Escolar Documentos
Profissional Documentos
Cultura Documentos
m m
;PcT2Xch E^[!(8bbdT !'
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
=4F34;78C7DAB30H>2C>14A ! (*?064B %C"
@93;C3B9@DC
D81D9>C@9B5
=5*61B81>
!#F9F139DI
fffSPX[h_X^]TTaR^\
>`UZIZ¶dHfYR_#Z_>¶afcR^ µ1RWDNHUV¶IRU- .
QGLQIRUPDOVXPPLWDLPVDWH[SDQGLQJWLHVDPLG.DVKPLUVKDGRZ
?C8Q =4F34;7814898=6 play in the region and beyond
EORFNFRXQFLOSROOV
rime Minister Narendra
shows that both the leaders are
taking ownership of the com- 4`_XcVddS`jT`eed ing of nomination forms,
October 9, before making pub-
told the media, “The Congress
party was keen on contesting
P Modi and Chinese
President Xi Jinping will hold
plex relationship.
“The key aspect of the a`]]d,?4A5AYRgV lic their decision to boycott the
local body polls.
the BDC polls in the larger
interest of the State.
talks in Tamil Nadu’s coastal
town of Mahabalipuram on
engagement will be how both
the countries make incremen- R]cVRUjYZ_eVURe Addressing a Press confer-
ence at the party headquarters
Unfortunately, in the absence of
conducive atmosphere in the
October 11-12 to deepen ties,
including in the field of
tal progress in addressing their
differences and end the cycle of
_`eeR\Z_XaRce,3;A in Jammu, J&K Pradesh
Congress Committee chief GA
State, we were forced to take
this decision to stay away from
counter-terrorism, even as the
second informal summit comes
ups and downs in the ties,” he
told PTI.
`_]jSZXaRcejZ_WcRj Mir, flanked by senior party
leaders and former Ministers,
the poll process”.
Continued on Page 4
amid lingering unease in ties He said the India-China
over Kashmir with India assert- relationship is not only con- <>78C:0=370A8Q 90<<D
ing that it is an internal matter.
Hours after India and
China announced Xi’s visit to
fined to bilateral ties, but has
important regional and global
dimensions. The first informal T he State unit of the
Congress, which had earli- &$!!;<WR^Z]ZVd
UZda]RTVUZ_"*%(
India, the Chinese state media summit between the two lead- er decided to contest the Block
quoted the Chinese President ers took place in the Chinese Development Council (BDC)
as telling Pakistan Prime city of Wuhan last year months elections in Jammu & Kashmir
Minister Imran Khan during after a 73-day standoff between to strengthen the second tier of
e`XVeC&&=VRTY
their meeting in Beijing that their armies in Doklam that the Panchayati Raj Institutions,
China has been “paying close F^aZTabRPaahPW^PaSX]VU^aX]bcP[[PcX^]Pb_aT_PaPcX^]bPaTd]STafPhU^acWTbTR^]SX]U^a\P[bd\\XcQTcfTT]?aX\T<X]XbcTa had triggered fears of a war. on Wednesday announced to
attention” to the situation in =PaT]SaP<^SXP]S2WX]TbT?aTbXST]cGX9X]_X]VX]cWTbTPbXSTcT\_[Tc^f]^U<PWPQP[X_daP\^]FTS]TbSPh ?C8 The perception that India’s boycott the polls.
Kashmir and the “facts are decision in August to withdraw With their leadership under
:C@?:?8@FE 5:776C6?46D
clear”. Jammu & Kashmir’s special detention since August 5, the ?=BQ =4F34;78 tled there in the Centre’s reha-
According to the Xinhua status, triggering tension with two regional parties from bilitation package.
news agency, the Chinese China’s ally Pakistan, clouded Kashmir valley, the National he Union Cabinet on These families were left
President also hoped that the
“relevant parties” can solve the
P6^eTa]\T]cb^daRTbbPXSGXXbTg_TRcTSc^PaaXeTX]2WT]]PXTPa[hPUcTa]^^]^]5aXSPh preparations for the summit
gained ground as both sides
Conference and the Peoples’
Democratic Party have already
T Wednesday approved a
resettlement package under
out of the package approved by
the Cabinet on November 30,
P8]SXPXbTg_TRcTSc^aPXbTcWTXbbdT^UQP[[^^]X]VcaPSTSTUXRXcX]2WX]P³bUPe^da
issue through peaceful dia- could only announce the dates indicated that they would stay which one-time financial assis- 2016 for displaced families of
PCWTUXabcX]U^a\P[bd\\XcQTcfTT]<^SXP]SG8 c^^Z_[PRTX]cWT2WX]TbTRXch^UFdWP][PbchTPa\^]cWb
logue. for Xi’s India visit on away from the poll process in the tance of C5.5 lakh will be Pakistan-occupied Jammu and
PUcTaP&"SPhbcP]S^UUQTcfTT]cWTXaPa\XTbX]3^Z[P\cWPcWPScaXVVTaTSUTPab^UPfPa
Reacting sharply to reports Wednesday, barely 50 hours “absence of conducive” political given to each of the 5,300 dis- Kashmir (PoJK) and Chhamb
of Xi and Khan discussing PCWT_TaRT_cX^]cWPc8]SXP³bSTRXbX^]X]0dVdbcc^fXcWSaPf9:³bb_TRXP[bcPcdbcaXVVTaX]VcT]bX^]fXcW before the Chinese leader lands atmosphere in the State. placed families who had under the PM’s Development
Kashmir, External Affairs 2WX]P³bP[[h?PZXbcP]R[^dSTS_aT_PaPcX^]bU^acWTbd\\XcVPX]TSVa^d]SPbQ^cWbXSTbR^d[S^][h in Chennai. The Congress decision has migrated from PoK and first Package 2015 for Jammu &
Ministry said Beijing is “well P]]^d]RTcWTSPcTbU^aGX³b8]SXPeXbXc^]FTS]TbSPhQPaT[h$W^dabQTU^aTcWT2WX]TbT[TPSTa[P]SbX] “The forthcoming Summit made the entire poll process a settled outside Jammu & Kashmir. As per the estimates,
aware” of New Delhi’s position 2WT]]PX will provide an opportunity for futile exercise as the BJP Kashmir before relocating in the wake of the 1947
and it is not for other countries the two leaders to continue remains the only party in the themselves to the State. Pakistani aggression in Jammu
to comment on its internal matter if there is a query. trade and business ties. India is ty along nearly 3,500 km long their discussions on overarch- fray for the BDC polls begin- The Cabinet meeting & Kashmir, 31,619 families
affairs. The summit in the ancient expected to raise the issue of Sino-India border will be major ing issues of bilateral, regional ning October 24. In Jammu chaired by Prime Minister migrated from PoJK to Jammu
Government sources also coastal town in southern India ballooning trade deficit in focus areas in the talks. and global importance and to region, Jammu & Kashmir Narendra Modi approved the & Kashmir. Of these, 26,319
said there was no question of is also taking place against the China’s favour, the sources Strategic affairs expert exchange views on deepening Panthers Party is the only sig- inclusion of the families from families settled in Jammu &
any discussion on the issue as backdrop of China’s growing said. Ashok Kantha said the summit India-China closer develop- nificant player in the poll fray. Jammu & Kashmir which were Kashmir and 5,300 families
it is India’s sovereign matter but trade friction with the US. They added that political between Modi and Xi in an ment partnership,” the MEA Interestingly, the State lead- displaced in 1947 and had initially moved to other parts
added that Modi will update Both leaders are likely to relations, trade and ways to informal setting in the midst of said in a statement. ership of the Congress party initially moved out of the State of the country.
the Chinese President on the explore ways of expanding maintain peace and tranquili- evolving geo-political power Continued on Page 4 waited till the last day of the fil- but later on returned and set- Continued on Page 4
20?BD;4
DBD:90?0=CA8>F8=
274<8BCAH=>14;?A8I4 $IWHUORQJHVW &aVcTV_eYZ\VZ_
52+>`UZ¶d5ZhR]Z
VWD\PRQVRRQ
Bc^RZW^[\)CWaTTaTbTPaRWTab
¯9^W]6^^ST]^dVW^UcWTDB
1aXcPX]³bBcP][ThFWXccX]VWP\
XZWee`"#Tc8`ge
P]S9P_P]³b0ZXaPH^bWX]^¯
f^]cWT=^QT[2WT\Xbcah?aXiT
deRWWaV_dZ`_Vcd
?=BQ =4F34;78
EHJLQVUHWUHDW
^]FTS]TbSPhU^acWT
STeT[^_\T]c^U[XcWXd\X^] n a Diwali gift to nearly
QPccTaXTb_PeX]VcWTfPhU^a
b\Pac_W^]TbP]SPU^bbX[UdT[
IGovernment
1.15 crore Central
employees and
UaTTb^RXTch pensioners, the Modi
A094B7:D<0AQ =4F34;78 Government on Wednesday
B4=B4GB=0?B%30H approved 5 per cent hike in
50;;B?DACB%#%?>8=CB fter the flood fury that dearness allowance. The hike
<d\QPX)1T]RW\PaZX]SXRTb
\PSTP]T\_WPcXRR^\TQPRZ^]
A wreaked its anger on near-
ly 2 crore people across 14
benefitting 50 lakh employees
and 65 lakh pensioners, to be
FTS]TbSPhPUcTaPbXgbTbbX^] States, the southwest monsoon effective from July 1, 2019,
[^bX]VbcaTPZPbX]eTbc^ab_X[TS finally began retreating on would result in an additional
X]c^aTRT]c[hQTPcT]S^f] Wednesday. The monsoon outgo of C16,000 crore annually
QP]ZX]VP]SUX]P]RXP[bc^RZb withdrawal will be complete by for the Government
PWTPS^UcWTTPa]X]VbbTPb^] October 20. The season ended The Cabinet meeting
1B4BT]bTgbdaVTS%#$(& with a 10 per cent higher rain- chaired by Prime Minister
_^X]cbfWX[TQa^PSTa=B4=XUch fall than the long term average. Narendra Modi approved
i^^\TS '%(_^X]cb ? According to India west monsoon has withdrawn releasing an additional install-
Meteorological Department from some parts of Punjab, ment of Dearness Allowance
C><0C>?A824B>0AB (IMD), this is the longest Haryana and north Rajasthan (DA) to Central Government
C>C':68=34;78 delayed withdrawal of mon- today, October 9, 2019, as employees and Dearness Relief
=Tf3T[WX)0UcTa^]X^]baTcPX[ soon. “The most delayed with- against the normal date of (DR) to pensioners — repre-
_aXRT^Uc^\Pc^TbbW^cd_c^ drawal in the past years was September 1,” the IMD said. senting an increase of 5 per-
C'_TaZX[^VaP\X]cWT]PcX^]P[ recorded in 1961 (on October The excess rain this year centage points over the existing
2P_XcP[^]FTS]TbSPhSdTc^ 1), followed by September 30, has not only flooded several rate of 12 per cent of the basic
bd__[hSXbad_cX^]RPdbTSQh 2007,” the IMD pointed out. cities and towns but are also pay/pension — to compensate
WTPehaPX]X]ZThVa^fX]VBcPcTb The normal date of the with- expected to cause extensive for price rise, an official state-
X]R[dSX]V:Pa]PcPZP drawal is September 1. damage to standing kharif ment said. The increase is in
“The withdrawal started crops in States such as Madhya accordance with the accepted
8<<86A0=CBC>14>DC from Kapurthala, Ambala, Pradesh, Maharashtra, West formula based on the recom-
145>A4;B?>;;B)B707 Karnal and Churu on Bengal, Rajasthan, Bihar and mendations of the 7th Central
:PXcWP[) D]X^]7^\T<X]XbcTa Wednesday. In view of the eastern Uttar Pradesh. Pay Commission.
0\XcBWPW^]FTS]TbSPhbPXS persistence of an anti-cyclonic As per data of flood situa- “This is the highest ever 5
TeTahX[[TVP[\XVaP]cX]cWT circulation in the lower tro- tion reported by the Ministry percentage points increase in
R^d]cahfX[[QTbT]cW^\TQTU^aT pospheric level over north- of Home Affairs, over 1,700 DA in one go by the Central
cWT]Tgc_Pa[XP\T]cPahT[TRcX^]b west India, gradual reduction people have died and crops in Government,” Information and
PbWTX]e^ZTScWT=A20acXR[T in moisture in the lower and nearly 13 lakh hectare in these Broadcasting Minister Prakash
"&P]ScWTAPUP[T_daRWPbT mid tropospheric levels and 14 States have been destroyed. Javadekar told the media.
SdaX]VP_^[[aP[[hWTaT reduction in rainfall, the south- Continued on Page 4 Continued on Page 4
B2X]e^ZTbb_[_^fTac^P]]d[\PaaXPVT
?C8Q =4F34;78 the Bench said. The Bench said that if both
The court, in a series of the parties to the marriage
he Supreme Court has judgments, has exercised its agree for separation perma-
T exercised its inherent pow-
ers under Article 142 of the
inherent powers under Article
142 of the Constitution for dis-
nently and/or consent for
divorce, in that case, certainly
Constitution to annul a mar- solution of a marriage where both the parties can move the
riage of an estranged couple, the court finds that the mar- competent court for a decree of
residing separately for over riage is “totally unworkable, divorce by mutual consent.
two decades, saying it was a emotionally dead, beyond sal- “Only in a case where one
case of irretrievable break down vage and has broken down irre- of the parties does not agree
of wedlock. trievably, even if the facts of the and give consent, only then the
All efforts to continue the case do not provide a ground powers under Article 142 of the
marriage have failed and there in law on which the divorce Constitution of India are
is no possibility of reunion could be granted,” the Bench required to be invoked to do
because of the strained rela- sible for them to live together. said. the substantial Justice between
tions between the parties, the “Therefore, we are of the In the recent verdict the the parties, considering the
top court said. opinion that while protecting court rejected the submission facts and circumstances of the
A bench of Justices Sanjay the interest of the respondent of the wife that unless there is case,” it said.
Kishan Kaul and MR Shah — wife — to compensate her a consent by both the parties, It said however that the
said that it appears that mar- by way of lump sum permanent even in exercise of powers interest of the wife is also
riage between the husband alimony, this is a fit case to under Article 142 of the required to be protected finan-
and the wife has “irretrievably exercise the powers under Constitution, the marriage can- cially so that she may not have
broken down” as they have Article 142 of the Constitution not be dissolved on the ground to suffer and depend upon
been residing separately for last of India and to dissolve the of irretrievable breakdown of others.
22 years and it will not be pos- marriage between the parties,” marriage. Continued on Page 4
=4F34;78kC7DAB30H k>2C>14A ! ( RP_XcP[!
