Você está na página 1de 36

Português (B)

Manual de instruções

RECEPTOR DE AV DVD

DVH-7580AV
CERTIFICADO DE GARANTIA
APARELHO: DVH-7580AV
NOME DO COMPRADOR :
TELEFONE :
CEP :
CIDADE :
ESTADO :
ENDEREÇO :
DATA DA COMPRA :
NOTA FISCAL :

VENDIDO POR :
No DE SÉRIE :
Atenção
Este Certificado de Garantia só tem validade quando preenchido e
acompanhado da Nota Fiscal correspondente. Conserve-os em seu poder.
CERTIFICADO DE GARANTIA VÁLIDO
SOMENTE NO TERRITÓRIO BRASILEIRO

A PIONEER DO BRASIL LTDA. Garante


que o aparelho desempenhará suas
funções em conformidade com o seu
manual de instruções, assegurando ao
adquirente deste aparelho, garantia
contra defeitos de matéria-prima e de
fabricação, por um período de 01 (um)
ano, incluso o período estabelecido
por lei, a contar da data de sua
aquisição, comprovada mediante a
apresentação da respectiva Nota Fiscal
do revendedor ao consumidor e deste
Certificado de Garantia devidamente
preenchido, observando o que segue:

1 A garantia supracitada é a única garantia,


quer expressa, quer implícita, ficando
excluídos quaisquer danos ou prejuízos
indiretos, tais como (de forma meramente
exemplificativa e não taxativa), lucros
cessantes, interrupção de negócios e outros
prejuízos pecuniários decorrentes do uso,
ou da possibilidade de usar este aparelho;
2 A PIONEER declara a garantia nula e
sem efeito se for constatada por ela, ou
pela assistência técnica autorizada que
o aparelho sofreu dano causado por
uso em desacordo com o manual de
instruções, ligações a tensão de rede
errada, acidentes (quedas, batidas,
etc.), má utilização, instalação
inadequada, ou ainda sinais de haver
sido violado, ajustado ou consertado
por pessoas não autorizadas;
3 O Certificado de Garantia só terá
validade quando preenchido
juntamente com a Nota Fiscal de
Venda ao Consumidor do aparelho;
4 Também será anulada a garantia
quando este Certificado de Garantia
apresentar qualquer sinal de
adulteração ou rasura;
5 Os consertos e manutenção do
aparelho em garantia, serão de
competência exclusiva das assistências
autorizadas e da PIONEER;
6 Os danos ou defeitos causados por
agentes externos, por danos causados
por uso de CDs/DVDs de má
qualidade, ação de produtos de
limpeza, excesso de pó, infiltração de
líquidos, produtos químicos
automotivos, tentativa de furto ou roubo
e demais peças que se desgastam
naturalmente com o uso (ex: baterias,
acessórios, botões, painéis, cintas), ou
por outras condições anormais de
utilização, em hipótese alguma serão
de responsabilidade do fabricante;
7 As despesas de frete, seguro e
embalagem não estão cobertas por esta
garantia, sendo de responsabilidade
exclusiva do proprietário;
8 Produtos com número de série
adulterado ou ilegível também não
serão cobertos pela presente garantia.
Conteúdo

Agradecemos por você ter adquirido este produto


PIONEER.
Leia este manual antes de utilizar o produto para garantir seu uso adequado. É
especialmente importante que você leia e observe as ADVERTÊNCIAS e os AVISOS neste
manual. Guarde-o em local seguro e acessível para referência futura.

Precauções ...............................................3 Parada total da reprodução.........................14


INFORMAÇÕES IMPORTANTES DE Seleção da faixa desejada ..........................14
SEGURANÇA ...............................................3 Avanço/retrocesso rápido durante a
Para garantir uma condução segura .............3 reprodução ..................................................14
Para evitar o descarregamento da bateria ....4 Reprodução aleatória de faixas (para CD/
Sobre esta unidade .......................................4 VCD/MP3/WMA apenas) ............................14
Repetir .........................................................14
Antes de utilizar este produto .................5 Repetir A-B ..................................................14
Funcionamento desta unidade................6 IR PARA ......................................................15
Ŗ Operações básicas .....................................9 PBC - Controle de reprodução (para VCD 2.0
Remoção do painel frontal para proteger a ou superior) .................................................15
unidade contra roubo ....................................9 Seleção de DVD Áudio ...............................15
Recolocação do painel frontal .......................9 Seleção de VCD Áudio ...............................15
Como ligar a unidade ....................................9 Seleção de legenda do DVD .......................15
Como desligar a unidade ..............................9 Seleção de título do DVD ...........................15
Seleção de uma fonte ...................................9 Seleção de ângulo do DVD .........................15
Ajuste do volume...........................................9 Zoom ...........................................................15
Ŗ Utilização e cuidados do controle remoto ..10 Ŗ Ajustes do sistema ...................................16
Utilização do controle remoto ......................10 Menu de ajuste............................................16
Substituição da bateria................................10 Geral ...........................................................16
Ŗ Operações básicas do menu ...................10 Vídeo ...........................................................17
Fonte (seleção de uma fonte) .....................10 Idioma .........................................................17
Lista (operação do menu da lista) ...............10 Áudio ...........................................................17
Áudio/Vídeo (ajuste de um menu de áudio) 10 Rádio ...........................................................17
Sistema (ajuste de um menu do sistema) ...10 Ŗ Ajuste de áudio .........................................17
Ŗ Rádio ..........................................................11 Ŗ Ajuste de vídeo ..........................................17
Menu Rádio .................................................11 Ŗ Conexão da unidade .................................18
Seleção de banda .......................................11 &KCITCOCFGſCÁºQ .....................................20
Sintonia manual (passo a passo) ................11 Ŗ Instalação ...................................................21
Busca ..........................................................11 Antes de instalar esta unidade ....................21
Armazenamento e chamada das emissoras Instalação da gaveta de montagem ............21
da memória .................................................11 Instalação do kit ..........................................21
LOC/DX (sintonia por busca local/distante) 11 Instalação ISO.............................................22
Ŗ Reprodução de USB ................................12 Fusível .........................................................22
Reprodução de arquivos em um dispositivo Reconexão da bateria .................................22
de armazenamento USB .............................12 Ŗ Remoção da unidade ................................23
Interrupção da reprodução de arquivos em Informações adicionais..........................24
um dispositivo de armazenamento USB .....12
Ŗ Solução de problemas ..............................24
Menu Lista ...................................................12
Ŗ Mensagens de erro ...................................25
Seleção da categoria de arquivos ...............12
Ŗ Orientações de manuseio ........................26
Seleção de uma pasta ................................12
Ŗ 'URGEKſECÁÐGU ..........................................30
Seleção de um arquivo (capítulo) ...............12
Reprodução de arquivos de áudio ..............12
Reprodução de arquivos de foto .................13
Reprodução de arquivos de vídeo ..............13
Reprodução de conteúdo DivX® VOD ........13
Ŗ Reprodução de disco ................................14
Inserção de um disco ..................................14
Ejeção de um disco .....................................14
Reprodução de disco ..................................14
Parada temporária da reprodução ..............14

2 Pt
Seção

Precauções 01

INFORMAÇÕES IMPORTANTES DE ADVERTÊNCIA

Português (B)
SEGURANÇA Não tente você mesmo instalar ou dar
Leia todas as instruções relacionadas ao aparelho manutenção ao aparelho. A instalação ou
e guarde-as para referência futura. manutenção do aparelho por pessoas sem
1 Leia este manual em sua totalidade e treinamento e experiência em equipamentos
atentamente antes de operar o aparelho. eletrônicos e acessórios automotivos pode
2 Mantenha este manual acessível como ser perigosa e expor você a riscos de choque
referência para os procedimentos de
elétrico, entre outros.
operação e as informações de segurança.
3 Dê atenção especial às advertências
contidas neste manual e siga atentamente
as instruções.
Para garantir uma condução segura
4 Não permita a utilização deste sistema ADVERTÊNCIA
por outras pessoas antes que elas leiam e Ŗ 1  % 1 0 & 7 6 1 4  8 ' 4 & '  % . # 4 1   0 1
compreendam as instruções de operação. % 1 0 ' % 6 1 4  & '  # . + / ' 0 6 # š “ 1   ( 1 +
5 Não instale o aparelho em um local onde DESENVOLVIDO PARA DETECTAR O
possa (i) obstruir a visão do motorista, (ii) STATUS ESTACIONADO E DEVE SER
comprometer o desempenho de qualquer ACOPLADO À FONTE DE ALIMENTAÇÃO
sistema operacional ou recursos de AO LADO DO BOTÃODO FREIO DE MÃO.
segurança do veículo, incluindo air bags, A CONEXÃO OU O USO INADEQUADO
botões com indicadores luminosos de DESSE CONDUTOR PODE VIOLAR A LEI
perigo, ou (iii) comprometer a habilidade APLICÁVEL E CAUSAR SÉRIOS ACIDENTES
do motorista em conduzir o veículo com OU DANOS.
segurança. Ŗ 2CTC GXKVCT Q TKUEQ FG FCPQU G HGTKOGPVQU G
6 Não opere este aparelho durante a C XKQNCÁºQ GO RQVGPEKCN FCU NGKU CRNKE¶XGKU
condução do veículo, pois isso desviará a esta unidade não pode ser utilizada com vídeo
sua atenção da condução segura. Obedeça visível para o motorista.
sempre as regras para uma condução Ŗ 2CTC GXKVCT Q TKUEQ FG CEKFGPVG G C XKQNCÁºQ
segura e siga as leis de trânsito existentes. GO RQVGPEKCN FCU NGKU CRNKE¶XGKU PGPJWOC
5GVKXGTFKſEWNFCFGGOQRGTCTQUKUVGOCQW visualização de vídeo nos assentos dianteiros
ler o aparelho, estacione o veículo em um deve ocorrer enquanto o veículo estiver sendo
local seguro e faça os ajustes necessários. conduzido.
7 Lembre-se de sempre apertar o cinto Ŗ 'O CNIWPU RCÈUGU QW GUVCFQU C XKUWCNK\CÁºQ
de segurança ao conduzir o veículo. de imagens em um aparelho dentro de um
Na hipótese de um acidente, se o cinto XGÈEWNQ CVÃ OGUOQ RQT QWVTCU RGUUQCU SWG
de segurança não estiver corretamente PºQ UGLCO Q OQVQTKUVC RQFG UGT KNGICN 'O
encaixado, seus ferimentos poderão ser tais locais onde essas regulamentações se
consideravelmente mais severos. CRNKECOGNCUFGXGOUGTQDGFGEKFCU
8 Nunca utilize fones de ouvido enquanto
dirige. #QVGPVCTCUUKUVKTCWOXÈFGQFWTCPVGCEQPFWÁºQ
9 Para proporcionar maior segurança, a advertência É estritamente proibida a
FGVGTOKPCFCUHWPÁÐGUſECOFGUCVKXCFCUC visualização da fonte de vídeo no assento
menos que o freio de mão esteja puxado e dianteiro durante a condução será visualizada
o veículo não esteja em movimento. no aparelho dianteiro. Para assistir a um vídeo
10 Nunca deixe o volume do seu aparelho PQCRCTGNJQFKCPVGKTQGUVCEKQPGQXGÈEWNQGOWO
muito alto de forma que você não local seguro e puxe o freio de mão.
consiga ouvir o trânsito e os veículos de
emergência.

Pt 3
Seção

01 Precauções

Para evitar o descarregamento da bateria Sobre esta unidade


Deixe o motor do veículo ligado enquanto utiliza Evite o uso prolongado do aparelho com volume
esta unidade para evitar que a bateria seja UWRGTKQTCFGEKDÃKURQKUKUVQRQFGT¶RTGLWFKECT
descarregada. a sua audição.
Ŗ 3WCPFQPºQJ¶HQTPGEKOGPVQFGGPGTIKCRCTC
GUVC WPKFCFG EQOQ RQT GZGORNQ SWCPFQ C TABELA:
DCVGTKC FQ XGÈEWNQ GUVKXGT UGPFQ UWDUVKVWÈFC Nível de Exemplos
o microcomputador desta unidade retorna à Decibéis
sua condição inicial. Recomendamos que você   $KDNKQVGECUKNGPEKQUCUWUUWTTQUNGXGU
transcreva os dados de ajuste de áudio antes   5 CNC FG GUVCT TGHTKIGTCFQT SWCTVQ
de realizar tais operações. longe do trânsito
  6T¸PUKVQ NGXG EQPXGTUCÁºQ PQTOCN
ADVERTÊNCIA escritório silencioso
60 Ar condicionado a uma distância de
Não utilize em veículos que não tenham uma OO¶SWKPCFGEQUVWTC
posição ACC.   #URKTCFQTFGRÎUGECFQTFGECDGNQ
restaurante ruidoso
  6T¶HGIQOÃFKQFGEKFCFGEQNGVQTFG
Patente dos EUA nº. 6.836.549; 6.381.747;
NKZQ CNCTOG FG FGURGTVCFQT C WOC
G
distância de 60 cm
Este produto i ncorpora a tecn ol ogia d e
OS RUÍDOS ABAIXO PODEM SER PERIGOSOS
RTQVGÁºQCQUFKTGKVQUCWVQTCKUSWGÃFGHGPFKFC
EM CASO DE EXPOSIÇÃO CONSTANTE
por patentes americanas e outros direitos de
  / G V TÏ   OQ V Q E K EN G V C   V T¶ H G I Q  F G
propriedade intelectual. A utilização dessa
ECOKPJºQEQTVCFQTFGITCOC
tecnologia de proteção aos direitos autorais
  % COKPJºQ FG NKZQ UGTTC GNÃVTKEC
deve ser autorizada pela Rovi e destina-se
furadeira pneumática
apenas aos usos residencial e de visualização
120 Show de banda de rock em frente às
NKOKVCFC C OGPQU SWG UGLC FQ EQPVT¶TKQ
ECKZCUCEÕUVKECUVTQXºQ
autorizada pela Rovi. A engenharia reversa ou
  6KTQFGCTOCFGHQIQCXKºQCLCVQ
FGUOQPVCIGOÃRTQKDKFC
180 Lançamento de foguete
Informação cedida pela Deafness Research
(QWPFCVKQPRQTEQTVGUKC

Fabricado sob licença da Dolby Laboratories.


