GLDQWHDWRMXGLFLDOIXQGDPHQWDGRRXYLGRR0LQLVWpULR3~EOLFR $UW$DGRomRVHUiGHIHULGDTXDQGRDSUHVHQWDUUHDLVYDQWD-
gens para o adotando e fundar-se em motivos legítimos.
SUBSEÇÃO III - DA TUTELA
$UW(QTXDQWRQmRGHUFRQWDGHVXDDGPLQLVWUDomRHVDOGDU
$UW$WXWHODVHUiGHIHULGDQRVWHPRVGDOHLFLYLODSHVVRD o seu alcance, não pode o tutor ou o curador adotar o pupilo ou o
de até vinte e um anos incompletos. curatelado.
Parágrafo Único - O deferimento da tutel pressupäe a prévia
decretação da Perda ou suspensão do pátrio poder e implica neces- $UW$DGRomRGHSHQGHGRFRQVHQWLPHQWRGRVSDLVRXGR
sariamente o dever de guarda. representante legal do adotando.
†ƒ2FRQVHQWLPHQWRVHUiGLVSHQVDGRHPUHODomRjFULDQoD
$UW  $ HVSHFLDOL]DomR GH KLSRWHFD OHJDO VHUi GLVSHQVDGD ou adolescente cujos pais sejam desconhecidos ou tenham sido
sempre que o tutelado não possuir bens ou rendimentos ou por qual- destituídos do pátrio poder.
quer outro motivo relevante. § 2° - Em se tratando de adotando maior de doze anos de idade,
Parágrafo Único - A especialização de hipoteca legal será tam- será também necessário o seu consentimento.
bém dispensada se os bens, porventura existentes em nome do tute-
ODGRFRQVWDUHPGHLQVWUXPHQWRS~EOLFRGHYLGDPHQWHUHJLVWUDGRQR $UW  $ DGRomR VHUi SUHFHGLGD GH HVWiJLR GH FRQYLYrQFLD
UHJLVWURGHLPyYHLVRXVHRVUHQGLPHQWRVIRUHPVX¿FLHQWHVDSHQDV com a criança ou adolescente, pelo prazo que a autoridade judiciária
SDUDDPDQWHQoDGRWXWHODGRQmRKDYHQGRVREUDVLJQL¿FDWLYDRXSUR- ¿[DUREVHUYDGDVDVSHFXOLDULGDGHVGRFDVR
vável. † ƒ  2 HVWiJLR GH FRQYLYrQFLD SRGHUi VHU GLVSHQVDGR VH R
adotando não tiver mais de um ano de idade ou se, qualquer que
$UW$SOLFDVHjGHVWLWXLomRGDWXWHODRGLVSRVWRQRDUW seja a sua idade, já estiver na companhia do adotante durante tempo
SUBSEÇÃO IV - DA ADOÇÃO VX¿FLHQWHSDUDVHSRGHUDYDOLDUDFRQYHQLrQFLDGDFRQVWLWXLomRGR
vínculo.
$UW$DGRomRGHFULDQoDHGHDGROHVFHQWHUHJHUVHiVHJXQ- § 2° - Em caso de adoção por estrangeiro residente ou
do o disposto, nesta Lei. domiciliado fora do País, o estágio de convivência, cumprido no
Parágrafo Único - E vedada a adoção por procuração. território nacional, será de no mínimo quinze dias para crianças de
até dois anos de idade, e de no mínimo trinta dias quando se tratar de
$UW2DGRWDQGRGHYHFRQWDUFRPQRPi[LPRGH]RLWRDQRV adotando acima de dois anos de idade.
à data do pedido, salvo se já estiver sob a guarda ou tutela dos ado-
tantes. $UW2YtQFXORGDDGRomRFRQVWLWXLVHSRUVHQWHQoDMXGLFLDO
que será inscrita no registro civil mediante mandado do qual não se
$UW$DGRomRDWULEXLXDFRQGLomRGH¿OKRDRDGRWDGRFRP fornecerá certidão.
os mesmos direitos e deveres, inclusive sucessórios, desligando-o †ƒ$LQVFULomRFRQVLJQDUiRQRPHGRVDGRWDQWHVFRPRSDLV
de qualquer vínculo com pais e parentes, salvo os impedimentos bem como o nome de seus ascendentes.
matrimoniais. § 2° - O mandado judicial, que será arquivado, cancelará o
†ƒ6HXPGRVF{QMXJHVRXFRQFXELQRVDGRWDR¿OKRGRRXWUR registro original do adotado.
PDQWrPVHRVYtQFXORVGH¿OLDomRHQWUHRDGRWDGRHRFyQMXJHRX † ƒ  1HQKXPD REVHUYDomR VREUH D RULJHP GR DWR SRGHUi
concubino do adotante e os respectivos parentes. constar nas certidões do registro.

Didatismo e Conhecimento 42
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
†ƒ$FULWpULRGDDXWRULGDGHMXGLFLiULDSRGHUiVHUIRUQHFLGD III - direito de contestar critérios avaliattivos, podendo recorrer
certidão para a salvaguarda de direitos. jVLQVWkQFLDVHVFRODUHVVXSHULRUHV
†ƒ$VHQWHQoDFRQIHULUiDRDGRWDGRRQRPHGRDGRWDQWHHD IV - direito de organização e participação em entidades estu-
SHGLGRGHVWHSRGHUiGHWHUPLQDUDPRGL¿FDomRGRSUHQRPH dantis;
† ƒ  $ DGRomR SURGX] VHXV HIHLWRV D SDUWLU GR WUkQVLWR HP 9DFHVVRDHVFRODS~EOLFDHJUDWXLWDSUy[LPDGHVXDUHVLGrQFLD
MXOJDGR GD VHQWHQoD H[FHWR QD KLSyWHVH SUHYLVWD QR DUW  † ƒ Parágrafo Único - É direito dos pais ou responsáveis ter ciência
caso em que terá força retroativa à data do óbito. GRSURFHVVRSHGDJyJLFREHPFRPRSDUWLFLSDUGDGH¿QLomRGDVSUR-
postas educacionais.
$UW$DGRomRpLUUHYRJiYHO
$UW   e GHYHU GR (VWDGR DVVHJXUDU j FULDQoD H DR DGROHV-
$UW$PRUWHGRVDGRWDQWHVQmRUHVWDEHOHFHRSiWULRSRGHU cente:
dos pais naturais. I - ensino fundamental, obrigatório e gratuito, inclusive para os
que a ele não tiveram acesso na idade própria;
$UW$DXWRULGDGHMXGLFLiULDPDQWHUiHPFDGDFRPDUFDRX II - progressiva extensão da obrigatoriedadde e gratuidade ao
foro regional, um registro de crianças e adolescentes em condições ensino médio;
de serem adotados e outro de pessoas interessadas na adoção. III - atendimento educacional especializado aos portadores de
†ƒ2GHIHULPHQWRGDLQVFULomRGDUVHiDSyVSUpYLDFRQVXOWD GH¿FLrQFLDSUHIHUHQFLDOPHQWHQDUHGHUHJXODUGHHQVLQR
DRVyUJmRVWpFQLFRVGR-XL]DGRRXYLGRR0LQLVWpULR3~EOLFR IV - atendimento em creche e pré-escola às crianças de zero a
§ 2° - Não será deferida a inscrição se o interessado não seis anos de idade;
VDWLVID]HURVUHTXLVLWRVOHJDLVRXYHUL¿FDGDTXDOTXHUGDVKLSyWHVHV V - acesso aos níveis mais elevados do ensino, da pesquisa e da
SUHYLVWDVQRDUW criação artística, segundo a capacidade de cada um;
VI - oferta de ensino noturno regular, adeqquado às condições
$UW&XLGDQGRVHGHSHGLGRGHDGRomRIRUPXODGRSRUHV- do adolescente trabalhador;
trangeiro residente ou domiciliado fora do País, observar-se-á o dis- VII - atendimento no ensino fundamental, atrravés de progra-
mas suplementares de material didático-escolar, transporte, alimen-
SRVWRQRDUW
WDomRHDVVLVWrQFLDjVD~GH
† ƒ  2 FDQGLGDWR GHYHUi FRPSURYDU PHGLDQWH GRFXPHQWR
†ƒ2DFHVVRDRHQVLQRREULJDWyULRHJUDWXLWRpGLUHLWRS~EOLFR
expedido pela autoridade competente do respectivo domicílio, estar
subjetivo.
devidamente habilitado à adoção, consoante as leis do seu país,
§ 2° - O não-oferecimento do ensino obrigatório pelo Poder
bem como apresentar estudo psicossocial elaborado por agência
3~EOLFR RX VXD RIHUWD LUUHJXODU LPSRUWD UHVSRQVDELOLGDGH GD
especializada e credenciada no país de origem.
autoridade competente.
§ 2° - A autoridade judiciária, de ofício ou a requerimento
† ƒ  &RPSHWH DR 3RGHU 3~EOLFR UHFHQVHDU RV HGXFDQGRV QR
GR 0LQLVWpULR 3~EOLFR SRGHUi GHWHUPLQDU D DSUHVHQWDomR GR WH[WR
ensino fundamental, fazer-lhes a chamada e zelar, junto aos pais ou
pertinente à legislação estrangeira, acompanhado de prova da responsável, pela freqüência à escola.
respectiva vigência.
† ƒ  2V GRFXPHQWRV HP OtQJXD HVWUDQJHLUD VHUmR MXQWDGRV $UW2VSDLVRXUHVSRQViYHOWrPDREULJDomRGHPDWULFXODU
aos autos, devidamente autenticados pela autoridade consular, VHXV¿OKRVRXSXSLORVQDUHGHUHJXODUGHHQVLQR
observados os tratados e convenções internacionais, e acompanhados
GDUHVSHFWLYDWUDGXomRSRUWUDGXWRUS~EOLFRMXUDPHQWDGR $UW   2V GLULJHQWHV GH HVWDEHOHFLPHQWRV GH HQVLQR IXQGD-
†ƒ$QWHVGHFRQVXPDGDDDGRomRQmRVHUiSHUPLWLGDDVDtGD mental comunicarão ao Conselho Tutelar os casos de:
do adotando do território nacional. I - maus-tratos envolvendo seus alunos;
,,UHLWHUDomRGHIDOWDVLQMXVWL¿FDGDVHGHHYDVmRHVFRODUHVJR-
$UW$DGRomRLQWHUQDFLRQDOSRGHUiVHUFRQGLFLRQDGDDHVWX- tados os recursos escolares;
do prévio e análise de uma comissão estadual judiciária de adoção, III - elevados níveis de repetêntia.
que fornecerá o respectivo laudo de habilitação para instruir o pro-
cesso competente. $UW   2 3RGHU 3~EOLFR HVWLPXODUi SHVTXLVDV H[SHULrQFLDV
Parágrafo Único - Competirá à comissão manter registro cen- e novas propostas relativas a calendário, serração, currículo, meto-
tralizado de interessados estrangeiros em adoção. dologia, didática e avaliação, com vistas à inserção de crianças e
adolescentes excluídos do ensino fundamental obrigatório.
CAPÍTULO IV - DO DIREITO À EDUCAÇÃO, À CULTURA,
AO ESPORTE E AO LAZER $UW   1R SURFHVVR HGXFDFLRQDO UHVSHLWDUVHmR RV YDORUHV
culturais, artísticos e históricos próprios do contexto social da crian-
$UW   $ FULDQoD H R DGROHVFHQWH WrP GLUHLWR j HGXFDomR ça e do adolescente, garantindo-se a estes a liberdade de criação e o
visando ao pleno desenvolvimento de sua pessoa, preparo para o acesso às fontes de cultura.
H[HUFtFLRGDFLGDGDQLDHTXDOL¿FDomRSDUDRWUDEDOKRDVVHJXUDQGR-
-se-lhes: $UW2V0XQLFtSLRVFRPDSRLRGRV(VWDGRVHGD8QLmR
I - igualdade de condições para o acesso e permanência na es- estimularão e facilitarão a destinação de recursos e espaços para pro-
cola; JUDPDo}HVFXOWXUDLVHVSRUWLYDVHGHOD]HUYROWDGDVSDUDDLQIkQFLDH
II - direito de ser respeitado por seus eduucadores; a juventude.

Didatismo e Conhecimento 43
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
CAPÍTULO V - DO DIREITO À PROFISSIONALIZAÇÃO E TÍTULO III - DA PREVENÇÃO
À PROTEÇÃO NO TRABALHO
CAPÍTULO I - DISPOSIÇÕES GERAIS
$UWeSURLELGRTXDOTXHUWUDEDOKRDPHQRUHVGHTXDWRU]H
anos de idade, salvo na condição de aprendiz. $UWeGHYHUGHWRGRVSUHYHQLUDRFRUUrQFLDGHDPHDoDRX
violação dos direitos da criança e do adolescente.
$UW$SURWHomRDRWUDEDOKRGRVDGROHVFHQWHVpUHJXODGD
por legislação especial, sem prejuízo do disposto nesta Lei. $UW$FULDQoDHRDGROHVFHQWHWrPGLUHLWRDLQIRUPDomRFXO-
tura, lazer, esportes, diversões, espetáculos e produtos e serviços que
$UW&RQVLGHUDVHDSUHQGL]DJHPDIRUPDomRWpFQLFRSUR- respeitem sua condição peculiar de pessoa em desenvolvimento.
¿VVLRQDOPLQLVWUDGDVHJXQGRDVGLUHWUL]HVHEDVHVGDOHJLVODomRGH
educação em vigor. $UW$VREULJDo}HVSUHYLVWDVQHVWD/HLQmRH[FOXHPGDSUH-
venção especial outras decorrentes dos princípios por ela adorados.
$UW  $ IRUPDomR WpFQLFRSUR¿VVLRQDO REHGHFHUi DRV VH-
guintes princípios: $UW$LQREVHUYkQFLDGDVQRUPDVGHSUHYHQomRLPSRUWDUiHP
I - garantia de acesso e freqüência obrigatória ao ensino re- UHVSRQVDELOLGDGHGDSHVVRD¿VLFDRXMXUtGLFDQRVWHUPRVGHVWD/HL
gular;
II - atividade compatível com o desenvolvimmento do ado- CAPÍTULO II - DA PREVENÇÃO ESPECIAL
lescente;
III - horário especial para o exercício das atividades. SEÇÃO I - DA INFORMAÇÃO, CULTURA, LAZER, ESPOR-
TES, DIVERSÕES E ESPETÁCULOS
$UW$RDGROHVFHQWHDWpTXDWRU]HDQRVGHLGDGHpDVVHJX-
rada bolsa de aprendizagem. $UW23RGHU3~EOLFRDWUDYpVGRyUJmRFRPSHWHQWHUHJXODUi
DVGLYHUV}HVHHVSHWiFXORVS~EOLFRVLQIRUPDQGRVREUHDQDWXUH]DGH-
$UW$RDGROHVFHQWHDSUHQGL]PDLRUGHTXDWRU]HDQRVVmR
les, as faixas etárias a que não se recomendem, locais e horário em que
assegurados os direitos trabalhistas e previdenciários.
sua apresentação se mostre inadequada.
Parágrafo Único - Os responsáveis pelas diversões e espetáculos
$UW$RDGROHVFHQWHSRUWDGRUGHGH¿FLrQFLDpDVVHJXUDGR
S~EOLFRVGHYHUmRD¿[DUHPOXJDUYLVtYHOHGHIiFLODFHVVRjHQWUDGD
trabalho protegido.
do local de exibição, informação destacada sobre a natureza do es-
SHWiFXORHDIDL[DHWiULDHVSHFL¿FDGDQRFHUWL¿FDGRGHFODVVL¿FDomR
$UW$RDGROHVFHQWHHPSUHJDGRDSUHQGL]HPUHJLPHID-
miliar de trabalho, aluno de escola técnica, assistido em entidade
$UW7RGDFULDQoDRXDGROHVFHQWHWHUiDFHVVRjVGLYHUV}HVH
governamental ou não-governamental, é vedado trabalho:
I - noturno, realizado entre as vinte e duas horas de um dia e HVSHWiFXORVS~EOLFRVFODVVL¿FDGRVFRPRDGHTXDGRVjVXDIDL[DHWiULD
as cinco horas do dia seguinte; Parágrafo Único - As crianças menores de dez anos somente po-
II - perigoso, insalubre ou penoso; derão ingressar e permanecer nos locais de apresentação ou exibição
III - realizado em locais prejudiciais à suaa formação e ao seu quando acompanhadas dos pais ou responsável.
desenvolvimento físico, psíquico, moral e social;
IV - realizado em horários e locais que nãoo permitam a fre- $UW$VHPLVVRUDVGHUiGLRHWHOHYLVmRVRPHQWHH[LELUmRQR
qüência à escola. KRUiULRUHFRPHQGDGRSDUDRS~EOLFRLQIDQWRMXYHQLOSURJUDPDVFRP
¿QDOLGDGHVHGXFDWLYDVDUWtVWLFDVFXOWXUDLVHLQIRUPDWLYDV
$UW2SURJUDPDVRFLDOTXHWHQKDSRUEDVHRWUDEDOKRHGX- Parágrafo Único - Nenhum espetáculo será apresentado ou anun-
cativo, sob responsabilidade de entidade governamental ou não- FLDGRVHPDYLVRGHVXDFODVVL¿FDomRDQWHVGHVXDWUDQVPLVVmRDSUH-
JRYHUQDPHQWDO VHP ¿QV OXFUDWLYRV GHYHUi DVVHJXUDU DR DGROHV- sentação ou exibição.
cente que dele participe condições de capacitação para o exercício
de atividade regular remunerada. $UW2VSURSULHWiULRVGLUHWRUHVJHUHQWHVHIXQFLRQiULRVGH
†ƒ(QWHQGHVHSRUWUDEDOKRHGXFDWLYRDDWLYLGDGHODERUDO HPSUHVDVTXHH[SORUHPDYHQGDRXDOXJXHOGH¿WDVGHSURJUDPDo}HV
em que as exigências pedagógicas relativas ao desenvolvimento em vídeo cuidarão para que não haja venda ou locação em desacordo
pessoal e social do educando prevalecem sobre o aspecto produtivo. FRPDFODVVL¿FDomRDWULEXtGDSHORyUJmRFRPSHWHQWH
§ 2° - A remuneração que o adolescente recebe pelo trabalho 3DUiJUDIRÒQLFR$V¿WDVDTXHDOXGHHVWHDUWLJRGHYHUmRH[tELU
efetuado ou a participação na venda dos produtos de seu trabalho no invólucro, informação sobre a natureza da obra e a faixa etária a
QmRGHV¿JXUDRFDUiWHUHGXFDWLYR que se destinam.

$UW   2 DGROHVFHQWH WHP GLUHLWR j SUR¿VVLRQDOL]DomR H j $UW$VUHYLVWDVHSXEOLFDo}HVFRQWHQGRPDWHULDOLPSUySULR


proteção no trabalho, observados os seguintes aspectos, entre ou- ou inadequado a crianças e adolescentes deverão ser comercializadas
tros: HPHPEDODJHPODFUDGDFRPDDGYHUWrQFLDGHVHXFRQWH~GR
I - respeito à condição peculiar de pessoa em desenvolvimen- Parágrafo Único - As editoras cuidarão para que as capas que
to; FRQWHQKDPPHQVDJHQVSRUQRJUi¿FDVRXREVFHQDVVHMDPSURWHJLGDV
,,FDSDFLWDomRSUR¿VVLRQDODGHTXDGDDRPHUFDGRGHWUDEDOKR com embalagem opaca.

Didatismo e Conhecimento 44
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW  $V UHYLVWDV H SXEOLFDo}HV GHVWLQDGDV DR S~EOLFR LQ- LIVRO II - PARTE ESPECIAL
fantoMXYHQLOQmRSRGHUmRFRQWHULOXVWUDo}HVIRWRJUD¿DVOHJHQGDV TÍTULO I - DA POLÍTICA DE ATENDIMENTO
FU{QLFDVRXDQ~QFLRVGHEHELGDVDOFRyOLFDVWDEDFRDUPDVHPX- CAPÍTULO I - DISPOSIÇÕES GERAIS
nições, e deverão respeitar os valores éticos e sociais da pessoa e
da família. $UW  $ SROtWLFD GH DWHQGLPHQWR GRV GLUHLWRV GD FULDQoD H
do adolescente far-se-á através de um conjunto articulado de ações
$UW2VUHVSRQViYHLVSRUHVWDEHOHFLPHQWRVTXHH[SORUHP governamentais e não-governamentais, da União, dos Estados, do
comercialmente bilhar, sinuca ou congênere ou por casas de jogos, Distrito Federal e dos Municípios.
assim entendidas as que realizem apostas, ainda que eventualmen-
te, cuidarão para que não seja permitida a entrada e a permanência $UW6mROLQKDVGHDomRGDSROtWLFDGHDWHQGLPHQWR
GHFULDQoDVHDGROHVFHQWHVQRORFDOD¿[DQGRDYLVRSDUDRULHQWDomR I - políticas sociais básicas;
GRS~EOLFR II - políticas e programas de assistência ssocial, em caráter su-
pletivo, para aqueles que deles necessitem;
III - serviços especiais de prevenção e atenndimento médico
SEÇÃO II - DOS PRODUTOS E SERVIÇOS
e psicossocial às vítimas de negligência, maus-tratos, exploração,
abuso, crueldade e opressão;
$UWe3URLELGDDYHQGDjFULDQoDRXDRDGROHVFHQWHGH
,9VHUYLoRGHLGHQWL¿FDomRHORFDOL]DomRRGHSDLVUHVSRQVi-
I - armas, munições e explosivos;
vel, crianças e adolescentes desaparecidos;
II - bebidas alcoólicas;< V - proteção jurídico-social por entidades de defesa dos direitos
III - produtos cujos componentes possam caussar dependência da criança e do adolescente.
física ou psíquica ainda que por utilização indevida;
IV - fogos de estampido e de artifício, excceto aqueles que $UW6mRGLUHWUL]HVGDSROtWLFDGHDWHQGLPHQWR
pelo seu reduzido potencial sejam incapazes de provocar qualquer I - municipalização do atendimento;
dano físico em caso de utilização indevida; II - criação de conselhos municipais, estadduais e nacional dos
9UHYLVWDVHSXEOLFDo}HVDTXHDOXGHRDUW direitos da criança e do adolescente, orgãos deliberativos e controla-
VI - bilhetes lotéricos e equivalentes. dores das ações em todos os níveis, assegurada a participação popu-
lar paritária por meio de organizações representativas, segundo leis
$UWeSURLELGDDKRVSHGDJHPGHFULDQoDRXDGROHVFHQWH federal, estaduais e municipais;
em hotel, motel, pensão ou estabelecimento congênere, salvo se ,,,FULDomRHPDQXWHQomRGHSURJUDPDVHVSHHFt¿FRVREVHUYD-
autorizado ou acompanhado pelos pais ou responsável. da a descentralização político-administrativa;
IV - manutenção de fundos nacional, estaduaais e municipais
SEÇÃO III - DA AUTORIZAÇÃO PARA VIAJAR vinculados aos respectivos conselhos dos direitos da criança e do,
adolescente;
$UW1HQKXPDFULDQoDSRGHUiYLDMDUSDUDIRUDGDFRPDUFD V - integração operacional de órgãos do Judiciário, Ministério
onde reside, desacompanhada dos pais ou responsável, sem ex- 3~EOLFR 'HIHQVRULD 6HJXUDQoD 3~EOLFD H$VVLVWrQWLD 6RFLDO SUH-
pressa autorização judicial. ferencialmente em um mesmo local, para efeito de agilização do
†ƒ$DXWRUL]DomRQmRVHUiH[LJLGDTXDQGR atendimento inicial a adolescente a quem se atribua autoria de ato
a) tratar-se de comarca contígua à da residência da criança, infracional;
se na mesma unidade da Federação, ou incluída na mesma região 9,PRELOL]DomRGDRSLQLmRS~EOLFDQRVHQWWLGRGDLQGLVSHQVi-
metropolitana; vel participação dos diversos segmentos da sociedade.
b) a criança estiver acompanhada:
$UW  $ IXQomR GH PHPEUR GR &RQVHOKR 1DFLRQDO H GRV
 GHDVFHQGHQWHRXFRODWHUDOPDLRUDWpRWHUFHLURJUDXFRP-
conselhos estaduais e municipais dos direitos da criança e do ado-
provado documentalmente o parentesco;
OHVFHQWHpFRQVLGHUDGDGHLQWHUHVVHS~EOLFRUHOHYDQWHHQmRVHUiUH-
2) de pessoa maior, expressamente autorizada pelo pai, mãe
munerada.
ou responsável.
§ 2° - A autoridade judiciária poderá, a pedido dos pais ou CAPÍTULO II - DAS ENTIDADES DE ATENDIMENTO
responsável. conceder autorização válida por dois anos.
SEÇÃO I - DISPOSIÇÕES GERAIS
$UW4XDQGRVHWUDWDUGHYLDJHPDRH[WHULRUDDXWRUL]DomR
é dispensável, se a criança ou adolescente: $UW  $V HQWLGDGHV GH DWHQGLPHQWR VmR UHVSRQViYHLV SHOD
I - estiver acompanhado de ambos os pais ou responsável; manutenção das próprias unidades, assim como pelo planejamento e
II - viajar na companhia de um dos pais, auutorizado expres- execução de programas de proteção e sócio-educativos destinados a
VDPHQWHSHORRXWURDWUDYpVGHGRFXPHQWRFRP¿UPDUHFRQKHFLGD crianças e adolescentes, em regime de:
I - orientação e apoio sócio-familiar;
$UW6HPSUpYLDHH[SUHVVDDXWRUL]DomRMXGLFLDOQHQKXPD II - apoio sócio-educativo em meio aberto;<
criança ou adolescente nascido em território nacional poderá sair III - colocação familiar;<
do País em companhia de estrangeiro residente ou domiciliado no IV - abrigo;
exterior. V - liberdade assistida;

Didatismo e Conhecimento 45
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
VI - semiliberdade; VII - oferecer instalações físicas em condiçções adequadas de
VII - internação, habitabilidade, higiene, salubridade e segurança e os objetos neces-
Parágrafo Único - As entidades govemamentais e não-gover- sários à higiene pessoal;
namentais deverão proceder a inscrição de seus programas, especi- 9,,,RIHUHFHUYHVWXiULRHDOLPHQWDomRVX¿FFLHQWHVHDGHTXDGRV
¿FDQGRRVUHJLPHVGHDWHQGLPHQWRQDIRUPDGH¿QLGDQHVWHDUWLJR à faixa etária dos adolescentes atendidos;
junto ao Conselho Municipal dos Direitos da Criança e do Adoles- IX - oferecer cuidados médicos, psicológicoos, odontológicos
cente, o qual manterá registro das inscrições e de suas alterações, do e farmacêuticos;
que fará comunicação ao Conselho Tutelar e à autoridade judiciária. ;SURSLFLDUHVFRODUL]DomRHSUR¿VVLRQDOL]DomR
XI - propiciar atividades culturais, esporttivas e de lazer;
$UW  $V HQWLGDGHV QmRJRYHPDPHQWDLV VRPHQWH SRGHUmR XII - propiciar assistência religiosa àquelees que desejarem, de
funcionar depois de registradas no Conselho Municipal dos Direi- acordo com suas crenças;
tos da Criança e do Adolescente, o qual comunicará o registro ao XIII - proceder a estudo social e pessoal de cada caso;
Conselho Tutelar e à autoridade judiciária da respectiva localidade. XIV - reavaliar periodicamente cada caso, coom intervalo má-
Parágrafo Único - Será negado o registro à entidade que: ximo de seis meses, dando ciência dos resultados à autoridade com-
a) não ofereça instalações físicas em condições adequadas de petente;
habitabilidade, higiene, salubridade e segurança; XV - informar, periodicamente, o adolescentte internado sobre
b) não apresente plano de trabalho compatível com os princí- sua situação processual;
pios desta Lei; XVI - comunicar às autoridades competentes ttodos os casos de
c) esteja irregularmente constituída; adolescente portadores de moléstias infecto-contagiosas;
d) tenha em seus quadros pessoas inidôneas, XVII - fornecer comprovante de depósito dos ppertences dos
adolescentes;
$UW$VHQWLGDGHVTXHGHVHQYROYDPSURJUDPDVGHDEULJR XVIII - manter programas destinados ao apoio ee acompanha-
deverão adotar os seguintes princípios: mento de egressos;
I - preservação dos vínculos familiares; XIX - providenciar os documentos necessárioss ao exercício da
II - integração em família substituta, quanndo esgotados os re- cidadania àqueles que não os tiverem;
cursos de manutenção na família de origem; XX - manter arquivo de anotações onde consttem data e cir-
III - atendimento personalizado e em pequenoos grupos;
FXQVWkQFLDVGRDWHQGLPHQWRQRPHGRDGROHVFHQWHVHXVSDLVRXUHV-
IV - desenvolvimento de atividades em regimme de co-educa-
ponsável, parentes, endereços, sexo, idade, acompanhamento da sua
ção;
formação, relação de seus pertences e demais dados que possibili-
V - não-desmembramento de grupos de irmãos;
WHPVXDLGHQWL¿FDomRHDLQGLYLGXDOL]DomRGRDWHQGLPHQWR
VI - evitar, sempre que possível, a transfeerência para outras
† ƒ  $SOLFDPVH QR TXH FRXEHU DV REULJDo}HV FRQVWDQWHV
entidades de crianças e adolescentes abrigados;
deste artigo às entidades que mantêm programa de abrigo.
VII - participação na vida da comunidade loccal;
§ 2° - No cumprimento das obrigações a que alude este artigo as
VIII - preparação gradativa para o desligamennto;
entidades utilizarão preferencialmente os recursos da comunidade.
IX - participação de pessoas da comunidade no processo edu-
cativo,
Parágrafo Único - O dirigente de entidade de abrigo é equipara- SEÇÃO II - DA FISCALIZAÇÃO DAS ENTIDADES
do ao guardião, para todos os efeitos de direito.
$UW$VHQWLGDGHVJRYHUQDPHQWDLVHQmRJRYHUQDPHQWDLV
$UW   $V HQWLGDGHV TXH PDQWHQKDP SURJUDPD GH DEULJR UHIHULGDVQRDUWVHUmR¿VFDOL]DGDVSHOR-XGLFLiULRSHOR0LQLVWp-
poderão, em caráter excepcional e de urgência, abrigar crianças e ULR3~EOLFRHSHORV&RQVHOKRV7XWHODUHV
adolescentes sem prévia determinação da autoridade competente,
ID]HQGRFRPXQLFDomRGRIDWRDWpRƒGLD~WLOLPHGLDWR $UW2VSODQRVGHDSOLFDomRHDVSUHVWDo}HVGHFRQWDVVHUmR
apresentados ao Estado ou ao Município, conforme a origem das
$UW$VHQWLGDGHVTXHGHVHQYROYHPSURJUDPDVGHLQWHUQD- dotações orçamentárias.
ção têm as seguintes obrigações, entre outras:
I - observar os direitos e garantias de que são titulares os ado- $UW0HGLGDVDSOLFiYHLVjVHQWLGDGHVGHDWHQGLPHQWRTXH
lescentes; GHVFXPSULUHPREULJDomRFRQVWDQWHGRDUWVHPSUHMXt]RGDUHV-
II - não restringir nenhum direito que não tenha sido objeto de ponsabilidade civil e criminal de seus dirigentes ou prepostos:
restrição na decisão de internação; I - às entidades governamentais:
III - oferecer atendimento personalizado, emm pequenas unida- a) advertência;
des e grupos reduzidos; b) afastamento provisório de seus dirigentes;
IV - preservar a identidade e oferecer ambiiente de respeito e F DIDVWDPHQWRGH¿QLWLYRGHVHXVGLULJHQWHV
dignidade ao adolescente; d) fechamento de unidade ou interdição de programa;
V - diligenciar no sentido do restabelecimento e da preservação II - às entidades não-governamentais:<
dos vínculos familiares; a) advertência;
VI - comunicar à autoridade judiciária, perriodicamente, os E VXVSHQVmRWRWDORXSDUFLDOGRUHSDVVHGHYHUEDVS~EOLFDV
casos em que se mostre inviável ou impossível o reatamento dos c) interdição de unidades ou suspensão de programa;
vínculos familiares; d) cassação do registro.

Didatismo e Conhecimento 46
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Parágrafo Único - Em caso de reiteradas infrações cometidas TÍTULO III - DA PRÁTICA DE ATO INFRACIONAL
por entidades de atendimento, que coloquem em risco os direitos CAPÍTULO I - DISPOSIÇÕES GERAIS
assegurados nesta Lei, deverá ser o fato comunicado ao Ministério
3~EOLFRRXUHSUHVHQWDGRSHUDQWHDXWRULGDGHMXGLFLiULDFRPSHWHQWH $UW&RQVLGHUDVHDWRLQIUDFLRQDODFRQGXWDGHVFULWDFRPR
para as providências cabíveis, inclusive suspensão das atividades crime ou contravenção penal.
ou dissolução da entidade.
$UW6mRSHQDOPHQWHLQLPSXWiYHLVRVPHQRUHVGHGH]RLWR
TÍTULO II - DAS MEDIDAS DE PROTEÇÃO anos, sujeitos às medidas previstas nesta Lei.
Parágrafo Único - Para os efeitos desta Lei, deve ser considera-
CAPÍTULO I - DISPOSIÇÕES GERAIS da a idade do adolescente à data do fato.

$UW$VPHGLGDVGHSURWHomRjFULDQoDHDRDGROHVFHQWH $UW$RDWRLQIUDFLRQDOSUDWLFDGRSRUFULDQoDFRUUHVSRQGH-
UmRDVPHGLGDVSUHYLVWDVQRDUW
são aplicáveis sempre que os direitos reconhecidos nesta Lei forem
ameaçados ou violados:
CAPÍTULO II - DOS DIREITOS INDIVIDUAIS
I - por ação ou omissão da sociedade ou do Estado;
II - por falta, omissão ou abuso dos pais oou responsável; $UW1HQKXPDGROHVFHQWHVHUiSULYDGRGHVXDOLEHUGDGH
III - em razão de sua conduta. VHQmRHPÀDJUDQWHGHDWRLQIUDFLRQDORXSRURUGHPHVFULWDHIXQGD-
mentada da autoridade judiciária competente.
CAPÍTULO II - DAS MEDIDAS ESPECÍE;FICAS D 3DUiJUDIRÒQLFR2DGROHVFHQWHWHPGLUHLWRjLGHQWL¿FDomRGRV
E PROTEÇÃO responsáveis pela sua apreensão, devendo ser informado acerca de
seus direitos.
$UW   $V PHGLGDV SUHYLVWDV QHVWH &DStWXOR SRGHUmR VHU
aplicadas isolada ou cumulativamente, bem como substituidas a $UW$DSUHHQVmRGHTXDOTXHUDGROHVFHQWHHRORFDORQGH
qualquer tempo. se encontra recolhido serão incontinente comunicados à autoridade
judiciária competente e à família do apreendido ou à pessoa por ele
$UW1DDSOLFDomRGDVPHGLGDVOHYDUVHmRHPFRQWDDV indicada.
necessidades pedagógicas, preferindo-se aquelas que visem ao for- Parágrafo Único - Examinar-se-á, desde logo e sob pena de res-
talecimento dos vínculos familiares e comunitários. ponsabilidade, a possibilidade de liberação imediata.

$UW9HUL¿FDGDTXDOTXHUGDVKLSyWHVHVSUHYLVWDVQRDUW $UW$LQWHUQDomRDQWHVGDVHQWHQoDSRGHVHUGHWHUPLQDGD
DDXWRULGDGHFRPSHWHQWHSRGHUiGHWHUPLQDUGHQWUHRXWUDVDV pelo prazo máximo de quarenta e cinco dias.
seguintes medidas: Parágrafo Único - A decisão deverá ser fundamentada e basear-
I - encaminhamento aos pais ou responsável, mediante termo VHHPLQGtFLRVVX¿FLHQWHVGHDXWRULDHPDWHULDOLGDGHGHPRQVWUDGD
de responsabilidade; a necessidade imperiosa da medida.
II - orientação, apoio e acompanhamento temmporários;
III - matrícula e freqüência obrigatórias emm estabelecimento $UW2DGROHVFHQWHFLYLOPHQWHLGHQWL¿FDGRQmRVHUiVXE-
R¿FLDOGHHQVLQRIXQGDPHQWDO PHWLGRDLGHQWL¿FDomRFRPSXOVyULDSHORVyUJmRVSROLFLDLVGHSURWH-
,9LQFOXVmRHPSURJUDPDFRPXQLWiULRRXRI¿FLDOGHDX[tOLR omRHMXGLFLDLVVDOYRSDUDHIHLWRGHFRQIURQWDomRKDYHQGRG~YLGD
à família, à criança e ao adolescente; fundada.
V - requisição de tratamento médico, psicológico ou psiquiá-
CAPÍTULO III - DAS GARANTIAS PROCESSUAIS
trico, em regime hospitalar ou ambulatorial;
9,LQFOXVmRHPSURJUDPDR¿FLDORXFRPXQLLWiULRGHDX[tOLR
$UW1HQKXPDGROHVFHQWHVHUiSULYDGRGHVXDOLEHUGDGH
orientação e tratamento a alcoólatras e toxicômanos; sem o devido processo legal.
VII - abrigo em entidade;<
VIII - colocação em família substituta. > $UW6mRDVVHJXUDGDVDRDGROHVFHQWHHQWUHRXWUDVDVVH-
Parágrafo Único - O abrigo é medida provisória e excepcio- guintes garantias:
nal, utilizável como forma de transição para a colocação em famí- I - pleno e formal conhecimento da atribuição de ato infracio-
lia substituta, não implicando privação de liberdade. nal, mediante citação ou meio equivalente;
II - igualdade na relação processual, podenndo conf’rontar-se
$UW$VPHGLGDVGHSURWHomRGHTXHWUDWDHVWH&DStWXOR com vítimas e testemunhas e produzir todas as provas necessárias
serão acompanhadas da regularização do registro civil. à sua defesa;
†ƒ9HUL¿FDGDDLQH[LVWrQFLDGHUHJLVWURDQWHULRURDVVHQWR III - defesa técnica por advogado;
de nascimento da criança ou adolescente será feito à vista dos IV - assistência judiciária gratuita e inteegral aos necessitados,
elementos disponíveis, mediante requisição da autoridade na forma da lei;
judiciária. V - direito de ser ouvido pessoalmente pela autoridade com-
§ 2° - Os registros e certidões necessárias à regularização de petente;
que trata este artigo são isentos de multas, custas e emolumentos, VI - direito de solicitar a presença de seuus pais ou responsável
gozando de absoluta prioridade. em qualquer fase do procedimento.

Didatismo e Conhecimento 47
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
CAPÍTULO IV - DAS MEDIDAS SÓCIO-EDUCATIVAS SEÇÃO V - DA LIBERDADE ASSISTIDA

SEÇÃO I - DISPOSIÇÕES GERAIS $UW$OLEHUGDGHDVVLVWLGDVHUiDGRWDGDVHPSUHTXHVHD¿-


JXUDUDPHGLGDPDLVDGHTXDGDSDUDR¿PGHDFRPSDQKDUDX[LOLDU
$UW9HUL¿FDGDDSUiWLFDGHDWRLQIUDFLRQDDODDXWRULGDGH e orientar o adolescente.
competente poderá aplicar ao adolescente as seguintes medidas: † ƒ  $ DXWRULGDGH GHVLJQDUi SHVVRD FDSDFLWDGD SDUD
I - advertência; acompanhar o caso, a qual poderá ser recomendada por entidade
II - obrigação de reparar o dano; ou programa de atendimento.
III - pressão de serviços à comunidade;
†ƒ$OLEHUGDGHDVVLVWLGDVHUi¿[DGDSHORSUD]RPtQLPRGH
IV - liberdade assistida;>
seis meses, podendo a qualquer tempo ser prorrogada, revogada
V - inserção em regime de semiliberdade;
ou substituída por outra medida, ouvido o orientador, o Ministério
VI - internação em estabelecimento educacioonal;
9,,TXDOTXHUXPDGDVSUHYLVWDVQRDUW,D9, 3~EOLFRHRGHIHQVRU
† ƒ $ PHGLGD DSOLFDGD DR DGROHVFHQWH OHYDUi HP FRQWD D
VXD FDSDFLGDGH GH FXLQSULOD DV FLUFXQVWkQFLDV H D JUDYLGDGH GD $UW,QFXPEHDRRULHQWDGRUFRPRDSRLRHDVXSHUYLVmR
infração. da autoridade competente, a realização dos seguintes encargos, en-
§ 2° - Em hipótese alguma e sob pretexto algum, será admitida tre outros:
a prestação de trabalho forçado. I - promover socialmente o adolescente e sua família, forne-
† ƒ  2V DGROHVFHQWHV SRUWDGRUHV GH GRHQoD RX GH¿FLrQFLD cendo-lhes orientação e inserindo-os, se necessário, em programa
mental receberão tratamento individual e especializado, em local R¿FLDORXFRPXQLWiULRGHDX[tOLRHDVVLVWrQFLDVRFLDO
adequado às suas condições. II - supervisionar a freqüência e o aproveiitamento escolar do
adolescente, promovendo, inclusive, sua matrícula;
$UW$SOLFDVHDHVWH&DStWXORRGLVSRVWRQQRVDUWVH ,,,GLOLJHQFLDUQRVHQWLGRGDSUR¿VVLRQDOOL]DomRGRDGROHV-
 cente e de sua inserção no mercado trabalho;
IV- apresentar relatório do caso.
$UW $ LPSRVLomR GDV PHGLGDV SUHYLVWDV QRV LQFLVRV ,,
D9, GR DUW  SUHVVXS}H D H[LVWrQFLD GH SURYDV VX¿FLHQWHV GD SEÇÃO VI - DO REGIME DE SEMILIBERDADE
autoria e da materialidade da infração, ressalvada a hipótese de
UHPLVVmRQRVWHUPRVGRDUW
$UW2UHJLPHGHVHPLOLEHUGDGHSRGHVHUGqWHQQLQDGR
Parágrafo Único - A advertência poderá ser aplicada sempre
desde o início, ou como forma de transição para o meio aberto,
TXHKRXYHUSURYDGDPDWHULDOLGDGHHLQGtFLRVVX¿FLHQWHVGDDXWR-
ria. possibilitada a realização de atividades externas, independente-
mente de autorização judicial.
SEÇÃO II - DA ADVERTÊNCIA † ƒ  p REULJDWyULD D HVFRODUL]DomR H D SUR¿VVLRQDOL]DomR
devendo, sempre que possível, ser utilizados os recursos existentes
$UW  $ DGYHUWrQFLD FRQVLVWLUi HP DGPRHVWDomR YHUEDO na comunidade.
que será reduzida a termo e assinada. § 2° - A medida não comporta prazo determinado, aplicando-
se, no que couber, as disposições relativas internação.
SEÇÃO III - DA OBRIGAÇÃO DE REPARAR O DANO
SEÇÃO VII - DA INTERNAÇÃO
$UW(PVHWUDWDQGRGHDWRLQIUDFLRQDOFRPUHÀH[RVSD-
trimoniais, a autoridade poderá determinar, se for o caso, que o $UW$LQWHUQDomRFRQVWLWXLPHGLGDSULYDWLYDGDOLEHUGD-
adolescente restitua a coisa, promova o ressarcimento do dano, ou, de, sujeita aos princípios de brevidade, excepcionalidade e respei-
por outra forma, compense o prejuízo da vítima. to à condição peculiar de pessoa em desenvolvimento.
Parágrafo Único - Havendo manifesta impossibilidade, a me- § l° - Será permitida a realização de atividades externas, a
dida poderá ser substituída por outra adequada. critério da equipe técnica da entidade, salvo expressa determinação
judicial em contrário.
SEÇÃO IV - DA PRESTAÇÃO DE SERVIÇOS À
§ 2° - A medida não comporta prazo determinado, devendo
COMUNIDADE
sua manutenção ser reavaliada, mediante decisão fundamentada,
$UW  $ SUHVWDomR GH VHUYLoRV FRPXQLWiULRV FRQVLVWH QD no máximo a cada seis meses.
realização de tarefas gratuitas de interesse geral, por período não †ƒ(PQHQKXPDKLSyWHVHRSHUtRGRPi[LPRGHLQWHUQDomR
excedente a seis meses, junto a entidades assistências hospitais, excederá a três anos.
escolas e outros estabelecimentos congêneres, bem como em pro- † ƒ $WLQJLGR R OLPLWH HVWDEHOHFLGR QR SDUiJUDIR DQWHULRU
gramas comunitários ou governamentais. R DGROHVFHQWH GHYHUi VHU OLEHUDGR FRORFDGR ¿P UHJLPH GH
Parágrafo Único - As tarefas serão atribuídas conforme as semiliberdade ou de liberdade assistida.
aptidões do adolescente, devendo ser cumpridas durante jornada † ƒ $ OLEHUDomR VHUi FRPSXOVyULD DRV YLQWH H XP DQRV GH
máxima de oito horas semanais, aos sábados, domingos e feriados idade.
RXGLDV~WHLVGHPRGRDQmRSUHMXGLFDUDIUHTrQFLDjHVFRODRXj †ƒ(PTXDOTXHUKLSyWHVHDGHVLQWHUQDomRVHUiSUHFHGLGDGH
jornada normal de trabalho. DXWRUL]DomRMXGLFLDORXYLGRR0LQLVWpULR3~EOLFR

Didatismo e Conhecimento 48
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW   $ PHGLGD GH LQWHUQDomR Vy SRGHUi VHU DSOLFDGD CAPÍTULO V - DA REMISSÃO
quando:
I - tratar-se de ato infracional cometido mediante grave amea- $UW   $QWHV GH LQLFLDGR R SURFHGLPHQWR MXGLFLDO SDUD
ça ou violência a pessoa; DSXUDomRGHDWRLQIUDFLRQDORUHSUHVHQWDQWHGR0LQLVWpULR3~EOLFR
II - por reiteração no cometimento de outraas infrações gra- poderá conceder a remissão, como forma de exclusão do processo,
ves; DWHQGHQGR jV FLUFXQVWkQFLDV H FRQVHTrQFLDV GR IDWR DR FRQWH[WR
,,,SRUGHVFXPSULPHQWRUHLWHUDGRHLQMXVWLL¿FiYHOGDPHGLGD social, bem como à personalidade do adolescente e sua maior ou
anteriormente imposta. menor participação no ato infracional.
†ƒ2SUD]RGHLQWHUQDomRQDKLSyWHVHGRLQFLVR,,,GHVWH Parágrafo Único - Iniciado o procedimento, a concessão da re-
artigo não poderá ser superior a três meses. missão pela autoridade judiciária importará na suspensão ou extin-
§ 2° - Em nenhuma hipótese será aplicada a internação, ção do processo.
havendo outra medida adequada.
$UW$UHPLVVmRQmRLPSOLFDQHFHVVDULDPHQWHRUHFRQKH-
cimento ou comprovação da responsabilidade, nem prevalece para
$UW$LQWHUQDomRGHYHUiVHUFXPSULGDHPHQWLGDGHH[-
efeito de antecedentes, podendo incluir eventualmente a aplicação
clusiva para adolescentes, em local distinto daquele destinado ao
de qualquer das medidas previstas em lei, exceto a colocação em
abrigo, obedecida rigorosa separação por critérios de idade, com-
regime de semiliberdade e a internação.
pleição física e gravidade da infração.
Parágrafo Único - Durante o período de internação, inclusive $UW$PHGLGDDSOLFDGDSRUIRUoDGDUHPLVVmRSRGHUiVHU
provisória, serão obrigatórias atividades pedagógicas. revista judicialmente, a qualquer tempo, mediante pedido expresso
GRDGROHVFHQWHRXGHVHXUHSUHVHQWDQWHOHJDORXGR0LQLVWpULR3~-
$UW6mRGLUHLWRVGRDGROHVFHQWHSULYDGRGHOLEHUGDGH blico.
entre outros os seguintes:
I - entrevistar-se pessoalmente com o representante do Minis- TÍTULO IV - DAS MEDIDAS PERTINENTES AOS PAIS
WpULR3~EOLFR OU RESPONSÁVEL
II - peticionar diretamente a qualquer autooridade;
lll - avistar-se reservadamente com seu defeensor; $UW6mRPHGLGDVDSOLFiYHLVDRVSDLVRXUHVSRQViYHO
IV - ser informado de sua situação processuual, sempre que ,HQFDPLQKDPHQWRDSURJUDPDR¿FLDORXFRPXQLWiULRGHSUR-
solicitada; moção à família;
V - ser tratado com respeito e dignidade; ,,  LQFOXVmR HP SURJUDPD R¿FLDO RX FRPXQLLWiULR GH DX[LOLR
VI - permanecer internado na mesma localidaade ou naquela orientação e tratamento a alcoólatras e toxicômanos;
mais próxima ao domicílio de seus pais ou responsável; III - encaminhamento a tratamento psicológicco ou psiquiátri-
VII - receber visitas, ao menos semanalmentee; co;
VIII - corresponder-se com seus familiares e amigos; IV - encaminhamento a cursos ou programas dde orientação;
IX - ter acesso aos objetos necessários à hhigiene e asseio pes- 9REULJDomRGHPDWULFXODUR¿OKRRXSXSLORHDFRPSDQKDUVXD
soal; freqüência e aproveitamento escolar;
X - habitar alojamento em condições adequadas de higiene e VI - obrigação de encaminhar a criança ou aadolescente a tra-
salubridade; tamento especializado;
;,UHFHEHUHVFRODUL]DomRHSUR¿VVLRQDOL]]DomR VII - advertência;
XII - realizar atividades culturais, esportiivas e de lazer; VIII - perda da guarda;
XIII - ter acesso aos meios de comunicação soocial; >
IX - destituição da tutela;
XIV - receber assistência religiosa, segundoo a sua crença, e
X - suspensão ou destituição do pátrio poder.
desde que assim o deseje;
Parágrafo Único - Na aplicação das medidas previstas nos in-
XV - manter a posse de seus objetos pessoaiis e dispor de local
FLVRV,;H;GHVWHDUWLJRREVHUYDUVHiRGLVSRVWRQRVDUWVH
seguro para guardá-los, recebendo comprovante daqueles porven-
tura depositados em poder da entidade; $UW   9HUL¿FDGD D KLSyWHVH GH PDXVWUDWRV RSUHVVmR RX
XVI - receber, quando de sua desinternação, os documentos abuso sexual impostos pelos pais ou responsável, a autoridade ju-
pessoais indispensáveis à vida em sociedade. diciária poderá determinar, como medida cautelar, o afastamento do
†ƒ(PQHQKXPFDVRKDYHUiLQFRPXQLFDELOLGDGH agressor da moradia comum.
§ 2° - A autoridade judiciária poderá suspender
temporariamente a visita, inclusive de pais ou responsável, se TÍTULO V - DO CONSELHO TUTELAR
existirem motivos sérios e fundados de sua prejudicialidade aos
interesses do adolescente. CAPÍTULO I - DISPOSIÇÕES GERAIS

$UW   e GHYHU GR (VWDGR ]HODU SHOD LQWHJULGDGH ItVLFD H $UW2&RQVHOKR7XWHODUpyUJmRSHUPDQHQWHHDXW{QRPR
mental dos internos, cabendo-lhe adotar as medidas adequadas de não jurisdicional, encarregado pela sociedade de zelar pelo cumpri-
contenção e segurança. PHQWRGRVGLUHLWRVGDFULDQoDHGRDGROHVFHQWHGH¿QLGRVQHVWD/HL

Didatismo e Conhecimento 49
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW(PFDGD0XQLFtSLRKDYHUiQRPtQLPRXP&RQVH- CAPÍTULO III - DA COMPETÊNCIA
lho Tutelar composto de cinco membros, escolhido pela comuni-
dade local para mandato de três anos, permitida uma recondução ( $UW$SOLFDVHDR&RQVHOKR7XWHODUDUHJUDGHFRPSHWrQ-
Nova redação conforme Lei Federal 8.242/91, de 12/10/91) FLDFRQVWDQWHGRDUW

$UW3DUDDFDQGLGDWXUDDPHPEURGR&RQVHOKR7XWHODU CAPÍTULO IV - DA ESCOLHA DOS CONSELHEIROS


serão exigidos os seguintes requisitos:
I - reconhecida idoneidade moral; $UW2SURFHVVRSDUDDHVFROKDGRVPHPEURVGR&RQVH-
II - idade superior a vinte e um anos;> lho Tutelar será estabelecido em Lei Municipal e realizado sob a
III - residir no município. responsabilidade do Conselho Municipal dos Direitos da Criança
HGR$GROHVFHQWHHD¿VFDOL]DomRGR0LQLVWpULR3~EOLFR(Nova re-
$UW/HL0XQLFLSDOGLVSRUiVREUHORFDOGLDHKRUiULRGH dação conforme Lei Federal 8.242/91, de 12/10/91)
funcionamento do Conselho Tutelar, inclusive quanto a eventual
remuneração de seus membros. CAPÍTULO V - DOS IMPEDIMENTOS
Parágrafo Único - Constará da Lei Orçamentária Municipal
previsão dos recursos necessários ao funcionamento do Conselho $UW6mRLPSHGLGRVGHVHUYLUQRPHVPR&RQVHOKRPD-
Tutelar. rido e mulher, ascendentes e descendentes, sogro e genro ou nora,
irmãos, cunhados, durante o cunhadio, tio e sobrinho, padrasto ou
$UW2H[HUFtFLRHIHWLYRGDIXQomRGHFRQVHOKHLURFRQV- madrasta e enteado.
WLWXLUiVHUYLoRS~EOLFRUHOHYDQWHHVWDEHOHFHUiSUHVXQomRGHLGRQHL- Parágrafo Único - Estende-se o impedimento do conselhei-
dade moral e assegurará prisão especial, em caso de crime comum, ro, na forma deste artigo, em relação à autoridade judiciária e ao
DWpRMXOJDPHQWRGH¿QLWLYR UHSUHVHQWDQWHGR0LQLVWpULR3~EOLFRFRPDWXDomRQD-XVWLoDGD,Q-
IkQFLDHGD-XYHQWXGHHPH[HUFtFLRQD&RPDUFD)RUR5HJLRQDO
CAPÍTULO II - DAS ATRIBUIÇÕES DO CONSELHO ou Distrital.

$UW6mRDWULEXLo}HVGR&RQVHOKR7XWHODU TÍTULO VI - DO ACESSO À JUSTIÇA


I - atender as crianças e adolescentes nas hipóteses previstas
QRVDUWVHDSOLFDQGRDVPHGLGDVSUHYLVWDVQRDUW,D CAPÍTULO I - DISPOSIÇÕES GERAIS
VII;
II - atender e aconselhar os pais ou responnsável, aplicando as $UWeJDUDQWLGRRDFHVVRGHWRGDFULDQoDRXDGROHVFHQWH
PHGLGDVSUHYLVWDVQRDUW,D9,, j'HIHQVRULD3~EOLFDDR0LQLVWpULR3~EOLFRHDR3RGHU-XGLFLiULR
III - promover a execução de suas decisäes, podendo para tan- por qualquer de seus órgãos.
to: †ƒ$DVVLVWrQFLDMXGLFLiULDJUDWXLWDVHUiSUHVWDGDDRVTXH
D UHTXLVLWDUVHUYLoRVS~EOLFRVQDViUHDVGHVD~GHHGXFDomR GHOD QHFHVVLWDUHP DWUDYpV GH GHIHQVRU S~EOLFR RX DGYRJDGR
serviço social, previdência, trabalho e segurança; nomeado.
b) representar junto à autoridade judiciária nos casos de des- †ƒ$VDo}HVMXGLFLDLVGDFRPSHWrQFLDGD-XVWLoDGD,QIkQFLD
FXPSULPHQWRLQMXVWL¿FDGRGHVXDVGHOLEHUDo}HV e da Juventude são isentas de custas e emolumentos, ressalvada a
,9  HQFDPLQKDU DR 0LQLVWpULR 3~EOLFR QRWtFFLD GH IDWR TXH KLSyWHVHGHOLWLJkQFLDGHPiIp
constitua infração administrativa ou penal contra os direitos da
criança ou adolescente; $UW2VPHQRUHVGHGH]HVVHLVDQRVVHUmRUHSUHVHQWDGRV
V - encaminhar à autoridade judiciária os casos de sua com- e os maiores de dezesseis e menores de vinte e um anos assistidos
petência; por seus pais, tutores ou curadores, na forma da legislação civil ou
VI - providenciar a medida estabelecida pella autoridade judi- processual.
FLiULDGHQWUHDVSUHYLVWDVQRDUWGH,D9,SDUDRDGROHVFHQWH Parágrafo Único - A autoridade judiciária dará curador espe-
autor de ato infracional; cial à criança ou adolescente, sempre que os interesses destes co-
9,,H[SHGLUQRWL¿FDo}HV lidirem com os de seus pais ou responsável, ou quando carecer de
VIII - requisitar certidões de nascimento e dde óbito de crian- representação ou assistência legal, ainda que eventual.
ça ou adolescente quando necessário;
IX - assessorar o Poder Executivo local na elaboração da pro- $UW(YHGDGDDGLYXOJDomRGHDWRVMXGLFLDLVSROLFLDLVH
posta orçamentária para planos e programas de atendimento dos administrativos que digam respeito a crianças e adolescentes a que
direitos da criança e do adolescente; se atribua autoria de ato infracional.
X - representar, em nome da pessoa e da família, contra a vio- Parágrafo Único - Qualquer notícia a respeito do fato não po-
ODomRGRVGLUHLWRVSUHYLVWRVQRDUW†LQFLVR,,GD&RQVWL- GHUi LGHQWL¿FDU D FULDQoD RX DGROHVFHQWH YHGDQGRVH IRWRJUD¿D
tuição Federal; UHIHUrQFLDDQRPHDSHOLGR¿OLDomRSDUHQWHVFRHUHVLGrQFLD
;,UHSUHVHQWDUDR0LQLVWpULR3~EOLFRSDUUDHIHLWRGDVDo}HV
de perda ou suspensão do pátrio poder. $UW  $ H[SHGLomR GH FySLD RX FHUWLGmR GH DWRV D TXH
$UW$VGHFLV}HVGR&RQVHOKR7XWHODUVRPHQWHSRGHUmR se refere o artigo anterior somente será deferida pela autoridade
ser revistas pela autoridade judiciária a pedido de quem tenha le- MXGLFLiULDFRPSHWHQWHVHGHPRQVWUDGRRLQWHUHVVHHMXVWL¿FDGDD
gítimo interesse. ¿QDOLGDGH

Didatismo e Conhecimento 50
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
CAPÍTULO LI - DA JUSTIÇA DA INFÂNCIA E G FRQKHFHUGHSHGLGRVEDVHDGRVHPGLVFRUGkQFLDSDWHUQDRX
DA JUVENTUDE materna, em relação ao exercício do pátrio poder;
e) conceder a emancipação nos termos da lei civil, quando fal-
SEÇÃO I - DISPOSIÇÕES GERAIS tarem os pais;
f) designar curador especial em casos de apresentação de quei-
$UW2V(VWDGRVHR'LVWULWR)HGHUDOSRGHUmRFULDUYDUDV xa ou representação, ou de outros procedimentos judiciais ou extra-
HVSHFLDOL]DGDVHH[FOXVLYDVGDLQIkQFLDHGDMXYHQWXGHFDEHQGRDR judiciais em que haja interesses de criança ou adolescente;
3RGHU-XGLFLiULRHVWDEHOHFHUVXDSURSRUFLRQDOLGDGHSRUQ~PHURGH g) conhecer de ações de alimentos;
habitantes, dotá-las de infra-estrutura e dispor sobre o atendimento, K GHWHUPLQDURFDQFHODPHQWRDUHWL¿FDomRHRVXSULPHQWRGRV
inclusive em plantões. registros de nascimento e óbito.

SEÇÃO II - DO JUIZ $UW&RPSHWHjDXWRULGDGHMXGLFLiULDGLVFLSOLQDUDWUDYpV


de portaria, ou autorizar, mediante alvará:
$UW$DXWRULGDGHDTXHVHUHIHUHHVWD/HLpR-XL]GD,Q- I - a entrada e permanência de criança ou adolescente, desacom-
IkQFLDHGD-XYHQWXGHRXR-XL]TXHH[HUFHHVVDIXQomRQDIRUPDGD panhado dos pais ou responsável, em:
Lei de Organização Judiciária local. a) estádio, ginásio e campo desportivo;
b) bailes ou promoções dançantes;
$UW$FRPSHWrQFLDVHUiGHWHUPLQDGD c) boate ou congêneres;
I - pelo domicílio dos pais ou responsável; d) casa que explore comercialmente diversäes eletrônicas;
II - pelo lugar onde se encontre a criança ou adolescente, à falta H HVW~GLRVFLQHPDWRJUi¿FRVGHWHDWURUiGLRHWHOHYLVmR
dos pais ou responsável. II - a participação de criança e adolescentte em:
†ƒ1RVFDVRVGHDWRLQIUDFLRQDOVHUiFRPSHWHQWHDDXWRULGDGH D HVSHWiFXORVS~EOLFRVHVHXVHQVDLRV
do lugar da ação ou omissão, observadas as regras de conexão, b) certames de beleza.
continência e prevenção. † ƒ  3DUD RV ¿QV GR GLVSRVWR QHVWH DUWLJR D DXWRULGDGH
§ 2° - A execução das medidas poderá ser delegada à autoridade judiciária levará em conta, dentre outros fatores:
competente da residência dos pais ou responsável, ou do local onde a) os princípios desta Lei;
sediar-se a entidade que abrigar a criança ou adolescente. b) as peculiaridades locais;
† ƒ  (P FDVR GH LQIUDomR FRPHWLGD DWUDYpV GD WUDQVPLVVmR c) a exigência de instalações adequadas;
VLPXOWkQHDGHUiGLRRXWHOHYLVmRTXHDWLQMDPDLVGHXPDFRPDUFD d) o tipo de freqüência habitual ao local;
será competente, para aplicação da penalidade, a autoridade e) a adequação do ambiente a eventual participação ou freqüên-
judiciária do local da sede estadual da emissora ou rede, tendo a cia de criança e adolescentes;
VHQWHQoD H¿FiFLD SDUD WRGDV WUDQVPLVVRUDV RX UHWUDQVPLVVRUDV GR f) a natureza do espetáculo.
respectivo Estado. § 2° - As medidas adoradas na conformidade deste artigo
deverão ser fundamentadas, caso a caso, vedadas as determinações
$UW$-XVWLoDGD,QIkQFLDHGD-XYHQWXGHpFRPSHWHQWH de caráter geral.
para:
,FRQKHFHUGHUHSUHVHQWDo}HVSURPRYLGDVSHOR0LQLVWpULR3~- SEÇÃO III - DOS SERVIÇOS AUXILIARES
blico, para apuração de ato infracional atribuído a adolescente, apli-
cando as medidas cabíveis; $UW&DEHDR3RGHU-XGLFLiULRQDHODERUDomRGHVXDSUR-
II - conceder a remissão como forma de susppensão ou extinção posta orçamentária, prever recursos para manutenção de equipe
do processo; LQWHUSUR¿VVLRQDO GHVWLQDGD D DVVHVVRUDU D -XVWLoD GD ,QIkQFLD H GD
III - conhecer de pedidos de adoção e seus iincidentes; Juventude.
IV - conhecer de ações civis fundadas em innteresses indivi-
duais, difusos ou coletivos afetos à criança e ao adolescente, obser- $UW   &RPSHWH j HTXLSH LQWHUSUR¿VVLRQDO GHQWUH RXWUDV
YDGRRGLVSRVWRQRDUW atribuições que lhe forem reservadas pela legislação local, fornecer
V - conhecer de ações decorrentes de irregularidades em entida- subsídios por escrito, mediante laudos, ou verbalmente, na audiên-
des de atendimento, aplicando as medidas cabíveis; cia, e bem assim desenvolver trabalhos de aconselhamento, orienta-
VI - aplicar penalidades administrativas noos casos de infrações ção, encaminhamento, prevenção e outros, tudo sob a imediata su-
contra norma de proteção a criança ou adolescentes; bordinação à autoridade judiciária, assegurada a livre manifestação
VII - conhecer de casos encaminhados pelo Coonselho Tutelar, do ponto de vista técnico.
aplicando as medidas cabíveis.
Parágrafo Único - Quando se tratar de criança ou adolescente CAPÍTULO III - DOS PROCEDIMENTOS
QDVKLSyWHVHVGRDUWpWDPEpPFRPSHWHQWHD-XVWLoDGD,QIkQFLD
HGD-XYHQWXGHSDUDR¿PGH SEÇÃO I - DISPOSIÇÕES GERAIS
a) conhecer de pedidos de guarda e tutela;
b) conhecer de ações de destituição do pátrio poder, perda ou $UW$RVSURFHGLPHQWRVUHJXODGRVQHVWD/HLDSOLFDPVH
PRGL¿FDomRGDWXWHODRXJXDUGD subsidiariamente as normas gerais previstas na legislação processual
c) suprir a capacidade ou o consentimento para o casamento; pertinente.