4>¶d5V_^Rc\gZdZe+22A 9PePSTZPa)
]^cVXeT]PbXc´b BdaeThc^R^d]c]d\QTa^U
=^S %"'ac`aVceZVd
ReeRTYVUW`c
e`^R\VµUV_ZR]¶a`]]ZddfV <Ph^a[TeT[\TTc W^dbTbaT`dXaTSU^a_^^a eRiUVWRf]e
BC055A4?>AC4A
BC055A4?>AC4AQ =4F34;78 school in the city is provided frivolous reasoning supplied by BC055A4?>AC4AQ =4F34;78 Q =4F34;78
swimming pool, happiness cur- Javadekar does not stand scruti-
fter the Centre refused to riculum and world-class hock- ny. Javadekar did not check his he Delhi Government will orth Delhi
A grant the go-ahead to the
scheduled visit of AAP nation-
ey field for the students but the
Center is not allowing us to
facts before speaking as in 2007
the then Delhi Chief Minister
T carry out a survey to esti-
mate the total demand for hous-
N Municipal
Corporation
al convener to Denmark, the explain it to the world about Late Sheila Dikshit had led the ing the poor under its ambitious (NMC) has attached 416 prop-
Aam Aadmi Party (AAP) on these achievements, he said. Delhi delegation for the summit project — Mukhyamantri Awas erties over non-payment of
Wednesday hit out at the Centre "Elections in Delhi are which was held in New York Yojna. For this, Delhi Urban property tax worth C2,775.42
and declared that it will take this round the corner, AAP will take that year. Various Mayors and Shelter Improvement Board lakh.
discriminatory treatment meted this issue of not granting per- Chief Ministers from around (DUSIB) is undertaking a mas- A senior NMC official said
out to Chief Minister Arvind mission to CM and ministers to the world had participated in sive demand survey in the 675 that the civic body attached
Kejriwal and Ministers before AP]YP]3X\aXk?X^]TTa
present our good work before that summit," he added. slum clusters of Delhi. these properties after owners
the people and make it an elec- the world to the people of Chadha further said that "The app-based digital sur- failed to pay tax on time. "The
tion issue. attended the same summit while Delhi. We will expose the Javadekar is clearly unaware of vey captures information about civic body has attached 416
AAP senior leader and being in the 'office'. motive and mindset of the BJP," the administrative structure of households living in slum clus- each family living in 'jhuggi' clus- DUSIB officials. The App-based properties since April 1st this
Rajya Sabha MP Sanjay Singh "The model of Delhi's edu- Singh said. major cities and States. Citing ters along with photographs of ters which will have the location, survey stores all the information year after their owners failed to
alleged that the Centre keeps cational reforms is being dis- "Why the BJP is scared of the example of the their personal identification cer- 'jhuggi' number along with pho- on an online database along with pay tax on time," he said,
cancelling official visits of AAP cussed across the world but the work done by the Kejriwal Commonwealth Games held tificates like Aadhaar Card, tograph of the family. geo coordinates which can be adding that NMC attached 125
leaders without citing any rea- Sisodia and Jain both were not Government. In the last few in Delhi in 2010 was inaugu- Voter ID, electricity bill, etc. "This survey will help the accessed and verified online by properties in last 15 days which
son. Singh said Deputy Chief granted permission to present years, the Delhi Government rated by then Delhi Chief along with pictures of the fam- Government in estimating the the officials, thus minimising involved an amount of
Minister Manish Sisodia was the model to the world," Singh has done a remarkable job by Minister whereas in other major ily members," a statement from demand for construction of cases of error and fraudulent C1,090.55 lakh while detached
also denied permission to visit said. improving the quality of edu- cities such events inaugurated Chief Minister Office (CMO) houses for the poor in the com- data capture by surveyors. 28 properties after realising an
Russia where he was scheduled The CM was expected to cation and health but the Centre by the Mayors. quoted. "The survey has already ing years," statement quoting Based on the eligibility cri- amount of C262.04 lakh.
to speak about educational speak at the C-40 Climate sum- does not want us to tell the Delhi BJP chief Manoj covered 1.25 lakh households in Urban Development Minister teria determined in the Policy, North DMC has also
reforms. Similarly, Health mit on his Government's effort world about these achieve- Tiwari said in a statement, "The roughly 270 slum clusters, who Satyendar Jain said. pucca flats will be allotted to the opened its all offices on all
Minister Satyendra Jain was in lowering air pollution in ments," Singh asked? "This way people of Delhi want to know will be issued survey certificates The Government said the families residing in slum clusters. Saturday except gazetted holi-
also refused permission to visit Delhi and present the set of ini- the BJP is not allowing the Delhi whether he (Kejriwal) is a Chief by the Delhi Government," the primary focus of the Notably, Only under days to facilitate tax payers.
Australia to talk about health tiatives taken by the AAP dis- Government to hold the flag of Minister or the mayor." "(The) statement said. It is being under- 'Mukhyamantri Awas Yojana - extreme circumstances espe- "Property owners are advised to
reforms in Delhi, he said. pensation that led to the 25 per India high in front of the world," Chief Minister himself tried to taken by an external agency 2015' is to rehabilitate the slum cially when it is not possible to pay their due property tax in
Singh's reaction came hours cent reduction in air pollution. he added. replace the mayor of Delhi for under the supervision of DUSIB clusters within a radius of five rehabilitate the slum cluster time as NMC has constituted a
after Union Minister Prakash The summit was slated to begin Meanwhile, criticising the this visit," he said. Kejriwal was officials, it said. kilometres of the existing slum within a five km radius will the special team to consolidate all
Javadekar said the permission on October 9 and end on decision of the centre, AAP to lead an eight-member dele- It stores all the information so that there is a minimum inter- settlement be rehabilitated fur- types of data available with
was not given as the summit was October 12. national spokesperson Raghav gation to the summit, to be held on an online database along with ruption in the lives of people ther away. The Delhi other agencies too. Geospatial
meant for the "mayor-level" In the last few years, the Chadha termed it incorrect, from October 9-12. At the sum- geo coordinates, which can be who are rehabilitated. Government is also in the Delhi Limited (GSDL) data is
participants. Terming it a "lame Delhi Government has done a ill-informed and misleading. mit, he was to speak on AAP accessed and verified online by According to Delhi process of construction of 5,500 also being used for verify actu-
excuse", the AAP leader said remarkable job by improving "C 40 is a group of the world's Government's experience in the officials, they added. Government, the survey is being new housing units for the eco- al details of properties includ-
earlier former Delhi Chief the quality of education and largest cities that is committed lowering pollution level in Delhi "The Delhi Government undertaken by an external nomically weaker sections at ing cell towers, nature of use of
Minister late Sheila Dikshit also health. Now, every Government to tackle climate change. The and other related issues. will issue survey certificates to agency under the supervision of prime locations in the city. property," he said.
&ODVV9,,,JLUOUDSHGE\WZR F^\P]ZX[[TSPb1B5QdbaP\bbR^^chUa^\QTWX]S
IRUPRQWKVJHWVSUHJQDQW BC055A4?>AC4AQ
=4F34;78
1YbaeQ\Ydi]Qig_bcU^Vb_]?Sd!"*C161B
B0?=0B8=67Q =4F34;78 monitoring agency — Delhi speed has become slow and
VQDWFKHUVDUUHVWHGLQ$\D1DJDU
BC055A4?>AC4AQ =4F PCR deputed at Aya Nagar police for further investiga-
Pollution Control Committee direction has become variable 34;78 border near Gurjar Chowk tion," said the DCP.
ir quality in Delhi and (DPCC). with predominately from the received a call regarding On the other hand, in
A National Capital Region
(NCR) is likely to deteriorate
Anand Vihar, RK Puram,
Chandni Chowk, Karni stadi-
east," quoted SAFAR's state-
ment on prevailing conditions
n separate incidents, the
Inabbed
Delhi Police PCR Unit has
snatching in the area.
"The caller informed that
Sagarpur area, the PCR per-
sonnel found a 10-year-old
from October 12 onwards. um, Pusa road, Karol Bagh, in atmosphere. two snatchers and two men have snatched his distressed girl.
Citing sporadic bio-mass burn- Rajouri Garden, Punjbai Bagh "Dry weather is likely to reunited a 10-year-old missing purse containing cash and "During patrolling, the
ing signatures in North India were such areas which tagged persist over the north-west girl with her family. other valuable documents and police team noticed a minor
over last one week and indica- under 'Unhealthy' category by Indian region and air quality In first incident, police per- they have entered in a house girl standing near a drain in
tions of increased fire activity the Air Quality Index (AQI) of deterioration is predicted to the sonnel deployed on Police at Aya Nagar area. Acting on Sagarpur area. The police team
during the last 24 hours as cap- US embassy on Wednesday middle end of the moderate Control Room (PCR) van, the call police team reached asked her about her parents
tured from the satellite imagery, wind speed has become slow evening. category for Thursday and fur- nabbed two snatchers-cum-rob- that spot," said the DCP. and address. Subsequently, a
pollution monitoring organi- and directions has become SAFAR, which measured ther deterioration to the high- bers in South Delhi's Aya Nagar. "Police team managed to PCR call was also received
sation System of Air Quality variable with predominately the overall average concentra- er end of the moderate catego- Police said that the accused nab the two accused who regarding the missing girl.
and Weather Forecasting And from the east — unfavorable tion of pollutants, has put air ry is expected for next two were caught within minutes were inside the house and hid- The family was contacted and
Research (SAFAR) has forecast for the dispersion of Suspended quality under moderate cate- days," SAFAR further high- after the crime was reported. ing. The duo was identified by after initial probe, the girl
deterioration of air quality. Particulate Matters (SPMs) in gory with chances of air qual- lighted. "However, current The accused have been the complainant on the spot. was reunited with her family,"
Besides few incidents of atmosphere. ity deterioration after two days wind direction is not favouring identified as Aman Sharma A case under section said the DCP.
agriculture residue burning, Meanwhile, City's Anand in its Air Quality weather fore- any transport from the north- (25), a resident of Delhi's Sinha, the Deputy 379/411/34 of Indian Penal
SAFAR also mentioned about Viahr was on top category cast. western region and hence any Mohammadpur area and Shail C ommissioner of Police Code (IPC) was registered
the evolving meteorological with value of Particulate "The overall air quality of drastic deterioration is not Dangi (25), a resident of Aya (DCP), Police Control Room against the duo at Fatehpur
state of affairs in northern Matters (PM) 10 at 211 μg/m3 Delhi is in the moderate cate- expected until the end of this nagar. (PCR), on the eve of Dusherra Beri police station and they
plains, SAFAR said that the measured by state pollution gory, as forecasted. The wind week," it stated. According to Sharat (October 8) around 6 pm a were handed over to local
8]RaTPbT^][X]TbTaeXRTbU^aXbbdP]RT^U ?;405>A0=4F;0=358;;8=34;78
QXacWSTPcWRTacXUXRPcTb) ;6c^<23b 94dVV\dcVa]jWc`^4V_ecV22A
BC055A4?>AC4AQ =4F34;78 tures for inclusion and correc- Baijal said in a statement issued New Delhi: The Delhi High Corruption Council of India
tion of names in Birth record by the L-G office. He further Court on Wednesday asked the claiming that the existing
elhi Lieutenant Governor to further facilitate users. stressed that efforts of MCDs in Centre, the AAP Government sites are filled much beyond
D Anil Baijal on Wednesday
directed the three municipal
The L-G directed
Municipal Commissioners to
streamlining issue of online
birth and death certificates
and the municipal corporations
here to respond to a PIL seek-
their capacity and also pose
a health risk to those living
corporations to increase online review functioning of will go a long way in promot- ing creation of a new landfill near them.
services for issuance of birth Registrars and Sub-Registrars ing 'ease of living' right from site for dumping the solid The petition has alleged
and death certificates in line and ensure that the first copy the time of birth. waste and garbage generated in that chemicals from the land-
with the goal of 'Digital India'. of Birth certificates is provid- The L-G office said approx- the national Capital. fill sites have reached the
Baijal stated that there is a ed to the parents by the respec- imately 10 lakh birth and death A bench of Chief Justice groundwater and contami-
huge potential to increase tive hospitals at the time of dis- certificates are issued in Delhi DN Patel and Justice C Hari nated it leading to various ail-
online issue of certificates charge itself for hospital births. every year. According to data, Shankar issued notice to the ments and water borne dis-
through wide publicity, simpler "The L-G exhorted that 10,09,873 birth and death cer- Environment Ministry, the eases in people living near-
processes and user-friendly municipal bodies should brace tificates were issued by munic- Delhi Government and the by.
interface. up providing citizen services ipal corporations last year, out three municipal corporations It has also contended
He also advised to incen- through online modes and of which 2,49,368 (24 per cent) seeking their stand on the plea that the landfill site at
tivise issue of online certificates promote ease of living in accor- were issued online and rest of which has also sought direc- Ghazipur is just 8 metres
and to upgrade existing soft- dance with vision of Prime the certificates were issued tions to stop dumping of waste Ghazipur, Bhalswa and Okhla. heard next on December 9, has short of the 73 metre tall
ware to provide additional fea- Minister Narendra Modi," offline. at the existing landfills at The petition, which will be been moved by NGO Anti Qutub Minar here. PTI
$OWKRXJKHYHU\SRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHO\IRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULW\RIRUELQGLQJLQDQ\ZD\RQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQ\UHVSRQVLELOLW\IRUDQ\
GDPDJHRUORVVWRDQ\SHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQ\DFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO\5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULI\DQGVHHNDSSURSULDWHDGYLFHWRVDWLVI\WKHPVHOYHVDERXWWKHYHUDFLW\RIDQ\NLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQ\FRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQ\HPSOR\HHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQ\NLQGRIFODLPPDGHE\WKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQ\NLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
4YZ_RaRjZ_XT]`dVReeV_eZ`_e`dZefReZ`_Z_<RdY^ZcIZeV]]d:^cR_
?C8Q 14898=6 al situation. “The Pakistan side briefed the situation. The two sides logue,” Xinhua quoted the appreciates China’s objective Chennai on October 11 and 12. aftermath of India’s move to
Khan’s visit to China comes the Chinese side on the situa- underlined that a peaceful, sta- Chinese president as saying. stance on the Kashmir issue. Beijing, the all-weather ally revoke Article 370 of the
hina is paying “close atten- at a time when tensions have tion in Jammu & Kashmir, ble, cooperative and prosperous China has always viewed Noting that China and of Islamabad, has backed Constitution.