“Dolby” e o símbolo de dois Ds são marcas
comerciais da Dolby Laboratories.
Outras marcas comerciais e marcas registradas
pertencem a seus respectivos proprietários.

'UVG RTQFWVQ Ã WO FKQFQ C NCUGT FG ENCUUG


 OCU EQPVÃO WO FKQFQ C NCUGT FG %NCUUG
superior à 1. Para garantir o máximo de
UGIWTCPÁC PºQ TGOQXC CU VCORCU QW VGPVG
acessar o interior do produto. Consulte o
RGUUQCN SWCNKſECFQ SWCPVQ CQU RTQEGFKOGPVQU
de manutenção.

PRODUTO A LASER DA CLASSE 1

4 Pt
Seção

Antes de utilizar este produto 02

Sobre esta unidade Desative o modo de demonstração

Português (B)
CUIDADO O modo de demonstração pode ser desligado
CVTCXÃUFQUGIWKPVGRTQEGUUQ
Ŗ 0 ºQ RGTOKVC SWG GUVC WPKFCFG GPVTG GO
contato com líquidos. Há risco de choque - Pressione o botão SRC para ligar esta
G N Ã V T K E Q   # N Ã O  F K U U Q   Q  E Q P V C V Q  E Q O unidade.
N È S W K F Q U  R Q F G  E C W U C T F C P Q U   H W O C Á C  G - Pressione e segure a tecla SEL para visualizar
superaquecimento desta unidade. o menu AJUSTE.
Ŗ 5GORTGFGKZGQXQNWOGDCKZQRCTCRQFGTQWXKT - Selecione o menu Geral e depois escolha o
os sons do tráfego. menu DEMO.
Ŗ 'XKVGCGZRQUKÁºQ´WOKFCFG - Selecione Desligar e depois pressione o centro
do Multicontrole para desligar o modo DEMO.
Nota - Pressione a tecla ESC para cancelar a seleção
As operações de ajuste de função serão do menu AJUSTE.
concluídas mesmo se o menu for cancelado antes
FGUGTGOEQPſTOCFCU 1OQFQFGFGOQPUVTCÁºQVCODÃOÃFGUCVKXCFQ
automaticamente ao ligar e desligar a chave de
No caso de problemas ignição.
5G GUVG RTQFWVQ PºQ HWPEKQPCT EQTTGVCOGPVG
entre em contato com o revendedor ou a Central
de Serviços autorizada da Pioneer mais próxima.

Reajuste do microprocessador
O microprocessador deve ser reajustado nas
seguintes situações:
Ŗ #PVGU FG WVKNK\CT GUVC WPKFCFG RGNC RTKOGKTC
vez após a instalação
Ŗ 5GCWPKFCFGRCTCTFGHWPEKQPCTEQTTGVCOGPVG
Ŗ 3WCPFQ OGPUCIGPU GUVTCPJCU QW KPEQTTGVCU
forem visualizadas no aparelho

1 Pressione o botão [ ] na parte superior


esquerda do painel frontal para movê-lo para
baixo.
2 Pressione [RESET] com a ponta de uma
caneta ou outro instrumento pontiagudo.

REINICIAR

Pt 5
Seção

03 Funcionamento desta unidade

Pressione o botão [ ] para abrir o painel frontal.

Parte Operação Parte Operação

Ŗ 2CKPGNCDGTVQ Ŗ 4
 GVQTPCTCQOGPWFCHQPVG
principal (pressione por mais
Ŗ .KICT FGU WUGQUDQVÐGU=Ŗ?
/MUTE Ŗ 'OWFGEGT
2CTCCGUSWGTFC =Ŗ?
2CTC
Ŗ &
 GUNKICT
RTGUUKQPGRQTOCKU a direita) no painel frontal ou [
de 2 s) SRC ] / [ ] no controle remoto
para selecionar o modo
Ŗ 5
 GNGEKQPCTOQFQFG
FGUGLCFQGRTGUUKQPGQ
reprodução:
botão [M.C.] no painel frontal
 Ŗ4&+1
ou [ENTER] no controle
 Ŗ&+5%
SWCPFQJ¶WOFKUEQ
inserido) remotoRCTCEQPſTOCT
 Ŗ75$
SWCPFQ75$GUV¶
Ŗ 4
 GRTQFW\KT2CWUCT
PQU
SRC conectado)
OQFQU&8&%&G/2
 ŖAUX-IN (Áudio frontal
& entrada de vídeo.
BAND WMA)
Ŗ 5
 GNGVQTFGDCPFC
PQOQFQ
&KURQUKVKXQURGTKHÃTKEQU
Rádio)
externos com saídas de
áudio e vídeo RCA podem
ser conectados à unidade.)

6 Pt
Seção

Funcionamento desta unidade 03

Português (B)
Parte Operação Parte Operação

Ŗ $
 WUECTCGOKUUQTCCPVGTKQT Ŗ %CPEGNCTQOGPWFGUGNGÁºQ
automaticamente (pressione de fonte e retornar ao menu
por mais de 2 s) (no modo anterior
Rádio). Ŗ &WTCPVGCTGRTQFWÁºQFQU
Ŗ $
 WUECTCGOKUUQTCCPVGTKQT XÈFGQURTGUUKQPGRCTC
ESC mostrar as informações.
manualmente (no modo
Rádio). Ŗ #RCTGNJQFGUNKICFQ
Ŗ
2CTCC Ŗ $
 WUECTCHCKZCQWECRÈVWNQ (pressionar por mais de 2 s)
esquerda) CPVGTKQT
PQUOQFQU%& Pressione qualquer botão
MP3/WMA e DVD Vídeo). para retomar.
Ŗ 4
 GVTQEGUUQT¶RKFQGO Ŗ 8CTTGFWTCRTQITCOCFC
PQ
RCUUQU
RTGUUKQPGRQT modo Rádio)
OCKUFGU 
PQUOQFQU%& Ŗ /GOÎTKCFCUOGNJQTGU
MP3/WMA e DVD Vídeo). BSM emissoras (pressionar por
Ŗ 0
 CXGICTRCTCCGUSWGTFC mais de 2 s) (no modo
dentre os itens de opções Rádio)
Ŗ 2CTCTTGRTQFWÁºQ
Ŗ #LWUVCTQPÈXGNFGXQNWOG Ŗ #8+0
MULTI- (girar). Conector de entrada AUX
Ŗ %QPſTOCTQRGTCÁºQ
EQPGEVQTGUVÃTGQXÈFGQFG
CONTROL (pressionar)
(M.C.) OO
Ŗ 2CTCTCDWUECCWVQO¶VKEC
PQ Utilize para conectar um
modo Rádio) (pressionar) dispositivo auxiliar.
Ŗ 0 CXGICTRCTCDCKZQFGPVTG
os itens de opções (nos Ŗ 0CXGICTRCTCEKOCFGPVTGQU
OQFQU&8&%&G/2 itens de opções (nos modos
WMA) &8&%&G/29/#
Ŗ
2CTCDCKZQ  Ŗ
2CTCEKOC 
Ŗ 4GRTQFW\KTCRTÎZKOC Ŗ 4GRTQFW\KTCGOKUUQTCFG
emissora de rádio rádio programada anterior
programada (no modo (no modo Rádio)
Rádio)
Ŗ $
 WUECTCRTÎZKOCGOKUUQTC Ŗ #LWUVGFG¶WFKQXÈFGQ
automaticamente (pressione (pressionar).
SEL Ŗ /GPWFGCLWUVG
RTGUUKQPCT
por mais de 2 s) (no modo
Rádio). por mais de 2 s).
Ŗ $
 WUECTCRTÎZKOCGOKUUQTC
Ŗ 5GPUQTTGOQVQ
manualmente (no modo
Rádio).
Ŗ #RCTGNJQ6(6FGRQN
Ŗ
2CTCC Ŗ $  WUECTCRTÎZKOCHCKZCQW
direita) ECRÈVWNQ
PQUOQFQU%& Ŗ 2QTVC75$
MP3/WMA e DVD Vídeo).
Ŗ #
 XCPÁQT¶RKFQGO Ŗ 5 NQV FG ECTTGICOGPVQ FG
passos (pressione por mais disco
FGU 
PQUOQFQU%& Ŗ $QVºQ'LGVCT
MP3/WMA e DVD Vídeo).
Ŗ 0
 CXGICTRCTCCFKTGKVCFGPVTG Ŗ 4'5'6
os itens de opções

CUIDADO
Ŗ 7
 VKNK\GWOECDQ75$QREKQPCNFC2KQPGGT
%&
U50E) para conectar o áudio player USB/
OGOÎTKC75$L¶SWGSWCNSWGTFKURQUKVKXQ
EQPGEVCFQFKTGVCOGPVG´WPKFCFGſECRTQLGVCFQ
para fora e pode ser perigoso.
Ŗ 0 ºQWVKNK\GRTQFWVQUPºQCWVQTK\CFQU

Pt 7
Seção

03 Funcionamento desta unidade


Ŗ Avançar rapidamente
Ŗ Pressione para pausar ou
retomar a reprodução.
Ŗ Próxima faixa/capítulo.
Ŗ $WUECTGOKUUQTCRQTKPVGTXCNQ
/
Ŗ Buscar a próxima emissora
SEEK +
disponível (pressionar por
mais de 2 s)
Ŗ 'ZKDKTCUKPHQTOCÁÐGUFG
reprodução.
DISP/
Ŗ Varredura programada
BSM
do rádio / Programação
automática do rádio.
1-9 Ŗ Botões de dígitos
G/# Ŗ Ir para busca
VOLUME Ŗ Pressione para aumentar
+/- ou diminuir o volume.
Ŗ Pressione para emudecer.
MUTE Pressione novamente para
cancelar.
Ŗ Alternar o canal de áudio.
AUDIO/ Ŗ #NVGTPCTQKFKQOCFQ¶WFKQFQ
MUSIC DVD.
Ŗ /QUVTCTlista de músicas.
Ŗ Acessar o menu do DVD.
Parte Operação MENU/
Ŗ # EGUUCT Q OGPW PBC (para
PBC
Ŗ Ligar/desligar. VCD 2.0 ou superior)
Ŗ 5CKTFQOGPWCVWCNGTGVQTPCT
Ŗ R e p r o d u z i r s e l e ç ã o d e ESC
ao último menu.
fonte.
SETUP Ŗ 'PVTCTPQmenu de ajuste
SRC Ŗ 4
 GVQTPCTCQOGPWFCHQPVG
principal (pressione por mais Ŗ * C D K N K V C T  F G U C D K N K V C T
RDM
de 2 s). reprodução aleatória
Ŗ S e l e c i o n a r u m â n g u l o / Ŗ * C D K N K V C T  F G U C D K N K V C T
RPT
ANGLE/ versão de diferença da reprodução com repetição
VIDEO cena do DVD atual. Ŗ Entrar no menu de ajuste
SEL
Ŗ /QUVTCTlista de vídeos de áudio/vídeo
SUB Ŗ S e l e c i o n a r i d i o m a d e Ŗ Retroceder rapidamente
TITLE/ legenda do DVD ou DivX.
PHOTO Ŗ Selecionar uma banda do
Ŗ /QUVTCTlista de fotos BAND
sintonizador.
Ŗ Ampliar ou reduzir imagem
Ŗ Faixa/capítulo anterior.
ZOOM ou tamanho de imagem
Ŗ Pressione para buscar a
ativa.
/ emissora anterior.
Ŗ Entrar no menu de título do
TITLE SEEK - Ŗ Buscar a emissora anterior
DVD.
disponível (pressionar por
Ŗ Cursor do menu. mais de 2 s)
ENTER Ŗ Entrar 0/ Ŗ +PUGTKTQPÕOGTQ
Ŗ P ressione para parar a C/ Ŗ .KORCTQPÕOGTQKPUGTKFQ
/
reprodução.
Ŗ  ",      Não há função neste
A B Ŗ Repetir A-B
modelo.
8 Pt
Seção

Funcionamento desta unidade 03

Operações básicas

Português (B)
Importante
Ŗ # Q TGOQXGT QW EQNQECT Q RCKPGN HTQPVCN
manuseie-o com cuidado.
Ŗ ' XKVG GZRQT Q RCKPGN HTQPVCN C KORCEVQU 1
excessivos.
Ŗ /CPVGPJCQRCKPGNHTQPVCNFKUVCPVGFCNW\FKTGVC
do sol e não o exponha a temperaturas altas.  8GTKſSWG UG Q RCKPGN HTQPVCN HQK EQTTGVCOGPVG
Ŗ 2CTCGXKVCTSWGQEQTTCOFCPQUCQFKURQUKVKXQ encaixado na unidade principal.
QWKPVGTKQTFQXGÈEWNQTGOQXCSWCKUSWGTECDQU 2 Pressione a extremidade superior esquerda
e dispositivos acoplados ao painel frontal FQRCKPGNHTQPVCNCVÃQUGWVQVCNGPECKZG
antes de retirá-lo.