Didatismo e Conhecimento 51
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW6HDPHGLGDMXGLFLDODVHUDGRWDGDQmRFRUUHVSRQGHUD † ƒ $ UHTXHULPHQWR GH TXDOTXHU GDV SDUWHV GR 0LQtVWpULR
procedimento previsto nesta ou em outra lei, a autoridade judiciária 3~EOLFR RX GH R¿FLR D DXWRULGDGH MXGLFLiULD SRGHUi GHWHUPLQDU D
poderá investigar os fatos e ordenar de ofício as providências neces- realização de estudo social ou, se possível, de perícia por equipe
ViULDVRXYLGRR0LQLVWpULR3~EOLFR LQWHUSUR¿VVLRQDO
†ƒ1DDXGLrQFLDSUHVHQWHVDVSDUWHVHR0LQLVWpULR3~EOL-
$UW$SOLFDVHjVPXOWDVRGLVSRVWRQRDUW co, serão ouvidas as testemunhas, colhendo-se oralmente o parecer
técnico, salvo quando apresentado por escrito, manifestando-se su-
SEÇÃO II - DA PEDRA E DA SUSPENSÃO DO FHVVLYDPHQWHRUHTXHUHQWHRUHTXHULGRHR0LQLVWpULR3~EOLFRSHOR
PÁTRIO PODER tempo de vinte minutos cada um, prorrogável por mais dez. A de-
cisão será proferida na audiência, podendo a autoridade judiciária,
$UW2SURFHGLPHQWRSDUDDSHUGDRXDVXVSHQVmRGRSi- excepcionalmente, designar data para sua leitura no prazo máximo
WULRSRGHUWHUiLQtFLRSRUSURYRFDomRGR0LQLVWpULR3~EOLFRRXGH de cinco dias.
quem tenha legítimo interesse.
$UW$VHQWHQoDTXHGHFUHWDUDSHUGDRXDVXVSHQVmRGR
$UW$SHWLomRLQLFLDOLQGLFDUi pátrio poder será averbada à margem do registro de nascimento da
I - a autoridade judiciária a que for dirigida; criança ou adolescente.
,,RQRPHRHVWDGRFLYLODSUR¿VVmRHDUHVLGrQFLDGRUHTXH-
UHQWHHGRUHTXHULGRGLVSHQVDGDDTXDOL¿FDomRHPVHWUDWDQGRGH SEÇÃO III - DA DESTRUIÇÃO DA TUTELA
SHGLGRIRUPXODGRSRUUHSUHVHQWDQWHGR0LQLVWpULR3~EOLFR
III - a exposição sumária do fato e o pedidoo; $UW1DGHVWLWXLomRGDWXWHODREVHUYDUVHiRSURFHGLPHQ-
IV - as provas que serão produzidas, ofereccendo desde logo, o to para a remoção de tutor previsto na lei processual civil e, no que
rol de testemunhas e documentos. couber, ao disposto na seção anterior.

$UW   +DYHQGR PRWLYR JUDYH SRGHUi D DXWRULGDGH MXGL- SEÇÃO IV - DA COLOCAÇÃO EM FAMÍLIA SUBSTITUTA
FLiULDRXYLGRR0LQLVWpULR3~EOLFRGHFUHWDUDVXVSHQVmRGRSiWULR
SRGHU OLPLQDU RX LQFLGHQWDOPHQWH DWp R MXOJDPHQWR GH¿QLWLYR GD $UW6mRUHTXLVLWRVSDUDFRQFHVVmRGHSHGLGRVGHFRORFD-
FDXVD¿FDQGRDFULDQoDRXDGROHVFHQWHFRQ¿DGRDSHVVRDLG{QHD ção em família substituta:
mediante termo de responsabilidade. ,TXDOL¿FDomRFRPSOHWDGRUHTXHUHQWHHGHVHXHYHQWXDOF{QMX-
gue, ou companheiro, com expressa anuência deste;
$UW2UHTXHULGRVHUiFLWDGRSDUDQRSUD]RGHGH]GLDV II - indicação de eventual parentesco do requerente e de seu
oferecer resposta escrita, indicando as provas a serem produzidas e F{QMXJXHRXFRPSDQKHLURFRPDFULDQoDRXDGROHVFHQWHHVSHFL¿-
oferecendo desde logo o rol de testemunhas e documentos. cando se tem ou não parente vivo;
Parágrafo Único - Deverão ser esgotados todos os meios para ,,,TXDOL¿FDomRFRPSOHWDGDFULDQoDRXGRDGROHVFHQWHHGH
a citação pessoal. seus pais, se conhecidos;
IV - indicação do cartório onde foi inscrito nascimento, anexan-
$UW6HRUHTXHULGRQmRWLYHUSRVVLELOLGDGHGHFRQVWLWXLU do, se possível, uma cópia da respectiva certidão.
advogado, sem prejuízo do próprio sustento e de sua família, po- V - declaração sobre a existência de bens, direitos ou rendimen-
derá requerer, em cartório, que lhe seja nomeado dativo, ao qual tos relativos à criança ou adolescente.
incumbirá a apresentação de resposta, contando-se o prazo a partir Parágrafo Único - Em se tratando de adoção, observar-se-ão
da intimação do despacho de nomeação. WDPEpPRVUHTXLVLWRVHVSHFt¿FRV

$UW6HQGRQHFHVViULRDDXWRULGDGHMXGLFLiULDUHTXLVLWDUi $UW6HRVSDLVIRUHPIDOHFLGRVWLYHUHPVLGRGHVWLWXtGRV
GH TXDOTXHU UHSDUWLomR RX yUJmR S~EOLFR D DSUHVHQWDomR GH GRFX- ou suspensos do pátrio poder, ou houverem aderido expressamente
mento que interesse à causa, de ofício ou a requerimento das partes ao pedido de colocação em família substituta, este poderá ser formu-
RXGR0LQLVWpULR3~EOLFR lado diretamente em cartório, em petição assinalada pelos própios
requerentes.
$UW1mRVHQGRFRQWHVWDGRRSHGLGRDDXWRULGDGHMXGLFLi- 3DUiJUDIRÒQLFR1DKLSyWHVHGHFRQFRUGkQFLDGRVSDLVHOHV
ULDGDUiYLVWDGRVDXWRVDR0LQLVWpULR3~EOLFRSRUFLQFRGLDVVDOYR serão ouvidos pela autoridade judiciária e pelo representante do Mi-
quando este for o requerente, decidindo em igual prazo. QLVWpULR3~EOLFRWRUQDQGRVHSRUWHUPRDVGHFODUDo}HV
† ƒ  +DYHQGR QHFHVVLGDGH D DXWRULGDGH MXGLLFLiULD SRGHUi
determinar a realização de estudo social ou perícia por equipe $UW$DXWRULGDGHMXGLFLiULDGHRItFLRRXDUHTXHULPHQ-
LQWHUSUR¿VVLRQDOEHPFRPRDRLWLYDGHWHVWHPXQKDV WRGDVSDUWHVRXGR0LQLVWpULR3~EOLFRGHWHUPLQDUiDUHDOL]DomRGH
† ƒ  6H R SHGLGR LPSRUWDU HP PRGL¿FDomR GH JXDUGD VHUi HVWXGR VRFLDO RX VH SRVVtYHO SHUtFLD SRU HTXLSH LQWHUSUR¿VVLRQDO
obrigatória, desde que possível e razoável, a oitiva da criança ou decidindo sobre a concessão de guarda provisória, bem como, no
adolescente. caso de adoção, sobre o estágio de convivência.

$UW$SUHVHQWDGDDUHVSRVWDDDXWRULGDGHMXGLFLiULDGDUi $UW  $SUHVHQWDGR R UHODWyULR VRFLDO RX R ODXGR SHULFLDO


YLVWDGRVDXWRVDR0LQLVWpULR3~EOLFRSRUFLQFRGLDVVDOYRTXDQGR e ouvida, sempre que possível, a criança ou o adolescente, dar-se-
este for o requerente, designando, desde logo, audiência de instrução iYLVWDGRVDXWRVDR0LQLVWpULR3~EOLFRSHORSUD]RGHFLQFRGLDV
e julgamento. decidindo a autoridade judiciária em igual prazo.

Didatismo e Conhecimento 52
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW1DVKLSyWHVHTXHDGHVWLWXLomRGDWXWHODDSHUGDRX $UW6HQGRRDGROHVFHQWHOLEHUDGRDDXWRULGDGHSROLFLDO
a suspensão do pátrio poder constituir presuposto lógico da medida HQFDPLQKDUiLPHGLDWDPHQWHDRUHSUHVHQWDQWHGR0LQLVWpULR3~EOLFR
principal de colocação em famílai substituta, será observado o pro- cópia do auto de apreensão ou boletim de ocorrência.
cedimento contraditório previsto nas seções II e III deste Capítulo.
3DUiJUDIRÒQLFR$SHUGDRXDPRGL¿FDomRGDJXDUGDSRGHUi $UW6HDIDVWDGDDKLSyWHVHGHÀDJUDQWHKRXYHULQGtFLRV
ser decretada nos mesmos autos do procedimento, observado o dis- de participação de adolescente na prática de ato infracional, a auto-
SRVWRQRDUW ULGDGHSROLFLDOHQFDPLQKDUiDRUHSUHVHQWDQWHGR0LQLVWpULR3~EOLFR
relatório das investigações e demais documentos.
$UW&RQFHGLGDDJXDUGDRXDWXWHODREVHUYDUVHiRGLV-
SRVWRQRDUWHTXDQWRjDGRomRRFRQWLGRQRDUW $UW2DGROHVFHQWHDTXHPVHDWULEXDDXWRULDGHDWRLQIUD-
cional não poderá ser conduzido ou transportado em compartimento
SEÇÃO V - DA APURAÇÃO DE ATO INFRACIONAL ATRI- fechado de veículo policial, em condições atentatórias à sua digni-
BUÍDO A ADOLESCENTE dade, ou que impliquem risco à sua integridade física ou mental, sob
pena de responsabilidade.
$UW2DGROHVFHQWHSRUIRUoDGHRUGHPMXGLFLDOVHUiGHVGH
logo, encaminhado à autoridade judiciária. $UW$SUHVHQWDGRRDGROHVFHQWHRUHSUHVHQWDQWHGR0LQLV-
WpULR3~EOLFRQRPHVPRGLDHjYLVWDGRDXWRGHDSUHHQVmREROHWLP
$UW2DGROHVFHQWHDSUHHQGLGRHPÀDJUDQWHGHDWRLQIUD- de ocorrência ou relatório policial, devidamente autuados pelo car-
cional será, desde logo, encaminhado à autoridade policial compe- tório judicial e com informação sobre os antecedentes do adoles-
tente. cente, procederá imediata e informalmente à sua oitiva e, em sendo
Parágrafo Único - Havendo repartição policial especializada possível, de seus pais ou responsável, vítima e testemunhas.
para atendimento de adolescente e em se tratando de ato infracio- Parágrafo Único - Em caso de não-apresentação, o representan-
nal praticado em coautoria com maior, prevalecerá a atribuição da WHGR0LQLVWpULR3~EOLFRQRWL¿FDUiRVSDLVRXUHVSRQViYHOSDUDDSUH-
repartição especializada, que, após as providências necessárias e sentação do adolescente, podendo requisitar o concurso das Polícias
conforme o caso, encaminhará o adulto à repartição policial própria. Civil e Militar.

$UW(PFDVRGHÀDJUDQWHGHDWRLQIUDFLRQDOFRPHWLGRPH- $UW$GRWDGDVDVSURYLGrQFLDVDTXHDOXGHRDUWLJRDQWH-
diante violência ou grave ameaça a pessoa, a autoridade policial, ULRURUHSUHVHQWDQWHGR0LQLVWpULR3~EOLFRSRGHUi
VHPSUHMXt]RGRGLVSRVWRQRVDUWVSDUiJUDIR~QLFRHGH- I - promover o arquivamento dos autos;
verá: II - conceder a remissão;
I - lavrar auto de apreensão, ouvidos as testemunhas e o ado- III - representar à autoridade judiciária para aplicação de medi-
lescente; da não-educativa.
II - apreender o produto e os instrumentos da infração;
III - requisitar os exames ou perícias necessários à comprova- $UW3URPRYLGRRDUTXLYDPHQWRGRVDXWRVRXFRQFHGLGDD
ção da materialidade e autoria da infração. UHPLVVmRSHORUHSUHVHQWDQWHGR0LQLVWpULR3~EOLFRPHGLDQWHWHUPR
3DUiJUDIRÒQLFR1DVGHPDLVKLSyWHVHVGHÀDJUDQWHDODYUDWX- fundamentado, que conterá o resumo dos fatos, os autos serão con-
ra do auto poderá ser substituída por boletim de ocorrência circuns- clusos à autoridade judiciária para homologação.
tanciada. †ƒ+RPRORJDGRRDUTXLYDPHQWRRXDUHPLVVmRDDXWRULGDGH
judiciária determinará, conforme o caso, cumprimento da medida.
$UW&RPSDUHFHQGRTXDOTXHUGRVSDLVRXUHVSRQViYHOR § 2° - Discordando, a autoridade judiciária fará remessa
adolescente será prontamente liberado pela autoridade policial, sob GRV DXWRV DR 3URFXUDGRU*HUDO GH -XVWLoD PHGLDQWH GHVSDFKR
termo de compromisso e responsabilidade de sua apresentação ao fundamentado, e este oferecerá representação, designará outro
UHSUHVHQWDQWHGR0LQLVWpULR3~EOLFRQRPHVPRGLDRXVHQGRLP- PHPEUR GR 0LQLVWpULR 3~EOLFR SDUD DSUHVHQWiOD RX UDWL¿FDUi
SRVVtYHOQRSULPHLURGLD~WLOLPHGLDWRH[FHWRTXDQGRSHODJUDYL- o arquivamento ou a remissão, que só então estará a autoridade
dade do ato infracional e sua repercussão social, deva o adolescente judiciária obrigada a homologar.
permanecer sob internação para garantia de sua segurança pessoal
RXPDQXWHQomRGDRUGHPS~EOLFD $UW6HSRUTXDOTXHUUD]mRRUHSUHVHQWDQWHGR0LQLVWpULR
3~EOLFRQmRSURPRYHURDUTXLYDPHQWRRXFRQFHGHUDUHPLVVmRRIH-
$UW(PFDVRGHQmROLEHUDomRDDXWRULGDGHSROLFLDOHQ- recerá representação à autoridade judiciária, propondo a instauração
caminhará, desde logo, o adolescente ao representante do Ministério de procedimento para aplicação da medida sócio-educativa que se
3~EOLFRMXQWDPHQWHFRPFySLDGRDXWRGHDSUHHQVmRRXEROHWLPGH D¿JXUDUDPDLVDGHTXDGD
ocorrência. †ƒ$UHSUHVHQWDomRVHUiRIHUHFLGDSRUSHWLomRTXHFRQWHUiR
†ƒ6HQGRLPSRVVtYHODDSUHVHQWDomRLPHGLDWDDDXWRULGDGH EUHYHUHVXPRGRVIDWRVHDFODVVL¿FDomRGRDWRLQIUDFLRQDOHTXDQGR
policial encaminhará o adolescente a entidade de atendimento, que necessário, o rol de testemunhas, podendo ser deduzida oralmente,
IDUiDDSUHVHQWDomRDRUHSUHVHQWDQWHGR0LQLVWpULR3~EOLFRQRSUD]R em sessão diária instalada pela autoridade judiciária.
de vinte e quatro horas. § 2° - A representação independe de prova pré-constituída da
§ 2° - Nas localidades onde não houver entidade de atendimento, autoria e materialidade.
a apresentação far-se-á pela autoridade policial. À falta de repartição
policial especializada, o adolescente aguardará a apresentação em $UW2SUD]RPi[LPRHLPSURUURJiYHOSDUDDFRQFOXVmR
dependência separada da destinada a maiores, não podendo, em do procedimento, estando o adolescente internado provisoriamente,
qualquer hipótese, exceder o prazo referido no parágrafo anterior. será de quarenta e cinco dias.

Didatismo e Conhecimento 53
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW2IHUHFLGDDUHSUHVHQWDomRDDXWRULGDGHMXGLFLiULDGH- III - não constituir o fato ato infracional;
signará audiência de apresentação do adolescente, decidindo, desde IV - não existir prova de ter o adolescente concorrido para o ato
logo, sobre a decretação ou manutenção da internação, observado o infracional.
GLVSRVWRQRDUWHSDUiJUDIR Parágrafo Único - Na hipótese deste artigo, estando o adoles-
†ƒ2DGROHVFHQWHHVHXVSDLVRXUHVSRQViYHOVHUmRFLHQWL¿FD- cente internado, será imediatamente colocado em liberdade.
GRVGRWHRUGDUHSUHVHQWDomRHQRWL¿FDGRVDFRPSDUHFHUjDXGLrQ-
cia, acompanhados de advogados. $UW$LQWLPDomRGDVHQWHQoDTXHDSOLFDUPHGLGDGHLQWH-
§ 2° - Se os pais ou responsável não forem localizados, a auto- mação ou regime de semiliberdade será feita:
ridade judiciária dará curador especial ao adolescente. I - ao adolescente e ao seu defensor;
†ƒ1mRVHQGRORFDOL]DGRRDGROHVFHQWHDDXWRULGDGHMXGLFLi- II - quando não for encontrado o adolescente, a seus pais ou
ria expedirá mandado de busca e apreensão, determinando o sobres- responsável, sem prejuízo do defensor.
tamento do feito, até a efetiva apresentação. † ƒ  6HQGR RXWUD D PHGLGD DSOLFDGD D LQWLPDomR IDUVHi
†ƒ(VWDQGRRDGROHVFHQWHLQWHUQDGRVHUiUHTXLVLWDGDDVXD unicamente na pessoa do defensor.
DSUHVHQWDomRVHPSUHMXt]RGDQRWL¿FDomRGRVSDLVRXUHVSRQViYHO § 2° - Recaindo a intimação na pessoa do adolescente, deverá
este manifestar se deseja ou não recorrer da sentença.
$UW$LQWHUQDomRGHFUHWDGDRXPDQWLGDSHODDXWRULGDGH
judiciária, não poderá ser cumprida em estabelecimento prisional. SEÇÃO VI - DA APURAÇÃO DE IRREGULARIDADE EM
†ƒ,QH[LVWLQGRQDFRPDUFDHQWLGDGHFRPDVFDUDFWHUtVWLFDV ENTIDADE DE ATENDIMENTO
GH¿QLGDVQRDUWRDGROHVFHQWHGHYHUiVHULPHGLDWDPHQWHWUDQV-
ferido para a localidade próxima. $UW2SURFHGLPHQWRGHDSXUDomRGHLUUHJXODULGDGHHP
§ 2° - Sendo impossível a pronta transferência, o adolescente entidade governamental e não-governamental terá início mediante
aguardará sua remoção em repartição policial, desde que em seção SRUWDULDGDDXWRULGDGHMXGLFLiULDRXUHSUHVHQWDomRGR0LQLVWpULR3~-
isolada dos adultos e com instalações apropriadas, não podendo ul- blico ou do Conselho Tutelar, onde consite, necessariamente, resu-
trapassar o prazo máximo de cinco dias, sob pena de responsabili- mo dos fatos.
dade.
Parágrafo Único - Havendo motivo grave, poderá a autorida-
GHMXGLFLiULDRXYLGRR0LQLVWpULR3~EOLFRGHFUHWDUOLPLQDUPHQWHR
$UW&RPSDUHFHQGRRDGROHVFHQWHVHXVSDLVRXUHVSRQVi-
afastamento provisório do diligente da entidade, mediante decisão
vel, a autoridade judiciára procederá à oitiva dos mesmos, podendo
fundamentada.
VROLFLWDURSLQLmRGHSUR¿VVLRQDOTXDOL¿FDGR
†ƒ6HDDXWRULGDGHMXGLFLiULDHQWHQGHUDGHTXDGDDUHPLVVmR
$UW2GLULJHQWHGDHQWLGDGHVHUiFLWDGRSDUDQRSUD]R
RXYLUiRUHSUHVHQWDQWHGR0LQLVWpULR3~EOLFRSURIHULQGRGHFLVmR
§ 2° - Sendo o fato grave, passível de aplicação de medida de de dez dias, oferecer resposta escrita, podendo juntar documentos e
internação ou colocação em regime de semiliberdade, a autorida- indicar as provas a produzir.
GH MXGLFLiULD YHUL¿FDQGR TXH R DGROHVFHQWH QmR SRVVXL DGYRJDGR
constituído, nomeará defensor, designando, desde logo, audiência $UW$SUHVHQWDGDRXQmRDUHVSRVWDHVHQGRQHFHVViULRD
em continuação, podendo determinar a realização de diligência e autoridade judiciária designará audiência de instrução e julgamento,
estudo do caso. intimando as partes.
†ƒ2DGYRJDGRFRQVWLWXtGRRXRGHIHQVRUQRPHDGRQRSUD]R †ƒ6DOYRPDQLIHVWDomRHPDXGLrQFLDDVSDUWHVHR0LQLVWpULR
de três dias contado da audiência de apresentação, oferecerá defesa 3~EOLFRWHUmRFLQFRGLDVSDUDRIHUHFHUDOHJDo}HV¿QDLVGHFLGLQGRD
prévia e rol detestemunhas. autoridade judiciária em igual prazo.
†ƒ1DDXGLrQFLDHPFRQWLQXDomRRXYLGDVDVWHiWHPXQKDV †ƒ(PVHWUDWDQGRGHDIDVWDPHQWRSURYLVyULRRXGH¿QLWLYRGH
arroladas na representação e na defesa prévia, cumpridas as diligên- GLULJHQWHGHHQWLGDGHJRYHUQDPHQWDODDXWRULGDGHMXGLFLiULDR¿FLDUi
FLDV H MXQWDGR R UHODWyULR GD HTXLSH LQWHUSUR¿VVLRQDO VHUi GDGD D à autoridade administrativa imediatamente superior ao afastado,
SDODYUD DR UHSUHVHQWDQWH GR 0LQLVWpULR 3~EOLFR H DR GHIHQVRU VX- marcando prazo para a substituição.
cessivamente, pelo tempo de vinte minutos para cada um, prorrogá- † ƒ  $QWHV GH DSOLFDU TXDOTXHU GDV PHGLGDV D DXWRULGDGH
vel por mais dez, a critério da autoridade judiciária, que em seguida MXGLFLiULD SRGHUi ¿[DU SUD]R SDUD D UHPRomR GDV LUUHJXODULGDGHV
proferirá decisão. YHUL¿FDGDV6DWLVIHLWDVDVH[LJrQFLDVRSURFHVVRVHUiH[WLQWRVHP
julgamento de mérito.
$UW6HRDGROHVFHQWHGHYLGDPHQWHQRWL¿FDGRQmRFRP- †ƒ$PXOWDHDDGYHUWrQFLDVHUmRLPSRVWDVDRGLULJHQWHGD
SDUHFHU LQMXVWL¿FDGDPHQWH j DXGLrQFLD GH DSUHVHQWDomR D DXWRUL- entidade ou programa de atendimento.
dade judiciária designará nova data, determinando sua condução
coercitiva. SEÇÃO VLL - DA APURAÇÃO DE INFRAÇÃO ADMINIS-
TRATIVA ÀS NORMAS DE PROTEÇÃO À CRIANÇA E AO
$UW$UHPLVVmRFRPRIRUPDGHH[WLQomRRXVXVSHQVmR ADOLESCENTE
do processo, poderá ser aplicada em qualquer fase do procedimento,
antes da sentença. $UW2SURFHGLPHQWRSDUDLPSRVLomRGHSHQDOLGDGHDG-
ministrativa por infração às normas de proteção à criança e ao ado-
$UW$DXWRULGDGHMXGLFLiULDQmRDSOLFDUiTXDOTXHUPHGLGD OHVFHQWHWHUiLQtFLRSRUUHSUHVHQWDomRGR0LQLVWpULR3~EOLFRRXGR
desde que reconheça na sentença: Conselho Tutelar, ou auto de infração elaborado por servidor efetivo
I - estar provada a inexistência do fato; ou voluntário credenciado, e assinado por duas testemunhas, se pos-
II - não haver prova da existência do fato; sível.

Didatismo e Conhecimento 54
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
† ƒ  1R SURFHGLPHQWR LQLFLDGR FRP R DXWR GH LQIUDomR VIII - mantida decisão apelada ou agravada, o escrivão reme-
SRGHUmRVHUXVDGDVIyUPXODVLPSUHVVDVHVSHFL¿FDQGRVHDQDWXUH]D WHUiRVDXWRVRXRLQVWUXPHQWRjVXSHULRULQVWkQFLDGHQWURGHYLQWH
e as ciUFXQVWkQFLDVGDLQIUDomR e quatro horas, independentemente de novo pedido do recorrente;
†ƒ6HPSUHTXHSRVVtYHOjYHUL¿FDomRGDLQIUDomRVHJXLU se a reformar, a remessa dos autos dependerá de pedido expresso da
VHi D ODYUDWXUD GR DXWR FHUWL¿FDQGRVH HP FDVR FRQWUiULR GRV SDUWHLQWHUHVVDGDRXGR0LQLVWpULR3~EOLFRQRSUD]RGHFLQFRGLDV
motivos do retardamento. contados da intimação.

$UW2UHTXHULGRWHUiSUD]RGHGH]GLDVSDUDDSUHVHQWD- $UW&RQWUDDVGHFLV}HVSURIHULGDVFRPEDVHQRDUW
ção de defesa, contado da data da intimação, que será feita: caberá recurso de apelação.
I - pelo autuante, no próprio auto, quando este for lavrado na
presença do requerido; CAPÍTULO V - DO MINISTÉRIO PÚBLICO
,,SRUR¿FLDOGHMXVWLoDRXIXQFLRQiULROHJDOPHQWHKDELOLWDGR
que entregará cópia do auto ou da representação ao requerido, ou a $UW$VIXQo}HVGR0LQLVWpULR3~EOLFRSUHYLVWDQHVWD/HL
seu representante legal, lavrando certidão; VHUmRH[HUFLGDVQRVWHUPRVGDUHVSHFWLYD/HL2UJkQLFD
III - por via postal, com aviso de recebimento, se não for en-
contrado o requerido ou seu representante legal; $UW&RPSHWHDR0LQLVWpULR3~EOLFR
IV - por edital, com prazo de trinta dias, se incerto ou não sa- I - conceder a remissão como forma de exclusão do processo;
bido o paradeiro do requerido ou de seu representante legal. II - promover e acompanhar os procedimentos relativos às in-
frações atribuídas a adolescentes;
$UW1mRVHQGRDSUHVHQWDGDDGHIHVDQRSUD]ROHJDOD III - promover e acompanhar as ações de alimentos e os pro-
DXWRULGDGH MXGLFLiULD GDUi YLVWD GRV DXWRV DR 0LQLVWpULR 3~EOLFR cedimentos de suspensão e destituição do pátrio poder, nomeação
por cinco dias, decidindo em igual prazo. HUHPRomRGHWXWRUHVFXUDGRUHVHJXDUGL}HVEHPFRPRR¿FLDUHP
WRGRVRVGHPDLVSURFHGLPHQWRVGDFRPSHWrQFLDGD-XVWLoDGD,QIkQ-
$UW$SUHVHQWDGDDGHIHVDDDXWRULGDGHMXGLFLiULDSUR- cia e da Juventude;
cederá na conformidade do artigo anterior, ou, sendo necessário, ,9SURPRYHUGHR¿FLRRXSRUVROLFLWDomRGRVLQWHUHVVDGRVD
designará audiência de instrução e julgamento. especialização e a inscrição de hipoteca legal e a prestação de contas
Parágrafo Único - Colhida a prova oral, manifestar-se-ão su- dos tutores, curadores e quaisquer administradores de bens de crian-
FHVVLYDPHQWH R 0LQLVWpULR 3~EOLFR H R SURFXUDGRU GR UHTXHULGR oDVHDGROHVFHQWHVQDVKLSyWHVHVGRDUW
pelo tempo de vinte minutos para cada um, prorrogável por mais 9  SURPRYHU R LQTXpULWR FLYLO H D DomR FLYLO S~EOLFD SDUD D
dez, a critério da autoridade judiciária, que em seguida proferirá proteção dos interesses individuais, difusos ou coletivos relativos
sentença. jLQIkQFLDHjDGROHVFrQFLDLQFOXVLYHRVGH¿QLGRVQRDUW†
inciso II, da Constituição Federal;
CAPÍTULO IV - DOS RECURSOS VI - instaurar procedimentos administrativos e, para, instruí-
-los:
$UW1RVSURFHGLPHQWRVDIHWRVj-XVWLoDGD,QIkQFLDHGD D H[SHGLUQRWL¿FDo}HVSDUDFROKHUGHSRLPHQWRVRXHVFODUHFL-
-XYHQWXGH¿FDDGRWDGRRVLVWHPDUHFXUVDOGR&yGLJRGH3URFHVVR PHQWRVHHPFDVRGHQmRFRPSDUHFLPHQWRLQMXVWL¿FDGRUHTXLVLWDU
&LYLODSURYDGRSHOD/HLQƒGHGHMDQHLURGHHVXDV condução coercitiva, inclusive pela polícia civil ou militar;
alterações posteriores, com as seguintes adaptações: b) requisitar informações, exames, perícias e documentos de
I - os recursos serão interpostos independentemente de pre- autoridades municipais, estaduais e federais, da administração direta
paro; ou indireta, bem como promover inspeções e diligências investiga-
II - em todos os recursos, salvo o de agravo de insento e de tórias;
embargos de declaração, o prazo para interpor e para responder c) requisitar informações e documentos a particulares e insti-
será sempre de dez dias; tuições privadas;
III - os recursos terão preferência de julgamento e dispensarão 9,,LQVWDXUDUVLQGLFkQFLDVUHTXLVLWDUGLOLJrQFLDVLQYHVWLJDWy-
revisor; rias e determinar a instauração de inquérito policial, para apuração
IV - o agravo será intimado para, no prazo de cinco dias, ofe- GHLOtFLWRVRXLQIUDo}HVjVQRUPDVGHSURWHomRjLQIkQFLDHjMXYHQ-
recer resposta e indicar as peças a serem trasladadas; tude;
V - será de quarenta e oito horas o prazo para a extração, a VIII - zelar pelo efetivo respeito aos direitos e garantias legais
conferência e o conserto do traslado; assegurados às crianças e adolescentes, promovendo as medidas ju-
VI - a apelação será recebida em seu efeito devolutivo. Será diciais e extrajudiciais cabíveis;
também conferido efeito suspensivo quando interposta contra sen- IX - impetrar mandado de segurança, de injunção e “habeas
tença que deferir a adoção por estrangeiro e, a juízo da autoridade FRUSXV´ HP TXDOTXHU MXt]R LQVWkQFLD RX WULEXQDO QD GHIHVD GRV
judiciária, sempre que houver perigo de dano irreparável ou de interesses sociais e individuais indisponíveis afetos à criança e ao
difícil reparação; adolescente;
VII - antes de determinar a remessa dos autos à superior ins- X - representar ao juízo visando à aplicação de penalidade por
WkQFLDQRFDVRGHDSHODomRRXGRLQVWUXPHQWRQRFDVRGHDJUDYR infrações cometidas contra as normas de proteção à infància e à ju-
a autoridade judiciária proferirá despacho fundamentado, manten- ventude, sem prejuízo da promoção da responsabilidade civil e pe-
do ou reformando a decisão, no prazo de cinco dias; nal do infrator, quando cabível;

Didatismo e Conhecimento 55
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
;,LQVSHFLRQDUDVHQWLGDGHVS~EOLFDVHSDUWLFXODUHVGHDWHQ- § 2° - A ausência do defensor não a determinará o adiamento
dimento e os programas de que trata esta Lei, adotando de pronto de nenhum ato do processo, devendo o juiz nomear substituto, ainda
as medidas administrativas ou judiciais necessárias à remoção de que provisoriamente, ou para o só efeito do ato.
LUUHJXODULGDGHVSRUYHQWXUDYHUL¿FDGDV †ƒ6HUiGLVSHQVDGDDRXWRUJDGHPDQGDWRTXDQGRVHWUDWDU
XII - requisitar força policial, bem como a colaboração dos de defensor nomeado ou, sido constituído, tiver sido indicado por
serviços médicos, hospitalares, educacionais e de assistência social, ocasião de ato formal com a presença da autoridade judiciária.
S~EOLFRVRXSULYDGRVSDUDRGHVHPSHQKRGHVXDVDWULEXLo}HV
† ƒ  $ OHJLWLPDomR GR 0LQLVWpULR 3~EOLFR SDUD DV Do}HV CAPÍTULO VII - DA PROTEÇÃO JUDICIAL DOS INTERES-
cíveis previstas neste artigo não impede a de terceiros, nas mesmas SES INDIVIDUAIS, DIFUSOS E COLETIVOS
hipóteses, segundo dispuserem a Constituição e esta Lei.
§ 2° - As atribuições constantes deste artigo não excluem outras, $UW   5HJHPVH SHODV GLVSRVLo}HV GHVWD /HL DV Do}HV GH
GHVGHTXHFRPSDWtYHLVFRPD¿QDOLGDGHGR0LQLVWpULR3~EOLFR responsabilidade por ofensa aos direitos assegurados à criança e ao
†ƒ2UHSUHVHQWDQWHGR0LQLVWpULR3~EOLFRQRH[HUFtFLRGH adolescente, referentes ao não-oferecimento ou oferta irregular:
suas funções, terá livre acesso a todo local onde se encontre criança I - o ensino obrigatório;
ou adolescente. II - de atendimento educacional especializado aos portadores
†ƒ2UHSUHVHQWDQWHGR0LQLVWpULR3~EOLFRVHUiUHVSRQViYHO GHGH¿FLrQFLD
pelo uso indevido das informações e documentos que requisitar, nas Ill - de atendimento em creche e pré-escola às crianças de zero
hipóteses legais de sigilo. a seis anos de idade;
†ƒ3DUDRH[HUFtFLRGDDWULEXLomRGHTXHWUDWDRLQFLVR9,,, IV - de ensino noturno regular, adequado às condições do edu-
GHVWHDUWLJRSRGHUiRUHSUHVHQWDQWHGR0LQLVWpULR3~EOLFR cando;
a) reduzir a termo as declarações do reclamante, instaurando o V - de programas suplementares de oferta de material didático-
competente procedimento, sob sua presidência; HVFRODUWUDQVSRUWHHDVVLVWrQFLDjVD~GHGRHGXFDQGRGRHQVLQRIXQ-
b) entender-se diretamente com a pessoa ou autoridade recla- damental;
PDGDHPGLDORFDOHKRUiULRSUHYLDPHQWHQRWL¿FDGRVRXDFHUWDGRV VI - de serviço de assistência social visando à proteção à famí-
F HIHWXDUUHFRPHQGDo}HVYLVDQGRjPHOKRULDGRVVHUYLoRVS~- OLDjPDWHUQLGDGHjLQIkQFLDHjDGROHVFrQFLDEHPFRPRDRDPSDUR
EOLFRVHGHUHOHYkQFLDS~EOLFDDIHWRVjFULDQoDHDRDGROHVFHQWH¿- às crianças e adolescentes que dele necessitem;
cando prazo razoável para sua perfeita adequação. 9,,GHDFHVVRjVDo}HVHVHUYLoRVGHVD~GH
9,,,  GH HVFRODUL]DomR H SUR¿VVLRQDOL]DomR GRV DGROHVFHQWHV
$UW1RVSURFHVVRVHSURFHGLPHQWRVHPTXHQmRIRUSDUWH privados de liberdade.
DWXDUiREULJDWRULDPHQWHR0LQLVWpULR3~EOLFRQDGHIHVDGRVGLUHLWRV Parágrafo Único - As hipóteses previstas neste artigo não ex-
e interesses de que cuida esta Lei, hipótese em que terá vista dos cluem da proteção judicial outros interesses individuais, difusos ou
autos depois das partes, podendo juntar documentos e requerer dili- FROHWLYRV SUySULRV GD LQIkQFLD H GD DGROHVFrQFLD SURWHJLGRV SHOD
gências, usando os recursos cabíveis. Constituição e pela Lei.

$UW$LQWLPDomRGR0LQLVWpULR3~EOLFRHPTXDOTXHUFDVR $UW$VDo}HVSUHYLVWDVQHVWH&DStWXORVHUmRSURSRVWDVQR
será feita pessoalmente. foro local onde ocorreu ou deva ocorrer a ação ou omissão, cujo
$UW$IDOWDGHLQWHUYHQomRGR0LQLVWpULR3~EOLFRDFDUUHWD juízo terá competência absoluta para processar a causa, ressalvadas
DQXOLGDGHGRIHLWRTXHVHUiGHFODUDGDGHR¿FLRSHORMXL]RXDUHTXH- a competência da Justiça Federal e a competência originária dos Tri-
rimento de qualquer interessado. bunais Superiores.

$UW  $V PDQLIHVWDo}HV SURFHVVXDLV GR UHSUHVHQWDQWH GR $UW3DUDDVDo}HVFtYHLVIXQGDGDVHPLQWHUHVVHVFROHWLYRV


0LQLVWpULR3~EOLFRGHYHUmRVHUIXQGDPHQWDGDV ou difusos, consideram-se legitimados concorrentemente:
,R0LQLVWpULR3~EOLFR
CAPÍTULO VI - DO ADVOGADO II - a União, os Estados, os Municípios, o Distrito Federal e os
Territórios;
$UW$FULDQoDRXRDGROHVFHQWHVHXVSDLVRXUHVSRQViYHO III - as associações legalmente constituídas há pelo menos um
e qualquer pessoa que tenha legítimo interesse na solução da lide DQRHTXHLQFOXDPHQWUHVHXV¿QVLQVWLWXFLRQDLVDGHIHVDGRVLQWHUHV-
poderão intervir nos procedimentos de que trata esta Lei, através de ses e direitos protegidos por esta Lei, dispensada a autorização da
advogado, o qual será intimado para todos os atos, pessoalmente ou assembléia, se houver prévia autorização estatutária.
SRUSXEOLFDomRR¿FLDOUHVSHLWDGRRVHJUHGRGHMXVWLoD †ƒ$GPLWLUVHiOLWLVFRQVyUFLRIDFXOWDWLYRHQWUHRV0LQLVWpULRV
Parágrafo Único - Será prestada assistência judiciária integral e 3~EOLFRVGD8QLmRHGRV(VWDGRVQDGHIHVDGRVLQWHUHVVHVHGLUHLWRV
gratuita àqueles que dela necessitarem. de que cuida esta Lei.
§ 2° - Em caso de desistência ou abandono da ação por
$UW1HQKXPDGROHVFHQWHDTXHPVHDWULEXDDSUiWLFDGH DVVRFLDomR OHJLWLPDGD R 0LQLVWpULR 3~EOLFR RX RXWUR LQWLPDGR
ato infracional, ainda que ausente ou foragido, será processado sem poderá assumir a titularidade ativa.
defensor.
†ƒ6HRDGROHVFHQWHQmRWLYHUGHIHQVRUVHUOKHViQRPHDGR $UW2VyUJmRVS~EOLFRVOHJLWLPDGRVSRGHUmRWRPDUGRV
pelo juiz, ressalvado o direito de, a todo tempo, constituir outro de interessados compromissos de ajustamento de sua conduta às exi-
sua preferência. JrQFLDVOHJDLVRTXDOWHUiH¿FiFLDGHWtWXORH[HFXWLYRH[WUDMXGLFLDO

Didatismo e Conhecimento 56
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW3DUDGHIHVDGRVGLUHLWRVHLQWHUHVVHVSURWHJLGRVSRU $UW   1DV Do}HV GH TXH WUDWD HVWH &DStWXOR QmR KDYH-
esta Lei, são admissíveis todas as espécies de ações pertinentes. rá adiantamento de custas, emolumentos, honorários periciais e
†ƒ$SOLFDPVHjVDo}HVSUHYLVWDVQHVWH&DStWXORDVQRUPDV quaisquer outras despesas.
do Código de Processo Civil.
† ƒ  &RQWUD DWRV LOHJDLV RX DEXVLYRV GH DXWRULGDGH S~EOLFD $UW4XDOTXHUSHVVRDSRGHUiHRVHUYLGRUS~EOLFRGHYHUi
ou agente de pessoa jurídica no exercício de arribações do Poder SURYRFDU D LQLFLDWLYD GR 0LQLVWpULR 3~EOLFR SUHVWDQGROKH LQIRU-
3~EOLFRTXHOHVHPGLUHLWROtTXLGRHFHUWRSUHYLVWRQHVWD/HLFDEHUi mações sobre fatos que constituam objeto de ação civil, e indican-
ação mandamental, que se regerá pelas normas da lei do mandado do-lhe os elementos de convicção.
de segurança.
$UW6HQRH[HUFtFLRGHVXDVIXQo}HVRVMXt]HVHWULEX-
$UW1DDomRTXHWHQKDSRUREMHWRRFXPSULPHQWRGHREUL- nais tiverem conhecimento de fatos que possam ensejar a propo-
JDo}HVGHID]HURXQmRID]HURMXL]FRQFHGHUiDWXWHODHVSHFt¿FDGD VLWXUDGHDomRFLYLOUHPHWHUmRSHoDVDR0LQLVWpULR3~EOLFRSDUDDV
obrigação ou determinará providências que assegurem o resultado
providências cabíveis.
prático equivalente ao do adimplemento.
† ƒ  6HQGR UHOHYDQWH R IXQGDPHQWR GD GHPDQGD H KDYHQGR
Art. 222 - Para instruir a petição inicial, o interessado poderá
MXVWL¿FDGRUHFHLRGHLQH¿FiFLDGRSURYLPHQWR¿QDOpOtFLWRDRMXL]
requerer às autoridades competentes as certidões e informações
FRQFHGHUDWXWHODOLPLQDUPHQWHRXDSyVMXVWL¿FDomRSUpYLDFLWDQGR
o réu. que julgar necessárias, que serão fornecidas no prazo de quinze
§ 2° - O juiz poderá, na hipótese do parágrafo anterior ou na dias.
sentença, impor multa diária ao réu, independentemente de pedido
GRDXWRUVHIRUVX¿FLHQWHRXFRPSDWtYHOFRPDREULJDomR¿[DQGR $UW20LQLVWpULR3~EOLFRSRGHUiLQVWDXUDUVREVXDSUH-
prazo razoável para o cumprimento do preceito. sidência, inquérito civil, ou requisitar, de qualquer pessoa, orga-
†ƒ$PXOWDVyVHUiH[LJtYHOGRUpXDSyVRWUiQVLWRHPMXOJDGR QLVPR S~EOLFR RX SDUWLFXODU FHUWLGlHV LQIRUPDo}HV H[DPHV RX
da sentença favorável ao autor, mas será devida desde o dia em que perícias, no prazo que assinalar, o qual não poderá ser inferior a
VHKRXYHUFRQ¿JXUDGRRGHVFXPSULPHQWR GH]GLDV~WHLV
†ƒ6HRyUJmRGR0LQLVWpULR3~EOLFRHVJRWDGDVWRGDVDV
$UW2VYDORUHVGDVPXOWDVUHYHUWHUmRDRIXQGRJHULGRSHOR diligências, se convencer da inexistência de fundamento para
Conselho dos Direitos da Criança e do Adolescente do respectivo a propositura da ação cível, promoverá o arquivamento dos
município. autos do inquérito civil ou das peças informativas, fazendo-o
†ƒ$VPXOWDVQmRUHFROKLGDVDWpWULQWDGLDVDSyVRWUkQVLWRHP fundamentadamente.
julgado da decisão serão exigidas através de execução promovida § 2° - Os autos do inquérito civil ou as peças de informação
SHOR0LQLVWpULR3~EOLFRQRVPHVPRVDXWRVIDFXOWDGDLJXDOLQLFLDWLYD arquivados serão remetidos, sob pena de se incorrer em falta grave,
aos demais legitimados. QRSUD]RGHWUrVGLDVDR&RQVHOKR6XSHULRUGR0LQLVWpULR3~EOLFR
§ 2° - Enquanto o fundo não for regulamentado, o dinheiro †ƒ$WpTXHVHMDKRPRORJDGDRXUHMHLWDGDDSURPRomRGH
¿FDUiGHSRVLWDGRUHPHVWDEHOHFLPHQWRR¿FLDOGHFUpGLWRHPFRQWD arquivamento, em sessão do Conselho Superior do Ministério
com correção monetária. 3~EOLFR SRGHUmR DV DVVRFLDo}HV OHJLWLPDGDV DSUHVHQWDU UD]}HV H
atas ou documentos, que serão juntados aos autos do inquérito ou
$UW2MXL]SRGHUiFRQIHULUHIHLWRVXVSHQVLYRDRVUHFXUVRV anexados às peças de informação.
para evitar dano irreparável à parte. †ƒ$SURPRomRGHDUTXLYDPHQWRVHUiVXEPHWLGDDH[DPHH
GHOLEHUDomRGR&RQVHOKR6XSHULRUGR0LQLVWpULR3~EOLFRFRQIRUPH
$UW7UDQVLWDGDHPMXOJDGRDVHQWHQoDTXHLPSXVHUFRQ- dispuser o seu Regimento.
GHQDomRDR3RGHU3~EOLFRRMXL]GHWHUPLQDUiDUHPHVVDGHSHoDVj
† ƒ  'HL[DQGR R &RQVHOKR 6XSHULRU GH KRPRORJDU D
autoridade competente, para apuração da responsabilidade civil e
promoção de arquivo, designará, desde logo, outro órgão do
administrativa do agente a que se atribua a ação ou omissão.
0LQLVWpULR3~EOLFRSDUDRDMXL]DPHQWRGDDomR
$UW'HFRUULGRVVHVVHQWDGLDVGRWUkQVLWRHPMXOJDGRGD
sentença condenatória sem que a associação autora lhe promova a $UW$SOLFDPVHVXEVLGLDULDPHQWHQRTXHFRXEHUDVGLV-
H[HFXomRGHYHUiID]rORR0LQLVWpULR3~EOLFRIDFXOWDGDLJXDOLQL- SRVLo}HVGD/HLQƒGHGHMXOKRGH
ciativa aos demais legitimados.
TÍTULO VII - DOS CRIMES E DAS INFRAÇÕES
$UW2MXL]FRQGHQDUiDDVVRFLDomRDXWRUDDSDJDUDRUpX ADMINISTRATIVAS
RVKRQRUiULRVDGYRFDWtFLRVDUELWUDGRVQDFRQIRUPLGDGHGR†GR
DUWGD/HLQƒGHGHMDQHLURGH&yGLJRGH3UR- CAPÍTULO I - DOS CRIMES
cesso Civil, quando reconhecer que a pretensão é manifestamente
infundada. SEÇÃO I - DISPOSIÇÕES GERAIS
3DUiJUDIRÒQLFR(PFDVRGHOLWLJkQFLDGHPiIpDDVVRFLDomR
autora e os diretores responsáveis pela propositura da ação serão $UW(VWH&DStWXORGLVS}HVREUHFULPHVSUDWLFDGRVFRQWUD
solidariamente condenados ao décuplo das custas, sem prejuízo de a criança e o adolescente, por ação ou omissão, sem prejuízo do
responsabilidade por perdas e danos. disposto na legislação penal.

Didatismo e Conhecimento 57
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW$SOLFDPVHDRVFULPHVGH¿QLGRVQHVWD/HLDVQRU- $UW'HL[DUDDXWRULGDGHFRPSHWHQWHVHPMXVWDFDXVD
PDVGD3DUWH*HUDOGR&yGLJR3HQDOHTXDQWRDRSURFHVVRDVSHU- de ordenar a imediata liberação de criança ou adolescente, tão logo
tinentes ao Código de Processo Penal. tenha conhecimento da ilegalidade da apreensão:
Pena - detenção de seis meses a dois anos.
$UW2VFULPHVGH¿QLGRVQHVWD/HLVmRGHDomRS~EOLFD $UW'HVFXPSULULQMXVWL¿FDGDPHQWHSUD]R¿[DGRQHVWD
incondicionada. Lei em benefício de adolescente privado de liberdade:
Pena - detenção de seis meses a dois anos.
SEÇÃO II - DOS CRIMES EM ESPÉCIE
$UW,PSHGLURXHPEDUDoDUDDomRGHDXWRULGDGHMXGLFLiULD
PHPEURGR&RQVHOKR7XWHODURXUHSUHVHQWDQWHGR0LQLVWpULR3~EOL-
$UW'HL[DURHQFDUUHJDGRGHVHUYLoRRXRGLULJHQWHGH
co no exercício de função prevista na Lei.
HVWDEHOHFLPHQWRGHDWHQomRjVD~GHGHJHVWDQWHGHPDQWHUUHJLVWUR
Pena - detenção de seis meses a dois anos.
das atividades desenvolvidas, na forma e prazo referidos no art.
 GHVWD /HL EHP FRPR GH IRUQHFHU j SDUWXULHQWH RX D VHX UHV- $UW6XEWUDLUFULDQoDRXDGROHVFHQWHDRSRGHUGHTXHPR
ponsável, por ocasião da alta médica, declaração de nascimento, WHPVREVXDJXDUGDHPYLUWXGHGHOHLRXRUGHPMXGLFLDOFRPR¿P
onde constem as intercorrências do parto e do desenvolvimento de colocação em lar substituto:
do neonato: Pena - reclusão de dois a seis anos, e multa.
Pena - detenção de seis meses a dois anos.
Parágrafo Único - Se o crime é culposo: $UW3URPHWHURXHIHWLYDUDHQWUHJDGH¿OKRRXSXSLORD
Pena - detenção de dois a seis meses, ou multa. terceiro, mediante paga ou recompensa:
Pena - reclusão de um a quatro anos, e multa.
$UW'HL[DURPpGLFRHQIHUPHLURRXGLULJHQWHGHHVWD- Parágrafo Único - Incide nas mesmas penas quem oferece ou
EHOHFLPHQWRGHDWHQomRjVD~GHGHJHVWDQWHGHLGHQWL¿FDUFRUUHWD- efetiva a paga ou recompensa.
mente o neonato e a parturiente, por ocasião do parto, bem como
GHL[DUGHSURFHGHUDRVH[DPHVUHIHULGRVQRDUWGHVWD/HL $UW3URPRYHURXDX[LOLDUDHIHWLYDomRGHDWRGHVWLQDGRDR
Pena - detenção de seis meses a dois anos. HQYLRGHFULDQoDRXDGROHVFHQWHSDUDRH[WHULRUFRPLQREVHUYkQFLD
Parágrafo Único - Se o crime é culposo: GDVIRUPDOLGDGHVOHJDLVRXFRPR¿WRGHREWHUOXFUR
Pena - detenção de dois a seis meses, ou multa. Pena - reclusão de quatro a seis anos, e multa.

$UW3URGX]LURXGLULJLUUHSUHVHQWDomRWHDWUDOWHOHYLVLYD
$UW3ULYDUDFULDQoDRXRDGROHVFHQWHGHVXDOLEHUGDGH
RXSHOtFXODFLQHPDWRJUi¿FDXWLOL]DQGRVHGHFULDQoDRXDGROHVFHQWH
SURFHGHQGRjVXDDSUHHQVmRVHPHVWDUHPÀDJUDQWHGHDWRLQIUD-
HPFHQDGHVH[RH[SOtFLWRRXSRUQRJUi¿FD
cional ou inexistindo ordem escrita da autoridade judiciária com-
Pena - reclusão de um a quatro anos, e multa.
petente: Parágrafo Único - Incorre na mesma pena quem, nas condições
Pena - detenção de seis meses a dois anos. referidas neste artigo, contracena com criança ou adolescente.
Parágrafo Único - Incide na mesma pena aquele que procede à
DSUHHQVmRVHPREVHUYkQFLDGDVIRUPDOLGDGHVOHJDLV $UW)RWRJUDIDURXSXEOLFDUFHQDGHVH[RH[SOtFLWRRXSRU-
QRJUi¿FDHQYROYHQGRFULDQoDRXDGROHVFHQWH
$UW   'HL[DU D DXWRULGDGH SROLFLDO UHVSRQViYHO SHOD Pena - reclusão de um a quatro anos.
apreensão de criança ou adolescente de fazer imediata comunica-
ção à autoridade judiciária competente e à família do aprendido ou $UW9HQGHUIRUQHFHUDLQGDTXHJUDWXLWDPHQWHRXHQWUHJDU
à pessoa por ele indicada: de qualquer forma, a criança o ou adolescente arma, munição ou
Pena - detenção de seis meses a dois anos. explosivo:
Pena - detenção de seis meses a dois anos, e multa.
$UW6XEPHWHUFULDQoDRXDGROHVFHQWHVREVXDDXWRULGD-
GHJXDUGDRXYLJLOkQFLDDYH[DPHRXDFRQVWUDQJLPHQWR $UW9HQGHUIRUQHFHUDLQGDTXHJUDWXLWDPHQWHPLQLVWUDU
Pena - detenção de seis meses a dois anos. ou entregar, de qualquer forma, a criança ou adolescente, sem justa
causa, produtos cujos componentes possam causar dependência físi-
$UW6XEPHWHUFULDQoDRXDGROHVFHQWHVREVXDDXWRULGD- ca ou psíquica, ainda que por utilização indevida:
Pena - detenção de seis meses a dois anos, e multa, se o fato não
GHJXDUGDRXYLJLOkQFLDDWRUWXUD
constitui crime mais grave.
Pena - reclusão de um a cinco anos.
†ƒ6HUHVXOWDUOHVmRFRUSRUDOJUDYH
$UW9HQGHUIRUQHFHUDLQGDTXHJUDWXLWDPHQWHRXHQWUHJDU
Pena - reclusão de dois a oito anos. de qualquer forma, a criança ou adolescente fogos de estampido ou
§ 2° - Se resultar lesão corporal gravíssima: GHDUWL¿FLRH[FHWRDTXHOHVTXHSHORVHXUHGX]LGRSRWHQFLDOVHMDP
Pena - reclusão de quatro a doze anos. incapazes de provocar qualquer dano físico em caso de utilização
†ƒ6HUHVXOWDUPRUWH indevida:
Pena - reclusão de quinze a trinta anos. Pena - detenção de seis meses a dois anos, e multa.

Didatismo e Conhecimento 58
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
CAPÍTULO II - DAS INFRAÇÕES ADMINISTRATIVAS $UW'HL[DURUHVSRQViYHOSRUGLYHUVmRRXHVSHWiFXORS~-
EOLFRGHD¿[DUHPOXJDUYLVtYHOHGHIiFLODFHVVRjHQWUDGDGRORFDO
$UW'HL[DURPpGLFRSURIHVVRURXUHVSRQViYHOSRUHVWD- de exibição, informação destacada sobre a natureza da diversão ou
EHOHFLPHQWRGHDWHQomRjVD~GHHGHHQVLQRIXQGDPHQWDOSUpHVFROD HVSHWiFXORHDIDL[DHWiULDHVSHFL¿FDGDQRFHUWL¿FDGRGHFODVVL¿FD-
ou creche, de comunicar à autoridade competente os casos de que ção:
WHQKDFRQKHFLPHQWRHQYROYHQGRVXVSHLWDRXFRQ¿UPDomRGHPDXV- Pena - multa de três a vinte salários de referência aplicando-se
-tratos contra criança ou adolescente:Pena - muita de três a vinte o dobro em caso de reincidência.
salários de referência, aplicando-se o dobro em caso de reincidência.
$UW$QXQFLDUVHSHoDVWHDWUDLV¿OPHVRXTXDLVTXHUUHSUH-
$UW,PSHGLURUHVSRQViYHORXIXQFLRQiULRGHHQWLGDGHGH sentações ou espetáculos, sem indicar os limites de idade a que não
atendimento o exercício dos direitos constantes nos incisos II, III, se recomendem:
9,,9,,,H;,GRDUWGHVWD/HL Pena - multa de três a vinte salários de referência, duplicada em
Pena - multa de três a vinte salários de referência, aplicando-se caso de reincidência, aplicável, separadamente, à casa de espetáculo
o dobro em caso de reincidência. e aos órgãos de divulgação ou publicidade.

$UW'LYXOJDUWRWDORXSDUFLDOPHQWHVHPDXWRUL]DomRGH- $UW7UDQVPLWLUDWUDYpVGHUiGLRRXWHOHYLVmRHVSHWiFXOR
vida, por qualquer meio de comunicação, nome, ato ou documento HPKRUiULRGLYHUVRGRDXWRUL]DGRRXVHPDYLVRGHVXDFODVVL¿FDomR
de procedimento policial, administrativo ou judicial relativo a crian- Pena - multa de vinte a cem salários de referência; duplicada
ça ou adolescente a que se atribua ato infracional: em caso de reincidência a autoridade judiciária poderá determinar a
Pena - multa de três a vinte salários de referência, aplicando-se suspensão da programação da emissora por até dois dias.
o dobro em caso de reincidência.
†ƒ,QFRUUHQDPHVPDSHQDTXHPH[LEHWRWDORXSDUFLDOPHQWH $UW([LELU¿OPHWUDLOHUSHoDDPRVWUDRXFRQJpQHUHFODV-
IRWRJUD¿DGHFULDQoDRXDGROHVFHQWHHQYROYLGRHPDWRLQIUDFLRQDO VL¿FDGR SHOR yUJmR FRPSHWHQWH FRPR LQDGHTXDGR jV FULDQoDV RX
RXTXDOTXHULOXVWUDomRTXHOKHGLJDUHVSHLWRRXVHUH¿UDDDWRVTXH adolescentes admitidos ao espetáculo:
OKHVHMDPDWULEXtGRVGHIRUPDDSHUPLWLUVXDLGHQWL¿FDUmRGLUHWDRX Pena - multa de vinte a cem salários de referência; na reincidên-
cia, a autoridade poderá determinar a suspensão do espetáculo ou o
indiretamente.
fechamento do estabelecimento por até quinze dias.
§ 2° - Se o fato for praticado por órgão de imprensa ou
emissora de rádio ou televisão, além da pena prevista neste artigo, a
$UW9HQGHURXORFDUDFULDQoDRXDGROHVFHQWH¿WDGHSUR-
autoridade judiciária poderá determinar a apreensão da publicação
JUDPDomR HP YtGHR HP GHVDFRUGR FRP D FODVVL¿FDomR DWULEXtGD
ou a suspensão da programação da emissora até por dois dias, bem
pelo órgão competente:
FRPRGDSXEOLFDomRGRSHULyGLFRDWpSRUGRLVQ~PHURV
Pena - multa de três a vinte salários de referência; em caso de
reincidência, a autoridade judiciária poderá determinar o fechamen-
$UW'HL[DUGHDSUHVHQWDUjDXWRULGDGHMXGLFLiULDGHVHX
to do estabelecimento por até quinze dias.
GRPLFtOLRQRSUD]RGHFLQFRGLDVFRPR¿PGHUHJXODUL]DUDJXDUGD
adolescente trazido de outra comarca para a prestação de serviço $UW   'HVFXPSULU REULJDomR FRQVWDQWH GRV DUWV  H 
doméstico, mesmo que autorizado pelos pais ou responsável: desta Lei:
Pena - multa de três a vinte salários de referência, aplicando-se Pena - multa de três a vinte salários de referência, duplicando-se
o dobro em caso de reincidência, independentemente das despesas a pena em caso de reincidência, sem prejuízo de apreensão da revista
de retorno do adolescente, se for o caso. ou publicação.

$UW'HVFXPSULUGRORVDRXFXOSRVDPHQWHRVGHYHUHVLQH- $UW'HL[DURUHVSRQViYHOSHORHVWDEHOHFLPHQWRRXRHP-
rentes ao pátrío poder ou decorrente de tutela ou guarda, bem assim presário de observar o que dispõe esta lei sobre o acesso de criança
determinação da autoridade judiciária ou Conselho Tutelar: ou adolescente aos locais de diversão, ou sobre sua participação no
Pena - multa de três a vinte salários de referência, aplicando-se espetáculo.
o dobro em caso de reincidência. Pena - muita de três a vinte salários de referência; em caso de
reincidência, a autoridade judiciária poderá determinar o fechamen-
$UW+RVSHGDUFULDQoDRXDGROHVFHQWHGHVDFRPSDQKDGR to do estabelecimento por até quinze dias.
dos pais ou responsável ou sem autorização escrita destes, ou da
autoridade judiciária, em hotel, pensão, motel ou congênere: DISPOSIÇÕES FINAIS E TRANSITÓRLAS
Pena - multa de dez a cinqüenta salários de referência; em caso
de reincidência, a autoridade judiciária poderá determinar o fecha- $UW$8QLmRQRSUD]RGHQRYHQWDGLDVFRQWDGRVGDSX-
mento do estabelecimento por até quinze dias. blicação deste Estatuto, elaborará projeto de lei dispondo sobre a
criação ou adaptação de seus órgãos às diretrizes da política de aten-
$UW   7UDQVSRUWDU FULDQoD RX DGROHVFHQWH SRU TXDOTXHU GLPHQWR¿[DGDVQRDUWHDRTXHHVWDEHOHFHR7tWXOR9GR/LYUR,,
PHLRFRPLQREVHUYkQFLDGRGLVSRVWRQRVDUWVHGHVWD/HL Parágrafo Único - Compete aos Estados e Municípios promo-
Pena - multa de três a vinte salários de referência, aplicando-se verem a adaptação de seus órgãos e programas às diretrizes e princí-
o dobro de reincidência. pios estabelecidos nesta Lei.

Didatismo e Conhecimento 59
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW 2V FRQWULEXLQWHVSRGHUmRGHGX]LUGRLPSRVWRGH-  $UW
vido, na declaração do Imposto sobre a Renda, o total das doa- § ƒ$XPHQWDVHDSHQDGHXPWHUoRVHRFULPHpSUDWLFDGR
ções feitas aos Fundos dos Direitos da Criança e do Adolescente contra pessoa menor de catorze anos.
- nacional, estaduais ou municipais - devidamente comprovadas,  $UW
obedecidos os limites estabelecidos em Decreto do Presidente da Parágrafo Único - Se a ofendida é menor de catorze anos:
5HS~EOLFD Pena - reclusão de quatro a dez anos.
†ƒ$VGHGXo}HVDTXHVHUHIHUHHVWHDUWLJRQmRHVWmRVXMHLWDV  $UW
a outros limites estabelecidos na legislação do imposto de renda, Parágrafo Único - Se o ofendido é menor de catorze anos:
nem excluem ou reduzem outros benefícios ou abatimentos e Pena - reclusão de três a nove anos.
deduções em vigor, de maneira especial as doações a entidades de
XWLOLGDGHS~EOLFD $UW2DUWGD/HLQƒGHGHGH]HPEURGH
§ 2° - Os Conselhos Municipais, Estaduais e Nacional dos ¿FDDFUHVFLGRGRVHJXLQWHLWHP
'LUHLWRVGD&ULDQoDHGR$GROHVFHQWH¿[DUmRFULWpULRVGHXWLOL]DomR $UW
através de planos de aplicação das doações subsidiadas e demais †ƒ$SHUGDHDVXVSHQVmRGRSiWULRSRGHU
receitas, aplicando necessariamente percentual para incentivo ao
acolhimento, sob a forma de guarda, de criança ou adolescente, $UW$,PSUHQVD1DFLRQDOHGHPDLVJUi¿FDVGD8QLmRGD
yUImRRXDEDQGRQDGRQDIRUPDGRGLVSRVWRQRDUW†ƒ9, administração direta ou indireta, inclusive fundações instituídas e
da Constituição Federal. PDQWLGDVSHOR3RGHU3~EOLFR)HGHUDOSURPRYHUmRHGLomRSRSXODU
†ƒ2'HSDUWDPHQWRGH5HFHLWD)HGHUDOGR0LQLVWpULRGD do texto integral deste Estatuto, que será posto à disposição das
Economia, Fazenda e Planejamento, regulamentará a comprovação escolas e das entidades de atendimento e de defesa dos direitos da
das doações feitas aos Fundos, nos termos deste artigo. (Nova re- criança e do adolescente.
dação conforme Lei Federal n° 8.242/91, de 12/10/91)
† ƒ  2 0LQLVWpULR 3~EOLFR GHWHUPLQDUi HP FDGD FRPDUFD $UW(VWD/HLHQWUDHPYLJRUQRYHQWDGLDVDSyVVXDSX-
D IRUPD GH ¿VFDOL]DomR GD DSOLFDomR SHOR )XQGR 0XQLFLSDO GRV blicação.
'LUHLWRV GD &ULDQoD H GR $GROHVFHQWH GRV LQFHQWLYRV ¿VFDLV 3DUiJUDIRÒQLFR'XUDQWHRSHUtRGRGHYDFkQFLDGHYHUmRVHU
referidos neste artigo. promovidas atividades e campanhas de divulgação e esclarecimen-
to acerca do disposto nesta Lei.
$UW¬IDOWDGRV&RQVHOKRV0XQLFLSDLVGRV'LUHLWRVGD
Criança e do Adolescente, os registros, inscrições e alterações a $UW5HYRJDPVHDV/HLVQƒVGHHGH
TXHVHUHIHUHRVDUWVSDUiJUDIR~QLFRHGHVWD/HLVHUmRHIH- GHRXWXEURGH &yGLJRGH0HQRUHV HDVGHPDLVGLVSRVL-
tuados perante a autoridade judiciária da comarca a que pertence ções em contrário.
a entidade. %UDVtOLD HP  GH MXOKR GH  ƒ GD ,QGHSHQGrQFLD H
3DUiJUDIRÒQLFR$8QLmR¿FDDXWRUL]DGDDUHSDVVDUDRV(V- ƒGD5HS~EOLFD
tados e Municípios, e os Estados aos Municípios, os recursos re-
ferentes aos programas e atividades previstos nesta Lei, tão logo
estejam criados os Conselhos dos Direitos da Criança e do Adoles-
cente nos seus respectivos níveis.
CONHECIMENTOS DE FISIOLOGIA DO
EXERCÍCIO, TREINAMENTO DESPORTIVO,
DESENVOLVIMENTO MOTOR.
$UW   (QTXDQWR QmR LQVWDODGRV RV &RQVHOKRV 7XWHODUHV
as atribuições a eles conferidas serão exercidas pela autoridade
judiciária.

$UW2'HFUHWROHLQƒGHGHGH]HPEURGH Princípios Básicos e Efeitos do Treinamento Físico


Código Penal, passa a vigorar com as seguintes alterações:
 $UW Os princípios do treino desportivo são basicamente seis, ha-
†ƒ1RKRPLFtGLRFXOSRVRDSHQDpDXPHQWDGDGHXPWHUoR vendo diferenciações pessoais de autores que lidam com o trei-
VHRFULPHUHVXOWDGHLQREVHUYkQFLDGHUHJUDWpFQLFDGHSUR¿VVmR QDPHQWRD¿UPDQGRDLQGDPDLVDQHFHVVLGDGHGHDSURIXQGDPHQWR
arte ou ofício, ou se o agente deixa de prestar imediato socorro à nos meios teóricos para o controle prático dos treinos. Treinamen-
vítima, não procura diminuir as conseqiiéncias do seu ato, ou foge to desportivo como estrutura lógica é a organização para a aplica-
SDUDHYLWDUSULVmRHPÀDJUDQWH6HQGRGRORVRRKRPLFtGLRDSHQD omRGRVPpWRGRVFLHQWt¿FRVGHWUHLQDPHQWRTXHYLVDPSRUPHLR
e aumentada de um terço, se o crime é praticado contra pessoa de mecanismos pedagógicos, atingir o mais alto rendimento hu-
menor de catorze anos. mano, nos aspectos e características técnicas, físicas, psicológicas,
 $UW sociais e espirituais do indivíduo ou equipe. “O treinamento, já
†ƒ$XPHQWDVHDSHQDGHXPWHUoRVHRFRUUHUTXDOTXHUGDV DFHLWR Ki DOJXP WHPSR FRPR FLrQFLD WHP VXD SRVLomR FLHQWt¿FD
KLSyWHVHVGRDUW†ƒ reforçada com referências consideradas essenciais para todos os
†ƒ$SOLFDVHjOHVmRFXOSRVDRGLVSRVWRQR†ƒGRDUW que buscam o alto rendimento atlético”. Tubino.