C tion” to the situation in
Kashmir and the “facts are
spiked between Pakistan and
India after New Delhi ended
including its concerns, posi-
tion, and current urgent issues,”
South Asia was in common
interest of all parties. Parties
relations with Pakistan as a
diplomatic priority and will
Pakistan are all-weather strate-
gic cooperative partners, Xi
Pakistan over the Kashmir
issue, with its Foreign Minister
India has categorically told
the international community
clear,” President Xi Jinping has the special status of Jammu and said a joint press release issued need to settle disputes and continue to firmly support said, “No matter how the inter- Wang Yi in his address to the that its move on Kashmir was an
told Pakistan Prime Minister Kashmir on August 5. at the end of Khan’s visit to issues in the region through Pakistan on issues concerning national and regional situation UN General Assembly saying, internal matter. India main-
Imran Khan on Wednesday Xi, who met Khan at the Beijing. “The Chinese side dialogue on the basis of equal- its core interests and of major changes, the friendship between “no actions that would unilat- tains Kashmir is a bilateral
and hoped that the “relevant leafy Diaoyutai State responded that it was paying ity and mutual respect,” it concern to it, Xi said. China and Pakistan has always erally change the status quo issue and no third party has any
parties” can solve the issue Guesthouse here, said China is close attention to the current added. He called on the two sides been unbreakable and rock- should be taken”. role in it.
through peaceful dialogue. ready to work with Pakistan to situation in Jammu & Kashmir Earlier, the official Xinhua to maintain close high-level solid, and China-Pakistan However, Foreign Ministry China and Pakistan have a
Xi, who is scheduled to forge a closer China-Pakistan and reiterated that the Kashmir news agency reported that exchanges, step up strategic cooperation has always main- spokesman Geng Shuang on fine tradition of mutual support
visit India on Friday to hold community of shared future in issue is a dispute left from his- President Xi told Khan that communication and coordi- tained strong vitality.” Tuesday said the Kashmir issue and assistance, Xi said, accord-
2nd informal summit with the new era. tory, and should be properly “China is paying close attention nate positions on major issues Khan’s visit to China, third should be resolved bilaterally, ing to state-run Xinhua new
Prime Minister Narendra Khan briefed Xi on and peacefully resolved based to the Kashmir situation and in a timely fashion. since he took over as Prime significantly omitting its recent agency. Noting that Pakistan
Modi, assured Khan during a Pakistan’s views on Kashmir, on the UN Charter, relevant the facts are clear.” Xi also pledged to contin- Minister in August last year, references to the UN and UN used to provide “selfless help” to
meeting here that the friend- hoping to avoid deterioration of UN Security Council resolu- “China supports Pakistan ue to firmly advance counter- acquires significance as it Security Council resolutions. China when China was in dif-
ship between China and the situation, saying that tions and bilateral agreements,” to safeguard its own legiti- terrorism efforts so as to safe- comes ahead of President Xi’s Geng’s comments marked ficulties, Xi said now that China
Pakistan is “unbreakable and Pakistan values and appreciates the release said. mate rights and hopes that the guard security and stability, the high-profile visit to India for a significant shift on what has developed, it sincerely hopes
rock-solid” despite changes China’s “objective and unbi- “China opposes any uni- relevant parties can solve their Xinhua report said. Khan said the 2nd informal summit with China has been saying on to help Pakistan develop faster
in the international and region- ased” position. lateral actions that complicate disputes through peaceful dia- Pakistan highly values and Modi at Mamallapuram near Kashmir in recent weeks in the and better.
DJDLQVWFHOHEULWLHV
area. Police said that Oberoi is worker and former student
55-year-old man was undergoing treatment of union leader was allegedly shot
A injured after he allegedly
jumped on to the Metro tracks
depression. Blue Line connects
Dwarka in Delhi to Electronic
dead by two men here, spark-
ing protests by his supporters
and was hit by a moving train City in Noida. The train was who set ablaze several
at Uttam Nagar East station on going towards Rajiv Chowk Patna/Muzaffarpur: The Bihar register a case under sections Government buses and police
the Delhi Metro’s Blue Line. metro station when the inci- police has ordered closure of a which the reading of the com- vehicles.
The incident occurred on dent occurred. sedition case lodged against plaint discloses”, he said. Kabir Tiwari, a former stu-
Wednesday afternoon and it According to a senior nearly 50 celebrities, including The ADG said the matter dent union president of APN
led to brief delay in Metro ser- police official, after receiving a filmmakers Shyam Benegal, was super vised by SSP college, was attacked around 10
vices on the corridor. police control room (PCR) call Mani Ratnam and Anurag Muzaffarpur. “The com- am at Ranjeet crossing on
The victim has been iden- regarding the incident, a police Kashyap, and the complainant plainant could not produce Malviya road here, they said.
tified as Sanjeev Oberoi, a res- team rushed to the spot. would be prosecuted for level- supporting documents or evi- He was taken to the district
ling “false” allegations, a top dence, not even the alleged let- hospital from where he was
police official said. ter written by the 49 persons, referred to Lucknow. Tiwari
B2X]e^ZTbb_[_^fTac^P]]d[\PaaXPVT The development comes
after a number of opposition
which may support his claim of
commission of any offence,”
died on the way, they said.
After the incident, sup-
From Page 1 leaders and prominent per- he said. porters of the BJP leader kept
It directed the husband to pay the wife a lump sum perma- sonalities condemned the filing “On this and other cir- the body in front of the city
nent alimony amounting to Rs 20 lakh by way of demand draft of the FIR last week on the cumstantial basis, the case is police station demanding
within a period of eight weeks. complainant by a Muzaffarpur- found to be false and order has immediate arrest of the
The husband has approached the apex court challenging the based advocate against the been issued by him to investi- accused. A mob of students
order of Hyderabad High Court, which had dismissed his appeal 0STe^cTTcWa^fbU[^fTabP]S_[PbcXRQPVbX]c^AXeTa1aPW\P_dcaPX]6dfPWPcX^]FTS]TbSPh 0? celebrities who had signed an gating officer to submit Final damaged 15 roadways buses
against the family court order rejecting his prayer to grant a decree open letter seeking Prime Report- False. Along with this, and a police jeep, besides set-
of divorce. Minister Narendra Modi’s finding this to be an intentional ting ablaze a police bike. PTI
The couple had married in May 9, 1993 and a child was born
from the wedlock in August 1995. There were differences in opin- 2PaTcPZTa^UBP[\P]´bQd]VP[^fWT[SX]!(ha^[ScWTUcRPbT intervention in “rising inci-
dents” of mob lynching across
purpose of complainant, pros-
ecution under sections 182
ion between the husband and the wife and according to the hus- the country. and 211 (of the IPC) will be
band, cruelty was meted out to him. By 1997, the wife had left Mumbai: A 62-year-old man, suburbs. Rana and some oth- could not track him down. The Additional Director submitted against complainant
the house of husband and stayed at her parental house after which who worked as caretaker of a ers were allegedly involved in Recently the crime branch General of Police for lodging a false case,” the
the husband filed a divorce petition in the year 1999 before the bungalow of Bollywood actor a theft and arrested by the officials received a tip-off that (Headquarters), Jitendra ADG added. Those named as
Family Court at Hyderabad on the ground of cruelty. Salman Khan, was arrested on crime branch in 1990, Rana was living in a house in Kumar, said on Wednesday accused by advocate Sudhir
The Family Court in 2003 dismissed the divorce petition by Wednesday in a three-decade- said senior police inspector Gorai beach area for last 20 the case was lodged at Kumar Ojha, who had filed the
observing and holding that the appellant — husband — failed old theft case, a police Ninad Sawant. years, he said. Muzaffarpur in the wake of the petition on July 23, also includ-
to prove the cruelty by the wife. The Family Court also refused official said. He was released on bail and Probe revealed that Rana Chief Judicial Magistrate’s order ed historian Ramachandra
to pass a decree of divorce on the ground of irretrievable break- Unit-4 of the city police’s then became untraceable, the was working as caretaker at under Section 156(3) of the Guha, actors Soumitra
down of marriage. crime branch arrested Shakti police officer said. A court Salman Khan’s bungalow, fol- CrPC. Chatterjee, Aparna Sena and
The husband challenged the family court order in the High Siddheshwar Rana from Khan’s had issued a non-bailable war- lowing which the arrest was Under the provision, the Revathi and light classical
Court which in 2012 dismissed his appeal. bungalow in Gorai in western rant against him but the police made. PTI police had “no option but to singer Shubha Mudgal. PTI
>`UZIZ¶dHfYR_#Z_>¶afcR^
From Page 1 counter-terror exercise is a polit bureau member of the “beyond one issue summit” the sources said it is an opera- the Special Representatives dia-
Government sources in expected to be held later this Chinese Communist Party. and New Delhi does not see tional issue. logue, set up to find
Delhi said Xi is expected to year. On China’s objection to the Imran Khan’s trip as an attempt The India-China border an early solution to the border
arrive in Chennai early after- Both leaders will also wit- declaration of Ladakh as a by China to hyphenate the dispute covers the 3,488-km dispute.
noon on Friday. Modi will ness a cultural programme fol- union territory, the sources India and Pakistan relationship. Line of Actual Control. China China criticised India’s
take him to the famous world lowing which Modi will host said it was a demand of local The broad objective of the claims Arunachal Pradesh as decision on Kashmir and its
heritage site of Shore temple a dinner for the Chinese leader. population and the decision summit will be to find a broad part of southern Tibet while Foreign Minister Wang Yi even
complex in Mahabalipuram On Saturday, both leaders has in no way changed the pathway for future growth of India contests it. Both sides raised it at the UN General
and both of them will have a will have a one-on-one meet- respective perception of the Sino-India ties, they said, have been maintaining that Assembly last month. Days
meeting at the site. ing followed by delegation- boundary between the two adding that there was no plan pending the final resolution of later, Chinese Ambassador to
The effort would be to level talks. The Chinese countries. to ink any pact or issue any the boundary issue, it is nec- Pakistan Yao Jing said China
chart broader pathways for President is expected to leave The sources also termed joint communique after the essary to maintain peace and was working for Kashmiris to
development as also deepen for Nepal from Chennai the visit of the Pakistan Prime Modi-Xi meetings. tranquility in the border areas. help them get their funda-
ties in key areas, including around 2 pm on Saturday. Minister to Beijing before Xi’s On China objecting to the The two sides have already mental rights and justice, com-
counter-terrorism, sources said, Xi will be accompanied by India trip as a “bilateral matter” Indian Army’s mega military held over 20 rounds of border ments which did not go down
adding the China-India Foreign Minister Wang Yi and and said Modi-Xi meeting is exercise in Arunachal Pradesh, talks under the framework of well with New Delhi.
&$!!;<
WR^Z]ZVd
From Page 1
&aVcTV_eYZ\VZ_
52+>`UZ¶d5ZhR]Z
XZWee`"#Tc8`ge
µ1RWDNHUV¶IRU- .
Further, during the Indo- From Page 1 elections) are being held to facilitate only voters in Jammu district, 2,687 in Rajouri,
Pak wars of 1965 and 1971, a
total of 10,065 more families deRWWaV_dZ`_Vcd Raising serious question marks over the
Government agencies, responsible for facil-
one party - ruling party.
“Our leaders are under detention. We
2,069 in Poonch, 893 in Samba, 2,186 in
Kathua, 2,072 In Udhampur, 1,339 in
were displaced from Chhamb- From Page 1 itating the poll process, GA Mir told have no other option but to announce that Reasi, 1,150 in Ramban, 1,900 in Doda and
Niabat area. Of these 3,500 Briefing the media on the reporters, “We had even approached the we are boycotting the election,” he said. 1,016 in Kishtwar.
families were displaced during decisions taken by the Cabinet, office of Chief Electoral Officer on October The Bharatiya Janata Party is contest- In the Ladakh region, there will have
the 1965 war and 6,565 fami- Javadekar said the decision 5, urging him to intervene and ask the State ing on 280 seats in the BDC polls. 841 voters in Kargil and 744 in Leh. In the
lies were displaced during the would bring cheers to the Government agencies to facilitate the easy The elections will be held on party basis Kashmir region, there will be 2,783 voters
1971 war. Government employees on the movement of political workers and restore and 26,629 panchs and sarpanchs are eli- in Kupwara, 1,450 in Baramulla, 584 in
The 36,384 displaced fam- eve of Diwali. Beginning communication lines. Till last evening, we gible to vote and contest for the post of BDC Bandipora, 374 in Ganderbal, 43 in
ilies covered under the package January 2019, the Government waited. None of our senior party leaders in chairpersons. Srinagar, 650 in Budgam, 132 in Pulwama,
approved by the Cabinet in had raised the DA/DR to 12 Kashmir valley and former Ministers, Nearly 24 per cent (12,766) of the posts 82 in Shopian, 168 in Kulgam and 763 in
2016 included 26,319 displaced per cent from 9 per cent. ground workers were released by the of panchs and sarpanchs are vacant due to Anantnag.
families from PoJK settled in The Government said the Government agencies. To complete the poll various reasons, including resignations, As many as 69 BDC chairpersons’
Jammu and Kashmir and combined impact on the exche- process we need active support of party deaths and non-conduct of the polls dur- posts have been reserved for Scheduled
10,065 displaced families dis- quer on account of both DA leaders and ground workers, he said. ing the exercise held last winter. Over 18,000 Tribe candidates, including 21 women, 25
placed from Chhamb-Niabat and DR would be Rs 15,909.35 “While majority of them remain under panchs and sarpanchs are eligible to take posts for Scheduled Castes (seven women)
area. The 5,300 displaced fam- crore per annum and Rs detention we cannot think of participating part in the election in the Jammu division. and 78 posts for women from the gener-
ilies of PoJK who initially 10,606.20 crore in financial in the BDC polls”, he added. The Kashmir division has only 7,528 al category.
moved out of Jammu & year 2019-20 (for a period of GA Mir claimed it appeared that these elected panchs and sarpanchs. Elections will be held for 310 of the 316
Kashmir were not included in eight months from July 2019 to elections (Block Development Council In the Jammu region, there will be 2,703 blocks in the State.
the approved package in 2016 February 2020). This will ben-
$IWHUORQJHVWVWD\PRQVRRQEHJLQVUHWUHDW
but are now being included, the efit about 49.93 lakh Central
statement said. Government employees and
65.26 lakh pensioners.
The additional financial
implication on account of this
increase in DA is estimated at From Page 1 the lower levels over the next the retreating monsoon the basis of the mean rainfall
Rs 8,590.20 crore per year; and The delayed onset of the two days, giving way (North-East monsoon),” during the four-month mon-
Rs 5,726.80 crore in the current monsoons initially meant a to dry and cooler air from IMD said. soon season over the 50-year
financial year (from July 2019 to rainfall deficit of 33 percent in across the border to fill the The monsoon, meanwhile, period from 1951-2010. It
February 2020). The addition- June, but the season ended with lower levels, suppressing has seen a number of other works out to an average of 89
al financial implication on a 10 per cent higher rainfall rainfall. records being made this year, cm for the country as a whole).
account of the DR to pension- than the long term average. “This would set up the the IMD said in a detailed During 18 of the last 19
ers is estimated to be Rs 7,319.15 On the flip side, longer right conditions for the mon- review at the end of what has years (2001-2019), North-East
crore per annum and Rs 4,870 monsoon could also restock soon to exit from parts of been an exceptionally produc- India has received seasonal
crore in the current fiscal. reservoirs and help replenish North-West India initially, tive season. rainfall less than LPA with an
DA/DR is paid to Central ground water, helping assuage before the withdrawal line cov- After 1994, (110 per cent of exception of 2007 (110 of of
Government employees/pen- water shortages in pockets of ers more areas over West, long-period average, or the LPA), the IMD observed.
sioners to adjust the cost of liv- the country of 1.3 billion peo- North-West, Central and East LPA), the rainfall received dur- This indicates that the sea-
ing and to protect their basic ple and boosting production of India. By the time the line ing the just concluded 2019 sonal rainfall over North-East
pay/pension from erosion in rabi crops. crosses Central India, condi- season is the highest seasonal India is passing through a
the real value. These are revised The IMD said that the tions would have evolved over rainfall received by the coun- below normal epoch
twice a year from January 1 and moisture level in the atmos- the Bay of Bengal, Peninsular try as a whole. like it was during the early
July 1. phere will reduce gradually in India and the Arabian Sea for (The LPA is calculated on 1950s to mid-1980s.