Remoção do painel frontal para proteger


a unidade contra roubo
1 Pressione o botão [ ] para abrir o painel
frontal. 2

Ŗ 5 G PºQ EQPUGIWKT GPECKZCT EQTTGVCOGPVG Q


1 RCKPGN HTQPVCN PC WPKFCFG RTKPEKRCN TGVKTGQ
e tente encaixá-lo novamente. Se tentar
GPECKZ¶NQ´HQTÁCGNGRQFGT¶UGTFCPKſECFQ

Como ligar a unidade


 5
 GIWTG Q NCFQ GUSWGTFQ FQ RCKPGN HTQPVCN Pressione o botão [ /MUTE ] para ligar a
GORWTTGQRCTCCFKTGKVCGOUGIWKFCRWZGQ unidade.
para fora.  6 CODÃO Ã NKICFQ SWCPFQ C VGENC =54%? Ã
pressionada.

Como desligar a unidade


Pressione e segure [ /MUTE ]CVÃFGUNKICT
a unidade.

Seleção de uma fonte


2 Pressione [ SRC ] para alternar entre:
RÁDIO (sintonizador)—DISC (quando há
 #
 NW\FQKPFKECFQTRKUECFGRQKUSWGQRCKPGNÃ um disco inserido)—USB (quando USB está
removido. conectado)—AUX-IN (AUX-IN não pode
3 Sempre mantenha o painel frontal removido GZGEWVCTWOCUGNGÁºQFGHQPVGCOGPQUSWG
GO WO FKURQUKVKXQ FG RTQVGÁºQ EQOQ WO AUX seja ativado no menu de ajuste.)
estojo.
Ajuste do volume
Gire [M.C.] para ajustar o volume. Gire no
Recolocação do painel frontal sentido anti-horário para diminuir e no sentido
 5
 GIWTG Q NCFQ GUSWGTFQ FQ RCKPGN HTQPVCN horário para aumentar o volume.
GORWTTGQ RCTC C FKTGKVC G GO UGIWKFC
GORWTTGQRCTCFGPVTQCVÃUGPVKTQENKSWG

Pt 9
Seção

03 Funcionamento desta unidade

Utilização e cuidados do Importante


Ŗ 0 ºQ FGKZG Q EQPVTQNG TGOQVQ GZRQUVQ C
controle remoto temperaturas altas ou à luz direta do sol.
Ŗ 1  EQPVTQNG TGOQVQ RQFGT¶ PºQ HWPEKQPCT
Utilização do controle remoto
EQTTGVCOGPVGUGſECTGZRQUVQ´NW\FKTGVCFQ
Aponte o controle remoto para a direção do
sol.
painel frontal para operá-lo.
Ŗ 0 ºQ FGKZG Q EQPVTQNG TGOQVQ ECKT PQ EJºQ
#QWVKNK\CTRGNCRTKOGKTCXG\RWZGQſNOGSWGUG
onde pode ficar preso embaixo do pedal do
projeta da bandeja.
freio ou acelerador.
Substituição da bateria
1 Deslize para fora a bandeja localizada na
parte posterior do controle remoto e insira a Operações básicas do menu
DCVGTKCEQOQURÎNQURQUKVKXQ
GPGICVKXQ
Ō 
alinhados corretamente.
Fonte (seleção de uma fonte)
 2 TGUUKQPG G UGIWTG =54%? CVÃ XKUWCNK\CT Q
Ŗ #QWVKNK\CTRGNCRTKOGKTCXG\RWZGQſNOGSWG
menu inicial.
se projeta da bandeja.
 7UG QU DQVÐGU  = Ŗ ?
2CTC C GUSWGTFC   = Ŗ ?
(Para a direita) no painel frontal ou [ ] / [ ]
no controle remoto para selecionar a fonte
desejada.
Pressione o botão [M.C.] no painel frontal ou
[ENTER] no controle remoto para selecionar.

Lista (operação do menu da lista)


Pressione [ESC] para visualizar o menu da lista
ADVERTÊNCIA (no modo MP3/WMA/CD-DA) (página 12).
Ŗ / CPVGPJC C DCVGTKC HQTC FQ CNECPEG FG
crianças.
 %CUQ GNC UGLC KPIGTKFC EQPUWNVG WO OÃFKEQ Áudio/Vídeo (ajuste de um menu de
imediatamente. áudio)
Ŗ #U DCVGTKCU
DCVGTKC QW DCVGTKCU KPUVCNCFCU  Pressione [SEL] para visualizar o menu de áudio/
PºQ FGXGO UGT GZRQUVCU C ECNQT GZEGUUKXQ vídeo.
EQOQ NW\ FKTGVC FQ UQN HQIQ QW UKVWCÁºQ Consulte Ajustes de áudio (página 17).
semelhante.

CUIDADO Sistema (ajuste de um menu do sistema)


Pressione e segure [SEL] por mais de 2
Ŗ 7VKNK\GWOCDCVGTKCFGNÈVKQ%4
8  segundos para visualizar o menu do sistema.
Ŗ 4GOQXCCDCVGTKCUGPºQHQTWVKNK\CTQEQPVTQNG Consulte Ajustes do sistema (página 16).
remoto por um mês ou mais.
Ŗ 5G C DCVGTKC HQT UWDUVKVWÈFC KPEQTTGVCOGPVG
haverá perigo de explosão. Substitua-a
apenas por uma do mesmo tipo ou
equivalente.
Ŗ 0 ºQ OCPWUGKG C DCVGTKC EQO HGTTCOGPVCU
metálicas.
Ŗ 0 º Q  C T O C \ G P G  C  D C V G T K C  E Q O  Q D L G V Q U
metálicos.
Ŗ ' O ECUQ FG XC\COGPVQ FC DCVGTKC NKORG
completamente o controle remoto e instale
uma nova bateria.
Ŗ # Q FGUECTVCT DCVGTKCU WUCFCU EGTVKHKSWG
se de estar em conformidade com as
regulamentações governamentais ou com
as normas das instituições públicas do meio
ambiente que se aplicam ao seu país/região.

10 Pt
Seção

Funcionamento desta unidade 03

Rádio Q DQVºQ = Ŗ ?
2CTC EKOC  QW = Ŗ ?
2CTC DCKZQ 

Português (B)
RCTC UGNGEKQPCT WO PÕOGTQ RTQITCOCFQ G
Menu Rádio GO UGIWKFC RTGUUKQPG Q DQVºQ =/%? RCTC
armazená-lo.
 8QEÄ VCODÃO RQFG TGCNK\CT C QRGTCÁºQ RGNQ
controle remoto conforme o passo a seguir:
RADIO
Pressione e segure um botão de número (1-
  PQ EQPVTQNG TGOQVQ C GOKUUQTC CVWCN UGT¶
armazenada na memória.

Armazenamento de uma emissora


programada automaticamente
A BSM (Memória das melhores emissoras)
EQ FLAT armazena automaticamente as 6 emissoras mais
fortes de cada banda; a unidade pode armazenar
18 emissoras no total.

Memória das melhores emissoras


1 Pressione e segure o botão [ BSM]
Indicador de fonte por mais de 2 segundos para buscar e
armazenar emissoras. Durante a busca e o
Hora CTOC\GPCOGPVQő$5/ŒCRCTGEGPQCRCTGNJQ
2 A unidade fará a reprodução resumida das
Banda
emissoras programadas automaticamente e
Emissora programada No. “AMS-” aparecerá no aparelho.
Ŗ 2CTCECPEGNCTRTGUUKQPGQDQVºQ= BSM]
Indicador de efeito sonoro novamente.
Frequência
Como chamar da memória emissoras
programadas
Seleção de banda Pressione o botão [ BSM] para fazer a
Pressione o botão [BAND ] várias vezes reprodução resumida de todas as emissoras
para selecionar a banda desejada. O indicador de programadas.
DCPFC
(/(/(/QW#/ UGT¶XKUWCNK\CFQ
LOC/DX (sintonia por busca local/
Sintonia manual (passo a passo) distante)
2TGUUKQPGQDQVºQ=Ŗ?
2CTCCGUSWGTFC QW=Ŗ? A sintonia por busca local permite que você
(Para a direita) para sintonizar passo a passo. sintonize apenas as emissoras de rádio com
UKPCKUUWſEKGPVGOGPVGHQTVGURCTCDQCTGEGRÁºQ
Busca Sintonia por busca distante permite receber todos
 2
 TGUUKQPG G UGIWTG Q DQVºQ = Ŗ ?
2CTC C os sinais.
GUSWGTFC QW=Ŗ?
2CTCCFKTGKVC RQTOCKUFG 1 Pressione e segure o botão [SEL] para
2 segundos para buscar a emissora anterior/ visualizar o modo de ajuste.
próxima disponível.  2TGUUKQPGQUDQVÐGU=Ŗ?
2CTCCGUSWGTFC 
2 Você pode cancelar a sintonia por busca  =Ŗ?
2CTCCFKTGKVC PQRCKPGNHTQPVCNQW= ] /
CQ RTGUUKQPCT Q DQVºQ =/%? QW = Ŗ ?
2CTC C [ ] no controle remoto para selecionar o
GUSWGTFC =Ŗ?
2CTCCFKTGKVC  menu de ajuste do Rádio.
 )KTG =/%? QW RTGUUKQPG Q DQVºQ = Ŗ ?
2CTC
baixo) no painel frontal ou o botão [ ] no
Armazenamento e chamada das
controle remoto para mover o cursor para a
emissoras da memória opção LOC DX.
8QEÄ RQFG HCEKNOGPVG CTOC\GPCT CVÃ UGKU 4 Pressione o botão [M.C.] ou [ENTER] para
emissoras programadas para cada banda. espalhar o submenu.
 )KTG=/%?QWRTGUUKQPGQUDQVÐGU=Ŗ?
2CTC
Armazenamento de uma emissora EKOC =Ŗ?
2CTCDCKZQ PQRCKPGNHTQPVCNQW
programada manualmente [ ] / [ ] no controle remoto para selecionar
1 Sintonize para uma emissora desejada a opção desejada.
EQPHQTOGQOÃVQFQCEKOC 6 Pressione o botão [M.C.] ou [ENTER] para
 2 TGUUKQPG G UGIWTG Q DQVºQ =/%? CVÃ C EQPſTOCT
emissora programada piscar na tela. Pressione
Pt 11
Seção

03 Funcionamento desta unidade

Reprodução de USB Seleção de uma pasta


 2TGUUKQPGQUDQVÐGU=Ŗ?
2CTCEKOC =Ŗ?
2CTC
Reprodução de arquivos em um baixo) ou [ ] / [ ] para selecionar uma
dispositivo de armazenamento USB pasta (se existirem pastas no armazenamento)
1 Abra a tampa da porta USB. GRTGUUKQPG=/%?QW='06'4?RCTCEQPſTOCT
2 Conecte o dispositivo de armazenamento USB  2CTC NQECNK\CT WOC UWDRCUVC TGRKVC Q RCUUQ
utilizando um cabo USB. acima.
3 A unidade alternará para o modo USB e
Seleção de um arquivo (capítulo)
carregará os arquivos no dispositivo USB
0Q OGPW FC NKUVC FG CTSWKXQU RTGUUKQPG QU
automaticamente.
DQVÐGU=Ŗ?
2CTCEKOC =Ŗ?
2CTCDCKZQ QW= ]
/[ ] para selecionar um arquivo e pressione o
Interrupção da reprodução de arquivos DQVºQ=/%?QW='06'4?CWPKFCFGECTTGICT¶Q
em um dispositivo de armazenamento arquivo e iniciará a reprodução.
USB Seleção de um arquivo de outra pasta:
Ŗ # NVGTPGRCTCQWVTQOQFQ 1. S e h o u v e r m a i s d e u m a p a s t a n o
Ŗ &GUEQPGEVG Q FKURQUKVKXQ FG CTOC\GPCOGPVQ CTOC\GPCOGPVQWOÈEQPGFGRCUVCCRCTGEGT¶
USB. sobre os nomes dos arquivos. Pressione os
DQVÐGU=Ŗ?
2CTCEKOC =Ŗ?
2CTCDCKZQ QW
Menu Lista [ ] / [ ] para selecioná-la e pressione o
botão [M.C.] ou [ENTER] para mostrar todas
as pastas.
 2TGUUKQPGQUDQVÐGU=Ŗ?
2CTCEKOC =Ŗ?
2CTC
baixo) ou [ ] / [ ] para selecionar uma pasta
e pressione o botão [M.C.] ou [ENTER] para
mostrar os arquivos na pasta.