Didatismo e Conhecimento 60
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Toda e qualquer atividade necessita de normas para uma conduta racional de aplicação. No caso do treinamento desportivo e muscula-
ção particularmente, algumas normas e regras foram sendo criadas ou desenvolvidas com base em princípios relacionados com a constitui-
omRItVLFDKXPDQDHFRPDVUHVSRVWDVRUJkQLFDVDRVHVWtPXORVDSOLFDGRV2VSULQFtSLRVGRWUHLQRGHVSRUWLYRVmREDVLFDPHQWHVHLVHDEDL[R
HVFDORQDGRV+iGLIHUHQFLDo}HVSHVVRDLVGHDXWRUHVTXHOLGDPFRPRWUHLQDPHQWRD¿UPDQGRDLQGDPDLVDQHFHVVLGDGHGHDSURIXQGDPHQWRQRV
meios teóricos para o controle prático dos treinos. É comum o surgimento de subdivisões dentro de algum dos princípios do treinamento, situa-
ção esta que será visualizada em alguns parágrafos abaixo.
3ULQFtSLRGDLQGLYLGXDOLGDGHELROyJLFD
2. Princípio da adaptação
3ULQFtSLRGDVREUHFDUJD
3ULQFtSLRGDFRQWLQXLGDGHUHYHUVLELOLGDGH
3ULQFtSLRGDLQWHUGHSHQGrQFLDYROXPH;LQWHQVLGDGH
3ULQFtSLRGDHVSHFL¿FLGDGHGRVPRYLPHQWRV

3ULQFtSLRVHVSHFt¿FRVGDPXVFXODomRA musculação possui particularidades no momento da aplicação prática dos trabalhos, que estão
sempre vinculadas aos princípios do treinamento desportivo. Os princípios do treino neste caso são singularmente aplicados de maneira mais
TXDOL¿FDGDHHQFDPSDQGREDVLFDPHQWHDLQGLYLGXDOLGDGHELROyJLFDDVREUHFDUJD HDHVSHFL¿FLGDGHGRVPRYLPHQWRV$HVWUXWXUDomRGDVVH-
quencias de exercícios, tornou-se um conceito paralelo e considerado, como sendo um principio do treinamento exclusivo dos trabalhos contra
resistência.

3ULQFtSLRGDLQGLYLGXDOLGDGHELROyJLFDCada ser humano possui estruturas físicas e psicológicas individualizadas ou diferenciadas dos
GHPDLVVXJHULQGRTXHFDGDXPGHQyVVHMDXPVHU~QLFR2VHUKXPDQRpDXQLmRHQWUHDVFDUDFWHUtVWLFDVGRJHQyWLSR FDUJDJHQpWLFDUHFHELGD 
com o fenótipo (carga geral de elementos que são adicionados ao indivíduo após o nascimento) que criam o suporte de individualização huma-
QD$EDL[RQRTXDGURHQFRQWUDVHDOJXPDVFDUDFWHUtVWLFDVGRJHQyWLSRHGRIHQyWLSR

Quadro 01

Genótipo Fenótipo
Estatura Habilidades motoras e esportivas
Biótipo ou estrutura corporal Nível intelectual
Aptidões físicas e intelectuais Consumo máximo de oxigênio e limiar anaeróbio
Força máxima 3HUFHQWXDOGH¿EUDVPXVFXODUHV
Composição corporal
3HUFHQWXDOGRVWLSRVGH¿EUDVPXVFXODUHV

$VUHVSRVWDVDRWUHLQDPHQWRDSOLFDGRVmRGHWHUPLQDGDVSRUFDUDFWHUtVWLFDVKHUHGLWiULDVDVVRFLDGDVjVLQÀXrQFLDVGRPHLRDPELHQWH%XVFD-
PRVFRQWLQXDPHQWHRDSHUIHLoRDPHQWRGDVFDUDFWHUtVWLFDVWpFQLFRHVSRUWLYDVGDIRUPDPDLVHVSHFt¿FDHLQGLYLGXDOL]DGDSRVVtYHO4XDQWRPDLVR
WUHLQRDSUR[LPDUVHGDVFDUDFWHUtVWLFDVSRVLWLYDVGHUHVSRVWDVLQGLYLGXDLVPDLRUHVVHUmRDVSHUIRUPDQFHVDOFDQoDGDV&DGDVHUKXPDQRp~QLFRH
por este motivo necessita de um direcionamento personalizado para o treinamento visando o alto rendimento físico e desportivo. É inadmissível
a padronização de qualquer forma de treinamento, para grupos inteiros de indivíduos. O genótipo caracteriza os potenciais, a predisposição
LQDWDRXDSWLGmR$VKDELOLGDGHVVmRSDUWHGRIHQyWLSRRXGDVFDUDFWHUtVWLFDVSRVVtYHLVGHVHUHPLQFRUSRUDGDVDRLQGLYtGXR2VSUR¿VVLRQDLVGD
Educação físicas são bem familiarizados com os termos Aptidão e habilidade.
Entendemos por aptidão didaticamente expondo, como sendo os potenciais ou as qualidades inatas do homem, que são expressas continua-
mente por meio da predisposição e do talento. Como exemplos citamos a aptidão de força muscular máxima, a aptidão de resistência cardio-
YDVFXODUPi[LPDÀH[LELOLGDGHHYHORFLGDGHPi[LPDDWLQJtYHO³(YLGHQWHPHQWHRWUHLQDPHQWRItVLFRQmRPHOKRUDDFDSDFLGDGHGHGHVHPSHQKR
além daquele limite preestabelecido pelo genótipo”. Hollmann & Hettinger. As habilidades referem-se aos elementos que são adquiridos ou
aprendidos ao longo do tempo de vida, somando-se e formando um quadro de experiências. O ato de jogar ou praticar esportes, são transmitidos
aos indivíduos por meio de treinos e repetições contínuos, e são bons exemplos do que sejam as habilidades. “As condições neuromusculares,
SVLFRFRJQLWLYDVHDQkWRPRELRPHFkQLFDVTXHVmRKHUGDGDVFDUDFWHUL]DPGHXPDIRUPDJHUDODDSWLGmR8PGHVHQYROYLPHQWRPXLWRDFLPDGD
média dessas condições denomina-se talento”. “Pode-se dizer que os potenciais são determinados geneticamente e as capacidades ou habilida-
des expressas são decorrentes do fenótipo”).

3ULQFtSLRGDDGDSWDomRO princípio da adaptação do organismo ao treinamento possui particularidades relacionadas com o nível de estí-
mulo a ele aplicado. Durante a aplicação de estímulos de treinamento sobre o organismo deparamo-nos com o conceito de síndrome de adapta-
omRJHUDO 6$* DTXDOSRVVXLIDVHVFRUUHODFLRQDGDVFRPRVHVWtPXORVRXVWUHVVHV2VVWUHVVHVSRGHPVHUGHRUGHPItVLFDELRTXtPLFDHPHQWDO
A síndrome de adaptação geral possui três fases distintas abaixo escalonadas.

Didatismo e Conhecimento 61
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
([FLWDomRRXFKRTXHDSUHVHQWHIDVHSRGHUiSURYRFDUGRUHVHSRUHVWHPRWLYRTXHGDPRPHQWkQHDQRUHQGLPHQWRSURYRFDQGRXPSH-
ríodo de reação de alarme no organismo.
2. Resistência ou adaptação - esta fase tende a provocar uma adaptação ao estímulo aplicado com elevação no rendimento.
([DXVWmRRXFDQVDoRQHVWDIDVHRFRUSRQmRUHVSRQGHSRVLWLYDPHQWHDRVHVWtPXORVSRUMiHVWDUDGDSWDGRSRVVLYHOPHQWHKDYHUiTXHGD
de rendimento nos casos de treinamento excessivo. Há o risco de lesões temporárias ou permanentes.

1RVFDVRVHPTXHRHVWtPXORVHMDPXLWRIUDFRHVWHQmRSURGX]LUiDGDSWDomRVDWLVIDWyULDHVHUiFODVVL¿FDGRFRPRHVWtPXOR'pELO2VHVWtPX-
ORVGHEDL[DLQWHQVLGDGHTXHDSHQDVH[FLWDPRRUJDQLVPRHQmRSURGX]HPDGDSWDo}HVSRVWHULRUHVVmRFODVVL¿FDGRVFRPR0pGLRV2VHVWtPXORV
Fortes são exatamente aqueles que proporcionam as adaptações mais seguras, plenas e prolongadas. Busca-se no treinamento consciente e
organizado, na maior parte do tempo, exatamente a manutenção desta forma de estímulo. Os estímulos Muito Fortes acarretam sensíveis danos
ao organismo e podem seguramente causar lesões, se não forem extremamente controlados por meio de testes periódicos e avaliações genera-
lizadas prévias relacionadas ao estado biológico maturacional e também psicológico do indivíduo.
Os conceitos acima descritos, trazem consigo um alerta e a base para que sejamos cautelosos no momento da aplicação de sobrecargas no
RUJDQLVPRGXUDQWHRVWUHLQDPHQWRV$EXVFDLQFHVVDQWHSRUFRPELQDo}HVLGHDLVGHDOWHUQkQFLDHQWUHRVHVWtPXORV0pGLRVH)RUWHV são a base para
o sucesso do treinamento. Saber em qual momento elevar o estímulo e ou reduzi-lo é a chave para as portas do alto rendimento. A utilização
de estímulos Muito Fortes é necessária para a ultrapassagem das barreiras que surgem no decorrer dos treinamentos dos atletas de alto nível.
Não devemos utilizar treinamentos nesta faixa de estímulo por mais de um ciclo (microciclo de choque), ou seja, mais do que sete dias, e muito
PHQRVXWLOL]iORFRPDWOHWDVRXSUDWLFDQWHVQRYDWRV8PFLFORGHWUHLQDPHQWRGHDDQRVFRQVHFXWLYRV OHLGRVTXDWURDQRV ID]VHQHFHVViULR
antes de arriscar estes níveis tão elevados de cargas nos treinos. Não devemos esquecer que grandes performances atléticas são alcançadas após
DDQRVGHWUHLQRVLQWHQVLYRVHVLVWHPiWLFRV$EDL[RQRTXDGURDSUHVHQWDVHXPDSURSRVWDFODVVL¿FDWyULDFRPDVFRQGLo}HVGHLQWHQVLGDGH
e carga adicional referente aos estímulos proveniente do treinamento contra resistência.

Quadro 02

Condições de intensidade Carga adicional Estímulo


Máxima  Muito forte
Submáxima D Muito forte
*UDQGHžVXE]RQD D Forte
*UDQGHžVXE]RQD D Forte
0RGHUDGDžVXE]RQD D Forte
Moderada 2º subzona D Médio
3HTXHQDžVXE]RQD D Médio
Pequena 2º subzona D Fraco

O organismo humano responde de maneira diferenciada a cada estímulo a ele aplicado. O estresse vivido quotidianamente no meio ambien-
te, produz interferências que devem ser consideradas em conjunto aos estímulos do treino. As respostas aos treinamentos podem ser negativas
FDVRKDMDLQÀXrQFLDGRPHLRVHPXPDGHTXDGRFRQWUROHGRWUHLQDGRU$VUHVSRVWDVDRVHVWtPXORVSVtTXLFRVHVRFLDLVVmRUHOHYDQWHVVREUHD
SHUIRUPDQFH$VDWLWXGHVSVLFROyJLFDVQHJDWLYDVFRPRDQVLHGDGHDQJXVWLDFRQ¿DQoDH[FHVVLYDGHSUHVVmRHWFHIDWRUHVVRFLDLVFRPRRDEXVR
de bebidas alcóolicas, festas, excessos sexuais, tabagismo e outros, necessitam estar sob controle do treinador. A individualidade deverá possuir
grande atenção aos períodos de adaptação, como exemplo citamos as crianças e os adolescentes, que possuem um estado de predisposição para
DGDSWDUHPVHPDLVIDFLOPHQWHDRVHVWtPXORVGHWUHLQRFRPSUHGRPLQkQFLDGHYROXPHDOWRFRPLQWHQVLGDGHPRGHUDGDDEDL[D
Em muitos casos surgem quedas sobre o rendimento biológico, sem uma explicação plausível. Quando após uma minuciosa pesquisa dos
hábitos de vida, surge o diagnóstico preciso de excesso de atividades paralelas, que são degradantes sobre as respostas do treinamento. A falta
de repouso adequado e maus hábitos alimentares são exemplos clássicos. O estresse no treinamento é necessário. As situações de estresse no
cotidiano são pouco prováveis de serem eliminadas. Resta ao treinador para que haja uma adaptação plena do organismo de seu educando, con-
centrar esforços e atenção, aos fatores que podem estar conduzindo o organismo a um estado de treinamento excessivo quer sejam eles durante
DVVHVV}HVGHWUHLQRRXGXUDQWHDVKRUDVIRUDGRkPELWRGHFRQWUROHWpFQLFR

3ULQFtSLRGDVREUHFDUJDRelaciona-se à aplicação das cargas de trabalho. O presente princípio está intimamente ligado ao treinamento
diário do indivíduo em sala de aula, assim como possui estreita relação com o princípio da adaptação e com o princípio da continuidade. Após a
aplicação de uma sobrecarga de treinamento o organismo necessita repor novamente a energia utilizada e reconstituir as estruturas desgastadas,
para que no ato da aplicação das sobrecargas futuras o organismo esteja em condições favoráveis para receber um novo estímulo, com intensida-
GHLJXDORXVXSHULRUDRDQWHULRUDSOLFDGR2IHQ{PHQRGDVXSHUFRPSHQVDomRDSOLFDGRDRVPHFDQLVPRVHQHUJpWLFRVRUJkQLFRVFDUDFWHUL]DVHSRU
promover o armazenamento a níveis ligeiramente acima daquele encontrado durante o início do treinamento. As reservas energéticas estarão,
após uma relação equilibrada entre repouso e reposição alimentar adequada, com um superávit ou estoque extra de energia, para ser utilizada
prontamente no próximo treinamento.

Didatismo e Conhecimento 62
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Sabendo-se da possibilidade da supercompensação, procura-se ampliar a intensidade das cargas de treinamento sempre que possível,
visDQGRSURYRFDUPDLRUHVYROXPHVQRVHVWRTXHVHQHUJpWLFRVSRUPHLRGHWUHLQDPHQWRVSHULyGLFRVFRPFDUDFWHUtVWLFDVHVSHFt¿FDVFRQWtQXDV
crescentes, variadas, assim como exatas. O tempo que levará para o organismo repor energia e estocá-la em suas reservas, esta intimamente
UHODFLRQDGRFRPDVREUHFDUJDLPSRVWDDEDL[RQRTXDGURDHQFRQWUDVHRSHUtRGRSDUDDUHFXSHUDomRGDVIRQWHVHQHUJpWLFDVXWLOL]DGDVGXUDQWH
XPWUHLQDPHQWRPi[LPR1RTXDGUREHQFRQWUDVHXPDFODVVL¿FDomRUHODFLRQDGDjVFDUJDGHWUHLQDPHQWRHPXPDVHVVmR

Quadro 03 a.
Sobrecarga de característica máxima

Fonte Anaeróbia láctica Aeróbia alática


Anaeróbia láctica (ATP-PC)
energética (Glicogênio) (glicogênio e gorduras)
Recuperação DPLQXWRV PLQXWRVDKRUDV DGLDV

Quadro 03 b.

Carga de treinamento por sessão Tempo para restauração


Extrema 0DLRUTXHKRUDV
*UDQGH 'HKDK
Substancial 'HKDK
Média 'HKDK
Pequena 0HQRUTXHKRUDV

Nos trabalhos contra resistência é fundamental a escolha das cargas exatamente dentro dos objetivos predeterminados, ou seja os percen-
tuais de carga devem estar dentro dos padrões relacionados ao desenvolvimento da qualidade física alvo. Cada carga imposta ao organismo
SURGX]UHVSRVWDVPHWDEyOLFDVItVLFDVHSVLFROyJLFDVHVSHFt¿FDVHHPFRPXPDFRUGRFRPDLQWHQVLGDGHLPSRVWD6REUHFDUJDVFRQWUDUHVLVWrQFLD
PXVFXODomR  SURGX]HP PRGL¿FDo}HV SULQFLSDOPHQWH VREUH D HVWUXWXUD SURWpLFD H PHWDEROLVPR JOLFROtWLFR RX DQDHUyELR GD ¿EUD PXVFXODU
principalmente as do tipo IIb e IIa, em contrapartida treinos cíclicos e contínuos de baixa e média intensidade, estimulam melhorias sobre os
DVSHFWRVPHWDEyOLFRVDHUyELRVVREUHDV¿EUDVPXVFXODUHVGRWLSR,HVREUHRVLVWHPDFiUGLRSXOPRQDUHFLUFXODWyULR9HUL¿FDVHGHVWDIRUPD
XPDFDUDFWHUtVWLFDEiVLFDSDUDRVXUJLPHQWRGRSULQFtSLRGDFDUJDHVSHFt¿FD
$VVREUHFDUJDVGHWUHLQDPHQWRSRGHPVHUFODVVL¿FDGDVFRPRVREUHFDUJDHVWLPXODQWHVREUHFDUJDGHPDQXWHQomRRXVREUHFDUJDGHGHV-
treinamento. A sobrecarga estimulante é sempre mais elevada que o nível neutro e produz adaptações sobre o organismo. A sobrecarga de
PDQXWHQomRpDTXHODRQGHRQtYHOHVWDGHQWURGD]RQDQHXWUD FRPSUHHQGHVHFRPR]RQDQHXWUDDVREUHFDUJDTXHQmRSURGX]PRGL¿FDo}HV
VLJQL¿FDWLYDVQHPSRVLWLYDVQHPQHJDWLYDVVREUHRRUJDQLVPRGRDWOHWD HSRUHVWHPRWLYRQmRHVWLPXODPHOKRULDVVREUHRRUJDQLVPRKDYHQGR
apenas a manutenção do estado de treinamento. A sobrecarga de destreinamento localiza-se abaixo da zona neutra e impossibilita a manutenção
RXHOHYDomRGHXPHVWDGRGHWUHLQDPHQWRGHVWDIRUPDLGHQWL¿FDVHXPGHFUpVFLPRQRUHQGLPHQWR9HUL¿FDVHXPDTXHGDQDFRQGLomRItVLFD
mais acentuada nos primeiros dias de sobrecargas de destreinamento, quando estas situam-se em limiares próximos aos de repouso.
2FRQFHLWRGHVREUHFDUJDFRQVLGHUDDSHQDVDVFDUJDVGHWUDEDOKRTXHLPS}HPDRVVLVWHPDVRUJkQLFRVHWHFLGRVFRUSRUDLVXPHVWtPXORDFL-
ma daquele limite, ao qual o organismo já esteja acostumado. Neste caso, seguindo-se o conceito proposto no presente parágrafo, os estímulos
TXHSURYRFDPGHVWUHLQDPHQWRQmRVHULDPFODVVL¿FDGRVFRPRVREUHFDUJDVHVLPFRPRHVWtPXORVGpEHLV)RUoRVDPHQWHGHYHPRVHPSUHJDUD
estas condições que propiciam ao estado de destreinamento, o conceito de princípio da reversibilidade. Este princípio será abordado juntamente
FRPRSULQFtSLRGDFRQWLQXLGDGH$EDL[RQRTXDGURHQFRQWUDPVHRVSHUFHQWXDLVGHFDUJDVUHODFLRQDGRVSDUDRWUHLQDPHQWRGDVYDOrQFLDV
físicas.

Quadro 04.

Valência física Repetições Grupos % de cargas


Força pura D D D
)RUoDGLQkPLFD D D D
Força explosiva D D D
Resistência de força muscular localizada D D D

Didatismo e Conhecimento 63
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Busca-se na aplicação das cargas o momento mais propício e manas consecutivas. Sucessivamente a este período, aplicamos um
exato em que o organismo esteja em seu mais alto nível de recupe- WUDEDOKRFRPFDUJDVGHHVWtPXORPpGLRGXUDQWHVHPDQDVVHJXLGD
ração física e psicológica. Esta forma de aplicação das cargas é uma GH  D  VHPDQDV FRP HVWtPXOR PXLWR IRUWH QHVWH FDVR DV VpULHV
das variáveis que buscamos freqüentemente para elevar continua- dos exercícios na musculação são repetidas no máximo duas vezes
mente o nível de rendimento. Esta forma de manipulação das cargas na semana). Outra maneira de variação nas cargas de treinamento
é também aceita como um principio de relacionado ao treinamento SDUDLQLFLDQWHVpRWUHLQDPHQWRHPVHPDQDVFRPHVWtPXORVPp-
desportivo e conceituado como princípio da sucessão exata das car- GLRVVHPDQDVFRPHVWtPXORIRUWHHDVVLPFRQWLQXDPHQWHDWpTXH
JDV+iXPDJUDQGHGL¿FXOGDGHHPSUHGHWHUPLQDURH[DWRHVWDGRGH LGHQWL¿TXHVHRLQLFLRGDHVWDELOL]DomRQRUHQGLPHQWRFRPDVFDU-
UHFXSHUDomRRUJkQLFRLQGLYLGXDOSRUHVWHIDWRGHYHPRVHVWDUFRQWL- gas de estímulo forte. A partir deste momento começamos a mesclar
nuamente indagando com os nossos alunos sobre sensações subje- HVWtPXORV PXLWR IRUWH GXUDQWH FLFORV GH WUHLQDPHQWRV FXUWRV GH 
WLYDVUHODFLRQDGDVDRHVWDGRGHkQLPRVRQRFDQVDoRRXGRUHVTXH VHPDQDFRPHVWtPXORVIUDFRVRXUHFXSHUDWLYRVGHDVHPDQDV
podem ser de grande ajuda na determinação de uma recuperação Como observado no parágrafo anterior as cargas possuem ca-
plena do organismo. Períodos muito curtos ou prolongados de inati- racterísticas diferenciadas, não sendo iguais mesmo durante o trei-
vidade, podem produzir as reações citadas. no contínuo, pelo fato de os atletas submeterem-se a competições
A recuperação plena do organismo poderá ocorrer em mo- com fases distintas de polimento e destreino programado. Por estes
mentos diferenciados, e em relação direta aos fatores exógenos e motivos expostos surgiu o princípio da carga periódica. As sobre-
LQWHQVLGDGHGRWUHLQDPHQWRYLGHTXDGUREFRPRVRQRDGHTXDGR cargas devem ser programadas com antecedência no plano geral de
DOLPHQWDomR EDODQFHDGD H VX¿FLHQWH YROXPH FDOyULFR HVWtPXOR RX treinamento em ordem direta com as competições alvo, feito isto
sobrecarga muito forte e periódica etc. Para um controle mais ra- saberemos com exatidão os momentos oportunos para a aplicação
cional deve-se fazer uso constante dos testes para a determinação GDV VREUHFDUJDV HVSHFt¿FDV YLVDQGR R GHVHQYROYLPHQWR GD TXDOL-
do estado atual de desempenho, e avaliar a evolução/involução do dade física mais importante para o presente momento. O estado de
mesmo em relação ao estado de desempenho no início de cada me- treinamento ideal deverá ser atingido em comum acordo com prá-
sociclo de treino. A comparação dos resultados pode ser a luz para o ticas de sobrecargas adequadas de treinamento e no período exato
acerto das sobrecargas que visam a elevação máxima da qualidade para a sua utilização. Caso as cargas de treinamento sejam de inten-
física alvo, e principalmente dentro do tempo previsto para o desem- sidade muito forte nos períodos iniciais ou mesmo débil durante a
penho máximo. IDVHFRPSHWLWLYDDVUHVSRVWDVRUJkQLFDVSRVLWLYDVSDUDRVXFHVVRQR
As cargas de trabalho devem ser contínuas e variadas na me- desenvolvimento das mais altas performances não serão atingidas.
dida do possível. A manutenção desta forma de dosagem de cargas
é o princípio da aplicação contínua das cargas. Cargas contínuas Princípio da continuidade/reversibilidade
(estímulo de treino permanente) criam a condição de treinamento
crônico ou prolongado e estão diretamente relacionadas ao acumulo $V PRGL¿FDo}HV LQGX]LGDV SHOR WUHLQDPHQWR VmR WUDQVLWyULDV
de experiências motoras, que após serem assimiladas ao longo dos ou passageiras. Todas as características secundárias adquiridas por
anos, serão perdidas na mesma proporção em que foram adquiridas meio do treino, perdem-se e retornam aos limites iniciais pré treina-
em caso de interrupção do treino, assim como, a recuperação será mento, após determinado período de inatividade. Pelo motivo ex-
mais rápida após a retomada dos trabalhos, mesmo que em condi- posto há sempre a necessidade de manutenção do treinamento em
ções de intensidade inferiores. Durante o período programado de níveis contínuos para a manutenção de um estado de treinamento
transição do treinamento, não deve ser permitido ao atleta excluir-se mais elevado. A perda nos níveis de adaptação adquiridos no treino
dos treinos por longos períodos, é preferível a redução dos trabalhos estão intimamente relacionados ao período de tempo em que foram
em termos de volume, para que não seja atingido o destreinamento, adquiridos. Como regra “quanto mais longo o período de treinamen-
o qual ocorre com longos períodos de inatividade. to mais longo será o período de destreino. Toda aquisição que se
Pelo motivo exposto acima, deve-se programar os treinamentos ganha lentamente e em um tempo prolongado mantém-se com mais
FRPDQWHFHGrQFLDVX¿FLHQWHSDUDTXHVHMDPLQFOXVRVSHUtRGRVPtQL- facilidade e perde-se com mais lentidão do que as aquisições conse-
mos de inatividade durante todo o ciclo de treinamento. A mesma re- guidas rapidamente e em um tempo curto.
gra é válida não só para o período de treinamento competitivo, mas Alguns aspectos morfológicos e funcionais como no caso das
também para todo o ciclo da vida humana. Não devemos manter os adaptações anaeróbias que perdem-se mais rapidamente do que as
percentuais de treinamento em níveis permanentes e muito menos as DGDSWDo}HV DHUyELDV H GH IRUoD Pi[LPD$ KLSHUWUR¿D PXVFXODU p
FDUJDVVHUHP¿[DV$DSOLFDomRGRSULQFtSLRGDVFDUJDVYDULiYHLVRX tanto quanto vagarosa em sua evolução durante o treino quanto no
variadas, é para que não haja uma estabilização e acomodação (que- destreinamento. A redução da força durante o destreino dá-se em
da) e seja um estímulo permanente ao desenvolvimento do estado uma velocidade inferior quando comparada com o tempo para aqui-
de treinamento. Para que o estímulo de cargas torne-se permanente sição no treino. Vale lembrar, que os níveis de força muscular em
e crescente há uma variação entre estímulos fortes, médios, e muito períodos curtos de destreino, permanecem um pouco acima daque-
fortes, este ultimo no caso de atletas de elite. Saber manipular com les encontrados no pré treinamento. Para evitar uma drástica perda
exatidão as cargas de trabalho intenso e recuperativo faz a diferença nos níveis de força alcançados, e criando condições para preservar
QRSURGXWR¿QDOGRWUHLQDPHQWR um declínio mais vagaroso da mesma, deve-se programar períodos
Os ciclos de treinamentos divididos e organizados em micro- curtos de trabalhos contra resistência. A atitude de criar microciclos
ciclos de choque, ordinário e recuperativo, criam as condições para breves de treinamento de força, visando uma manutenção satisfató-
um maior controle e menor erro sobre a aplicação de cargas elevadas ULDGDIRUoDFRPPHQRUSHUGDPRPHQWkQHDID]VHOyJLFDQHFHVViULD
e intermediárias. A utilização de um ciclo de treino ordinário com e econômica, assim como aproveita de maneira otimizada os efeitos
LQWHQVLGDGH GH HVWtPXOR IRUWH p EHP WROHUDGR GXUDQWH  D  VH- residuais do treinamento.

Didatismo e Conhecimento 64
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Para a manutenção ou preservação da força durante um breve período de destreino ou manutenção, deve-se trabalhar contra resistência
duas vezes por semana, salientamos que estas cargas de trabalhos possuem baixo volume mas com intensidade elevada nos casos de atletas de
elite e praticantes assíduos. A escolha dos exercícios torna-se valiosa, e é imprescindível a presença dos exercícios principais no caso de atletas
GHHOLWH'iVHSUHIHUrQFLDDRVH[HUFtFLRVPXOWLDUWLFXODUHVHGHJUDQGHVPDVVDVPXVFXODUHVH[FHWRQRVFDVRVHVSHFt¿FRVHVSRUWLYRV

Princípio da interdependência volume X intensidade

O presente princípio baseia-se na relação ótima de aplicação do volume e da intensidade no treinamento, comumente sempre que o volume
GHWUHLQRHOHYDVHUHGX]VHDLQWHQVLGDGH&RPRUHJUDJHUDOGHVHJXUDQoDGiVHSULRULGDGHDRYROXPHQDVSULPHLUDVPRGL¿FDo}HVGRWUHLQR
HPVHJXLGDHOHYDVHDLQWHQVLGDGH(QWHQGHPRVFRPRYROXPHDTXDQWLGDGHGHWUHLQDPHQWRFDUDFWHUL]DGDSRUWRGDPXGDQoDRXPRGL¿FDomR
UHODFLRQDGDDRQ~PHURGHUHSHWLo}HVSRUVpULHGHH[HUFtFLRVQ~PHURGHH[HUFtFLRVHPFDGDVpULHRXVHTXrQFLDQ~PHURGHJUXSRVQ~PHURGH
treinos diários, semanais e mensais do macrociclo. A intensidade é reconhecida como a qualidade do treinamento, possui estreita relação com
as manipulações sobre a sobrecarga de trabalho(percentual de cargas), intervalos de repouso, velocidade de execução dos gestos etc.
O volume de treinamento na atualidade encontra um lugar de destaque tão alto quanto a intensidade. Em alguns esportes é elemento deter-
minante do sucesso esportivo, e relacionado diretamente com a quantidade de treinamento alcançado no decorrer da preparação do atleta. Como
exemplo os esportes de resistência (maratona, esqui de fundo, triatlon etc.) fazem parte desse seleto grupo.

“Elevar o volume de treinamento é uma necessidade para qualquer desporto ou evento aeróbio”.

“Uma característica adicional de treinamento, importante sob o ponto de vista prático, é o alto volume de treinamento ou a quantidade
total de peso levantado durante uma sessão de treinamento”.

A intensidade do treinamento é prioritária e inerente aos esportes de força e velocidade, por este motivo há uma grande preocupação com
o controle das sobrecargas empregadas no cotidiano. Para que haja um acompanhamento periódico sobre a intensidade aplicada no treinamento
GHIRUoDGHYHPRVXWLOL]DURFDOFXORGRFRH¿FLHQWHGHLQWHQVLGDGHSRUPHLRGDHTXDomR&RH¿FLHQWHGHLQWHQVLGDGHHP  PpGLDGHSHVR
OHYDQWDGR.J[ 6RPD FDUJDVPi[LPDV GRGHVHPSHQKRDWOpWLFR.J%XVFDVHH[FHSFLRQDOPHQWHQRWUHLQDPHQWRDWXDODPDQXWHQomR
dos treinos de atletas de elite, um alto volume associado a uma intensidade também elevada. A presente forma de estímulo só deve ser utilizada
durante períodos breves de treinos, e visam principalmente ultrapassar os limites de estagnação ou estabilização da performance física.

“A elevação contínua do volume de treinamento é provavelmente uma das mais altas prioridades do treinamento contemporâneo”.

1RTXDGURHQFRQWUDVHXPPRGHORLPDJLQiULRGHPHVRFLFORFRPRVPLFURFLFORVGHLQWHQVLGDGHHYROXPHHOHYDGRVGHWUHLQDPHQWR

Quadro 05

0HVRFLFORHVSHFt¿FR3HUFHQWXDOGHFDUJDV

Semanas Microciclos Volume Intensidade


ž Choque Alto Alta
2º Recuperativo Moderado Moderada
ž Choque Alto Alta
ž Recuperativo Moderado Moderada

$DSOLFDomRGHXPHVWtPXORGHWUHLQDPHQWRSURYRFDVREUHRRUJDQLVPRXPDUHVSRVWDHVSHFL¿FDHUHODFLRQDGDGLUHWDPHQWHjIRUPDGHH[HU-
FtFLRXWLOL]DGR7UHLQDPHQWRGHIRUoDSURYRFDDGDSWDo}HVVREUHRVPHFDQLVPRVQHXURPXVFXODUHVHVSHFt¿FRVGDV¿EUDVPXVFXODUHVTXHIRUDP
solicitadas nos treinos. Contrariamente, os exercícios de resistência provocam adaptações musculares sobre as mitocôndrias e capilares para
HOHYDUDFDSDFLGDGHGHJHUDUHQHUJLDDHUyELD$SUySULDÀH[LELOLGDGHSRVVXLHOHPHQWRVUHODFLRQDGRVFRPDVUHVSRVWDVHVSHUDGDVGRWUHLQDPHQWR
2WUHLQDPHQWRGHÀH[LELOLGDGHGHYHVHURPDLVSUy[LPRSRVVtYHOGDUHDOLGDGHGRHVSRUWHSUDWLFDGRRXVHMDDSRVLomRGRPRYLPHQWRQRWUHLQR
poderá trazer respostas diferenciadas caso não esteja adequada à posição normalmente utilizada durante a prática esportiva. Os fusos muscula-
res reagem de maneira semelhante àquela já habituada (treinada) e a cada novo processo de utilização diferenciado, este deve ser ajustado ou
regulado mediante a nova exigência motora.
Mesmo nas atividades com a mesma característica de movimento e energética, obtêm-se respostas diferentes, e em comum acordo com
DH[LJrQFLDPRWRUDDSOLFDGD$VPRGL¿FDo}HVLQGX]LGDVSRUWUHLQDPHQWRGHFRUULGDHFLFOLVPRVREUHROLPLDUGHODFWDWRVDQJtQHR)RUDP
FRPSDUDGDVDPRVWUDVSRUPHLRGHWHVWHVUHDOL]DGRVQRLQtFLRHQR¿QDOGRWHPSRGHWUHLQDPHQWR2VWHVWHVIRUDPUHDOL]DGRVHPWDSHWHURODQWHH
ELFLFOHWD5HVSHFWLYDPHQWHRVUHVXOWDGRVIRUDPRWUHLQDPHQWRGHFRUULGDDXPHQWRXHHOHYRXHPRVUHVXOWDGRVGRVWHVWHVQDHVWHLUDH
QDELFLFOHWD2WUHLQDPHQWRGHFLFOLVPRHOHYRXHPRVUHVXOWDGRVQDELFLFOHWDHVHPQHQKXPDPHOKRULDQROLPLDUQDHVWHLUD

Didatismo e Conhecimento 65
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
“A transferência dos ganhos de treinamento pode diferir signi- ¿FDVHRXLQGLFDGDVSDUDFRPDUHDOLGDGHPRPHQWkQHDGRFRQGLcio-
¿FDWLYDPHQWHPHVPRHPH[HUFtFLRVPXLWRVLPLODUHV´ namento ou estado de treinamento do aluno/atleta. Abaixo estarão
enumeradas algumas das possíveis divisões, que podem ser utili-
Há a possibilidade de possibilitarmos melhorias sobre a endu- zadas no ato da confecção das séries ou sequências de exercícios.
rance intensa, quando esta for treinada paralelamente e principal-
mente em dias alternados com a força muscular, neste caso detec- 6HTXrQFLD6LPSOHVRXDOWHUQDGDSRUDUWLFXODomR realiza-
tamos uma transferência positiva da forma de treinamento e não da -se um exercício em uma região articular, o próximo será executa-
HVSHFL¿FLGDGH GR WUHLQR MXVWL¿FDQGR D XWLOL]DomR PRPHQWkQHD GR do em outra região distinta e após repouso predeterminado. Alter-
Cross training neste caso em particular. Necessitamos ainda de mais na-se progressivamente os exercícios durante a realização de toda
pesquisas relacionadas à possível síndrome de transferencia positiva a sequência. Utiliza-se esta forma de treinamento principalmente
para varias atividades de treinamento cruzado ou combinado. Como SDUDRVLQLFLDQWHVREMHWLYDQGRSRUPHLRGDDOWHUQkQFLDGRVJUXSRV
H[HPSOR FOiVVLFR GD HVSHFL¿FLGDGH GR PRYLPHQWR WHPRV QDWXUDO- musculares não elevar demasiadamente o nível de fadiga local. Os
mente uma diferença no desenvolvimento da força, relacionada com
WUHLQDPHQWRVYLVDQGRIRUoDPi[LPDIRUoDH[SORVLYDHIRUoDGLQk-
cada angulo do arco do jogo articular. Por este fato, um treinamento
PLFDVmREHQH¿FLDGRVTXDQGRKiSRXFDRXQHQKXPDIDGLJDDFHQ-
voltado apenas para o desenvolvimento das qualidades físicas espe-
tuada no momento da realização da exigência motora.
Ft¿FDVGRHVSRUWHWRUQDVHSRXFRSURGXWLYRRXSRWHQFLDOPHQWHLQ-
IHULRUFDVRQmRVHMDDVVRFLDGRDRVPRYLPHQWRVHJHVWRVHVSHFt¿FRV
HVSRUWLYRV$ELRPHFkQLFDHVSRUWLYDSRVVXLHOHPHQWRVGHWHUPLQDQ- 6HTXrQFLD%iVLFD dá-se ênfase aos exercícios que envolvam
tes no momento da escolha dos exercícios, para serem introduzidos RV JUDQGHV JUXSRV RX FDGHLDV PXVFXODUHV HVSHFL¿FDPHQWH
e treinados a cada período do programa geral de treinamento . exercícios biarticulares. A inclusão dos exercícios que envolvam
Nadadores devem destinar a maior parte do tempo do treina- RVP~VFXORVGHFDUDFWHUtVWLFDGHVXVWHQWDomRFRUSRUDOFRPRFR[DV
mento, realizando e aperfeiçoando o nado propriamente dito, corre- JO~WHRVORPEDUHVDEGRPLQDLVGRUVDLVVXSHULRUHVHRPEURVGHYHP
dores devem correr e assim logicamente os outros esportes devem sempre estar presentes nesta série, caso não haja impedimentos de
fazer o mesmo, na aplicação dos gestos e das técnicas inerentes ao ordem anatomopatológica, para a inclusão dos mesmos.
esporte. Na escolha dos exercícios para o desenvolvimento dos jo-
YHQVDWOHWDVTXDVHWRGRVRVH[HUFtFLRVVmREHQp¿FRVHSURSRUFLR- 6HTXrQFLD3ULRULWiULD a escolha dos exercícios dá-se fren-
nam melhorias da performance, devendo ser usados na formação WH D XPD H[LJrQFLD HVSHFt¿FD VREUH XP JUXSDPHQWR RX UHJLmR
física de base ou geral durante os primeiros anos de desenvolvimen- muscular previamente selecionado. Neste exemplo os exercícios
to esportivo. À medida que o atleta aproxima-se de seu limite máxi- são aglomerados em função da característica de atuação do mesmo
mo geneticamente determinado, e passa a competir rotineiramente grupo muscular sobre os movimentos.
buscando a superação de recordes, surge a necessidade de otimizar
a escolha dos exercícios, para que os mesmos sejam produtivos na 6HTXrQFLD3DUFHODGD os exercícios são dispostos em se-
elevação do estado de treinamento. ries distintas e divididos ou distribuídos ao longo do dia (manhã,
A complexidade do exercício torna-o cada vez mais estressante. tarde , noite) ou durante a semana de treino. Treinos ao longo do
À medida que os exercícios complexos são introduzidos no treina- GLDVmREDVLFDPHQWHXWLOL]DGRVSRUKDOWHUR¿OLVWDV$IRUPDSDUFHOD-
mento, de forma lenta e gradual passam a ser melhor compreendidos da semanalmente é alvo principal dos culturistas, por proporcionar
e assimilados por parte do organismo do atleta, tornando-se mais maior período de repouso entre as solicitações dos grupos muscu-
plástico e até certo ponto realizado de modo intuitivo. As exigências lares selecionados em cada série. A presente série também poderá
para o treino de alta complexidade técnica são inerentes aos esportes ser utilizada nos trabalhos da musculação atual, nos casos daquelas
competitivos. Os treinamentos técnicos devem ser precedidos por SHVVRDVTXHWUHLQDPDSDUWLUGHGLDVQDVHPDQDGHYHVHGLYLGLUD
período de repouso pleno, para que a assimilação pelo sistema ner- VpULHFRPPXLWDDWHQomRJDUDQWLQGRTXHRVP~VFXORVVHMDPVROLFL-
voso central dos engramas motores dos gestos, seja facilitada e não
tados no mínimo ideal de duas vezes durante a semana.
possua interferências geradas principalmente por cansaço extremo
ou má adaptação.
6HTXrQFLD6HOHWLYD faz-se a seleção de exercícios de carac-
terística biarticular ou multiarticular, com esse treinamento visa-se
“A transferência do ganho de treinamento é baixa em bons
atletas; para iniciantes quase todos exercícios são úteis”. DWLQJLU HVWDGRV GH IDGLJD H[WUHPRV VREUH RV P~VFXORV VHOHFLRQD-
GRV$R¿QDOGDUHDOL]DomRGRQ~PHURGHUHSHWLo}HVSUHGHWHUPLQD-
Os exercícios para desenvolvimento da velocidade de desloca- dos para cada grupo, aplica-se duas contrações de caráter estático
mento, da força explosiva e coordenação motora, devem ser intro- RXLVRPpWULFRHPWRUQRGHDVHJXQGRV(VWDPDQHLUDGHPRQ-
duzidos no início da sessão de treinamento, exceto nos casos em que tagem e execução dos exercícios deve ser encorajada apenas aos
YLVDVHDFDSDFLGDGHGHUHVLVWrQFLDRXPDQXWHQomRGDH¿FLrQFLDGRV DOXQRVH[SHULHQWHVRXHPIDVHGHWUHLQDPHQWRHVSHFt¿FR
gestos sobre estresse ou fadiga competitiva.
6HTXrQFLD$VVRFLDGDjDUWLFXODomRDGMDFHQWH o segundo
3ULQFtSLRGDHVWUXWXUDomRGDVVHTXHQFLDVGHH[HUFtFLRVEsse exercício é composto pela articulação que foi utilizada durante o
princípio é responsável pela criação ou montagem das séries ou se- primeiro exercício, e adicionada a uma articulação próxima ou
quências de exercícios, na forma de aplicação prática durante os trei- DGMDFHQWHYLVDQGRDPDQXWHQomRPi[LPDGRÀX[RVDQJXtQHRQD
nos contra resistência. Em função direta com os períodos ou fases de região articular promovendo uma maior vascularização por meio
treinamento, deve-se selecionar e utilizar as sequências mais especí- de uma elevada hiperemia local.

Didatismo e Conhecimento 66
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
 6HTXrQFLD $OWHUQDGD SRU RULJHP H LQVHUomR PXVFXODU Habilidades Motoras Fundamentais
esta forma de ordenação é aplicada utilizando-se os exercícios que Estabilizadoras
envolvem cadeias musculares de característica biarticular. Comu- - É o aspecto mais fundamental do aprendizado de movimentar-
PHQWHKDYHUiDOWHUQkQFLDHQWUHRWUDEDOKRLQLFLDOVHUVREUHDRULJHP -se;
RXDLQVHUomRQmRKDYHQGRXPDUHJUDHVSHFL¿FDGHWHUPLQDQWH - Envolve a disposição de manter em equilíbrio a relação indi-
víduo / força da gravidade.
8. Sequência Continuada, bombeada ou localizada por - Todo movimento envolve um elemento de estabilidade quan-
DUWLFXODomR há uma exploração «máxima» dos movimentos do analisado da perspectiva do equilíbrio;
permitidos por uma articulação. A forma de montagem da série - A estabilidade implica na manutenção do controle corporal em
JHUDOPHQWHXWLOL]DPRYLPHQWRVRXP~VFXORVRSRVWRVVREUHDPHVPD movimentos que favoreçam o equilíbrio;
articulação ou seja agonista/antagonista, podendo-se aplicar ou - Todas as atividades locomotoras e manipulativas são, em par-
excluir os intervalos de recuperação entre os exercícios opostos. A te, movimentos estabilizadores.
característica de manutenção da hiperemia muscular no membro
utilizado é objetivada da mesma forma que a série do parágrafo Locomotoras
anterior. Manipulativas
0RYLPHQWRV $[LDLV Movimentos do tronco ou dos mem-
Os princípios do treinamento desportivo e musculação são bros que direcionam o corpo em posição estacionária. Inclinar-se,
inter-relacionados, e não há a possibilidade de exclusão de algum. esticar-se, virar-se, balançar-se, alcançar, erguer, empurrar, puxar;
Sempre um princípio estará em conformidade com os outros, e caso Frequentemente combinam-se com outros para criar habilidades
não sejam respeitados e dentro de uma lógica ou controle racional, PRWRUDV PDLV HODERUDGDV 'HVHPSHQKRV H¿FLHQWHV HP JLQiVWLFD
cria-se com esta atitude de negligência, as condições exatas para a patinação e dança, incorporam movimentos axiais, bem como mo-
instalação de lesões e ou mesmo, não atingir o maior rendimento vimentos locomotores.
individual predeterminado geneticamente. Conhecer e dominar os
princípios básicos do treinamento desportivo e musculação, assim
como, aplica-los coerentemente, é parte integrante de um conjunto
de situações reais que devem sempre nortear os caminhos de um
treinador.
O professor deve estar preparado e fundamentado nos princí-
SLRVWHyULFRVDFLPDH[SRVWRVSDUDWULOKDUVHJXURHFLHQWL¿FDPHQWH
alicerçado, e assim obter sucesso, por meio do controle sobre os me-
FDQLVPRV¿VLROyJLFRVSVLFROyJLFRVHVRFLDLVTXHLQFLGHPVREUHDV
UHVSRVWDVRUJkQLFDV2FRQWUROHVREUHDVUHVSRVWDVGRRUJDQLVPRDRV
treinos aplicados, é decisivo para elevar de forma segura o estado de
treinamento dos educandos. Sempre que for alcançado um degrau a
mais na escada que conduz ao equilíbrio entre a condição física, psí-
quica, social e espiritual, obteremos por meio deste degrau a certeza
GRFXPSULPHQWRGDWDUHIDWpFQLFRSUR¿VVLRQDOGD(GXFDomR)tVLFD

Habilidades Motoras Fundamentais

Fatores que interferem no desenvolvimento das habilidades


motoras fundamentais 5RWDomR&RUSRUDO Requerem quantidades excessivas de con-
trole de equilíbrio. Envolvem labirinto e cerebelo.
- Embora relacionada à idade, a aquisição das habilidades mo-
toras não é dependente da idade, mas de outros fatores:
- Da tarefa em si
- Do indivíduo
- Do ambiente

Habilidades motoras fundamentais e desenvolvimento

- O movimento é um processo em desenvolvimento nos anos


LQLFLDLVGDLQIkQFLD
- O estágio de amadurecimento da maior parte das habilidades
PRWRUDVIXQGDPHQWDLVVHGiSRUYROWDGRVDQRV
- Um “movimento fundamental” envolve os elementos básicos
somente daquele movimento em particular;
- Os traços básicos de um movimento fundamental devem ser
os mesmos para todas as crianças.

Didatismo e Conhecimento 67
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
'HVYLRCombinado de movimentos locomotores de deslizar com rápidas alterações de direção, requerendo reações rápidas.

Equilíbrio em um só pé

(TXLOtEULR(VWiWLFR o mais comum a ser avaliado.

Caminhada Direcionada

$SRLR,QYHUWLGR onde o corpo assume a posição de cabeça para baixo, por alguns segundos, antes da interrupção do movimento.

Didatismo e Conhecimento 68
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Movimentos Locomotores Fundamentais

&DPLQKDGD Processo de perder e recuperar equilíbrio continuamente. O desenvolvimento da caminhada independente pode surgir entre
RVHPHVHV$PDWXUDomRGHVWHSDGUmRGHORFRPRomRpDWLQJLGDHQWUHRVHRVDQRV

A Marcha

Desenvolvimento Motor

Didatismo e Conhecimento 69
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$ &RUULGD Não está associada ao desenvolvimento da
marcha, toda criança que anda, em princípio, corre. O padrão
amadurecido da corrida é fundamental para a participação bem
sucedida nas atividades recreativas, de lazer e desportivas.

3XOR é similar à corrida, envolve transferência de peso de um


pé a outro, perda de contato com a superfície, maior elevação e co-
EUHPDLRUHVGLVWkQFLDVTXHDFRUULGD

6DOWR 0LVWR envolve a passada e o salto juntos, em padrão


FRPELQDGR GH PRYLPHQWR e XP ÀX[R FRQWtQXR GD SDVVDGD H GR
6DOWRGHXPDDOWXUDConcentra-se no impulso, na fase de ele- salto, envolvendo o ritmo.
vação e no padrão do pouso.
0RYLPHQWRV 0DQLSXODWLYRV )XQGDPHQWDLV Envolve o rela-
6DOWR9HUWLFDOEnvolve a projeção do corpo verticalmente no cionamento de um indivíduo com objetos e caracteriza-se pela apli-
ar, o impulso dado por um ou dois pés e o pouso, com os dois pés cação de força nos objetos e a recepção da força.
.
0RYLPHQWRV$PRUWHFHGRUHV quando o corpo ou parte dele é
posicionado no caminho de um objeto em movimento, com o pro-
pósito de parar ou desviar esse objeto: apanhar; aparar.

0RYLPHQWRV3URSXOVRUHV quando um objeto é movimentado


para longe do corpo: arremessar; chutar; bater; rolar.

Os Movimentos Manipulativos Envolvem

- Projeção de estimativa da trajetória


- Velocidade da viagem
3UHFLVmR'LVWkQFLD
- Massa do objeto em movimento

OBS: combinam movimentos estabilizadores e locomotores.

Movimentos Manipulativos Fundamentais

- Rolamento de bola
- Arremesso supramanual
- Ato de apanhar
- Chute
- Ato de aparar
6DOWR+RUL]RQWDO É um movimento explosivo que requer o de- - Ato de rebater
sempenho coordenado de todas as partes do corpo. Impulso e pouso - Drible
devem ser feitos com os dois pés. - Voleio

Didatismo e Conhecimento 70
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Sequência do surgimento das habilidades de estabilidade

Movimento Emergência Maturidade


(TXLOtEULRGLQkPLFR DQRV DQRV
Equilíbrio estático PHVHV DQRV
Movimentos axiais 2 meses DQRV

Sequência do surgimento das habilidades locomotoras

Movimento Emergência Maturidade


Caminhada PHVHV PHVHV
Corrida PHVHV DQRV
Salto PHVHV DQRV
Saltito DQRV DQRV
*DORSH DQRV DQRV

Sequência do surgimento das habilidades manipulativas

Movimento Emergência Maturidade


Alcançar, segurar e soltar DPHVHV PHVHV
Lançar DQRV DQRV
Agarrar, pegar 2 anos DQRV
Chutar PHVHV DQRV
Bater DQRV DQRV

$VKDELOLGDGHVPRWRUDVIXQGDPHQWDLVVmRDEDVHGDSVLFRPRWULFLGDGHSDUDDIXWXUDDTXLVLomRGDVKDELOLGDGHVPRWRUDVHVSHFt¿FDVSDUDFDGD
desporto... e o desenvolvimento continua...

$SWLGmR0RWRUD3RGHVHUGH¿QLGDFRPRDVFRQGLo}HVLQWUtQVHFDVjWDUHIDDFHUWRLQGLYtGXRHDRDPELHQWHTXHWRUQDPRGRPtQLRGHXPD
tarefa particular apropriado.

+DELOLGDGHV0RWRUDV(VSHFLDOL]DGDV6mRSDGU}HVPRWRUHVIXQGDPHQWDLVPDGXURVTXHIRUDPUH¿QDGRVHFRPELQDGRVSDUDIRUPDU
KDELOLGDGHVHVSRUWLYDVHVSHFt¿FDVHKDELOLGDGHVPRWRUDVFRPSOH[DV+DELOLGDGHVPRWRUDVHVSHFLDOL]DGDVVmRHVSHFt¿FDVGHWDUHIDV2V
movimentos fundamentais não o são.

Progresso das Habilidades Motoras Especializadas

Estágio de Transição
3ULPHLUDVWHQWDWLYDVGHFRPELQDUHUH¿QDUSDGU}HVPRWRUHVPDGXURV
- Aumento de interesse nos esportes e nos padrões de desempenho;
$VFULDQoDVQmRVHVHQWHPOLPLWDGDVSRUIDWRUHVDQDW{PLFRV¿VLROyJLFRVRXDPELHQWDLV
- O indivíduo procura “compreender a ideia” de como desempenhar a habilidade esportiva;
- A habilidade e a competência são limitadas.

Estágio de Aplicação
- O indivíduo torna-se mais consciente de seus recursos físicos pessoais;
- A ênfase está na melhora da competência;
- O treino é a chave para o desenvolvimento de níveis superiores de habilidade.

Estágio de Utilização Permanente


- Os indivíduos reduzem a área de suas buscas atléticas;
- Algumas áreas são escolhidas para a participação em atividades competitivas;
- Atividades permanentes são escolhidas com base nos interesses pessoais, habilidades, disponibilidade e em experiências passadas;
- Ocorre uma crescente responsabilidade e compromisso de tempo.

Didatismo e Conhecimento 71
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
- O desenvolvimento motor fundamental maduro é pré-requi- inferiores unidos, com as pontas dos pés dirigidas para frente. Não
sito para a incorporação bem sucedida de habilidades motoras es- LPSRUWDSRUWDQWRTXHRFDGiYHUHVWHMHVREUHDPHVDHPGHF~ELWR
pecializadas. YHQWUDOGHF~ELWRGRUVDORXGHF~ELWRODWHUDODVGHVFULo}HVDQDW{PLFDV
- O desenvolvimento de habilidades motoras especializadas é são feitas considerando o indivíduo em posição anatômica.
altamente dependente de oportunidades para a prática, encorajamen-
to e ensino de qualidade. Planos de Delimitação e Secção do Corpo Humano

Depois que uma criança alcança o estágio maduro de um pa- Na posição anatômica o corpo humano pode ser delimitado por
drão motor fundamental, poucas alterações ocorrem na forma da- planos tangentes á superfície. Estes planos são ditos planos de de-
TXHODKDELOLGDGHPRWRUDQDIDVHPRWRUDHVSHFLDOL]DGD2UH¿QDPHQ- limitação.
to do padrão e variações na forma de estilo ocorrem à medida que
se alcança maior habilidade (precisão, exatidão e controle), porém, Têm-se assim, os seguintes planos:
o padrão básico permanece inalterado. As habilidades motoras es-
pecializadas são movimentos fundamentais maduros que foram -Dois planos verticais, um tangente ao ventre (plano ventral ou
anterior) e outro ao dorso (plano dorsal ou posterior). Estes e outros
DGDSWDGRVjVQHFHVVLGDGHVHVSHFt¿FDVGHXPDDWLYLGDGHHVSRUWLYD
a eles paralelos são também designados como planos frontais, por
recreativa ou do cotidiano.
serem paralelos á “fronte”.
-Dois planos verticais tangentes aos lados do corpo (planos la-
terais direito e esquerdo).
&21&(,726$1$720,$%,20(75,$ -Dois planos horizontais, um tangente á cabeça (plano cranial
BIOMECÂNICA E FISIOLOGIA DO ESFORÇO. ou superior) e outro á planta dos pés (plano podálico ou inferior).
Já os planos de secção são:
-Plano que divide o corpo humano em metades direita e esquer-
da é denominado de mediano. Toda secção do corpo feita por planos
paralelos ao mediano é uma secção sagital (corte sagital) e os planos
Fisiologia:(do grego physis  QDWXUH]D IXQomR RX IXQFLRQD- de secção são também chamados sagitais.
mento; e logos SDODYUDRXHVWXGR pRUDPRGDELRORJLDTXHHVWX- -Planos de secção que são paralelos aos planos ventral e dorsal
GDDVP~OWLSODVIXQo}HVPHFkQLFDVItVLFDVHELRTXtPLFDVQRVVHUHV são ditos frontais e a secção é também denominada frontal (corte
YLYRV'HXPDIRUPDPDLVVLQWpWLFDD¿VLRORJLDHVWXGDRIXQFLRQD- frontal).
mento do organismo. -Planos de secção que são paralelos aos planos cranial podálico
e caudal são horizontais. A secção é denominada transversal (corte
Para o entendimento do funcionamento do nosso organismo, e transversal).
necessária a visão de noções básicas de como se dá a inter-relação
entre os sistemas. É disto que trata a Fisiologia. A homeostase de- )LJXUD3ODQRVGHVHFomRGRFRUSRKXPDQR
signa a tendência do organismo vivo em manter constante o meio
interno, em equilíbrio. Quando o organismo não consegue manter a
homeostase ocorre a doença. Quando o corpo é ameaçado ou sofre
um trauma, sua resposta pode envolver mudanças estruturais ou fun-
cionais. Essas mudanças podem ser adaptativas ou mal adaptativas.
Os mecanismos de defesa que o corpo suporta vai determinar a dife-
UHQoDHQWUHVD~GHHGRHQoD

Quando você procura assistência médica, precisa usar os


termos anatômicos corretos para descrever a posição, a direção e a
localização da vítima. Primeiramente, veremos os termos relativos à
posição, direção e localização.

Posição anatômica

Para evitar o uso de termos diferentes nas descrições anatômica,


considerando que a posição pode ser variável, optou-se por uma po-
sição padrão, denominada posição de descrição anatômica (posição
anatômica). A B C D - Plano cranial ou superior
()*+3ODQRSRGiOLFRRXLQIHULRU
Descrição da posição anatômica: indivíduo em posição ereta A B E F - Plano ventral ou anterior
(em pé, posição ortostática ou bípede), com a face voltada pra fren- &'*+3ODQRGRUVDORXSRVWHULRU
te, olhar dirigido para o horizonte, membros superiores estendidos, %&)*3ODQRODWHUDOHVTXHUGR
aplicados ao tronco e com as palmas voltadas para frente, membros A D E H - Plano lateral direito

Didatismo e Conhecimento 72
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
)LJXUD3ODQRVGHGHOLPLWDomRGRFRUSRKXPDQR Princípios gerais de construção corpórea nos vertebrados
- Antimeria: o plano mediano divide o corpo do indivíduo em
duas metades, direita e esquerda. Estas metades são denominadas
antímeros e são semelhantes, morfológica e funcionalmente, sendo
possível dizer que o homem é construído segundo o princípio da
simetria bilateral.
- Metameria: superposição, no sentido longitudinal, de segmen-
WRV VHPHOKDQWHV FDGD VHJPHQWR FRUUHVSRQGHQGR D XP PHWkPHUR
Exemplo: coluna vertebral (superposição das vértebras), caixa torá-
cica (superposição de costelas).
- Paquimeria: é o princípio segundo o qual o segmento axial do
corpo do indivíduo é constituído, esquematicamente, por dois tubos.
Os tubos, denominados paquímeros, são respectivamente, ventral e
dorsal. O paquímero ventral, maior, contém a maioria das vísceras
e, por esta razão é também denominado paquímero visceral. O pa-
químero dorsal compreende a cavidade craniana e o canal vertebral
e aloja o sistema nervoso central; por esta razão, também é chamada
de paquímero neural.
(VWUDWL¿FDomRRFRUSRVHULDIRUPDGRSRUXPDVpULHGHFDPD-
das, (estratos) superpostas umas as outras. Exemplo: pele, tecido
- Eixos do corpo humano FHOXODUVXEFXWkQLRDSRQHXURVHP~VFXORVSHULW{QLR
São linhas imaginárias traçadas no indivíduo. Os eixos princi-
pais seguem três direções ortogonais: Planos dos movimentos
(L[RVDJLWDOkQWHURSRVWHULRUXQHRFHQWURGRSODQRYHQWUDODR +iSODQRVHVSHFt¿FRVGHPRYLPHQWRQRVTXDLVRVYiULRVPR-
centro do plano dorsal (héteropolar) YLPHQWRVDUWLFXODUHVSRGHPVHUFODVVL¿FDGRV4XDQGRRPRYLPHQWR
(L[RORQJLWXGLQDOFUkQLRFDXGDOXQHRFHQWURGRSODQRFUDQLDO ocorre em um plano, a articulação move-se ou gira em torno de um
ao centro do plano podálico (héteropolar). HL[RTXHWHPXPDUHODomRGHžFRPHVVHSODQR
-Eixo transversal, látero-lateral: une o centro do plano lateral - Plano antero-posterior ou sagital: esse plano bisseciona o cor-
direito ao centro do plano lateral esquerdo (homopolar). po da frente para trás, dividindo-o em metades simétricas direita e
x Termos de posição e direção HVTXHUGD'HPRGRJHUDORVPRYLPHQWRVGHÀH[mRHH[WHQVmRWDLV
-Estruturas situadas no plano mediano (linha xy) são denomina- como rosca bíceps, extensões de joelhos e elevações de deitado a
das medianas (a, b, c). Exemplo: coluna vertebral, nariz. sentado (abdominais) ocorrem neste plano.
- As estruturas (d, e , f) são ditas, respectivamente, medial, in- - Plano lateral, frontal ou coronal: ele bisseciona o corpo lateral-
termédia e lateral. Exemplo: o V dedo ( mínimo) é medial em rela- mente de lado a lado, dividindo-o em metades da frente e de trás. Os
ção ao polegar, enquanto este é lateral em relação ao V dedo. movimentos de abdução e adução tais como abdução de quadril e de
- As estruturas (g, h, i) são ditas, respectivamente, dorsal (pos- RPEURHÀH[mRODWHUDOHVSLQKDORFRUUHPQHVWHSODQR
terior), média e ventral (anterior). - Plano transverso ou horizontal: divide o corpo horizontalmen-
$VHVWUXWXUDV H UHSUHVHQWDPDIDFHH[WHUQDHDIDFHLQWHU- te em metade superior e inferior. De maneira geral, os movimentos
na da costela. rotacionais tais como pronação, supinação e rotação espinhal ocor-
- Nos membros empregam-se termos especializados de posi- rem neste plano.
ção. Por exemplo, a mão é distal, o antebraço é médio e o braço é
proximal em relação ao corpo. Termos relativos à posição:
Posição anatômica – o paciente está em pé, ereto, os braços para
baixo ao longo do corpo, as palmas voltadas para frente. “Direita” e
“esquerda” referem-se à direita e esquerda da vítima.
3RVLomRGHGHF~ELWRGRUVDO±RDFLGHQWDGRHVWiGHLWDGRGHFRVWDV
(com a barriga para cima).
3RVLomRGHGHF~ELWRYHQWUDO±RDFLGHQWDGRHVWiGHLWDGRFRPD
barriga para baixo (de bruços).
3RVLomR GH GHF~ELWR ODWHUDO ± R SDFLHQWH HVWi GHLWDGR GH ODGR
(direito ou esquerdo).

Termos relativos à direção e à localização:


- Superior – em direção à cabeça.
- Inferior – em direção aos pés.
- Anterior – em direção à frente.
- Posterior – em direção ao dorso.
- Medial – em direção à linha mediana ou centro do corpo.
)LJXUDWHUPRVGHSRVLomRHGLUHomR - Lateral – para a esquerda ou direita da linha mediana.

Didatismo e Conhecimento 73
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
- Proximal – próximo ao ponto usado como referência. Derme
- Distal – longe do ponto usado como referência.
6XSHU¿FLDO – próximo à superfície. $GHUPHFyULRF~WLVYHUGDGHLUDRXSHOHYHUGDGHLUDpULMDÀH[tYHO
- Profundo – distante da superfície. e elástica. É mais espessa na superfície dorsal do corpo que na ventral
- Interno – do lado de dentro. e na parte lateral mais que na medial dos membros. Nas pálpebras,
- Externo – do lado de fora. HVFURWRHSrQLVpH[FHVVLYDPHQWH¿QDHGHOLFDGD
A pele consiste em um tecido conjuntivo com quantidade variável
GH¿EUDVHOiVWLFDVHQXPHURVRVQHUYRVYDVRVVDQJXtQHRVHOLQIiWLFRV
O tecido conjuntivo se dispõe em duas camadas: uma profunda ou
reticular eDRXWUDVXSHU¿FLDORXSDSLODU
$ FDPDGD UHWLFXODU FRQVLVWH GH WHFLGR FRQMXQWLYR ¿EURHOiVWLFR
composto sobretudo de feixes colágenos. As células desta camada são
SULQFLSDOPHQWH¿EUREODVWRVHKLVWLyFLWRV1DVFDPDGDVPDLVSURIXQ-
GDV GD FDPDGD UHWLFXODU HQFRQWUDPVH JOkQGXODV VXGRUtSDUDV VHEi-
FHDVIROtFXORVGRSrORHSHTXHQRVDF~PXORVGHFpOXODV
A camada papilar consiste em numerosas eminências vasculares
altamente sensitivas, as papilas. As papilas são pequenas eminências
cônicas de extremidades arredondadas ou dilatadas.