=4F34;78kC7DAB30H k>2C>14A ! ( ]PcX^]$
>=2
2>=6´B?
?A4B834=CB78? :?I>65:2D42>
2:@QddQS[c A
?=BQ =4F34;78 minister also slammed those
who left the party after s the Congress remains ost-arrest of former Finance
S enior Congress leaders on Congress suffered a crushing beset with sharp differ- P Minister P Chidambaram
Wednesday raked up the
issue of party presidentship
yet again with former Union
defeat at the hands of the BJP.
“Many people left the party
after Congress’ performance.
3_^WbUcc ences even on a non-issue like
the “shastra pujan” of Rafale by
Union Home Minister Rajnath
by CBI in connection with the
INX Media scam, his son Karti
appeared before the
Minister Salman Khurshid say- Rahul left after our 2019 per- ?=BQ =4F34;78 Singh, BJP president Amit Enforcement Directorate (ED)
ing the party would have been formance, we wanted him to eferring to Khurshid’s Shah on Wednesday used it in on Wednesday and was grilled
in a better position had Rahul
Gandhi continued as its chief
continue but it was his decision
and we had to respect it. If he
R comments, the BJP
attacked the opposition party
poll-bound Haryana to lash out
at the Opposition party accus-
by the agency in a related
money laundering probe. The
and not quit after the 2019 Lok would have stayed on it would for its lack of leadership and ing it of being “against Indian move comes amid fresh leads
Sabha election results. And have been better for the party,” said its own members do not traditions”. gathered by the ED in the
while leader of the Congress in Khurshid said. know where their leader While senior Congress case. abroad.
Lok Sabha Adhir Ranjan On losing to BJP in the Lok (Rahul Gandhi) has gone. leader Mallikarjun Kharge Karti, the Congress MP Last year, the ED had
Chowdhury said the party Sabha elections, he said that Asserting that the BJP faces termed the Rafale shashtra representing Sivaganga in attached assets worth Rs 54
would love to have the Gandhi there are many upcoming elec- no challenge in the upcoming pujan in France as a “tamasha” Amit Shah took on the grand Another Congress leader Tamil Nadu, was summoned crore of Karti that were locat-
scion back as chief of the party, tions and the party now has to Assembly elections in by the Modi Government, he old party over its criticism of Rashid Alvi too termed as for a fresh round of question- ed in India, the UK and Spain
another senior leader forget the past and be fully pre- Maharashtra and Haryana was promptly dubbed an “athe- the “shastra pooja” and said, “drama” the performance of ing in the case, officials said. in connection with the INX
Jyotiraditya Scindia maintained pared for future elections. scheduled for October 21, BJP ist” by his own party leader “Congress people felt bad about shastra puja. “I want to say that Karti appeared at an Media case.
the Congress needed intro- Adhir Ranjan Chowdhury national spokesperson Sanjay Nirupam, who just a this too. The Congress has to this is a government of dra- agency office here and when Agency sources had earli-
spection. said that politicians like Rahul Narendra Taneja said, “You couple of days ago voiced his oppose whatever BJP does.” matics. You are going to France quizzed by reporters, he er alleged that P Chidambaram
Highlighting that the who step down taking moral need to exist on the ground disgruntlement with the party “Should the shastra pujan and performing puja. Wasn’t quipped that he had come to and Karti were the “beneficial
party’s future hangs in the bal- responsibility are rare in present to pose any kind of challenge publicly and singled out Kharge tradition be observed or not? the Rafale jet coming to India? say hello to the investigators on owners” of several shell firms
ance, Khurshid, however, said day politics. Several Congress but the Congress is just not for it. Should we keep this tradition You are going to a foreign the occasion of Dussehra. that were incorporated in India
only Sonia Gandhi, the current leaders both at the state and at there. The morale of their Reacting further, the BJP alive or not? Rajnath Singh ji country and doing all this Karti was earlier ques- and abroad in connection with
interim Congress president, the central level had criticised cadre is very low. Their own said the Congress is used to performed shastra pooja in drama. The question is does the tioned multiple times by the a Foreign Investment
can transform the party as it Rahul for “walking away” from leader, Salman Khurshid, is worshipping Ottavio France but the Congress peo- Narendra Modi Government ED in connection with the Promotion Board (FIPB)
had won the elections in 2004 the party president’s post fol- saying that Rahul Gandhi is Quattrocchi, the alleged mid- ple felt very bad about this too,” and the BJP consider Atal case and his statement was approval given to the INX
under her watch. He went on lowing the party’s defeat in the not there. They have no dleman in the Bofors deal. Shah said at the rally in Kaithal (Bihari Vajpayee) ji its leader or recorded under the Prevention Media group during
to say that Rahul’s exit from the 2019 Lok Sabha polls. leader and even the party This came after Kharge’s usage in Haryana. not. If it considers him their of Money Laundering Act Chidambaram’s tenure as the
party created an uneasy vacu- “Yes I have heard about the doesn’t know where Rahul of “tamasha” (drama), pointing Kharge even took a dig at leader, then he was the Prime (PMLA). Union finance minister.
um and urged Sonia to con- statements by certain leaders. I Gandhi is.” out that the Congress made no the Defence Minister’s sortie in Minister for six years, but did The Central Bureau of The alleged kickbacks
tinue as the party chief. would just say, yes it would such display when the Bofors the fighter jet, saying, he do any such drama going to Investigation (CBI) arrested received by the father-son duo
“My personal view is that have been good if Rahul stayed of us should take lessons from guns were purchased. “There is “These people go, show off, France,” Alvi asked. his father and senior Congress were used to meet their “per-
Sonia Gandhi should continue back as party president. But at him,” Chowdhury, a five-time no need to do such “tamasha’’. sit inside (the aircraft)”. He hit out at the govern- leader P Chidambaram in the sonal expenses”. They put the
as AICC President, we have the same time, we must also Lok Sabha MP from West When we bought weapons like Congress leader Udit Raj, ment for “ignoring” the real case last month. The senior money in over two dozen for-
pleaded with her and we hope appreciate the example of Bengal, told a news agency. the Bofors gun previously pur- a former minister of the BJP, problems of the country such Chidambaram is currently eign accounts and acquired
our pleas are heard. We hope moral accountability, he has set Scindia refused to com- chased, no one went and also took a dig at Defence as rising unemployment. “You undergoing judicial custody at multiple immovable assets in
she remains our permanent for everybody. Politicians like ment on Khurshid’s remarks brought them while showing Minister’s action, questioning are not talking about the Tihar Jail. countries such as Malaysia,
president. She has kept inspir- Rahul, who step down taking but did not mince words in say- off,” Kharge said. what the world would think of economy of the country, it is On Wednesday, Karti was the United Kingdom and Spain
ing us,” Khurshid said. the moral responsibility, are a ing the party undoubtedly Addressing an election India after such a “supersti- coming down day by day,” he questioned on some fresh leads among others, the ED has
The former external affairs rare breed in Indian politics. All needs to do introspection. rally in poll bound Haryana, tious” show. said. obtained by the agency from alleged.
8=B7>AC
B2c^TgP\X]TXU72bRP]caP]bUTa A><:D2?D496>6 =^cU^a^cWTaR^d]caXTbc^R^\\T]c^]8]SXP´b
58AX]cTa]P[T]`dXahX]c^bTgdP[ 7_fdUhdU^Tc1QTXQb X]cTa]P[PUUPXab)<40^]GX8\aP]:PbW\XacP[Zb
19?´BB0C8B73D14H
F8=B1870AABB40C
?Pc]P=Tf3T[WX) CWT19?^]
BcPcTbhTcc^bTc
A^PSCaP]b_^ac2^a_^aPcX^]
6^ecaPXbTbP__[T_a^RdaT\T]caPcTUa^\C$#c^C%_TaZV ABAC2Xb]^c^Q[XVTSc^VXeT
°R^\_PbbX^]PcT±Y^Qc^P
ST_T]ST]c^UXcbT\_[^hTTfW^
d_\T]cP[WTP[cWQ^Sh
A094B7:D<0AQ =4F34;78 20,000-25000 tonnes apple WPbSXTSX]Pa^PS\XbWP_
have been procured after the X]e^[eX]VcWTR^a_^aPcX^]³b
ithin a fortnight the abrogation of Article 370 from eTWXR[TPbWTXbP[aTPShT]cXc[TS
W Centre has yet again
revised upward the rate of
the valley.
Nafed has fixed apple
c^R^\_T]bPcX^]d]STacWT
<^c^aETWXR[Tb0RccWT
apple procurement from C54 to prices to encourage more farm- ?=B Q =4F34;78 Jharkhand, Tamil Nadu , stressed that while prompt Bd_aT\T2^dacWPbad[TS
C60 per kg almost meeting the ers to join the MIS scheme of Tripura, Uttar Pradesh, clinical treatment is neces-
demand of apple growers/farm- the state government so that ven as mental health dis- Himachal Pradesh, Sikkim, sary to tackle the condition, 2181>>:B58A<B´2<3
ers under the Market
Intervention Scheme (MIS).
apple growers could not be suf-
fered due to lock down after the
E orders are on the rise in the
country, at least 10 States
Karnataka, Andhra Pradesh,
Assam, Maharashtra, Odisha,
whenever required there are
non-clinical measures such as
5>A2740C8=61>8
=Tf3T[WX) CWT218WPbQ^^ZTS
As per the revised rate, C60, C44 abrogation of Article 370 from including Delhi, Rajasthan, Punjab, Telangana, yoga, community support and cWT2<3P]ScWT24>^U
and C24 per kg have been apple growers in the Valley. The The procurement has begun in the State. Haryana and Uttarakhand are Uttarakhand, Mizoram, participation in positive activ- <d\QPXQPbTSVa^d]SWP]S[X]V
fixed for grade A, B and C vari- rate has been revised from the backdrop of terrorists burn- According to the yet to set up mandatory State Gujarat, Kerala and Nagaland. ities to prevent the mental R^\_P]h;XeTfT[0XaCTP\?ec
ety of apple with wood packing. C54, C38 and C15.75 per kg to ing some apple orchards to Horticulture department of Mental Health Authority According to the health disorders. ;cSU^aP[[TVTS[hRWTPcX]VBcPcT
The farmers/growers had C60, C44 and C24 per kg for threaten apple farmers. Jammu & Kashmir, as many as (SMHA)to address the med- Government reply to an RTI According to a survey of 1P]Z^U8]SXPc^cWTcd]T^UC&
demanded C61 per kg for grade A, B and C varieties of Nafed chairman Bijender 3000-3200 farmers have regis- ical and rehabilitation needs of query filed by Supreme Court 10,233 individuals conducted Ra^aTQhbdQ\XccX]VU^aVTS
Grade A apple. apple with wood grass packing Singh told The Pioneer that he tered themselves with Nafed the sector. Ten per cent of advocate and mental health across seven States by Delhi- S^Rd\T]cbU^aPePX[X]V[^P]b
The State Government’s respectively. met with J & K Governor and State Government’s India’s population suffers from activist, Gaurav Kumar Bansal, based CIMBS in collaboration fWXRWaT\PX]TSd]_PXS^UUXRXP[b
request for a price of C70 per Similarly, C59, C43 and C23 Satya Pal Malik and discussed Horticulture Department. mental illnesses, and 90 per only 19 States have set up State with the World Federation for bPXS^]FTS]TbSPhCWT218X]
kg was rejected. The rate has per kg have been fixed for bout the ongoing process of Jammu & Kashmir produced cent of them remain untreat- Mental Health Authority Mental Health (WFMH), Xcb58A]P\TS2WPXa\P]P]S
been revised according to the grade A, B, and C for apple procurement and marketing 24.30 lakh metric tonnes of ed. (SMHA) so far while only athough 43 per cent were <P]PVX]V3XaTRc^a<P]TZ3PeTa
fruit grade and type of pack- with cardboard tray packing of the apple produce from the fruit last year, out of which What’s worst, none of the Triupra has constituted the aware of a person with men- P]S2WXTU4gTRdcXeT>UUXRTa
aging material under Market respectively. While C58 per kg Valley by the Nafed and its 21.61 lakh metric tonnes were States except Tripura has been Mental Health Review Board. tal illness within their family 1daiX]3PeTaQTbXSTbcWT
Intervention Scheme (MIS). have been fixed for grade A, benefit to the apple growers from Kashmir division. The able to establish mental health The RTI reply shows that or friends, nearly 20 per cen- R^\_P]hPbPRRdbTS
This wad decided at a high C42 per Kg for grade B and C22 who will be getting many times apple harvest was estimated at review board as envisaged in the Central Government has treported no mental health
level meeting between Jammu for grade C with cardboard more remuneration for various 18.82 lakh metric tonnes. the Mental Health Act 2017. no information on formula- facility or clinic even within a 6>EC;0D=274B
& Kashmir Governor Satya grass packing. grades of apple. Singh briefed About seven lakh families are The Act that guarantees rights tion of State Mental Health 50 km radius of their resi- 64<8=834E824
Pal Malik and the and the According to the order, Malik of the initiatives of directly or indirectly engaged in of people affected by mental Rules as well as health regula- dence. =Tf3T[WX) 5^abTP\[TbbP]S
National Agricultural C40, C25 and C19 per kg have NAFED for promotion of co- the fruit trade. Apples are cul- illness also entrusts respective tions. Overall, only 49 per cent TUUTRcXeTSXbbT\X]PcX^]^U
Cooperative Marketing been fixed for grade A, B and C operative marketing of agri- tivated on 3.87 lakh hectares in state governments to ensure Concerned at the poor had a mental health facility T\TaVT]RhX]U^a\PcX^]P]S
Federation of India ( Nafed) for Maharaji apple variety cultural produce, better price Kashmir. It fetches C8,000 crore facilities for rehabilitating implementation, Union Social within a 20 km radius. R^\\d]XRPcX^]^]fPa]X]Vb^]
chairman Bijender Singh at whereas, for American apple realisation for small and mar- annually and supports seven them. Welfare Minister Similarly, while 48 per cent SXbPbcTab[XZTRhR[^]TWXVW
the Raj Bhawan on Tuesday variety C47 per kg have been ginal farmers and diversifica- lakh families. It also mandates the States Thaawarchand Gehlot has had a person with a known fPeTbP]Scbd]P\Xb_^cT]cXP[
evening. An order to this fixed for Grade A, C31 per Kg tion of activities to make avail- The Modi Government to have a functional authori- written to all the States to work addiction in their family or UXbWX]Vi^]TbP]S^RTP]bcPcTb
effect has been issued. Earlier, for grade B and C17 for grade C. able essential items of daily had earlier announced that it is ty within nine months of the for raising awareness for pro- friends, 59 per cent had no U^aTRPbcb>B5c^UXbWTa\T]
the rates were revised on J & K contributes nearly need to the consumers at looking to procure about 12 law coming into force, but motion of mental health of de-addiction service near their cWT6^eTa]\T]c^]FTS]TbSPh
September 28. 70-80 per cent of the overall affordable rates. lakh tonnes or 60-70 per cent most of the States have missed individuals across the society house. Such distances are [Pd]RWTScWT6PVP]4]PQ[TS
As per the revised order apple production in India. Singh said that after Nafed of apples from growers so that the deadline. The States are cautioning that if ignored at deterrents that contribute to a <PaX]Ta³b8]bcad\T]cU^a
issued, the procurement rate Besides, the Nafed will lift 10 initiatives, several private farmers don’t suffer due to also yet to draft the rules of the initial stage, it can take shape wide treatment gap, said Dr =PeXVPcX^]P]S8]U^a\PcX^]
for apple revised within a fort- to12 lakh tonnes of apple from traders have also started lifting due to prevalent situation in the Act. The 19 States which have of an epidemic. Sunil Mittal, psychiatrist and 64<8=8STeXRT
night to give better price to the Valley this apple season. apple from the Valley. Nearly Kashmir Valley. set up SMHA are Manipur, In this connection, he Director, WFMH.