Reprodução de arquivos de áudio

Indicador de fonte
EQ FLAT
Indicador de status da reprodução
Número da faixa atual/Número total de
faixas
Hora

Indicador da lista de áudio


Informações sobre a faixa
Indicador da lista de fotos
Informações de Reprodução com
Indicador da lista de vídeos Repetição e Aleatória
Lista de arquivos Indicador de efeito sonoro

Tempo decorrido/Tempo total da faixa


Seleção da categoria de arquivos Ŗ 0Q OGPW FG TGRTQFWÁºQ RTGUUKQPG Q DQVºQ
A unidade entrará na lista de arquivos depois de [ESC] para retornar à categoria superior.
ECTTGICTQCTOC\GPCOGPVQRTGUUKQPGQDQVºQ=Ŗ?
(Para a esquerda) no painel frontal ou o botão [ ] Reproduzir/Pausa
no controle remoto para retornar à seleção de tipo Pressione o botão [ BAND ] no painel frontal
de arquivo. ou [ ] no controle remoto para reproduzir/
2TGUUKQPG QU DQVÐGU =Ŗ?
2CTCEKOC =Ŗ?
2CTC pausar.
baixo) no painel frontal ou [ ] / [ ] no controle
remoto para selecionar a categoria de arquivos Faixa anterior/próxima

WFKQ(QVQ8ÈFGQ GRTGUUKQPG=/%?QW='06'4? PressKQPGQDQVºQ=Ŗ?
2CTCCGUSWGTFC QW=Ŗ?
RCTCEQPſTOCT (Para a direita) para ir para a faixa anterior ou
próxima.
12 Pt
Seção

Funcionamento desta unidade 03

Avanço ou retrocesso rápido Reprodução de conteúdo DivX® VOD

Português (B)
 TGUUKQPGGUGIWTGQDQVºQ=Ŗ?
2CTCCGUSWGTFC 
2 Certos conteúdos DivX® VOD (vídeo sob
QW=Ŗ?
2CTCCFKTGKVC RQTOCKUFGUGIWPFQU demanda) só podem ser reproduzidos por um
RCTCTGVTQEGFGTCXCPÁCTTCRKFCOGPVGGO determinado número de vezes.
16 passos. Quando você tentar reproduzir este tipo de
Voltar ao menu da lista conteúdo salvo em um dispositivo de
CTOC\GPCOGPVQGZVGTPQQPÕOGTQTGOCPGUEGPVG
Pressione o botão [ESC] para voltar ao menu da
lista. de vezes que ele poderá ser reproduzido será
mostrado na tela. Você pode então decidir se
Reprodução de arquivos de foto reproduzirá ou não o conteúdo do dispositivo de
Reproduzir/Pausa armazenamento externo.
Pressione o botão [BAND ] ou [ ] para Ŗ 5 G PºQ JQWXGT WO NKOKVG RCTC Q PÕOGTQ FG
reproduzir/pausar. vezes que o conteúdo DivX® VOD pode ser
XKUWCNK\CFQ XQEÄ RQFGT¶ KPUGTKT Q FKURQUKVKXQ
Foto anterior/próxima de armazenamento externo no player e
 TGUUKQPGQDQVºQ=Ŗ?
2CTCCGUSWGTFC QW=Ŗ?
2 reproduzir o conteúdo quantas vezes quiser e
(Para a direita) para ir para a foto anterior ou
nenhuma mensagem será exibida.
próxima.
Ŗ 8QEÄRQFGEQPſTOCTQPÕOGTQFGXG\GUSWG
Rotação da foto o conteúdo pode ser reproduzido verificando
Pressione o botão [ ] para girar a foto o número exibido após “Visualizações
u   u   u RTGUUKQPG Q DQVºQ = ] restantes:”.
RCTC IKTCT C HQVQ u    u   u ECFC
RTGUUKQPCOGPVQRCTCIKTCTCHQVQuRTGUUKQPGQU Importante
DQVÐGU=Ŗ?
2CTCEKOC =Ŗ?
2CTCDCKZQ QW= ] / Ŗ 2CTC TGRTQFW\KT EQPVGÕFQ &KX:® VOD nesta
[ ] para girar a foto 180°. WPKFCFG XQEÄ RTKOGKTQ RTGEKUC TGIKUVTCT C
Voltar ao menu da lista unidade junto ao seu provedor de conteúdo
Pressione o botão [ BSM] para voltar ao DivX® VOD. Para obter detalhes sobre o seu
menu da lista. EÎFKIQ FG TGIKUVTQ EQPUWNVG 8KUWCNK\CÁºQ FQ
código de registro DivX® VOD.
Reprodução de arquivos de vídeo Ŗ 1  EQPVGÕFQ &KX: ®  81& Ã RTQVGIKFQ RGNQ
Reproduzir/Pausa sistema DRM (Digital Rights Management). O
Pressione o botão [BAND ] ou [ ] para sistema limita a reprodução de conteúdo de
reproduzir/pausar. GSWKRCOGPVQUGURGEÈſEQUGTGIKUVTCFQU

Capítulo anterior/próximo Se uma mensagem for visualizada após inserir


Pressione oDQVºQ=Ŗ?
2CTCCGUSWGTFC QW=Ŗ? o dispositivo de armazenamento externo com
(Para a direita) para ir para o capítulo anterior ou conteúdo DivX ®  81& WVKNK\G Q /% RCTC
próximo. selecionar o modo desejado.
Avanço ou retrocesso rápido Gire para alterar o modo. Pressione para
PresUKQPGGUGIWTGQDQVºQ=Ŗ?
2CTCCGUSWGTFC  selecionar.
QW=Ŗ?
2CTCCFKTGKVC RQTOCKUFGUGIWPFQU Ŗ 4GRTQFW\KTŌ4GRTQFW\QEQPVGÕFQ&KX:® VOD
RCTCTGVTQEGFGTCXCPÁCTTCRKFCOGPVGGO Ŗ 4 GRTQFW\KT RTÎZKOQ Ō 2WNC RCTC Q RTÎZKOQ
16 passos. arquivo
Ŗ 2 CTCT Ō 5G XQEÄ PºQ SWKUGT TGRTQFW\KT Q
Voltar ao menu da lista conteúdo DivX® VOD
Pressione o botão [ BSM] para voltar ao
menu da lista.
Notas
Ŗ &
 esconecte os dispositivos de armazenamento
USB da unidade quando não estiverem em
uso.
Ŗ .GXCT¶ CNIWPU OKPWVQU FWTCPVG C TGRTQFWÁºQ
FG FKURQUKVKXQU FG CTOC\GPCOGPVQ GZVGTPQ
contendo uma combinação de vários tipos de
arquivos de mídia.
Ŗ 7VKNK\GWOECDQ75$QREKQPCNFC2KQPGGT
%&
U50E) para conectar o áudio player USB/
OGOÎTKC 75$ L¶ SWG SWCNSWGT FKURQUKVKXQ
conectado diretamente à unidade fica
projetado para fora e pode ser perigoso.
Ŗ 0ºQWVKNK\GRTQFWVQUPºQCWVQTK\CFQU
Pt 13
Seção

03 Funcionamento desta unidade

Reprodução de disco Parada total da reprodução


 & WTCPVG C TGRTQFWÁºQ RTGUUKQPG Q DQVºQ
Inserção de um disco [ BSM] uma vez para parar a reprodução
1 Pressione o botão [ ?
R¶IKPC ) para GQNQECNTGNGXCPVGPQFKUEQÃUCNXQ2TGUUKQPG
abrir o painel. [BAND ] ou [ ] para retomar a
2 Insira um disco no slot de carregamento reprodução a partir do local salvo no disco.

R¶IKPC ). 2. P r e s s i o n e [ BSM] duas vezes
para interromper a reprodução.
3 Feche o painel e a unidade mudará para o
Pressione [BAND ] ou [ ]
modo de disco automaticamente.
para iniciar a reprodução do início: a página
de Título do DVD ou a primeira faixa do VCD /
Nota: CD.
Ŗ C onfirme se há um disco na unidade
antes de inserir outro. Seleção da faixa desejada
Ŗ A unidade sairá da fonte de reprodução  2TGUUKQPG Q DQVºQ = Ŗ ?
2CTC C GUSWGTFC  QW
atual e entrará no modo de DVD quando = Ŗ ?
2CTC C FKTGKVC  RCTC RWNCT RCTC C HCKZC
um disco for inserido. anterior/seguinte.
Ŗ 1 f o r m a t o d e d i s c o a s e g u i r s e r á
UWRQTVCFQ %&4 %&49 &8&4 Avanço/retrocesso rápido durante a
&8& 4&8&49&8& 49 reprodução
2TGUUKQPG Q DQVºQ = Ŗ ?
2CTC C GUSWGTFC  QW
= Ŗ ?
2CTC C FKTGKVC  RQT OCKU FG  UGIWPFQU
Ejeção de um disco X¶TKCU XG\GU RCTC UGNGEKQPCT : : : :
1 Pressione o botão [ ] para abrir o painel. para retroceder ou avançar rapidamente a faixa
2 Pressione o botão [  ?
R¶IKPC  ) para durante a reprodução.
ejetar o disco. - Durante a operação de avanço ou retrocesso
3 Feche o painel. T¶RKFQ RTGUUKQPG =$#0& ] ou [ ]
Notas: brevemente para reproduzir de novo.
Ŗ & GRQKUFGGLGVCTQFKUEQCWPKFCFGTGXGTVGT¶ - Durante a operação de avanço ou retrocesso
para outro modo automaticamente. T¶RKFQQXQNWOGUGT¶GOWFGEKFQ
Ŗ 8QEÄRQFGGLGVCTWOFKUEQSWCPFQCWPKFCFG
estiver desligada. A unidade permanecerá Reprodução aleatória de faixas (para CD/
desligada depois que o disco for ejetado. VCD/MP3/WMA apenas)
Ŗ 5GQFKUEQPºQHQTTGOQXKFQFCWPKFCFGFGPVTQ Você pode reproduzir todas as faixas em ordem
FG  UGIWPFQU GNG UGT¶ TGECTTGICFQ RCTC aleatória.
impedir danos acidentais.  & WTCPVG C TGRTQFWÁºQ RTGUUKQPG Q DQVºQ
[ RDM ] na unidade de controle remoto para
Reprodução de disco selecionar a reprodução aleatória.
 3
 WCPFQ WO FKUEQ HQT KPUGTKFQ Q CRCTGNJQ 2. Pressione o botão [RDM] novamente para
mostrará “Carregando”. Para MP3/WMA ou selecionar a reprodução normal.
FKUEQEQOX¶TKQUCTSWKXQUQVGORQFGNGKVWTC
poderá exceder 1 minuto. Repetir
2. Enquanto os arquivos de áudio/foto/vídeo &WTCPVGCTGRTQFWÁºQRTGUUKQPGQDQVºQ=426?
UºQTGRTQFW\KFQUQOGPWFCNKUVCCRCTGEGPQ na unidade de controle remoto para selecionar a
aparelho. O menu da lista e as operações são reprodução com repetição.
iguais com a reprodução de USB (página de
referência 12). Repetir A-B
Selecione a passagem desejada para repetir a
Parada temporária da reprodução reprodução.
 &
 WTCPVGCTGRTQFWÁºQRTGUUKQPG=$#0& ] - Pressione [A->B] no controle remoto uma vez
ou [ ] para pausar a reprodução. para selecionar o ponto de início.
- O som será emudecido. - Pressione [A->B] novamente para selecionar
- O aparelho mostra “PAUSE”. Q RQPVQ FG VÃTOKPQ C RCUUCIGO UGNGEKQPCFC
Pressione [BAND ] ou [ ] novamente começa a ser reproduzida.
para continuar a reprodução. - Pressione [A->B] mais uma vez para sair.
 2CTC TGVQOCT C TGRTQFWÁºQ PQTOCN TGRKVC C
operação.

14 Pt
Seção

Funcionamento desta unidade 03

IR PARA Seleção de ângulo do DVD

Português (B)
Ir para o título/capítulo desejado ou ponto no Pressione o botão [ ANGLE/VIDEO ] para
tempo diretamente do vídeo. selecionar um ângulo diferente a ser exibido se o
1 Pressione o botão [ G ](IR PARA) no controle DVD tiver visualizações com vários ângulos.
remoto; o menu de busca será exibido na parte
superior da tela. Zoom
 7UG QU DQVÐGU = Ŗ ?
2CTC EKOC   = Ŗ ?
2CTC 2TGUUKQPG Q DQVºQ = <11/ ? C KOCIGO UGT¶
baixo) no painel frontal ou [ ] / [ ] no ampliada de acordo.
EQPVTQNG TGOQVQ RCTC UGNGEKQPCT 6ÈVWNQ
%CRÈVWNQQW*QTCUGPGEGUU¶TKQ
As opções do menu de busca dependem do
tipo de vídeo; talvez exiba apenas uma ou
duas opções.
3. Use o botão [ ] ou [ ] para selecionar o
título/capítulo desejado ou insira o número
usando os botões de dígitos.
4. Pressione o botão [M.C.] ou [ENTER] para
EQPſTOCT

PBC - Controle de reprodução (para VCD


2.0 ou superior)
 5 GXQEÄKPUGTKTWO8%&EQO2$%RTGUUKQPGQ
DQVºQ=/'072$%?RCTCFGſPKTQ2$%EQOQ
Ativado/Desativado.
 3WCPFQQ2%$HQTFGſPKFQEQOQ&GUCVKXCFQ
a reprodução iniciará a partir do início da
primeira faixa automaticamente.
 3 WCPFQ Q 2$% HQT FGHKPKFQ EQOQ #VKXCFQ
o menu PBC será exibido. Use os botões
de navegação ou botões de dígitos para
UGNGEKQPCT C HCKZC FGUGLCFC RTGUUKQPG Q
botão [M.C.] ou [ ENTER ] para confirmar
a reprodução e depois o PBC será definido
como Desativado automaticamente.