7HFLGR6XEFXWkQHR

$GHUPHHVWiVLWXDGDVREUHDWHODVXEFXWkQHD(VWD~OWLPDFDPDGD
não é considerada como pertencente à pele e por isso é chamada de
WHODRXWHFLGRVXEFXWkQHRRXKLSRGHUPH2WHFLGRVXEFXWkQHRpFRP-
posto principalmente por tecido conjuntivo frouxo e tecido adiposo.
Ela desempenha duas funções principais: auxilia a isolar o corpo das
YDULDo}HVH[WUHPDVGRPHLRDPELHQWHH¿[DDSHOHjVHVWUXWXUDVVXEMD-
centes. Poucas áreas do corpo não possuem esse tecido; nestes locais,
Sistema Tegumentar DSHOHHVWi¿[DGDGLUHWDPHQWHQRRVVR$SHOHGDVDUWLFXODo}HVHGRV
O tegumento ou pele cobre a superfície do corpo protegendo-o dedos apresenta dobras e é enrugada porque está aderida ao osso.
GDVLQÀXrQFLDVDPELHQWDLVGDQRVDV&RPRDSHOHpIDFLOPHQWHDFHV-
sível, ela é importante nos exames físicos. A pele propicia: Anexos da Pele
- Proteção do corpo contra o meio ambiente, abrasões, perda de 2VDQH[RVGDSHOHVmRDVXQKDVRVSrORVHDVJOkQGXODVVXGRUtSD-
OtTXLGRVXEVWkQFLDVQRFLYDVHPLFURRUJDQLVPRVLQYDVRUHV ras e sebáceas com seus respectivos ductos.
5HJXODomRGRFDORUDWUDYpVGDVJOkQGXODVVXGRUtSDUDVHYDVRV - Unhas: são estruturas achatadas, elásticas, de textura córnea,
sanguíneos. aplicadas sobre a superfície dorsal das falanges distais. Cada unha está
6HQVLELOLGDGHSRUPHLRGRVQHUYRVVXSHU¿FLDLVHVXDVWHUPL- implantada por uma porção chamada raiz em um sulco da pele; a por-
nações sensitivas. ção exposta é denominada corpo e a extremidade distal, borda livre.
$XQKDp¿UPHPHQWHDGHUHQWHDRFyULRHH[DWDPHQWHPROGDGD
A pele forma um envoltório para as estruturas do corpo e subs- sobre a superfície; a parte de baixo do corpo e da raiz da unha é
WkQFLDVYLWDLV OtTXLGRV IRUPDQGRDVVLPRPDLRUyUJmRGRFRUSR chamada matriz da unha porque é esta que a produz. Próximo a raiz
A pele é composta de: GDXQKDRWHFLGRQmRHVWi¿UPHPHQWHDGHULGRDRWHFLGRFRQMXQWLYR
(SLGHUPHFDPDGDFHOXODUVXSHU¿FLDO mas apenas em contato com o mesmo; por isso esta porção da unha é
Derme: camada de tecido conectivo profunda. esbranquiçada e chDPDGDO~QXODGHYLGRDVXDIRUPD
Pelos: são encontrados em quase toda superfície do corpo. Va-
Epiderme riam muito em comprimento, espessura e cor nas diferentes partes do
A epiderme, ou cutícula, não é vascularizada, consiste de epi- corpo e nas várias raças humanas. Um pêlo consiste em raiz (a parte
WpOLRHVWUDWL¿FDGRDPROGDVHSHUIHLWDPHQWHVREUHDFDPDGDSDSLODU implantada na pele) e haste (a porção que se projeta da superfície).
da derme, e varia de espessura em diferentes partes. Em alguns lu- A raiz do pelo termina no bulbo do pelo que é mais esbranquiça-
gares como na palma da mão e planta dos pés, ela é espessa, dura do e de textura mais mole do que a haste e está alojado em um canalí-
HGHWH[WXUDFyUQHD2HSLWpOLRHVWUDWL¿FDGRGDHSLGHUPHFRPS}HVH culo da epiderme que o envolve, chamado folículo do pelo. No fundo
de várias camadas denominadas de acordo com diversas categorias, de cada folículo encontra-se uma pequena eminência cônica vascular
tais como o aspecto das células, textura, composição e posição. Es- ou papila. Ela é contínua com a camada dérmica do folículo e supri-
VDVFDPDGDVVmRGHVXSHU¿FLDOSDUDSURIXQGRHVWUDWRFyUQHRHVWUDWR GDFRP¿EULODVQHUYRVDV2IROtFXORSLORVRFRQVLVWHHPGXDVW~QLFDV
O~FLGRHVWUDWRJUDQXORVRHVWUDWRHVSLQKRVRHHVWUDWREDVDO2HVWUDWR externa e interna ou epidérmica. O bulbo piloso é moldado sobre a
FyUQHRpUHPDQHVFHQWHGDVFpOXODVTXHFRQWpPXPDSURWHtQD¿EURVD papila e compõe-se de células epiteliais poliédricas que, ao passarem
a queratina. para o interior da raiz do pêlo, se alongam, tornando-se fusiformes.

Didatismo e Conhecimento 74
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
A haste do pelo consiste, de dentro para fora, de três partes: a - Terminações Nervosas Encapsuladas
medula, o córtex e a cutícula. A medula em geral está ausente em &RUS~VFXORV7iWHLV 0HLVVQHU (QFRQWUDGRVQDVSDSLODVGpU-
delgados pêlos que cobrem a superfície do corpo e comumente nos micas da mão e do pé, parte anterior do antebraço, lábios, pálpe-
GD FDEHoD &RPS}HVH GH ¿OHLUDV GH FpOXODV SROLpGULFDV FRQWHQGR bra e língua. Tem forma cilíndrica e possui uma cápsula de tecido
JUkQXORV GH HOHLGLQD H IUHTXHQWHPHQWH HVSDoRV DpUHRV 2 FyUWH[ FRQMXQWLYRHXPFHUQHFHQWUDOFRP¿EUDVQHUYRVDVPLHOtQLFDV6mR
constitui a parte da haste; suas células são alongadas e unidas para mecanorreceptores de adaptação rápida, fornecendo informações a
IRUPDU¿EUDVIXVLIRUPHVDDFKDWDGDVFRQWHQGRJUkQXORVGHSLJPHQWR UHVSHLWRGDVIRUoDVPHFkQLFDVUDSLGDPHQWHÀXWXDQWHV
em pêlos escuros e ar nos brancos. A cutícula compõe-se de uma *UDQGHV&RUS~VFXORV/DPHODGRVGH9DWHU3DFFLQL(QFRQWUDGRV
simples camada de escamas achatadas que se sobrepõem da profun- nas faces ventrais da mão e do pé, órgãos genitais, braço, pescoço,
didade para a superfície. papila mamária, periósteo e próximos à articulações. São ovóides,
Correlacionado aos folículos pilosos há um conjunto de HVIpULFRVHHVSLUDODGRVHFDGDXPSRVVXLXPDFiSVXOD ODPHODV 
SHTXHQLQRV IHL[HV GH ¿EUDV PXVFXODUHV OLVDV LQYROXQWiULDV XPD ]RQD GH FUHVFLPHQWR LQWHUPHGLiULD H XP FHUQH FHQWUDO 
GHQRPLQDGDVHUHWRUHVGRVSrORV(PHUJHPGDFDPDGDVXSHU¿FLDOGD ODPHODV  TXH FRQWpP XP WHUPLQDO D[{QLFR &DGD FRUS~VFXOR p
derme e se inserem no folículo. Colocam-se do lado para onde o suprido por uma ou, raramente, duDV¿EUDVPLHOLQL]DGDV $DOID 
pêlo se inclina, e pela sua ação diminuem a obliqüidade do folículo, (VVD¿EUDSHUGHDEDLQKDGHPLHOLQDHQDMXQomRFRPDFHUQH
tornando-o reto. perde a célula de Schwann. São mecanoceptores de adaptação muito
*OkQGXODV6XGRUtSDUDV *OGRVXRU VmRHQFRQWUDGDVHPTXD- UiSLGDUHVSRQGHQGRVRPHQWHDGLVW~UELRVUHSHQWLQRVHHVSHFLDOPHQ-
se toda a parte da pele. Consistem de um simples tubo cuja a parte WHVHQVtYHLVjYLEUDomR3RGHPFKHJDUDXPFRPSULPHQWRGHD
profunda constitui uma bolsa esférica ou oval chamada corpo da PPYLVtYHLVDROKRQ~FRPRFRUSRVEUDQFRVRYDODGRV$RFRUWH
JOkQGXODHQTXDQWRDSRUomRVXSHULRURXGXFWRDWUDYHVVDDGHUPHH microscopicamente, tem o aspecto de uma cebola.
a epiderme, abrindo-se na superfície da pele por uma abertura afu- $UUDQMRV&XWkQHRV(VSHFLDLV$UUDQMRVTXHLQIRUPDPRHVWD-
QLODGD1DVFDPDGDVVXSHU¿FLDLVGDGHUPHRGXFWRpUHWLOtQHRPDV GRPHFkQLFRHWpUPLFRGDVXSHUItFLHGRFRUSRLQFOXVLYHHVWtPXORV
nas camadas profundas o ducto é enrolado ou mesmo retorcido. São nocivos.
muito abundantes na palma das mãos e planta dos pés. São subdivididos em: mecanoceptores, termoceptores e noci-
*OkQGXODV6HEiFHDVVmRyUJmRVJODQGXODUHVSHTXHQRVHVDFX-
FHSWRUHV$DWLYLGDGHGH¿EUDVQHUYRVDVVHQVLWLYDVLVRODGDVpDWLYDGD
liformes alojados na derme, encontradas em muitas partes da pele,
somente por certos tipos de estímulos aplicados à área da pele que
PDV HP DEXQGkQFLD QR FRXUR FDEHOXGR H QD IDFH &DGD JOkQGXOD
HODLQHUYDRTXHPRVWUDRVHXDOWRJUDXGHHVSHFL¿FLGDGHWRUQDQGR
consiste de um simples ducto que emerge de um agrupamento ova-
difícil uma correlação estreita entre morfologia e função.
lado ou em forma de garrafa – os alvéolos, que são em geral de dois
a cinco, podendo chegar, em alguns casos, até vinte. Cada alvéolo é
composto de uma membrana basal transparente contendo um certo
Q~PHURGHFpOXODVHSLWHOLDLV

Receptores Sensitivos Encontrados na Pele


- Terminações Nervosas Livres: são encontradas em todos os
tecidos conjuntivos. São mielinizadas ou amielínicas, mas sempre
GH GLkPHWUR SHTXHQR H EDL[D YHORFLGDGH GH FRQGXomR *UXSR ,,,
RX*UXSR,9 3RGHPVHUSROLPRGDLVRXXQLSRGDLV QRFLFHSWRUHV 
6mR VHQVtYHLV DRV HVWtPXORV PHFkQLFRV WpUPLFRV H HVSHFLDOPHQWH
DRVGRORURVRV6mRIRUPDGDVSRUXPD[{QLRUDPL¿FDGRHQYROWRSRU
células de Schwann sendo, por sua vez, ambos envolvidos por uma
membrana basal.
- Terminações Epidérmicas: Associadas com folículos pilosos
¿EUDVPLHOLQL]DGDV  ANOTAÇÕES
7HUPLQDo}HV HP 3DOLoDGD  DV ¿EUDV VH DSUR[LPDP GR IROt-
culo em diferentes direções, logo abaixo do ducto sebáceo, onde
se divide e corre paralela com o pêlo na camada folicular externa.
Caracterizam-se como terminações nervosas livres.

0HQLVFRV7iWHLV &pOVGH0HUNHO 8PD¿EUDDIHUHQWHFRVWX- —————————————————————————


PDHVWDUUDPL¿FDGDFRPYiULRVGLVFRVWHUPLQDLVGHVWDVUDPL¿FDo}HV
nervosas. Estes discos estão englobados em uma célula especiali- —————————————————————————
]DGD FXMD VXSHUItFLH GLVWDO VH ¿[D jV FpOXODV HSLGpUPLFDV SRU XP —————————————————————————
prolongamento de seu protoplasma e se interdigitam com os cerati-
nócitos adjacentes. —————————————————————————
Assim, os movimentos de pressão e tração sobre epiderme de-
sencadeam o estímulo. São mecanorreceptores (Tipo I) e de adapta- —————————————————————————
ção lenta, receptivos à pressão vertical e servidos por grandes afe-
—————————————————————————
rentes mielinizados (A alfa). São encontrados nas partes distais das
extremidades e na pele dos lábios e genitais externos. —————————————————————————

Didatismo e Conhecimento 75
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Esquema resumido dos receptores sensitivos encontrados na pele:

RECEPTORES DE SUPERFÍCIE SENSAÇÃO PERCEBIDA


5HFHSWRUHVGH5XI¿QL Calor
Discos de Merkel Tato e pressão
Receptores de Vater-Pacini Pressão
Receptores de Meissner Tato
Terminações nervosas livres Principalmente dor

Sistema Esquelético

O sistema esquelético é composto de ossos e cartilagens.

Conceito de Ossos: Ossos são órgãos esbranquiçados, muito duros, que unindos-se aos outros, por intermédio das junturas ou articula-
ções constituem o esqueleto. É uma forma especializada de tecido conjuntivo cuja a principal característica é a mineralização (cálcio) de sua
PDWUL]yVVHD ¿EUDVFROiJHQDVHSURWHRJOLFDQDV 

2RVVRpXPWHFLGRYLYRFRPSOH[RHGLQkPLFR8PDIRUPDVyOLGDGHWHFLGRFRQMXQWLYRDOWDPHQWHHVSHFLDOL]DGRTXHIRUPDDPDLRU
SDUWHGRHVTXHOHWRHpRSULQFLSDOWHFLGRGHDSRLRGRFRUSR2WHFLGRyVVHRSDUWLFLSDGHXPFRQWtQXRSURFHVVRGHUHPRGHODPHQWRGLQkPLFR
produzindo osso novo e degradando osso velho.

O osso é formado por vários tecidos diferentes: tecido ósseo, cartilaginoso, conjuntivo denso, epitelial, adiposo, nervoso e vários tecidos
formadores de sangue.

Quanto a irrigação do osso, temos os canais de Volkman e os canais de Havers. O tecido ósseo não apresenta vasos linfáticos, apenas o
tecido periósteo tem drenagem linfática.

Canais de Havers-VmRXPDVpULHGHWXERVHPWRUQRGHHVWUHLWRVFDQDLVIRUPDGRVSRUODPHODVFRQFrQWULFDVGH¿EUDVFROiJHQDV(VWDUHJLmR
pGHQRPLQDGDRVVRFRPSDFWRRXGLi¿VH9DVRVVDQJtQHRVHFpOXODVQHUYRVDVHPWRGRRRVVRFRPXQLFDPVHSRURVWHyFLWRV TXHHPLWHP
expansões citoplasmáticas que põem em contato um osteócito com o outro) em lacunas (espaços dentro da matriz óssea densa que contêm
células ósseas). Este arranjo original é propício ao depósito de sal mineral, o que dá resistência ao tecido ósseo. Deve-se ainda ressaltar
que esses canais percorrem o osso no sentido longitudinal levando dentro de sua luz, vasos sanguíneos e nervos que são responsáveis pela
nutrição do tecido ósseo. Ele faz que os vasos sanguínios passem pelo tecido ósseo.

Canais de Volkmann são canais microscópicos encontrados no osso compacto, são perpendiculares aos Canais de Havers, e são um dos
componentes do sistema de Haversian. Os canais de Volkmann também podem transportar pequenas artérias em todo o osso. Os canais de
Volkmann não apresentam lamelas concêntricas.

2LQWHULRUGDPDWUL]yVVHDH[LVWHHVSDoRVFKDPDGRVODFXQDVTXHFRQWrPFpOXODVyVVHDVFKDPDGDVRVWHyFLWRV&DGDRVWHy¿WRSRVVXLSUR-
longamentos chamados canalículos, que se estendem a partir das lacunas e se unem aos canalículos das lacunas vizinhas, formando assim,
uma rede de canalículos e lacunas em toda a massa de tecido mineralizado.

Conceito de Cartilagem: É uma forma elástica de tecido conectivo semirígido - forma partes do esqueleto nas quais ocorre movimento.
A cartilagem não possui suprimento sangüíneo próprio; conseqüentemente, suas células obtêm oxigênio e nutrientes por difusão de longo
alcance.

Funções do Sistema Esquelético:

- Sustentação do organismo (apoio para o corpo)


- Proteção de estruturas vitais (coração, pulmões, cérebro)
%DVHPHFkQLFDSDUDRPRYLPHQWR
- Armazenamento de sais (cálcio, por exemplo)
- Hematopoiética (suprimento contínuo de células sangüíneas novas).

Didatismo e Conhecimento 76
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
1~PHURGH2VVRVGR&RUSR+XPDQR

eFOiVVLFRDGPLWLURQ~PHURGHRVVRV

Cabeça  Membro Superior 


&UkQLR  &LQWXUD(VFDSXODU 
)DFH  %UDoR 
$QWHEUDoR 
Pescoço  0mR 

Tórax  Membro Inferior 


FRVWHODV &LQWXUD3pOYLFD 
YpUWHEUDV &R[D 
HVWHUQR -RHOKR 
3HUQD 
Abdômen  3p 
YpUWHEUDVORPEDUHV
VDFUR
FyFFL[ Ossículos do Ouvido Médio 

Divisão do Esqueleto:

Esqueleto Axial - Composta pelos ossos da cabeça, pescoço e do tronco.


Esqueleto Apendicular - Composta pelos membros superiores e inferiores.
A união do esqueleto axial com o apendicular se faz por meio das cinturas escapular e pélvica.

&ODVVL¿FDomRGRV2VVRV

2VRVVRVVmRFODVVL¿FDGRVGHDFRUGRFRPDVXDIRUPDHP

Ossos Longos: Tem o comprimento maior que a largura e são constituídos por um corpo e duas extremidades. Eles são um pouco encur-
YDGRVRTXHOKHVJDUDQWHPDLRUUHVLVWrQFLD2RVVRXPSRXFRHQFXUYDGRDEVRUYHRHVWUHVVHPHFkQLFRGRSHVRGRFRUSRHPYiULRVSRQWRVGH
WDOIRUPDTXHKiPHOKRUGLVWULEXLomRGRPHVPR2VRVVRVORQJRVWrPVXDVGLi¿VHVIRUPDGDVSRUWHFLGRyVVHRFRPSDFWRHDSUHVHQWDPJUDQGH
TXDQWLGDGHGHWHFLGRyVVHRHVSRQMRVRHPVXDVHSt¿VHV([HPSOR)rPXU
Ossos Curtos: São parecidos com um cubo, tendo seus comprimentos praticamente iguais às suas larguras. Eles são compostos por osso
HVSRQMRVRH[FHWRQDVXSHUItFLHRQGHKi¿QDFDPDGDGHWHFLGRyVVHRFRPSDFWR([HPSOR2VVRVGR&DUSR
2VVRV/DPLQDUHV 3ODQRV 6mRRVVRV¿QRVHFRPSRVWRVSRUGXDVOkPLQDVSDUDOHODVGHWHFLGRyVVHRFRPSDFWRFRPFDPDGDGHRVVRHVSRQ-
MRVRHQWUHHODV2VRVVRVSODQRVJDUDQWHPFRQVLGHUiYHOSURWHomRHJHUDPJUDQGHViUHDVSDUDLQVHUomRGHP~VFXORV([HPSORV)URQWDOH3DULHWDO
$OpPGHVVHVWUrVJUXSRVEiVLFRVEHPGH¿QLGRVKiRXWURVLQWHUPHGLiULRVTXHSRGHPVHUGLVWULEXtGRHPJUXSRV
Ossos Alongados: São ossos longos, porém achatados e não apresentam canal central. Exemplo: Costelas.
Ossos Pneumáticos: São osso ocos, com cavidades cheias de ar e revestidas por mucosa (seios), apresentando pequeno peso em relação ao
seu volume. Exemplo: Esfenóide.
Ossos Irregulares: Apresentam formas complexas e não podem ser agrupados em nenhuma das categorias prévias. Eles têm quantidades
variáveis de osso esponjoso e de osso compacto. Exemplo: Vértebras.
Ossos Sesamóides: Estão presentes no interior de alguns tendões em que há considerável fricção, tensão e estresse físico, como as palmas
HSODQWDV(OHVSRGHPYDULDUGHWDPDQKRHQ~PHURGHSHVVRDSDUDSHVVRDQmRVmRVHPSUHFRPSOHWDPHQWHRVVL¿FDGRVQRUPDOPHQWHPHGHP
DSHQDVDOJXQVPLOtPHWURVGHGLkPHWUR([FHo}HVQRWiYHLVVmRDVGXDVSDWHODVTXHVmRJUDQGHVRVVRVVHVDPyLGHVSUHVHQWHVHPTXDVHWRGRVRV
seres humanos.
2VVRV6XWXUDLV6mRSHTXHQRVRVVRVORFDOL]DGRVGHQWURGHDUWLFXODo}HVFKDPDGDVGHVXWXUDVHQWUHDOJXQVRVVRVGRFUkQLR6HXQ~PHUR
varia muito de pessoa para pessoa.

Estrutura dos Ossos Longos:

A disposição dos tecidos ósseos compactos e esponjoso em um osso longo é responsável por sua resistência. Os ossos longos contém locais
de crescimento e remodelação, e estruturas associadas às articulações. As partes de um osso longo são as seguintes:

'Li¿VH: é a haste longa do osso. Ele é constituída principalmente de tecido ósseo compacto, proporcionando, considerável resistência ao
osso longo.

Didatismo e Conhecimento 77
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
(St¿VHDVH[WUHPLGDGHVDODUJDGDVGHXPRVVRORQJR$HSt¿VHGHXPRVVRRDUWLFXODRXXQHDXPVHJXQGRRVVRHPXPDDUWLFXODomR
&DGDHSt¿VHFRQVLVWHGHXPD¿QDFDPDGDGHRVVRFRPSDFWRTXHUHYHVWHRRVVRHVSRQMRVRHUHFREHUWRVSRUFDUWLODJHP

0HWi¿VHSDUWHGLODWDGDGDGLi¿VHPDLVSUy[LPDGDHSt¿VH

&RQ¿JXUDomR([WHUQDGRV2VVRV

SALIÊNCIAS ÓSSEAS
Articulares Não Articulares
- Processos
- Tubérculos
- Cabeça 7URFkQWHU
- Côndilo - Espinha
- Faceta - Eminência
/kPLQDV
- Cristas

Cabeça do Fêmur Processos Transverso e Espinhoso (Vértebras)


DEPRESSÕES ÓSSEAS
Articulares Não Articulares
- Fossas
- Sulcos
- Cavidades - Forames
- Acetábulo - Meatos
- Fóvea - Seios
- Fissuras
- Canais

&DYLGDGH*OHQyLGH (VFiSXOD Processos Transverso e Espinhoso (Vértebras)

Didatismo e Conhecimento 78
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
&RQ¿JXUDomR,QWHUQDGRV2VVRV

$VGLIHUHQoDVHQWUHRVGRLVWLSRVGHRVVRFRPSDFWRHHVSRQMRVRRXUHWLFXODUGHSHQGHPGDTXDQWLGDGHUHODWLYDGHVXEVWkQFLDVVyOLGDVHGD
TXDQWLGDGHHWDPDQKRGRVHVSDoRVTXHHOHVFRQWpP7RGRVRVRVVRVWHPXPD¿QDOkPLQDVXSHU¿FLDOGHRVVRFRPSDFWRHPWRUQRGHXPDPDVVD
FHQWUDOGHRVVRHVSRQMRVRH[FHWRRQGHR~OWLPRpVXEVWLWXtGRSRUXPDFDYLGDGHPHGXODU
2RVVRFRPSDFWRGRFRUSRRXGLi¿VHTXHHQYROYHDFDYLGDGHPHGXODUpDVXEVWkQFLDFRUWLFDO$DUTXLWHWXUDGRRVVRHVSRQMRVRHFRPSDFWR
varia de acordo com a função. O osso compacto fornece força para sustentar o peso.
1RVRVVRVORQJRVSODQHMDGRVSDUDULJLGH]HLQVHUomRGHP~VFXORVHOLJDPHQWRVDTXDQWLGDGHGHRVVRFRPSDFWRpPi[LPDSUy[LPRGRPHLR
GRFRUSRRQGHHOHHVWiVXMHLWRDFXUYDUVH2VRVVRVSRVVXHPDOJXPDHODVWLFLGDGH ÀH[LELOLGDGH HJUDQGHULJLGH]

Periósteo e Endósteo:

O PeriósteopXPDPHPEUDQDGHWHFLGRFRQMXQWLYRGHQVRPXLWR¿EURVRTXHUHYHVWHDVXSHUItFLHH[WHUQDGDGLi¿VH¿[DQGRVH¿UPHPHQWH
DWRGDDVXSHUItFLHH[WHUQDGRRVVRH[FHWRjFDUWLODJHPDUWLFXODU3URWHJHRRVVRHVHUYHFRPRSRQWRGH¿[DomRSDUDRVP~VFXORVHFRQWpPRV
vasos sanguíneos que nutrem o osso subjacente.

O Endósteo se encontra no interior da cavidade medular do osso, revestido por tecido conjuntivo.

Tecido Ósseo Compacto Tecido Ósseo Esponjoso


Contém poucos espaços em seus componentes rígidos. Dá Constitui a maior parte do tecido
proteção e suporte e resiste às forças produzidas pelo peso e ósseo dos ossos curtos, chatos e irregulares. A maior parte é
PRYLPHQWR(QFRQWUDGRVJHUDOPHQWHQDVGLi¿VHV HQFRQWUDGDQDVHSL¿VHV

Ossos da Cabeça

2FUkQLRpRHVTXHOHWRGDFDEHoDYiULRVRVVRVIRUPDPVXDVGXDVSDUWHVR1HXURFUkQLRHR(VTXHOHWRGD)DFH2QHXURFUkQLRIRUQHFHR
LQYyOXFURSDUDRFpUHEURHDVPHQLQJHVHQFHIiOLFDVSDUWHVSUR[LPDLVGRVQHUYRVFUDQLDQRVHYDVRVVDQJtQHRV2FUkQLRSRVVXLXPWHWRVHPH-
OKDQWHDXPDDEyEDGD±DFDOYiULD±HXPDVVRDOKRRXEDVHGRFUkQLRTXHpFRPSRVWDGRHWPyLGHHSDUWHVGRRFFLSLWDOHGRWHPSRUDO2HVTXHOHWR
da face consiste em ossos que circundam a boca e o nariz e contribuem para as órbitas.

Tórax

É uma caixa osteocartilagínea que contém os principais órgãos da respiração e circulação e cobre parte dos órgãos abdominais.
A face dorsal é formado pelas doze vértebras torácicas, e a parte dorsal das doze costelas. A face ventral é constituída pelo esterno e car-
tilagens costais. As faces laterais são compostas pelas costelas e separadas umas das outras pelos onze espaços intercostais, ocupados pelos
P~VFXORVHPHPEUDQDVLQWHUFRVWDLV

Coluna Vertebral

$FROXQDYHUWHEUDOWDPEpPFKDPDGDGHHVSLQKDGRUVDOHVWHQGHVHGRFUkQLRDWpDSHOYH(ODpUHVSRQViYHOSRUGRLVTXLQWRVGRSHVR
corporal total e é composta por tecido conjuntivo e por uma série de ossos, chamados vértebras, as quais estão sobrepostas em forma de uma
FROXQDGDtRWHUPRFROXQDYHUWHEUDO$FROXQDYHUWHEUDOpFRQVWLWXtGDSRUYpUWHEUDVVDFURFyFFL[HFRQVWLWXLMXQWRFRPDFDEHoDHVWHUQR
e costelas, o esqueleto axial.

Membro Superior

Os ossos dos membros superiores podem ser divididos em quatro segmentos:

Cintura Escapular - Clavícula e Escápula


Braço - Úmero
Antebraço - Rádio e Ulna
Mão - Ossos da Mão

Membro Inferior

O membro inferior tem função de sustentação do peso corporal, locomoção, tem a capacidade de mover-se de um lugar para outro e manter
o equilíbrio. Os membros inferiores são conectados ao tronco pelo cíngulo do membro inferior (ossos do quadril e sacro).

Didatismo e Conhecimento 79
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$EDVHGRHVTXHOHWRGRPHPEURLQIHULRUpIRUPDGRSHORVGRLVRVVRVGRTXDGULOTXHVmRXQLGRVSHODVtQ¿VHS~ELFDHSHORVDFUR2FtQJXOR
do membro inferior e o sacro juntos formam a PELVE ÓSSEA.
Os ossos dos membros inferiores podem ser divididos em quatro segmentos:

Cintura Pélvica - Ilíaco (Osso do Quadril)


Coxa - Fêmur e Patela
Perna - Tíbia e Fíbula
Pé - Ossos do Pé
Sistema Muscular
&RQFHLWRGH0~VFXORV

São estruturas individualizadas que cruzam uma ou mais articulações e pela sua contração são capazes de transmitir-lhes movimento. Este
pHIHWXDGRSRUFpOXODVHVSHFLDOL]DGDVGHQRPLQDGDV¿EUDVPXVFXODUHVFXMDHQHUJLDODWHQWHpRXSRGHVHUFRQWURODGDSHORVLVWHPDQHUYRVR2V
P~VFXORVVmRFDSD]HVGHWUDQVIRUPDUHQHUJLDTXtPLFDHPHQHUJLDPHFkQLFD
2P~VFXORYLYRpGHFRUYHUPHOKD(VVDFRORUDomRGHQRWDDH[LVWrQFLDGHSLJPHQWRVHGHJUDQGHTXDQWLGDGHGHVDQJXHQDV¿EUDVPXVFX-
lares.
2VP~VFXORVUHSUHVHQWDPGRSHVRFRUSRUDOWRWDO

)XQo}HVGRV0~VFXORV

a) Produção dos movimentos corporais: Movimentos globais do corpo, como andar e correr.
E (VWDELOL]DomRGDV3RVLo}HV&RUSRUDLV$FRQWUDomRGRVP~VFXORVHVTXHOpWLFRVHVWDELOL]DPDVDUWLFXODo}HVHSDUWLFLSDPGDPDQXWHQomR
GDVSRVLo}HVFRUSRUDLVFRPRDGH¿FDUHPSpRXVHQWDU
F 5HJXODomRGR9ROXPHGRVÏUJmRV$FRQWUDomRVXVWHQWDGDGDVIDL[DVDQHODUHVGRVP~VFXORVOLVRV HVItQFWHUHV SRGHLPSHGLUDVDtGDGR
FRQWH~GRGHXPyUJmRRFR
G 0RYLPHQWRGH6XEVWkQFLDVGHQWURGR&RUSR$VFRQWUDo}HVGRVP~VFXORVOLVRVGDVSDUHGHVYDVRVVDQJtQHRVUHJXODPDLQWHQVLGDGHGR
ÀX[R2VP~VFXORVOLVRVWDPEpPSRGHPPRYHUDOLPHQWRVXULQDHJDPHWDVGRVLVWHPDUHSURGXWLYR2VP~VFXORVHVTXHOpWLFRVSURPRYHPRÀX[R
de linfa e o retorno do sangue para o coração.
H 3URGXomRGH&DORU4XDQGRRWHFLGRPXVFXODUVHFRQWUDLHOHSURGX]FDORUHJUDQGHSDUWHGHVVHFDORUOLEHUDGRSHORP~VFXORpXVDGRQD
manutenção da temperatura corporal.

*UXSRV0XVFXODUHV

(PQ~PHURGHQRYH6mRHOHV
a) Cabeça
b) Pescoço
c) Tórax
d) Abdome
e) Região posterior do tronco
f) Membros superiores
g) Membros inferiores
h) Órgãos dos sentidos
i) Períneo

&ODVVL¿FDomRGRV0~VFXORV

Quanto a Situação:

D 6XSHU¿FLDLVRX&XWkQHRV(VWmRORJRDEDL[RGDSHOHHDSUHVHQWDPQRPtQLPRXPDGHVXDVLQVHUo}HVQD
FDPDGDSURIXQGDGDGHUPH(VWmRORFDOL]DGRVQDFDEHoD FUkQLRHIDFH SHVFRoRHQDPmR UHJLmRKLSRWHQDU 
Exemplo: Platisma.

Didatismo e Conhecimento 80
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo

E 3URIXQGRVRX6XEDSRQHXUyWLFRV6mRP~VFXORVTXHQmRDSUHVHQWDPLQVHUo}HVQDFDPDGDSURIXQGDGD
GHUPHHQDPDLRULDGDVYH]HVVHLQVHUHPHPRVVRV(VWmRORFDOL]DGRVDEDL[RGDIiVFLDVXSHU¿FLDO([HPSOR
Pronador quadrado.

Quanto à Forma:

D /RQJRV6mRHQFRQWUDGRVHVSHFLDOPHQWHQRVPHPEURV2VPDLVVXSHU¿FLDLVVmRRVPDLVORQJRVSRGHQGR
passar duas ou mais articulações. Exemplo: Bíceps braquial.

b) Curtos: Encontram-se nas articulações cujos movimentos tem pouca amplitude, o que não exclui força
QHPHVSHFLDOL]DomR([HPSOR0~VFXORV da mão.

c) Largos: Caracterizam-se por serem laminares. São encontrados nas paredes das grandes cavidades (tórax
e abdome). Exemplo: Diafragma.

Didatismo e Conhecimento 81
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Quanto à Disposição da Fibra: 7LSRVGH0~VFXORV:

a) Reto: Paralelo à linha média. Ex: Reto abdominal.


b) Transverso: Perpendicular à linha média. Ex: Transverso
abdominal.
c) Oblíquo: Diagonal à linha média. Ex: Oblíquo externo.

Quanto à Origem e Inserção:

a) Origem: Quando se originam de mais de um tendão. Ex. Bí-


ceps, Quadríceps. D 0~VFXORV(VWULDGRV(VTXHOpWLFRV&RQWUDHPVHSRULQÀXrQ-
b) Inserção: Quando se inserem em mais de um tendão. Ex: cia da nossa vontade, ou seja, são voluntários. O tecido muscular
Flexor Longo dos Dedos. esquelético é chamado de estriado porque faixas alternadas claras e
escuras (estriações) podem ser vistas no microscópio óptico.

Quanto à Função:

D $JRQLVWDV6mRRVP~VFXORVSULQFLSDLVTXHDWLYDPXPPR-
YLPHQWRHVSHFt¿FRGRFRUSRHOHVVHFRQWUDHPDWLYDPHQWHSDUDSUR-
duzir um movimento desejado. Ex: Pegar uma chave sobre a mesa,
DJRQLVWDVVmRRVÀH[RUHVGRVGHGRV
E $QWDJRQLVWDV0~VFXORVTXHVHRS}HPjDomRGRVDJRQLVWDV
quando o agonista se contrai, o antagonista relaxa progressivamente,
produzindo um movimento suave. Ex: idem anterior, porém os anta- E 0~VFXORV/LVRV/RFDOL]DGRQRVYDVRVVDQJtQHRVYLDVDp-
gonistas são os extensores dos dedos. reas e maioria dos órgãos da cavidade abdômino-pélvica. Ação in-
c) Sinergistas: São aqueles que participam estabilizando as arti- voluntária controlada pelo sistema nervoso autônomo.
culações para que não ocorram movimentos indesejáveis durante a
ação principal. Ex: idem anterior, os sinergistas são estabilizadores F 0~VFXOR(VWULDGR&DUGtDFR5HSUHVHQWDDDUTXLWHWXUDFDUGtD-
do punho, cotovelo e ombro.
FDeXPP~VFXORHVWULDGRSRUpPLQYROXQWiULR±$8725,70,&,-
d) Fixadores: Estabilizam a origem do agonista de modo que
DADE.
HOHSRVVDDJLUPDLVH¿FLHQWHPHQWH(VWDELOL]DPDSDUWHSUR[LPDOGR
membro quando move-se a parte distal.

Quanto à Nomenclatura:

2QRPHGDGRDRVP~VFXORVpGHULYDGRGHYiULRVIDWRUHVHQWUH &RPSRQHQWHV$QDW{PLFRVGRV0~VFXORV(VWULDGRV:
HOHVR¿VLROyJLFRHRWRSRJUi¿FR
a) Ação: Extensor dos dedos. D 9HQWUH0XVFXODUpDSRUomRFRQWUiWLOGRP~VFXORFRQVWLWXtGD
b) Ação Associada à Forma: Pronador redondo e pronador qua- SRU¿EUDVPXVFXODUHVTXHVHFRQWUDHP&RQVWLWXLRFRUSRGRP~VFX-
drado. lo (porção carnosa).
F $omR$VVRFLDGDj/RFDOL]DomR)OH[RUVXSHU¿FLDOGRVGHGRV E 7HQGmRpXPHOHPHQWRGHWHFLGRFRQMXQWLYRULFRVHP¿EUDV
G )RUPD0~VFXOR'HOWyLGH OHWUDJUHJDGHOWD  FROiJHQDVHTXHVHUYHSDUD¿[DomRGRYHQWUHHPRVVRVQRWHFLGR
e) Localização: Tibial anterior. VXEFXWkQHRHHPFiSVXODVDUWLFXODUHV3RVVXHPDVSHFWRPRUIROyJLFR
I 1~PHURGH2ULJHP%tFHSVIHPRUDOHWUtFHSVEUDTXLDO GH¿WDVRXGHFLOLQGURV

Didatismo e Conhecimento 82
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Componentes Anatômicos do Tecido Conjuntivo:

D )iVFLD6XSHU¿FLDOVHSDUDRVP~VFXORVGDSHOH
E )iVFLD0XVFXODUpXPDOkPLQDRXIDL[DODUJDGHWHFLGRFRQ-
MXQWLYR¿EURVRTXHDEDL[RGDSHOHFLUFXQGDRVP~VFXORVHRXWURV
órgãos do corpo.
c) Epimísio é a camada mais externa de tecido conjuntivo, cir-
FXQGDWRGRRP~VFXOR
G 3HULPtVLRFLUFXQGDJUXSRVGHDRXPDLV¿EUDVPXVFX-
lares individuais, separando-as em feixes chamados fascículos. Os
fascículos podem ser vistos a olho nu.
H (QGRPtVLRpXP¿QRUHYHVWLPHQWRGHWHFLGRFRQMXQWLYRTXH
SHQHWUDQRLQWHULRUGHFDGDIDVFtFXORHVHSDUDDV¿EUDVPXVFXODUHV
individuais de seus vizinhos.

c) Aponeurose é uma estrutura formada por tecido conjuntivo.


0HPEUDQDTXHHQYROYHJUXSRVPXVFXODUHV*HUDOPHQWHDSUHVHQWD-
VHHPIRUPDGHOkPLQDVRXHPOHTXHV
G %DLQKDV7HQGtQHDVVmRHVWUXWXUDVTXHIRUPDPSRQWHVRXW~-
neis entre as superfícies ósseas sobre as quais deslizam os tendões.
Sua função é conter o tendão, permitindo-lhe um deslizamento fácil.
H %ROVDV6LQRYLDLVVmRHQFRQWUDGDVHQWUHRVP~VFXORVRXHQWUH
XPP~VFXORHXPRVVR6mRSHTXHQDVEROVDVIRUUDGDVSRUXPDPHP-
brana serosa que possibilitam o deslizamento muscular.

Tipos de Contrações:

2QRPHGDGRDRVP~VFXORVpGHULYDGRGHYiULRVIDWRUHVHQWUH
HOHVR¿VLROyJLFRHRWRSRJUi¿FR
D &RQWUDomR&RQFrQWULFDRP~VFXORVHHQFXUWDHWUDFLRQDRXWUD
Sistema Circulatório
HVWUXWXUDFRPRXPWHQGmRUHGX]LQGRRkQJXORGHXPDDUWLFXODomR
Ex: Trazer um livro que estava sobre a mesa ao encontro da cabeça. O sistema circulatório é formado por dois sistemas de transpor-
b) Contração Excêntrica: quando aumenta o comprimento total te principais: o sistema cardiovascular, que compreende o coração,
GRP~VFXORGXUDQWHDFRQWUDomR([LGHPDQWHULRUSRUpPTXDQGR vasos sanguíneos e sangue, com o objetivo de carregar oxigênio e
recolocamos o livro sobre mesa. nutrientes para as células do corpo e transportar os resíduos das célu-
c) Contração Isométrica: servem para estabilizar as articulações las corporais para os rins. O sistema linfático fornece drenagem para
HQTXDQWR RXWUDV VmR PRYLGDV *HUD WHQVmR PXVFXODU VHP UHDOL]DU o líquido dos tecidos, denominado linfa.
movimentos. É responsável pela postura e sustentação de objetos
HPSRVLomR¿[D([LGHPDQWHULRUSRUpPTXDQGRROLYURpVXVWHQ- Funções do sistema cardiovascular
WDGRHPDEGXomRGHƒ
x transporte de gases: os pulmões, responsáveis pela
Anatomia Microscópica da Fibra Muscular: obtenção de oxigênio e pela eliminação de dióxido de carbono,
comunicam-se com os demais tecidos do corpo por meio do sangue.
O tecido muscular consiste de células contráteis especializadas, x transporte de nutrientes: no tubo digestório, os nutrientes
RX¿EUDVPXVFXODUHVTXHVmRDJUXSDGDVHGLVSRVWDVGHIRUPDDOWD- UHVXOWDQWHVGDGLJHVWmRSDVVDPDWUDYpVGHXP¿QRHSLWpOLRHDOFDQ-
PHQWHRUJDQL]DGD&DGD¿EUDGHP~VFXORHVTXHOpWLFRDSUHVHQWDGRLV çam o sangue. Por essa verdadeira “auto-estrada”, os nutrientes são
WLSRVGHHVWUXWXUDV¿OLIRUPHVPXLWRGHOJDGDVFKDPDGDVPLR¿ODPHQ- levados aos tecidos do corpo, nos quais se difundem para o líquido
WRVJURVVRV PLRVLQD H¿QRV DFWLQD  intersticial que banha as células.
x transporte de resíduos metabólicos: a atividade metabóli-
ca das células do corpo origina resíduos, mas apenas alguns órgãos
podem eliminá-los para o meio externo. O transporte dessas subs-
WkQFLDVGHRQGHVmRIRUPDGDVDWpRVyUJmRVGHH[FUHomRpIHLWRSHOR
sangue.
x WUDQVSRUWH GH KRUP{QLRV KRUP{QLRV VmR VXEVWkQFLDV VH-
cretadas por certos órgãos, distribuídas pelo sangue e capazes de
PRGL¿FDURIXQFLRQDPHQWRGHRXWURVyUJmRVGRFRUSR$FROHFLVWR-
cinina, por exemplo, é produzida pelo duodeno, durante a passagem
do alimento, e lançada no sangue. Um de seus efeitos é estimular a
contração da vesícula biliar e a liberação da bile no duodeno.

Didatismo e Conhecimento 83
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
x LQWHUFkPELRGHPDWHULDLVDOJXPDVVXEVWkQFLDVVmRSURGX- coração, os impulsos originados dele espalham-se para os átrios e
zidas ou armazenadas em uma parte do corpo e utilizadas em outra ventrículos, estimulando essas áreas tão rapidamente, de modo que
parte. Células do fígado, por exemplo, armazenam moléculas de o ritmo do nódulo SA torna-se o ritmo de todo o coração; por isso é
glicogênio, que, ao serem quebradas, liberam glicose, que o sangue chamado marcapasso.
leva para outras células do corpo. x Sistema De Purkinje ou fascículo átrio-ventricular: embo-
x transporte de calor: o sangue também é utilizado na dis- UDRLPSXOVRFDUGtDFRSRVVDSHUFRUUHUSHUIHLWDPHQWHWRGDVDV¿EUDV
tribuição homogênea de calor pelas diversas partes do organismo, musculares cardíacas, o coração possui um sistema especial de con-
colaborando na manutenção de uma temperatura adequada em todas dução denominado sistema de Purkinje ou fascículo átrio-ventri-
as regiões; permite ainda levar calor até a superfície corporal, onde FXODU FRPSRVWR GH ¿EUDV PXVFXODUHV FDUGtDFDV HVSHFLDOL]DGDV RX
pode ser dissipado. ¿EUDVGH3XUNLQMH )HL[HGH+LVVRXPLyFLWRViWULRYHQWULFXODUHV 
x distribuição de mecanismos de defesa: pelo sangue circu- que transmitem os impulsos com uma velocidade aproximadamente
lam anticorpos e células fagocitárias, componentes da defesa contra YH]HVPDLRUGRTXHRP~VFXORFDUGtDFRQRUPDOFHUFDGHPSRU
agentes infecciosos. VHJXQGRHPFRQWUDVWHFRPPSRUVHJXQGRQRP~VFXORFDUGtDFR
x coagulação sanguínea: pelo sangue circulam as plaquetas,
pedaços de um tipo celular da medula óssea (megacariócito), com b- Controle Nervoso do Coração
função na coagulação sanguínea. O sangue contém ainda fatores de O sistema nervoso é conectado com o coração através de dois
coagulação, capazes de bloquear eventuais vazamentos em caso de grupos diferentes de nervos do sistema nervoso autônomo: paras-
rompimento de um vaso sanguíneo. simpáticos e simpáticos. A estimulação dos nervos parassimpáticos
FDXVDRVVHJXLQWHVHIHLWRVVREUHRFRUDomR  GLPLQXLomRGDIUH-
x O coração é um órgão muscular oco que se localiza no quência dos batimentos cardíacos; (2) diminuição da força de con-
meio do peito, sob o osso esterno, ligeiramente deslocado para a WUDomRGRP~VFXORDWULDO  GLPLQXLomRQDYHORFLGDGHGHFRQGXomR
esquerda. Ele contrai e relaxa alternadamente para bombear os pul- dos impulsos através do nódulo AV (átrio-ventricular), aumentando
mões (onde ocorre a oxigenação) e depois para a vasta rede de vasos RSHUtRGRGHUHWDUGRHQWUHDFRQWUDomRDWULDOHDYHQWULFXODUH  
sanguíneos. As artérias e arteríolas carregam o sangue oxigenado do GLPLQXLomR GR ÀX[R VDQJXtQHR DWUDYpV GRV YDVRV FRURQiULRV TXH
coração para as células do corpo. A troca de líquido, oxigênio e gás PDQWrPDQXWULomRGRSUySULRP~VFXORFDUGtDFR
carbônico entre o sangue e as células dos tecidos ocorre através dos x Todos esses efeitos podem ser resumidos, dizendo-se que
capilares. As vênulas e veias carregam o sangue pobre em oxigênio a estimulação parassimpática diminui todas as atividades do cora-
de volta para o coração, onde o ciclo recomeça. ção. Usualmente, a função cardíaca é reduzida pelo parassimpático
x Cada vez que o coração contrai, a corrente sanguínea pode durante o período de repouso, juntamente com o restante do corpo.
ser sentida, na forma de pulsação, em qualquer lugar onde uma ar- Isso talvez ajude a preservar os recursos do coração, pois durante
téria passa próxima a superfície da pele. As principais localizações os períodos de repouso, indubitavelmente há um menor desgaste do
onde podem ser sentidas o pulso são: no punho, na virilha e no pes- órgão.
coço. x A estimulação dos nervos simpáticos apresenta efeitos
x As emergências envolvendo o sistema circulatório ocor- H[DWDPHQWHRSRVWRVVREUHRFRUDomR  DXPHQWRGDIUHTXrQFLDFDU-
rem quando há sangramento descontrolado, comprometimento da GtDFD  DXPHQWRGDIRUoDGHFRQWUDomRH  DXPHQWRGRÀX[R
circulação ou quando o coração perde sua capacidade de bombear. sanguíneo através dos vasos coronários visando a suprir o aumento
x O coração humano, como o dos demais mamíferos, apre- GDQXWULomRGRP~VFXORFDUGtDFR(VVHVHIHLWRVSRGHPVHUUHVXPL-
senta quatro cavidades: duas superiores, denominadas átrios e duas dos, dizendo-se que a estimulação simpática aumenta a atividade
inferiores, denominadas ventrículos. O átrio direito comunica-se cardíaca como bomba, algumas vezes aumentando a capacidade
FRPRYHQWUtFXORGLUHLWRDWUDYpVGDYiOYXODWULF~VSLGH2iWULRHV- GH ERPEHDU VDQJXH HP DWp  SRU FHQWR (VVH HIHLWR p QHFHVVi-
querdo, por sua vez, comunica-se com o ventrículo esquerdo através rio quando um indivíduo é submetido a situações de estresse, tais
GDYiOYXODELF~VSLGHRXPLWUDO$IXQomRGDVYiOYXODVFDUGtDFDVp como exercício, doença, calor excessivo, ou outras condições que
JDUDQWLUTXHRVDQJXHVLJDXPD~QLFDGLUHomRVHPSUHGRViWULRVSDUD H[LJHPXPUiSLGRÀX[RVDQJXtQHRDWUDYpVGRVLVWHPDFLUFXODWyULR
os ventrículos. Por conseguinte, os efeitos simpáticos sobre o coração constituem
x  $V FkPDUDV FDUGtDFDV FRQWUDHPVH H GLODWDPVH o mecanismo de auxílio utilizado numa emergência, tornando mais
DOWHUQDGDPHQWH  YH]HV SRU PLQXWR HP PpGLD 2 SURFHVVR GH forte o batimento cardíaco quando necessário.
FRQWUDomRGHFDGDFkPDUDGRPLRFiUGLR P~VFXORFDUGtDFR GHQR- x Os neurônios pós-ganglionares do sistema nervoso sim-
mina-se sístole. O relaxamento, que acontece entre uma sístole e a pático secretam principalmente noradrenalina, razão pela qual são
seguinte, é a diástole. denominados neurônios adrenérgicos. A estimulação simpática do
a- A atividade elétrica do coração FpUHEURWDPEpPSURPRYHDVHFUHomRGHDGUHQDOLQDSHODVJOkQGXODV
x Nódulo sinoatrial (SA) ou marcapasso ou nó sino-atrial: adrenais ou supra-renais. A adrenalina é responsável pela taquicar-
região especial do coração, que controla a frequência cardíaca. Lo- dia (batimento cardíaco acelerado), aumento da pressão arterial e
caliza-se perto da junção entre o átrio direito e a veia cava superior da frequência respiratória, aumento da secreção do suor, da glicose
e é constituído por um aglomerado de células musculares especia- sangüínea e da atividade mental, além da constrição dos vasos san-
OL]DGDV$IUHTXrQFLDUtWPLFDGHVVDV¿EUDVPXVFXODUHVpGHDSUR[L- guíneos da pele.
PDGDPHQWHFRQWUDo}HVSRUPLQXWRHQTXDQWRRP~VFXORDWULDOVH x O neurotransmissor secretado pelos neurônios pós-gan-
FRQWUDLFHUFDGHYH]HVSRUPLQXWRHRP~VFXORYHQWULFXODUFHUFD glionares do sistema nervoso parassimpático é a acetilcolina, razão
GHYH]HVSRUPLQXWR'HYLGRDRIDWRGRQyGXORVLQRDWULDOSRVVXLU pela qual são denominados colinérgicos, geralmente com efeitos an-
uma frequência rítmica mais rápida em relação às outras partes do tagônicos aos neurônios adrenérgicos. Dessa forma, a estimulação

Didatismo e Conhecimento 84
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
parassimpática do cérebro promove bradicardia (redução dos bati- - O transporte, no sangue e nos líquidos corporais, do oxigênio
mentos cardíacos), diminuição da pressão arterial e da frequência (dos pulmões para as células) e do dióxido de carbono (das células
respiratória, relaxamento muscular e outros efeitos antagônicos aos para os pulmões).
da adrenalina. - A regulação da ventilação e de outros aspectos da respiração.
x Em geral, a estimulação do hipotálamo posterior aumenta São exemplos de doenças do sistema respiratórias a DPOC
a pressão arterial e a frequência cardíaca, enquanto que a estimulação GRHQoD SXOPRQDU REVWUXWLYD FU{QLFD  TXH QHOD LQFOXL R HQ¿VHPD
da área pré-óptica, na porção anterior do hipotálamo, acarreta efeitos pulmonar e a bronquite crônica; embolia pulmonar; síndrome do
opostos, determinando notável diminuição da frequência cardíaca e desconforto respiratório agudo (SDRA); edema agudo de pulmão
da pressão arterial. Esses efeitos são transmitidos através dos centros ($3  SQHXPRQLD LQIHFo}HV LQVX¿FLrQFLD UHVSLUDWyULD DJXGD
de controle cardiovascular da porção inferior do tronco cerebral, e (IRA); dentre outras.
daí passam a ser transmitidos através do sistema nervoso autônomo. A inspiração, que promove a entrada de ar nos pulmões, dá-se
SHODFRQWUDomRGDPXVFXODWXUDGRGLDIUDJPDHGRVP~VFXORVLQWHU-
Sistema Respiratório costais. O diafragma abaixa e as costelas elevam-se, promovendo
O corpo depende de um suprimento constante de oxigênio, que o aumento da caixa torácica, com consequente redução da pressão
é disponibilizado para o sangue pelo sistema respiratório, que com- interna (em relação à externa), forçando o ar a entrar nos pulmões. A
preende as cavidades nasais, faringe, laringe, traquéia e os pulmões. expiração, que promove a saída de ar dos pulmões, dá-se pelo rela-
A passagem do ar para dentro e para fora dos pulmões é deno- [DPHQWRGDPXVFXODWXUDGRGLDIUDJPDHGRVP~VFXORVLQWHUFRVWDLV
minada respiração. Durante a inspiração, o ar entra através do na- O diafragma eleva-se e as costelas abaixam, o que diminui o volume
riz chegando até os pulmões. Estes se expandem para preencher a da caixa torácica, com conseqüente aumento da pressão interna, for-
cavidade torácica, o sangue que circula nos pulmões é oxigenado. çando o ar a sair dos pulmões.
'XUDQWHDH[SLUDomRRVP~VFXORVGRSHLWRUHOD[DPOLEHUDQGRRDU
dos pulmões, o ar exalado carrega com ele gás carbônico. Cinética do movimento inspiratório com elevação das costelas
$IUHTXrQFLDUHVSLUDWyULDQRUPDOHPUHSRXVRPHGLGDSHORQ~- e abaixamento do diafragma.
PHURGHUHVSLUDo}HVSRUPLQXWRpGHDHPDGXOWRVGHD O transporte de gás oxigênio está a cargo da hemoglobina,
HPFULDQoDVHGHDHPEHErV
proteína presente nas hemácias. Cada molécula de hemoglobina
As emergências envolvendo o sistema respiratório incluem a
FRPELQDVH FRP  PROpFXODV GH JiV R[LJrQLR IRUPDQGR D R[L
REVWUXomR DV¿[LD GL¿FXOGDGHSDUDUHVSLUDUHSDUDGDUHVSLUDWyULD
hemoglobina. Nos alvéolos pulmonares o gás oxigênio do ar
difunde-se para os capilares sangüíneos e penetra nas hemácias,
onde se combina com a hemoglobina, enquanto o gás carbônico
(CO2) é liberado para o ar. Nos tecidos ocorrem um processo in-
verso: o gás oxigênio dissocia-se da hemoglobina e difunde-se pelo
líquido tissular, atingindo as células.
(PUHSRXVRDIUHTXrQFLDUHVSLUDWyULD )5 pGDRUGHPGHDWp
movimentos por minuto. A respiração é controlada automaticamen-
te por um centro nervoso localizado no bulbo. Desse centro partem
RV QHUYRV UHVSRQViYHLV SHOD FRQWUDomR GRV P~VFXORV UHVSLUDWyULRV
GLDIUDJPDHP~VFXORVLQWHUFRVWDLV 
Os sinais nervosos são transmitidos desse centro através da co-
OXQD HVSLQKDO SDUD RV P~VFXORV GD UHVSLUDomR 2 PDLV LPSRUWDQWH
P~VFXORGDUHVSLUDomRRGLDIUDJPDUHFHEHRVVLQDLVUHVSLUDWyULRV
através de um nervo especial, o nervo frênico, que deixa a medula
espinhal na metade superior do pescoço e dirige-se para baixo, atra-
vés do tórax até o diafragma.
$UHVSLUDomRpRLQWHUFkPELRGHJDVHVHQWUHXPRUJDQLVPRHR  2V VLQDLV SDUD RV P~VFXORV H[SLUDWyULRV HVSHFLDOPHQWH RV
PHLRQRTXDOHVVHRUJDQLVPRYLYH0DLVHVSHFL¿FDPHQWHWUDWDVHGD P~VFXORV DEGRPLQDLV VmR WUDQVPLWLGRV SDUD D SRUomR EDL[D GD
absorção de oxigênio, sua utilização nos tecidos e a eliminação de PHGXODHVSLQKDOSDUDRVQHUYRVHVSLQKDLVTXHLQHUYDPRVP~VFXORV
dióxido de carbono pelo organismo. Existem algumas ocasiões em que a concentração de oxigênio
Para o diagnóstico e o tratamento da maioria das doenças respi- nos alvéolos cai a valores muito baixos. Isso ocorre especialmente
UDWyULDVpQHFHVViULRFRPSUHHQGHURVSULQFtSLRVGD¿VLRORJLDUHVSL- em locais de grande altitude ou quando uma pessoa contrai pneumo-
ratória e das trocas gasosas. Algumas doenças respiratórias resultam nia, por exemplo.
de ventilação inadequada, ao passo que outras resultam de anorma-
lidades na difusão através da membrana pulmonar ou no transporte PULMÕES
de gases dos pulmões para os tecidos.
Podemos dividir a respiração em quatro grandes eventos, do Os pulmões são órgãos essenciais na respiração. São duas vís-
ponto de vista funcional: ceras situadas uma de cada lado, no interior do tórax e onde se dá
- A ventilação pulmonar, que é a remoção cíclica do gás alveo- o encontro do ar atmosférico com o sangue circulante, ocorrendo
lar pelo ar atmosférico. então, as trocas gasosas (HEMATOSE). Eles estendem-se do dia-
- A difusão do oxigênio e do dióxido de carbono entre os alvéo- fragma até um pouco acima das clavículas e estão justapostos às
los e o sangue. costelas.

Didatismo e Conhecimento 85
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
O pulmão direito é o mais espesso e mais largo que o esquerdo. Ele também é um pouco mais curto pois o diafragma é mais alto no lado
direito para acomodar o fígado. O pulmão esquerdo tem uma concavidade que é a incisura cardíaca.
&DGDSXOPmRWrPXPDIRUPDTXHOHPEUDXPDSLUkPLGHFRPXPiSLFHXPDEDVHWUrVERUGDVHWUrVIDFHV
Ápice do Pulmão: Está voltado cranialmente e tem forma levemente arredondada. Apresenta um sulco percorrido pela artéria subclávia,
denominado sulco da artéria subclávia. No corpo, o ápice do pulmão atinge o nível da articulação esterno-clavicular.
Base do Pulmão: A base do pulmão apresenta uma forma côncava, apoiando-se sobre a face superior do diafragma. A concavidade da base
do pulmão direito é mais profunda que a do esquerdo (devido à presença do fígado).
Margens do Pulmão: Os pulmões apresentam três margens: uma anterior, uma posterior e uma inferior. A borda anterior é delgada e
estende-se à face ventral do coração. A borda anterior do pulmão esquerdo apresenta uma incisura produzida pelo coração, a incisura cardíaca. A
ERUGDSRVWHULRUpURPEDHSURMHWDVHQDVXSHUItFLHSRVWHULRUGDFDYLGDGHWRUiFLFD$ERUGDLQIHULRUDSUHVHQWDGXDVSRUo}HV  XPDTXHpGHOJDGD
e projeta-se no recesso costofrênico e (2) outra que é mais arredondada e projeta-se no mediastino.

3HVR2VSXOP}HVWHPHPPpGLDRSHVRGHJUDPDV
$OWXUD2VSXOP}HVWHPHPPpGLDDDOWXUDGHFHQWtPHWURV
Faces: O pulmão apresenta três faces:

a) Face Costal (face lateral): é a face relativamente lisa e convexa, voltada para a superfície interna da cavidade torácica.
E )DFH'LDIUDJPiWLFD IDFHLQIHULRU pDIDFHF{QFDYDTXHDVVHQWDVREUHDF~SXODGLDIUDJPiWLFD
c) Face Mediastínica (face medial): é a face que possui uma região côncava onde se acomoda o coração. Dorsalmente encontra-se a região
denominada hilo ou raiz do pulmão. Pulmonar.

Divisão: Os pulmões apresentam características morfológicas diferentes.


2SXOPmRGLUHLWRDSUHVHQWDVHFRQVWLWXtGRSRUWUrVORERVGLYLGLGRVSRUGXDV¿VVXUDV8PD¿VVXUDREOLTXDTXHVHSDUDORERLQIHULRUGRVORERV
PpGLRHVXSHULRUHXPD¿VVXUDKRUL]RQWDOTXHVHSDUDRORERVXSHULRUGRORERPpGLR
2SXOPmRHVTXHUGRpGLYLGLGRHPXPORERVXSHULRUHXPORERLQIHULRUSRUXPD¿VVXUDREOtTXD$QWHULRUPHQWHHLQIHULRUPHQWHRORER
superior do pulmão esquerdo apresenta uma estrutura que representa resquícios do desenvolvimento embrionário do lobo médio, a língula do
pulmão.
Cada lobo pulmonar é subdividido em segmentos pulmonares, que constituem unidades pulmonares completas, consideradas autônomas
sob o ponto de vista anatômico.

Pulmão Direito
/RER6XSHULRUDSLFDODQWHULRUHSRVWHULRU
/RER0pGLRPHGLDOHODWHUDO
/RER,QIHULRUDSLFDO VXSHULRU EDVDODQWHULRUEDVDOSRVWHULRUEDVDOPHGLDOHEDVDOODWHUDO

Pulmão Esquerdo
/RER6XSHULRU$SLFRSRVWHULRUDQWHULRUOLQJXODUVXSHULRUHOLQJXODULQIHULRU
/RER,QIHULRUDSLFDO VXSHULRU EDVDODQWHULRUEDVDOSRVWHULRUEDVDOPHGLDOHEDVDOODWHUDO

),6,2/2*,$'$5(63,5$d­2

Ventilação pulmonar
$LQVSLUDomRTXHSURPRYHDHQWUDGDGHDUQRVSXOP}HVGiVHSHODFRQWUDomRGDPXVFXODWXUDGRGLDIUDJPDHGRVP~VFXORVLQWHUFRVWDLV2
diafragma abaixa e as costelas elevam-se, promovendo o aumento da caixa torácica, com consequente redução da pressão interna (em relação
à externa), forçando o ar a entrar nos pulmões.

A expiração, que promove a saída de ar dos pulmões, dá-se pelo relaxamento


GDPXVFXODWXUDGRGLDIUDJPDHGRVP~VFXORVLQWHUFRVWDLV2GLDIUDJPDHOHYDVHH
as costelas abaixam, o que diminui o volume da caixa torácica, com conseqüente
aumento da pressão interna, forçando o ar a sair dos pulmões.

Transporte de gases respiratórios


O transporte de gás oxigênio está a cargo da hemoglobina, proteína presente nas hemácias. Cada molécula de hemoglobina combina-se
FRPPROpFXODVGHJiVR[LJrQLRIRUPDQGRDR[LKHPRJORELQD

Didatismo e Conhecimento 86
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
FDGDVHJXQGRVXPLPSXOVRQHUYRVRTXHHVWLPXODDFRQWUDomRGD
musculatura torácica e do diafragma, fazendo-nos inspirar. O CR é
capaz de aumentar e de diminuir tanto a frequência como a ampli-
tude dos movimentos respiratórios, pois possui quimiorreceptores
que são bastante sensíveis ao pH do plasma. Essa capacidade permi-
te que os tecidos recebam a quantidade de oxigênio que necessitam,
além de remover adequadamente o gás carbônico. Quando o sangue
torna-se mais ácido devido ao aumento do gás carbônico, o centro
respiratório induz a aceleração dos movimentos respiratórios. Dessa
forma, tanto a frequência quanto a amplitude da respiração tornam-
-se aumentadas devido à excitação do CR.
Em situação contrária, com a depressão do CR, ocorre diminui-
ção da frequência e amplitude respiratórias.
A respiração é ainda o principal mecanismo de controle do pH
do sangue.

Nos alvéolos pulmonares o gás oxigênio do ar difunde-se para


os capilares sangüíneos e penetra nas hemácias, onde se combina
com a hemoglobina, enquanto o gás carbônico (CO2) é liberado para
o ar (processo chamado hematose)

O aumento da concentração de CO2 desloca a reação para a


direita, enquanto sua redução desloca para a esquerda.
Dessa forma, o aumento da concentração de CO2 no sangue
SURYRFDDXPHQWRGHtRQV+HRSODVPDWHQGHDRS+iFLGR6HD
concentração de CO2 diminui, o pH do plasma sangüíneo tende a se
tornar mais básico (ou alcalino).
Se o pH está abaixo do normal (acidose), o centro respiratório é
excitado, aumentando a a freqüência e a amplitude dos movimentos
respiratórios. O aumento da ventilação pulmonar determina elimi-
nação de maior quantidade de CO2, o que eleva o pH do plasma ao
seu valor normal.
Caso o pH do plasma esteja acima do normal (alcalose), o cen-
tro respiratório é deprimido, diminuindo a frequência e a amplitu-
de dos movimentos respiratórios. Com a diminuição na ventilação
pulmonar, há retenção de CO2 e maior produção de íons H, o que
determina queda no pH plasmático até seus valores normais.
A ansiedade e os estados ansiosos promovem liberação de adre-
nalina que, freqüentemente levam também à hiperventilação, algu-
mas vezes de tal intensidade que o indivíduo torna seus líquidos
Controle da respiração RUJkQLFRV DOFDOyWLFRV EiVLFRV  HOLPLQDQGR JUDQGH TXDQWLGDGH GH
GLy[LGRGHFDUERQRSUHFLSLWDQGRDVVLPFRQWUDo}HVGRVP~VFXORV
(PUHODWLYRUHSRXVRDIUHTXrQFLDUHVSLUDWyULDpGDRUGHPGH de todo o corpo.
DPRYLPHQWRVSRUPLQXWR Se a concentração de gás carbônico cair a valores muito baixos,
A respiração é controlada automaticamente por um centro outras conseqüências extremamente danosas podem ocorrer, como
nervoso localizado no bulbo. Desse centro partem os nervos res- o desenvolvimento de um quadro de alcalose que pode levar a uma
SRQViYHLV SHOD FRQWUDomR GRV P~VFXORV UHVSLUDWyULRV GLDIUDJPD H irritabilidade do sistema nervoso, resultando, algumas vezes, em
P~VFXORV LQWHUFRVWDLV  2V VLQDLV QHUYRVRV VmR WUDQVPLWLGRV GHVVH tetania (contrações musculares involuntárias por todo o corpo) ou
FHQWURDWUDYpVGDFROXQDHVSLQKDOSDUDRVP~VFXORVGDUHVSLUDomR mesmo convulsões epilépticas.
2PDLVLPSRUWDQWHP~VFXORGDUHVSLUDomRRGLDIUDJPDUHFHEHRV Existem algumas ocasiões em que a concentração de oxigênio
sinais respiratórios através de um nervo especial, o nervo frênico, nos alvéolos cai a valores muito baixos. Isso ocorre especialmente
que deixa a medula espinhal na metade superior do pescoço e dirige- quando se sobe a lugares muito altos, onde a pressão de oxigênio é
-se para baixo, através do tórax até o diafragma. Os sinais para os muito baixa ou quando uma pessoa contrai pneumonia ou alguma
P~VFXORVH[SLUDWyULRVHVSHFLDOPHQWHRVP~VFXORVDEGRPLQDLVVmR outra doença que reduza o oxigênio nos alvéolos. Sob tais condi-
transmitidos para a porção baixa da medula espinhal, para os nervos ções, quimiorreceptores localizados nas artérias carótida (do pes-
HVSLQKDLVTXHLQHUYDPRVP~VFXORV,PSXOVRVLQLFLDGRVSHODHVWLPX- coço) e aorta são estimulados e enviam sinais pelos nervos vago e
lação psíquica ou sensorial do córtex cerebral podem afetar a respi- glossofaríngeo, estimulando os centros respiratórios no sentido de
ração. Em condições normais, o centro respiratório (CR) produz, a aumentar a ventilação pulmonar.