=4F34;78kC7DAB30H k>2C>14A ! ( ]PcX^]%
2gVcdZ`_e`354a`]]Via`dVdµY`]]`h_Vdd¶`W4`_X?4A5A+3;A
%-'OHG1'$*RYW 9:=??daVTb?aTi ´>3Y]`_bdQ^dV_b
?C8 Q 90<<D
JP candidate Sudhanshu
along with Trivedi, who is
National spokesperson of ?C8Q 0;860A7 tection of the poorest and margin-
U Adityanath will address rallies
on October 15, 16 and 18 in the run-up
the Gangoh (Saharanpur), Rampur and
Iglas-SC (Aligarh) Assembly constituen-
B Trivedi was on Wednesday
elected unopposed to the Rajya
the BJP.
Trivedi’s win was all but ttar Pradesh BJP president
alised section of the society. The BJP
will make a clean sweep in the upcom-
to the October 21 bypolls to 11 Assembly
seats in the State, the ruling BJP said
cies to address poll rallies, he added.
The Bharatiya Janata Party (BJP) has
Sabha from Uttar Pradesh.
He has been elected to the
certain due to the huge major-
ity the BJP enjoys in the Uttar
U Swatantradev Singh on
Wednesday said his party was on
ing by-elections,” he told reporters.
He said that the party’s main
on Wednesday.
According to state BJP media co-
announced candidates for 10 seats,
while the Pratapgarh seat has been given
Rajya Sabha on the seat which Pradesh Assembly. course to make a clean sweep in the plank is to work for a clean India and incharge Alok Awasthi, Adityanath will to its ally, Apna Dal.
fell vacant following the death Jaitley, who died in August upcoming by-elections for 11 make the state plastic free. address rallies in the Gobindnagar The bypolls will be held in the
of BJP stalwart Arun Jaitley. He was personally present this year, was elected last year Aassembly seats. Singh claimed it Replying to a question regarding (Kanpur), Manikpur (Chitrakoot), Gangoh, Rampur, Iglas (SC), Lucknow
Trivedi, who had filed his to receive his certificate, and his tenure was till 2024. would be a one-sided contest. the recent sensational murder in Lucknow Cantonment and Pratapgarh Cantonment, Govindnagar, Manikpur,
nomination papers on Friday, Dubey said. Trivedi, who is equally “BJP workers in the entire State Jhansi, the UP BJP chief said, “This Assembly constituencies on Pratapgarh, Zaidpur (SC), Jalalpur, Balha
was declared elected unop- Senior Ministers in the articulate in Hindi as well as are a committed cadre and are work- Government has nothing to hide and October 15. (SC) and Ghosi Assembly constituencies.
posed on Wednesday, the last Yogi Adityanath Government, English, is making his debut in ing for the party’s programmes rather that is why we are holding a magiste- The Chief Minister will address ral- The Ghosi seat fell vacant following
day of withdrawal of names, including Brijesh Pathak, Parliament after being than seeking personal gains. rial probe. The crime is connected to lies in the Zaidpur-SC (Barabanki), the resignation of its MLA Phagu
special secretary to the Vidhan Ashutosh Tandon, Mohsin associated with the BJP for a “The Government of Yogi the activities of the mining mafia and Jalalpur (Ambedkarnagar), Balha-SC Chauhan, after he was appointed as the
Sabha BB Dubey said. Raza and UP BJP vice-presi- long period. Adityanath is committed for the pro- the truth will not be suppressed.” (Bahraich) and Ghosi (Mau) Assembly governor of Bihar.
APUP[TbW^d[Sf^aah?PZfWh
Assembly elections. directly from 1998 to 2008
According to sources, the and when she failed to plant
CPI(M) is planning a host of them in Bengal she took a
long marches in the State over ‘reverse strategy’: this time by
2^]VXbd]WP__h)BWPW]PfPi
a host of issues ranging from stoking minority communal-
employment to rising inflation ism which bore fruit angering
to workmen’s rights, the Hindus and pushing them
preservation of secular fabric, towards the BJP and to make
adequate opportunity for edu- the BJP’s work easy. She pur-
cation and so on. sued a policy of ruthless per- ?C8Q 0DA0=60103 reporters here. Minister did it,” the BJP
The long marches will secution of the Left workers Congress leader Rahul leader said.
cover all districts and who were forced to take akistan should be worried Gandhi had made alleged cor- Asked about Opposition’s
possibly all the blocks and
panchayats of the State before
shelter under the saffron
umbrella because they were in
P about India acquiring
Rafale fighter jets, not the
ruption in the Rafale deal a
major issue during this year’s
criticism that the BJP was turn-
ing abrogation of Article 370
culminating at district power in the Centre and they Congress, BJP spokesperson Lok Sabha elections. and withdrawal of special sta-
headquarters and finally at the were armed with the CBI,” a Shahnawaz Hussain said here On some Congress leaders tus of Jammu & Kashmir into
State capital, sources said. former CPI(M) MP from on Wednesday. criticising Rajnath Singh per- an issue for Maharashtra elec-
“Bengal has been North Bengal said. Defence Minister Rajnath forming “shastra puja” of the tions, Hussain denied the
communally polarised by From an impressive 30 Singh took symbolic delivery of aircraft, Hussain said worship- charge.
Mamata Banerjee and the BJP. percent vote share in 2014 the the first Rafale aircraft in ing weapons on Vijayadashami “We revoked it (the con-
Now the Chief Minister is Left Front’s vote percentage France on Tuesday. is our tradition. stitutional provision) and we
crying hoarse against the slumped to 7.5 percent in 2019 “The Congress could not “It was Indian Air Force will talk about that. Congress
Hindutva forces. But the way with a majority of its decades get Rafale jets for the country Day and also Vijayadashami is making it a political issue.
she stoked minoritism in old sympathizers preferring to for one decade. They tried to when a Rafale jet was handed Maharashtra has contributed to
Bengal for the past several vote for the BJP. The Congress put hurdles in its path when over. Worshiping weapons national security, so we are
years and the way she sup- vote share came down from 10 they were in Opposition,” on Vijayadashami is a telling people here about revo-
pressed Left movement gave percent to 5 per cent. Hussain alleged, speaking to tradition and so our Defence cation,” he said. C^daXbcbcPZTbT[UXTbPccWT<dVWP[6PaST]X]BaX]PVPa^]CdTbSPh 0?
F_YSUcQ]`\Uc_V CW^bTfW^fP]cc^
\XbdbT;PSPZW
%-3LQFKHVWRZDUGVFU FX[[aTcWX]Z^]bd__^acc^
3XY^]QiQ^Q^T aTb^daRTb]^c PHPEHUVKLSLQ%HQJDO CABX]Qh_^[[bXU:2A
cdeTU^dd_RUdQ[U^ fT[R^\T)=P\VhP[ ?C8Q :>;:0C0 cross one crore mark. The response among
the masses is huge. Everyday we are receiv-
PSP\P]c^]AC2bcaXZT)2?8
?C8Q B7079070=?DA Dinesh Tripathi said. ?C8Q ?D=4 uoyed by its stupendous performance in ing thousands of applications,” a senior state Hyderabad: The Telangana unit of a Roundtable organised here by
police team on
Chief Judicial Magistrate
Omveer Singh on October 4 adakh BJP MP Jamyang
B the last Lok Sabha poll, the West Bengal
BJP is all set to achieve a record member-
BJP leader said.
According to Tushar Ghosh, convenor
CPI on Wednesday said it will
rethink on its support to the TRS
Telangana State Road
Transport Corporation employees’
A Wednesday took former
Union Minister Swami
had ordered that voice samples
of Chinmayanand, the law
L Tsering Namgyal on
Wednesday said several people
ship of one crore in the State, party lead-
ers claimed on Wednesday.
of the BJP’s membership drive in Bengal,
after the process of enrolling cadres gets
in the October 21 Huzurnagar
Assembly by-election if Chief
unions.
Various employees and workers
Chinmayanand and the student student and three others be wanted to visit the region to The Bengal BJP unit has surpassed the over the process of sorting out would start. Minister K Chandrasekhar Rao unions of TSRTC are on an indef-
who has accused him of rape taken. explore business opportuni- target set by the Central leadership to enroll “More than 90 lakh people so have have continued with his “oppressive” inite strike since October 5 in
to the Forensic Science The former Union ties but only those who are 60 lakh members when the countrywide taken the membership either online or stand against striking transport response to a call by the Joint
Laboratory in Lucknow for Minister, arrested by the SIT, genuinely interested in tap- membership drive began on July 6, accord- offline. According to the trend, we would corporation employees. Action Committee (JAC), demand-
taking their voice samples. was booked under section ping its resources, and ing to the party sources. soon cross one crore mark, the target set The term “self-dismissal” of ing merger of the RTC with the gov-
“Chinmayanand was taken 376C, a charge short of rape, on not misusing them, can be Although the membership drive across by our state president Dilip Ghosh. So once employees used by KCR will ernment and recruitment to various
to Lucknow at 6 am and the law the basis of the complaint filed welcomed. the country closed on August 20, it is on in this membership process gets over we would boomerang on him and he will be posts, among others.
student at about 9 am to by the 23-year-old woman who Speaking at an event here a few states such as West Bengal, which are start the process of verifying details and self-dismissed, CPI Telangana sec- The Chandrasekhar Rao-led
FSL in the State capital studies at a college run by his in Maharashtra, Namgyal said priority states for the BJP, and the exercise background,” Ghosh told PTI. retary Chada Venkat Reddy said government made it clear it has not
for their voice test,” Jail ashram. those people who wanted to in these states will continue till December Since 2014 Lok Sabha poll, the BJP has adding he should immediately intention of merging the loss-mak-
Superintendent Rakesh Kumar The woman has been use the resources in Ladakh for this year, party leaders said. grown by leaps and bounds in the state. In withdraw such remarks. ing PSU with it. The bypoll for
told PTI. charged with extortion, fol- selfish purposes are not wel- As per the data released by the state BJP 2009, the BJP in Bengal had garnered “If KCR does not retract from Huzurnagar was necessitated by the
“Two separate teams of lowing a complaint by the 72- come in the region. on August 22, the BJP had clocked 77 lakh around 1.75 lakh membership. The figures his stance of removing RTC resignation of Telangana Pradesh
the police have taken them to year-old Chinmayanand’s After abrogation of Article membership. went upto nearly 43 lakh during the mem- employees, if he continues to follow Congress Committee President N
Lucknow following court lawyer that she and three oth- 370 and 35 A, several people “As per the latest record 96 lakh peo- bership drive in 2014, when the party on oppressive methods on employees, Uttam Kumar Reddy
orders to take their voice sam- ers were demanding money want to visit Ladakh to explore ple have applied for the BJP membership. its own bagged 18 per cent votes and two we will rethink (extending support) following his election to Lok Sabha.
ples,” Superintendent of Police, from the leader. business opportunities. By the beginning of November we would Lok Sabha seats. for Huzurnagar bypolls,” he said at ` ` PTI
=4F34;78kC7DAB30H k>2C>14A ! ( ]PcX^]&
?C8Q <D<108
Pune: Senior NCP leader Ajit
Pawar on Wednesday down-
M Devendra Fadnavis said on
Wednesday that Opposition Congress
ly from political and social life after the
State Assembly poll outcome, 78-year-
in Kolhapur district of western
Maharashtra.
into peals of laughter.
After advising his party colleague
played Congress veteran and NCP have accepted defeat even old NCP chief Sharad Pawar poked fun Alluding to large desertions and not to talk like that and asking the for-
nion Minister and Dalit Sushilkumar Shinde’s state- before votes are cast in the state at himself while sending out a strong defections from the NCP ranks to the mer to remember that he was the party
U leader Ramdas Athawale
said on Wednesday that his
ment which had reignited
murmurs about the merger of
Assembly polls, as seen by Congress
leader Rahul Gandhi’s absence from
message to the ruling saffron alliance:
“Have I come old? Abhi to main jawan
BJP-Sena alliance, Patil said: “it would
not be surprising if the generation next
president, Pawar continued in lighter
vein: “Abhi tho main Jawan hu... I will
outfit had to continue to the Sharad Pawar-led party campaign. hoon... I will pack off everyone home of Pawar family switches over to the BJP pack off everyone home first then I will
support the BJP-led the BJP is not merely electoral with the Grand Old Party. He also said the Nationalist first then I will go”. in the coming years. If they do, we will go home”.
ruling alliance in Maharashtra and for power, I am with them Shinde caused a flutter on Congress Party is “half- empty”, and Pawar’s age and State BJP’s vow to come them”. Pawar, who will turn 79 on
as there was no over various social issues as Tuesday when he said the NCP will be emptied fully after retire him became a talking point on Elsewhere at Wadgaon in Akola December 12, has hit campaign trial for
other option. well,” he added. and the Congress will come the poll results are out on Wednesday, as the campaign for district of eastern Maharashtra — bet- the second time in the run-up to the
Athawale heads a faction The Union Minister of together “because now they are October 24. the October 21 Assembly polls picked ter known as Vidarbha, Pawar was in State Assembly polls. Before the
of the Republican Party of State for Social Justice also also tired and we are also tired”. “They are already in defeatist up pace. his element while campaigning for his Election Commission came out with the
India (RPI), founded by Dr B refuted rumours of his wife Ajit dubbed the remarks frame of mind. I read in newspapers State BJP president Chandrakant party candidate Sangram Gawande. schedule for the October 21 State
R Ambedkar. Seema entering into politics. Shinde’s “personal opinion”. that Rahul Gandhi is in Patil set the ball rolling by saying that After a welcome speech by a former Assembly polls on September 21, the
“I have no other political “She does attend some “He is a senior leader of Bangkok,” Fadnavis said at a rally at his party would ensure that Pawar legislator and office-bearer Tukaram Maratha leader had toured several
choice, so I am with BJP in this rallies and party functions. It Congress and he had expressed Ner in Dhule district of north “retires from political and social life for- Bidkar who in good faith described parts of the state once.
(Maharashtra Assembly) elec- does not mean she will join his personal opinion. I heard Maharashtra. ever” after the State Assembly polls were Pawar as “our beloved 80-year old Pawar has come in for a consider-
tion,” Athawale, known for active politics. She looks after what he said, and according to “He knows they are going to lose out on October 24. leader”, Pawar retaliated albeit in a able appreciation in the state political
his candid way of speaking, my house and helps me me, he had expressed what he anyway, so why take the blame for “We will ensure that he (Sharad lighter vein, “All youngsters have grown for the enthusiastic manner in which he
told a Marathi news channel. remain active in politics,” thinks, which is his right,” defeat? He is not ready to come here,” Pawar) permanently retires from social under my tutelage. I am happy with has been campaigning for his party can-
“But the association with Athawale said to a question. said Ajit. PTI Fadnavis said. and political arenas once the assembly their progress. I liked everything in his didate.