Seleção de DVD Áudio


Pressione o botão [ AUDIO/MUSIC ] para
selecionar o idioma do áudio a ser ouvido se o
DVD tiver vários idiomas de áudio.

Seleção de VCD Áudio


Pressione o botão [ AUDIO/MUSIC ] para
UGNGEKQPCT Q ECPCN FG ¶WFKQ C UGT QWXKFQ
' &
'UVÃTGQ 

Seleção de legenda do DVD


Pressione o botão [ SUBTITLE/PHOTO ] para
selecionar o idioma da legenda a ser exibida se o
DVD tiver legendas em vários idiomas.

Seleção de título do DVD


Pressione o botão [ TITLE ] para exibir a lista de
VÈVWNQUQWECRÈVWNQUWUGQUDQVÐGU=Ŗ?
2CTCEKOC 
=Ŗ?
2CTCDCKZQ PQRCKPGNHTQPVCNQW= ] / [ ] /
[ ] / [ ?PQEQPVTQNGTGOQVQQWFKIKVGQPÕOGTQ
RCTC UGNGEKQPCT RTGUUKQPG Q DQVºQ =/%? QW
[ ENTER ] para reproduzir.

Pt 15
Seção

03 Funcionamento desta unidade

Ajustes do sistema Desativação do DivX®


Exiba as informações de ativação de DivX®.
'O VQFQU QU OQFQU RTGUUKQPG G UGIWTG =5'.? Para reproduzir conteúdo DivX ® VOD (vídeo
para entrar no menu de ajuste do sistema. UQDFGOCPFC PGUVCWPKFCFGÃRTGEKUQRTKOGKTQ
A unidade não pode entrar no menu de ajuste registrar a unidade junto a um provedor de
SWCPFQ Q UKUVGOC GUV¶ QEWRCFQ EQOQ RQT conteúdo DivX® VOD.
exemplo carregando um disco ou USB.
Registro do DivX®
 2
 TGUUKQPGQUDQVÐGU=Ŗ?
2CTCCGUSWGTFC =Ŗ?
Para mostrar o código de registro DivX® e site da
(Para a direita) ou [ ] / [ ] para selecionar a
Web.
categoria.
 )KTG=/%?QWRTGUUKQPGQUDQVÐGU=Ŗ?
2CTC
Controle dos pais
EKOC   = Ŗ ?
2TC DCKZQ  QW = ] / [ ] para
 3WCPFQő+PUGTKTUGPJCŒCRCTGEGTPQCRCTGNJQ
UGNGEKQPCT QRÁÐGU G C UGIWKT RTGUUKQPG Q
insira uma senha de 4 dígitos pelo controle
botão [M.C.] ou [ENTER] para acessar o
remoto (Senha original: 8888). Pressione o
submenu.
botão [M.C.] ou [ENTER] para confirmar e
 )KTG=/%?QWRTGUUKQPGQUDQVÐGU=Ŗ?
2CTC
“Corrigir senha” será exibido.
EKOC   = Ŗ ?
2TC DCKZQ  QW = ] / [ ] para
 2TGUUKQPG =/%? QW ='06'4? IKTG =/%?QW
FGUVCECTCUGNGÁºQFGUGLCFCRTGUUKQPG=/%?
RTGUUKQPGQUDQVÐGU=Ŗ?
2CTCEKOC =Ŗ?
2CTC
QW='06'4?RCTCEQPſTOCT
baixo) ou [ ] / [ ] para selecionar um nível de
Ŗ 2TGUUKQPCT= ] retornará ao menu superior.
ENCUUKſECÁºQ
Menu de ajuste  #ENCUUKſECÁºQÃFGC
(1) com os maiores limites durante a
reprodução.
(8) com os menores limites durante a
SETTING
reprodução.
3 Pressione o botão [M.C.] ou [ENTER] para
EQPſTOCT

&GſPKÁºQFGUGPJC
 3WCPFQő+PUGTKTUGPJCŒCRCTGEGTPQCRCTGNJQ
KPUKTC C UGPJC CPVKIC RGNQ EQPVTQNG TGOQVQ
pressione o botão [M.C.] ou [ENTER] para
EQPſTOCTGő%QTTKIKTUGPJCŒUGT¶GZKDKFQ
 2 TGUUKQPG =/%? QW ='06'4? KPUKTC WOC
PQXCUGPJCFGFÈIKVQURGNQEQPVTQNGTGOQVQ
pressione o botão [M.C.] ou [ENTER] para
Hora EQPſTOCT
 'O UGIWKFC KPUKTC C PQXC UGPJC PQXCOGPVG
Categoria
RCTCEQPſTOCTFWCUXG\GU2TGUUKQPGQDQVºQ
Opções =/%?QW='06'4?Gő&GſPKÁºQDGOUWEGFKFC
FGUGPJCŒÃGZKDKFQ
Submenu Ŗ 5GPJCQTKIKPCN
Ŗ 5G XQEÄ GUSWGEGT UWC UGPJC KPUKTC C UGPJC
Geral original para desbloquear.
Bipe:
Ative ou desative o som de bipe. Ajustes padrão
Carregue os ajustes padrão.
Formato de horas: 3WCPFQQOGPWFGUGNGÁºQCRCTGEGTRTGUUKQPG
Selecione 12 horas ou 24 horas. QUDQVÐGU=Ŗ?
2CTC C GUSWGTFC   = Ŗ ?
2CTC C
direita) ou [ ] / [ ] para selecionar Sim ou
Ajuste de horas: Não. Pressione o botão [M.C.] ou [ENTER] para
2TGUUKQPG Q DQVºQ = Ŗ ?
2CTC C FKTGKVC  QW = ] EQPſTOCT
RCTCCNVGTPCTGPVTGJQTCUGOKPWVQUIKTG=/%?QW
RTGUUKQPGQUDQVÐGU=Ŗ?
2CTCEKOC =Ŗ?
2CTC Aux
baixo) ou [ ] / [ ] para ajustar. Selecione dispositivo auxiliar ativado ou
desativado.

16 Pt
Seção

Funcionamento desta unidade 03

Demo Ajuste de áudio

Português (B)
5GNGEKQPG &GOQ RTGUUKQPG =/%? QW ='06'4?
para executar. “Demo” piscará no canto superior
FKTGKVQ G GO UGIWKFC Q OQFQ &'/1 UGT¶ AUDIO SETTING
ativado.
EQ FLAT

Rolagem de texto
Selecione Rolagem de texto ativada ou
desativada.
Vídeo
Relação de aspecto:
4:3: para imagens em TV de 4:3.
16:9: para TV de tela ampla de 16:9.
Pressione o botão [SEL] para entrar no menu
Idioma de ajuste de áudio. O primeiro pressionamento
&GſPKÁºQFQKFKQOCFG.GIGPFCWFKQ/GPWFQ mostra o EQ atual. Pressione o botão [ ] / [ ]
DVD exibido na tela. no controle remoto para alterar o EQ nesta ordem:
Se o DVD tiver o arquivo de áudio no idioma EQ FLAT -> EQ POP -> EQ ROCK -> EQ
UGNGEKQPCFQ QU FK¶NQIQU GUEWVCFQU GUVCTºQ PQ CLASSIC -> EQ JAZZ -> EQ USER.
idioma selecionado.
2CTCFGVGTOKPCTCFGſPKÁºQFQWUW¶TKQRTGUUKQPG
Áudio QDQVºQ=5'.?QWQUDQVÐGU=Ŗ?
2CTCCGUSWGTFC 
Sonoridade: =Ŗ?
2CTCCFKTGKVC PQRCKPGNHTQPVCNQW= ] / [ ]
Ative ou desative a sonoridade. PQ EQPVTQNG TGOQVQ RCTC UGNGEKQP¶NC KPENWKPFQ
$#5
)TCXG /+&
/ÃFKQ 64'
#IWFQ $#.
Subwoofer:
'SWKNÈDTKQ (#&
(CFGT RTGUUKQPGQDQVºQ= ] /
5GNGEKQPG *\ *\ QW *\ RCTC CVKXCT C [ ] no controle remoto para ajustar o valor.
frequência de corte do subwoofer.
Selecione subwoofer desativado para ativar a
remoção da linha traseira.
Ajuste de vídeo
Volume secundário:
Selecione o volume do subwoofer: 0 a 33.
Ŗ 8 QNWOG UGEWPF¶TKQ PºQ RQFG UGT CLWUVCFQ VIDEO SETTING
quando Subwoofer desativado for selecionado.

Rádio
LOC DX:
Selecione rádio local ou distante.
LOC: somente emissoras com forte sinal podem
ser recebidas. BRI CON SAT
DX: emissoras com sinais fortes e fracos podem
ser recebidas.

Estéreo Mono: 0QOGPWFGCLWUVGWFKQRTGUUKQPGQDQVºQ=5'.?


5GNGEKQPG(/GUVÃTGQQWOQPQ QWQUDQVÐGU=Ŗ?
2CTCCGUSWGTFC =Ŗ?
2CTCC
direita) no painel frontal ou [ ] / [ ] no controle
Passo FM(Passo de sintonia FM): TGOQVQ RCTC UGNGEKQP¶NC KPENWKPFQ $4+
DTKNJQ 
Selecione passo de FM 50kHZ ou 100kHZ. %10
EQPVTCUVG 5#6
UCVWTCÁºQ RTGUUKQPGQ
buscar passo de sintonia botão [ ] / [ ] no controle remoto para ajustar o
Ŗ 1  RCUUQ FG UKPVQPKC RGTOCPGEG C  M*\ valor.
durante a sintonia manual.

Passo de AM:
Selecione passo de AM 9kHZ ou 10kHZ.
O passo de sintonia AM pode ser alternado entre
9kHz e 10kHz.

Pt 17
Seção

04 Instalação

Conexão da unidade Importante


Ŗ 'UVC WPKFCFG PºQ RQFG UGT KPUVCNCFC GO WO
ADVERTÊNCIA veículo sem uma posição ACC (Acessório) na
chave de ignição.
Ŗ 2 CTC GXKVCT Q TKUEQ FG CEKFGPVG G C XKQNCÁºQ
GO RQVGPEKCN FCU NGKU CRNKE¶XGKU PGPJWOC
visualização de vídeo nos assentos dianteiros
deve ocorrer enquanto o veículo estiver sendo
conduzido.
Ŗ 'O CNIWPU RCÈUGU QW GUVCFQU C XKUWCNK\CÁºQ
de imagens em um aparelho dentro de um Posição ACC Nenhuma posição ACC
XGÈEWNQ CVÃ OGUOQ RQT QWVTCU RGUUQCU SWG
PºQ UGLCO Q OQVQTKUVC RQFG UGT KNGICN 'O Ŗ 7VKNK\CTGUVCWPKFCFGGOEQPFKÁÐGUFKHGTGPVGU
tais locais onde essas regulamentações se das seguintes pode causar incêndio ou mau
CRNKECOGNCUFGXGOUGTQDGFGEKFCU funcionamento.
— Veículos com bateria de 12 volts e
Para garantir uma condução segura aterramento negativo.
— Alto-falantes com 50 W (valor de saída) e
ADVERTÊNCIA
4 ohm a 8 ohm (valor de impedância).
1%10&76148'4&'%.#4101%10'%614 Ŗ 2CTC GXKVCT EWTVQEKTEWKVQ UWRGTCSWGEKOGPVQ
&'#.+/'06#š“1(1+&'5'081.8+&12#4# QWRTQDNGOCUFGHWPEKQPCOGPVQEGTVKſSWGUG
DETECTAR O STATUS ESTACIONADO E DEVE de seguir as instruções abaixo.
SER ACOPLADO À FONTE DE ALIMENTAÇÃO — Desconecte o terminal negativo da bateria
AO LADO DO BOTÃODO FREIO DE MÃO. A antes da instalação.
CONEXÃO OU O USO INADEQUADO DESSE  ō 2TQVGLCCſCÁºQEQORTGUKNJCURCTCECDQU
CONDUTOR PODE VIOLAR A LEI APLICÁVEL E QW HKVC GNÃVTKEC 2CTC RTQVGIGT C HKCÁºQ
CAUSAR SÉRIOS ACIDENTES OU DANOS. WVKNK\G ſVC GNÃVTKEC CQ TGFQT FC ſCÁºQ SWG
ſECGOEQPVCVQEQOCURGÁCUOGV¶NKECU
CUIDADO — Coloque todos os cabos afastados de
RGÁCU SWG UG OQXKOGPVCO EQOQ C
Ŗ #2+10''4PºQTGEQOGPFCSWGXQEÄKPUVCNG
marcha e os trilhos do assento.
nem faça qualquer reparo no aparelho. A
— Coloque todos os cabos afastados de
instalação ou o reparo do produto pode expor
NWICTGUSWGRQUUCOCSWGEGTEQOQRGTVQ
XQEÄCTKUEQUFGEJQSWGGNÃVTKEQGPVTGQWVTQU
da saída do aquecedor.
Recorra à equipe de manutenção autorizada
— Não conecte o cabo amarelo à bateria
da Pioneer para a instalação e o reparo do
passando-o pelo orifício em direção ao
aparelho.
compartimento do motor.
Ŗ 2 TQVGLC VQFC C HKCÁºQ EQO RTGUKNJCU RCTC
— Cubra quaisquer conectores de cabo
ECDQU QW HKVC GNÃVTKEC 0ºQ RGTOKVC SWG HKQU
FGUEQPGEVCFQUEQOſVCKUQNCPVG
FGUGPECRCFQUſSWGOGZRQUVQU
— Não encurte os cabos.
Ŗ 0 ºQ RGTHWTG Q EQORCTVKOGPVQ FQ OQVQT
— Nunca corte o isolamento do cabo
para conectar o cabo amarelo do aparelho
de alimentação desta unidade para
à bateria do veículo. A vibração do motor
compartilhar a energia com outros
pode eventualmente fazer com que o
dispositivos. A capacidade de corrente do
isolamento acabe no ponto em que o fio
ECDQÃNKOKVCFC
passa do compartimento do passageiro para
— Utilize um fusível com a classificação
o compartimento do motor. Muito cuidado ao
prescrita.
RTQVGIGTQſQPGUUGRQPVQ
— Nunca faça a conexão do cabo negativo
Ŗ % GTVKHKSWGUG FG SWG QU ECDQU PºQ GPVTGO
do alto-falante diretamente ao terra.
em contato com peças do veículo que se
— Nunca conecte juntos os cabos negativos
OQXKOGPVCO EQOQ E¸ODKQ HTGKQ FG OºQ QW
de vários alto-falantes.
mecanismo de deslizamento do assento.
Ŗ 3WCPFQGUVCWPKFCFGGUVKXGTNKICFCQUUKPCKU
Ŗ 0ºQGPEWTVGQUECDQU5Gſ\GTKUUQQEKTEWKVQ
de controle serão emitidos pelo cabo azul/
de proteção poderá falhar.
branco. Conecte esse cabo ao controle remoto
do sistema de um amplificador de potência
GZVGTPQ QW VGTOKPCN FG EQPVTQNG FQ TGNÃ FC
antena automática do veículo (máx. 300 mA
12 V CC).