Didatismo e Conhecimento 87
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
A capacidade e os volumes respiratórios
2VLVWHPDUHVSLUDWyULRKXPDQRFRPSRUWDXPYROXPHWRWDOGHDSUR[LPDGDPHQWHOLWURVGHDU±DFDSDFLGDGHSXOPRQDUWRWDO'HVVHYROXPH
apenas meio litro é renovado em cada respiração tranqüila, de repouso. Esse volume renovado é o volume corrente.
6HQR¿QDOGHXPDLQVSLUDomRIRUoDGDH[HFXWDUPRVXPDH[SLUDomRIRUoDGDFRQVHJXLUHPRVUHWLUDUGRVSXOP}HVXPDTXDQWLGDGHGHDSUR[L-
PDGDPHQWHOLWURVGHDURTXHFRUUHVSRQGHjFDSDFLGDGHYLWDOHpGHQWURGHVHXVOLPLWHVTXHDUHVSLUDoão pode acontecer.
0HVPRQR¿QDOGHXPDH[SLUDomRIRUoDGDUHVWDQDVYLDVDpUHDVFHUFDGHOLWURGHDURYROXPHUHVLGXDO

1XQFDVHFRQVHJXHHQFKHURVSXOP}HVFRPDUFRPSOHWDPHQWHUHQRYDGRMiTXHPHVPRQR¿QDOGHXPDH[SLUDomRIRUoDGDRYROXPHUHVLGXDO
permanece no sistema respiratório. A ventilação pulmonar, portanto, dilui esse ar residual no ar renovado, colocado em seu interior
O volume de ar renovado por minuto (ou volume-minuto respiratório) é obtido pelo produto da frequência respiratória (FR) pelo volume
FRUUHQWH 9& 905 )5[9&

Em um adulto em repouso, temos:


)5 PRYLPHQWRVSRUPLQXWR
9& OLWURV
3RUWDQWRYROXPHPLQXWRUHVSLUDWyULR [ OLWURVPLQXWR
2VDWOHWDVFRVWXPDPXWLOL]DURFKDPDGR³VHJXQGRI{OHJR´1R¿QDOGHFDGDH[SLUDomRFRQWUDHPRVP~VFXORVLQWHUFRVWDLVLQWHUQRVTXH
abaixam as costelas e eliminam mais ar dos pulmões, aumentando a renovação.

Sistema Digestório

O trato digestório e os órgãos anexos constituem o sistema digestório. O trato digestório é um tubo oco que se estende da cavidade bucal
DRkQXVVHQGRWDPEpPFKDPDGRGHFDQDODOLPHQWDURXWUDWRJDVWULQWHVWLQDO$VHVWUXWXUDVGRWUDWRGLJHVWyULRLQFOXHPERFDIDULQJHHV{IDJR
HVW{PDJRLQWHVWLQRGHOJDGRLQWHVWLQRJURVVRUHWRHkQXV
2FRPSULPHQWRGRWUDWRJDVWULQWHVWLQDOPHGLGRQRFDGiYHUpGHFHUFDGHP1DSHVVRDYLYDpPHQRUSRUTXHRVP~VFXORVDRORQJRGDV
paredes dos órgãos do trato gastrintestinal mantém o tônus.
2VyUJmRVGLJHVWyULRDFHVVyULRVVmRRVGHQWHVDOtQJXDDVJOkQGXODVVDOLYDUHVRItJDGRYHVtFXODELOLDUHRSkQFUHDV2VGHQWHVDX[LOLDP
no rompimento físico do alimento e a língua auxilia na mastigação e na deglutição. Os outros órgãos digestórios acessórios, nunca entram em
contato direto com o alimento. Produzem ou armazenam secreções que passam para o trato gastrintestinal e auxiliam na decomposição química
do alimento.
2WUDWRJDVWURLQWHVWLQDOpXPWXERORQJRHVLQXRVRGHDPHWURVGHFRPSULPHQWRGHVGHDH[WUHPLGDGHFHIiOLFD FDYLGDGHRUDO DWpD
caudal (kQXV .

FUNÇÕES

1- 'HVWLQDVHDRDSURYHLWDPHQWRSHORRUJDQLVPRGHVXEVWkQFLDVHVWUDQKDVGLWDVDOLPHQWDUHVTXHDVVHJXUDPDPDQXWHQomRGHVHXVSUR-
cessos vitais.
2- 7UDQVIRUPDomRPHFkQLFDHTXtPLFDGDVPDFURPyOpFXODVDOLPHQWDUHVLQJHULGDV SURWHtQDVFDUERKLGUDWRVHWF HPPROpFXODVGHWDPD-
nhos e formas adequadas para serem absorvidas pelo intestino.
3- Transporte de alimentos digeridos, água e sais minerais da luz intestinal para os capilares sangüíneos da mucosa do intestino.
4- Eliminação de resíduos alimentares não digeridos e não absorvidos juntamente com restos de células descamadas da parte do trato
JDVWURLQWHVWLQDOHVXEVWkQFLDVVHFUHWDGDVQDOX]GRLQWHVWLQR

Didatismo e Conhecimento 88
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Órgãos Anexos: A porção seguinte do intestino grosso é o cólon, segmento que
*/È81'8/$66$/9$5(6VmRUHSUHVHQWDGDVSRUSDUHV VHSURORQJDGRFHFRDWpRkQXV
que são as parótidas, submandibulares e sublinguais. Cólon Ascendente - Cólon Transverso - Cólon Descendente -
*/Æ1'8/$63$5Ï7,'$6DPDLRUGDVWUrVHVLWXDVHQD Cólon Sigmóide
parte lateral da face, abaixo e adiante do pavilhão da orelha. Irrigada Colo Ascendente – é a segunda parte do intestino grosso. Passa
por ramos da artéria carótida externa. Inervada pelo nervo auriculo- para cima do lado direito do abdome a partir do ceco para o lobo
temporal, glossofaríngeo e facial. GLUHLWRGRItJDGRRQGHVHFXUYDSDUDDHVTXHUGDQDÀH[XUDGLUHLWDGR
 */Æ1'8/$6 68%0$1',%8/$5(6 p DUUHGRQGDGD H FROR ÀH[XUDKHSiWLFD 
VLWXDVHQRWULkQJXORVXEPDQGLEXODUeLUULJDGDSRUUDPRVGDDUWpULD Colo Transverso – é a parte mais larga e mais móvel do intesti-
IDFLDOHOLQJXDO2VQHUYRVVHFUHWRPRWRUHVGHULYDPGH¿EUDVSDUDV- QRJURVVR(OHFUX]DRDEGRPHDSDUWLUGDÀH[XUDGLUHLWDGRFRORDWpD
VLPSiWLFDVFUDQLDLVGRIDFLDODV¿EUDVVLPSiWLFDVSURYrPGRJkQJOLR ÀH[XUDHVTXHUGDGRFRORRQGHFXUYDVHLQIHULRUPHQWHSDUDWRUQDUVH
cervical superior. FROR GHVFHQGHQWH$ ÀH[XUD HVTXHUGD GR FROR ÀH[XUD HVSOrQLFD 
*/Æ1'8/$668%/,1*8$,6pDPHQRUGDVWUrVHORFDOL- normalmente mais superior, mais aguda e menos móvel do que a
za-se abaixo da mucosa do assoalho da boca. É irrigada pelas arté- ÀH[XUDGLUHLWDGRFROR
rias sublinguais e submentonianas. Os nervos derivam de maneira &ROR'HVFHQGHQWH±SDVVDUHWURSHULWRQHDOPHQWHDSDUWLUGDÀH-
LGrQWLFDDRVGDJOkQGXODVXEPDQGLEXODU xura esquerda do colo para a fossa ilíaca esquerda, onde ele é contí-
)Ë*$'22ItJDGRpDPDLRUJOkQGXODGRRUJDQLVPRHpWDP- nuo com o colo sigmóide.
bém a mais volumosa víscera abdominal. Sua localização é na re- Colo Sigmóide – é caracterizado pela sua alça em forma de “S”,
JLmRVXSHULRUGRDEG{PHQORJRDEDL[RGRGLDIUDJPD¿FDQGRPDLV de comprimento variável. O colo sigmóide une o colo descendente
DGLUHLWDLVWRpQRUPDOPHQWHGHVHXYROXPHHVWmRDGLUHLWDGD DRUHWR$WHUPLQDomRGDVWrQLDVGRFRORDSUR[LPDGDPHQWHDFP
OLQKDPHGLDQDHjHVTXHUGD3HVDFHUFDGHJHUHVSRQGHSRU GRkQXVLQGLFDDMXQomRUHWRVLJPyLGH
DSUR[LPDGDPHQWHGRSHVRGRFRUSRDGXOWR O reto recebe este nome por ser quase retilíneo. Este segmento
 3Æ1&5($6 2 SkQFUHDV SURGX] DWUDYpV GH XPD VHFUHomR GRLQWHVWLQRJURVVRWHUPLQDDRSHUIXUDURGLDIUDJPDGDSHOYH P~V-
exócrina o suco pancreático que entra no duodeno através dos duc- FXORVOHYDQWDGRUHVGRkQXV SDVVDQGRDVHFKDPDUGHFDQDODQDO
tos pancreáticos, uma secreção endócrina produz glucagon e insu-
2FDQDODQDODSHVDUGHEDVWDQWHFXUWR FHQWtPHWURVGHFRPSUL-
OLQD TXH HQWUDP QR VDQJXH 2 SkQFUHDV SURGX] GLDULDPHQWH 
mento) é importante por apresentar algumas formações essenciais
±POGHVXFRSDQFUHático.
SDUD R IXQFLRQDPHQWR LQWHVWLQDO GDV TXDLV FLWDPRV RV HV¿QFWHUHV
anais.
,17(67,12*52662
O esfíncter anal interno é o mais profundo, e resulta de um es-
SHVVDPHQWRGH¿EUDVPXVFXODUHVOLVDVFLUFXODUHVVHQGRFRQVHTHQ-
O intestino grosso pode ser comparado com uma ferradura,
WHPHQWHLQYROXQWiULR2HVItQFWHUDQDOH[WHUQRpFRQVWLWXtGRSRU¿-
DEHUWDSDUDEDL[RPHGHFHUFDGHFHQWtPHWURVGHGLkPHWURH
PHWURVGHFRPSULPHQWR(OHVHHVWHQGHGRtOHRDWpRkQXVHHVWi¿[R bras musculares estriadas que se dispõem circularmente em torno do
à parede posterior do abdômen pelo mesecolo. esfíncter anal interno, sendo este voluntário. Ambos os esfíncteres
O intestino grosso absorve a água com tanta rapidez que, em devem relaxar antes que a defecação possa ocorrer.
FHUFDGHKRUDVRPDWHULDODOLPHQWDUWRPDDFRQVLVWrQFLDWtSLFD
do bolo fecal. )XQo}HVGR,QWHVWLQR*URVVR
O intestino grosso apresenta algumas diferenças em relação ao
intestino delgado: o calíbre, as tênias, os haustros e os apêndices - Absorção de água e de certos eletrólitos;
epiplóicos. - Síntese de determinadas vitaminas pelas bactérias intestinais;
O intestino grosso é mais calibroso que o intestino delgado, por - Armazenagem temporária dos resíduos (fezes);
isso recebe o nome de intestino grosso. A calibre vai gradativamente - Eliminação de resíduos do corpo (defecação).
D¿QDQGRFRQIRUPHYDLFKHJDQGRQRFDQDODQDO
$VWrQLDVGRFyORQ ¿WDVORQJLWXGLQDLV VmRWUrVIDL[DVGHDSUR- PERITÔNIO
[PDGDPHQWH  FHQWtPHWUR GH ODUJXUD H TXH SHUFRUUHP R LQWHVWLQR
grosso em toda sua extensão. São mais evidentes no ceco e no cólon O peritônio é a mais extensa membrana serosa do corpo. A parte
ascendente. que reveste a parede abdominal é denominada peritônio parietal e a
Os haustros do cólon (saculações) são abaulamentos ampulares TXHVHUHÀHWHVREUHDVYtVFHUDVFRQVWLWXLRSHULW{QLRYLVFHUDO2HV-
separados por sulcos transversais. paço entre os folhetos parietal e visceral do peritônio é denominada
Os apêndices epiplóicos são pequenos pingentes amarelados cavidade peritoneal.
constituídos por tecido conjuntivo rico em gordura. Aparecem prin- Determinadas vísceras abdominais são completamente envol-
cipalmente no cólon sigmóide. YLGDVSRUSHULW{QLRHVXVSHQVDVQDSDUHGHSRUXPDGHOJDGDOkPLQD
2LQWHVWLQRJURVVRpGLYLGLGRHPSDUWHVSULQFLSDLVFHFR FH- ¿QDGHWHFLGRFRQMXQWLYRUHYHVWLGDSHODVHURVDFRQWHQGRRVYDVRV
cum), cólon (ascendente, transverso, descendente e sigmóide), reto sangüíneos. A estas pregas é dado o nome geral de mesentério.
HkQXV Os mesentérios são: o mesentério propriamente dito, o meso-
A primeira é o ceco, segmento de maior calibre, que se comu- cólon transverso e o mesocólon sigmóide. Em adição a estes, estão
QLFDFRPRtOHR3DUDLPSHGLURUHÀX[RGRPDWHULDOSURYHQLHQWHGR presentes, algumas vezes, um mesocólon ascendente e um descen-
intestino delgado, existe uma válvula localizada na junção do íleo dente.
com o ceco - válvula ileocecal (iliocólica). No fundo do ceco, en- O mesentério propriamente dito – tem origem nas estruturas
contramos o Apêndice Vermiforme. ventrais da coluna vertebral e mantém suspenso o intestino delgado.

Didatismo e Conhecimento 89
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
O mesocólon transverso – prende o cólon transverso à parede O néfron é formado por dois componentes principais:
posterior do abdome.
O mesocólon sigmóide – mantém o cólon sigmóide em cone- &RUS~VFXOR5HQDO
xão com a parede pélvica. &iSVXOD*ORPHUXODU GH%RZPDQ 
O mesocólon ascendente e descendente – ligam o cólon ascen- *ORPpUXOR±UHGHGHFDSLODUHVVDQJtQHRVHQRYHODGRVGHQWUR
dente a descendente à parede posterior do abdome. da cápsula glomerular
O peritônio apresenta dois omentos: o maior e o menor.
O omento maior é um delgado avental que pende sobre o cólon 7~EXOR5HQDO
transverso e as alças do intestino delgado. Está inserido ao longo 7~EXORFRQWRUFLGRSUR[LPDO
da curvatura maior do estômago e da primeira porção do duodeno. - Alça do Néfron (de Henle);
O omento menor estende-se da curvatura menor do estômago e da 7~EXORFRQWRUFLGRGLVWDO
porção inicial do duodeno até o fígado. 7~EXORFROHWRU.
Apêndices Epiplóicos – são pequenas bolsas de peritônio cheias
de gordura, situadas ao longo do cólon e parte superior do reto. Funções dos Rins
Os rins realizam o trabalho principal do sistema urinário, com
Sistema Urinário as outras partes do sistema atuando, principalmente, como vias de
SDVVDJHPHiUHDVGHDUPD]HQDPHQWR&RPD¿OWUDomRGRVD:=Q-
O sistema urinário é constituído pelos órgãos uropoéticos, isto gue e a formação da urina, os rins contribuem para a homeostasia
é, incumbidos de elaborar a urina e armazená-la temporariamente dos líquidos do corpo de várias maneiras. As funções dos rins in-
até a oportunidade de ser eliminada para o exterior. Na urina encon- cluem:
WUDPRViFLGR~ULFRXUHLDVyGLRSRWiVVLRELFDUERQDWRHWF - Regulação da composição iônica do sangue;
Este aparelho pode ser dividido em órgãos secretores - que pro- - Manutenção da osmolaridade do sangue;
duzem a urina - e órgãos excretores - que são encarregados de pro- - Regulação do volume sangüíneo;
cessar a drenagem da urina para fora do corpo. - Regulação da pressão arterial;
- Regulação do pH do sangue;
Os órgãos urinários compreendem os rins (2), que produzem
- Liberação de hormônios;
a urina, os ureteres (2) ou ductos, que transportam a urina para a
- Regulação do nível de glicose no sangue;
EH[LJD  RQGH¿FDUHWLGDSRUDOJXPWHPSRHDXUHWUD  DWUDYpV
([FUHomRGHUHVtGXRVHVXEVWkQFLDVHVWUDQKDV
da qual é expelida do corpo.
Além dos rins, as estruturas restantes do sistema urinário fun-
*OkQGXODV6XSUDUHQDLV
cionam como um encanamento constituindo as vias do trato uriná-
$VJOkQGXODVVXSUDUHQDLV DGUHQDLV HVWmRORFDOL]DGDVHQWUHDV
ULR(VVDVHVWUXWXUDV±XUHWHUHVEH[LJDHXUHWUD±QmRPRGL¿FDPD
IDFHVVXSHURPHGLDLVGRVULQVHRGLDIUDJPD&DGDJOkQGXODVXSUD-
urina ao longo do caminho, ao contrário, elas armazenam e condu- UHQDOHQYROYLGDSRUXPDFiSVXOD¿EURVDHXPFR[LPGHJRUGXUD
zem a urina do rim para o meio externo. possui duas partes: o córtex e a medula supra-renal, ambas produ-
zindo diferentes hormônios.
RIM O córtex secreta hormônios essenciais à vida, enquanto que os
hormônios medulares não são essenciais para a vida. A medula da
Os rins são órgãos pares, em forma de grão de feijão, localiza- supra-renal pode ser removida, sem causar efeitos que comprome-
dos logo acima da cintura, entre o peritônio e a parede posterior do tem a vida.
abdome. Sua coloração é vermelho-parda. A medula supra-renal secreta dois hormônios: epinefrina (adre-
Os rins estão situados de cada lado da coluna vertebral, por dian- nalina) e norepinefrina. Já o córtex supra-renal secreta os esteróides.
te da região superior da parede posterior do abdome, estendendo-se
HQWUHDFRVWHODHRSURFHVVRWUDQVYHUVRGDYpUWHEUDORPEDU6mR Sistema Nervoso
descritos como órgãos retroperiotoneais, por estarem posicionados
por trás do peritônio da cavidade abdominal. O sistema nervoso é responsável por controlar a maioria das
Os rins são recobertos pelo peritônio e circundados por uma funções de um organismo, coordenando e regulando as atividades
massa de gordura e de tecido areolar frouxo. Cada rim tem cerca de corporais. O neurônio é a unidade funcional deste sistema.
FPGHFRPSULPHQWRDFPGHODUJXUDHXPSRXFRPDLV Neurônio
TXHFPGHHVSHVVXUD2HVTXHUGRpXPSRXFRPDLVFRPSULGRH Os neurônios comunicam-se através de sinapses; por eles pro-
mais estreito do que o direito. O peso do rim do homem adulto varia pagam-se os impulsos nervosos.
HQWUHDJQDPXOKHUDGXOWDHQWUHDJ2ULPGLUHLWR O neurônio é a unidade funcional do sistema nervoso formado
normalmente situa-se ligeiramente abaixo do rim esquerdo devido por: dendrito, corpo celular e axônio. A transmissão ocorre apenas
ao grande tamanho do lobo direito do fígado. no sentido do dendrito ao axônio.
Os dendritosVmRSURORQJDPHQWRVJHUDOPHQWHPXLWRUDPL¿FDGRV
Néfrons e que atuam como receptores de estímulos, funcionando portanto,
como “antenas” para o neurônio.
O néfron é a unidade morfofuncional ou a unidade produtora de Os axônios são prolongamentos longos que atuam como condu-
XULQDGRULP&DGDULPFRQWpPFHUFDGHPLOKmRGHQpIURQV WRUHVGRVLPSXOVRVQHUYRVRV2VD[{QLRVSRGHPVHUDPL¿FDUHHVVDV
A forma do néfron é peculiar, inconfundível, e admiravelmente UDPL¿FDo}HVVmRFKDPDGDVGHcolaterais. Todos os axônios têm um
adequada para sua função de produzir urina. início (cone de implantação), um meio (o axônio propriamente dito)

Didatismo e Conhecimento 90
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
H XP ¿P WHUPLQDO D[RQDO RX ERWmR WHUPLQDO  2 WHUPLQDO D[RQDO Cerebelo
é o local onde o axônio entra em contato com outros neurônios e/ O cerebelo é responsável pelo controle motor. A organização
ou outras células e passa a informação (impulso nervoso) para eles. básica do cerebelo é praticamente a mesma em todos os vertebra-
A região de passagem do impulso nervoso de um neurônio para a GRVGLIHULQGRDSHQDVQRQ~PHURGHFpOXODVHJUDXGHHQUXJDPHQWR
célula adjacente chama-se sinapse. Às vezes os axônios têm muitas Pesquisas recentes sugerem que a principal função do cerebelo seja
UDPL¿FDo}HV HP VXDV UHJL}HV WHUPLQDLV H FDGD UDPL¿FDomR IRUPD a coordenação sensorial e não só o controle motor.
XPDVLQDSVHFRPRXWURVGHQGULWRVRXFRUSRVFHOXODUHV(VWDVUDPL¿-
cações são chamadas coletivamente de arborização terminal. Funções:
Os corpos celulares dos neurônios são geralmente encontrados x Movimento
em áreas restritas do sistema nervoso, que formam o Sistema Ner- x Equilíbrio
YRVR&HQWUDO 61& RXQRVJkQJOLRVQHUYRVRVORFDOL]DGRVSUy[LPR x Postura
da coluna vertebral. x Tônus muscular
Do sistema nervoso central partem os prolongamentos dos neu-
Tronco Encefálico
rônios, formando feixes chamados nervos, que constituem o Siste-
Funções:
ma Nervoso Periférico (SNP).
x Respiração
O axônio está envolvido por um dos tipos celulares se- x Ritmo dos batimentos cardíacos
guintes: célula de Schwann (encontrada apenas no SNP)ou x Pressão Arterial
oligodendrócito(encontrado apenas no SNC) Em muitos axônios,
esses tipos celulares determinam a formação da bainha de mielina Mesencéfalo
- invólucro principalmente lipídico (também possui como consti-
tuinte a chamada proteína básica da mielina) que atua como isolante Funções:
térmico e facilita a transmissão do impulso nervoso. Em axônios x Visão
mielinizados existem regiões de descontinuidade da bainha de mie- x Audição
lina, que acarretam a existência de uma constrição (estrangulamen- x Movimento dos Olhos
to) denominada nódulo de Ranvier. No caso dos axônios mieliniza- x Movimento do corpo
dos envolvidos pelas células de Schwann, a parte celular da bainha
GHPLHOLQDRQGHHVWmRRFLWRSODVPDHRQ~FOHRGHVWDFpOXODFRQVWLWXL Ponte
o chamado neurilema. A função da ponte é transmitir as informações da medula e do
Sistema nervoso central - divide-se em encéfalo e medula. O bulbo até o córtex cerebral. Faz conexão com centros hierarquica-
encéfalo corresponde ao telencéfalo (hemisférios cerebrais), diencé- mente superiores.
falo (tálamo e hipotálamo), cerebelo, e tronco cefálico, que se divide O córtex sensorial coordena os estímulos vindos de várias par-
em: BULBO, situado caudalmente; MESENCÉFALO, situado cra- tes do sistema nervoso. O córtex motor é responsável pelas ações
nialmente; e PONTE, situada entre ambos. voluntárias e o córtex de associação está relacionado com o armaze-
namento da memória.
Medula espinhal
A medula espinhal é o centro dos DUFRVUHÀH[RV. Encontra-se Principais divisões do Sistema Nervoso Periférico
organizada em segmentos (região cervical, lombar, sacral, caudal, O SNP pode ser divido em voluntário e autônomo.
raiz dorsal e ventral). É uma estrutura subordinada ao cérebro, po-
rem pode agir independente dele. Sistema Nervoso Voluntário
Está relacionado com os movimentos voluntários. Os neurônios
levam a informação do SNC aos P~VFXORVHVTXHOpWLFRV, inervando-
Cérebro
-os diretamente. Pode haver movimentos involuntários.
O cérebro está relacionado com a maioria das funções:
Córtex Cerebral Sistema Nervoso Autônomo
(VWi UHODFLRQDGR FRP RV PRYLPHQWRV LQYROXQWiULRV GRV P~V-
Funções: culos como não-estriado e estriado cardíaco, sistema endócrino e
x Pensamento respiratório.
x Movimento voluntário É divido em simpático e parassimpático. Eles têm função
x Linguagem antagônica sobre o outro. São controlados pelo SNC, principalmente
x Julgamento pelo hipotálamo e atuam por meio da adrenalina e da acetilcolina. O
x Percepção mediador químico do SNA simpático é a acetilcolina e a adrenalina,
enquanto do parassimpático é apenas a acetilconlina.
O encéfalo dos mamíferos é dividido em: telencéfalo (cérebro), Os DWRV UHÀH[RV são reações involuntárias que envolvem
diencéfalo (tálamo e hipotálamo), mesencéfalo (teto), metencéfalo impulsos nervosos, percorrendo um caminho chamDGRDUFRUHÀH[R
(ponte e cerebelo) e mielencéfalo (bulbo). 8PH[HPSORPXLWRFRQKHFLGRGHDUFRUHÀH[RpRUHÀH[RSD-
telar. O tendão do joelho é o órgão receptor do estímulo. Quando
Bulbo ou medula oblonga UHFHEHRHVWtPXOR H[XPDSDQFDGD RVGHQGULWRVGRVQHXU{QLRV¿-
O bulbo tem a função relacionada com a respiração e é consi- cam excitados. O impulso é transmitido aos neurônios associativos
GHUDGRXPFHQWURYLWDO7DPEpPHVWiUHODFLRQDGRFRPRVUHÀH[RV por meio de sinapses, que por sua vez transmitem o impulso aos
cardiovasculares e transmissão de informações sensoriais e motoras. neurônios motores.

Didatismo e Conhecimento 91
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
2VQHXU{QLRVDVVRFLDWLYRVOHYDPDLQIRUPDomRDRHQFpIDORHRVQHXU{QLRVPRWRUHVH[FLWDPRVP~VFXORVGDFR[DID]HQGRFRPTXHDSHUQD
se movimente.
1R61&H[LVWHPDVFKDPDGDVVXEVWkQFLDVFLQ]HQWDHEUDQFD$VXEVWkQFLDFLQ]HQWDpIRUPDGDSHORVFRUSRVGRVQHXU{QLRVHDEUDQFDSRU
VHXVSURORQJDPHQWRV&RPH[FHomRGREXOERHGDPHGXODDVXEVWkQFLDFLQ]HQWDRFRUUHPDLVH[WHUQDPHQWHHDVXEVWkQFLDEUDQFDPDLVLQWHU-
namente.
Os órgãos do SNC são protegidos por estruturas esqueléticas (caixa craniana, protegendo o encéfalo; e coluna vertebral, protegendo a
medula - também denominada raque) e por membranas denominadas meninges, situadas sob a proteção esquelética: dura-máter (a externa),
aracnóide (a do meio) e pia-máter (a interna). Entre as meninges aracnóide e pia-máter há um espaço preenchido por um líquido denominado
líquido cefalorraquidiano ou líquor.

O impulso nervoso

A membrana plasmática do neurônio transporta alguns íons ativamente, do líquido


H[WUDFHOXODUSDUDRLQWHULRUGD¿EUDHRXWURVGRLQWHULRUGHYROWDDROtTXLGRH[WUDFHOXODU$VVLP
funciona a bomba de sódio e potássio, que bombeia ativamente o sódio para fora, enquanto
o potássio é bombeado ativamente para dentro.Porém esse bombeamento não é equitativo:
para cada três íons sódio bombeados para o líquido extracelular, apenas dois íons potássio são
bombeados para o líquido intracelular.

O telencéfalo compreende uma parte mediana, da qual se envagina duas porções laterais, as vesículas telencefálicas laterais. A parte media-
na é fechada anteriormente por uma lamina que constitui a porção mais cranial do sistema nervoso e se denomina lamina terminal. As vesículas
telencéfalicas laterais crescem muito para formar os hemisférios cerebrais e escondem quase completamente a parte mediana e o diencéfalo.
O diencéfalo apresenta quatro pequenos divertículos: dois laterais, as vesículas ópticas, que formam a retina; um dorsal, que forma a
JOkQGXODSLQHDOHXPYHQWUDORLQIXQGtEXORTXHIRUPDDQHXURKLSy¿VH
Cavidade do tubo neuralDOX]GRWXERQHXUDOSHUPDQHFHQRVLVWHPDQHUYRVRGRDGXOWRVRIUHQGRHPDOJXPDVSDUWHVYDULDVPRGL¿FDo}HV
A luz da medula primitiva forma, no adulto, o canal central da medula. A cavidade dilatada do rombencéfalo forma o IV ventrículo. A cavidade
do diencéfalo e a da parte mediana do telencéfalo forma o III ventrículo.
A luz do mesencéfalo permanece estreita e constitui o aqueduto cerebral que une o III ao IV ventrículo. A luz das vesículas telencéfalicas
laterais forma, de cada lado, os ventrículos laterais, unidos ao III ventrículo pelos dois forames interventriculares. Todas as cavidades são
revestidas por um epitélio cuboidal denominado epêndima e, com exceção do canal central da medula, contêm um liquido cérebro-espinhal,
ou líquor.
FlexurasGXUDQWHRGHVHQYROYLPHQWRGDVGLYHUVDVSDUWHVGRDUTXHQFpIDORDSDUHFHPÀH[XUDVRXFXUYDWXUDVQRVHXWHWRRXDVVRDOKRGHYLGDV
SULQFLSDOPHQWHDULWPRVGHFUHVFLPHQWRGLIHUHQWHV$SULPHLUDÀH[XUDDDSDUHFHUpDÀH[XUDFHIiOLFDTXHVXUJHQDUHJLmRHQWUHRPHVHQFpIDOR
HRSURVHQFpIDOR/RJRVXUJHHQWUHDPHGXODSULPLWLYDHRDUTXHQFpIDORXPDVHJXQGDÀH[XUDGHQRPLQDÀH[XUDFHUYLFDO(ODpGHWHUPLQDGD
SRUXPDÀH[mRYHQWUDOGHWRGDDFDEHoDGRHPEULmRQDUHJLmRGRIXWXURSHVFRoR)LQDOPHQWHDSDUHFHXPDWHUFHLUDÀH[XUDGHGLUHomRFRQWUDULD
DVGXDVSULPHLUDVQRSRQWRGHXQLmRHQWUHRPHWDHRPLHOHQFpIDORDÀH[XUDSRQWLQD&RPRGHVHQYROYLPHQWRDVGXDVÀH[XUDVFDXGDLVVH
GHVID]HPHSUDWLFDPHQWHGHVDSDUHFHP(QWUHWDQWRDÀH[XUDFHIiOLFDSHUPDQHFHGHWHUPLQDGRQRHQFpIDORGRKRPHPDGXOWRXPkQJXORHQWUH
o cérebro, derivando do prosencéfalo, e o resto do neuro-eixo.

Didatismo e Conhecimento 92
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Divisão do sistema nervoso com base em critérios anatômicos +LSy¿VH
e funcionais
$KLSyWHVHpXPDSHTXHQDJOkQGXODXPFRUSRRYyLGHFRPWD-
PDQKRVHPHOKDQWHGHXPDHUYLOKDWDPEpPFRQKHFLGDFRPRJOkQ-
dula pituitária. Tem coloração cinza-avermelhado, medindo cerca
GHPPGHGLkPHWURWUDQVYHUVRHPPGHGLkPHWURDQWHURSRVWH-
ULRUHSHVDQGRDSUR[LPDGDPHQWHPJ$KLSy¿VHHVWiORFDOL]DGD
abaixo do hipotálamo, posteriormente ao quiasma óptico, em uma
depressão em forma de sela do osso esfenóide, denominada fossa
KLSR¿ViULDeFREHUWDVXSHULRUPHQWHSHORGLDIUDJPDGDVHODFLU-
FXODUGDGXUDPiWHU$KLSy¿VHHVWi¿[DGDjVXSHUItFLHLQIHULRUGR
hipotálamo, por uma curta haste denominada infundíbulo. Ela pos-
VXLGXDVSDUWHVXPDDQWHULRUDDGHQRKLSy¿VHHRXWUDSRVWHULRUD
QHXURKLSy¿VH$KLSy¿VHVHFUHWDRLWRKRUP{QLRVHSRUWDQWRDIHWD
quase todas as funções do corpo.

$GHQRKLSy¿VH

$SDUWHDQWHULRUGDKLSy¿VHDDGHQRKLSy¿VHpFRPSRVWDGH
tecido epitelial glandular e é altamente vascular e constituída de
células epiteliais de tamanho e forma variados, dispostas em cor-
dões ou folículos irregulares. Sintetiza e libera pelo menos oito
hormônios importantes:
- Somatotropina (STH), envolvida no controle do crescimento
SISTEMA ENDÓCRINO do corpo;
- Mamotropina (LTH), que estimula o crescimento e a secre-
2VLVWHPDQHUYRVRHDVJOkQGXODVHQGyFULQDVVmRRVGRLVSULQ- ção da mama feminina;
cipais mecanismos de comunicação e coordenação do corpo hu- - Adrenocorticotropina (ACTH), que controla a secreção de
PDQR (OHV UHJXODP TXDVH WRGRV RV VLVWHPDV RUJkQLFRV (PERUD DOJXQVKRUP{QLRVFRUWLFDLVGDJOkQGXODVXSUDUHQDO
o sistema nervoso e o sistema endócrino trabalham intimamente 7LURWURSLQD 76+ TXHHVWLPXODDDWLYLGDGHGDJOkQGXODWL-
associados, eles possuem várias diferenças. reóide;
O sistema nervoso comunica-se através de sinais elétricos - Hormônio estimulador do folículo (FSH), que estimula o
chamados impulsos nervosos, que transmitem a informação crescimento e a secreção de estrógenos nos folículos ováricos e a
rapidamente e, geralmente, realizam efeitos de curta duração. espermatogênese nos testículos;
No sistema endócrino, ao contrário, a comunicação se faz por - Hormônio das células intersticiais (ICSH), que ativa a secre-
VLQDLV TXtPLFRV DWUDYpV GH VXEVWkQFLDV FKDPDGDV KRUP{QLRV 2 ção de andrógenos através do testículo;
sistema endócrino responde mais lentamente e normalmente causa - Hormônio Luteinizante (LH), que induz a secreção de pro-
efeitos mais duradouros. JHVWHURQDSHORFRUSRO~WHR
2VLVWHPDHQGyFULQRpIRUPDGRSRUJOkQGXODVHQGyFULQDVTXH - Hormônio estimulador de melanócitos (MSH), que aumenta
produzem hormônios e estão amplamente distribuídas pelo cor- DSLJPHQWDomRFXWkQHD
SR$VJOkQGXODVHQGyFULQDVVmRJOkQGXODVVHPGXFWRVLVWRpHODV
secretam hormônios diretamente no interior de capilares (sanguí-
1HXURKLSy¿VH
neos).
2ORERSRVWHULRUGDKLSy¿VHpXPDHYDJLQDomRGHVFHQGHQWHGR
O sistema endócrino produz seus efeitos por meio da secreção
de hormônios. Os hormônios são mensageiros químicos que in- DVVRDOKRGRGLHQFpIDOR$SRUomRSRVWHULRUGDKLSy¿VHpFRPSRVWD
ÀXHQFLDPRXFRQWURODPDVDWLYLGDGHVGHRXWURVWHFLGRVRXyUJmRV SRUWHFLGRQHUYRVRHSRUWDQWRpFKDPDGDGHQHXURKLSy¿VH6LQWH-
A maioria dos hormônios é transportada pelo sangue a outras par- tiza dois hormônios:
tes do corpo, exercendo efeitos em tecidos mais distantes. - Vasopressina (ADH), antidiurético, que controla a absorção
$VSULQFLSDLVJOkQGXODVHQGyFULQDVVmR GHiJXDDWUDYpVGRW~EXORVUHQDLV
±+LSy¿VH 2FLWRFLQDTXHSURPRYHDFRQWUDomRGRP~VFXORQmRHVWULDGR
±*OkQGXOD7LUHyLGH GR~WHURHGDPDPD
±*OkQGXODV3DUDWLUHyLGHV
±*OkQGXODV6XSUDUHQDLV 2VGRLVKRUP{QLRVGDQHXURKLSy¿VHVmRSURGX]LGRVQRKLSR-
±3kQFUHDV WiODPRHWUDQVSRUWDGRVQRLQWHULRUGRLQIXQGtEXOR KDVWHKLSR¿Vi-
±*{QDGDV 2YiULRVH7HVWtFXORV ULD HDUPD]HQDGRVQDJOkQGXODDWpVHUHPXWLOL]DGRV2VLPSXOVRV
±7LPR nervosos para o hipotálamo estimulam a liberação dos hormônios
±*OkQGXOD3LQHDO GDQHXURKLSy¿VH

Didatismo e Conhecimento 93
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
*OkQGXOD7LUHyLGH Córtex Supra-renal

$JOkQGXODWLUHyLGHSRVVXLWRPYHUPHOKRDFDVWDQKDGRFHU- 2FyUWH[VXSUDUHQDOXPD¿QDFDPDGDH[WHUQD SHULIpULFD 


FDGHJHpDOWDPHQWHYDVFXODUL]DGD(VWiORFDOL]DGDQDUHJLmR mostra três zonas celulares: as zonas glomerulosa (mais externa),
kQWHURLQIHULRUGRSHVFRoRkQWHURODWHUDOPHQWHjWUDTXpLDHORJR fasciculada (mais larga) e reticulada (mais interna). O córtex secreta
abaixo da laringe, no nível entre a quinta vértebra cervical e a os hormônios chamados esteroides.
primeira vértebra torácica. A tireóide possui dois lobos (direito =RQD *ORPHUXORVD 3URGX]HP DOGRVWHURQD PLQHUDORFRUWLFyL-
e esquerdo) que são conectados entre si por uma parte central de), que tem função importante na regulação do volume e da pressão
GHQRPLQDGDLVWPRGDJOkQGXODWLUHyLGH&DGDORERSRVVXLDSUR[L- do sangue, e na concentração do equilíbrio eletrolítico do sangue.
PDGDPHQWHFPGHFRPSULPHQWR$JOkQGXODHVWiHQYROYLGDSRU Em geral, a aldosterona retém o sódio e a água e elimina potássio.
uma cápsula de tecido conjuntivo e contém dois tipos de células: Zona Fasciculada: Produzem hormônios que mantêm o equi-
as células foliculares, localizadas nos folículos tereoideanos, e as líbrio dos carboidratos, proteínas e gorduras (glicocorticóides). O
células parafoliculares, localizadas entre os folículos. principal glicocorticóide é o cortisol.
)ROtFXOR 7LUHRLGHDQR D JOkQGXOD WLUHyLGHD p FRPSRVWD SRU Zona Reticulada: Podem produzir hormônios sexuais (proges-
muitas unidades secretoras chamadas folículos. As células foli- terona, estrógenos e andrógenos).
culares secretam e armazenam dois hormônios tireoideanos: O córtex é essencial para a vida; a remoção completa é letal sem
7ULLRGRWLURQLQD 7 terapia de substituição. Também exerce considerável controle sobre
7HWUDLRGRWLURQLQD 7RXWLUR[LQD os linfócitos e tecido linfático.
 'RV GRLV KRUP{QLRV WLUHyLGHRV D 7 p SURYDYHOPHQWH R
estimulador principal do ritmo metabólico da célula, com ação Medula Supra-renal
PXLWR SRGHURVD H LPHGLDWD HQTXDQWR D 7 p SRGHURVD SRUpP
menos rápida. $PHGXODVXSUDUHQDODSDUWHLQWHUQDGDJOkQGXODpFRQVLGHUD-
$VJOkQGXODVSDUDIROLFXODUHVVHFUHWDPRVHJXLQWHKRUP{QLR da uma extensão da parte simpática do sistema nervoso autônomo. É
- Calcitonina, que regula o metabolismo de cálcio, principal- FRQVWLWXtGDGHJUXSRVHFROXQDVGHFpOXODVFURPD¿QVVHSDUDGRVSRU
mente suprindo a reabsorção óssea. largos sinusóides venosos. Pequenos grupos de neurônios ocorrem
na medula.
*OkQGXODV3DUDWLUHyLGHV
A medula da supra-renal secreta dois hormônios:
±(SLQHIULQD $GUHQDOLQD TXHSRVVXLHIHLWRDFHQWXDGRVREUH
$VJOkQGXODVSDUDWLUHyLGHVVmRSHTXHQDVHVWUXWXUDVRYyLGHV
o metabolismo de carboidratos.
RXOHQWLIRUPHVPDUURQDPDUHODGDVSHVDQGRFHUFDGHJHJH-
2 – Norepinefrina (Noradrenalina), que produz aceleração do
UDOPHQWHVHVLWXDQGRHQWUHDVPDUJHQVGRORERSRVWHULRUGDJOkQ-
coração vasoconstrição e pressão sanguínea elevada.
GXOD WLUHyLGH H VXD FiSVXOD *HUDOPHQWH H[LVWHP GXDV GH FDGD
(VVHVKRUP{QLRVVmRFODVVL¿FDGRVFRPRDPLQDVHSRUHVWDUHP
lado, superior e inferior.
no grupo químico chamado catecol, são denominados catecolami-
&DGD JOkQGXOD SDUDWLUHyLGH SRVVXL XPD ¿QD FiSVXOD GH WH-
nas. Esses hormônios são produzidos em situações de emergência e
cido conjuntivo com septos intraglandulares, mas carecendo de estresse, produzindo os seguintes efeitos (além dos descritos acima):
lóbulos. - Conversão de glicogênio em glicose no fígado;
$VJOkQGXODVSDUDWLUHyLGHVVHFUHWDPRKRUP{QLRSDUDWLUHyL- - Elevação do padrão metabólico da maioria das células;
deo (PTH) que está relacionado com o controle do nível e da - Dilatação dos brônquios.
distribuição de cálcio e fósforo. O PTH atua em três órgãos-alvo:
ossos, trato digestório (intestino) e rins. O efeito geral do PTH é 3kQFUHDV
o aumento dos níveis plasmáticos de cálcio e a diminuição dos
níveis plasmáticos de fosfato. 2 SkQFUHDV VHFUHWD GRLV KRUP{QLRV D LQVXOLQD H R JOXFDJRQ
As células que produzem esses hormônios são denominadas ilhotas
*OkQGXODV6XSUDUHQDLV DGUHQDLV pancreáticas (Langerhans). As ilhotas são constituídas de aglome-
rações esferóides ou elipsóides de células, dispersas no tecido exó-
$VJOkQGXODVVXSUDUHQDLVVmRSHTXHQRVFRUSRVDPDUHODGRV crino, juntamente com células endócrinas esparsas, frequentemente
DFKDWDGRVkQWHURSRVWHULRUPHQWHHVWmRVLWXDGRVkQWHURVXSHULR- VROLWiULDV2SkQFUHDVKXPDQRSRGHFRQWHUPDLVGHXPPLOKmRGH
res a cada extremidade superior do rim. Circundadas por tecido ilhas, geralmente mais numerosas na cauda. Essas ilhotas possuem
conjuntivo contendo muita gordura perinéfrica, são envolvidos dois tipos de células: os endocrinócitos alfa, que produzem glucagon
SHODIiVFLDUHQDOPDVVHSDUDGDVGRVULQVSRUWHFLGR¿EURVR&DGD e os endocrinócitos beta que produzem insulina. Esses dois hormô-
XPDPHGHDSUR[LPDGDPHQWHPPYHUWLFDOPHQWHPPWUDQV- nios ajudam a controlar os níveis de glicose no sangue. O efeito
YHUVDOPHQWHHPPQDGLPHQVmRDQWHURSRVWHULRUSHVDQGRFHU- da insulina é baixar os níveis de glicose enquanto que o glucagon
FDGHJ aumenta esses níveis.
8PDJOkQGXODVXSUDUHQDOVHFFLRQDGDUHYHODXPFyUWH[H[- Ação da insulina: diminui os níveis de glicose através de dois
WHUQRGHFRUDPDUHODHIRUPDQGRDPDVVDSULQFLSDOHXPD¿QD PHFDQLVPRV DXPHQWDRWUDQVSRUWHGHJOLFRVHGRVDQJXHSDUDR
PHGXOD YHUPHOKRHVFXUR IRUPDQGR FHUFD GH  GD JOkQGXOD interior das células; 2) estimula as células a queimar glicose como
A medula é completamente envolvida pelo córtex, exceto no seu FRPEXVWtYHO$LQVXOLQDpR~QLFRKRUP{QLRTXHGLPLQXLDJOLFRVH
hilo. sanguínea.

Didatismo e Conhecimento 94
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Ação do glucagon: esse hormônio aumenta a glicose sanguínea O timo situa-se na parte superior da cavidade torácica, poste-
GHGXDVPDQHLUDV HVWLPXODQGRDFRQYHUVmRGHJOLFRJrQLRHPJOL- riormente ao esterno e das quatro cartilagens costais superiores, in-
cose no fígado; 2) estimulando a conversão de proteínas em glicose. IHULRUPHQWHjJOkQGXODWLUHyLGH(DQWHULRUPHQWHDRSHULFiUGLRDUFR
da aorta e seus ramos. Sendo mais preciso, o timo localiza-se nos
*{QDGDV 2YiULRVH7HVWtFXORV mediastinos superior e inferior anterior, estendendo-se inferiormen-
WHDWpDTXDUWDFDUWLODJHPFRVWDOFRPVXDVSDUWHVVXSHULRUHVD¿ODQ-
$VJ{QDGDVVmRJOkQGXODVVH[XDLVTXHFRQVWLWXHPQRVRYiULRV do-se em direção ao pescoço e, algumas vezes, alcançando os pólos
(mulheres) e testículos (homens). Essas gônadas, além de produzi- LQIHULRUHVGDJOkQGXODWLUHRLGH
rem os gametas (óvulos e espermatozóides), também secretam hor- 2WLPRWHPDIXQomRGHSURGX]LUGLYHUVDVVXEVWkQFLDV LQFOXVLYH
mônios, que serão descritos abaixo. hormônios) que regulam a produção de linfócitos, a diferenciação e
DVDWLYLGDGHVQRWLPR(VVDVVXEVWkQFLDVLQFOXHPTXDWURSROLSHSWt-
Ovários: existem dois ovários localizados um de cada lado da deos principais quimicamente bem distribuídos: timulina, timopoe-
cavidade pélvica. tina, timosina alfa I e timosina beta IV.
A timulina é produzida dentro do timo e precisa da presença
Os ovários produzem dois hormônios sexuais femininos: o
de zinco para a atividade funcional (reage exclusivamente com as
estrógeno e a progesterona. Esses hormônios participam do desen-
FpOXODV7 $WLPRSRHWLQDLQWHQVL¿FDGLYHUVDVIXQo}HVGDFpOXOD7$
volvimento e do funcionamento dos órgãos genitais femininos e da
timulina e a timopoetina agem sistematicamente para dar regulação
expressão das características sexuais femininas, sendo que tais ca-
imune perfeitamente ajustadas das células T, auxiliando a manuten-
racterísticas desenvolvem-se principalmente em resposta ao estró- ção do equilíbrio entre as atividades de seus diferentes subconjuntos.
geno. Elas incluem: As atividades da timosina alfa I e beta IV não são bem claras. Sabe-
- Desenvolvimento das mamas; -se que as timosinas promovem maturação dos linfócitos no interior
- Distribuição da gordura nos quadris, coxas e mamas; do timo e também estimulam o desenvolvimento e a atividade dos
'LVWULEXLomRGHSHORVHPiUHDVHVSHFt¿FDVGRFRUSR linfócitos no desempenho de suas funções linfáticas por todo corpo.
- Maturação de órgãos genitais;
)HFKDPHQWRGDVFDUWLODJHQVHSL¿VLDLVGRVRVVRVORQJRV &RUSR *OkQGXOD 3LQHDO
Tanto o estrógeno como a progesterona são controlados por
hormônios de liberação no hipotálamo, e pelas gonadotropinas da 2FRUSRSLQHDORXHSt¿VHGRFpUHEURpXPSHTXHQRyUJmRSLUL-
DGHQRKLSy¿VH forme, cinza-avermelhado, que ocupa uma depressão entre os co-
lículos superiores. Está inferiormente ao esplênio do corpo caloso,
Testículos: estão localizados dentro do escroto separado deste pela tela corióidea do terceiro ventrículo. O corpo
O principal hormônio secretado pelos testículos é a testostero- PHGHDSUR[LPDGDPHQWHPPGHFRPSULPHQWR6XDEDVHHVWiSUHVD
na, um esteróide produzido por suas células intersticiais. O estímulo SRUXPSHG~QFXORTXHVHGLYLGHHPOkPLQDVLQIHULRUHVXSHULRUVH-
para secreção da testosterona é o hormônio luteinizante (LH), pro- paradas pelo recesso pineal do terceiro ventrículo. E contendo, res-
YHQLHQWHGDDGHQRKLSy¿VH SHFWLYDPHQWHDVFRPLVVXUDVHSLWDOkPLFDVHGDKDErQXOD
A testosterona auxilia na maturação dos espermatozóides e é O corpo pineal contém cordões e folículos de pinealócitos e cé-
responsável pelas características sexuais masculinas, tais como: OXODVGDQHXURJOLDHQWUHDVTXDLVVHUDPL¿FDPPXLWRVYDVRVVDQJXt-
- Crescimento e desenvolvimento dos órgãos genitais neos e nervos. Septos se estendem até o corpo a partir da pia-máter
masculinos; adjacente.
- Crescimento musculoesquelético; 2FRUSRSLQHDOPRGL¿FDDDWLYLGDGHGDDGHQRKLSy¿VHQHXURKL-
- Crescimento e distribuição dos pêlos; Sy¿VHSkQFUHDVHQGyFULQRSDUDWLUHyLGHVFyUWH[HPHGXODGDJOkQ-
- Aumento da laringe, acompanhado por alterações da voz. dula supra-renal e gônadas. As secreções pineais podem alcançar
suas células-alvo via líquido cérebro-espinal ou através da corrente
A secreção da testosterona é controlada por hormônios de libe-
sanguínea.
ração produzidos no hipotálamo, e pelos hormônios luteinizantes da
$JOkQGXODSLQHDOVHFUHWDDPHODWRQLQDXPKRUP{QLRTXHDOWHUD
DGHQRKLSy¿VH
RFLFORUHSURGXWLYRLQÀXHQFLDQGRDVHFUHomRGHKRUP{QLRVGHOLEH-
ração do hipotálamo. Acredita-se também que a melatonina esteja
Timo relacionada com ciclo sono/vigília, possuindo um efeito tranqüili-
zante. Ela tem sido chamada de “relógio biológico do corpo”, con-
O timo possui determinadas funções secretoras hormonais e lin- trolando a maioria dos biorritmos.
fáticas (produzindo linfócitos T). Ele varia de tamanho e atividade,
GHSHQGHQGRGDLGDGHGRHQoDHGRHVWDGR¿VLROyJLFRPDVSHUPDQH- OUTROS HORMÔNIOS
FHDWLYRPHVPRQDLGDGHDYDQoDGD$RQDVFLPHQWRSHVDFHUFDGH
DJFUHVFHQGRDWpDSXEHUGDGHTXDQGRHOHSHVDGHDJPRX +RUP{QLRV$VVRFLDGRVD6LVWHPD2UJkQLFRV(VSHFt¿FRV
seja, apresenta-se muito maior na criança do que no adulto, sendo
TXHDSyVDSXEHUGDGHDJOkQGXODLQYROXLRXVHWRUQDPHQRUVHQGR Esses hormônios normalmente controlam as atividades de um
substituído por tecido conjuntivo a adiposo. No início da vida, ele é yUJmR HVSHFt¿FR 3RU H[HPSOR FpOXODV SURGXWRUDV GH KRUP{QLRV
GHFRUFLQ]DUy]HRPROHH¿QDPHQWHOREXODGRFRQVWLWXtGRHPGRLV presentes no trato digestório secretam colecistoquinina, gastrina e
lobos piramidais iguais, unidos por tecido conectivo frouxo. Após a secretina. Esses hormônios ajudam a regular a digestão. Os rins se-
meia idade, o timo torna-se amarelado devido à sua gradual substi- cretam eritropoietina, que auxilia a regular a produção de glóbulos
tuição por tecido adiposo. vermelhos do sangue.

Didatismo e Conhecimento 95
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Prostaglandinas

$VSURVWDJODQGLQDVVmRVXEVWkQFLDVTXtPLFDV KRUP{QLRV GHULYDGRVGHiFLGRVJUD[RVHGRiFLGRDUDFG{QLFR6mRSURGX]LGDVSRUGLYHUVRV


WHFLGRVHJHUDOPHQWHDJHPSUy[LPRDRVVHXVVtWLRVGHVHFUHomR(ODVH[HUFHPLPSRUWDQWHSDSHOQDUHJXODomRGDFRQWUDomRGRP~VFXOROLVRHQD
UHVSRVWDLQÀDPDWyULD$VSURVWDJODQGLQDVWDPEpPVmRDVVRFLDGDVDRDXPHQWRGDVHQVLELOLGDGHGDVWHUPLQDo}HVQHUYRVDVSDUDDGRU

5HVXPRGDV*OkQGXODV(QGyFULQDVH+RUP{QLRV

*OkQGXOD
Hormônio Tecidos/Órgãos Alvo Ação Principal do Hormônio
Endócrina

Liberadores: estimulam a secreção


Hipotálamo $GHQRKLSy¿VH hormonal
Liberadores e inibidores
Inibidores: inibem a secreção hormonal

Hormônio do
Promove crescimento de todos os tecidos
FUHVFLPHQWR *+  Ossos e tecidos moles
(somatopropina)
Estimula a produção de leite
Prolactina (PRL) *OkQGXODVPDPiULDV
(VWLPXODDSURGXomRGH7H7
Tireoestimulante *OkQGXODWLUHyLGH
(TSH e Tireotropina)
$GHQRKLSy¿VH Estimula a secreção de hormônios do córtex
Adrenocorticotrópico Córtex da supra-renal
da supra-renal, principalmente o cortisol
(ACTH)
Estimula o desenvolvimento dos óvulos/
*RQDGRWUR¿QDV Ovários e testículos
espermatozóides e estrógeno nas mulheres
- Folículo-estimulante
(FSH)
Provoca a ovulação; estimula secreção
de progesterona na mulher e testosterona nos
Ovários e testículos
homens
- Luteinizante (LH)

Rins e vasos Estimula reabsorção da água pelos rins e


Antidiurético (ADH) sanguíneos determina a constricção dos vasos sanguíneos
1HXURKLSy¿VH
Contração da musculatura uterina no parto
HOLEHUDomRRXHMHomRGROHLWHGDVJOkQGXODV
Ocitocina Útero e mamas mamárias

Estimulam o padrão metabólico e regulam o


Todos os tecidos
crescimento e o desenvolvimento
*OkQGXOD 7H7
Tireóide
Favorece a formação de osso e diminui os
Calcitocina Ossos e rins
níveis de cálcio

Determina a reabsorção óssea, aumenta os


*OkQGXODV Ossos, rins e níveis de cálcio, estimula a absorção de cálcio
Paratireóides Paratireóideo (PTH) intestinos pelos rins e intestinos e estimula a excreção de
fosfato pelos rins

Didatismo e Conhecimento 96
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo

Diversos tecidos,
*OkQGXOD
Epinefrina (em pequena especialmente coração e Estimula na elevação dos níveis de glicose e
Supra-renal
TXDQWLGDGHDQRUH¿QHIULQD vasos sanguíneos participa da resposta ao estresse.
Medula

Auxiliam na regulação do metabolismo de


*OLFRFRUWLFyLGHV proteínas, carboidratos e gorduras, elevam os
Todos os tecidos
(cortisol) níveis de glicose no sangue e participam na
resposta ao estresse
*OkQGXOD
Estimulam os rins a reabsorver sódio
Supra-renal Rins
Mineralocorticóides e excretar potássio e auxiliam a regular o
Córtex
(aldolterona) equilíbrio hídrico e eletrolítico
Órgãos sexuais,
Estimula o desenvolvimento das
RVVRVP~VFXORVHSHOH
Hormônios sexuais características sexuais secundárias em homens
e mulheres
3kQFUHDV
)tJDGRP~VFXORVH
(Ilhotas *OXFDJRQ
tecido adiposo Eleva níveis de glicose no sangue
pancreáticas)
Células Alfa
3kQFUHDV
)tJDGRP~VFXORVH Regula o metabolismo de carboidratos,
(Ilhotas Insulina
tecido adiposo gorduras e proteínas e diminui os níveis de
pancreáticas)
glicose no sangue
Células Beta
Estrógenos e Órgãos sexuais, pele,
*{QDGDV Estimulam o desenvolvimento dos óvulos e
progesterona RVVRVHP~VFXORV
Ovários das características sexuais femininas

Andrógenos Órgãos sexuais, pele Estimulam o desenvolvimento dos


*{QDGDV
(testosterona) HP~VFXORV espermatozóides e das características sexuais
Testículos
masculinas

Timo Linfócitos T
Timosina Estimula a maturação dos linfócitos T

*OkQGXOD
Diversos tecidos Auxilia a ajustar o biorritmo e controla o
Pineal Melatonina
sono

LEGISLAÇÃO RELACIONADA AOS


ESPORTES.

Legislação do Esporte

LEI Nº 11.438, DE 29 DE DEZEMBRO DE 2006.

Dispõe sobre incentivos e benefícios para fomentar as atividades de caráter desportivo e dá outras providências.
O PRESIDENTE DA REPÚBLICA Faço saber que o Congresso Nacional decreta e eu sanciono a seguinte Lei:

CAPÍTULO I
DOS INCENTIVOS AO DESPORTO

$UWž$SDUWLUGRDQRFDOHQGiULRGHHDWpRDQRFDOHQGiULRGHLQFOXVLYHSRGHUmRVHUGHGX]LGRVGRLPSRVWRGHUHQGDGHYLGRapura-
do na Declaração de Ajuste Anual pelas pessoas físicas ou em cada período de apuração, trimestral ou anual, pela pessoa jurídica tributada com
base no lucro real os valores despendidos a título de patrocínio ou doação, no apoio direto a projetos desportivos e paradesportivos previamente
aprovados pelo Ministério do Esporte.

Didatismo e Conhecimento 97
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
† ž  $V GHGXo}HV GH TXH WUDWD R FDSXW GHVWH DUWLJR ¿FDP II - doação:
limitadas: D DWUDQVIHUrQFLDJUDWXLWDHPFDUiWHUGH¿QLWLYRDRSURSRQHQWH
,UHODWLYDPHQWHjSHVVRDMXUtGLFDD XPSRUFHQWR GRLP- de que trata o inciso V do caput deste artigo de numerário, bens ou
posto devido, observado o disposto no †žGR$UWžGD/HLQo serviços para a realização de projetos desportivos e paradesportivos,
GHGHGH]HPEURGH, em cada período de apuração; desde que não empregados em publicidade, ainda que para divulga-
,,UHODWLYDPHQWHjSHVVRDItVLFDD VHLVSRUFHQWR GRLP- ção das atividades objeto do respectivo projeto;
posto devido na Declaração de Ajuste Anual, conjuntamente com as b) a distribuição gratuita de ingressos para eventos de caráter
deduções de que trata o art. 22 da Lei noGHGHGH]HPEUR desportivo e paradesportivo por pessoa jurídica a empregados e seus
GH. dependentes legais ou a integrantes de comunidades de vulnerabili-
§ 2º As pessoas jurídicas não poderão deduzir os valores de dade social;
TXHWUDWDRFDSXWGHVWHDUWLJRSDUD¿QVGHGHWHUPLQDomRGROXFURUHDO III - patrocinador: a pessoa física ou jurídica, contribuinte do
e da base de cálculo da Contribuição Social sobre o Lucro Líquido imposto de renda, que apóie projetos aprovados pelo Ministério do
- CSLL. Esporte nos termos do inciso I do caput deste artigo;
† ž  2V EHQHItFLRV GH TXH WUDWD HVWH DUWLJR QmR H[FOXHP RX IV - doador: a pessoa física ou jurídica, contribuinte do imposto
UHGX]HPRXWURVEHQHItFLRV¿VFDLVHGHGXo}HVHPYLJRU de renda, que apóie projetos aprovados pelo Ministério do Esporte
†ž1mRVmRGHGXWtYHLVRVYDORUHVGHVWLQDGRVDSDWURFtQLRRX nos termos do inciso II do caput deste artigo;
GRDomRHPIDYRUGHSURMHWRVTXHEHQH¿FLHPGLUHWDRXLQGLUHWDPHQWH 9SURSRQHQWHDSHVVRDMXUtGLFDGHGLUHLWRS~EOLFRRXGHGL-
pessoa física ou jurídica vinculada ao doador ou patrocinador. UHLWRSULYDGRFRP¿QVQmRHFRQ{PLFRVGHQDWXUH]DHVSRUWLYDTXH
†ž&RQVLGHUDPVHYLQFXODGRVDRSDWURFLQDGRURXDRGRDGRU tenha projetos aprovados nos termos desta Lei.
I - a pessoa jurídica da qual o patrocinador ou o doador seja ti-
tular, administrador, gerente, acionista ou sócio, na data da operação $UWž$DYDOLDomRHDDSURYDomRGRHQTXDGUDPHQWRGRVSURMH-
RXQRV GR]H PHVHVDQWHULRUHV WRVDSUHVHQWDGRVQDIRUPDSUHYLVWDQR$UWžGHVWD/HLFDEHPDXPD
,,RF{QMXJHRVSDUHQWHVDWpRWHUFHLURJUDXLQFOXVLYHRVD¿QV Comissão Técnica vinculada ao Ministério do Esporte, garantindo-
e os dependentes do patrocinador, do doador ou dos titulares, ad- -se a participação de representantes governamentais, designados
ministradores, acionistas ou sócios de pessoa jurídica vinculada ao pelo Ministro do Esporte, e representantes do setor desportivo, indi-
patrocinador ou ao doador, nos termos do inciso I deste parágrafo; cados pelo Conselho Nacional de Esporte.
III - a pessoa jurídica coligada, controladora ou controlada, ou 3DUiJUDIR~QLFR$FRPSRVLomRDRUJDQL]DomRHRIXQFLRQD-
que tenha como titulares, administradores acionistas ou sócios algu- PHQWRGDFRPLVVmRVHUmRHVWLSXODGRVHGH¿QLGRVHPUHJXODPHQWR
ma das pessoas a que se refere o inciso II deste parágrafo.
Art. 2º Os projetos desportivos e paradesportivos, em cujo fa- $UWž2VSURMHWRVGHVSRUWLYRVHSDUDGHVSRUWLYRVGHTXHWUD-
vor serão captados e direcionados os recursos oriundos dos incenti- WD R$UW ž GHVWD /HL VHUmR VXEPHWLGRV DR 0LQLVWpULR GR (VSRUWH
vos previstos nesta Lei, atenderão a pelo menos uma das seguintes acompanhados da documentação estabelecida em regulamento e de
PDQLIHVWDo}HVQRVWHUPRVHFRQGLo}HVGH¿QLGDVHPUHJXODPHQWR orçamento analítico.
I - desporto educacional; †ž$DSURYDomRGRVSURMHWRVGHTXHWUDWDRFDSXWGHVWHDUWLJR
II - desporto de participação; VRPHQWH WHUi H¿FiFLD DSyV D SXEOLFDomR GH DWR R¿FLDO FRQWHQGR
III - desporto de rendimento. o título do projeto aprovado, a instituição responsável, o valor
† ž  3RGHUmR UHFHEHU RV UHFXUVRV RULXQGRV GRV LQFHQWLYRV autorizado para captação e o prazo de validade da autorização.
previstos nesta Lei os projetos desportivos destinados a promover § 2º Os projetos aprovados e executados com recursos desta
a inclusão social por meio do esporte, preferencialmente em Lei serão acompanhados e avaliados pelo Ministério do Esporte.
comunidades de vulnerabilidade social.
§ 2º É vedada a utilização dos recursos oriundos dos incentivos CAPÍTULO II
previstos nesta Lei para o pagamento de remuneração de atletas DISPOSIÇÕES GERAIS
SUR¿VVLRQDLVQRVWHUPRVGDLei noGHGHPDUoRGH,
em qualquer modalidade desportiva. $UW ž $ GLYXOJDomR GDV DWLYLGDGHV EHQV RX VHUYLoRV UHVXO-
†ž2SURSRQHQWHQmRSRGHUiFDSWDUSDUDFDGDSURMHWRHQWUH WDQWHV GRV SURMHWRV GHVSRUWLYRV H SDUDGHVSRUWLYRV ¿QDQFLDGRV QRV
patrocínio e doação, valor superior ao aprovado pelo Ministério do termos desta Lei mencionará o apoio institucional, com inserção da
Esporte, na forma do $UWžGHVWD/HL Bandeira Nacional, nos termos da Lei noGHo de setembro
GH.
$UWž3DUD¿QVGRGLVSRVWRQHVWD/HLFRQVLGHUDVH
I - patrocínio: $UWž$SUHVWDomRGHFRQWDVGRVSURMHWRVEHQH¿FLDGRVSHORV
D DWUDQVIHUrQFLDJUDWXLWDHPFDUiWHUGH¿QLWLYRDRSURSRQHQWH LQFHQWLYRV SUHYLVWRV QHVWD /HL ¿FD D FDUJR GR SURSRQHQWH H VHUi
de que trata o inciso V do caput deste artigo de numerário para a apresentada ao Ministério do Esporte, na forma estabelecida pelo
UHDOL]DomRGHSURMHWRVGHVSRUWLYRVHSDUDGHVSRUWLYRVFRP¿QDOLGDGH regulamento.
promocional e institucional de publicidade;
b) a cobertura de gastos ou a utilização de bens, móveis ou imó- $UWž20LQLVWpULRGR(VSRUWHLQIRUPDUij6HFUHWDULDGD5H-
veis, do patrocinador, sem transferência de domínio, para a realiza- FHLWD)HGHUDODWpR~OWLPRGLD~WLOGRPrVGHPDUoRRVYDORUHVFRU-
ção de projetos desportivos e paradesportivos pelo proponente de respondentes a doação ou patrocínio, destinados ao apoio direto a
que trata o inciso V do caput deste artigo; projetos desportivos e paradesportivos, no ano-calendário anterior.