6HQLRU&RQJUHVVOHDGHUUDLVHVUHYROWDJDLQVW6RQLD5DKXO Bd\P[PcWPeXbXcb19?
:D<0A274;;0??0= Q
274==08
with ‘charisma’ in the Congress.
There are no charismatic lead-
ership in the party as of now.
CWTU^a\Ta2^]VaTbb
[TPSTaP[[TVTScWPccWT
has many controversial refer-
ences, including that of the
Bofors scam. Swamy has men-
serving caucus who has only
vested interests. “The only gain
made by the Congress in the
menting the Supreme Court
verdict,” said Ramachandran.
He lambasted the present
^UUXRTUdT[bb_TRd[PcX^]
PQ^dcY^X]X]V_Pach
_PachWPbUP[[T]X]c^cWT
seasoned Congress leader We had charismatic leaders tioned in the book that the real 2019 Lok Sabha election was leadership of the party for
A in Kerala, who had served
as Minister for two terms has
like Jawaharlal Nehru and
Indira Gandhi in the past.
WP]Sb^UPbT[UbTaeX]V
RPdRdbfW^WPb^][h
name of Sonia is Antonio.
Though the book was pub-
from Kerala where the minori-
ties cast their votes for the
nominating Rahul Gandhi as
the p[arty chief despite his
raised a revolt against the Though Rajiv Gandhi gave eTbcTSX]cTaTbcb lished in 2011, till date not a Congress because of their fear incapacity to occupy a seat
present leadership of the party enough indications that he single Congress leader or for Narendra Modi. The which was once adorned by ?C8Q 14=60;DAD from you (media)..You will be
including the Congress would emerge as a leader with newspaper. activist has challenged the con- Hindus cast their votes for the legends like Mahatma Gandhi the first to know,” Sumalatha
High Command. the stature of Nehru and “Recently I happened to tents,” pointed out Congress because they were and Subhash Chandra Bose. he visit by independent told reporters at Mandya after
KK Ramachandran, popu-
larly known in the State as
Indira, he turned out to be a
major disappointment,” said
read a book Sonia Gandhi, Her
Life, Her Lies and Her
Ramachandran.
The former Congress
disgusted with the CPI-M
which spoiled the serenity and
“The election to the post of
AICC president itself was
T MP Sumalatha Ambareesh
to the BJP office in her con-
visiting the BJP office. She said
she will seek BJP’s cooperation
Ramachandran Master, has Ramachandran in an article he Manipulations authored by Dr leader alleged that the party has sacredness of Sabarimala shrine manipulated and held under a stituency — Mandya — and support for the develop-
said that there are no leaders wrote for a popular Malayalam Subramanian Swamy. The book fallen into the hands of a self- under the pretext of imple- threat,” he said. to attend a meeting on ment of her constituency.
Wednesday sparked specula- “Other than that as of now
tion about her joining the to questions about joining this
B438C8>=270A64B0608=BC24;41A8C84B
19?WPb]^cWX]Vc^S^fXcW
XcbPhbBdbWX[:d\Pa<^SX
?C8Q ?0C=0
=0A030C0?4B
=Tfb_^acP[24>
<PcWTfBP\dT[
`dTbcX^]TSQh218
Kolkata: The CBI on
Wednesday interrogated
Narada News portal CEO
Mathew Samuel in connec-
tion with a sting operation he
claimed to have carried out five
years ago, agency sources said.
In the tapes that surfaced in
2016, ahead of Bengal assem-
bly polls, persons resembling
senior Trinamool Congress
leaders and IPS officer are seen
accepting money from repre-
sentatives of a fictitious com-
pany in return for favours.
Samuel, who had been
questioned by the agency on
earlier occasions, too, appeared
before the CBI on Monday
afternoon at its Nizam Palace
office, the sources said.
The Central Bureau of
Investigation (CBI) made its
first arrest in the case last
month, when it apprehended
IPS officer SMH Mirza,
who is currently in judicial
custody. PTI
^_]X^]
=4F34;78kC7DAB30H k>2C>14A ! (
'
gggTQY\i`Y_^UUbS_]
UPRTQ^^ZR^\SPX[h_X^]TTak /CWT3PX[h?X^]TTak X]bcPVaP\R^\SPX[h_X^]TTa
&KLQD¶VZHDNVSRW
A2A6CH:E9A2DD:@?
>`UZIZViaVTeReZ`_d
8OWLPDWHO\HFRQRPLFFRQFHUQVRIERWKQDWLRQVZLOOXQGHUSLQ
WKHPDWUL[RIDRQHRQRQHZRUNLQJUHODWLRQVKLS
CWT]PcX^]Xb\XVWchQdcP[b^UaPVX[TQTRPdbTXcWPb]^cQTT]PQ[Tc^cPZTcWT\PbbTbP]ScWT
%
\ QRZ DQ LQIRUPDO PHHWLQJ EHWZHHQ
3ULPH 0LQLVWHU 1DUHQGUD 0RGL DQG
&KLQHVH3UHVLGHQW;L-LQSLQJKDVEHHQ f^a[SP[^]VGX³bSaTP\^UP]TfTaPfX[[aT\PX]XU_T^_[TPaT]^cVaP]cTSb^\TUaTTS^\b
DSURWHFWLYHVKDIWFXVKLRQLQJWKHVLPPHULQJ
WHQVLRQEHWZHHQERWKQDWLRQV7KHWZROHDG
HUVHPERG\WKH:XKDQVSLULWLQDWRWDOUHFDOO
RIWKHLUILUVWIULHQGO\IDFHWRIDFHWKDWVWDYHG
RIIPXWXDOWHUULWRULDOFRQIURQWDWLRQLQ'RNODP
$QGWKRXJKIULFWLRQLVLQHYLWDEOHLQDQDV\P
PHWULFDOUHODWLRQVKLSZLWKWKH&KLQHVHVSHDN
LQJLQDIRUNHGWRQJXHWKHUHLVDOVRDQXQGHU
VWDQGLQJWKDWWDNLQJWKLQJVWRRIDULVQRWFRQ
3<1E45 0A?8
GXFLYHWRERWK%XWRYHUULGLQJWUDGLWLRQDOSRVWXULQJGHSHQGVDORWRQWKHSHUVRQD
DQGZLOORIWKHOHDGHUVERWKRIZKRPDUHGHILQLWLYHDQGSXUSRVHIXOEXWDUHIDF hina is a mighty country; we saw
LQJFKDOOHQJLQJWLPHVLQJHRSROLWLFV;L PD\KDYHWDNHQWKDWH[WUDVWHSEXWLV
\HWWRIXOO\GHK\SKHQDWHKLVDOOZHDWKHUIULHQG3DNLVWDQIURP,QGLDSDUWLFXODUO\
DIWHUZHFKDQJHGWKHVWDWXVRI-DPPX .DVKPLUDUHRUGHULQJZKLFKKHWKRXJKW
ZRXOGJRRQWRFKDOOHQJHDUHDV&KLQDFRQWUROOHGLQ3DNLVWDQRFFXSLHG.DVKPLU
OLNHWKH6KDNVJDP9DOOH\DQGWKHWHUULWRULDOLW\RI$NVDL&KLQ,QLWLDOO\JRLQJZLWK
C it on October 1 at the Tiananmen
Square. On the occasion of the
70th anniversary of the People’s
Republic of China (PRC),
President Xi Jinping was on the same wave-
length as his predecessor Mao Zedong 70
years ago, when he announced the founda-
3DNLVWDQRXUHDVWHUQQHLJKERXUGHVFULEHG.DVKPLUDVD´GLVSXWHIURPWKHSDVWµ tion of the PRC. The morale of the parade was:
DQGVRXJKWDVROXWLRQDFFRUGLQJWR81UHVROXWLRQV+RZHYHUDKHDGRIWKH0RGL “Power comes from the barrel of the gun.”
;LPHHWLWKDVFKDQJHGLWVWXQHDQGVDLG,QGLDDQG3DNLVWDQVKRXOGUHVROYHWKH “No force can ever undermine China’s sta-
tus or stop the Chinese people and the nation
LVVXHELODWHUDOO\2IFRXUVH&KLQD·VDQ[LHWLHVDUHDERXWWKH/LQHRI$FWXDO&RQWURO from marching forward,” said President Xi
/$&DQG/DGDNKWKRXJKWKH*RYHUQPHQWKDVFODULILHGWKDWWKHODWWHU·VHQKDQFHG from the rostrum of the Tiananmen Square.
VWDWXVKDVQRWKLQJWRGRZLWKLW%XW.DVKPLU·VUHRUJDQLVDWLRQDQGWDONRIUHFRY The Chinese Premier reminded those
who were present or watched the function that
HULQJRFFXSLHGWHUULWRULHVDVDFRUUHFWLYHVXUJHU\RIKLVWRU\KDYHXQGRXEWHGO\ “70 years ago, Comrade Mao Zedong solemn-
ZRUULHG&KLQDZLWKWKH3HRSOH·V/LEHUDWLRQ$UP\3/$URXWLQHO\KHDYLQJGRZQ ly declared to the world that the PRC was
WKHERUGHUZLWKLQFXUVLRQV,QGLDKDVQRZVWDUHGEDFNDWWKDWWKUHDWDQGHYHQ founded and the Chinese people had stood
up. This great event completely reversed
UHVLVWHGDOODWWHPSWVWREHHQFLUFOHGE\&KLQD·V%HOWDQG5RDG,QLWLDWLYH,WKDV China’s miserable fate born from poverty and
WKHUHIRUHPDQDJHGWRVXEVXPHDJJUHVVLYHWDONSRLQWVWRWKHODUJHUVSUHDGRI weakness and being bullied and humiliated
ELODWHUDOLVVXHVRIPXWXDOLQWHUHVWDQGQRWOHWWKHPVSLQWKHD[LV.DVKPLUZRQ·W over more than 100 years since the advent of
EHRQWKHWDEOHZKHQ0RGLDQG;LPHHWEXWWKH,QGLDQVLGHLVQRWILJKWLQJVK\RI modern times.” The Chinese State media was
ecstatic as it said, “China had reaffirmed its
GLVFXVVLQJLWHLWKHUVKRXOGWKH&KLQHVH3UHVLGHQWVRZDQW&KLQDDOVRZRXOGQRW commitment to global peace and develop-
ZDQWWRIDFHDFRXQWHUFKDUJHWKDWWKH&KLQD3DNLVWDQ(FRQRPLF&RUULGRU&3(& ment.” It added, “We will continue to work ner. Beyond the crypto-politic British colony has witnessed killed by different communist
LQ*LOJLW%DOWLVWDQLVLQGLVSXWHGWHUULWRU\DQGWKHUHIRUHIDOOVIRXORI81UHVROX with people from all countries to push for aspect of this tifo, our objective defiant protesters for several Governments around the world
jointly building a community with a shared was to remind everyone that the weeks. Interestingly, Hong since 1917. The statistics of vic-
WLRQVWRR<HVLWZLOOFRQWLQXHLWVVWUDWHJLFDOOLDQFHZLWK3DNLVWDQZLOOPDNHQRLV future for humanity.” spectators and supporters are also Kongers took their campaign tims include deaths through exe-
HVDVDFRHUFLYHWDFWLFEXWDVDVXSHUSRZHUFDQQRWRYHUORRNDPLGGOLQJSRZHU Many doubted as they watched in awe the actors of the match and respect against Beijing to their stadium, cutions, man-made hunger,
OLNH,QGLDDQGDFWZLWKLPSXQLW\DVEHIRUH,QGLDZRQ·WEHLQWLPLGDWHG DF-17 hypersonic ballistic missile (a hyper- is due to them as much as to a few booing the Chinese national famine, war, deportations and
7UXWKEHWROGERWK,QGLDDQG&KLQDQHHGPRUHFRQYHUJHQFHWKDQGLYHUJHQFH
sonic glide vehicle that can deliver both hundred thousand viewers at the 0102:;0B7C> anthem before the city’s soccer forced labour. In China alone, 65
DWWKLVSRLQWRIWLPH&KLQDLVLQWKHPLGGOHRIDQDFULGWUDGHZDUZLWKWKH86
nuclear and conventional payloads) and the
new-generation road-mobile DF-41, which
other end of the planet.”
The message to Beijing con- 278=0³B<867C team lost to Iran in its first
home qualifier for the 2022
million people died while the
Soviet Union accounted for 20
ZKLFKLVQRZLQWHUQDWLRQDOLVLQJLWVWUHDWPHQWRI8LJKXU0XVOLPVDVDPDMRUULJKWV made its debut in an official parade. Some tinued: “These Tibetan flags can 70BBC0AC43C> World Cup. million. Cambodia and North
YLRODWLRQLVVXHVW\PLHLQJDQ\YRLFHWKDW&KLQDPLJKWUDLVHRQWKHKXPDQULJKWV
15,000 troops from 59 units, 47 belonging to
the ground forces and a dozen air-borne
piss off the League and its new
shareholders, which are under <0=854BC054F The European Union (EU)
recently issued a statement: “The
Korea accounted for two million
each. The list is long.
SODQNLQ.DVKPLU7KHFHDVHOHVVSURWHVWVLQ+RQJ.RQJDQGWKHUHVXUJHQFHRI squadrons, participated in the parade. Xi the control of the Chinese State. 30HB145>A4 escalation of violence and contin- Meanwhile, the propaganda
7LEHWDQDFWLYLVWVDUHQRWGRLQJLWDQ\JRRGHLWKHU%HVLGHVPRVWQDWLRQVDUHQRZ inspected 580 new weapon systems, almost But we will be delighted to renew
C74?0A0348=
uing unrest in Hong Kong, machine of the communist
all of them were “Made in China”, proving that the experience…” including the use of live ammu- regime in Beijing works in full
ZDU\RILWVQHZ6LON5RDGSODQWKDWFRQGHPQVWKHPWRDGHEWWUDSSHGH[LVWHQFH
FRPSURPLVHGERWKWHUULWRULDOO\DQGHFRQRPLFDOO\,WWKHUHIRUHQHHGV,QGLDIRU
Beijing’s military industry is truly becoming
self-sufficient. It is a lesson that India has hope-
It is, perhaps, a sign of what
the Financial Review calls a dan-
14898=60C4;;8=6 nition, resulting in critical injuries
to at least one person, are deeply
steam. It published a White
Paper entitled, “Seeking
LWVDEVRUSWLYHPDUNHWWRVXVWDLQLWVPDQXIDFWXULQJKHIWDQGZRXOGZDQWWRZRUN fully noted a few days before the Chinese gerous decade ahead as China’s 8=2834=CC>>: troubling. The EU maintains its Happiness for People: 70 Years of
RXWDQDUUDQJHPHQWWKDWGRHVQ·WRYHUODSDQ\PXOWLODWHUDOFRQFHUQV,QGLDWRR
President visits Mamallapuram.