18 Pt
Seção

Instalação 04

Se o veículo estiver equipado com uma antena

Português (B)
CEQRNCFC CQ XKFTQ EQPGEVGC CQ VGTOKPCN FC
fonte de alimentação do intensificador da
antena.
Ŗ 0WPECEQPGEVGQECDQC\WNDTCPEQCQVGTOKPCN
FGRQVÄPEKCFQCORNKſECFQTGZVGTPQ
 #NÃO FKUUQ PWPEC Q EQPGEVG CQ VGTOKPCN FG
RQVÄPEKC FC CPVGPC CWVQO¶VKEC 5G ſ\GT KUUQ
a bateria poderá descarregar ou apresentar
defeitos.
Ŗ 1 ECDQ RTGVQ Ã Q VGTTC 'UUG ECDQ G Q ECDQ
VGTTC FG QWVTQ RTQFWVQ
GURGEKCNOGPVG
RTQFWVQUFGCNVCVGPUºQEQOQCORNKſECFQTGU
de potência) devem ser conectados
separadamente.
 & Q EQPVT¶TKQ UG GNGU HQTGO FGUEQPGEVCFQU
CEKFGPVCNOGPVG KPEÄPFKQ QW RTQDNGOCU FG
funcionamento podem ser ocasionados.

Pt 19
04
Seção
20
Pt

&KCITCOCFGſCÁºQ

Instalação
Saída de vídeo Para Monitor
(Amarelo) com sistema NTSC

Antena do rádio

Fusível de 10 A
(luz Verde / SW de estacionamento
Branca) (Entrada de nível
Conector
de atividade baixa)
Amplificador
Saída da linha frontal R (Vermelho)
(Marrom) L (Branco)
Traseira/Saída do alto-falante
de graves secundário R (Vermelho)
(Cinza) L (Branco)
Conector ISO

Para alguns modelos de carro, pode ser necessário modificar a


fiação do cabo de alimentação fornecido conforme ilustrado, ou
a memória da unidade pode ser perdida após o desligamento.
Entre em contato com o fabricante do veículo antes de instalar
Função esta unidade.
Local Fiação original Fiação modificada
Conector A Conector B
Amarelo Amarelo Amarelo Amarelo
1 6TCUGKTQFCFKTGKVC
4QZQ Vermelho Vermelho Vermelho Vermelho
Traseiro da direita (-) / Roxo com Listra
2
Preta
3 &KCPVGKTQFCFKTGKVC
%KP\C
Importante:
$CVGTKC8
 Dianteiro da direita (-) / Cinza com Listra O condutor de estacionamento no conector de alimentação deve
4 ser conectado ao lado ativado do circuito do freio de mão (o lado
Amarelo Preta
que se torna o terra quando o freio é aplicado) e, na tela "General
Controle da ANT/AMP / Set Up"(Configuração Geral), o modo de estacionamento deve ser
5 &KCPVGKTQFCGUSWGTFC
$TCPEQ definido para "on"(ligado).
Azul com listra branca
Conexão incorreta: o uso de condutor e o ajuste incorreto podem
Dianteiro da esquerda (-) / Branco com violar as regulamentações do tráfego em estradas.
6 Iluminação / Laranja
Listra Preta
7 #%% 8GTOGNJQ 6TCUGKTQFCGUSWGTFC
8GTFG
Traseiro da esquerda (-) / Verde com
8 Terra / Preto
Listra Preta
Seção

Instalação 04

Instalação  5 G  C  C D G T V W T C  H Q T  O W K V Q  R G S W G P C 

Português (B)
cuidadosamente corte ou lime conforme
Antes de instalar esta unidade PGEGUU¶TKQCVÃSWGCICXGVCFGUNK\GHCEKNOGPVG
1. Desconecte a bateria para dentro da abertura. Não force a gaveta
 # PVGU FG EQOGÁCT UGORTG FGUEQPGEVG Q para dentro da abertura ou deixe-a dobrar ou
terminal negativo da bateria. EWTXCT8GTKſSWGUGJ¶GURCÁQUWſEKGPVGCVT¶U
do painel da unidade do chassis.
Esta unidade pode ser instalada em qualquer
Nota: painel com uma abertura adequada de 183
Ŗ 5 G C WPKFCFG HQT KPUVCNCFC GO WO ECTTQ OO
.  Z  OO
#  EQOQ OQUVTCFQ CEKOC
equipado com uma unidade interna ou 1 RCKPGN FGXG VGT  OO   OO FG
EQORWVCFQT FG PCXGICÁºQ UG Q ECDQ FC espessura para poder suportar a unidade.
DCVGTKC HQT FGUEQPGEVCFQ C OGOÎTKC FQ  2QUKEKQPGCUÃTKGFGCDCUFGFQDTCFKÁCULWPVQ
computador poderá ser perdida. Sob essas ´ RCTVG UWRGTKQT KPHGTKQT G NCVGTCKU FC ICXGVC
EQPFKÁÐGU FGXG UGT VQOCFQ EWKFCFQ GZVTC de montagem. Com a gaveta completamente
durante a instalação para evitar um curto- KPUGTKFCPCCDGTVWTCFQRCKPGNFQDTGSWCPVCU
circuito. CDCU RWFGT RCTC HQTC EQPHQTOG PGEGUU¶TKQ
Ŗ 0 C KPUVCNCÁºQ RCTC CUUGIWTCT C FKURGTUºQ para fixar a gaveta no painel (Consulte a
FG ECNQT CRTQRTKCFC CQ WVKNK\CT GUVC WPKFCFG página seguinte).
EGTVKſSWGUGFGFGKZCTWOGURCÁQCORNQCVT¶U
do painel traseiro e amarre os cabos soltos de
forma que não bloqueiem as saídas de ar. CUIDADO
 2CTCWODQOHWPEKQPCOGPVQFQ&8&RNC[GTQ
chassis deve ser montado a 30° da horizontal.
%GTVKſSWGUG FG SWG C WPKFCFG UGLC OQPVCFC
Deixe um dentro dessa limitação.
espaço amplo
5 cm
4. Coloque a unidade na frente da abertura
FQ RCKPGN FG HQTOC SWG C HKCÁºQ RQUUC UGT
5 cm 5cm VTC\KFCCVTCXÃUFCICXGVCFGOQPVCIGO5KIC
QFKCITCOCFCſCÁºQEQOEWKFCFQGEGTVKſSWG
se de que todas as conexões estejam seguras
e isoladas com porcas ou fita isolante.
&GRQKU FG EQPENWKT CU EQPGZÐGU FC HKCÁºQ
2. Remova os parafusos de transporte NKIWGCWPKFCFGRCTCEQPſTOCTCQRGTCÁºQ
C
ignição deve estar ligada). Se a unidade não
HWPEKQPCT XGTKHKSWG PQXCOGPVG VQFC C HKCÁºQ
Importante CVÃQRTQDNGOCUGTEQTTKIKFQ
Remova esses dois parafusos de transporte antes 5. Certifique-se de que o rádio esteja com
FC KPUVCNCÁºQ &Q EQPVT¶TKQ Q &8& RNC[GT PºQ Q NCFQ EQTTGVQ XKTCFQ RCTC EKOC G FGUNK\G
funcionará. cuidadosamente o rádio na gaveta de
OQPVCIGO CVÃ SWG GNC UGLC VQVCNOGPVG
3. Remova a unidade da gaveta assentada e os clipes de mola travem no lugar.
 'TICCUVTCXCUGOCODCUCUNCVGTCKUWVKNK\CPFQ  7 O ÎVKOQ FGUGORGPJQ Ã QDVKFQ SWCPFQ C
Q EJCXGVC FG GZVTCÁºQ
HQTPGEKFC  FC ICXGVC WPKFCFGÃKPUVCNCFCCWO¸PIWNQKPHGTKQTCu
para remover a metade da gaveta da unidade. 6. Fixe a parte traseira da unidade ao corpo do
carro usando o parafuso de montagem e a
Instalação da gaveta de montagem almofada de borracha.
7. Teste a unidade usando as instruções de
1. Deslize a gaveta de montagem para fora do
“Operação” a seguir.
EJCUUK 5G GUVKXGT VTCXCFC PC RQUKÁºQ WVKNK\G
as ferramentas de remoção (fornecidas) para
desengatá-la. Instalação do kit
 8 GTKHKSWG Q VCOCPJQ FG CDGTVWTC FQ RCKPGN Se o seu veículo requerer a utilização de um kit
deslizando a gaveta de montagem dentro dele. FG KPUVCNCÁºQ RCTC OQPVCT GUVC WPKFCFG UKIC
as instruções incluídas no kit de instalação para
prender a unidade à placa de montagem fornecida
com o kit.
1. Faça a conexão da fiação e teste a unidade
conforme descrito nas instruções de instalação
da Gaveta de Montagem.

Pt 21
Seção

04 Instalação

2. Instale o conjunto do rádio/placa de montagem 5. Monte o conjunto da nova unidade no painel


ao subpainel de acordo com as instruções no ou console central utilizando o procedimento
kit de instalação. inverso do passo 1.
3. Substitua o painel de instrumentos.
Fusível
Instalação ISO #Q UWDUVKVWKT WO HWUÈXGN EGTVKHKSWGUG FG SWG Q
'UVCWPKFCFGVGOQTKHÈEKQUTQUSWGCFQUPQURCKPÃKU HWUÈXGN PQXQ Ã FQ VKRQ G CORGTCIGO EQTTGVQU
laterais do chassis que podem ser utilizados com 7VKNK\CTWOHWUÈXGNKPEQTTGVQRQFGFCPKſECTQT¶FKQ
os suportes de montagem originais de fábrica
de alguns veículos para a instalação do rádio no Reconexão da bateria
RCKPGN %QPUWNVG C NQLC FQ UGW UKUVGOC GUVÃTGQ 3WCPFQ C HKCÁºQ GUVKXGT EQPENWÈFC TGEQPGEVG Q
automotivo local para assistência neste tipo de terminal negativo da bateria.
instalação.
1. Remova o rádio de fábrica existente do painel
ou montagem de console central. Guarde
todas as peças e suportes como serão usados
para instalar o novo rádio.
2. Desencaixe cuidadosamente a estrutura
plástica da parte frontal do chassis da nova
unidade. Remova e descarte a estrutura.
3. Remova os suportes de montagem de fábrica
GCURGÁCUFCWPKFCFGGZKUVGPVGGſZGQUPC
unidade nova. Não exceda o tamanho máximo
do parafuso M5 x 6 mm. Parafusos maiores
RQFGTºQFCPKſECTQUEQORQPGPVGUPQKPVGTKQT
do chassis.
4. Faça a conexão da fiação da nova unidade
conforme descrito nas instruções de instalação
da Gaveta de Montagem.

Chave de fenda

Protetor de borracha do
parafuso de montagem

Parafusos de
transporte 1. Gaveta de montagem
Quando não remover
os parafusos de
VTCPURQTVGQNGKVQTFG 2. A traseira da unidade
disco não funciona.
Instale depois de 3. Moldura de acabamento
remover os parafusos
de transporte.

Nota:
(KZGCRNCECFGCECDCOGPVQPCFKTGÁºQEQTTGVCCRCTVGUWRGTKQTÃOCKUſPCFQSWGCRCTVGKPHGTKQT

22 Pt
Seção

Instalação 04

Remoção da unidade

Português (B)
1. Remova o painel (Página de referência 9).
2. Retire a moldura de acabamento firmemente
segurando um lado e puxando.

3. Insira as chavetas de extração na lateral do


CRCTGNJQCVÃUGRTGPFGTGO'OUGIWKFCRWZG
o rádio para fora. Se as chavetas de extração
GUVKXGTGO KPUGTKFCU GO ¸PIWNQ PºQ VTCXCTºQ
corretamente e não liberarão a unidade.