Didatismo e Conhecimento 98
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
3DUiJUDIR~QLFR$VLQIRUPDo}HVGHTXHWUDWDHVWHDUWLJRVHUmR $UW%$GLYXOJDomRGDVDWLYLGDGHVEHQVRXVHUYLoRVUH-
prestadas na forma e condições a serem estabelecidas pela Secre- sultantes de projetos desportivos e paradesportivos, culturais e de
taria da Receita Federal. SURGXomR DXGLRYLVXDO H DUWtVWLFD ¿QDQFLDGRV FRP UHFXUVRV S~EOL-
cos mencionará o apoio institucional com a inserção da Bandeira
$UWž&RPSHWHj6HFUHWDULDGD5HFHLWD)HGHUDOQRkPELWRGH Nacional, nos termos da Lei noGHoGHVHWHPEURGH.
VXDVDWULEXLo}HVD¿VFDOL]DomRGRVLQFHQWLYRVSUHYLVWRVQHVWD/HL $UW&6HPSUHMXt]RGRGLVSRVWRQRDUWGD&RQVWLWXL-
ção Federal, os Ministérios da Cultura e do Esporte encaminharão
$UW&RQVWLWXHPLQIUDomRDRVGLVSRVLWLYRVGHVWD/HL ao Congresso Nacional relatórios detalhados acerca da destinação
I - o recebimento pelo patrocinador ou doador de qualquer e regular aplicação dos recursos provenientes das deduções e be-
YDQWDJHP¿QDQFHLUDRXPDWHULDOHPGHFRUUrQFLDGRSDWURFtQLRRX QHItFLRV¿VFDLVSUHYLVWRVQDV/HLVQosGHGHGH]HPEURGH
da doação que com base nela efetuar; HGHGHGH]HPEURGHSDUD¿QVGHDFRP-
II - agir o patrocinador, o doador ou o proponente com dolo, SDQKDPHQWRH¿VFDOL]DomRRUoDPHQWiULDGDVRSHUDo}HVUHDOL]DGDV
fraude ou simulação para utilizar incentivo nela previsto; $UW(VWD/HLHQWUDHPYLJRUQDGDWDGHVXDSXEOLFDomR
,,,GHVYLDUSDUD¿QDOLGDGHGLYHUVDGD¿[DGDQRVUHVSHFWLYRV %UDVtOLDGHGH]HPEURGHo da Independência
projetos dos recursos, bens, valores ou benefícios com base nela HoGD5HS~EOLFD
obtidos;
IV - adiar, antecipar ou cancelar, sem justa causa, atividade LUIZ INÁCIO LULA DA SILVA
GHVSRUWLYDEHQH¿FLDGDSHORVLQFHQWLYRVQHODSUHYLVWRV Orlando Silva de Jesus Júnior
V - o descumprimento de qualquer das suas disposições ou
das estabelecidas em sua regulamentação. - LEGISLAÇÃO ESTADUAL

$UW$VLQIUDo}HVDRVGLVSRVLWLYRVGHVWD/HLVHPSUHMXt]R LEI QUE CRIA O PRÓ-ESPORTE


das demais sanções cabíveis, sujeitarão: LEI Nº 9.365
I - o patrocinador ou o doador ao pagamento do imposto não
recolhido, além das penalidades e demais acréscimos previstos na Cria o Programa Estadual de Fomento e Incentivo ao Esporte
legislação; e Lazer e o Fundo de Incentivo ao Esporte e Lazer do Estado do
II - o infrator ao pagamento de multa correspondente a 2 Espírito Santo - PRÓ-ESPORTE e dá outras providências.
(duas) vezes o valor da vantagem auferida indevidamente, sem
prejuízo do disposto no inciso I do caput deste artigo. 2*29(51$'25'2(67$'2'2(63Ë5,726$172
3DUiJUDIR~QLFR2SURSRQHQWHpVROLGDULDPHQWHUHVSRQViYHO Faço saber que a Assembleia Legislativa decretou e eu sancio-
SRULQDGLPSOrQFLDRXLUUHJXODULGDGHYHUL¿FDGDTXDQWRDRGLVSRVWR no a seguinte Lei:
no inciso I do caput deste artigo.
$UW2VUHFXUVRVSURYHQLHQWHVGHGRDo}HVRXSDWURFtQLRV $UWž)LFDFULDGRR3URJUDPD(VWDGXDOGH)RPHQWRH,QFHQ-
HIHWXDGRVQRVWHUPRVGR$UWžGHVWD/HLVHUmRGHSRVLWDGRVHPR- tivo ao Esporte e Lazer no Estado do Espírito Santo, visando o
YLPHQWDGRVHPFRQWDEDQFiULDHVSHFt¿FDQR%DQFRGR%UDVLO6$ desenvolvimento e a promoção de práticas no campo do esporte,
ou na Caixa Econômica Federal, que tenha como titular o propo- lazer e atividade física, nas suas diversas dimensões.
nente do projeto aprovado pelo Ministério do Esporte.
3DUiJUDIR~QLFR  1mR VmR GHGXWtYHLVQRV WHUPRVGHVWD/HL Art. 2º O Programa Estadual de Fomento e Incentivo ao Es-
os valores em relação aos quais não se observe o disposto neste porte e Lazer no Estado do Espírito Santo será realizado pela Se-
artigo. cretaria de Estado de Esportes e Lazer - SESPORT, mediante ajus-
WHVFRPHQWLGDGHVS~EOLFDVHSULYDGDVFRPRVVHJXLQWHVSULQFtSLRV
$UW7RGRVRVUHFXUVRVXWLOL]DGRVQRDSRLRGLUHWRDSURMH- e objetivos:
tos desportivos e paradesportivos previstos nesta Lei deverão ser I - descentralização administrativa e apoio institucional às fe-
disponibilizados na rede mundial de computadores, de acordo com derações esportivas;
a Lei noGHGHGH]HPEURGH. II - promoção prioritária do desporto escolar;
3DUiJUDIR ~QLFR  2V UHFXUVRV D TXH VH UHIHUH R FDSXW GHVWH III - a prática e o desenvolvimento do esporte e do lazer entre
artigo ainda deverão ser disponibilizados, mensalmente, no sítio crianças, adolescentes e jovens em situação de risco pessoal e so-
do Ministério do Esporte, constando a sua origem e destinação. FLDOSHVVRDVFRPGH¿FLrQFLDHDLGDGH
IV - formação continuada, nas áreas do conhecimento, apli-
$UW$2YDORUPi[LPRGDVGHGXo}HVGHTXHWUDWDR$UW cadas ao esporte e lazer, de atletas, dirigentes, árbitros, técnicos,
žGHVWD/HLVHUi¿[DGRDQXDOPHQWHHPDWRGR3RGHU([HFXWLYR SUR¿VVLRQDLVGDiUHDGHHGXFDomRItVLFDHiUHDVD¿QV
com base em um percentual da renda tributável das pessoas físicas V - incremento do interesse da população pela prática habitual
e do imposto sobre a renda devido por pessoas jurídicas tributadas de esportes;
com base no lucro real. VI - construção, ampliação e recuperação de instalações es-
3DUiJUDIR ~QLFR  'R YDORU Pi[LPR D TXH VH UHIHUH R FDSXW portivas;
GHVWHDUWLJRR3RGHU([HFXWLYR¿[DUiRVOLPLWHVDVHUHPDSOLFDGRV VII - apoio a atletas de alto rendimento;
para cada uma das manifestações de que trata o Art. 2º desta Lei. VIII - ampliação do Projeto Campeões de Futuro.

Didatismo e Conhecimento 99
CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UWž)LFDFULDGRR)XQGRGH,QFHQWLYRDR(VSRUWHH/D]HUGR IV - os controles necessários à execução orçamentária do Fun-
Estado do Espírito Santo, doravante denominado PRÓ-ESPORTE, do;
que será regido pelas normas estabelecidas nesta Lei e pelo seu re- V - as prestações de contas ao grupo coordenador;
gulamento. VI - a forma de liquidação e a destinação a ser dada ao patrimô-
nio do Fundo na hipótese de sua liquidação ou extinção.
$UWž&RQVWLWXLUmRUHFXUVRVGR35Ï(63257(
I - dotação consignada no orçamento anual do Estado do Espí- $UWž&RPRyUJmRJHVWRUGR35Ï(63257(FRPSHWHj6(6-
rito Santo; PORT:
II - doações, auxílios e transferências de entidades nacionais, I - cumprir e zelar pelo cumprimento do Regulamento do Fun-
internacionais, governamentais e não governamentais; do;
,,,HPSUpVWLPRVHRXWUDVFRQWULEXLo}HV¿QDQFHLUDVGHHQWLGD- II - estabelecer normas e critérios gerais que devem ser atendi-
des nacionais e internacionais; dos pelos programas, projetos e ações passíveis de serem custeados
IV - recursos de transferências negociadas e não onerosas, junto com recursos do Fundo;
a organismos nacionais e internacionais de apoio e fomento; ,,,RUJDQL]DURFURQRJUDPD¿QDQFHLURGHUHFHLWDHGHVSHVDGR
V - recursos oriundos da amortização, correção, juros e multas Fundo e acompanhar sua execução;
GRV¿QDQFLDPHQWRVHIHWXDGRVSHORSUySULR)XQGR IV - conduzir o processo de seleção dos projetos inscritos nos
VI - recursos patrimoniais; editais de incentivo ao esporte;
VII - outros recursos, créditos e rendas adicionais ou extraordi- V - apreciar e deliberar sobre a criação e condições operacio-
nárias que, por sua natureza, lhe possam ser destinadas. QDLVGHOLQKDVGH¿QDQFLDPHQWR
VI - analisar e decidir sobre o mérito de projetos que busquem
$UWž2VUHFXUVRVGR35Ï(63257(VHUmRDSOLFDGRVHPFRQ- ¿QDQFLDPHQWRV GLVSRQLELOL]DGRV FRP UHFXUVRV GR )XQGR MXQWR DR
VRQkQFLDFRPRGLVSRVWRQRDUWLJRžGHVWD/HLHFRPRVSULQFtSLRV DJHQWH¿QDQFHLURUHFRPHQGDQGRRVRXQmR
da preservação da integridade patrimonial do Fundo e da maximiza- VII - acompanhar e avaliar, por meio de relatórios periódicos,
ção dos resultados e da cooperação sob os aspectos esportivo, social, DVRSHUDo}HVGH¿QDQFLDPHQWRFRPULVFRRSHUDFLRQDOGDLQVWLWXLomR
DPELHQWDOHHFRQ{PLFRWHQGRDLQGDDVVHJXLQWHV¿QDOLGDGHV ¿QDQFHLUD
I - o treinamento e a participação de atletas e equipes esportivas VIII - responsabilizar-se pelo acompanhamento do cronograma
em competições; físico dos projetos que receberam recursos do Fundo, exceto para a
II - a criação de prêmios, inclusive em espécie, para reconheci- PRGDOLGDGH UHHPEROViYHO FRP ULVFR GD LQVWLWXLomR ¿QDQFHLUD TXH
mento de boas práticas do esporte e do lazer no Estado; será responsável pelo procedimento;
III - a concessão de Bolsa-Atleta destinada a atletas praticantes IX - deliberar sobre a elaboração dos editais;
do desporto de rendimento, em todas as suas formas de expressão. X - editar instruções normativas e resolutivas;
XI - avaliar e aprovar a criação de subcontas para melhor con-
$UWž1DDSOLFDomRGRVUHFXUVRVGR35Ï(63257(D6(6- trole e acompanhamento dos recursos do Fundo;
3257REVHUYDGRVRVSUD]RVGH¿QLGRVHPUHJXODPHQWRSXEOLFDUi XII - outras ações e iniciativas que lhe sejam cometidas pelo
anualmente, um ou mais editais de incentivo ao esporte e ao lazer, Regulamento do Fundo.
FXMRVEHQH¿FLiULRVVHUmRDVSHVVRDVItVLFDVHMXUtGLFDVGHGLUHLWRSUL-
YDGRFRPRXVHP¿QVOXFUDWLYRVGHFDUiWHUHVWULWDPHQWHHVSRUWLYR $UW  2 yUJmR FRQVXOWLYR GR 35Ï(63257( p R *UXSR
†ž6HUmRGH¿QLGRVSHORVHGLWDLVGHLQFHQWLYRDRHVSRUWH Coordenador, a quem competirá:
I - os requisitos e as condições de inscrição de projetos candida- I - estabelecer as diretrizes e as prioridades para a aplicação dos
WRVjREWHQomRGHDSRLR¿QDQFHLURGR)XQGR recursos do Fundo;
II - as hipóteses de vedação à participação no processo seletivo; II - orientar e aprovar a captação e a aplicação dos recursos do
III - os critérios para a seleção e a aprovação dos projetos ins- Fundo;
critos; III - propor normas e procedimentos visando à melhoria opera-
,9RXWUDVGHWHUPLQDo}HVTXHVH¿]HUHPQHFHVViULDV cional do Fundo;
§ 2º A SESPORT designará, na forma do regulamento, um ou IV - acompanhar e propor , quando necessário, ajustes na regu-
mais especialistas de notório saber da sociedade civil para atuação lamentação do Fundo;
nos processos de análise, seleção e julgamento de mérito dos projetos V - analisar as propostas de programação orçamentárias anuais
inscritos, no termos dos editais de incentivo ao esporte. do Fundo;
VI - acompanhar a aplicação dos recursos do Fundo;
$UWž2VUHFXUVRVGR)XQGRVHUmRDSOLFDGRVPHGLDQWHSUHPLD- VII - avaliar as atividades desenvolvidas e os resultados obtidos
ção, acordos, contratos, termos de compromisso, convênios, ajustes, com a aplicação dos recursos do Fundo, consubstanciados em rela-
protocolos e patrocínios. tórios, no que concerne ao cumprimento das diretrizes e prioridades
estabelecidas.
$UWž235Ï(63257(VHUiDGPLQLVWUDGRSHOD6(63257D
TXHPFRPSHWHHODERUDUR5HJXODPHQWRGHVWD/HLQRSUD]RGHDWp $UW&RPS}HR*UXSR&RRUGHQDGRUGR35Ï(63257(XP
(noventa) dias, contados de sua publicação, no qual se disciplinará, integrante de cada um dos seguintes órgãos e entidade:
dentre outras, as seguintes matérias: I - Secretaria de Estado de Esportes e Lazer, que o presidirá;
I - a elaboração do Plano de Aplicações do Fundo; II - Secretaria de Estado de Economia e Planejamento;
II - as modalidades de aplicação dos recursos do Fundo; III - Secretaria de Estado da Fazenda;
III - as demonstrações de receita e despesas; IV - Conselho Estadual de Esportes e Lazer.

Didatismo e Conhecimento 100


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW235Ï(63257(WHUiHVFULWXUDomRFRQWiELOSUySULD †ž)LFDPWUDQVIHULGRVHUHQRPHDGRVRVFDUJRVGHSURYLPHQWR
¿FDQGRDDSOLFDomRGHVHXVUHFXUVRVVXMHLWDjSUHVWDomRGHFRQWDVDR em comissão da SEDU para a SESPORT, constantes no Anexo I,
Tribunal de Contas do Estado do Espírito Santo, nos prazos previs- que integra a presente Lei Complementar.
tos na legislação pertinente. § 2º Fica transferida para a SESPORT a localização dos
VHUYLGRUHVS~EOLFRVTXHGHVHPSHQKDYDPVXDVIXQo}HVQDVXQLGDGHV
$UW2VUHFXUVRVGHVWLQDGRVDR)XQGRQmRXWLOL]DGRVDWpR organizacionais extintas, de que trata o “caput” deste artigo e seus
¿QDOGRH[HUFtFLRDSXUDGRVQREDODQoRDQXDOVHUmRWUDQVIHULGRVD incisos.
crédito do mesmo Fundo no exercício seguinte. † ž )LFDP WUDQVIHULGRV SDUD D 6(63257 R DFHUYR GH EHQV
$UW2VUHFXUVRVGR)XQGRVHUmRGHSRVLWDGRVHPLQVWLWXLomR móveis, imóveis, os programas e projetos, materiais de consumo,
¿QDQFHLUDR¿FLDO os equipamentos, as máquinas e instalações das unidades
$UW$VGHVSHVDVGHFRUUHQWHVGDLPSODQWDomRGR)XQGRGH organizacionais extintas, de que trata o “caput” deste artigo e seus
Incentivo ao Esporte e Lazer do Estado do Espírito Santo correrão incisos.
por conta de recursos orçamentários da SESPORT.
$UWž$6HFUHWDULDGH(VWDGRGD(GXFDomRH(VSRUWHV6('8
$UW)LFDR3RGHU([HFXWLYRDXWRUL]DGRDDEULURVFUpGLWRV passa a denominar-se Secretaria de Estado da Educação - SEDU.
adicionais necessários ao cumprimento desta Lei.
$UWž)LFDFULDGRHLQFOXtGRQDHVWUXWXUDRUJDQL]DFLRQDOEiVLFD
$UW)LFDPDXWRUL]DGDVDVDOWHUDo}HVQR33$SDUDRTXDGULr- da SESPORT, em nível de direção superior, o Conselho Estadual de
QLRQHFHVViULDVDRFXPSULPHQWRGHVWD/HL Esportes e Lazer - CEEL, órgão colegiado, de caráter consultivo e
normativo.
$UW(VWD/HLVHUiUHJXODPHQWDGDQRSUD]RGHDWp QRYHQ-
ta) dias a contar da data de sua vigência. $UWž6mRDWULEXLo}HVGR&((/
I - manifestar-se sobre matéria relacionada com o esporte e la-
$UW(VWD/HLHQWUDHPYLJRUDSDUWLUGHž zer;
II - interpretar a legislação desportiva nacional e estadual, ela-
3DOiFLR$QFKLHWDHP9LWyULDGH'H]HPEURGH
borar instruções normativas sobre a sua aplicação e zelar pelo seu
3$8/2&(6$5+$5781**20(6
cumprimento;
*RYHUQDGRUGR(VWDGR
III - homologar os planos e programas estaduais de incentivo
ao esporte e lazer;
,9DFRPSDQKDUDDSOLFDomRGRVUHFXUVRVPDWHULDLVH¿QDQFHL-
LEI COMPLEMENTAR Nº 322
ros do Estado, destinados às atividades esportivas e de lazer;
O GOVERNADOR DO ESTADO DO ESPÍRITO SANTO
V - desenvolver outras atividades relacionadas com o desporto
Cria a Secretaria de Estado de Esportes e Lazer SES- e o lazer.
PORT e dá outras providências.
Faço saber que a Assembléia Legislativa decretou e eu sanciono $UWž2&((/VHUiFRQVWLWXtGRGH RQ]H PHPEURVUHSUH-
a seguinte Lei: sentativos dos setores e entidades a seguir:
I - o Secretário de Estado de Esportes e Lazer, seu Presidente e
$UW ž )LFD FULDGD H LQFOXtGD QD HVWUXWXUD RUJDQL]DFLRQDO Ei- membro nato;
VLFDGR3RGHU([HFXWLYR(VWDGXDOQRVWHUPRVGD/HLQžGH ,, WUrV UHSUHVHQWDQWHVHVFROKLGRVGHQWUHSHVVRDVGHQRWy-
D6HFUHWDULDGH(VWDGRGH(VSRUWHVH/D]HU6(63257 ria e reconhecida capacidade e experiência em assuntos desportivos,
yUJmRGHž SULPHLUR HVFDOmRKLHUiUTXLFR indicados pelo Secretário da Pasta;
,,, GRLV UHSUHVHQWDQWHVGDVIHGHUDo}HVLQWHJUDQWHVGRVLV-
$UWž$6(63257pGHQDWXUH]DVXEVWDQWLYDHWHPSRU¿QD- tema desportivo nacional, com atuação regular no Estado;
lidade formular a política estadual voltada ao desenvolvimento do ,9 XP UHSUHVHQWDQWHGR&RQVHOKR5HJLRQDOGH(GXFDomR
HVSRUWHHGROD]HUPDQWHULQWHUFkPELRFRPRUJDQLVPRVS~EOLFRVH Física;
privados, nacionais e internacionais, voltados à promoção do espor- 9   XP  UHSUHVHQWDQWH GD LPSUHQVD HVSRUWLYD GR (VStULWR
WHHOD]HUHVWLPXODUDVLQLFLDWLYDVS~EOLFDVHSULYDGDVQRGHVHQYROYL- Santo;
mento das atividades esportivas e de lazer; planejar, coordenar, su- 9, XP UHSUHVHQWDQWHGR&ROpJLR%UDVLOHLURGH&LrQFLDV
pervisionar e avaliar os planos e programas de incentivo ao esporte do Esporte - CBCE;
e lazer e as ações de democratização da prática esportiva. 9,, XP UHSUHVHQWDQWHGDVHQWLGDGHVGDVSHVVRDVSRUWDGR-
ras de necessidades especiais;
$UWž$VDWLYLGDGHVGDiUHDGHHVSRUWHVGD6HFUHWDULDGH(VWDGR 9,,, XP UHSUHVHQWDQWHGDVHVFRODVGHHQVLQRVXSHULRUGH
GD(GXFDomRH(VSRUWHV6('8¿FDPWUDQVIHULGDVSDUDD6(63257 educação física do Espírito Santo;
,;   XP  UHSUHVHQWDQWH GD$VVRFLDomR GDV )HGHUDo}HV GH
$UW ž )LFDP H[WLQWDV QD HVWUXWXUD RUJDQL]DFLRQDO EiVLFD GD Esporte Amador.
SEDU, as seguintes unidades organizacionais: †ž$RUJDQL]DomRHRIXQFLRQDPHQWRGR&((/VHUmRGH¿QLGRV
I - Subsecretaria de Estado de Esportes; no seu regimento interno.
II - Coordenação de Esportes Comunitário; § 2º Os membros do CEEL serão indicados ao Secretário de
III - Coordenação de Esportes Competição. Estado de Esportes e Lazer e por ele designados.

Didatismo e Conhecimento 101


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UWž$HVWUXWXUDRUJDQL]DFLRQDOEiVLFDGD6(63257pDVH- $UW¬*HUrQFLD7pFQLFD$GPLQLVWUDWLYDFRPSHWHGDUVX-
guinte: porte técnico-administrativo para planejar e gerenciar as ativida-
I - nível de direção superior: des GHDGPLQLVWUDomRJHUDOUHFXUVRVKXPDQRVRUoDPHQWRH¿QDQoDV
a) a posição do Secretário de Estado de Esportes e Lazer; HLQIUDHVWUXWXUDItVLFDGDViUHDVHVSRUWLYDVQRkPELWRGHDEUDQJrQ-
b) o CEEL; cia da Secretaria; outras atividades correlatas.
II - nível de assessoramento:
D R*DELQHWHGR6HFUHWiULR $UW  ¬ *HUrQFLD GH (VSRUWH GH )RUPDomR H 5HQGLPHQWR
b) a Assessoria Técnica; compete formular políticas esportivas e de lazer de caráter competi-
III - nível de gerência: tivo; coordenar e elaborar plano estadual de esportes e lazer; elabo-
a) a posição do Subsecretário de Estado de Esportes e Lazer; rar o plano plurianual de ações; elaborar as diretrizes e prioridades
IV - nível de atuação instrumental: de formação e rendimento esportivos; elaborar projetos de capaci-
D *UXSRGH$GPLQLVWUDomRH5HFXUVRV+XPDQRV WDomRGHUHFXUVRV¿QDQFHLURVFRRUGHQDUDHODERUDomRGDSURSRVWD
E *UXSRGH3ODQHMDPHQWRH2UoDPHQWR RUoDPHQWiULDDQXDOHPDUWLFXODomRFRPR*UXSRGH3ODQHMDPHQWRH
F *UXSR)LQDQFHLUR6HWRULDO 2UoDPHQWRSURJUDPDURRUoDPHQWRHPFRQVRQkQFLDFRPDGLVSRQL-
ELOLGDGH¿QDQFHLUDDFRPSDQKDUHFRQWURODUDDSOLFDomRGRVUHFXUVRV
V - nível de execução programática:
vinculados ao esporte e lazer; outras atividades correlatas.
D *HUrQFLD7pFQLFD$GPLQLVWUDWLYD
6XEJHUrQFLDGH,QIUD(VWUXWXUD)tVLFD
$UW¬*HUrQFLDGH(VSRUWHH/D]HUFRPSHWHIRUPXODUSROt-
6XEJHUrQFLDGH*HVWmR&RPSDUWLOKDGD
ticas esportivas e de lazer, tendo o esporte como qualidade de vida,
E *HUrQFLDGH(VSRUWHGH)RUPDomRH5HQGLPHQWR VD~GHHEHPHVWDUItVLFRHSVLFROyJLFRFRRUGHQDUHHODERUDUSODQR
6XEJHUrQFLDGH)RUPDomRH5HQGLPHQWR estadual de esporte e lazer; elaborar o plano plurianual de ações;
2. Subgerência de Eventos; elaborar as diretrizes e prioridades; elaborar projetos de captação
F *HUrQFLDGH(VSRUWHH/D]HU GHUHFXUVRV¿QDQFHLURVHPDUWLFXODomRFRP*UXSRGH3ODQHMDPHQ-
6XEJHUrQFLDGH(VSRUWHH/D]HUGD,GDGHHSRUWDGRUHVGH WRH2UoDPHQWRHPFRQVRQkQFLDFRPDGLVSRQLELOLGDGH¿QDQFHLUD
necessidades especiais; acompanhar e controlar a aplicação dos recursos vinculados ao es-
2. Subgerência de Eventos de Esporte Social e Comunitário; porte e lazer; outras atividades correlatas.
G *HUrQFLDGH(VSRUWH(GXFDFLRQDOH&RPXQLWiULR
6XEJHUrQFLDGH(VSRUWHGH&RPSHWLomR $UW  ¬ *HUrQFLD GH (VSRUWH (GXFDFLRQDO H &RPXQLWiULR
2. Subgerência de Esporte Educacional e Lazer. FRPSHWHIRUPXODUSROtWLFDVS~EOLFDVHVSRUWLYDVHGXFDFLRQDOHFRPX-
3DUiJUDIR~QLFR$UHSUHVHQWDomRJUi¿FDGDHVWUXWXUDRUJDQL- nitária como instrumento de inserção social e complemento a ativi-
zacional básica da SESPORT é a constante do Anexo II, que inte- GDGHHVFRODUHPFRQVRQkQFLDFRPDVGLUHWUL]HVHDo}HVHVWDEHOHFLGDV
gra a presente Lei Complementar. SHOR*RYHUQRHODERUDURSODQRSOXULDQXDOGHDo}HVHODERUDUGLUH-
trizes e prioridades para a Lei de Diretrizes Orçamentárias; elaborar
$UW  $V DWULEXLo}HV GR 6HFUHWiULR GH (VWDGR GR 6XEVH- SURMHWRVGHFDSWDomRGHUHFXUVRV¿QDQFHLURVFRRUGHQDUDHODERUDomR
FUHWiULRGH(VWDGRGR*DELQHWHGR6HFUHWiULRGRV*UXSRVGH$G- GDSURSRVWDRUoDPHQWiULDDQXDOHPDUWLFXODomRFRPR*UXSRGH
ministração, Recursos Humanos, Financeiro e de Planejamento e Planejamento e Orçamento; programar o orçamento em conso-
2UoDPHQWRVmRDVFRQWLGDVQRVDUWLJRVH QkQFLD FRP D GLVSRQLELOLGDGH ¿QDQFHLUD DFRPSDQKDU H FRQWURODU
GD/HLQž a aplicação dos recursos vinculados ao esporte e lazer; elaborar os
projetos e atividades em todas as manifestações e formas; incentivar
$UW  ¬ $VVHVVRULD 7pFQLFD FRPSHWH DVVHVVRUDU WHFQLFD- a efetiva participação da comunidade na elaboração de planos e pro-
mente o Secretário da Pasta e as demais unidades administrativas postas esportivas; outras atividades correlatas.
da Secretaria, sob a forma de estudos, projetos, pareceres, pesqui-
sas, exposição de motivos, análises, redação e interpretação de $UW¬6XEJHUrQFLDGH,QIUD(VWUXWXUD)tVLFDFRPSHWHHOD-
ERUDUDVHVSHFL¿FDo}HVWpFQLFDVSDUDPRELOLiULRHHTXLSDPHQWRVGDV
WH[WRVOHJDLVHQRUPDWLYRVDUWLFXODUVHFRPD3URFXUDGRULD*HUDO
quadras esportivas e áreas de lazer; desenvolver levantamentos para
GR(VWDGR3*(YLVDQGRjVROXomRKRPRJrQHDGRVSUREOHPDVGH
LGHQWL¿FDomRGDVQHFHVVLGDGHVGDViUHDVGHHVSRUWHHOD]HUGRVPX-
ordem legal; outras atividades correlatas.
nicípios; planejar, organizar, coordenar e acompanhar as atividades
UHODFLRQDGDVDRVVHUYLoRVGHREUDVQRkPELWRGD6HFUHWDULDRFHQWUR
$UW¬6XEVHFUHWDULDGH(VWDGRGH(VSRUWHVH/D]HUFRP- GH WUHLQDPHQWR DGPLQLVWUDU HVSDoRV ItVLFRV GRV JUi¿FRV TXDGUDV
SHWHIRUPXODULPSOHPHQWDUHH[HFXWDUDVDo}HVSROtWLFDVS~EOLFDV polivalentes, pistas, piscinas e áreas de lazer; outras atividades cor-
de esportes e lazer, de modo a assegurar as práticas formais e não relatas.
formais como direito de cada um nas suas modalidades diferentes,
em articulação com os municípios; integrar as ações esportivas e $UW¬6XEJHUrQFLDGH*HVWmR&RPSDUWLOKDGDFRPSHWHGH-
GHOD]HUFRPDVDo}HVGHyUJmRVJRYHUQDPHQWDLVHPiUHDVD¿QV VHQYROYHUSDUFHULDVYLVDQGRjFRRSHUDomRP~WXDHDFRQFHQWUDomR
SURPRYHURHVSRUWHSUR¿VVLRQDOHPDUWLFXODomRFRPRVLVWHPDIH- GHHVSDoRVFRPXWLOLGDGHVS~EOLFDVSULYDGDVHRUJDQL]Do}HVQmRJR-
deral e setor privado; desenvolver políticas de formação contínua vernamentais nas áreas de transportes, alimentação de atletas e alo-
e de utilização esportiva; promover a organização das ações dos jamentos, material esportivo, dentre outros; integrar ações de coope-
órgãos estaduais e municipais voltadas para o desporto; outras ati- ração entre Estado e municípios para a ampliação de oportunidades,
vidades correlatas. melhoria e qualidades desportivas; outras atividades correlatas.

Didatismo e Conhecimento 102


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW  ¬ 6XEJHUrQFLD GH )RUPDomR H 5HQGLPHQWR FRPSHWH $UW)LFDFULDGRRFDUJRGH6HFUHWiULRGH(VWDGRGH(VSRUWHV
promover a capacitação de técnicos e árbitros com formação em e Lazer, sem referência.
esportes de alto rendimento; realizar as competições previstas nos
FDOHQGiULRV R¿FLDLV GDV HQWLGDGHV HVSRUWLYDV SURPRYHU R GHVHQ- $UW)LFDFULDGR XP FDUJRGHSURYLPHQWRHPFRPLVVmR
volvimento do esporte de base e de alto rendimento para atletas; GH&KHIHGH*UXSR)LQDQFHLUR6HWRULDOUHI4&LQWHJUDQWHGDHV-
FRRUGHQDUHDFRPSDQKDUDVDWLYLGDGHVGHFRQWUROHH¿VFDOL]DomRGRV trutura organizacional da Secretaria de Estado da Fazenda - SEFAZ,
FRQYrQLRV ¿UPDGRV GHVHQYROYHU HVWXGRV H DQiOLVHV VREUH SOHLWRV FRPDWXDomRQRkPELWRGD6(63257
programas, projetos e ações, em sua área; outras atividades corre-
latas. $UW)LFDPFULDGRVRVFDUJRVGHSURYLPHQWRHPFRPLVVmR
com suas nomenclaturas, quantitativos, referências e valores, para
$UW¬6XEJHUrQFLDGH(YHQWRVFRPSHWHFRRUGHQDUDVDo}HV atender às necessidades de funcionamento da SESPORT, constantes
dos centros esportivos visando à realização de estudos e pesquisas no Anexo III, que integra a presente Lei Complementar.
com vistas ao desenvolvimento do esporte; planejar, coordenar,
acompanhar e apoiar a realização de eventos estadual e municipal; $UW)LFDH[WLQWRR&RQVHOKR5HJLRQDOGH'HVSRUWRFULDGR
outras atividades correlatas. SHOD/HL'HOHJDGDQžGH

$UW¬6XEJHUrQFLDGH(VSRUWHH/D]HUGD,GDGHHSRU- $UW  )LFD R 3RGHU ([HFXWLYR DXWRUL]DGR D WUDQVIHULU GD


tadores de necessidades especiais compete incentivar o idoso e os SEDU para a SESPORT, por meio de créditos adicionais, os saldos
portadores de necessidades especiais a desenvolver atividades es- orçamentários das ações desenvolvidas pela Coordenação de Espor-
portivas e de lazer; pesquisar e elaborar projetos que congreguem tes Competição e pela Coordenação de Esportes Comunitário, bem
estes seguimentos esportivos; incentivar e criar programas de espor- como às de manutenção da Subsecretaria de Estado de Esportes e
te e lazer e atividades físicas que proporcionem melhor qualidade de aquelas relativas a pessoal e encargos sociais necessários ao cumpri-
vida e hábitos que estimulem a participação comunitária; desenvol- mento desta Lei Complementar.
ver projetos de acesso aos locais de desenvolvimento de atividades
de esporte e lazer; outras atividades correlatas. $UW)LFDR3RGHU([HFXWLYRDXWRUL]DGRDSURPRYHUDVDOWH-
UDo}HVQR3ODQR3OXULDQXDOSDUDRTXDGULrQLRQHFHVVi-
Art. 22. À Subgerência de Eventos de Esporte Social e Co- rias ao cumprimento desta Lei Complementar.
munitário compete planejar e promover ações voltadas à políticas
HVSRUWLYDVQRkPELWRFRPXQLWiULRHODERUDUH[HFXWDUVXSHUYLVLRQDU $UW  )LFD R 3RGHU ([HFXWLYR DXWRUL]DGR D UHJXODPHQWDU D
e controlar os calendários e programações de projetos desportivos SUHVHQWH/HL&RPSOHPHQWDUQRSUD]RGH QRYHQWD GLDVDFRQWDU
comunitários e acompanhar os eventos realizados no Estado; asses- da data de sua publicação.
sorar tecnicamente a realização de eventos promovidos por asso-
ciações, prefeituras ou grupos comunitários; elaborar propostas de $UW(VWD/HL&RPSOHPHQWDUHQWUDHPYLJRUQDGDWDGHVXD
ações que permitam a formação nas diversas modalidades desporti- publicação.
vas da população em geral, principalmente, em nível regional e/ou 3DOiFLRGD)RQWH*UDQGHHP9LWyULDHPGHPDLRGH
municipal; outras atividades correlatas.
3$8/2&(6$5+$5781**20(6
$UW  ¬ 6XEJHUrQFLD GH (VSRUWH GH &RPSHWLomR FRPSHWH *RYHUQDGRUGR(VWDGR
planejar, orientar e coordenar as atividades de caráter amadorista e
HVWXGDQWLODSRLDUUHDOL]Do}HVDPDGRULVWDHSUR¿VVLRQDOSURPRYLGDV
por federações desportivas, prestando-lhes a devida orientação téc- LEI Nº 8 641
nica; realizar estudos, pesquisas e levantar dados que informem a
VLWXDomRGRGHVSRUWRDPDGRUHSUR¿VVLRQDOHPWRGDVDViUHDVPXQL- Institui o Programa Estadual de Incentivo à Realização de
cipal, estadual e federal; organizar e promover cursos de arbitragem Competições Esportivas no Estado do Espírito Santo.
e atualização técnica nas diversas modalidades desportivas em ação
conjunta com as federações; outras atividades correlatas. O GOVERNADOR DO ESTADO DO ESPÍRITO SANTO

$UW¬6XEJHUrQFLDGH(VSRUWH(GXFDFLRQDOH/D]HUFRP- Faço saber que a Assembléia Legislativa decretou e eu sanciono


pete coordenar e implementar as políticas relativas ao esporte edu- a seguinte Lei:
cacional e lazer; planejar e coordenar projetos, ações, capacitação
de recursos humanos destinados ao esporte escolar; coordenar e $UWž)LFDLQVWLWXtGRQR(VWDGRGR(VStULWR6DQWRR3URJUDPD
DFRPSDQKDUDVDWLYLGDGHVHVSRUWLYDVHGHOD]HUFRQWURODUH¿VFDOL]DU Estadual de Incentivo à Realização de Competições Esportivas de
RV FRQYrQLRV ¿UPDGRV UHDOL]DU HVWXGRV H SHVTXLVDV FRP YLVWD DR kPELWRPXQLFLSDOHVWDGXDOQDFLRQDOHLQWHUQDFLRQDO
desenvolvimento de esporte escolar; planejar, coordenar e avaliar 3DUiJUDIR~QLFR)LFDPLQFOXtGDVQR3URJUDPDDVFRPSHWLo}HV
ações voltadas à proteção, ao resgate e ao incentivo de esporte esco- paradesportivas.
lar; outras atividades correlatas.
$UWž23URJUDPDGHTXHWUDWDRDUWLJRžWHUiFRPRREMHWLYRV
$UW  2 FDUJR GH 6HFUHWiULR GH (VWDGR GD (GXFDomR H (V- EXVFDU DSRLR ¿QDQFHLUR PpGLFR H WpFQLFR H DVVHJXUDU ORFDO FRP
portes, sem referência, passa a intitular-se Secretário de Estado da a devida estrutura de segurança, para a realização de competições
Educação, sem referência. esportivas no Estado.

Didatismo e Conhecimento 103


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
$UW ž 6y SRGHUmR UHFHEHU R DSRLR GR 3URJUDPD DV FRPSH- Art. 2º Poderão, também, pleitear a concessão da Bolsa os
WLo}HV R¿FLDLV UHDOL]DGDV SHODV IHGHUDo}HV HVSRUWLYDV HVWDGXDLV RX atletas de reconhecido destaque, de modalidades não olímpicas ou
pelas confederações esportivas brasileiras, mediante apresentação não paraolímpicas que não sejam vinculadas ao COI ou ao Comitê
GH3URMHWR2¿FLDO'HVFULWLYRGHWRGDHVWUXWXUDGDFRPSHWLomRRQGH Paraolímpico, mediante indicação dos dirigentes das entidades dos
deverá constar o levantamento do custo da mesma, comprovado por respectivos esportes, referendado por histórico de resultados e situa-
orçamento de empresa legalmente constituída e hábil a prestar o ser- ção no “ranking” estadual, nacional e/ou internacional da respectiva
viço e, ainda, apresentação de plano de aplicação dos recursos. modalidade.

3DUiJUDIR~QLFR$VHQWLGDGHVUHIHULGDVQR³FDSXW´GHVWHDUWLJR $UWž&DEHDR&RQVHOKR(VWDGXDOGH(VSRUWHVH/D]HUSHULR-
para efeito de recebimento do apoio do Programa, só poderão reali- GLFDPHQWH UDWL¿FDU RX VXVSHQGHU R EHQHItFLR PHQVDO FRQFHGLGR
zar atividades previstas no seu Estatuto. diante do recebimento de relatórios encaminhados pelas federações
correspondentes, atestando resultados e dedicação de seus atletas
$UWž23RGHU([HFXWLYRSRGHUiLPSOHPHQWDUR3URJUDPD(V- EHQH¿FLiULRV
tadual de Incentivo à Realização de Competições Esportivas, atra-
vés do seu órgão competente, facultando-lhe, ainda, a realização de $UWž$%ROVD$WOHWD&DSL[DEDVHUiFRQFHGLGDSHORSUD]RGH
FRQYrQLRV FRP DV DGPLQLVWUDo}HV S~EOLFDV PXQLFLSDLV H SDUFHULDV XP XP DQRFRQ¿JXUDQGR GR]H UHFHELPHQWRVPHQVDLVSRGHQ-
com a iniciativa privada, para que os objetivos contidos no artigo 2º do ser renovada por iguais períodos.
desta Lei sejam alcançados.
$UWž$FRQFHVVmRGD%ROVD$WOHWD&DSL[DEDQmRJHUDTXDO-
3DUiJUDIR~QLFR9(7$'2 TXHUYtQFXORHQWUHRVDWOHWDVEHQH¿FLDGRVHDDGPLQLVWUDomRS~EOLFD
estadual.
$UW ž 2 FULWpULR SDUD DV FRPSHWLo}HV UHFHEHUHP R DSRLR GR
Programa deverá ser o da alternatividade das modalidades esporti- $UWž$VGHVSHVDVGHFRUUHQWHVGDFRQFHVVmRGD%ROVD$WOHWD
vas e o retorno que as mesmas trarão para o Estado sob o aspecto Capixaba correrão por conta dos recursos orçamentários da Secreta-
turístico, social e econômico. ria de Estado de Esportes e Lazer.

$UWž$VGHVSHVDVGHFRUUHQWHVGDDSOLFDomRGHVWD/HLFRUUHUmR $UWž2VDWOHWDVEHQH¿FLDGRVSUHVWDUmRFRQWDGRVUHFXUVRV¿-
por conta de dotações orçamentárias próprias, que serão suplemen- QDQFHLURVUHFHELGRVQDIRUPDHQRVSUD]RV¿[DGRVHPUHJXODPHQWR
tadas se necessário.
$UW ž )LFD R 3RGHU ([HFXWLYR DXWRUL]DGR D DEULU RV FUpGLWRV
$UWž9(7$'2 adicionais necessários ao cumprimento desta Lei.

$UWž(VWD/HLHQWUDHPYLJRUQDGDWDGHVXDSXEOLFDomR $UWž)LFDPDXWRUL]DGDVDVDOWHUDo}HVQR33$SDUDRTXDGULr-
QLRQHFHVViULDVDRFXPSULPHQWRGHVWD/HL
3DOiFLRGD)RQWH*UDQGHHP9LWyULDGHRXWXEURGH
3$8/2&(6$5+$5781**20(6 $UW(VWD/HLVHUiUHJXODPHQWDGDQRSUD]RGHDWp QRYHQ-
*RYHUQDGRUGR(VWDGR ta) dias a contar da data de sua vigência.

LEI QUE CRIA O BOLSA-ATLETA CAPIXABA $UW(VWD/HLHQWUDHPYLJRUDSDUWLUGHž


LEI Nº 9.366
3DOiFLR$QFKLHWDHP9LWyULDGH'H]HPEURGH
Institui o Programa Bolsa-Atleta Capixaba e dá outras provi-
dências. 3$8/2&(6$5+$5781**20(6
2*29(51$'25'2(67$'2'2(63Ë5,726$172 *RYHUQDGRUGR(VWDGR
Faço saber que a Assembléia Legislativa decretou e eu sanciono
a seguinte Lei: TRANSFORMAÇÃO DO ESPORTE EM ESPETÁCULO E
EM NEGÓCIO.
$UWž)LFDFULDGRR3URJUDPD%ROVD$WOHWD&DSL[DEDGHVWLQD-
do a atletas praticantes do desporto de rendimento em modalidades Na realidade empresarial, institucional e social brasileira iden-
olímpicas e paraolímpicas, bem como naquelas modalidades vincu- WL¿FDPVHGLIHUHQWHVS~EOLFRVHQYROYLGRVHQWUHDVSRVVLELOLGDGHVGR
ladas ao Comitê Olímpico Internacional - COI e ao Comitê Parao- Negócio do Esporte, assim como em todo o globo. Os investimentos
OtPSLFR,QWHUQDFLRQDOQRYDORUDQXDOJOREDOGHDWp VHWH- YHUL¿FDGRVDSRQWDPR(VSRUWHFRPRRSURGXWRFRPPDLRUSRWHQFLDO
centos e cinquenta mil) Valores de Referência do Tesouro Estadual de crescimento nos próximos anos. O interesse de agentes econômi-
957(VD¿PGHSRVVLELOLWDUDFRQWLQXLGDGHGHWUHLQDPHQWRjTXHOHV cos nos desportos congrega, inevitavelmente, as formas de comu-
que tenham obtido destaque em suas modalidades esportivas. nicação de massa; portanto, a utilização da Mídia nesse processo é
3DUiJUDIR ~QLFR 3DUD R SURSyVLWR GH TXH WUDWD R FDSXW GHVWH fundamental. É importante a observação da relação das partes que
artigo, os atletas serão selecionados e adotados, anualmente, tendo compõem esse mercado, - a mídia, os atletas e equipes, as próprias
como critério a colocação no “ranking” estadual, nacional e/ou in- empresas e instituições, as confederações esportivas e a sociedade
ternacional de cada modalidade. GHFRQVXPRFDGDTXDOFRPVHXVLQWHUHVVHVDOpPGDUHÀH[mRFUtWLFD

Didatismo e Conhecimento 104


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
sobre o papel dos meios de comunicação: a manipulação ou am- impõem-lhe como que uma desconfortável imobilidade: para
SOLDomRGDFRQVFLrQFLDGDRSLQLmRS~EOLFDDLQYHVWLJDomRVREUHRV inocentá-la, gela-a. É que o mito é uma fala roubada e restituída.
mecanismos ideológicos e a produção das ideias dominantes. Para Simplesmente, a fala que se restitui não é exatamente a mesma que
tanto, ressalta-se os pensamentos de alguns autores das correntes foi roubada: trazida de volta, não foi colocada no seu lugar exato. É
teóricas do estruturalismo, da escola de Frankfurt e do pós-estru- HVVHEUHYHURXERHVVHPRPHQWRIXUWLYRGHIDOVL¿FDomRTXHFRQVWLWXL
WXUDOLVPR(VVDUHÀH[mRWHyULFDHFUtWLFDDUHVSHLWRGRVSURFHVVRV o aspecto transido da fala mítica.
comunicacionais de massa, fornecem subsídios indispensáveis à in- E os mitos ídolos do esporte - cuja imagem de heróis vencedo-
vestigação das relações entre comunicação e mercado, sob a ótica do res é amplamente explorada pelos investidores, agentes do capitalis-
chamado Marketing Esportivo. mo - nos remete à perspectiva de Barthes sobre O Mito, na Direita,
em que é essencial: bem alimentado, de Leites Nestlé e Parmalat,
9LVLWDQGRR0LWRBartKHVUHWUDWDRVPHFDQLVPRVGDPLWL¿FD- lustroso, com Bombril, expansivo, como a Coca-Cola ou o McDo-
ção, que reduz o signo à forma, deformando o sentido original, em- nalds, falador, como as redes de TV e rádio, e inventa-se continua-
pobrecendo o contexto histórico, pela repetição e eternização. Cria- mente pela classe dominante. Apodera-se de tudo: justiças, morais,
VHSRUWDQWRRXWURVHQWLGRSDUDRS~EOLFRWUDQVIRUPDQGRDKLVWyULD estéticas, diplomacias, artes domésticas, literatura e espetáculos,
HPQDWXUH]DSRLVDIRUPDSURGX]RFRQFHLWRSHUPLWLQGRD³VLJQL¿- inclusive os esportivos.
cação”, que é o próprio mito. Podem-se ilustrar esses mecanismos:
A sua expansão tem a exata medida da omissão do nome bur-
a mídia necessita - para seus objetivos comerciais, editoriais e de
guês. A burguesia pretende conservar o ser sem o parecer: é, por-
programação - da audiência de campeonatos fortes como espetáculo
WDQWRDSUySULDQHJDWLYLGDGHTXHVROLFLWDLQ¿QLWDPHQWHRPLWR2
e de atletas carismáticos como seus personagens reais, os mitos, para
oprimido não é coisa nenhuma, possui apenas uma fala, a de sua
alimentarem a avidez de consumo do esporte pela população, em
emancipação, o opressor é tudo, a sua fala é rica, multiforme, ma-
qualquer classe social e em qualquer tempo. É quando assistimos
leável, dispõe de todos os graus possíveis de dignidade: tem a posse
DRDWOHWDtGRORGHRXWURUDQDPtGLDTXHRFRQFHLWRGHVLJQL¿FDomR
exclusiva da metalinguagem. O oprimido faz o mundo, possui ape-
PDQLIHVWDVHHPWRGDDVXDDSURSULDomR$LPDJHPGH0DQp*DU-
nas uma linguagem ativa, transitiva (política). O opressor conser-
rincha, por exemplo, vem até nós para nos obrigar a reconhecer o
va o mundo, a sua fala é plenária, intransitiva, gestual, teatral: é o
corpo de intenções que o motivou e o colocou ali como sinal de uma
KLVWyULDLQGLYLGXDOGHJrQLRGRIXWHEROFRPRXPDFRQ¿GrQFLDHXPD Mito; a linguagem do oprimido tem como objetivo a transformação,
cumplicidade: é um verdadeiro apelo que a mídia nos dirige. Esse a linguagem do opressor, a eternização. Os investimentos interna-
apelo para se tornar mais imperativo, consentiu todos os empobreci- cionais - cada vez maiores nas atividades econômicas relacionadas
PHQWRVWXGRRTXHMXVWL¿FDYDRKRPHP0DQp*DUULQFKDVXDYLGD ao esporte no Brasil – absorvem o mercado esportivo como negócio
quase miserável, seu problema de alcoolismo, sua pouca instrução PXLWROXFUDWLYR$¿QDOOHYDQGRVHHPFRQWDTXHXPDGDVYHUGD-
etc., tudo isso desapareceu; permaneceu apenas um sinal breve, in- deiras forças do Brasil é o esporte, e que a televisão brasileira é am-
discutível: suas jogadas magistrais, seus dribles desconcertantes. O plamente engajada no sistema capitalista, a burguesia produz, com
apelo é tão franco, que a sensação é a deste mito ter sido criado no facilidade, mitos em grande quantidade no meio esportivo.
instante em que assistimos a um documentário, somente para nós, Como visto, a mídia tem necessidade de produção de novas
como um objeto mágico surgindo no nosso presente, sem nenhum “mercadorias”. O capitalismo cria mitos profanos, cotidianamente:
vestígio da história que o produziu, assim como Barthes considera. pessoas que têm uma aparência comum, de origem em camadas po-
(VWDIDODLQWHUSHODWLYDpVLPXOWDQHDPHQWHXPDIDODSHWUL¿FDGD pulares. O esporte é uma possibilidade de ascensão social a esses
no momento que me atinge, suspende-se, gira sobre si própria, e que sonham em ser candidatos a mito, e ser veículo para algum tipo
UHFXSHUDXPDJHQHUDOLGDGH¿FDWUDQVLGDSXUDLQRFHQWH$DSURSULD- de consumo. Esse consumo é proporcionado pelo entretenimento,
ção do conceito é assim, de repente, afastada pela literalidade do SHODLQIRUPDomRHPXLWDVYH]HVSHODSDL[mR$SDUWLUGDtRVUHÀH-
sentido físico do termo: a imperialidade francesa condena os negros xos nos consumidores serão persuasivos perante um produto, um
TXHID]DVDXGDomRPLOLWDUDQmRVHUQDGDPDLVGRTXHXPVLJQL¿- serviço, uma marca, uma organização. Barthes nos faz examinar o
cante instrumental, o negro interpela-me em nome da imperialidade papel das classes dominantes, permitindo desenvolver o tema sobre
francesa; mas, ao mesmo tempo, a saudação militar do negro torna- a mídia e o esporte nacional (Seleção Brasileira de Futebol na Copa
VHHVSHVVDYLWUL¿FDGDSHWUL¿FDGDQXPFRQVLGHUDQGRHWHUQRGHVWL- GHHRMDUJmRR¿FLDO³3UD)UHQWH%UDVLO´SRUH[HPSOR HRVLQ-
nado a fundar a imperialidade francesa. Essa consideração lembra vestidores capitalistas, compostos por empresas e instituições, que
os imigrantes das colônias francesas e os descendentes destes que já experimentaram e aprovaram, na comunicação da sua imagem, a
MRJDUDPQDVHOHomRGHIXWHEROGD)UDQoDQD&RSDGHFRQGHQDQ- utilização de mitos esportivos (Pelé, Ayrton Senna, Seleção Brasilei-
GRRVDVHUDTXHOHVLJQL¿FDQWHLQVWUXPHQWDO$LPDJHPGHVVHV³FR- UDGH9{OHLGD2OLPStDGDHWF TXHSURSRUFLRQDUDPSHORVPHLRV
ORQL]DGRV´SHU¿ODGRVODGRDODGRDRVMRJDGRUHVJHQXLQDPHQWHIUDQ- de comunicação: alta credibilidade e consistente reconhecimento da
FHVHVQD&RSDHPTXHIRUDPFDPSH}HVWRUQDVHRHWHUQRYLWUL¿FDGR RSLQLmR S~EOLFD HPSDWLD HQWUH D SRSXODomR H XPD PDUFD JUDQGH
HSHWUL¿FDGRGHVWLQDGRDFRQVROLGDUDLJXDOGDGHIUDQFHVD poder de penetração em mercados potenciais, difusão de informação
É o esporte na mídia como veículo do poder. Os «colonizados» no dia-a-dia das pessoas, ser sempre notícia. Outro aspecto: já que
sofrem discriminação racial pelos considerados franceses genuíno. o mito possui um caráter imperativo, poderia - por meio do esporte
2 PLWR GD VHOHomR IUDQFHVD ©PLVFLJHQDGDª DPHQL]D HVVH FRQÀLWR HGDPtGLDFRQVFLHQWL]DUDMXYHQWXGHHDRSLQLmRS~EOLFDHPJHUDO
aos olhos do mundo. À superfície da linguagem, algo se mobiliza; sobre sociabilidade e cidadania, cultura e estilo de vida saudável
R XVR GD VLJQL¿FDomR HVWi HVFRQGLGR VRE R IDWR GDQGROKH XP DU - longe da marginalidade e das drogas - e até mesmo uma sensibili-
QRWL¿FDGRU PDV VLPXOWDQHDPHQWH R IDWR SDUDOLVD D LQWHQomR ]DomRSUR¿VVLRQDO

Didatismo e Conhecimento 105


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Ideias de Louis Althusser vendedores de jornais que, apoiados em sua bicicleta, comentam os
resultados de uma competição de ciclismo. Não é sem razão que os
O também estruturalista Althusser presume que toda formação editores de jornais organizam competições reservadas a seus em-
social surge de um modo de produção dominante e, para existir, toda pregados jovens. Tais corridas despertam um imenso interesse entre
formação social, ao mesmo tempo em que produz, e para poder pro- aqueles que delas participam, pois o vencedor tem a oportunidade
duzir, tem que reproduzir as condições de produção. Então pode- GHGHL[DUDYHQGDGHMRUQDLVSHODVLWXDomRGHFRUUHGRUSUR¿VVLRQDO
mos dizer que, o processo de produção põe em movimento as forças 'HPRGRLGrQWLFRJUDoDVDRV¿OPHVGHDWXDOLGDGHVTXDOTXHUSHVVRD
produtivas existentes em e sob a vigência das relações de produção tem a sua chance de aparecer na tela. Pode ser mesmo, que venha
GH¿QLGDV'LVVHPRV HHVWDWHVHDSHQDVUHSHWLDFpOHEUHVSURSRVLo}HV a ocasião de aparecer numa verdadeira obra de arte... Não há nin-
do materialismo histórico) que Marx concebe a estrutura de toda a JXpPKRMHHPGLDDIDVWDGRGDSUHWHQVmRGHVHU¿OPDGRHD¿PGH
VRFLHGDGHFRPRFRQVWLWXtGDSRU³QtYHLV´RX³LQVWkQFLDV´DUWLFXODGDV melhor entender essa pretensão, vale considerar a situação atual dos
SRUXPDGHWHUPLQDomRHVSHFt¿FDDLQIUDHVWUXWXUDRXEDVHHFRQ{PL- escritores.
ca (“unidade” de forças produtivas e relações de produção) e a supe- Podem-se investigar as características do capitalismo e a dire-
UHVWUXWXUDTXHFRPSUHHQGHGRLV³QtYHLV´RX³LQVWkQFLDV´DMXUtGLFR- ção em substituir os processos sociais em processos mercantilistas e
-política (o direito e o Estado) e a ideológica (as distintas ideologias, estudar a industrialização da produção cultural, ambiguamente de-
religiosa, moral, jurídica, política, etc...). PRFUiWLFDHPDQLSXODGRUDWUDoDQGRVHXPSDUDOHORj³LQG~VWULD´GR
,VVRSRVVLELOLWDXPDLQWHUHVVDQWHUHÀH[mRVREUHDVUHODo}HVGH esporte, cujos artistas (equipes e atletas) se submetem às produções
um investidor que, aplicando recursos nos Negócios do Esporte, (organização de eventos e transmissões em rádio e TV). Os con-
interage com seus fornecedores, seus revendedores, seus consumi- IURQWRVHVSRUWLYRVSRGHPVHUXPDDSDULomR~QLFDGHXPDUHDOLGDGH
GRUHV VHX S~EOLFRDOYR SRWHQFLDO RV IRUPDGRUHV GH RSLQLmR VHXV quando vistos in loco nas praças desportivas, ou reproduções próxi-
IXQFLRQiULRVRSRGHUS~EOLFRDOpPGHDWOHWDVRXHTXLSHVGRVVHXV mas às massas, quando assistidos ou ouvidos na mídia eletrônica. A
torcedores, as federações esportivas e os meios de comunicação. LPSRUWkQFLDGD79SDUDDFRPXQLFDomRYLDHVSRUWHpDSRQWDGDFRPR
Outro ponto a ser examinado, é o fato de que, os AIEs (Aparelhos YLWDOSDUDRDXPHQWRGRS~EOLFRFRQVXPLGRUHSDUDDVREUHYLYrQFLD
Ideológicos de Estado) compreendem várias instituições. “Enume- dos clubes e atletas. A tendência é o investimento em: a) tecnologia
UDPRV QDV IRUPDo}HV VRFLDLV FDSLWDOLVWDV FRQWHPSRUkQHDV XP Q~- da reprodução, privilegiando o espetáculo nas transmissões televi-
mero relativamente elevado de aparelhos ideológicos de Estado: o sivas e b) arenas esportivas menores como cenário, “quase um es-
aparelho escolar, o aparelho religioso, o aparelho familiar, o apare- W~GLR´FRPFRQIRUWRHUHTXLQWHSDUDRVPDLVDEDVWDGRVXPFDUiWHU
~QLFRGD³REUDGHDUWH´HVXDLQVHUomRKLVWyULFDKLFHWQXQF DXWHQ-
lho político, o aparelho sindical, o aparelho de informação, o apare-
ticidade da presença do evento no próprio local onde se encontra).
lho cultural etc...”. Essa análise é importante, já que todos os AIEs
Para Adorno e Horkheimer, a industrialização e o sistema cul-
contribuem para um mesmo resultado: a reprodução das relações de
tural fragmentado de racionalidade técnica a serviço da dominação,
produção, isto é, das relações capitalistas de exploração.
deixam claros os pontos a se observar, principalmente a manipula-
Althusser propõe uma teoria da ideologia em geral como uma
omRGDVQHFHVVLGDGHVGRS~EOLFRHGDLQG~VWULDFXOWXUDOGHSHQGHQWH
representação da relação imaginária dos indivíduos com suas con-
dos setores empresariais mais poderosos. Os investidores buscam
dições reais de existência. Ele defende a tese de que a ideologia tem o seu diferencial, utilizando o esporte e os meios de comunicação.
uma existência material. A ideologia reconhece, apesar de sua de- O cinema e o rádio não precisam mais se apresentar como arte.
formação imaginária, que as ‘ideias’ de um sujeito humano existem A verdade de que não passam de um negócio, eles a utilizam como
ou devem existir em seus atos, e que quando isso acontece, ela lhe uma ideologia destinada a legitimar o lixo que propositalmente pro-
atribui outras ideias correspondentes aos atos (mesmo perversos) GX]HP (OHV VH GH¿QHP D VL PHVPRV FRPR LQG~VWULDV H DV FLIUDV
que ele de fato pratica. Essa ideologia fala de atos; nós falaremos de publicadas dos rendimentos de seus diretores gerais suprimem toda
atos inseridos em práticas. E essas práticas são regidas por rituais em G~YLGDTXDQWRjQHFHVVLGDGHVRFLDOGRVVHXVSURGXWRV2HVSRUWHQD
que elas se inscrevem, dentro da existência material de um aparelho PtGLDpDSUySULDLQG~VWULDGDGLYHUVmRRSURORQJDPHQWRGRWUDEDOKR
ideológico, nem que seja numa pequena parte desse aparelho: uma e as operações padronizadas, que geram as reações esperadas por
pequena missa numa igrejinha, um enterro, um pequeno jogo num parte do espectador: a promessa do prazer associado ao consumo
clube esportivo, um dia de aula numa escola, uma reunião de um (consumidor eterno). O esporte na mídia é persuasivo no desejo da
partido político, etc. ascensão social, na ideia de felicidade (sorte, talento), mantendo a
Uma simples transmissão televisiva de um presidente home- ideologia do capitalismo.
nageando uma seleção de futebol, por exemplo, ganha dimensões
de sustentação da superestrutura dominante, estabelecendo a per- O poder da imagem via esporte
manência das atuais relações entre o poder político e econômico e a
classe trabalhadora. Pode-se revisitar a questão já abordada anteriormente por Ben-
MDPLQ TXDQGR FLWDGD D LPSRUWkQFLD GD PtGLD SDUD D FRPXQLFDomR
A Manipulação pelo esporte, na tendência à valorização do espetáculo pela TV. A
imagem televisiva da arena de competição como cenário é um simu-
Para o importante integrante da Escola de Frankfurt Walter lacro. “A simulação põe em causa a diferença do ‘verdadeiro’ e do
Benjamin, a mídia, pela sua capacidade de reprodução, permite o ‘falso’, do ‘real’ e do ‘imaginário’. O simulador está ou não doen-
acesso das camadas sociais menos privilegiadas às obras culturais. te, se produz ‘verdadeiros’ sintomas?” (Baudrillard). Além disso,
Tanto como apreciador quanto como participante. A técnica do ci- observa-se hoje, o anseio de transformar as praças esportivas em
nema assemelha-se àquela do esporte, no sentido de que todos os verdadeiros centros de consumo - como um shopping -, com res-
espectadores são, nos dois casos, semiespecializas. Basta, para isso taurantes, lojas, outras atividades de lazer etc., a exemplo do que já
¿FDU FRQYLQFHQWH KDYHU HVFXWDGR DOJXP GLD XP JUXSR GH MRYHQV ocorre nos Estados Unidos e em outros países desenvolvidos.