However, a backlash to China’s might has
rise falters: “Economists, defence
planners and security strategists
?;0248=5A0=24 position that restraint, de-escala-
tion and dialogue are the only
Progress on Human Rights in
China.” One of the chapters is on
KDVLWVRZQGLSORPDWLFEDWWOHRQ.DVKPLUMXVWLI\LQJLWVORFNGRZQ7KHQWKHUHLV started to manifest. A few days before the have begun testing the consensus F7827B7>F43 way forward.” It further observed: the “Splendid History of China’s
WKHHFRQRPLFVORZGRZQWKDWLWQHHGVWRJHWRXWRI,QVXFKDVFHQDULRERWK parade in Beijing, a telling incident took place
in France, which showed that it is not just
around China’s inevitable rise and
have come up with some surpris- C70C8C8B=>C “Fundamental freedoms, includ-
ing the right of assembly of
Human Rights Protection.”
The restive population of the
VLGHVKDYHOLWWOHRSWLRQEXWWRJRIRULQFUHPHQWDOUHDOLVPLQWLHV3HUKDSVWKDW·V China’s or the US’ neighbours who have to ing predictions.” 9DBC278=0³B Hong Kongers, must continue to western Muslim province of
WKHUHDVRQZK\,QGLDWRRKDVQRWEHHQRSHQO\YRFDODERXWWKHSURWHVWVLQ+RQJ
.RQJDQGKDVHYHQFODPSHGGRZQRQ7LEHWDQDFWLYLVWVIURPGHVFHQGLQJRQ
face difficulties to accept the so-called peace-
ful rise of the Middle Kingdom. It looked
ANI said it in different
words: “China exhibits Cold War >AC74DB³ be upheld and the possibility to
hold peaceful demonstrations
Xinjiang or the Tibetans, whose
religious freedom has been ruth-
0DPDOODSXUDPLQ7DPLO1DGXWKHYHQXHIRUWKHLQIRUPDOPHHWLQJ&KLQDLVGHV innocuous but at the start of the French Ligue mentality with huge military =48671>DABF7> must be ensured. These rights lessly stifled, will tell you anoth-
SHUDWHIRU+XDZHLWREHSDUWRIWKH*UROORXWLQ,QGLDEXWWKHODWWHUVHHPVWR
One’s football match between Olympique
Lyonnais (OL) and Nantes, an entire wing of
parade.” It added: “China regu-
larly likes to point the finger at the 70E4C>5024 must be exercised peacefully.”
It is clear that the world will
er story.
All this should be kept in
KDYHJLYHQLQWR86·IHDUVRIVS\LQJDQGGDWDWKHIW6R&KLQDKDVJRQHVRIDUDV the Gerland stadium in Lyon displayed a tifo, US for harbouring a ‘Cold War 385582D;C84BC> not accept another Tiananmen mind when President Xi arrives
WRVD\WKDWLWZLOOFRPSO\ZLWK,QGLD·VSDUDPHWHUVRQ+XDZHLDQGLVPDNLQJQRLV a gigantic graphic display organised by thou-
sands (or tifosis) of fans. A Tibetan flag. Why?
mentality’ but nothing speaks of
militaristic ambitions and mar- 0224?CC74 massacre. Though foreign offi-
cials and experts applauded a
in South India to “informally”
meet Prime Minister Narendra
HVDERXWFRUUHFWLQJWKHWUDGHLPEDODQFHHQFRXUDJLQJ,QGLDQFRPSDQLHVWRLQYHVW Simply because China is the club’s second tial glory as a large military B>20;;43 speech by Chinese President Xi, Modi. China is mighty and
XSJUDGLQJWKH1DWKX/DERUGHUWUDGHSRUWDQGORZHULQJWDULIIVIRU,QGLDQH[SRUWV shareholder and the OL management had parade. And no military specta- as Beijing reaffirmed its com- innovative but it is fragile sim-
LQWR&KLQD,QWKHHQGLWZLOOEHWKHHFRQRPLFGLPHQVLRQWKDWZLOOGHILQHQHZ decided to reschedule the match to 13:30 cle comes close to the size of the ?40245D;A8B4>5 mitment to world peace and ply because it is unable to take
GLSORPDWLFHQJDJHPHQWVDQGWUDGHRIIV3HUKDSVWKHFKRLFHRIWKHYHQXHLVVLJ
hours for a broadcast in China (matches usu-
ally take place at 17:30 or 21:00 hrs). China
event held in Tiananmen Square
on October 1.”
C74<833;4 development, one cannot forget
that communism killed millions
the masses and the world along.
Xi’s dream of a new era will
QLILFDQW0DPDOODSXUDPZDVDIORXULVKLQJVHDSRUWRIWKH3DOODYDG\QDVWVIRUD is simply mighty. It is not only the Gaulish :8=63>< of its own citizens during the remain as long as the Middle
ORQJWLPHZKRKDGDWKULYLQJUHODWLRQVKLSZLWK&KLQDDQGKDGHYHQVHQWHQYR\V The supporters, known as the “bad tribes who are revolting against past 70 years. Kingdom does not allow a
gones” (“gones” is the OL supporters’ nick- the Chinese hegemonic mindset A French book, The Black minimum freedom to its own
WKHUHGXULQJWKHLUUXOH6R0RGLDQG;LPD\MXVWZRUNRXWDQHZEDUWHUGHDO name) wrote on their Facebook page: “At the in Hong Kong; lakhs of young Book of Communism — Crimes, people.
kick-off, we deployed a tifo representing the people refused to slip under the Terror, Repression, calculated that (The writer is an expert on
8V_VcReZ_XT`_ec`gVcdj
Tibetan flag accompanied by a free Tibet ban- yoke of Beijing. The former more than 94 million people were India-China relations)
7KH(3&$KDVFDOOHGIRUDJHQHUDWRUEDQEH\RQGWKHERUGHUV B>D=318C4
8cf^d[SWPeTQTT]V^^SXU 0[^c^UfWPc8³\PQ[Tc^ =^\PccTaW^fcWTX]cTa]P 8]SXaP6P]SWX]TeTab^dVWc
RI'HOKL7KLVKDVVWLUUHGXSVRPHWURXEOHIRUFRQGRV 6(=V APWd[6P]SWXbcPhTSQPRZPb PRWXTeTXbQTRPdbT^UWX\ cX^]P[P]SaTVX^]P[bXcdPcX^] e^cTbX]cWT]P\T^UcWT
5
_Pach_aTbXST]c1dcfT\dbc AP]eTTaBX]VW¯X]cTa\b RWP]VTbcWTUaXT]SbWX_ eP[^da^UcWT0a\hBWT
HVLGHQWVRIWKHFDSLWDOKDYHQHYHUKDG P[b^P__aTRXPcTcWTTgP\_[T ^UW^fR^\U^acPQ[TWTXb QTcfTT]2WX]PP]S?PZXbcP] VPeTRaTSXcc^cWTbTRdaXch
D VWHDGLHU VXSSO\ RI HOHFWULFLW\ (YHQ ^U\^aP[PRR^d]cPQX[XchWT fXcW\hbdRRTbb^aW^f WPbP[fPhbQTT]d]QaTPZPQ[T _Tab^]]T[U^afX]]X]VP
WKRXJK IL[HG FKDUJHV KDYH LQFUHDVHG WPbbTcU^aTeTahQ^Sh bd__^acXeTWTXb P]Sa^RZb^[XS RadRXP[fPaU^acWTR^d]cah
VXEVWDQWLDOO\ XQLW FRVWV KDYH UHPDLQHG WKH 2^]VaTbb[TPSTa 0Rc^a 2WX]TbT?aTbXST]c =2?RWXTU
VDPHDQGVXSSO\KDVEHHQYHU\FRQVWDQW6R ¯0SWXa2W^fSWdah ¯3TT_XZP?PSdZ^]T ¯GX9X]_X]V ¯BWPaPS?PfPa
ZKHQ WKH (QYLURQPHQW 3ROOXWLRQ &RQWURO
$XWKRULW\(3&$D6XSUHPH&RXUWPRQLWRUHG
ERG\WKDWWUDFNVDQGWDNHVSUHYHQWLYHDFWLRQ ;4CC4AB C>C74438C>A
RQ SROOXWLRQ LQ WKH 1DWLRQDO &DSLWDO 5HJLRQ
implying that the country will
6bUUdXU\UQTUbc
1&5GHFLGHGWREDQWKHXVHRIJHQHUDWRUV
DIHZ\HDUVDJRLWZDVQ·WPXFKRIDSUREOHP
CdbY[UdXUbYWXdRQ\Q^SU venture to develop indigenous-
ly. India must soon emerge as
DVXQSODQQHGSRZHURXWDJHVDQGORDGVKHG WXbaTUTabc^cWTTSXc^aXP[°B2bPeTb0PaThU^a]^f±
C
Sir — Ever since the abrogation the preferred destination for
of Article 370, there has been a >Rc^QTa'CWTBd_aT\T2^dac³bSXaTRcXeTc^cWT the co-development and co-cre-
GLQJKDGEHHQHOLPLQDWHGIRUWKHODUJHSDUW)RUWKHSDVWIHZ\HDUVWKH(3&$ complete clampdown in the <PWPaPbWcaP 6^eTa]\T]c PbZX]V Xc c^ bc^_ cWT ation of an indigenous defence
KDVIRXQGLWVHOIPLUHGLQFRQWURYHUV\SDUWLFXODUO\ZLWKWKHVHDOLQJRILOOHJDOVKRSV Valley. Some positive signs are, UT[[X]V^UcaTTbX]<d\QPX³b0PaThXbfT[R^\TQdc_Ta manufacturing ecosystem.
EXWPRVWRILWVVWHSVKDYHEHHQDFFHSWHGEHJUXGJLQJO\E\FDSLWDOUHVLGHQWV%XW however, emerging. Higher sec- WP_b\dRWSP\PVTWPbP[aTPShQTT]S^]T0dcW^aXcXTb KV Seetharamaiah
ondary schools, colleges and ^U cWT <d\QPX <Tca^ APX[ 2^a_^aPcX^] <<A2 WPS Hassan
DVIDUPHUVEHJLQWREXUQWKHLUILHOGVLQDUHDVVXUURXQGLQJ'HOKLDOEHLWLQOHVVHU universities have reopened and P[aTPShRW^__TS! # ^UcWTXaX]cT]STS! '$caTTbX]
QXPEHUVWKDQEHIRUHWKH(3&$OLNHWKH'HOKL*RYHUQPHQWLVJHDULQJXSIRUWKH the public transport system, too, cWT""WTRcPaTU^aTbc_PcRWcWPcfPb_XRZTSU^acWTR^]
SUHGLFWHGSROOXWLRQDQGKDVEDQQHGWKHXVHRIJHQHUDWRUV7KLVQRWMXVWLQ'HOKL has restarted. bcadRcX^]^UP<Tca^RPabWTS4eT]cW^dVWcWT<<A2 3_^WbUccµT_g^VQ\\
EXWDOVRLQVXUURXQGLQJWRZQVRI1&5$QGWKLVVHHPVWRKDYHUDLVHGWKHKDFN Most importantly, in the first WPbR[PX\TScWPcXcWPb_[P]cTS!#caTTbPRa^bbcWT
major move signalling easing of RXchc^R^\_T]bPcTU^acWT[^bbP]TR^bhbcT\bdRWPb Sir — With Assembly elections
OHVRIUHVLGHQWVDQGLQGXVWULDOXQLWVLQ1RLGD*UHDWHU1RLGD*XUXJUDPDQG)DULGDEDG curbs on detained Kashmiri lead- cWPc^U0PaThfX[[cPZThTPabc^STeT[^_ cWT[TPSX]aTSdRX]VV[^QP[fPa\X]V;TPSTab\dbcP[b^ in Haryana and Maharashtra
7KHSUREOHPLVWKDWPDQ\RIWKHVDWHOOLWHFLWLHVLQ+DU\DQDDQG8WWDU3UDGHVK ers after Article 370 was abrogat- FWPcXbQTh^]SR^\_aTWT]bX^]XbcWTUPRccWPccWT aTP[XbTcWPcSTeT[^_\T]cRP]]^cR^\TPccWTR^bc^UTR^ getting closer, the internal crisis
GRQRWKDYHDUHJXODUSRZHUVXSSO\:RUVHVWLOOZLWKVHYHUDOUHVLGHQWLDOSURMHFWV ed, a 15-member National <PWPaPbWcaP6^eTa]\T]cS^Tb]^cWPeTP_^[XRhcWPc [^VXRP[SP\PVTFPhbRP]QTU^d]ScWPcRP]WT[_<<A2 within the Congress has only
Conference (NC) delegation met STUX]Tb°U^aTbcb±8]UPRccWT2T]caP[6^eTa]\T]cXbhTc R^]cX]dTfXcWXcb_a^YTRc0UcTaP[[XcRP]]^cQTST]XTS worsened. The exodus of leaders
VWDOOHGDQGPDQ\EXLOGHUVQRWUHFHLYLQJFRPSOHWLRQFHUWLILFDWHVRUMXVWGHOD\VE\ detained party leaders Farooq c^R^\Td_fXcWP[TVP[STUX]XcX^]U^a^daU^aTbcbCWXb cWPc<d\QPX]TTSbPQTccTa_dQ[XRcaP]b_^acbhbcT\0 continues and the leadership
WKHDXWKRULWLHVLQSURYLGLQJHOHFWULFDOFRQQHFWLYLW\SRZHUIURPGLHVHOILUHGJHQ Abdullah and Omar Abdullah in Xb^]TV[PaX]VPb_TRccWPcWPb[TSc^BcPcT6^eTa]\T]cb c^dVWQP[P]RX]VPRc]TTSbc^QTS^]T has failed to inspire confidence
HUDWRUVLVWKHOLIHOLQHIRUVHYHUDOFRPPXQLWLHV(YHQZKHQWKHUHLVSRZHUDYDLO Srinagar. _PhX]VbRP]caTb_TRcc^U^aTbcPaTPbCWT0PaThT_Xb^ST 3TeT]SaP:WdaP]P among party members. It is
The NC delegation, which P[b^S^Tb]^cQ^STfT[[PcPcX\TfWT]8]SXPXbcPZX]V 1W^_P[ shocking that the grand old
DEOHRXWDJHVDUHDUHJXODUDIIDLU7KHVZDQNLHVWDSDUWPHQWVKDYHSROOXWLRQVSHZ was permitted to meet the party is finding it difficult to
LQJJHQHUDWRUVZRUNLQJIRUKRXUVSURYLGLQJEDFNXSSRZHU5HVLGHQWVKDYHDVNHG Abdullahs by the Jammu & keep its flock together. The pre-
WKH(3&$WREHOHQLHQWEXWWKHERG\KDVPDGHDQDPHIRULWVHOIZLWKLWVKDUGOLQH Kashmir Governor, demanded opmental cause, which will be dif-
=Y\Ucd_W_ which developed J-20, an indige- sent crisis is a direct outcome of
that they and other political ficult to achieve without the sup- nously made fifth generation the leadership deficit at the top
VWDQFHDVVHYHUDOWUDGHUVLQ'HOKLKDYHGLVFRYHUHGWRWKHLULPPHQVHFRVW7KDW detainees be freed to revive the port of local leaders. aircraft. level. For a diverse country like
VDLGWKHUHLVRQHDGYDQWDJHLQWKHZLQWHUPRQWKV7KDWWKHGUDPDWLFGHPDQG political process in the State, Second, it will send a strong Sir — This refers to the editorial, Indigenisation is one area we India, the presence of a strong
SHDNRIWKHKRWVXPPHUPRQWKVLVPXFKUHGXFHGDVDLUFRQGLWLRQHUVJHWVZLWFKHG where Block Development message to the international com- “Welcoming the Rafale” (October never pursued earnestly. The Opposition is a must. The
Council elections are scheduled munity that measures are being 9). The first Rafale fighter jet has country has a vibrant defence Congress needs a leader who can
RII%XWZKDWDERXWKHDWLQJGHYLFHV"7KH(3&$·VQRWLFHRQJHQHUDWRUVVKRXOG for October 24. It’s high time that taken to restore normalcy. This now formally joined Indian Air manufacturing ecosystem that pump life into it.