Pt 23
Apêndice

Informações adicionais

Solução de problemas
Comum

Sintoma Causa Ação

1UſQUGEQPGEVQTGUGUVºQ
%QPſTOGOCKUWOCXG\UGVQFCUCU
conectados de forma
conexões estão corretas.
incorreta.
8GTKſSWGQOQVKXQSWGHG\EQOSWG
o fusível queimasse e substitua-o.
O fusível está queimado.
%GTVKſSWGUGFGKPUVCNCTWOHWUÈXGNEQO
COGUOCENCUUKſECÁºQ
Não haverá alimentação. A
unidade não funcionará. Ruído e/ou outros fatores
estão fazendo com que
o microprocessador Pressione [RESET].
incorporado funcione
incorretamente.

A energia não está habilitada Pressione o botão [ /MUTE ] para


corretamente. ligar a unidade.

A operação com o controle


TGOQVQPºQÃRQUUÈXGN
A unidade não funciona
corretamente mesmo quando A bateria está baixa. Recarregue uma nova bateria.
os botões do controle
remoto adequados são
pressionados.

Não há som.
Os cabos não estão Conecte os cabos
O nível do volume não
conectados corretamente. corretamente.
aumentará.

A relação de aspecto está O ajuste da relação de


Selecione o ajuste apropriado para o
incorreta e a imagem está aspecto está incorreto para o
seu aparelho.
alongada. aparelho.

Conecte um cabo
O freio de mão
Não há do freio de mão
não está
imagem exibida. e
conectado.
puxe-o.

A imagem visualizada para Os dados não podem


Pare a reprodução uma vez e inicie-a
(pausa) e a unidade não mais ser lidos durante a
novamente.
pode ser operada. reprodução.

Não há som.
O nível do volume está baixo. Ajuste o nível do volume.
O nível do volume está baixo.

O som e o vídeo estão


#WPKFCFGPºQGUV¶ſTOG #EQRNGCWPKFCFGEQOſTOG\C
pulando.

Subpastas não podem ser A reprodução com repetição 5GNGEKQPGPQXCOGPVGCUÃTKGFG


reproduzidas. de pasta foi selecionada. repetição.

24 Pt
Apêndice

Informações adicionais

Outra pasta foi selecionada

Português (B)
5GNGEKQPGPQXCOGPVGCUÃTKGFG
durante a reprodução com
repetição.
repetição.
#UÃTKGFGTGRGVKÁºQOWFC
automaticamente. A busca por faixa ou avanço/
retrocesso rápido foi realizada 5GNGEKQPGPQXCOGPVGCUÃTKGFG
durante a reprodução com repetição.
repetição de arquivo.

Mensagens de erro
Ao entrar em contato com o revendedor ou a
%GPVTCNFG5GTXKÁQUFC2KQPGGTOCKURTÎZKOCCPQVGCOGPUCIGOFGGTTQ

Mensagem Causa Ação


#IWCTFGRQFGFGOQTCTCNIWPUOKPWVQU
Carregando O disco está sendo lido para alguns discos ou dispositivo de
armazenamento.

O disco está sujo Limpe o disco com um tecido macio

O disco está de cabeça para baixo Insira o disco com o rótulo para cima
Sem disco

Disco não presente no


Insira o disco
compartimento de carregamento

O disco está sujo Limpe o disco com um tecido macio


Disco ruim
O disco está de cabeça para baixo Insira o disco com o rótulo para cima

Disco 1HQTOCVQFQFKUEQPºQÃ
Troque por outro disco.
desconhecido compatível com esta unidade

1&8&PºQÃEQORCVÈXGNEQOQ Use discos com código regional


Erro de região
código de região da unidade correspondente.

Pressione o botão EJECT por 5 segundos para


Erro Operação ilegal do mecanismo
TGFGſPKTQOGECPKUOQFGECTTGICOGPVQ

8GTKſSWGCEQPGZºQFQUCNVQHCNCPVGU
A unidade não funciona ou a Se a mensagem não desaparecer mesmo
ERRO DE conexão dos alto-falantes está FGRQKUSWGQOQVQTHQTFGUNKICFQNKICFQGPVTG
AMPLIFICADOR KPEQTTGVCQEKTEWKVQFGRTQVGÁºQà em contato com o revendedor ou uma Central
ativado. de Serviços da Pioneer autorizada para obter
assistência.

Pt 25
Apêndice

Informações adicionais

Orientações de manuseio Dispositivo de armazenamento USB


Ŗ 5QNWEKQPGSWCKUSWGTFÕXKFCUSWGXQEÄRQUUC
Disco ter sobre o seu dispositivo de armazenamento
externo (USB) com o fabricante.
Ŗ 0
 QXQUFKUEQURQFGOVGTCNIWOCU Ŗ 0 ºQ FGKZG Q FKURQUKVKXQ FG CTOC\GPCOGPVQ
rugosidades nas bordas. Se tais discos externo (USB) em locais com alta temperatura.
HQTGOWVKNK\CFQUQRNC[GTRQFGT¶PºQ Ŗ &GRGPFGPFQFQFKURQUKVKXQFGCTOC\GPCOGPVQ
funcionar ou podem ocorrer saltos no GZVGTPQ
75$ RQFGOQEQTTGTQURTQDNGOCUC
UQO7VKNK\GWOCGUHGTQIT¶ſECQWUKOKNCT seguir.
para remover as rugosidades da borda  Ŗ#UQRGTCÁÐGURQFGOXCTKCT
 Ŗ2 Q F G  U G T  S W G  Q  F K U R Q U K V K X Q  F G
do disco. armazenamento não seja reconhecido.
Ŗ 0 WPECEQNGGVKSWGVCUPCUWRGTHÈEKGFQFKUEQQW
 Ŗ 2 QFG UGT SWG QU CTSWKXQU PºQ UGLCO
marque a superfície com um lápis ou caneta.
reproduzidos corretamente.
Ŗ 0WPECTGRTQFW\CWOFKUEQEQOſVCEGNQHCPG
Ŗ %QPGZÐGUXKCJWD75$PºQUºQUWRQTVCFCU
QWEQNCUQDTGGNGPGOEQOOCTECU
Ŗ 0ºQEQPGEVGPCFCCPºQUGTWOFKURQUKVKXQFG
descascadas. Se você tenta reproduzir um
armazenamento USB.
FKUEQPGUUCUEQPFKÁÐGURQFGPºQUGTECRC\
Ŗ ( K Z G  F G  H Q T O C  U G I W T C  Q  F K U R Q U K V K X Q  F G
de recuperá-lo fora do player ou ele poderá
armazenamento USB enquanto você
FCPKſECTQRNC[GT
estiver dirigindo. Não deixe o dispositivo de
Ŗ 0WPECWUGFKUEQUEQOTKUEQUITCPFGUQWSWG
CTOC\GPCOGPVQ 75$ ECKT PQ EJºQ QPFG
GUVGLCOFGHQTOCFQUTCEJCFQUGVE1WUQFG
RQUUCſECTRTGUQGODCKZQFQRGFCNFQHTGKQQW
tais discos pode causar operação incorreta ou
acelerador.
danos.
Ŗ &GRGPFGPFQFQFKURQUKVKXQFGCTOC\GPCOGPVQ
Ŗ 2CTCTGOQXGTWOFKUEQFQUGWGUVQLQFG
75$VCNXG\GNGRQUUCECWUCTTWÈFQPQT¶FKQ
CTOC\GPCOGPVQRTGUUKQPGCRCTVGEGPVTCNFC
Ŗ ' UVC WPKFCFG RQFG TGRTQFW\KT CTSWKXQU PQ
ECKZCGNGXCPVGQFKUEQRCTCHQTCUGIWTCPFQQ
¶WFKQ RNC[GT RQTV¶VKNOGOÎTKC 75$ SWG Ã
cuidadosamente pelas bordas.
compatível com USB Mass Storage Class.
Ŗ 0ºQWVKNK\GHQNJCUFGRTQVGÁºQFGFKUEQU
0Q GPVCPVQ CTSWKXQU RTQVGIKFQU RQT FKTGKVQU
disponíveis no mercado ou discos equipados
autorais armazenados nos dispositivos USB
EQOGUVCDKNK\CPVGUGVE'NGURQFGOFCPKſECT
não podem ser reproduzidos.
o disco ou provocar a quebra do mecanismo
Ŗ 7 OC OGOÎTKC 75$ RCTVKEKQPCFC PºQ Ã
interno.
compatível com esta unidade.
Ŗ &GRGPFGPFQ FQ VKRQ FG ¶WFKQ RNC[GT RQTV¶VKN
Discos duais
75$OGOÎTKC75$WVKNK\CFQQFKURQUKVKXQRQFG
Discos duais são discos com dois lados que
não ser reconhecido ou os arquivos de áudio
RQUUWGOFGWONCFQWO%&FG¶WFKQITCX¶XGNG
podem não ser reproduzidos corretamente.
FQQWVTQWO&8&FGXÈFGQITCX¶XGN
Ŗ 0 ºQ FGKZG Q ¶WFKQ RNC[GT RQTV¶VKN 75$
# TGRTQFWÁºQ FQ NCFQ FQ &8& à RQUUÈXGN EQO
memória USB exposto à luz direta do sol por
esta unidade.
WO NQPIQ RGTÈQFQ FG VGORQ 5G HK\GT KUUQ Q
0QGPVCPVQEQOQQNCFQFQ%&FQUFKUEQUFWCKU
dispositivo poderá apresentar problemas de
PºQÃEQORCVÈXGNEQOQRCFTºQFQU%&UEQOWPU
funcionamento em decorrência do aumento da
talvez não seja possível reproduzir o lado do CD
temperatura.
nesta unidade.
Ŗ #VÃ  RCUVCU G  CTSWKXQU RQFGO UGT
Carregamentos frequentes e ejeção de um disco
reconhecidos.
dual pode resultar em arranhões no disco.
Ŗ 2QFG QEQTTGT WO RGSWGPQ CVTCUQ CQ KPKEKCT C
Arranhões profundos podem causar problemas
reprodução de arquivos de áudio incorporados
na reprodução com esta unidade. Em alguns
com arquivos de áudio ou dados de
ECUQU Q FKUEQ FWCN RQFG HKECT RTGUQ PQ UNQV FG
imagem armazenados em um dispositivo de
carregamento e não ser ejetado.
armazenamento USB com várias hierarquias
2CTC GXKVCT KUUQ TGEQOGPFCOQU SWG XQEÄ PºQ
de pastas.
use Discos duais nesta unidade.
Consulte as informações fornecidas pelo
fabricante do disco para saber mais a respeito
dos discos duais.

26 Pt
Apêndice

Informações adicionais

Arquivos de imagens JPEG Exemplo de uma hierarquia

Português (B)
Ŗ , 2 ' )  Ã  C  H Q T O C  C D T G X K C F C  F G  , Q K P V
Photographic Experts Group e refere-se a ( 0 )
um padrão de tecnologia de compressão de
1
imagem.
Ŗ 1 U CTSWKXQU UºQ EQORCVÈXGKU EQO KOCIGPU
ᅅķ
2
GUV¶VKECU $CUGNKPG ,2') G ':+(  CVÃ C
resolução de 8 192 × 7 680. (O formato EXIF ᅅĸ
à Q OCKU WUCFQ GO E¸OGTCU HQVQIT¶HKECU 3
digitais.) ᅅĹ
Ŗ 6 CNXG\ PºQ UGLC RQUUÈXGN C TGRTQFWÁºQ FG ᅅĺ
arquivos no formato EXIF que tenham sido ᅅĻ
processados por um computador pessoal. 4
Ŗ 0 º Q  J ¶  E Q O R C V K D K N K F C F G  E Q O  , 2 ' ) ᅅļ
progressivo.
ᅅĽ
5

Importante
ᅅľ
ƻ Pasta raiz
6
Ŗ # Q PQOGCT WO CTSWKXQ FG KOCIGO ,2') Pasta
adicione a extensão de nome de arquivo 7

ᅅĿ
Arquivo
EQTTGURQPFGPVG
LRILRGILRGQWLſH 
Ŗ ' UVC WPKFCFG TGRTQFW\ CTSWKXQU EQO GUUCU Camada 1 Camada 2 Camada 3 Camada 4 Camada 5

GZVGPUÐGUFGPQOGFGCTSWKXQ
LRILRGILRG
ou .jfif) como um arquivo de imagem JPEG.
2CTCGXKVCTRTQDNGOCUFGHWPEKQPCOGPVQPºQ
utilize essas extensões para arquivos que não Dispositivo de armazenamento externo
sejam arquivos de imagem JPEG. (USB)
# UGSWÄPEKC FG TGRTQFWÁºQ à C OGUOC
CUIDADO
que a sequência gravada no dispositivo de
A Pioneer não se responsabilizará pela perda dos armazenamento externo (USB).
FCFQUPQ¶WFKQRNC[GTRQTV¶VKN75$OGOÎTKC75$ Para especificar a sequência de
mesmo se esses dados tiverem sido perdidos T G R T Q F W Á º Q   Q  O Ã V Q F Q  C  U G I W K T  Ã
durante a utilização desta unidade. recomendado.
Crie um nome de arquivo incluindo
PÕOGTQUSWGGURGEKſSWGOCUGSWÄPEKC
FGTGRTQFWÁºQ
RQTGZGORNQZZZOR
e 099yyy.mp3).
Coloque esses arquivos em uma pasta.
Salve a pasta contendo os arquivos no
dispositivo de armazenamento externo
(USB).
0Q GPVCPVQ FGRGPFGPFQ FQ CODKGPVG
FG UKUVGOC VCNXG\ XQEÄ PºQ EQPUKIC
GURGEKſECTCUGSWÄPEKCFGTGRTQFWÁºQ
2CTC ¶WFKQ RNC[GTU RQTV¶VGKU 75$ C
UGSWÄPEKCÃFKHGTGPVGGFGRGPFGFQRNC[GT