Didatismo e Conhecimento 106


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
A mídia é a impulsionadora da disseminação do esporte - e 6HULDSUHFLVRHQ¿PDQDOLVDURVGLIHUHQWHVHIHLWRVGDLQWHQVL¿FD-
consequentemente do Negócio do Esporte - pela ocupação cada ção da competição entre as nações que a televisão produziu através
vez maior de tempo e espaço principalmente na TV. Pierre Bordieu da planetarização do espetáculo olímpico, como o aparecimento
HQIDWL]D D DPSOLDomR GD FDSDFLGDGH GH FRPSUHHQVmR GR S~EOLFR H de uma política esportiva dos Estados orientados para os sucessos
o poder da TV. O peso das instituições, a posição dominante dos internacionais, a exploração simbólica e econômica das vitórias e
PHLRVGHFRPXQLFDomRRDMXVWHjVHVWUXWXUDVPHQWDLVGRS~EOLFRR a industrialização da produção esportiva, que implica o recurso ao
FDPSRMRUQDOtVWLFRHRFRQWUROHGHYLVLELOLGDGHS~EOLFDDLPSRVLomR doping e a formas autoritárias de treinamento.
do sensacionalismo e a adulação das paixões elementares são todos No esporte, o atleta é apenas o sujeito aparente de um espetácu-
aspectos preciosos encontrados no ambiente do esporte e da mídia, lo que é produzido de certa maneira duas vezes: uma primeira vez,
por exemplo, nos Jogos Olímpicos. por todo um conjunto de agentes, atletas, treinadores, médicos, orga-
O referencial aparente é a manifestação “real”, isto é, um espe- nizadores, juízes, cronometristas, encenadores de todo o cerimonial,
táculo propriamente esportivo, confronto de atletas vindos de todo o que concorrem para o bom transcurso da competição esportiva no
mundo que se realiza sob o signo de ideais universalistas e uma ima- estádio; uma segunda vez, por todos aqueles que produzem a repro-
JHPFRPIRUWHFRORUDomRQDFLRQDOLVWDGHV¿OHSRUHTXLSHVQDFLRQDLV dução em imagens desse espetáculo, muitas vezes sob a pressão da
entrega de medalhas com bandeiras e hinos nacionais. O referencial concorrência e de todo o sistema das pressões exercidas sobre eles
oculto é o conjunto das representações desse espetáculo fotografa- pela rede de relações objetivas na qual estão inseridos. É na segun-
GR H SULQFLSDOPHQWH ¿OPDGR GLYXOJDGR SHODV WHOHYLV}HV VHOHo}HV da, dentro desses contextos, por meio das imagens, que a história
nacionais efetuadas no material em aparência nacionalmente indi- dos jogos olímpicos, em cada era, se perpetuará e será contada às
ferenciado (já que a competição é internacional) que é oferecido no futuras gerações.
estádio. Objeto duplamente oculto, já que ninguém o vê em sua tota- Como o Negócio do Esporte é instrumento da eternização do
lidade e ninguém vê que ele não é visto, podendo cada telespectador capitalismo, é necessário passar pela “eternização do presente” de
ter a ilusão de ver o espetáculo olímpico em sua verdade. F. Jameson. A relação do passado com o presente é uma questão
As emissoras de TV de cada país dão tanto espaço a um atleta de imagem (presente que se projeta no futuro). O poder da ima-
ou a uma prática esportiva, quanto mais eles forem capazes de sa- gem alicerça a valorização da ideia da liberdade de mercado, que se
tisfazer o orgulho nacionalista e, consequentemente os patrocinado- prende na materialidade, e da impossibilidade da individualidade.
res. A representação televisiva, embora apareça como um simples Interessante analisar o controle das imagens em um mercado incon-
registro transforma a competição esportiva entre atletas originários
trolável, assim como a onipresença dos meios de comunicação a que
de todo universo em um confronto entre campeões de diferentes na-
nos submetemos.
ções.
Para compreender esse processo seria preciso primeiro, analisar
a construção social do espetáculo olímpico, das próprias competi-
ções, mas também de todas as manifestações de que elas são cerca-
GDVFRPRRVGHV¿OHVGHDEHUWXUDHHQFHUUDPHQWR6HULDSUHFLVRHP POLÍTICA NACIONAL DO ESPORTE
seguida, analisar a produção da imagem televisiva desse espetáculo,
que, enquanto suporte de spots publicitários, torna-se um produto
comercial que obedece à lógica do mercado e, portanto, deve ser
concebido de maneira a atingir e prender o mais duradouramente
SRVVtYHORS~EOLFRPDLVDPSORSRVVtYHODOpPGHGHYHUVHURIHUHFLGD DOCUMENTOS DE REFERÊNCIA Documento Principal
nos horários de grande audiência nos países economicamente domi- ‡'RFXPHQWRVGHVHQYROYLGRVHHODERUDGRVSHORV6HWRUHVGD&k-
QDQWHVHODGHYHVXEPHWHUVHjGHPDQGDGHS~EOLFRFXUYDQGRVHjV PDUD6HWRULDOGR(VSRUWHHP
SUHIHUrQFLDV GRV GLIHUHQWHV S~EOLFRV QDFLRQDLV SRU HVWH RX DTXHOH
esporte e mesmo às suas expectativas nacionais ou nacionalistas, por Documentos Legais
uma seleção ponderada dos esportes e das provas capazes de pro- ‡ $UW  GD &RQVWLWXLomR )HGHUDO GH  ‡ /HL Qž 
porcionar sucessos em seus países e satisfações a seu nacionalismo. GH  H VXD UHJXODPHQWDomR SHOR 'HFUHWR Qž  GH
$LPSRUWkQFLDGRVGLIHUHQWHVHVSRUWHVQDVFRQIHGHUDo}HVHVSRU- 
tivas internacionais dependem cada vez mais do seu sucesso televi- ‡ /HL Qž  GH  TXH DOWHURX GLVSRVLWLYRV GD /HL
sual e dos lucros econômicos relativos. As pressões da transmissão Qž  ‡ 0HGLGD 3URYLVyULD Qž  GH  TXH
afetam também cada vez mais a escolha dos esportes olímpicos, dos DOWHURXGLVSRVLWLYRVGD/HLQžHGLVS{VVREUHDRUJDQL]D-
lugares e dos momentos oferecidos e a própria duração das provas omRGD3UHVLGrQFLDGD5HS~EOLFDHGRV0LQLVWpULRVDOpPGHRXWUDV
e cerimônias. providências.
A atração é o campo de produção dos Jogos Olímpicos como ‡/HLQžGH /HLGH'LUHWUL]HVH%DVHVGD(GX-
espetáculo televisivo, ou melhor, como ferramenta de comunicação, cação Nacional Outros Documentos Importantes.
isto é, o conjunto das relações objetivas entre os agentes e as gran- ‡ ,QIRUPH ¿QDO GD 7HUFHLUD &RQIHUrQFLD ,QWHUQDFLRQDO GH 0L-
des redes de televisão, que disputam os direitos de retransmissão e nistros e Altos Funcionários Encarregados da Educação Física e do
os dólares dos representantes de poderosas marcas internacionais: (VSRUWH±
os patrocinadores. Para atender aos interesses destes, produtores da ‡3URSRVWDGH3ODQRSDUDR(VSRUWHGR%UDVLODSUHVHQWDGDSHOR
imagem destinada à TV estão comprometidos, orientando um traba- Panathlon Internacional, de autoria do Prof. Henrique Nicolini.
lho individual e coletivo de construção da representação dos Jogos: ‡ 3ODQR 1DFLRQDO GH 'HVHQYROYLPHQWR GR (VSRUWH SXEOLFDGR
seleção, enquadramento e montagem das imagens. HP

Didatismo e Conhecimento 107


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
CONTEXTO ESPORTIVO BRASILEIRO 2 JUDQGH LGHyORJR GR WH[WR GR DUWLJR  IRL$OYDUR 0HOR )LOKR
A Evolução da Legislação Esportiva Brasileira A Legislação e quem apresentou-o na Assembléia Constituinte foi o presidente
Esportiva Brasileira teve na sua história apenas cinco leis do esporte: do Conselho Nacional de Desportos (CND), prof. Manoel Tubino.
ž 2'HFUHWR/HLQžGHž $/HLQžGH $SHVDUGRJUDQGHQ~PHURGHHPHQGDVRWH[WRIRLPDQWLGRQDVXD
ž $/HLQž /HL=LFR GHž $/HL essência, graças a determinação do relator da Comissão de Educa-
Qž /HL3HOp GHž $/HLQž /HL0DJXLWR ção, Artur da Távola.
9LOHOD GH1XPDSHTXHQDVtQWHVHLQLFLDOSHUFHEHVHTXH eHYLGHQWHTXHDSyVD&RQVWLWXLomRGHWHULDTXHRFRUUHU
RVGRLVSULPHLURVGRFXPHQWRVOHJDLVR'HFUHWR/HLQžHD/HL XPDQRYDOHLSRLVDDQWLJD/HLHVWDYDFRPSOHWDPHQte in-
SHUWHQFHPDRVSHUtRGRVFRQKHFLGRVFRPRDXWRULWiULRVTXHR compatibilizada com o novo status quo. Foi então que surgiu a Lei
Brasil já ultrapassou, o Estado Novo e o Período Militar de Poder. Já QžHPGHMXOKRGHPDLVFRQKHFLGDFRPR/HL=LFRTXH
DVOHLV /HL=LFR HD /HL3HOp SRGHPVHUFRQVLGHUDGDV YLULDDVHUUHJXODPHQWDGDSHOR'HFUHWRQžGHGHQRYHPEURGH
FRPRFRQVHTrQFLDVQDWXUDLVGRDUWLJRGD&RQVWLWXLomR)HGHUDO 2PDLVLPSRUWDQWHGHVWDOHLIRLRIDWRGDPHVPDVHUXPDOHL
GH)LQDOPHQWHD/HLUHFHQWHPHQWHDSURYDGDHMiFRQKH- conceitual e principiológica. Além disso, foi a Lei Zico que rompeu
cida como Lei Maguito Vilela, nada mais é do que um ajustamento GH¿QLWLYDPHQWHDWXWHODHVWDWDOVREUHRHVSRUWHEUDVLOHLURDWHQGHQGR
na Lei Pelé, em função das pressões existentes no futebol brasileiro, RVSUHFHLWRVGD&RQVWLWXLomRGH
por causa da lei anterior. A Lei Zico teve uma grande contribuição de Artur da Távola.
Para o entendimento desta evolução da legislação esportiva A extinção do CND, a preconização de critérios e diretrizes para a
brasileira, é importante explicitar algumas observações conjuntu- organização e funcionamento das entidades esportivas foram mar-
rais que permitem as interpretações das etapas correspondentes a cas desta lei.
HVWDVOHLV1DGpFDGDGHRFRUULDPLQ~PHURVFRQÀLWRVQDiUHD &RPDFKHJDGDGR*RYHUQR)HUQDQGR+HQULTXH&DUGRVRIRL
do futebol brasileiro, que já era o esporte mais popular na nação. nomeado um Ministro Extraordinário de Esportes, Edson Arantes
O Estado, então, ao resolver regulamentar as atividades esportivas, do Nascimento (Pelé) que, com a contribuição de alguns esportistas,
estendem essa normatização além do futebol, atingindo todas as mo- apresentou projeto de lei, que viria a ser mais uma vez relatada por
dalidades esportivas praticadas no Brasil, estabelecendo o Decreto- Artur da Tavola. Esta lei recebeu o nome de “Lei Pelé”, e trouxe
/HLQžHPGHDEULOGH(VWHGHFUHWRWUDWRXGDVEDVHV LQ~PHURVDYDQoRVFRPRDH[WLQomRGRSDVVHGRMRJDGRUSUR¿VVLRQDO
da organização dos esportes no país e já no artigo segundo criava o de futebol, a pressão para que as associações esportivas (do futebol
&RQVHOKR1DFLRQDOGH'HVSRUWRV &1' GHVWLQDGRDRULHQWDU¿VFD- SULQFLSDOPHQWH VHWRUQDVVHPSUR¿VVLRQDLVHDLQGDPDQWHYHDSDUWH
lizar e incentivar a prática dos esportes em todo o território nacional. conceitual e principiológica da Lei Zico.
2 DXWRU LQWHOHFWXDO GHVWH GHFUHWROHL DVVLQDGR SRU *HW~OLR 9DUJDV Como as mudanças incidiam no futebol, vários interesses foram
foi João Lyra Filho. Com este decreto, estava instalada no Brasil ameaçados e este fato gerou uma resistência crescente que mais tar-
a burocratização e a cartorialização no esporte brasileiro, o que vi- de provocaria uma revisão da Lei Pelé.
ria obstaculizar os fatos esportivos brasileiros por muito tempo. O O Congresso Nacional passou a constituir-se palco desta nova
próprio CND viria a consolidar a tutela estatal sobre o Esporte com discussão sobre a Lei Pelé e os pontos considerados polêmicos fo-
as seguidas deliberações que cada vez mais tiravam a autonomia ram adaptados à nova conjuntura, invertendo-se algumas perspecti-
das entidades esportivas. Este quadro permaneceu até a metade da vas da Lei Pelé. Esta nova lei passou a ser conhecida como Lei Ma-
GpFDGDGHTXDQGRR%UDVLODWUDYHVVDYDXPQRYRSHUtRGRDXWR- JXLWR9LOHODDTXDODLQGDGHL[RXSRQWRVGHFRQÀLWRQDFRPXQLGDGH
ULWiULRTXHSHUGXURXGHD)RLQHVWHSHUtRGRTXHVDLXD nacional do futebol, que viriam a ser tratados pelo Poder Executivo,
/HLQžHPGHRXWXEURGH(VWHOHLIRLUHJXODPHQWDGD através do Ministério do Esporte e Turismo. O Ministro do Esporte
SHOR'HFUHWRQžGHGHDJRVWRGH5HJLVWUDVHTXH e Turismo, Carlos Melles, liderou um movimento de ajustamento da
esta lei e o seu decreto regulamentador mantiveram as imposições legislação brasileira para que o futebol nacional pudesse se adequar
burocráticas e disciplinadoras. Entretanto, foi nesta lei que pela pri- as suas necessidades do momento e ainda criou um Conselho Nacio-
meira vez um texto legal tratou da Política Nacional de Educação nal de Esporte, órgão destinado a acompanhar o processo do esporte
Física e Desportos e introduziu um Sistema Desportivo Nacional, brasileiro, buscando as soluções emergenciais, mas sem constituir-
além de também abordar, com normas, as entidades esportivas como -se num aparelho de Estado para interferir na autonomia das en-
as confederações, federações e clubes. A justiça esportiva também tidades. Ao contrário, pela representatividade dos Conselheiros, as
mereceu atenção neste documento legal. deliberações serão o atendimento das expectativas da comunidade
(VWH SDQRUDPD SHUPDQHFHX DWp R ¿P GR SHUtRGR PLOLWDU HP esportiva nacional.
TXDQGRR0LQLVWpULRGD(GXFDomRTXHWLQKDRHQWmRPLQLVWUR A Expansão Quantitativa das Práticas Esportivas no Brasil e
Marco Maciel como seu titular, criou sob a presidência de Manoel suas Desigualdades a expansão quantitativa das práticas esportivas
Tubino a Comissão de Reformulação do Esporte Brasileiro. Desta QR%UDVLOpYLVtYHOHHVWiH[SUHVVDQRFUHVFHQWHQ~PHURGHSUDWL-
FRPLVVmRVDtUDPLQGLFDo}HVGHUHIRUPXODomRDSDUWLUGDQHFHVVL- cantes formais e não-formais de esportes, de eventos esportivos,
dade de revisão do próprio conceito de esporte no Brasil. A grande GH SUR¿VVLRQDLV TXH RFXSDP R HVSDoR GH WUDEDOKR UHODFLRQDGR DR
conseqüência desta comissão, ou o seu melhor produto, foi a consti- fenômeno esportivo, de cientistas que direcionam seus estudos nas
WXFLRQDOL]DomRGRHVSRUWHEUDVLOHLURSHORDUWLJRGD&RQVWLWXLomR TXHVW}HVHVSRUWLYDVGHLQG~VWULDVFRPSURPHWLGDVFRPHTXLSDPHQ-
)HGHUDO GH  1R SUHkPEXOR GHVWH DUWLJR R (VSRUWH QR %UDVLO tos e materiais esportivos, de manifestações da mídia (TVs, rádios,
teve o seu conceito atualizado ao ser considerado como direito de jornais, sites, bancos de dados etc), de modalidades esportivas pra-
FDGDXP1HVWHPHVPRDUWLJR¿FDYDGHWHUPLQDGDDDXWRQRPLDGDV ticadas no país, de instalações esportivas espalhadas pelo território
entidades e associações esportivas. Desse modo, estava rompida a brasileiro e por muitos outros fatos. Esta expansão quantitativa pode
tutela do Estado sobre a Sociedade em relação à área do Esporte. VHU H[SOLFDGD SULQFLSDOPHQWH SRU D  FUHVFLPHQWR GHPRJUi¿FR GR

Didatismo e Conhecimento 108


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
país; b) desenvolvimento sócio-econômico; c) proliferação da mídia dividuais as práticas esportivas, têm sido desenvolvida, com ênfa-
HVSHFt¿FD LQFOXVLYHSHORVPHLRVLQWHUQDFLRQDLVGDPtGLD G EXVFD se, em todo o país, através de campanhas esclarecedoras, algumas
GHHQWUHWHQLPHQWRHTXDOLGDGHGHYLGDSHORKRPHPFRQWHPSRUkQHR FRPH[FHOHQWHH¿FiFLD$VH[SHULrQFLDVPXQLFLSDLVHYLGHQFLDPTXH
e) mais consciência e conhecimento do valor do esporte. Entretan- somente a presença de instalações e equipamentos ainda não são
to, numa análise desta expansão, não é difícil perceber que as desi- VX¿FLHntes para a adesão das populações aos programas de esporte
gualdades quanto à ocupação do esporte no território nacional ainda comunitário ou popular. Programas e campanhas consistentes são
persiste, embora em alguns casos tenha diminuído. A desigualdade imprescindíveis. O sucesso do programa “Agita São Paulo” é uma
de prática esportiva no país praticamente acompanha o nosso mapa prova inconteste da necessidade de orientação, acompanhamento e
de desigualdades sócio-econômicas. No esporte ainda ocorrem de- até avaliação, a qual, além de qualitativa deve ser quantitativa, uma
VLJXDOGDGHVHVSHFt¿FDVHPUHODomRjVPRGDOLGDGHVHVSRUWLYDV(P vez que o aumento da participação é o objetivo. Na manifestação
FDGD XP GRV HVSRUWHV H[LVWHP GHVSURSRUo}HV QRV SURFHVVRV GH ‡ esporte de rendimento é que se encontra a maior diversidade de si-
IRPHQWR‡LQLFLDomRHVSRUWLYD‡SUiWLFDHVSRUWLYDIHPLQLQD tuações e onde está expressa esta grande pluralidade do esporte bra-
Um dos pontos a serem adequados no esporte brasileiro será sileiro. Abaixo, listamos várias situações relativas às modalidades
justamente a correção destes processos. HVSRUWLYDV  2 )XWHERO EUDVLOHLUR p SUDWLFDGR JHQHUDOL]DGDPHQWH
&RQVLGHUDo}HVVREUHD'LQkPLFDGR(VSRUWH%UDVLOHLUR$SDUWLU em todo o país, com equipes de diversos níveis disputando compe-
GD&RPLVVmRGH5HIRUPXODomRGR(VSRUWH%UDVLOHLUR  HSULQ-
WLo}HVSUR¿VVLRQDLVUHJLRQDLVHQDFLRQDLV$OJXPDVHTXLSHVGHIX-
FLSDOPHQWH GD &RQVWLWXLomR )HGHUDO GH  R (VSRUWH EUDVLOHLUR
tebol mobilizam grandes massas de torcedores. É o maior interesse
pelo menos teoricamente e parcialmente em termos de prática, é
da mídia esportiva.
entendido sob o pressuposto do direito de todos ao esporte e as for-
2. Os Esportes Coletivos Terrestres com Bola (Basquetebol,
mas de exercício deste direito são o esporte educacional, o esporte
escolar, o esporte-lazer e o esporte de rendimento. A abrangência Voleibol, Futsal, Handebol, Vôlei de Praia) se apresentam em dife-
GHVWHHVSRUWHYHPGHVGHDLQIkQFLDFKHJDQGRjWHUFHLUDLGDGHSDV- UHQWHVSHUVSHFWLYDV‡HTXLSHVGHFOXEHVGHIXWHEROFRPJUDQGHVWRU-
sando pela adolescência, juventude e idade adulta. Como é direito de FLGDV‡HTXLSHVTXHUHSUHVHQWDPPXQLFtSLRV‡HTXLSHVGHHPSUHVDV
todos, evidentemente que existem práticas organizadas institucio- ‡HTXLSHVGHFOXEHVTXHQmRWHPIXWHEROSUR¿VVLRQDO‡HTXLSHVGH
nalmente e práticas não- formais também para as pessoas com ne- XQLYHUVLGDGHV‡HTXLSHVGHSHVVRDVItVLFDVTXHVHUHSUHVHQWDPVHP
cessidades especiais. A principal característica do esporte brasileiro instituições (ex: Vôlei de Praia)
é a pluralidade de situações. Interessante é que esta pluralidade ou ‡HTXLSHVUHVXOWDQWHVGHFRPELQDo}HVHQWUHDVRSo}HVDFLPD
diversidade ocorre nas quatro manifestações (esporte educacional, Os esportes coletivos com bola também se apresentam nas op-
esporte escolar, esporte-lazer e esporte de rendimento), o que está ções acima variando por modalidade. Outra observação é que exis-
expresso em quadros circunstanciais diferentes. O esporte educacio- tem clubes tradicionais em alguns esportes, cidades tradicionais em
nal, muitas vezes, é entendido equivocadamente como uma repro- algumas modalidades e até equipes itinerantes que trocam de loca-
dução do esporte de rendimento no ambiente escolar. Recordando- OLGDGHGHSHQGHQGRGRDSRLR¿QDQFHLUR1RFDVRGDVFLGDGHVWUDGL-
-se que o esporte educacional deve estar referenciado em princípios FLRQDLVSRGHVHDWpD¿UPDUTXHDLGHQWLGDGHGHDOJXQVPXQLFtSLRV
sócio-educativos e deve constituir-se como componente do processo estão relacionados com alguns esportes. Dois exemplos são Franca
educativo para a formação da cidadania, observa-se que nos esta- %DVTXHWHERO H6HUWmR]LQKR +yTXHLVREUH3DWLQV 2V(VSRUWHV
dos e municípios brasileiros existem poucos exemplos de prática 7UDGLFLRQDLV 2OtPSLFRV7HUUHVWUHV $WOHWLVPR *LQiVWLFD (VJULPD
de esporte educacional. O que existe, na verdade, são competições Tênis de Mesa, Tiro, Tiro ao Arco etc), praticados principalmente
estudantis de rendimento, conhecidas como esporte escolar, o que em clubes e as vezes em esquemas municipais em apenas alguns
não pode ser condenado, porque representa o exercício do direito HVWDGRVEUDVLOHLURV$OJXQVFRPHQWiULRVHVSHFt¿FRV‡2$WOHWLVPR
dos jovens de talento ao esporte e às possibilidades de ocupação distribuído irregularmente no país, carece de instalações e equipa-
PDLVWDUGHGHHVSDoRSUR¿VVLRQDOGHWUDEDOKRQHVWDRSomRGRHVSRU- mentos modernos. É praticado pelas classes de menor prestígio so-
te. A lamentar, apenas, o fato de que as oportunidades de prática cial, o que resulta na necessidade de mais investimentos. Fora Ma-
esportiva escasseiam para aqueles que não possuem talento ou bio- naus, os pólos principais estão nas regiões Leste e Sul. Apesar disso,
tipos adequados para o esporte de resultados. Com isto, muitos não a história esportiva brasileira tem sido contemplada com grandes he-
vivenciam nas escolas as práticas esportivas que contribuem para
UyLVFDPSH}HVHQXPQ~PHURFRQVLGHUiYHOGHPHGDOKDVROtPSLFDV
a formação da cidadania. Entretanto, existem várias experiências
‡$ *LQiVWLFD SUDWLFDGD QDV UHJL}HV /HVWH H 6XO QHFHVVLWD GH
YLWRULRVDVGHHVSRUWHHGXFDFLRQDOQRSDtVGHVGHR¿QDOGDGpFDGD
DSDUHOKRVGHXPFHUWRPRGRVR¿VWLFDGRV*HUDOPHQWHpGHVHQYROYL-
GH4XDQWRDRHVSRUWHOD]HUSRGHVHD¿UPDUpXPDUHVSRQVD-
GDQXPQ~PHURSHTXHQRGHFOXEHVEUDVLOHLURV1RQtYHOLQWHUQDFLR-
bilidade praticamente direta dos estados e municípios, pois atinge
as pessoas comuns e está invariavelmente ligado à disponibilidade nal o Brasil está distante dos primeiros colocados, sobrando apenas
de instalações e equipamentos, além da formulação de programas e algum destaque na América Latina;
campanhas para as práticas esportivas. É o Esporte Comunitário e ‡$(VJULPDSRXFRGHVHQYROYLGDQR%UDVLOSRUIDOWDGHHTXL-
sua principal característica é que ele atende somente a voluntários. pamentos, que são produzidos no exterior, é um esporte praticado
Atualmente, no Brasil, existem excelentes programas em alguns SRUXPQ~PHURUHGX]LGRGHLQVWLWXLo}HVGDVUHJL}HV/HVWHH6XO$
municípios, principalmente no Estado de São Paulo (São Caetano e Esgrima ainda carece de recursos humanos;
Sorocaba são bons exemplos). Alguns governos estaduais também ‡27rQLVGH0HVDGHSRLVGHXPUHODWLYRGHVHQYROYLPHQWRHQ-
apresentam ótimos programas de esporte-lazer, onde a participação trou num processo de estagnação, sem obter resultados expressivos
e o prazer são fundamentais. A grande responsabilidade de mudança LQWHUQDFLRQDLV3UHFLVDGHXPDXPHQWRPDUFDQWHQRQ~PHURGHSUD-
de hábitos das pessoas para que incorporem em suas culturas in- WLFDQWHVHFUHVFLPHQWRQRLQWHUFkPELRLQWHUQDFLRQDO

Didatismo e Conhecimento 109


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
‡27LURGHPXLWDWUDGLomRROtPSLFDHVWiH[WUHPDPHQWHGL¿- 2V(VSRUWHVGH,GHQWLGDGH&XOWXUDOFRPRD&DSRHLUD3H-
cultado no país, pelo avanço tecnológico das armas e a nossa con- teca, Tamboréu, Futevolei, são modalidades ainda pouco organiza-
seqüente inacessibilidade a esta tecnologia, e pela necessidade de das nacionalmente e que não tem recebido o devido apoio do poder
muita munição para treinamento; S~EOLFRHPERUDHVWHVHMDXPSUHFHLWRFRQVWLWXFLRQDO $UWGD
‡27LURDR$UFRHR/HYDQWDPHQWRGH3HVRVHPERUDWUDGLFLR- &RQVWLWXLomRGH $&DSRHLUDDRFRQWUiULRDRVSRXFRVYDLIX-
nais, são modalidades pouco elegidas para a prática no país. Poucos gindo deste status quo e chega, inclusive, em outros países. Ela tem
resultados expressivos em competições internacionais. sido objeto de livros, dissertações e teses em universidades.
2V(VSRUWHV$TXiWLFRV 1DWDomR6DOWRV2UQDPHQWDLV1DGR  2V (VSRUWHV ,QWHOHFWLYRV LVWR p DTXHOHV GH SRXFR PRYL-
Sincronizado e Pólo Aquático), tem que ser analisados separada- mento como o Xadrez, Bilhar, Aeromodelismo, etc, de boa difusão
PHQWH ‡ $ 1DWDomR GH YLVtYHO SURJUHVVR SHOR DSRLR UHFHELGR H interna no país, têm poucos resultados internacionais expressivos.
entusiasmo crescente da comunidade nacional deste esporte, tem 2V(VSRUWHVGH([SUHVVmR&RUSRUDOFRPRD*LQiVWLFD5tW-
REWLGRVLJQL¿FDWLYRVUHVXOWDGRVLQWHUQDFLRQDLVHXPDTXDQWL¿FDomR mica Desportiva, Aeróbica, Dança Esportiva etc, apresentam-se
FUHVFHQWHGRQ~PHURGHQDGDGRUHV FRPGLIHUHQWHVJUDXVGHGHVHQYROYLPHQWR$*LQiVWLFD5tWPLFD'HV-
SRUWLYDpSUDWLFDGDHPERPQtYHODSHQDVHPDOJXQVQ~FOHRVHVWD-
‡$RFRQWUiULRR1DGR6LQFURQL]DGRHRV6DOWRV2UQDPHQWDLV
GXDLV 3DUDQi0LQDV*HUDLV6mR3DXORH5LRGH-DQHLURSULQFLSDO-
FRP DOJXP SURJUHVVR QHFHVVLWDP GH XP DXPHQWR GR Q~PHUR GH
PHQWH $$HUyELFDRX*LQiVWLFD$HUyELFDWHPVHXVSyORVSULQFLSDLV
praticantes e técnicos especializados;
nos estados de São Paulo e Rio de Janeiro. Os demais esportes de
‡23yOR$TXiWLFRFRPXPQ~PHURSHTXHQRGHHTXLSHVORFD- expressão corporal têm pouca prática no país.
lizadas no eixo Rio-São Paulo, tem neste fator uma causa do pouco 27rQLVPHUHFHXPFRPHQWiULRHVSHFLDO(UDKiSRXFRWHP-
desenvolvimento brasileiro neste esporte, embora exista um poten- po, um esporte praticado pelas chamadas elites sociais, isto é, por
cial considerável de melhoria desta modalidade no Brasil. DTXHOHVGHPDLVUHQGD'HSRLVGR³(IHLWR*XJD´HVWHHVSRUWHHVWiVH
25HPRGHJUDQGHSRWHQFLDOGHYLGRDQRVVDLPHQVDFRVWD PXOWLSOLFDQGRTXDQWRDRQ~PHURGH
HDRVODJRVODJRDVHULRVGRSDtVFRQWLQXDFRPPXLWDVGL¿FXOGDGHV praticantes, principalmente entre os jovens brasileiros e hoje,
de desenvolvimento. Ao que parece, a falta de barcos modernos em pode-se esperar bons resultados num futuro próximo.
TXDQWLGDGHLQWHUFkPELRVFRPRH[WHULRULQIUDHVWUXWXUDHFDOHQGi- 1RV(VSRUWHVGH0RWRUHVR%UDVLOWHPJUDQGHGHVWDTXHLQ-
rios, explicam a ausência de um processo de melhoria. ternacional no Automobilismo, devido ao processo contínuo provo-
$&DQRDJHPSHORWHPSRTXHH[LVWHR¿FLDOPHQWHQR%UDVLO cado pelos mitos Emerson Fittipaldi, Nelson Piquet e Ayrton Senna,
tem apresentado progressos, mas está longe dos níveis que pode al- que, pelos seus sucessos, causaram uma grande migração de jovens
cançar. Tem todas as possibilidades de crescimento a medida que vá pilotos para as principais competições pelo mundo. De certa forma,
PXOWLSOLFDQGRRQ~PHURGHFDQRtVWDVHRVORFDLVGHSUiWLFD os pilotos brasileiros continuam brilhando. Nos outros esportes com
2V(VSRUWHV'HULYDGRVGDV$UWHV0DUFLDLV -XG{.DUDWr-LX- motores, como o Motociclismo, Motonáutica, Jet Sky e outros, a
-LWVX7DHNZRQG{$LNLG{HWF DSUHVHQWDPVHFRPXPJUDQGHQ~- participação brasileira é irregular, sem continuidade de registros ex-
mero de praticantes em todo o território nacional, sendo que, depois pressivos. Os esportes com motores são auto-sustentados, por causa
GR)XWHEROHGR)XWVDOUHSUHVHQWDPRPDLRUQ~PHURGHDWOHWDVFRP dos patrocínios e muitas vezes pelo interesse das televisões, como é
registro nas entidades. Apenas o Judô e o Taekwondô tiveram dis- o caso do Motociclismo.
putas olímpicas. Aliás, no Judô, o Brasil teve grandes conquistas, 1RV(VSRUWHV6XEDTXiWLFRV &DoD6XEPDULQD3HVFD0HU-
inclusive, dois campeões olímpicos. Os esportes derivados das artes JXOKRHWF R%UDVLOWHPXPUHWURVSHFWRVLJQL¿FDWLYRFRPXPDDWXD-
marciais são modalidades, que no esporte de rendimento, o inter- lidade apenas regular em termos de competições internacionais. O
FkPELRLQWHUQDFLRQDOpGHFLVLYRSDUDTXHVHREWHQKDERQVUHVXOWD- Q~PHURGHSUDWLFDQWHVDRORQJRGDQRVVDFRVWDHQRVULRVHODJRV
dos. Estes esportes têm nas graduações (faixas) um grande estímulo deixam um prognóstico favorável se a estrutura for melhorada.
para o desenvolvimento. 2,DWLVPRSUDWLFDGRSHODVFODVVHVGHSUHVWtJLRVRFLDOPDLV
elevadas, nas suas diversas opções de barcos, tem uma prática inter-
$V/XWDV %R[H/XWD2OtPSLFD/XWD*UHFR5RPDQD QmR
na auto-sustentada e grandes resultados e glórias nas competições
são da cultura esportiva nacional. Apenas o Boxe, praticado por es-
internacionais, como os Jogos Olímpicos e campeonatos mundiais.
tratos sociais mais baixos tem uma procura regular pela motivação
$VSDUWLFLSDo}HVEUDVLOHLUDVQRH[WHULRUFDUHFHPGHUHFXUVRV¿QDQ-
GH XP SRVVtYHO SUR¿VVLRQDOLVPR ,VWR ID] FRP TXH R %UDVLO WHQKD ceiros. As diversas classes de barco tem seus movimentos principal-
alguns destaques. Atualmente o “efeito Popó” tem provocado um mente nas regiões Leste e Sul do país.
aumento considerável de jovens ao Boxe, principalmente na Bahia. 27ULDWORHVSRUWHFULDGRQRV~OWLPRVDQRVFRPELQDQGR-
1DV OXWDV GH GLVSXWD ROtPSLFD D GL¿FXOGDGH GR HTXLSDPHQWR -se provas de Atletismo, Natação e Ciclismo, cresce rapidamente no
FDPSRGHOXWD WHPGL¿FXOWDGRDLQGDPDLVVHXVGHVHQYROYLPHQWRV SDtVFRPRDX[tOLRGDPtGLD0DVQRV~OWLPRVDQRVSDUHFHTXHHVWH
A indução por campanhas e facilitações são os caminhos para que os processo desacelerou. Por outro lado, o potencial continua grande
brasileiros procurem estas modalidades. pelo interesse que desperta nos jovens.
1RV(VSRUWHVGH$YHQWXUDHGD1DWXUH]DGHQRPLQDGRVSHOD 2&LFOLVPRSRGHULDHVWDUHPQtYHOGHFRPSHWLomREHPPDLV
mídia de Esportes Radicais, individuais, o Brasil tem obtido grandes DOWR SHOR SRWHQFLDO TXH DSUHVHQWD$ IDOWD GH LQWHUFkPELR LQWHUQD-
UHVXOWDGRV QDV FRPSHWLo}HV QR H[WHULRU$OpP GLVVR R Q~PHUR GH cional e de um calendário intenso que promova de fato este esporte
praticantes no país é considerável (Skate, Surfe, Vôo Livre etc). De SDUHFHTXHVmRDVYDULiYHLVGHGL¿FXOGDGHTXHH[LVWHP
XP PRGR JHUDO VmR HVSRUWHV VHP JUDQGHV GL¿FXOGDGHV ¿QDQFHLUDV 2%HLVHEROFRPRXPHVSRUWHFOiVVLFRQD$PpULFDGR1RUWH
para as competições, pois além dos patrocínios e espaço crescente e Central, no Brasil apenas atingiu a comunidade japonesa de São
QDPtGLDH[LVWHPRVSUrPLRV¿QDQFHLURV'HSRLVGR)XWHEROHVVHV Paulo. Para o seu desenvolvimento há a necessidade de uma difusão
esportes são os que ocupam maior tempo na televisão a cabo. mais ampliada.

Didatismo e Conhecimento 110


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
2V(VSRUWHV'HULYDGRVGH2XWURV(VSRUWHVIRUPDPXPFRQ- c) O ex-diretor da UNESCO René Maheu, que defendeu a tese
junto de franco progresso no Brasil. Do Tênis, as modalidades Bad- de que o Esporte e a Cultura vieram de uma mesma fonte: o lazer.
PLQJWRQ6TXDVKMiWHPXPQ~PHURUD]RiYHOGHDGHSWRVHQTXDQWR Para ele, o Esporte e a Cultura, ao introduzir a espontaneidade, além
o Paddle ainda está nos seus primeiros passos. Do Futebol saíram de remeterem a valores éticos, oferecem dignidade à liberdade.
o Futebol de Praia (Beach Soccer, uma variação), o Futebol Sete Pelos autores citados, e por muitos outros, é nítido que as prá-
RX6RFLHW\)XWVDOHWFWRGRVFRPJUDQGHQ~PHURGHSUDWLFDQWHV2V ticas de Esporte são componentes dos quadros culturais dos países.
esportes derivados de outros esportes não param de aparecer e de Existem, inclusive, modalidades esportivas que são consideradas
crescer. expressões de identidade cultural. No Brasil, o Futebol é uma mar-
2+LSLVPREHPGHVHQYROYLGRQRSDtVVHFRQVLGHUDUPRVDV ca cultural reconhecida em todo o mundo. Além do Futebol, outros
VXDVGL¿FXOGDGHVGHSUiWLFDpWDPEpPXPDPRGDOLGDGHSUDWLFDGD esportes também fazem parte do retrato cultural brasileiro. Por outro
por pessoas com mais possibilidades sociais. O Brasil tem melhora- lado, ainda há as modalidades esportivas de criação nacional como
do muito nas suas performances no exterior e a prática interna tem a capoeira, o futevolei, a peteca e outras que representam manifesta-
FUHVFLGR$GL¿FXOGDGHGHHQYLRGRVDQLPDLVSDUDFRPSHWLo}HVIRUD ções culturais surgidas no país e que até já estão chegando em outras
GR%UDVLOpVHPG~YLGDXPGRVyELFHVSDUDXPJUDQGHGHVHQYROYL- culturas do exterior.
mento deste esporte no país. $1HFHVVLGDGHGD'H¿QLomRGH3DSpLVGD8QLmRHGH6HJPHQ-
22. Os Esportes de Outras Identidades Culturais, são escassa- WRVGD6RFLHGDGH'LDQWHGR(VSRUWH([LVWHSRXFDVG~YLGDVVREUHRV
PHQWHSUDWLFDGRVQR%UDVLOFRPRH[HPSORR*ROIHSUDWLFDGRHP diversos papéis dos diferentes segmentos e setores da sociedade e do
FOXEHV H KRWpLV VR¿VWLFDGRV SRU SHVVRDV GH SRGHU DTXLVLWLYR PDLV Estado em relação ao Esporte. Entretanto, faz-se necessário reforçar
alto. O Cricket é apenas praticado nos centros de tradição inglesa. O a descrição destes papéis, uma vez que muitas vezes os quadros cir-
mesmo acontece com o Sumô, que tem conseguido algumas com- cunstanciais afastam esses setores sociais de suas missões e funções
petições nas comunidades japonesas. Outros tipos de lutas (Krav- e pelo fato de que uma Política dependerá sempre do exercício cor-
Magá, Kiukushin-Oyama etc) são praticados por comunidades loca- reto e adequado dos mesmos. Assim achou-se pertinente repassar
lizadas. O Brasil tem competido em algumas destas modalidades em os papéis da União, Estados, Municípios, entidades do Esporte ins-
eventos no exterior e até tem obtido alguns bons resultados. titucionalizado, universidades e instituições de Ciência, empresas,
1R(VSRUWH0LOLWDU 3HQWDWORV&RUULGDGH2ULHQWDomRHWF R PtGLDHGHPDLVyUJmRVS~EOLFRVHSULYDGRVHQYROYLGRVQRSURFHVVR
Brasil tem historicamente conseguido manter-se entre os principais esportivo brasileiro.
FRPSHWLGRUHVGRPXQGR$JUDQGHGL¿FXOGDGHVmRRVUHFXUVRV¿QDQ- Papel da União – A União deve considerar o Esporte em toda a
ceiros para esta participação internacional. sua abrangência social, como uma questão nacional de Estado, en-
 2V (VSRUWHV 3DUDROtPSLFRV SDUD DGDSWDGRV R %UDVLO WHYH volvendo todos os Ministérios e seus setores para que as práticas es-
XPDYDQoRPXLWRJUDQGHQRV~OWLPRVDQRVTXDQWRDUHVXOWDGRVHV- portivas venham constituir-se em meios de promoção da população,
SRUWLYRVLQWHUQDFLRQDLV(QWUHWDQWRQRSDtVRSURFHVVRGHTXDQWL¿- inclusive, visando a melhoria da qualidade de vida e auto- estima
cação ainda está longe do desejável. GRVEUDVLOHLURV3DUDDWLQJLUHVWD¿QDOLGDGHR(VWDGRGHYHUiFXPSULU
 2 (VSRUWH 8QLYHUVLWiULR GHSRLV GH GXUDQWH PXLWR WHPSR o seu Plano de Desenvolvimento do Esporte, no qual deverá estar
permanecer num processo entrópico referenciado nos Jogos Univer- inserida uma Política de maior alcance. No papel da União, invaria-
sitários Brasileiros (JUBs), começa a deslocar-se para as universi- velmente estão as seguintes indicações ou diretrizes:
GDGHV3HORQ~PHURFUHVFHQWHGHXQLYHUVLGDGHVSDUWLFXODUHVTXHYmR (VWDEHOHFHUR(VSRUWHFRPRXPDGDVSULRULGDGHVVRFLDLV
aderindo às federações e confederações nacionais, inclusive, dispu- 2. Elaborar o Plano Nacional de Desenvolvimento do Esporte;
WDQGRDVFRPSHWLo}HVSULQFLSDLVGRSDtV¿FDYLVtYHOTXHRHVSRUWH  3URPRYHU R GHVHQYROYLPHQWR GR (VSRUWH (GXFDFLRQDO (V-
universitário , reformulado, tem tudo para um grande progresso. porte Escolar e Esporte-lazer;
+iDLQGDXPERPQ~PHURGHHVSRUWHVSUDWLFDGRVQR%UDVLO )RPHQWDUDFDSDFLWDomRGHUHFXUVRVKXPDQRVTXHDWXDPQR
na perspectiva do rendimento, e em função do seu locus (ex.: Espor- Esporte do país;
te Classista), que ainda não possuem a representatividade descrita  'LVSRQLELOL]DU UHFXUVRV DWUDYpV GH DJrQFLDV GH IRPHQWR j
neste documento. ciência aplicada ao Esporte (Congressos, pesquisas, estudos, inter-
PREMISSAS O Reconhecimento do Esporte como Manifesta- FkPELRVODERUDWyULRVWHFQRORJLDHGLIXVmRGDLQIRUPDomR 
ção Cultural (VWLPXODUDLQG~VWULDQDFLRQDOGR(VSRUWH
A Cultura, entendida no sentido subjetivo como um complexo %XVFDUFRQYrQLRVLQWHUQDFLRQDLVHVSRUWLYRVTXHWUDJDPSUR-
GH YDORUHV VLJQL¿FDo}HV H REMHWRV VLPEyOLFRV TXH HVWmR LQVHULGRV gresso esportivo e/ou que contribuam para a cultura da paz;
no processo de formação intelectual do homem como um todo e, no  3URSLFLDU H LQFHQWLYDU D OLYUH LQLFLDWLYD QD RUJDQL]DomR HV-
sentido objetivo, como um conjunto de hábitos e criações humanas portiva;
em todos os seus planos de atividades, permite nestas duas concei- /HJLVODUSDUDTXHRSURFHVVRHVSRUWLYREUDVLOHLURWHQKDXP
tuações perceber que o Esporte deve ser compreendido como uma referencial legal compatível com o estágio de desenvolvimento al-
manifestação cultural. cançado;
Diversos autores da contemporaneidade reforçaram esta pers- &ULDUFRQGLo}HVOHJDLVIDYRUiYHLVDWUDYpVGHOHJLVODomRHV-
pectiva do Esporte como manifestação cultural, entre os quais: a) SHFt¿FDTXHWUDJDPRLQWHUHVVHGHSDWURFtQLRVHLQYHVWLPHQWRVGD
2HVSDQKRO*XLPDTXHQRVVHXVHVFULWRVHYLGHQFLRXTXHHQWHQGH iniciativa privada e atração da mídia, no sentido de um desenvolvi-
a cultura pela interpretação da sociedade a partir das práticas espor- mento auto sustentado do Esporte;
tivas; /HJLVODUSDUDTXHDVHQWLGDGHVHVSRUWLYDVSRVVDPDGTXLULU
E  2 ¿OyVRIR SRUWXJXrV 0DQXHO 6HUJLR SDL GD FRQFHSomR GD sem tributação, os equipamentos esportivos indisponíveis no Brasil;
Ciência da Motricidade Humana, que mostrou que o Esporte e a (VWDEHOHFHUOHLVHQRUPDVTXHFRPEDWDPRVLOtFLWRVGR(V-
Cultura se encontram no jogo; porte, inclusive, contra o doping;

Didatismo e Conhecimento 111


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
(VWLPXODUHDSRLDURV(VWDGRVH0XQLFtSLRVQDVVXDVDo}HV  $SRLDU DV RUJDQL]Do}HV HVSRUWLYDV HVWDGXDLV IHGHUDo}HV
para o desenvolvimento do Esporte em seus territórios; associações etc);
'LVSRQLELOL]DUSDWURFtQLRVHLQYHVWLPHQWRVSHODVHPSUHVDV 'LIXQGLUHSURPRYHURVHVSRUWHVGHFULDomRGR(VWDGRFRP
de responsabilidade da União, para as entidades esportivas e ações SURJUDPDVHVSHFLDLV$SRLDUDVSUiWLFDVHVSRUWLYDVGDVSHVVRDV
do Plano Nacional de Desenvolvimento do Esporte; com necessidades especiais;
,QYHVWLUUHFXUVRVS~EOLFRVQDLQIUDHVWUXWXUDHVSRUWLYD LQV- 'HVHQYROYHUHDSRLDUSURJUDPDVSDUDFULDQoDVHDGROHVFHQ-
talações e equipamentos) de acordo com os objetivos formulados no tes carentes;
Plano Nacional de Desenvolvimento do Esporte; $SRLDUHGHVHQYROYHUSURJUDPDVHVSRUWLYRVSDUDDFKDPDGD
 &RQWULEXLU SDUD D PHOKRULD FRQVWDQWH GD SHUIRUPDQFH GDV terceira idade;
equipes nacionais nos competições internacionais; 3URSLFLDUDLQVHUomRGHSURJUDPDVHHYHQWRVHVSRUWLYRVQRV
'LIXQGLUHSURPRYHUFRPSURJUDPDVGLIHUHQFLDGRVRVHV- calendários e programações turísticas;
portes de criação nacional e identidade cultural; Papel dos Municípios – Os Municípios têm um papel dos mais
$SRLDUR(VSRUWHSDUDSHVVRDVFRPQHFHVVLGDGHVHVSHFLDLV importantes nas práticas esportivas populares ou comunitárias, além
inclusive, nas participações internacionais; de uma responsabilidade direta nas escolas fundamentais quanto ao
'HVHQYROYHUHDSRLDUSURJUDPDVGHSUiWLFDVHVSRUWLYDVSDUD Esporte Educacional e Esporte Escolar. A seguir, apresenta-se as
grupos em estado de carência, principalmente com crianças e ado- ações consideradas prioritárias para os governos municipais:
lescentes; (QWHQGHURHVSRUWHFRPRXPDGDVSULRULGDGHVPXQLFLSDLVUH-
'HVHQYROYHUSURJUDPDVHVSHFLDLVHVSRUWLYRVGHSUHVHUYDomR lacionadas à Qualidade de Vida das pessoas, elaborando uma Políti-
GDFXOWXUDLQGtJHQD$SRLDUSURJUDPDVHVSRUWLYRVGDFKDPDGD ca Municipal de Esporte e um Plano conseqüente;
terceira Idade; 2. Desenvolver o Esporte Educacional no ensino fundamental
22. Estimular a interseção do Esporte com o Turismo, favore- na perspectiva da formação para a cidadania e de dar oportunidades
cendo a introdução de programas e eventos esportivos nos calendá- de práticas esportivas para os jovens que se apresentarem com con-
rios e promoções turísticas; dições;
3URPRYHUHDSRLDUDUHDOL]DomRGHFRPSHWLo}HVHVSRUWLYDV  ,QYHVWLU UHFXUVRV S~EOLFRV SDUD GLVSRQLELOL]DomR GH LQVWDOD-
internacionais no Brasil;
ções esportivas para as práticas populares de lazer, atendendo as vo-
$SRLDUDSDUWLFLSDomRGHEUDVLOHLURV GLULJHQWHVWpFQLFRVH
cações esportivas e culturais das pessoas do município;
cientistas) nas entidades internacionais esportivas.
3URPRYHUHYHQWRVHVSRUWLYRV
Papel dos Estados – Os Estados, incluindo o Distrito Federal e
'HVHQYROYHUSURMHWRVHVSRUWLYRVHVSHFt¿FRVGHLQWHUHVVHGR
os Territórios, deverão formular e aplicar as Políticas e Planos Esta-
município;
duais do Esporte, a partir de diagnósticos ou inventários efetuados.
0RELOL]DUDLQLFLDWLYDSULYDGDSDUDRVSURMHWRVHVSRUWLYRVGR
Nestes planos estarão as ações que delinearão o papel desejável.
município;
Lista-se abaixo as ações julgadas prioritárias:
'HVWLQDUUHFXUVRVSDUDDVDWLYLGDGHVHVSRUWLYDVHPJHUDO )RPHQWDUHVFRODVGHDSUHQGL]DJHPHVSRUWLYDSULQFLSDOPHQWH
2. Desenvolver o Esporte Educacional e Esporte Escolar nas em determinadas modalidades que expressam as vocações esporti-
perspectivas da formação para a cidadania e de dar oportunidades vas do município;
de práticas esportivas para os jovens que se apresentarem com con-  'DU FRQGLo}HV GH WUDEDOKR SDUD RV UHFXUVRV KXPDQRV TXH
dições; DWXDPQRVHVSDoRVS~EOLFRVHVSRUWLYRVGRPXQLFtSLR
3URPRYHUHYHQWRVHVSRUWLYRVVREGLYHUVDVIRUPDV FLGDGHV  &ULDU QR kPELWR PXQLFLSDO XPD OHJLVODomR TXH IDYRUHoD R
associações, escolas, mistas etc); desenvolvimento esportivo do município com a adesão, inclusive,
(VWLPXODUDSHVTXLVDFLHQWt¿FDUHODWLYDDR(VSRUWHDWUDYpVGD da iniciativa provada;
GLVSRQLELOL]DomRGHUHFXUVRVSRUDJrQFLDVGH¿QDQFLDPHQWR  &RQWULEXLU FRP DV DVVRFLDo}HV HVSRUWLYDV SULQFLSDOPHQWH
 'HVHQYROYHU SURMHWRV HVSRUWLYRV HVSHFt¿FRV GH VLWXDo}HV H aquelas que possam representar a imagem do município quanto às
FLUFXQVWkQFLDVGRHVWDGRGHDFRUGRFRPD3ROtWLFD(VWDGXDOGH(V- suas tradições e vocações esportivas;
porte; $SRLDUDWUDYpVGHSURJUDPDVHVSHFLDLVRVWDOHQWRVHVSRU-
$SRLDU DV LQLFLDWLYDV H PRYLPHQWRV PXQLFLSDLV D IDYRU GR tivos surgidos, de forma que eles tenham condições de desenvolvi-
desenvolvimento do Esporte; mento atlético;
)RPHQWDUDFDSDFLWDomRGHUHFXUVRVKXPDQRVTXHDWXDPQR 'LIXQGLUHSURPRYHURVHVSRUWHVGHFULDomRUHJLRQDO
(VSRUWHGRHVWDGR)DYRUHFHUDLQVWDODomRGHXQLGDGHVLQGXVWULDLV $SRLDUDVSUiWLFDVHVSRUWLYDVGDVSHVVRDVFRPQHFHVVLGDGHV
produtoras de equipamentos e material esportivo no estado; especiais;
&ULDUQDVXDMXULVGLomROHLVTXHIDYRUHoDPRGHVHQYROYLPHQ- 'HVHQYROYHUSURJUDPDVHVSRUWLYRVSDUDFULDQoDVHDGROHV-
WRHVSRUWLYRHVWDGXDO'LVSRQLELOL]DUSDWURFtQLRVHLQYHVWLPHQWRV centes carentes;
pelas empresas de responsabilidade do Estado, para as entidades &ULDUHGHVHQYROYHUSURJUDPDVHVSRUWLYRVSDUDDFKDPDGD
esportivas estaduais e ações previstas no Plano Estadual de Desen- terceira idade;
volvimento do Esporte; 3URSLFLDUTXHRVSURJUDPDVHHYHQWRVHVSRUWLYRVIDoDPSDU-
,QYHVWLUUHFXUVRVS~EOLFRVGR(VWDGRQDLQIUDHVWUXWXUDHV- te dos calendários e programações turísticas do município;
portiva estadual (instalações e equipamentos), de acordo com os Papel das Entidades do Esporte Institucionalizado – O Comi-
objetivos formulados no Plano Estadual de Desenvolvimento do tê Olímpico Brasileiro (COB) e o Comitê Paraolímpico Brasileiro
Esporte; (CPB), as Confederações Esportivas Nacionais, as Federações Es-
&RQWULEXLUSDUDDPHOKRULDGDVUHSUHVHQWDo}HVHVSRUWLYDVGR portiva Estaduais e as associações esportivas constituem as entida-
Estado nas competições nacionais; des principais do esporte institucionalizado e têm um papel relacio-

Didatismo e Conhecimento 112


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
nado com o desenvolvimento do esporte de rendimento. O COB, RPRGHORXVDGRHPQmRVHUYLULDSDUDXPHVWXGRVREUHRDWXDO
por sua vez, além desta responsabilidade, tem compromissos diretos momento do esporte brasileiro, pois na situação anterior, inclusive, o
com o Movimento Olímpico Internacional, que tem sido o sentido esporte era entendido somente como rendimento, isto é, existia uni-
de ética esportiva em todo o mundo. Estas entidades, entre as quais camente no documentos legais do país o esporte institucionalizado e
também se encontram aquelas desvinculadas ao Olimpismo, têm seu as práticas não-formais esportivas eram entendidas como recreação.
papel expresso pelas seguintes ações: Hoje, o Brasil precisa de um processo permanente de avaliação
5HSUHVHQWDUR%UDVLOQDVFRPSHWLo}HVLQWHUQDFLRQDLV2&2% que permita um direcionamento correto dos recursos disponíveis
coordenará a participação brasileira nas competições do Movimento para o esporte. Em outras palavras, precisa ser instado um processo
Olímpico e o CPB, as competições do movimento paraolímpico; de aplicação contínua de diagnósticos que permita os retratos do
2. Estabelecer Planos de Expectativa para cada esporte, os quais esporte no país, a cada novo momento. Como o Esporte Educa-
compreenderão um ciclo de alguns anos. O mais comum será o ciclo cional, o Esporte Escolar e o Esporte-Lazer são responsabilidades
olímpico, isto é, de uma disputa de Jogos Olímpicos ao próximo. preponderantes dos Estados e cidades, os diagnósticos sobre estas
Entretanto, de acordo com as características e o contexto de cada manifestações deverão ser desenvolvidos pelos governos estaduais
modalidade, este plano poderá variar, chegando a mais ou menos e prefeituras municipais, sobre indicadores sócio-esportivos como:
tempo;  LQVWDODo}HV H HTXLSDPHQWRV GLVSRQtYHLV JLQiVLRV TXDGUDV
(ODERUDUXP3ODQR,QWHUQRGH'HVHQYROYLPHQWRGDVPRGDOL- praças, praias, aparelhos para esporte etc);
dades sob suas responsabilidades no país, inclusive, quanto a recur- Q~PHURGHSUDWLFDQWHV
sos humanos (técnicos, administradores, árbitros etc); SURJUDPDVH[LVWHQWHV HVFRODVHVSRUWLYDVSURJUDPDVGHDGXO-
%XVFDUPHLRVSDUDXPDSDUWLFLSDomRSROtWLFDQRH[WHULRUSDUD tos e idosos etc);
fortalecer a posição brasileira no contexto internacional; YRFDo}HVHVSRUWLYDV SHODVWUDGLo}HV 
2UJDQL]DUFDOHQGiULRVGRVHVSRUWHVVREVXDUHVSRQVDELOLGDGH WLSRVGHJHVWmRHRUJDQL]DomR
QRSDtVHFXPSULORFRPH¿FLrQFLD UHFXUVRV¿QDQFHLURVGLVSRQtYHLV
$GPLQLVWUDUWRGRVRVDVVXQWRVGRVHVSRUWHVGRVTXDLVVmRUHV- DSRLRGDLQLFLDWLYDSULYDGD DTXHH[LVWHHDSRWHQFLDO 
ponsáveis, por todo o território nacional. UHFXUVRVKXPDQRVH[LVWHQWHV
Papel da Universidades e das Agências de Fomento à Ciência – HVWXGRVREUHDSRSXODomR SHUFHQWXDLVSRUIDL[DHWiULD 
As Universidades e as Agências de Ciência são responsáveis diretas  RXWURV LQGLFDGRUHV MXOJDGRV SHUWLQHQWHV SDUD FDGD FDVR$
pela formação de recursos humanos e pela transformação do conhe- FRQVWUXomRGHXPDUHGHH¿FD]GHLQIRUPDo}HVSHUPLWLUiDVWRWDOL-
cimento. Assim, na área do Esporte, o papel destas instituições pode zações necessárias nestes indicadores do chamado Esporte Social.
ser descrito por estas ações: Entretanto, um diagnóstico nacional exige ainda uma análise
 )RUPDU UHFXUVRV KXPDQRV SHOD XQLYHUVLGDGHV SDUWLFXODU- detalhada sobre cada modalidade esportiva, com outros indicadores
mente no curso de Educação Física, para atuar nos diversos espaços HVSHFt¿FRVDVHUHPOHYDQWDGRVFRPR
de trabalho ao Esporte, em nível de extensão, graduação e pós-gra- DQiOLVHTXDOLWDWLYDGDJHVWmRHRUJDQL]DomRHVSRUWLYD FRQIH-
duação (Universidades); deração nacional e federações esportivas)
2. Debater nas universidades sobre os problemas e questões do 2. posicionamento político no cenário internacional (participa-
processo do esporte brasileiro (Universidades); ções de dirigentes da federação internacional da modalidade)
 )LQDQFLDU LQYHVWLJDo}HV FLHQWt¿FDV VREUH R (VSRUWH SHODV  DQiOLVH GR SRVLFLRQDPHQWR LQWHUQDFLRQDO GD PRGDOLGDGH
DJrQFLDVGH¿QDQFLDPHQWRGHSHVTXLVD $JrQFLDVGH3HVTXLVD  DWUDYpVGRVUHVXOWDGRVLQWHUQDFLRQDLVGRV~OWLPRVWHPSRVQRPDV-
$SRLDURVSHVTXLVDGRUHVGD&LrQFLDGR(VSRUWHSURSLFLDQGR culino e no feminino)
DVFRQGLo}HVQHFHVViULDVSDUDDVVXDVDWLYLGDGHVFLHQWt¿FDV 8QLYHU- PRGHORGDPRGDOLGDGHQRSDtV RSo}HVUHJLVWUDGDVQDVHTXL-
sidades e Agências de Pesquisa). pes: clubes, cidades, empresas, universidades, esquemas mistos etc)
O Papel das Empresas Estatais (Banco do Brasil, Caixa Econô- OHYDQWDPHQWRGDLQLFLDomRHVSRUWLYDQDPRGDOLGDGH TXDQWL-
PLFD3HWUREUDV&RUUHLRVHRXWURVD¿QV ±$WpRPRPHQWRDVFKDPD- GDGHHGLVWULEXLomRJHRJUi¿FD
das empresas estatais têm patrocinado alguns esportes num entendi- FRPSURPHWLPHQWRGDPtGLD SULQFLSDOPHQWHDWHOHYLVmR SHOD
mento direto empresa-confederação esportiva. Este processo parece modalidade
incompleto, uma vez que ao tratar-se de uma empresa estatal e con- FRPSURPHWLPHQWRGHSDWURFLQDGRUHV SULYDGRVHHVWDWDLV QD
sequentemente inserida numa política de Estado, muitas vezes não modalidade
está atendendo às prioridades esportivas formuladas pelo governo, HODERUDomRGHUDQNLQJVWpFQLFRV SRUHVWDGRVHDVVRFLDo}HV
através do Ministério do Esporte e Turismo (MET). Embora estas de prática, masculino e feminino)
empresas estatais têm propiciado grandes progressos em alguns es- GHSHQGrQFLDGHHTXLSDPHQWRVGRH[WHULRU
portes, há necessidade de uma revisão neste papel. A reformulação,  DQiOLVH TXDOLWDWLYD GRV FDPSHRQDWRV H WRUQHLRV QDFLRQDLV
para que elas exerçam um papel compatível com o seu potencial regionais e estaduais masculinos e femininos)
de contribuição, passa pela direção dos recursos disponibilizados, DQiOLVHGRVPHLRVFLHQWt¿FRVGHDSRLRjPRGDOLGDGH ODERUD-
revisão do processo decisório e aumento dos repasses. tórios, congressos, estudos etc)
HVTXHPDVGHLQWHUFkPELRLQWHUQDFLRQDO
A Necessidade de um Diagnóstico para o Esporte Brasileiro DQiOLVHTXDOLWDWLYDHTXDQWLWDWLYDGRVWpFQLFRVHPDWLYLGDGH
e dos outros recursos humanos da modalidade
O Brasil só teve um diagnóstico esportivo, o qual ocorreu em ORFDOL]DomRJHRJUi¿FDGRVSyORVPDLVGHVHQYROYLGRVGRHV-
HTXHQDpSRFDVHUYLXSDUDWRGDDSROtWLFDQDFLRQDOGH(GXFDomR porte (de rendimento e de prática não-formal masculino e feminino)
)tVLFDH(VSRUWHVHVHUYLXFRPRUD]mRSDUDPRGL¿FDomRGDOHJLVOD- LGHQWL¿FDomRGRVSRQWRVFRQVLGHUDGRVIRUWHVGDSUiWLFDGHV-
omRYLJHQWHSURYRFDQGRD/HLQžHP(YLGHQWHPHQWHTXH te esporte no país

Didatismo e Conhecimento 113


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
GHVFULomRGDVGH¿FLrQFLDVGHVWHHVSRUWHQRSDtV ros às práticas esportivas, estabeleceu, no seu primeiro momento,
RXWURVLQGLFDGRUHVMXOJDGRVSHUWLQHQWHVSDUDFDGDFDVR$SyV um Ministro Extraordinário dos Esportes, convidando, para o exer-
o levantamento relativo a estes indicadores listados, a modalidade cício da missão, o mais famoso dos esportistas do país: o Pelé. Num
GLDJQRVWLFDGDGHYHUiVHUFODVVL¿FDGDGHDFRUGRFRPFDGDXPDGDV segundo momento, o presidente Fernando Henrique Cardoso criou
opções abaixo: o Ministério do Esporte e do Turismo, elevando o status do trata-
a) esportes considerados desenvolvidos; mento dos assuntos esportivos para o nível ministerial. Esta medida
b) esportes considerados em desenvolvimento; consolidou a posição do esporte como questão nacional, o que pode
F HVSRUWHVFRQVLGHUDGRVQmRGHVHQYROYLGRV(VWDFODVVL¿FDomR VHUMXVWL¿FDGRSHODDPSOLDomRFRQVLGHUiYHOGHVHXDOFDQFHVRFLDO
poderá receber outras categorias de acordo com os dados levanta- O Esporte, ao deixar de ser entendido unicamente na perspec-
dos. Outra observação importante é a indispensável distinção entre tiva do rendimento e passar a ser percebido também na perspectiva
a categorização do esporte masculino e do esporte feminino. Esta GR VRFLDO (VSRUWH (GXFDFLRQDO (VSRUWH SDUD 3RUWDGRUHV GH 'H¿-
FDWHJRUL]DomR VHP G~YLGD IDFLOLWDUi QD HODERUDomR GRV SODQRV GH ciências, Esporte para a Terceira Idade, Esporte para as Pessoas Co-
GHVHQYROYLPHQWRHGHVWLQDomRGHPHGLGDVHUHFXUVRV¿QDQFHLURV PXQVHWF SDVVRXDLQWHUYLUHIHWLYDPHQWHQD6D~GHQD(GXFDomRH
no Lazer das pessoas. É evidente que esta abrangência ampliada do
O Esporte Brasileiro Deve Ser Uma Questão de Estado alcance do Esporte no país, fez com que o mesmo fosse gradualmen-
te se tornando uma prioridade do Estado.
Um dos aspectos mais discutidos pela intelectualidade bra- Esta mobilização do povo brasileiro em torno do Esporte, seja
sileira tem sido quais são as verdadeiras questões nacionais. Esse nas práticas esportivas não-formais ou acompanhando o esporte de
DVVXQWR VHPSUH GHL[RX G~YLGDV DWp SHORV FRQWRUQRV GLIHUHQWHV GH DOWD FRPSHWLomR FRPR D¿FLRQDGR SURYRFRX XP HQYROYLPHQWR GD
nosso próprio processo civilizatório, pois até a nossa independência maioria dos setores governamentais nos assuntos do esporte. Atual-
foi concretizada por um herdeiro da Coroa Portuguesa, não permi- PHQWHH[LVWHXPDLQG~VWULDGR(VSRUWHHPFUHVFLPHQWRXPDEXVFD
tido, como ocorreu em outros países, uma consolidação desejável permanente de qualidade de vida através de um estilo de vida ativo
do conceito de nação. A Abolição da Escravatura foi ainda mais um no qual a prática esportiva está sempre presente, um aumento dos
episódio histórico conseqüente da Coroa Portuguesa do que da as- espaços ocupacionais de trabalho nas atividades esportivas, um de-
piração do povo brasileiro. Da mesma forma, também a Proclama- senvolvimento da ciência aplicada ao esporte e interseções cada vez
omRGD5HS~EOLFDIRLRULXQGDGDVHOLWHVGRSDtVQmRGHL[DQGRXPD PDLVIRUWHVGDViUHDVGD6D~GH(GXFDomR/D]HUH7XULVPRFRPRV
participação protagonista da maioria dos brasileiros. Foi nesse pro-
fatos esportivos. No Brasil, cada vez mais o esporte se efetiva como
cesso, recheado de concessões das elites e de soluços nacionalistas,
questão nacional. O interesse e o acompanhamento do povo brasi-
misturadas com apelos patrióticos isolados, que o Estado brasileiro
leiro pelos resultados esportivos brasileiros nas Copas do Mundo,
cresceu, alternando as questões nacionais legítimas e não-legítimas,
Jogos Olímpicos, Torneios Internacionais de Tênis, Provas Interna-
DVTXDLVIRUDPGHPDUFDQGRVREGLIHUHQWHVkQJXORVHSHUVSHFWLYDV
cionais de Automobilismo e demais competições esportivas contra
a nossa própria história. A população, muitas vezes, chegou a aderir
outros países colocam o esporte de forma inequívoca como questão
a essas questões e, em outras, apenas acompanhar o processo ins-
QDFLRQDOLPSRUWDQWH6RPDVHDLVWRDVSROtWLFDVS~EOLFDVPXQLFLSDLV
WDODGR1RPXQGRFRQWHPSRUkQHRJOREDOL]DGRXPGRVH[HUFtFLRV
e estaduais, preocupados em desenvolver o esporte educacional e
GLItFHLVpMXVWDPHQWHLGHQWL¿FDUDVTXHVW}HVHVVHQFLDOPHQWHQDFLR-
nais, destacando-as das outras, as quais, na verdade, constituem-se o esporte lazer, procurando a democratização das oportunidades de
DSHQDVHPSUREOHPDVHSLVyGLFRV2H[HUFtFLRGDLGHQWL¿FDomRGDV prática esportiva.
verdadeiras questões nacionais nos encaminha para os nortes das Nesta perspectiva do esporte como questão nacional, o Minis-
SROtWLFDVHDo}HVS~EOLFDV WpULRGR(VSRUWHH7XULVPR 0(7 QmRSRGHVHUR~QLFRUHVSRQViYHO
2(VSRUWHVHPG~YLGDpXPDGDVTXHVW}HVTXHWHPSDVVDGR pelo esporte brasileiro. Ao contrário, na sua missão de coordenar e
GHVSHUFHELGR QHVVH FDPLQKR GH LGHQWL¿FDomR GDV TXHVW}HV QDFLR- D¿UPDUDRUTXHVWUDomRVRFLDOSDUDTXHRHVSRUWHIDYRUHoDDWRGRVRV
nais de cada ciclo histórico. Paradoxalmente, quando estamos no brasileiros em mais este dos seus direitos constitucionais, o MET
exterior, facilmente tomamos conhecimento que o Brasil é identi- criará relações de interdependência e interação entre os poderes e
¿FDGRSULQFLSDOPHQWHSHODQRVVDDUWHHSHORQRVVRHVSRUWH1RVVRV com os outros Ministérios, Estados e Municípios. A consciência na-
heróis esportivos como Pelé, Ayrton Senna, Ademar Ferreira da FLRQDOVREUHDUHOHYkQFLDVRFLDOGR(VSRUWHHGHTXHRPHVPRGHYD
6LOYD*XJD.XHUWHQHPXLWRVRXWURVIRUDPHFRQWLQXDPDVHURV ser tratado como questão de Estado, certamente propiciará mais e
grandes embaixadores do Brasil em todos os cantos do mundo. O melhores condições para a projeção internacional do país e, na pró-
futebol, como todos sabemos, é parte essencial da identidade brasi- pria auto-estima e qualidade de vida dos brasileiros.
leira, como relata Roberto da Matta. Por outro lado, internamente,
em todo o país, nossos atletas e nossas conquistas esportivas, cons- AÇÕES OPERATIVAS
tituem-se nos próprios pilares da auto-estima da nação brasileira.
1RPXQGRGLQkPLFRGRVHVSRUWHVHPTXHDFDGDGLDVXUJHP ¬ OX] GDV VXJHVW}HV GRV *UXSRV 7HPiWLFRV (VSRUWH GH %DVH
mais modalidades, acontecem mais competições e a mídia (princi- Desenvolvimento do Esporte, Esporte de Rendimento e Esporte
palmente a televisão) vai aumentando o interesse, o Brasil vai se SDUD3HVVRDV3RUWDGRUDVGH'H¿FLrQFLDTXHFRQVWLWXHPD&kPDUD
D¿UPDQGRQRVFHQiULRVLQWHUQDFLRQDOHQDFLRQDOIRUWDOHFHQGRDLQGD Setorial do Esporte, instalados pelo Exmo. Sr. Ministro de Estado
mais a relação do Esporte na nossa identidade cultural. O governo do Esporte e Turismo, Carlos Melles, após a análise das premissas
EUDVLOHLURDRUHFRQKHFHUDLPSRUWkQFLDGRIHQ{PHQRHVSRUWLYRHP da Política Nacional do Esporte, e considerando as referências
FRPSOHWDFRQVRQkQFLDFRPRSUHkPEXORGRDUWGD&RQVWLWXLomR necessárias, chegou-se às Ações Operacionais, as quais estão
)HGHUDOGHTXHUHFRQKHFHXRGLUHLWRGHFDGDXPGRVEUDVLOHL- vinculadas nos temas dos grupos.