Utilização correta do aparelho


CUIDADO

Ŗ Se líquido ou algo estranho estiver


PQ KPVGTKQT FC WPKFCFG FGUNKIWGC
imediatamente e entre em contato com
o revendedor ou a Central de Serviços

Pt 27
Apêndice

Informações adicionais

da PIONEER mais próxima. Não utilize a antena distante do aparelho para evitar
C WPKFCFG PGUUCU EQPFKÁÐGU RQKU KUUQ a distorção do vídeo pela apresentação
RQFGECWUCTKPEÄPFKQEJQSWGGNÃVTKEQQW FGRQPVQUHCKZCUEQNQTKFCUGVE
outra falha.
Ŗ 5G HWOCÁC HQT RGTEGDKFC DGO EQOQ LED (diodo emissor de luz) de luz de
WO TWÈFQ QW EJGKTQ GUVTCPJQ QW QWVTQU fundo
UKPCKU CPQTOCKU PQ CRCTGNJQ FGUNKIWG Ŗ 'OVGORGTCVWTCUDCKZCUCWVKNK\CÁºQFQ
imediatamente a unidade e entre em LED de luz de fundo pode aumentar o
contato com o revendedor ou a Central CVTCUQFCKOCIGODGOEQOQFGITCFCT
de Serviços da PIONEER mais próxima. UWCSWCNKFCFGFGXKFQ´UECTCEVGTÈUVKECU
A utilização desta unidade nessas da tela de LCD. A qualidade da
condições pode resultar em danos imagem melhora com um aumento na
permanentes no sistema. temperatura.
Ŗ 0ºQFGUOQPVGQWOQFKſSWGGUVCWPKFCFG Ŗ 2CTCRTQVGIGTQ.'&FGNW\FGHWPFQQ
já que nela existem componentes de CRCTGNJQſECT¶GUEWTQPQUCODKGPVGUC
alta tensão que podem causar choque seguir:
GNÃVTKEQ %GTVKHKSWGUG FG GPVTCT GO — Quando há incidência direta da luz
contato com o revendedor ou com a solar
Central de Serviços da PIONEER mais — Próximo da abertura de ar quente
RTÎZKOCRCTCKPURGÁºQKPVGTPCCLWUVGUQW Ŗ # XKFC ÕVKN FQ .'& FG NW\ FG HWPFQ Ã
reparos. FG OCKU FG   JQTCU 0Q GPVCPVQ
pode diminuir se ele for utilizado em
Manuseio do aparelho temperaturas altas.
Ŗ Quando o aparelho ficar exposto à luz Ŗ 3WCPFQQ.'&FGNW\FGHWPFQCNECPÁCT
direta do sol por um longo período de Q HKPCN FC XKFC ÕVKN C VGNC HKECT¶ GUEWTC
VGORQ GNG HKECT¶ OWKVQ SWGPVG Q SWG e a imagem não será mais projetada.
resultará em possíveis danos à tela de 5G KUUQ CEQPVGEGT GPVTG GO EQPVCVQ
LCD. Você deve evitar a exposição da com o revendedor ou com a Central de
unidade do aparelho à luz direta do sol o Serviços autorizada da PIONEER mais
tanto quanto possível. próxima.
Ŗ 1CRCTGNJQFGXGUGTWVKNK\CFQFGPVTQFCU
HCKZCUFGVGORGTCVWTCFGŌu%C u% Direitos autorais e marcas comerciais
Em temperaturas mais altas ou mais Este item incorpora a tecnologia de
baixas que esta faixa de temperatura para RTQVGÁºQ EQPVTC EÎRKC SWG à FGHGPFKFC
QRGTCÁºQQCRCTGNJQRQFGPºQHWPEKQPCT pelas patentes americanas e outros
normalmente. direitos de propriedade intelectual da Rovi
Corporation. A engenharia reversa ou
Tela de cristal líquido (LCD) FGUOQPVCIGOÃRTQKDKFC
Ŗ 1 ECNQT FQ CSWGEGFQT RQFG FCPKHKECT C
tela de LCD e o ar frio do sistema de MP3
refrigeração pode causar umidade dentro O fornecimento deste produto dá o direito
do aparelho resultando em possíveis a apenas uma licença para uso particular
FCPQU #NÃO FKUUQ UG Q CRCTGNJQ HQT GPºQEQOGTEKCNGPºQF¶QFKTGKVQCWOC
TGUHTKCFQRGNQUKUVGOCFGTGHTKIGTCÁºQC licença nem implica qualquer direito de uso
tela poderá tornar-se escura ou a duração deste produto em qualquer transmissão
FQRGSWGPQVWDQƀWQTGUEGPVGWVKNK\CFQPQ GOVGORQTGCN
VGTTGUVTGXKCUCVÃNKVGECDQ
aparelho poderá ser reduzida. GQW SWCNSWGT QWVTQ OGKQ  EQOGTEKCN
Ŗ 2GSWGPQU RQPVQU RTGVQU QW DTCPEQU VTCPUOKUUºQTGRTQFWÁºQ XKC +PVGTPGV
(pontos claros) podem ser visualizados intranets e/ou outras redes ou em outros
na tela de LCD. Isso ocorre devido às sistemas de distribuição de conteúdo
características da tela de LCD e não GNGVTÏPKEQEQOQCRNKECVKXQUFG¶WFKQRCIQ
indicam um problema de funcionamento. ou áudio por demanda. É necessária uma
Ŗ #QWVKNK\CTWOVGNGHQPGEGNWNCTOCPVGPJC licença independente para tal uso. Para
28 Pt
Apêndice

Informações adicionais

QDVGTFGVCNJGUXKUKVG

Português (B)
http://www.mp3licensing.com.

WMA
9KPFQYU /GFKC Ã WOC OCTEC EQOGTEKCN
ou registrada da Microsoft Corporation nos
Estados Unidos e/ou em outros países.
Este produto inclui a tecnologia proprietária
da Microsoft Corporation e não pode ser
utilizado nem distribuído sem uma licença
FC/KETQUQHV.KEGPUKPI+PE

DivX®
“DivX ®  %GTVKHKECFQ &KX: ® e logotipos
associados são marcas registradas da Rovi
Corporation ou suas subsidiárias e são
usados sob licença.

SOBRE DIVX VÍDEO: DivX ®  Ã WO HQTOCVQ


FG XÈFGQ FKIKVCN ETKCFQ RGNC &KX: ..% WOC
UWDUKFK¶TKC FC 4QXK %QTRQTCVKQP 'UVG Ã WO
dispositivo oficial certificado pela DivX ® que
reproduz vídeo DivX. Visite divx.com para obter
mais informações e ferramentas de software para
converter seus arquivos em vídeos DivX.

SOBRE VÍDEO SOB DEMANDA DIVX: este


dispositivo certificado pela DivX ® deve ser
registrado para reproduzir conteúdo de Vídeo
sob demanda DivX (VOD) adquirido. Para gerar o
EÎFKIQFGTGIKUVTQNQECNK\GCUGÁºQ&KX:81&PQ
menu de ajuste (página de referência 16). Vá para
vod.divx.com para obter mais informações sobre
como concluir o registro.

Dolby Digital
Fabricado sob licença da Dolby
Laboratories. “Dolby” e o símbolo do
duplo D são marcas comerciais da Dolby
Laboratories.

Pt 29
Apêndice

Informações adicionais

'URGEKſECÁÐGU
Geral
Fonte de alimentação nominal: .........................8%%
HCKZCFGVGPUºQRGTOKUUÈXGN8C8%%
0ÈXGNFGUCÈFCO¶ZRTÃUCÈFC..........................8
Consumo máx. de energia: ...............................#
Dimensões (L × A × P):
Chassis ....................................................178 mm × 50 mm × 165 mm
Face .........................................................188 mm × 58 mm × 22 mm
Peso: .................................................................MI

Aparelho
Tamanho da tela/relação do aspecto: ..............RQNGICFCUFGNCTIWTC
¶TGCFGXKUWCNK\CÁºQGHGVKXC
OOªOO
Pixels: ................................................................320 × (RGB) × 240
/ÃVQFQFGGZKDKÁºQ .........................................Matriz ativa TFT
Faixa de temperatura durável (desligada) .........Ōu%C u%

DVD player
Sistema..............................................................&8&8ÈFGQ8ÈFGQ%&%&9/#/2&KX:,2')
Discos utilizáveis ...............................................&8&8ÈFGQ8ÈFGQ%&%&%&449&8&v4494&.
Número de região .............................................4 para modelos do Brasil
Resposta de frequência.....................................*\CM*\
EQO&8&HTGSWÄPEKCFGCOQUVTCIGOFG
96 kHz)
Relação do sinal ao ruído ..................................75 dB (1 kHz) (rede IEC-A) (nível de RCA)
Nível de saída:
Vídeo ........................................................8RRš
v8
Número de canais .............................................
GUVÃTGQ
(QTOCVQFGFGEQFKſECÁºQ/2 .........................MPEG-1 & 2 Camada de áudio 3
(QTOCVQFGFGEQFKſECÁºQ9/# .......................8GT
¶WFKQFGECPCKU 
9KPFQYU/GFKC
Player)
(QTOCVQFGFGEQFKſECÁºQ&KX:.........................8GTFQ*QOG6JGCVGT
CXKFKXZ
Saída de vídeo DVD ..........................................NTSC

Áudio
Potência de saída RMS ... ................................ 9 ª 
 C   *\   FG 6*& ECTIC FG  š
ambos os canais acionados)
Impedância de carga .........................................š=šCš
šRCTCECPCN RGTOKUUÈXGN?
0ÈXGNFGUCÈFCO¶ZRTÃUCÈFC...........................8
'SWCNK\CFQT
'SWCNK\CFQTIT¶ſEQFGDCPFCU 
Frequência ...............................................80/1k/10 kHz
Ganho ......................................................C F$

Subwoofer (mono):
Frequência ...............................................80 Hz/120 Hz/160 Hz
Ganho ......................................................-79 dB a 0 dB

USB
'URGEKſECÁºQRCFTºQ75$ ...............................75$75$FGXGNQEKFCFGVQVCN
Corrente de energia máxima .............................500 mA
Sistema de arquivos ..........................................(#6(#6

30 Pt
Apêndice

Informações adicionais

Sintonizador de FM

Português (B)
Faixa de frequência .........................................../*\C/*\
Sensibilidade utilizável ......................................10 µ (Sinal/Ruído: 30 dB)

Sintonizador de AM
Faixa de frequência ...........................................531 kHz a 1 602 kHz (9 kHz)
.................................................................530 kHz a 1 640 kHz (10 kHz)
Sensibilidade utilizável ......................................30 dBµ (Sinal/Ruído: 20 dB)

Nota:
#UGURGEKſECÁÐGUGQFGUKIPGUVºQUWLGKVQUCOQFKſECÁÐGUUGOCXKUQRTÃXKQ

Pt 31
PIONEER DO BRASIL LTDA.
Escritório de vendas:
4WC6TG\GFG/CKQCPFCT%'25ºQ2CWNQ
52$TCUKN
Fábrica:
#X6QTSWCVQ6CRCLÎU%QNÏPKC5CPVQ#PVÏPKQ%'2
/CPCWU#/$TCUKN
PIONEER CORPORATION
5JKPQIWTC5CKYCKMW-CYCUCMKUJK
-CPCICYC,#2#0
PIONEER ELECTRONICS (USA) INC.
21$QZ.QPI$GCEJ%CNKHQTPKC75#
TEL: (800) 421-1404
PIONEER EUROPE NV
*CXGP-GGVDGTINCCP$/GNUGNG$GNIKWO$GNIKSWG
TEL: (0) 3/570.05.11
PIONEER ELECTRONICS ASIACENTRE PTE. LTD.
#NGZCPFTC4QCF5KPICRQTG
TEL: 65-6472-7555
PIONEER ELECTRONICS AUSTRALIA PTY. LTD.
#TEQ.CPG*GCVJGTVQP8KEVQTKC#WUVTCNKC
TEL: (03) 9586-6300
PIONEER ELECTRONICS OF CANADA, INC.
(GTTKGT5VTGGV7PKV/CTMJCO1PVCTKQ.4<%CPCFC
TEL: 1-877-283-5901
TEL: 905-479-4411
PIONEER ELECTRONICS DE MEXICO, S.A. de C.V.
Blvd.Manuel Avila Camacho 138 10 piso
%QN.QOCUFG%JCRWNVGRGE/GZKEQ&(
TEL: 55-9178-4270
‫ܜ‬䢦㙵ӑ᳝䰤݀ৌ
ৄ࣫Ꮦܻ␪औ⨲‫ܝ‬䏃  㰳  ῧ
䳏䁅   
‫ܜ‬䢦䳏ᄤ 佭␃ ᳝䰤݀ৌ
佭␃б啡䭋≭☷䘧  㰳  ῧ
䳏䁅 

2012 PIONEER CORPORATION.


Todos os direitos reservados.

Impresso no Brasil

PN:127075004204 XFBR