Didatismo e Conhecimento 114


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Esporte de Base Ações

A Educação Física, o Esporte Educacional, o Esporte Escolar $(GXFDomR)tVLFDFRPRGLUHLWRGHWRGRVGHYHVHUREULJDWy-


H R (VSRUWH &RPXQLWiULR &RQVLGHUDo}HV ‡$ (GXFDomR )tVLFD QR ria no ensino fundamental e médio, inclusive nos cursos noturnos;
seu conceito renovado pelo Manifesto Mundial de Educação Físi-  2 (VSRUWH (GXFDFLRQDO SHOD VXD UHOHYkQFLD FRQFHLWXDO H
FD ),(3  HGLWDGR SHOD )HGHUDomR ,QWHUQDFLRQDO GH (GXFDomR como meio de desenvolvimento integral dos indivíduos e para a sua
)tVLFD p LQGLFDGD FRPR XP GLUHLWR GH WRGRV H TXH D /HL Qž  formação de cidadão, deve ser promovido em todo território educa-
GH  /HL GH 'LUHWUL]HV H %DVHV GD (GXFDomR 1DFLRQDO  FLRQDODWUDYpVGHFDPSDQKDVHSURJUDPDVHVSHFt¿FRV
DSHQDVSUHVFUHYHSHOR†žGRDUWTXHD(GXFDomR)tVLFDGHYH 2(VSRUWH(VFRODUGHYHVHULPSOHPHQWDGRSRUXP3URJUDPD
estar integrada à proposta pedagógica da escola, como componente Nacional do Esporte Escolar, que atinja todos os estados brasilei-
curricular da Educação Básica, sendo facultada ao ensino noturno; ros, fomentando desde as competições escolares municipais até as
‡$ (GXFDomR )tVLFD DSUHVHQWDVH FRP DPSODV SRVVLELOLGDGHV nacionais. Este programa deverá ainda propiciar diagnósticos (mu-
de desenvolver a dimensão psicomotora dos alunos, conjuntamente nicipais, estaduais e nacional), publicações de esclarecimento e inte-
com os domínios cognitivos e sociais, oferecendo oportunidades de gração com as comunidades;
aumentar suas potencialidades, de forma democrática e não seletiva, $VDo}HVGH(GXFDomR)tVLFD(VSRUWH(GXFDFLRQDOH(VSRUWH
aprimorando-os como seres humanos; (VFRODUGHYHUmRDSUHVHQWDUSURJUDPDVHVSHFt¿FRVFRPDGDSWDo}HV
‡$'HFODUDomRGH3XQWDGHO(VWHSXEOLFDGDQRLQIRUPH¿QDOGD LQFOXVLYH GH LQVWDODo}HV H DJUXSDPHQWRV DRV SRUWDGRUHV GH GH¿-
Terceira Conferência Internacional de Ministros e Altos Funcioná- ciências físicas;
rios Encarregados da Educação Física e do Esporte (MINEPS III), 2(VSRUWHFRPRTXHVWmRGH(VWDGRGHYHSURSLFLDUQRDP-
SURPRYLGDSHOD81(6&2QRVHXDUWUHLWHURXDLPSRUWkQFLDGD biente escolar, a consecução de parcerias entre segmentos do gover-
Educação Física e do Esporte como elemento essencial e parte in- no para que a juventude brasileira tenha a oportunidade de obter os
tegrante do processo de Educação Permanente e desenvolvimento seus benefícios;
humano e social; 1DFRQVWUXomRGHQRYDVHVFRODVQRSDtVGHYHUmRFRQVWDUGH
‡$&RPLVVmR,,GD0,1(36,,,DSyVHVWDEHOHFHUD(GXFDomR instalações e espaços esportivos para a Educação Física, Esporte
Educacional e Esporte Escolar;
Física e o Esporte como direito fundamental das crianças e jovens
2(VSRUWH&RPXQLWiULRFRPRXPDPDQLIHVWDomRGHGHPR-
do mundo, reconheceu que são meios essenciais para a qualidade de
cratização das oportunidades de práticas esportivas, deve ser fomen-
YLGDDVD~GHHREHPHVWDUGHWRGDVDVSHVVRDV
tado por um Programa Nacional de Esporte Comunitário.
‡2(VSRUWH(GXFDFLRQDOSHOD/HLQžGHQRVHX
DUWž,QFLVR,HVWiFRQFHLWXDGRFRPRDTXHODPDQLIHVWDomRHVSRU-
Desenvolvimento do Esporte Legislação e Esporte Brasileiro
tiva praticada nos sistemas de ensino e em formas assistemáticas
Auto-Sustentado
de Educação, evitando-se a seletividade, a hipercompetitividade de
VHXV SUDWLFDQWHV FRP D ¿QDOLGDGH GH DOFDQoDU R GHVHQYROYLPHQWR Considerações
integral do indivíduo e a sua formação para o exercício da cidadania
e a prática do lazer; ‡2SURFHVVRGHGHVHQYROYLPHQWRGRHVSRUWHEUDVLOHLURIRLKLV-
‡2(VSRUWH(GXFDFLRQDOQRFRQFHLWRDFLPDpUHIHUHQFLDGRHP WRULFDPHQWHLQVX¿FLHQWHHSUHMXGLFDGRSHODIDOWDGHHVWtPXORVOHJDLV
princípios sócio- educativos, como os princípios da inclusão, da par- e tarifários, principalmente o esporte de rendimento, pelo seu alto
ticipação, da cooperação, da co-educação, da co-responsabilidade, e custo, explicado pelo cumprimento dos calendários internacionais e
RXWURVHHVWiFRQVROLGDGRFRPRSULRULGDGHGHUHFXUVRVS~EOLFRVQR nacionais, importação de equipamentos de competição, treinamento
DUWGD&RQVWLWXLomR)HGHUDOGH HSHVTXLVDSUR¿VVLRQDOLVPRDLQGDQmRYLDELOL]DGR¿QDQFHLUDPHQWH
‡+iXPDDFHLWDomRLQWHUQDFLRQDOTXHHR(VSRUWH(VFRODUGL- no que diz respeito às receitas de patrocínio e adesão da mídia;
ferentemente do Esporte Educacional, embora tenham pontos co- ‡$DQWLJD/HLQžDUWFRQFHGLDLVHQomRDR,PSRV-
muns ao incorporar objetivos educativos, é aquele disputado nos to de Importação e ao Imposto sobre Produtos Industrializados, aos
ambientes escolares, com os mesmos códigos e regras do esporte de equipamentos destinados à prática de esportes e que, a eliminação
competição de adultos, privilegiando os jovens de mais habilidade deste benefício deixou o Brasil em grande desvantagem diante dos
esportiva, inclusive, oferecendo condições para que desenvolvam centros esportivos da Europa, América do Norte e Ásia;
suas potencialidades, sem descuidar da formação para a cidadania; ‡$VHQWLGDGHVGLULJHQWHVGR(VSRUWHDSHVDUGRLPSRUWDQWHVHU-
‡2IDWRGD/HLQžWHUHVWDEHOHFLGRD(GXFDomR)tVLFDSHOR viço que prestam à representatividade do Brasil no exterior e da ação
DUW†žFRPRFRPSRQHQWHFXUULFXODUGD(GXFDomR%iVLFDHTXH esportiva social federativa que praticam pelo desenvolvimento es-
a promoção do Esporte Educacional e das práticas esportivas não- portivo interno das modalidades esportivas no país, não estão isentas
IRUPDLVHVWmRFRPSUHHQGLGRVQRDUW,QFLVR9SHUPLWHDLQWHU- HP WHUPRV ¿VFDLV QR &yGLJR7ULEXWiULR 1DFLRQDO GH  /HL Qž
pretação de que a Educação Física e o Esporte Educacional pelo art. DUW
,QFLVRV,,,,,9H9,,WrPDDTXLVLomRHPDQXWHQomRGHPDWHULDO ‡2GLUHLWRGHLPDJHP/HLQžDUWQmRLQFOXLDV
contemplados, quando efetuados em ambiência escolar; entidades de administração esportiva nos eventos por elas organi-
‡9iULRVPLQLVWpULos e setores do governo federal têm responsa- zados;
bilidades diretas com as crianças, adolescentes e jovens, principal- ‡2(VSRUWHEUDVLOHLURDSHVDUGDVDOWHUDo}HVUHFHQWHVQDOHJLV-
mente o Ministério da Educação e o Conselho Nacional dos Direitos ODomR HVSRUWLYD FRQWLQXD D QHFHVVLWDU GH XPD OHL HVSHFt¿FD SDUD
da Criança e do Adolescente e que, o Ministério do Esporte e Turis- R )XWHERO HP YLUWXGH GH VXD LPSRUWkQFLD QRV FRQWH[WRV QDFLRQDO
mo deve desenvolver programas conjuntos com estes segmentos; H PXQGLDO GH VXD UHOHYkQFLD VyFLR HFRQ{PLFD GH VXDV UHODo}HV
‡$VDo}HVQDVHVFRODVVRPHQWHWHUmRH¿FiFLDFDVRFKHJXHPDRV complexas e ainda por representar expressivo fator na construção da
Estados e principalmente aos municípios. identidade cultural nacional;

Didatismo e Conhecimento 115


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
‡([LVWHPGLYHUVDVGL¿FXOGDGHVQRSURFHVVROHJDOHVSRUWLYREUD- ‡$VHPSUHVDVGHFRPXQLFDomRHPDUNHWLQJHVSRUWLYRWrPHYL-
sileiro, tais como: denciado um crescente interesse pelo esporte em todo o país;
D FRQÀLWRVHQWUHSURFHGLPHQWRVHVSRUWLYRVQR%UDVLOHSURFH- ‡4XHHPRXWURVSDtVHVDVHPSUHVDVGHFRPXQLFDomRGHVWLQDP
dimentos internacionais; percentuais do arrecadado em contratos relativos à divulgação do
(b) criação sem critérios e indiscriminada de entidades nacio- esporte para o desenvolvimento esportivo;
nais e estaduais de direção esportiva;
(c) ausência de mecanismos legais, por órgão superior, que per- Ação
PLWDDVROXomRGHLUUHJXODULGDGHVHFRQÀLWRVDWUDYpVGHLQWHUYHQo}HV
FRPSUD]RVGH¿QLGRV 7RGRVRVFRPSRQHQWHVGR6LVWHPD(VSRUWLYR%UDVLOHLURLQ-
‡2V(VWDGRVH0XQLFtSLRVWrPSDSpLVVRFLDLVHFXOWXUDLVUHOH- clusive o Ministério do Esporte e Turismo, pelo que a mídia pode
vantes diante dos assuntos do Esporte e por isto devem criar opor- RIHUHFHU GH UHWRUQR DR HVSRUWH GHYHP HVWDEHOHFHU HVWUDWpJLDV H¿-
WXQLGDGHVHIHWLYDVGHUDWL¿FDUSRUDo}HVH[HFXWLYDVHOHJLVODWLYDVRV cazes de aproximação com os meios de comunicação e marketing
seus compromissos com o desenvolvimento do Esporte em seus
esportivo, para que o Esporte receba a difusão necessária no sentido
territórios, como meio incontestável de Educação, Cultura, Quali-
de um processo efetivo de desenvolvimento.
GDGHGH9LGD6D~GH/D]HUH7XULVPRDOpPGDDXWRHVWLPDGHVXDV
populações;
‡4XHDVFRPSHWLo}HVHVSRUWLYDVQRSDtVH[LJHPPXLWDVYH]HV Ciência e Tecnologia
YLDJHQVGHORQJDGLVWkQFLDHGLVSXWDGDVFRPJUDQGHTXDQWLGDGHGH
jovens, inclusive menores; &RQVLGHUDo}HV ‡ 1RV ~OWLPRV DQRV R %UDVLO WHP REWLGR XP
grande destaque nos Congressos Internacionais das chamadas Ciên-
Ações cias ou Ciência do Esporte, inclusive nos Congressos Pré-Olímpicos
H GR$PHULFDQ &ROOHJH RI 6SRUW 0HGLFLQH ¿FDQGR D PDLRULD GDV
2(VSRUWHFRPRPDQLIHVWDomRFXOWXUDOLQFRQWHVWHHGHLQH- YH]HVHQWUHRVWUrVSULPHLURVSDtVHVHPQ~PHURGHWUDEDOKRVVHOHFLR-
TXtYRFDUHOHYkQFLDVRFLDOQRSDtVSDUDRVHXGHVHQYROYLPHQWRFRPR nados e apresentados;
fenômeno sócio-cultural prioritário da nação, precisa receber estí- ‡ 2 %UDVLO Mi WHP SURJUDPDV GH SyVJUDGXDomR VWULFWRVHQVX
mulos legais imprescindíveis para a arrancada de um processo de em nível de doutoramento e mestrado em vários estados, aproxi-
viabilização econômica, tais como: PDGDPHQWH  GRXWRUHV HP (GXFDomR )tVLFD DOJXQV EUDVLOHLURV
D RVPHVPRVPHFDQLVPRVOHJDLVGH¿QDQFLDPHQWRGDiUHDGD QD GLUHomR GH RUJDQLVPRV LQWHUQDFLRQDLV FLHQWt¿FRV TXH WUDWDP GD
&XOWXUDRXRHVWDEHOHFLPHQWRGHQRYRVPHFDQLVPRV¿VFDLVHVSHFt¿- Educação Física e do Esporte, uma considerável produção de livros
cos para o Esporte, de modo que a iniciativa privada possa ser mo- e periódicos esportivos especializados, uma produção anual extensa
bilizada para investimento na área esportiva; quanto a eventos (Congressos, simpósios etc) sobre atividade física
(b) retirada de impostos de Importação e o Sobre Produtos In- e esportiva, entidades nacionais nos diversos ramos da Ciência do
dustrializados para equipamentos esportivos de competição, treina- (VSRUWH 0HGLFLQD (VSRUWLYD 3VLFRORJLD (VSRUWLYD %LRPHFkQLFD
mento e pesquisa; Aplicada ao Esporte etc) e outros indicadores que atestem a boa po-
2)XWHEROEUDVLOHLURSHODVVXDVFLUFXQVWkQFLDVHHVSHFLDOLGD- VLomRDRSDtVHQWUHDTXHOHVGHJUDQGHSURGXomRFLHQWt¿FDQDiUHDGR
GHVGHYHVHUUHJXODGRSRUXPDOHLHVSHFt¿FD Esporte;
2&RQVHOKR1DFLRQDOGR(VSRUWHUHFpPFULDGRQDHVWUXWXUD ‡([LVWHXPFUHVFHQWHQ~PHURGHXQLYHUVLGDGHVTXHMiGHEDWHP
esportiva brasileira, deve ser o órgão superior legalmente indicado o Esporte no seu ambiente, inclusive em dissertações de mestrados
SDUDGLULPLURVFRQÀLWRVGRHVSRUWHLQVWLWXFLRQDOL]DGRGR%UDVLO e teses de doutorados, além de grupos de pesquisadores que investi-
2V(VWDGRVH0XQLFtSLRVQRH[HUFtFLRGHVHXVSDSpLVGLDQWH gam os assuntos e problemas do Esporte nacional;
dos seus compromissos com as suas populações através do Esporte,
‡([LVWHXPD5HGH&(1(63 &HQWURGH([FHOrQFLD(VSRUWLYD 
devem estabelecer mecanismos legais de incentivo às práticas es-
fomentada pela União há alguns anos junto a algumas universidades
portivas formais e não-formais;
brasileiras, que têm demonstrado capacidade e potencial de atuação
$VHQWLGDGHVGLULJHQWHVHVSRUWLYDVQDFLRQDLVSHODUHOHYkQFLD
de suas atuações no desenvolvimento de suas modalidades esporti- para o Esporte;
vas, devem ser contempladas pela legislação esportiva com meca- ‡([LVWHPQR%UDVLODJrQFLDVIHGHUDLV &13T),1(3 HHVWD-
nismos que permitam recursos para as suas manutenções; duais (Sistema FAP- Fapesp, Faperj etc), que destinam poucos re-
6HMDLQVWLWXtGRXP6HJXUR2EULJDWyULRSDUDRVSDUWLFLSDQWHV cursos para as investigações relativas ao Esporte;
de competições dos Calendários esportivos nacionais; ‡$SHVDUGRVXFHVVREUDVLOHLURQDGLYXOJDomRGHWUDEDOKRVFLHQ-
$TXHVWmRGR'RSLQJQR%UDVLOGHYHVHUUHJXODGDSRUXPD Wt¿FRVQRH[WHULRUDLQGDQmRH[LVWHXPDUHODomRUD]RiYHOGHDSUR-
OHJLVODomR HVSHFt¿FD DWXDOL]DGD HP UHODomR DR WUDWDPHQWR LQWHUQD- veitamento interno e de integração dos centros de pesquisa com as
cional deste assunto. entidades esportivas de direção;

Esporte e Mídia Ações


2%UDVLOGHYHFRQVROLGDUDVXDSRVLomRLQWHUQDFLRQDOQD&LrQ-
Considerações FLD GR (VSRUWH GHVWLQDQGR UHFXUVRV ¿QDQFHLURV FRPSDWtYHLV SDUD
reforçar e apoiar: (a) apresentação de trabalhos em congressos no
‡1RPXQGRFRQWHPSRUkQHRDPtGLDpREVHUYDGDFRPRDSULQ- H[WHULRU E SHVTXLVDVFLHQWt¿FDVUHODWLYDVDSUREOHPDVGR(VSRUWH
FLSDOYDULiYHOGHGHVHQYROYLPHQWRGRHVSRUWHSRLVLQÀXHQFLDGLUHWD- (c) programas de pós-graduação stricto-sensu; (d) participação de
mente nas possibilidades de patrocínio e de chamamento dos jovens brasileiros nos organismos internacionais de Educação Física e Es-
para o interesse com as práticas esportivas; SRUWH H SHULyGLFRVQDFLRQDLVGHQtYHOFLHQWt¿FR I HYHQWRVFLHQ-

Didatismo e Conhecimento 116


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Wt¿FRVLQWHUQDFLRQDLVDVHUHPUHDOL]DGRVQR%UDVLO J ODERUDWyULRV 2. Deverá ser criado o Passaporte Anti-Doping, que irá constituir-
de Ciência do Esporte com a aquisição de equipamentos; (h) apoio -se numa obrigatoriedade para os atletas que forem representar o Bra-
DLQWHUFkPELRVFLHQWt¿FRVLQWHUQDFLRQDLV L FULDUFRPLWrVWpFQLFR- sil em competições internacionais;
FLHQWt¿FRVQDVFRQIHGHUDo}HVHVSRUWLYDVQDFLRQDLV $VHQWLGDGHVGHGLUHomRGH(VSRUWHGHYHUmRFULDUQDDEUDQJrQ-
2. A Rede CENESP, pelo seu potencial e pelas suas possibili- cia de suas atuações, programas anti-doping;
dades deve: (a) integrar parte de suas atividades com as entidades
esportivas; (b) crescer, permitindo que outras universidades sejam Diagnóstico do Esporte
WDPEpPFRQWHPSODGDVFRPUHFXUVRVS~EOLFRV
$VDJrQFLDVGHSHVTXLVDQR%UDVLOIHGHUDLVHHVWDGXDLVGH- Considerações
YHPGHVWLQDUUHFXUVRV¿QDQFHLURVGHDFRUGRFRPDVQHFHVVLGDGHVjV ‡1mRH[LVWH3ODQHMDPHQWRVHPXPGLDJQyVWLFRSUHFHGHQWHFRP
Ciência do Esporte, pelo que pode representar o avanço do conheci- indicadores que evidenciam os pontos fortes e os pontos fracos da
mento desta área para o país e sua população; área a ser planejada;
‡2~OWLPRGLDJQyVWLFRGHVHQYROYLGRVREUHD(GXFDomR)tVLFDHR
Empresas Estatais e Esporte (VSRUWHEUDVLOHLURIRLHP

&RQVLGHUDo}HV‡$VHPSUHVDVHVWDWDLVEUDVLOHLUDVGHVGHDGpFD- Ação
GDGHSUHVWDPH[FHOHQWHDSRLRDDOJXQVHVSRUWHVSDWURFLQDQGR 2%UDVLOGHYHGHVHQYROYHUXPGLDJQyVWLFRHVSRUWLYRFRPR
suas entidades de direção nacional nas suas atividades pelo país e levantamento da infra-estrutura e dos recursos humanos, materiais e
no exterior, contribuindo para expressivos resultados esportivos das ¿QDQFHLURVGLYLGLQGRRHPGXDVSDUWHV
representações nacionais; ž 2(VSRUWH6RFLDODVHUDSOLFDGRQRV(VWDGRVH0XQLFtSLRV
‡2VSDWURFtQLRVGDVHVWDWDLVHPERUDFRQWULEXtVVHPPXLWRSDUD onde serão analisados o Esporte Educacional, o Esporte Escolar e o
alguns esportes, somente foram conseqüência de um entendimento Esporte-lazer;
das empresas com os dirigentes dos esportes patrocinados, sem ne- ž R(VSRUWHGH5HQGLPHQWRFRPDQiOLVHHVSHFt¿FDVREUHLQGL-
nhuma participação dos órgãos governamentais responsáveis pelo FDGRUHVGHGHVHQYROYLPHQWRGHFDGDPRGDOLGDGHHVSRUWLYDHDR¿QDO
Esporte; FODVVL¿FDQGRDVHPHVSRUWHVGHVHQYROYLGRVHVSRUWHVHPGHVHQYROYL-
‡$VHPSUHVDVS~EOLFDVHVWDGXDLVSRXFRFRQWULEXtUDPSDUDR(V- mento e esportes não- desenvolvidos.
porte nos Estados;
Planos, Projetos Plurianuais e Talentos Esportivos
Ações
$VHPSUHVDVHVWDWDLVEUDVLOHLUDVGHYHPFRQWLQXDUDSRLDQGRR Considerações
Esporte brasileiro, aumentando as dotações publicitárias neste sen- ‡2VJUDQGHVUHVXOWDGRVQDVSULQFLSDLVFRPSHWLo}HVGHDOWRUHQ-
tido; dimento são sempre conseqüências de Planos de Expectativa bem
2. O Ministério do Esporte e Turismo (MET), coordenador do IRUPXODGRVDFUHVFLGRVGHXPDERDSROtWLFDGHLGHQWL¿FDomRHGHVHQ-
esporte brasileiro como questão de Estado, deve participar do pro- volvimento de talentos;
cesso decisório da seleção da distribuição das dotações publicitárias ‡$H[SHFWDWLYDHVSRUWLYDLQWHUQDFLRQDOHEUDVLOHLUD FDVRGRYROHL-
das empresas estatais brasileiras, inclusive, apresentando um plano bol masculino) evidenciam que os Planos de Expectativa no esporte
de distribuição, de acordo com o Plano de Desenvolvimento do Es- de rendimento devem compreender um período de oito anos.
porte Brasileiro; Ações
$V HPSUHVDV HVWDWDLV HVWDGXDLV GHYHP DGHULU DR SDWURFtQLR 2&RPLWr2OtPSLFR%UDVLOHLURGHYHUiFRQWLQXDUSODQHMDQGRRV
GR (VSRUWH QRV kPELWRV HVWDGXDLV DUWLFXODQGR VXDV Do}HV FRP DV esportes dos Jogos Olímpicos com planos de expectativa plurianuais
secretarias estaduais responsáveis pelo Esporte; FRPREMHWLYRVHPHWDVEHPGH¿QLGRV
2. O Comitê Paraolímpico Brasileiro deverá planejar os esportes
O Problema Doping dos Jogos Paraolímpicos com planos de expectativa plurianuais com
REMHWLYRVHPHWDVEHPGH¿QLGRV
Considerações $V HQWLGDGHV GH GLUHomR QDFLRQDO UHVSRQViYHLV SRU HVSRUWHV
‡2GRSLQJpDWXDOPHQWHFRQVLGHUDGRRJUDQGH³ÀDJHOR´GR(V- não-olímpicos e não-paraolímpicos também deverão elaborar os pla-
porte, pois a “ciência do doping” cresce as vezes mais que a “ciência nos de expectativa plurianuais;
contra o doping”; $VHQWLGDGHVHVSRUWLYDVGHGLUHomRQDFLRQDOGHYHUmRQRVOLPL-
‡$LPDJHPGRVSDtVHVHGRVDWOHWDV¿FDLUUHYHUVLYHOPHQWHPDQ- tes do regime democrático brasileiro que consagra o direito de ir e vir,
chada quando são constatados casos de doping em competições in- criar e desenvolver um programa de talentos esportivos que permita
ternacionais; ao Brasil chegar ao maior nível em todas as modalidades da cultura
‡1R%UDVLODOHJLVODomRVREUHGRSLQJHVWiFRPSOHWDPHQWHXO- HVSRUWLYDQDFLRQDOHQDTXHODVHPTXHRSDtVVH¿]HUSUHVHQWH
trapassada e há um consenso internacional de que esta legislação
precisa ser continuamente revista; Bingo
‡$SHVDUGHH[LVWLUQR%UDVLOFLHQWLVWDVGHUHQRPHLQWHUQDFLRQDO
sobre doping, o Brasil ainda não possui um controle efetivo sobre Considerações
seus atletas de equipes nacionais; ‡2%LQJRSHODOHJLVODomRDWXDOWHPRVHXFRQWUROHHIHWXDGRSHOD
$o}HV2&RQVHOKR1DFLRQDOGR(VSRUWHGHYHUiVHURyUJmR Caixa Econômica Federal;
que tratará da atualização da normatização contra o doping, podendo ‡2%LQJRWHPVLGRSDUDDOJXPDVHQWLGDGHVHDVVRFLDo}HVHVpor-
usar assessores ad-hoc entre os especialistas do assunto, e propor WLYDVGRSDtVXPFRPSOHPHQWR¿QDQFHLURTXHWHPFRQWULEXtGRGH
XPDOHJLVODomRHVSHFt¿FDSDUDHVWDTXHVWmR alguma forma para o desenvolvimento de modalidades esportivas.

Didatismo e Conhecimento 117


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Ação ‡ 1R VLVWHPD DWXDO GH GLVSRQLELOL]DomR GH UHFXUVRV S~EOLFRV
$&DL[D(FRQ{PLFD)HGHUDOGHYHDSULPRUDURFRQWUROHGR com contrapartidas das entidades receptoras, os projetos do espor-
Bingo no país, de modo que as entidades de direção e de prática te de rendimento brasileiros são extremamente prejudicados pois
esportiva obtenham mais recursos para o desenvolvimento dos es- são exigidos recursos das entidades de direção, a maioria das vezes
portes sob suas responsabilidades. inexistentes, e dependentes de outras fontes variáveis como patrocí-
nios, inscrições etc.
O Esporte de Rendimento A Comissão Nacional de Atletas
Ações
Considerações $VHQWLGDGHVHVSRUWLYDVGHDGPLQLVWUDomRQDFLRQDODRFULDU
‡$ &RPLVVmR 1DFLRQDO GH$WOHWDV IRUPDGD SRU DWOHWDV GHV- equipes nacionais permanentes, com planos de expectativa para
WDFDGRV UHVXOWDGRV HVSRUWLYRV IRL FULDGD SHOD 3RUWDULD Qž  GH as modalidades sob as suas responsabilidades, devem tratar, com
GR0LQLVWpULRGR(VSRUWHH7XULVPR 0(7 FRPRRE- ênfase, das processos de iniciação e desenvolvimento esportivo e
GD LGHQWL¿FDomR GH WDOHQWRV FRP RV ELRWLSRV LQGLFDGRV SDUD HVVHV
jetivo de assessorar as ações deste Ministério indicando necessida-
esportes;
des, expectativas e aspirações dos atletas;
2. O Comitê Olímpico Brasileiro (COB) e o Comitê Paraolím-
‡1DFRPSRVLomRGD&RPLVVmR1DFLRQDOGH$WOHWDVRVDWOHWDV
pico Brasileiro (CPB) devem aprovar e supervisionar os planos de
integrantes deverão ter participado de Jogos Olímpicos ou Parao- VXDV¿OLDGDVDFRPSDQKDQGRRVHDYDOLDQGRRVSHORVUHODWyULRVSH-
límpicos, sendo que cada modalidade deverá ter no máximo dois riódicos;
participantes; 20LQLVWpULRGR(VSRUWHH7XULVPRSRUDo}HVLQWHUPLQLVWH-
‡$WOHWDVGHHVSRUWHVQmRROtPSLFRVGHH[SUHVVmRWDPEpPSR- riais, no exercício de suas responsabilidades, deve ser co-respon-
derão ser convidados para participar na Comissão. sável pelas representações esportivas nacionais, cabendo-lhe uma
atuação de articulação e apoio aos planos;
Ação  2V DWOHWDV H RV GHPDLV UHFXUVRV KXPDQRV SDUWLFLSDQWHV GH
 2 0LQLVWpULR GR (VSRUWH H 7XULVPR 0(7  GHYHUi UHXQLU equipes nacionais permanentes e/ou de representações brasileiras
periodicamente a Comissão Nacional de Atletas para coletar su- devem ter todas as garantias de que não sofrerão prejuízos em suas
gestões e indicações que contribuam para o processo esportivo RXWUDVDWLYLGDGHVSUR¿VVLRQDLVRXHVFRODUHVDOpPGHHVWDUFREHUWRV
brasileiro; SRUVHJXURVHSODQRVGHVD~GH
Equipes Permanentes, Representações Esportivas Brasileiras 2WUHLQDPHQWRGDVHTXLSHVSHUPDQHQWHVHRXGHUHSUHVHQWD-
Olímpicas e Paraolímpicas ções nacionais deverá dispor de instalações e equipamentos compa-
tíveis com o alto nível;
Considerações (PVLWXDo}HVGHWUHLQDPHQWRHIRUPDomRGHHTXLSHVUHSUH-
‡ 2V SODQRV GDV HQWLGDGHV HVSRUWLYDV GH DGPLQLVWUDomR QD- sentativas do país, todos os problemas relativos a superposição de
cional, pelas experiências vencedoras olímpicas e paraolímpicas, patrocínios entre as entidades e atletas devem ser resolvidas a priori;
devem estar previstos para que os jovens cheguem às competi- 2VUHFXUVRVS~EOLFRVSDUDRVSODQRVGHVSRUWLYRVGHH[SHFWD-
o}HVLQWHUQDFLRQDLVQXPSHUtRGRFRPSUHHQGLGRHQWUHHDQRV tiva deverão ser distribuídos em cotas anuais e a contrapartida das
GHSHQGHQGRGDVFLUFXQVWkQFLDVHHVSHFL¿FLGDGHVGHFDGDHVSRUWH entidades nacionais de direção esportiva deverá constituir-se numa
‡$LQLFLDomRHVSRUWLYDDGHTXDGDHDLGHQWL¿FDomRGHWDOHQWRV avaliação positiva de cumprimento do projeto ou alcance das metas
com biotipos corretos posteriormente são considerados estratégias propostas.
imprescindíveis para futuros sucessos esportivos em todos os es-
portes; Projeções e Prioridades para os Planos das Entidades Esporti-
vas de Direção Nacional
‡$TXDQWL¿FDomRGHSURFHVVRVGHLQLFLDomRHVSRUWLYDSDUDRV
sexos masculino e feminino é consensualmente aceito como uma
Considerações
YDULiYHOSRVLWLYDQDIXWXUDTXDOL¿FDomRGHFDGDPRGDOLGDGHHVSRU-
‡2%UDVLOSDUWLFLSDUiGRV-RJRV2OtPSLFRVH3DUDROtPSLFRVGH
tiva; HGRV-RJRV3DQDPHULFDQRVGHHGRV-RJRV
‡&DEHjVHQWLGDGHVGHDGPLQLVWUDomRQDFLRQDO D SUHSDUDUDV 6XODPHULFDQRV GH  H  GRV -RJRV GH ,QYHUQR GH  H
representações nacionais para as competições internacionais; (b) GRVFDPSHRQDWRVPXQGLDLVSDQDPHULFDQRVVXODPHULFDQRV
selecionar e desenvolver os recursos humanos que atuam tecnica- MRJRVPXQGLDLVPLOLWDUHVHGHXPJUDQGHQ~PHURGHMRJRVFDPSHR-
mente nos processos esportivos de rendimento; (c) planejar e de- natos e torneios internacionais nos quais a imagem esportiva nacio-
senvolver equipes permanentes que tenham potencial para sucesso nal estará sendo exposta;
no exterior; ‡ &DGD HQWLGDGH GH DGPLQLVWUDomR QDFLRQDO LQFOXVLYH R &2%
‡([LVWHPLQ~PHUDVGL¿FXOGDGHVSDUDDSDUWLFLSDomRGRVLQWH- e o CPB, tem o dever de estabelecer suas prioridades na projeção
grantes das representações esportivas em eventos internacionais do calendário internacional existente e desenvolver os seus planos
quanto a garantias e dispensas de trabalho, escolas, universidades de desenvolvimento e de expectativa para as modalidades sob suas
durante as competições e treinamentos; responsabilidades;
‡1DVVLWXDo}HVGHH[LVWrQFLDGHHTXLSHVQDFLRQDLVSHUPDQHQ- ‡1R%UDVLORVPRGHORVGHGLVSXWDHVSRUWLYDVmRYDULiYHLVSRU
tes, há necessidade de locais de treinamento com instalações com- HVSRUWHUHJLmRFLGDGHHRXWUDVFLUFXQVWkQFLDVHTXHHVWDGLYHUVLGD-
patíveis com o treinamento de alta competição; GHpDRPHVPRWHPSRGL¿FXOGDGHHDVSHFWRSRVLWLYR
‡([LVWHPFRQÀLWRVHPUHODomRDRVSDWURFtQLRVGHDWOHWDVHGH ‡2VFDOHQGiULRVLQWHUQDFLRQDLVHQDFLRQDLVQRVTXDLVHVWiHQ-
equipes nacionais que muitas vezes interferem no desenvolvimen- volvido o Esporte brasileiro, deverão ser divulgados numa delimi-
to dos programas de treinamento estabelecidos; tação de dois anos.

Didatismo e Conhecimento 118


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
Ações Eventos Esportivos Internacionais no Brasil
20LQLVWpULRGR(VSRUWHH7XULVPRGHYHHVWDEHOHFHUXPSUR-
cesso de coleta de informações sobre os calendários dos diversos Considerações
esportes praticados institucionalmente no Brasil, para elaborar um ‡eFRQVHQVRQRHVSRUWHPXQGLDOTXHWRGRVRVSDtVHVTXHSUR-
Calendário Nacional Esportivo, que deve ser bienal; movem as megacompetições (Jogos Olímpicos, Jogos Pan-ameri-
2. Nas competições internas dos diferentes esportes, as entida- canos, Campeonatos Mundiais etc) aceleram os seus processos de
des de direção deverão admitir, a pluralidade circunstancial de cada desenvolvimento esportivo;
situação, permitindo que as equipes participantes sejam de natureza ‡2%UDVLOFRPDOJXQVSURJUDPDVHDMXVWHVWHPWRGDVDVFRQGL-
distintas (exemplo: participação de universidades em competições ções de sediar os grandes eventos esportivos do planeta;
promovidas pelas confederações e federações). ‡2SULPHLURJUDQGHHYHQWRSRVVtYHORQGHR%UDVLOSRGHVHGLDU
a sua realização, em termos cronológicos, são os Jogos Pan-ameri-
Formação e Capacitação de Recursos Humanos FDQRVGHVHQGRTXHDFLGDGHGR5LRGH-DQHLURpDLQGLFDGD
‡3DUDTXHRFRUUDXPDFRQ¿DQoDLQWHUQDFLRQDOQDVSRVVLELOLGD-
Considerações
des do Brasil sediar eventos como Jogos Olímpicos, Copa do Mun-
‡2VUHFXUVRVKXPDQRVSDUDR(VSRUWH WUHLQDGRUHVDGPLQLVWUD-
do, Universíade etc, há a necessidade de aumentar consideravelmen-
GRUHVSUHSDUDGRUHVItVLFRVPpGLFRVHVSRUWLYRV¿VLRWHUDSHXWDVELR-
PHFkQLFRV SVLFyORJRV QXWULFLRQLVWDV H RXWURV  VHUmR VHPSUH XPD WHRQ~PHURGHFRPSHWLo}HVLQWHUQDFLRQDLVQRSDtV
variável de qualidade em qualquer processo de desenvolvimento
esportivo; Ações
‡ (PERUD H[LVWDP QR H[WHULRU SULQFLSDOPHQWH QD (XURSD 2&RPLWr2OtPSLFR%UDVLOHLUR &2% HR&RPLWr3DUROtPSL-
processos de formação para treinadores, utilizando-se ex-atletas, co Brasileiro (CPB) devem evidenciar internacionalmente o empe-
no Brasil, não é possível uma abertura deste tipo, pois: (a) a Lei QKRHPWUD]HUDVPHJDFRPSHWLo}HVHVSRUWLYDVVHPSUHUHD¿UPDQGR
Qž  UHJXODPHQWRX R H[HUFtFLR SUR¿VVLRQDO GD (GXFDomR a vontade política do governo brasileiro neste sentido;
)tVLFD QR %UDVLO GHWHUPLQDQGR FRPR SUHUURJDWLYD GR SUR¿VVLRQDO 
graduado em curso superior de Educação Física, com registro no sis- 2. O governo federal e os governos municipal e estadual corres-
tema CONFEF/CREF a prestação de serviços à população em todas pondentes às cidades candidatas aos eventos internacionais devem,
as atividades à Educação Física nas suas diversas manifestações; (b) além das cartas de garantia, disponibilizar recursos que evidenciem
a Educação Física, pelo art. 2 do Manifesto Mundial de Educação esta vontade política do Estado;
)tVLFD),(3pXPSURFHVVRGH(GXFDomRTXHXWLOL]DDWLYLGDGHV $V(QWLGDGHV(VSRUWLYDVGHGLUHomRQDFLRQDOGHYHPGLVSXWDU
físicas na forma de exercícios ginásticos, jogos, esportes, danças, a sede de campeonatos sul-americanos, pan-americanos, mundiais e
atividades de aventura, relaxamento e outras opções de lazer ativo, outras competições de grande apelo na mídia internacional.
com propósitos educativos;
‡$LQGDQR%UDVLOD/HLQžGHTXHGLVS{VVR- ,QLFLDomR(VSRUWLYDH&HUWL¿FDomR
EUHRV7UHLQDGRUHV3UR¿VVLRQDLVGH)XWHEROHHVWLPXORXSDUDTXH
os treinadores completassem cursos superiores de Educação Física, Consideração
FDUDFWHUL]RXRVFRPRDTXHOHVSUR¿VVLRQDLVFRQWUDWDGRVSRUFOXEHV ‡$LQLFLDomRHVSRUWLYDpDSULPHLUDHWDSDGRSURFHVVRGHGHVHQ-
GHIXWHEROFRPD¿QDOLGDGHGHWUHLQDUDWOHWDVGHIXWHEROSUR¿VVLRQDO volvimento esportivo e, para que seja um fator positivo no mesmo,
ou amador, ministrando-lhes técnicas e regras de Futebol, com o é imprescindível que se apresente com qualidade.
REMHWLYRGHDVVHJXUDUOKHVFRQKHFLPHQWRVWiWLFRVVX¿FLHQWHVSDUDD
prática desse Esporte. Esta caracterização permite uma transferência Ação
para os treinadores de outros esportes que desse modo podem dirigir
'HYHVHUFULDGDXPDFHUWL¿FDomRDSRLDGDHPFULWpULRVULJR-
equipes mas não podem exercer atividades esportivas de ensino;
URVRVGHTXDOLGDGHSDUDRVQ~FOHRVGHLQLFLDomRHVSRUWLYD
‡([LVWHPYiULRVWLSRVGHSUR¿VVLRQDLVTXHSRGHPDWXDUQRSUR-
cesso esportivo como advogados, engenheiros, arquitetos, médicos,
SVLFyORJRVELRTXtPLFRVELRPHFkQLFRV¿VLRWHUDSHXWDVSURIHVVRUHV 3ULRULGDGHVGRV5HFXUVRV3~EOLFRV
de Educação Física, nutricionistas etc.
Considerações
Ações ‡2VUHFXUVRVS~EOLFRVSDUDR(VSRUWHEUDVLOHLURVHPSUHIRUDP
$VXQLYHUVLGDGHVEUDVLOHLUDVSHODDXWRQRPLDTXHOKHVIDFXOWD LQVX¿FLHQWHV H RV FULWpULRV GH SULRUL]DomR QXQFD IRUDP VX¿FLHQWH-
D/HLQžGH /HLGH'LUHWUL]HVH%DVHVGD(GXFD- mente claros;
ção Nacional) poderão oferece cursos de extensão, cursos de pós- ‡2%UDVLOFRPXPDH[WHQVmRFRQWLQHQWDOHVWiDH[LJLUFULWpULRV
-graduação lato-sensu e programas de pós- graduação stricto-sensu, JHRJUi¿FRVGHGLVWULEXLomRGHUHFXUVRV
além de desenvolver projetos de pesquisa e debates relativos ao Es-
SRUWH3RGHUmRLQFOXVLYHFULDUQRVHXkPELWRDFDGrPLFRVHWRUHVVRE Ações
a denominação de “Universidade do Esporte” ou outro qualquer; $GLVWULEXLomRGRVUHFXUVRVS~EOLFRVGHYHUmRVHUHIHUHQFLDU
2. O Comitê Olímpico Brasileiro, o Comitê Parolímpico Brasi- em diagnósticos do esporte brasileiro;
leiro e as Entidades esportivas de administração nacional, poderão 2. No esporte de rendimento, as prioridades, além de se basea-
FRPSRUFRPDVXQLYHUVLGDGHVLQWHUFkPELRVTXHSHUPLWDPDFULDomR UHPQDFODVVL¿FDomRHPHVSRUWHVGHVHQYROYLGRVHPGHVHQYROYLPHQ-
de “Universidades do Esporte”, olímpicos ou paraolímpicos, que se- to e em não-desenvolvidos, deverão levar em conta preferencial-
rão setores para o aperfeiçoamento dos recursos humanos para atuar mente as modalidades olímpicas, paraolímpicas, pan-americanas e
nos meios esportivos e para o desenvolvimento de pesquisas. pan-americanas paraolímpicas.

Didatismo e Conhecimento 119


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
2(VSRUWHSDUD3HVVRDV3RUWDGRUDVGH'H¿FLrQFLD ‡2VSRUWDGRUHVGHGH¿FLrQFLDItVLFDPHQWDODXGLWLYDYLVXDO
HP~OWLSODVDOYRUHVWULomRUDUDVmRFDSD]HVGHSDUWLFLSDUGHDXODV
Estruturas Organizacionais das Entidades Esportivas de Pes- de Educação Física, assim como atividades de lazer e de esporte
soas Portadoras de Dediciência competitivo ou não e que os efeitos desta participação são extre-
mamente positivos, inclusive, muitas vezes com a reversão do es-
Considerações tigma;
‡$VHQWLGDGHVHVSRUWLYDVGHSHVVRDVSRUWDGRUDVGHGH¿FLrQFLD ‡ $ &DUWD ,QWHUQDFLRQDO GD (GXFDomR )tVLFD H GR (VSRUWH
WrP JUDQGHV GL¿FXOGDGHV GH PDQXWHQomR GHYLGR D  SRXFR DSHOR 81(6&2 HR0DQLIHVWR0XQGLDOGH(GXFDomR)tVLFD),(3
SDUDDPtGLD E Q~PHURSHTXHQRGHUHJLVWURVGHDWOHWDVHPFDGD FRQVDJUDUDPD(GXFDomR)tVLFDFRPRXPGLUHLWRGHWRGRV
HQWLGDGH F GL¿FXOGDGHVQDPRELOL]DomRGHSUDWLFDQWHVHVSRUWLYRV
SDUD VHXV HYHQWRV G  IDOWD GH Q~FOHRV GH LQLFLDomR HVSRUWLYD H  Ações
GL¿FXOGDGHVGHSDWURFtQLRV I UHFXUVRVS~EOLFRVLQVX¿FLHQWHV $VHVFRODVGHYHPFULDUFRQGLo}HVHLQFOXLURVSRUWDGRUHVGH
‡([LVWHPLPSRVWRVHWD[DVTXHWrPDOJXPWLSRGHUHODomRFRP GH¿FLrQFLDVItVLFDVQDVDXODVGH(GXFDomR)tVLFD
RVSRUWDGRUHVGHGH¿FLrQFLDFRPRR'39$7 6HJXUR2EULJDWyULR 2. As escolas devem promover as práticas esportivas em ter-
de Automóvel). mos educacionais no Ensino Fundamental e Médio;
 2V (VWDGRV H 0XQLFtSLRV VHUmR RV UHVSRQViYHLV SHOR IR-
Ação PHQWR GH FRPSHWLo}HV H GH (VSRUWH (VFRODU QR kPELWR GH VXDV
2(VWDGRGHYHGHVWLQDUDOJXPWLSRUHFHLWDH[WUDtGDGHXP atuações.
imposto ou taxa, ou de um incentivo para a iniciativa privada, no
VHQWLGR GH TXH DV HQWLGDGHV GLULJHQWHV GR HVSRUWH SDUD GH¿FLHQWHV As Entidades de Direção Nacional dos Esportes para Portado-
tenham condições de implementar seus programas e suas manuten- UHVGH'H¿FLrQFLD
ções.
Considerações
2(VSRUWHSDUD3RUWDGRUHVGH'H¿FLrQFLDQRV(VWDGRVH0X- ‡$WXDOPHQWHH[LVWHP D DVHQWLGDGHVGHDGPLQLVWUDomRQD-
nicípios FLRQDO¿OLDGDVDR&RPLWr3DUDROtPSLFR%UDVLOHLUR $%5$'(&$5
– Associação Brasileira de Desporto em Cadeira de Rodas, ANDE
Considerações ±$VVRFLDomR1DFLRQDOGH'HVSRUWRSDUD'H¿FLHQWHV$%'&±$V-
‡23URJUDPDGH$omR0XQGLDOSDUD3HVVRDV3RUWDGRUDVGH'H- sociação Brasileira de Desporto para Cegos, ABDEM – Associa-
¿FLrQFLDDWUDYpVGHVXDV1RUPDVH5HFRPHQGDo}HV,QWHUQDFLRQDLV omR%UDVLOHLUDSDUD'H¿FLHQWHV0HQWDLV  E RXWUDVHQWLGDGHVQmR
VREUH'H¿FLrQFLD  GH¿QLXD'H¿FLrQFLDFRPRSHUGDRXOLPL- ¿OLDGDVDR&RPLWr3DUDROtPSLFR%UDVLOHLUR $2(%±$VVRFLDomR
tação de oportunidades de participar da vida comunitária em con- Olimpíadas Especiais, CBBC – Confederação Brasileira de Bas-
GLo}HVGHLJXDOGDGHFRPDVGHPDLVSHVVRDVSRUWDQWRLGHQWL¿FDUD quete em Cadeira de Rodas, CBBS – Confederação Brasileira de
situação de incapacidade pessoal em detrimento do próprio meio Desportos para Surdos, CDLB – Confederação Brasileira de Luta
social; de Braço, CBTM – Confederação Brasileira de Tênis de Mesa
‡$VUHVSRQVDELOLGDGHVGHSURPRomRGHLQLFLDWLYDVQHFHVViULDV Adaptado;
para a inclusão, a integração social, a melhoria da qualidade de vida ‡$VHQWLGDGHVGHDGPLQLVWUDomRQDFLRQDOGHHVSRUWHVSDUDGH-
e a garantia dos direitos dessas pessoas, têm sido divididas entre o ¿FLHQWHVWrPDUHVSRQVDELOLGDGHGDRUJDQL]DomRHGHVHQYROYLPHQ-
(VWDGRHD6RFLHGDGHSRUPHLRGHLQVWLWXLo}HVS~EOLFDVHSULYDGDV to das modalidades sob suas responsabilidades, além do planeja-
‡$VGL¿FXOGDGHVSDUDRGHVHQYROYLPHQWRGHSHVVRDVSRUWDGR- mento para as participações internacionais;
UDVGHGH¿FLrQFLDUHFDHPQDLQDFHVVLELOLGDGHDRVPHLRVItVLFRVHGH ‡$ SDUWLFLSDomR PDVFXOLQD p YLVLYHOPHQWH PDLRU QR HVSRUWH
comunicação, e são, de um modo geral, conseqüências de condições SDUDSHVVRDVSRUWDGRUHVGHGH¿FLrQFLDV
culturais, econômicas e ambientes desfavoráveis;
‡2(VSRUWHSDUDSHVVRDVSRUWDGRUDVGHGH¿FLrQFLDDLQGDQmR Ação
encontrou na maioria dos Estados e municípios brasileiros o apoio $V(QWLGDGHVGH'LUHomR1DFLRQDOGH(VSRUWHVSDUD'H¿-
necessário para o seu desenvolvimento. FLHQWHVGHYHUmR D HODERUDUXPSODQRGHH[SDQVmRSDUDDQRV
Ação FRPPHWDVTXDQWL¿FDGDVSDUDFDGDDQRTXDQWRDRDXPHQWRGHSUD-
2V(VWDGRVH0XQLFtSLRVGHYHPLQFOXLUR(VSRUWHSDUD3HV- WLFDQWHV HVSRUWLYRV QXPD GLVWULEXLomR JHRJUi¿FD GHVHMiYHO E 
VRDV3RUWDGRUDVGH'H¿FLrQFLDQRVVHXVSODQRVHSURJUDPDVGHGH- EXVFDUSDWURFtQLRVHUHFXUVRV¿QDQFHLURVSDUDR¿QDQFLDPHQWRGH
senvolvimento do Esporte, inclusive, criando setores responsáveis suas atividades; (c) formular planos de expectativa para as equipes
por estas ações. nacionais que farão parte das competições internacionais; (d) de-
senvolvimento de campanhas e estratégias de divulgação do espor-
A Educação Física e o Esporte para Pessoas Portadoras de De- WHSDUDGH¿FLHQWHVQDVPtGLDVQDFLRQDOHUHJLRQDO H HODERUDomR
¿FLrQFLD e execução de um calendário esportivo expressivo; (f) criar bolsas
SDUDROtPSLFDVGHLQFHQWLYRDRVDWOHWDVHSUR¿VVLRQDLVGHQtYHOQD-
Considerações cional e internacional; (g) estimular a formação e capacitação de
‡1R%UDVLODVFRPSHWLo}HVHVSRUWLYDVHVFRODUHVHQWUHSHVVRDV recursos humanos especializados; (h) estimular brasileiros a par-
SRUWDGRUHVGHGH¿FLrQFLDVmRHVFDVVDV WLFLSDUGHHQWLGDGHVHVSRUWLYDVLQWHUQDFLRQDLVSDUDGH¿FLHQWHVItVL-
‡1mRH[LVWHDREULJDWRULHGDGHGH(GXFDomR)tVLFD3DUD3HVVRDV FRV L HVWLPXODUDSDUWLFLSDomRIHPLQLQDQRVGH¿FLHQWHVHPWRGR
3RUWDGRUDVGH'H¿FLrQFLD o território nacional.

Didatismo e Conhecimento 120


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
O Ministério do Esporte e Turismo e os Esportes para Porta- ‡4XHDR5HFRQKHFHUTXHSUiWLFDVFRUSRUDLVUHODFLRQDGDVDR
GRUHVGH'H¿FLrQFLD desenvolvimento de valores, podem levar à participação de cami-
nhos sociais responsáveis e busca da cidadania; CONSTITUI-SE
Considerações num meio efetivo para a conquista de um estilo de vida ativo dos
‡&DEHDR0LQLVWpULRGR(VSRUWHH7XULVPR 0(7 JHULUERD seres humanos.
parte dos recursos políticos destinados ao Esporte e cuidar de uma Esporte: Fenômeno sócio-cultural, que tem no jogo o seu vín-
distribuição planejada de forma que as práticas esportivas cada vez culo cultural e na competição o seu elemento essencial e que nas
mais cresçam no país como direito de todos; suas diferentes formas, contribui para a formação e aproximação dos
seres humanos ao reforçar o desenvolvimento de valores como a
‡20LQLVWpULRGR(VSRUWHH7XULVPR 0(7 WDPEpPGHYHVHU
moral, a ética, a solidariedade, a fraternidade e a cooperação, o que
responsável pelas participações nacionais nos eventos internacio-
RWRUQDQXPGRLVPHLRVPDLVH¿FD]HVSDUDDFRQYLYrQFLDKXPDQD
QDLVSDUDSHVVRDVSRUWDGRUDVGHGH¿FLrQFLDV
Esporte de Rendimento: Praticado de acordo com as regras e
‡20LQLVWpULRGR(VSRUWHH7XULVPR 0(7 WHPUHVSRQVDELOL- FyGLJRVGDVHQWLGDGHVLQWHUQDFLRQDLVHTXHWHPFRPR¿QDOLGDGHD
dades diretas no desenvolvimento do processo esportivo brasileiro. obtenção de resultados expressivos, vitórias, recordes, tudo dentro
de um referencial ético expresso na formação de um espírito espor-
Ações tivo dos seus praticantes.
 2 0LQLVWpULR GR (VSRUWH H7XULVPR 0(7  GHYHUi DSRLDU Esporte Educacional: Praticado nos sistemas de ensino e em
e estimular, articulando com as entidades de direção dos espor- formas assistemáticas de educação, evitando-se a seletividade, a
WHV SDUD SRUWDGRUHV GH GH¿FLrQFLD D  QD EXVFD GH SDWURFtQLRV H KLSHUFRPSHWLWLYLGDGHGHVHXVSUDWLFDQWHVFRPD¿QDOLGDGHGHDO-
UHFXUVRV¿QDQFHLURV E QDGLIXVmRGHVVHVHVSRUWHVSHORSDtV F  cançar o desenvolvimento integral do indivíduo e a sua formação
QDFULDomRGHEROVDVSDUDROtPSLFDVSDUDRVDWOHWDVHSUR¿VVLRQDLV SDUDRH[HUFtFLRGDFLGDGDQLDHDSUiWLFDGROD]HU $UWžGD/HLQž
destas modalidades; (d) na formação e capacitação de recursos hu-  
manos especializados; (e) na participação de dirigentes brasileiros Esporte Lazer ou Comunitário: Praticado de modo voluntário,
QDV HQWLGDGHV LQWHUQDFLRQDLV GH HVSRUWHV SDUD GH¿FLHQWHV I  QDV FRPDVPRGDOLGDGHVLQVWLWXFLRQDOL]DGDVRXQmRFRPUHJUDVR¿FLDLV
equipes nacionais paraolímpicos e de esportes não-paraolímpicos; ou adaptadas, e que contribui para a integração dos praticantes, para
2. O Ministério do Esporte e Turismo (MET) deverá ainda DSURPRomRGDVD~GHHRXWURVDVSHFWRVLPSRUWDQWHVGDYLGDVRFLDO
apoiar e estimular, articulando com outros setores do Estado e So- Esporte Escolar: Praticado pelos jovens de talento no ambien-
ciedade, no sentido de que: (a) os governos estaduais e municipais WHHVFRODUFRPD¿QDOLGDGHGHGHVHQYROYLPHQWRHVSRUWLYRGRVVHXV
praticantes, sem perder de vista a formação dos mesmos para a ci-
criem ou mantenham setores de desenvolvimento do esporte para
dadania.
SHVVRDVSRUWDGRUDVGHGH¿FLrQFLD E DVHPSUHVDVHVWDWDLVWDPEpP
Política Nacional do Esporte: Conjunto de ações que formu-
DSRLHPRVHVSRUWHVSDUDGH¿FLHQWHV F R0LQLVWpULRGD(GXFDomR lam um sentido para a convivência Estado-Sociedade, congregando
faça as alterações necessárias na legislação e nas suas ações para expectativas sociais, fundamentos axiológicos, visão de futuro e os
TXHRVGH¿FLHQWHVItVLFRVSRVVDPSDUWLFLSDUGDVDXODVGH(GXFDomR meios existentes.
Física, Esporte Educacional e das competições de Esporte Escolar; 3UR¿VVLRQDOGH(GXFDomR)tVLFD)RUoDGHWUDEDOKRTXDOL¿FDGD
(d) as universidades e estabelecimentos de ensino superior, para e registrada no Sistema CONFEF/CREF, responsável pelo exercício
que preparem recursos humanos com possibilidades em nível de SUR¿VVLRQDOQDiUHDGH(GXFDomR)tVLFD
extensão, pós-graduação lato-sensu e em linhas de pesquisa nos
SURJUDPDVVWULFWRVHQVX H DVDJrQFLDVGH¿QDQFLDPHQWRH[LVWHQ-
tes no Brasil (CNPq, Sistema FAP etc) destinem recursos para as
DIMENSÕES BIOLÓGICAS APLICADAS À
investigações em problemas relacionados ao esporte para pessoas
EDUCAÇÃO FÍSICA E AO ESPORTE.
SRUWDGRUDVGHGH¿FLrQFLD

*/266È5,2
Educação Física: como direito de todas as pessoas, é um pro-
FHVVRGH(GXFDomRVHMDSRUYLDVIRUPDLVRXQmRIRUPDLV‡4XHDR O ser humano não é biologicamente estático.
,QWHUDJLUFRPDVLQÀXrQFLDVFXOWXUDLVHQDWXUDLV iJXDDUVROHWF  Desde o momento da concepção até a morte, é por demais co-
nhecida a ocorrência de transformações quantitativas e qualitativas,
GHFDGDUHJLmRHLQVWDODo}HVHHTXLSDPHQWRVDUWL¿FLDLVDGHTXDGRV
quer no sentido evolu- tivo quer no involutivo. Durante as duas pri-
‡4XHDR8WLOL]DUDWLYLGDGHVItVLFDVQDIRUPDGHH[HUFtFLRVJL-
meiras décadas de vida, a principal atividade do organismo humano
násticos, jogos, esportes, danças, atividades de aventura, relaxa-
p³FUHVFHU´H³GHVHQYROYHUVH´IHQ{PHQRVVLPXOWkQHRVHFRQGLFLR-
mento e outras opções de lazer ativo, com propósitos educativos; nados à maior ou à menor velocidade do processo maturacional e de
‡4XHDR2EMHWLYDUDSUHQGL]DJHPHGHVHQYROYLPHQWRGHKDEL- sua inte- ração com indicadores do ambiente. Por conta da existência
lidades motoras de crianças, jovens, adultos e idosos, aumentando de forte interação entre o crescimento e o desenvolvimento, muitas
as suas condições pessoais para a aquisição de conhecimentos e vezes ambos os conceitos vêm sendo empregados de forma indiscri-
atitudes favoráveis para a consolidação de hábitos sistemáticos de PLQDGDFRPRPHVPRVLJQL¿FDGR7RGDYLDFUHVFLPHQWRHGHVHQ-
prática física; volvimento referem-se a pro- cessos que, embora indissociáveis e
‡4XHDR3URPRYHUXPDHGXFDomRHIHWLYDSDUDDVD~GHHRFX- cuja ocorrência isolada é impossível, são fenômenos diferentes que
pação saudável do tempo livre de lazer; VHPSUHGHPRQVWUDPFRUUHVSRQGrQFLDGLUHWDHQWUHVL3RUGH¿QLomR

Didatismo e Conhecimento 121


CONHECIMENTOS ESPECÍFICOS/Técnico Desportivo
crescimento corresponde ao processo resultante da multiplicação e talmente os propósitos da monitoração do crescimento físico. Por
da diferenciação celular que determina alterações progressivas nas exemplo, o biologista humano, preocupado com a relação causa-
GLPHQV}HVGRFRUSRLQWHLURRXGHSDUWHVHVHJPHQWRVHVSHFt¿FRV HIHLWR GRV IDWRUHV ¿VLROyJLFRV H HFROyJLFRV GHYHUi HVWDU LQWHUHVVD-
em relação ao fator tempo, do nascimento à idade adulta. Em con- do em determinada série de medidas; o engenheiro de “design”,
trapartida, o desenvolvimento caracteriza-se pela sequência de mo- preocupado com a construção de equipamentos ou vestimentas,
GL¿FDo}HVHYROXWLYRVHPyUJmRVHVLVWHPDVGRRUJDQLVPRKXPDQR GHYHUiHVWDULQWHUHVVDGRHPRXWUDVpULHGHPHGLGDVHRSUR¿VVLR-
que induzem ao aperfeiçoamento de suas complexas funções. Desse nal de Educação Física e Esporte, preocupado com a interação de
modo, o crescimento refere-se essencialmente às transformações fatores ambientais no desenvolvimento de atributos biológicos no
quantitativas, enquanto o desenvolvimento engloba simultaneamen- organismo jovem, deverão interessar-se por uma terceira série de
te tanto as transformações quantitativas quanto as qualitativas e é re- medidas. Por consequência, em determinados momentos algumas
sultante de aspectos associados ao próprio processo de crescimento medidas antropométricas podem ser comuns a diferentes tipos de
físico, à maturação biológica e às experiências vivenciadas no atri- análise do crescimento físico; outras medidas antropométricas, po-
buto considerado: desempenho motor, emocional, social, cognitivo, UpP SRGHP VHU HVSHFt¿ FDV GH GHWHUPLQDGD iUHD GH DWXDomR 3RU
etc. Por consequência, considera-se que desenvol- vimento apresen- TXHVWmRGHFRQYHQLrQFLDSDUDRSUR¿VVLRQDOGH(GXFDomR)tVLFDH
ta conceito mais abrangente que crescimento; contudo, com base em Esporte o crescimento físico pode ser visualizado e analisado com
pressupostos associados às inter-relações entre atributos morfo- ló- base em um grupo restrito de medidas antropométricas que apresen-
JLFRVHIXQFLRQDLVYHUL¿FDVHTXHLQGLFDGRUHVGHFUHVFLPHQWRItVLFR tam alguma relação entre si, considerando a similaridades de seus
GH¿QHPVHFRPRSUpUHTXLVLWRVSDUDDRWLPL]DomRGRSURFHVVRGH aspectos biológicos. Em relação ao tamanho corporal, aquelas di-
desenvolvimento no organismo jovem; sobretudo no que se refere mensões obtidas com base no eixo longitudinal do corpo são as mais
ao desempenho motor. Portanto,