ZDNHXSWKHSRZHUDXWKRULWLHVDQGGHYHORSHUVWRJHWWKHLUDFWVWRJHWKHU7KHUH the leaders must be freed without will further strengthen India’s Forces’ (IAF) inventory. This will can help us achieve self-reliance. Zoya
LVOLWWOHGRXEWWKDWGLHVHOJHQHUDWRUVDUHSROOXWLQJDQGPXVWEHVZLWFKHGRIILISRO compromising on security. case. Kashmir really needs to help arrest the slide in the IAF’s In this connection, Air Chief Via email
This bodes well for two rea- open up. operational capability and will, in Marshall RKS Bhadauria has
OXWDQWVJHWRXWRIKDQG,IZHUHDOO\ZDQWFOHDQHUDLUDFWLRQPXVWEHWDNHQRUHOVH sons. First, their release will help TK Nandanan fact, enhance it. But India needs said that India will not import BT]Shh^daUUTTSQPRZcc^)
WKHQH[WJHQHUDWLRQZLOOFRQWLQXHWRDVNKDUGHUTXHVWLRQVIURPXV the Government further its devel- Chennai to emulate the example of China, the fifth generation fighter jets, [TccTabc^_X^]TTa/V\PX[R^\
P]P[hbXb
=4F34;78kC7DAB30H k>2C>14A ! (
gggTQY\i`Y_^UUbS_]
(
58ABC2>;D<=
C_\YdeTUQ^ @?9>D2>D=C4A@?9>D
ebRQ^SebcU
C74A48B=>=443C>3>C0<0B70F74=F4 8BB70B7CA0?D90 =>C3>=4>=E890H030B70<8.
1>D67CF40?>=B;8:4C741>5>AB6D==>>=4 8F0=CC>C4;;C74<2>=6A4BBC78=:01>DC
F4=C0=31A>D67CC74<F78;4B7>F8=6>55 F70CB7>D;314>??>B430=3F70C=>C
FXcWcWTQaTPZS^f]^UcWTY^X]cUP\X[hbhbcT\ °2>=6A4BB;4034A °D=8>=7><4<8=8BC4A
aXbX]V\XVaPcX^]b^RXP[\TSXPPSSXRcX^]P]SWTRcXR <0;;8:0A9D=:70A64 0<8CB707
[XeTb[^]T[X]TbbWPbQTR^\TP]T_XST\XR
;L¶VDJHQGDGHFRGHG
@B1;B9D9?>330A ,Q0DPDOODSXUDP0RGLDQG;LPLJKWUHDIILUPFRPPLWPHQWVPDGHDWWKH:XKDQ
6XPPLWZKLOHZLWK1HSDOWKHODWWHUZLOOWU\WRH[SHGLWHGHOD\HG&KLQHVHSURMHFWV
,
QDZRUOGRILQWHUQHWFRQQHFWLYLW\DQGWKRXVDQGVRIVRFLDO
PHGLDIULHQGVDQGIROORZHUVGHVRODWLRQZRXOGVHHPOLNHDPLV
SODFHGZRUG+RZHYHUWKHORQHOLQHVVHSLGHPLFLVUHDODQGLW
LVFRQVXPLQJWKHHQWLUHZRUOG7KH%ULWLVK*RYHUQPHQWODVW\HDU
DSSRLQWHGD0LQLVWHURI/RQHOLQHVVWRDGGUHVVWKHLVVXHDQGDFFRUG
LQJWRDVWXG\PRUHWKDQQLQHPLOOLRQSHRSOHLQ(QJODQGRIWHQRU
DOZD\VIHOWDORQH6LPLODUGHPDQGVIRU*RYHUQPHQWLQWHUYHQWLRQ
KDYHEHHQUDLVHGLQ$XVWUDOLD
:LWKWKHEUHDNGRZQRIWUDGLWLRQDOMRLQWIDPLOLHVLQFUHDVLQJ
PLJUDWLRQJURZLQJGLVFRQQHFWDQGKHFWLFFLW\OLYHVWKDWOHDYHOLW
WOHWLPHIRUVRFLDOLVLQJWKHDOLHQDWLRQV\QGURPHLVFUHHSLQJLQWR
,QGLDQFLWLHVDVZHOO6RFLDOPHGLDKDVIXUWKHUFRPSRXQGHGWKH
SUREOHPE\DOORZLQJSHRSOHWRFRQQHFWYLUWXDOO\DQ\WLPHWKHUH B9C89 6D?C0
E\GLPLQLVKLQJWKHLPSRUWDQFHRISHUVRQWRSHUVRQFRQWDFW$URXQG
PLOOLRQ,QGLDQVDUHHVWLPDWHGWREHVXIIHULQJIURPGHSUHVVLRQ hinese President Xi Jinping is expected
DQGWKHUHDUHURXJKO\RYHUVXLFLGHVDQQXDOO\
&RQWUDU\WREHOLHIORQHVRPHQHVVLVQRWVRPHWKLQJWKDWLPSDFWV
MXVWWKHHOGHUO\$VWXG\E\DKHDOWKLQVXUDQFHSURYLGHULQWKH86
C to arrive in India to hold a second infor-
mal summit with Prime Minister
Narendra Modi at Mamallapuram near Chennai
IRXQGWKDWPLOOHQQLDOVDQG*HQHUDWLRQ=ZHUHLQIDFWORQHOLHUWKDQ from October 11 to 12 and pay a State visit to
ROGHUJHQHUDWLRQV,Q,QGLDDVWXG\E\$JHZHOO)RXQGDWLRQ Nepal on October 13. The Mamallapuram sum-
DFURVVGLVWULFWVIRXQGWKDWDZKRSSLQJSHUFHQWRIHOGHU mit is important for the country as it comes
O\SHRSOHVXIIHUIURPDIHHOLQJRILVRODWLRQ:KLOHZHGRQRWKDYH amid escalating tensions in the South Asian
DVLPLODUVXUYH\RUGDWDIRU\RXQJ,QGLDQVWUHQGVLQWKLVFDWHJR region, especially between India and Pakistan,
U\DUHH[SHFWHGWREHVLPLODU8QGHUVWDQGDEO\WKHVLWXDWLRQLVPRUH
after the Modi Government abrogated Article CA03470B144=
SURQRXQFHGLQXUEDQFHQWUHVZKHUHDODUJHQXPEHURISHRSOHOLYH
370, revoking the special privileges given to 0BCA>=6?>8=C
DORQHDZD\IURPWKHFRPIRUWRIIDPLO\DQGIULHQGV$QDWLRQ
Jammu & Kashmir (J&K) by the Constitution. 5>A8=3800=3
During the informal meeting, Modi and Xi are 278=0=>C
ZLGHVXUYH\FRQGXFWHGE\WKH1DWLRQDO,QVWLWXWHRI0HQWDO+HDOWK expected to hold comprehensive talks on a host
DQG1HXUR6FLHQFHVLQHVWLPDWHGWKDWDURXQGSHUFHQW of issues concerning bilateral relations and
F068=6F0A
RIWKHSRSXODWLRQVXIIHUHGIURPGLIIHUHQWPHQWDOLOOQHVVHVZLWK exchange views on regional and international 0608=BC4027
DURXQGSHUFHQWUHTXLULQJLPPHGLDWHDWWHQWLRQ7KHVWXG\ matters of importance. >C74A34B?8C4
FRQFOXGHGWKDWUHVLGHQWVIURPPHWURFLWLHVZKHUHLVRODWLRQDQG Given the growing tension between New >=6>8=61>A34A
VWUHVVDUHPRUHSURQRXQFHGKDGJUHDWHUSUHYDOHQFHDFURVVGLI Delhi and Islamabad post the abrogation of 38B?DC4B>E4A
IHUHQWPHQWDOGLVRUGHUV Article 370 and Beijing’s support to Pakistan, C74;8=4>5
(YHQPRUHDODUPLQJLVWKHIDFWWKDWVKULQNLQJIDPLO\VL]HVDQG
this meeting is critical from China’s standpoint, 02CD0;2>=CA>;
EUHDNGRZQRIWKHMRLQWIDPLO\V\VWHPWKDWSURYLGHGDPXFKQHHG
too, considering that India has managed to build G8<867C0BBDA4
HGVRFLDOFXVKLRQKDYHOHGWRORQHOLQHVVDPRQJFKLOGUHQ$OVR
trust and traction with its immediate neighbours 8=380>50
— Bangladesh, Bhutan and Maldives. 10;0=243
LQFUHDVLQJPLJUDWLRQDQGJHRJUDSKLFDOGLVORFDWLRQUHVXOWLQDORVV In doing so, India’s “neighbourhood first
RILGHQWLW\DPRQJFKLOGUHQ/RQJWHUPORQHOLQHVVRUODFNRISHR policy” has taken centrestage, as it did, soon
1DB8=4BB0B74 ambitious use of loans and aid to gain China has attempted to forge diplo- that has belied China’s expectations in
SOHWRSHRSOHFRQQHFWLRQDOVRKDVKDUPIXOHIIHFWVRQSK\VLFDO after Modi took oath for the second term this 3830CC74 influence around the world — and of matic ties with Bhutan, fears of a Tibet- gaining the desired results through the
KHDOWK'HILFLHQFLHVLQVRFLDOUHODWLRQVKLSVDUHDVVRFLDWHGZLWKDQ year. His first overseas visit was to the Maldives. FD70=BD<<8C its willingness to play hardball to col- like saga repeating itself on its soil have BRI. Second, China’s support to
LQFUHDVHGULVNRIGHYHORSLQJFRURQDU\KHDUWGLVHDVHDQGVWURNH This island nation has proven to be a litmus test F8C7A460A3C> lect. always kept Bhutan away from China. Pakistan against India’s decision to
,VRODWLRQLVDOVRDVVRFLDWHGZLWKLQFUHDVHGLQFLGHQFHRIPHQWDO for Modi’s foreign policy, especially in terms of =4?0;>C74A However, to undo the damage Despite Beijing’s overtures to abrogate Article 370 and a red carpet
KHDOWKLVVXHVOLNHDQ[LHW\GHSUHVVLRQDQGDVXLFLGDOWHQGHQF\,W finding a friendly ground due to former C70=C741A8 caused in recent years, Modi was Dhaka, India’s ties with Bangladesh welcome to Prime Minister Imran
LQFUHDVHVWKHULVNRIFKURQLFGLVHDVHVVXFKDVGLDEHWHV3HRSOH
Maldivian President Abdulla Yameen’s closeness ?;0C5>A< invited to Sri Lanka this year, 28 years have remained strong and mutually Khan before Xi’s trip to Chennai indi-
ZKRDUHORQHO\DUHDOVRDWKLJKHUULVNRIHDUO\GHDWKDVFRPSDUHG
with China. The political upheaval in the A4;0C8>=B70E4 after former Prime Minister Rajiv beneficial. The recently-concluded cates continuity in Beijing’s strategic
WRSHRSOHZLWKJUHDWHUVRFLDOFRQQHFWLRQV
Maldives caused by the imprisonment of a num- 8<?A>E438=C74 Gandhi’s visit in 1987. From there, visit of Prime Minister Sheikh Hasina cooperation with Pakistan. In such a
ber of political leaders, including former 0A40B>5 Modi sent a strong message to the to New Delhi is a case in point as a situation, China looks weak in its com-
,QIDFWDVWXG\IRXQGWKDWVRFLDOLVRODWLRQDQGOLYLQJ President Mohamed Nasheed, had raised strate- world community that India, along number of important pacts were mitment to fight against global terror-
DORQHERRVWHGWKHFKDQFHRIDSUHPDWXUHGHDWK3RRUFRSLQJPHFK gic and political concerns in India at that time.
B42DA8CH0=3
with its neighbours, would fight ter- signed by the two neighbours. The ism. Third is the ongoing trade deficit
DQLVPVDGGLFWLRQVDQGFRPSXOVLYHEHKDYLRXUDUHIRXQGWREHPRUH The political instability in the Maldives had lim- 8=5A0BCAD2CDA4 rorism by visiting the St Anthony’s growing manufacturing industry in between India and China. In 2018,
FRPPRQDPRQJSHRSOHZKRDUHDORQH$PRQJWKHHOGHUO\ORQH ited India’s options and even though Nasheed 34E4;>?<4=C Church in Kochchikade, where dead- Bangladesh is certainly a promising India’s trade deficit with China
OLQHVVLVDOVRDVVRFLDWHGZLWKLQFUHDVHGFRJQLWLYHGHFOLQHDQGZRUV had called upon New Delhi to intervene, it had ly attacks had killed hundreds of peo- alternative for India away from China. accounted for $57.86 billion and in the
HQLQJRIKHDOWK$FFRUGLQJWRH[SHUWVLQWKHILHOGRIPHQWDOKHDOWK abstained from making any moves in the ple during Easter celebrations. As an In the case of Nepal, China has current year, India’s exports to China
IRUWKRVHEDWWOLQJZLWKWKHIHHOLQJRIEHLQJDORQHWKHUHLVQREHW domestic matters of the island nation. indicator of New Delhi’s growing been treading with caution. While it have declined by 1.62 per cent. Trade
Nasheed had also alleged that Yameen want- clout, Modi also addressed the Sri has failed to formulate a unified South has been a strong point for the two
WHUWKHUDS\WKDQPDLQWDLQLQJWLHVZLWKLPPHGLDWHDQGH[WHQGHG ed to sell land to Beijing for the construction Lankan Parliament during his visit and Asian policy due to its different inter- countries not waging war against each
IDPLO\PHPEHUV of a Chinese base in the Indian Ocean and was became the first Indian Prime Minister ests and equations with each of the other despite ongoing border dis-
:KLOHLWLVGLIILFXOWWRUHYHUVHVRFLDOHYROXWLRQVWHSVFDQEH leading the country into debt by borrowing and only the second foreign leader countries involved, attempts to attract putes over the Line of Actual Control.
WDNHQWRKHOSLQGLYLGXDOVEHWWHUFRSHZLWKEHLQJDORQHDQGILQG money from China for infrastructure projects. after British Premier David Cameron them have been made on a similar note Xi might assure India of a balanced
ZD\VWRVWULNHUHDOIULHQGVKLSV,QWKHFDVHRIFKLOGUHQDQGWHHQDJHUV This had proved to be a critical time for India’s to visit Jaffna in the war-ravaged since the launch of the Belt and Road business as he did at the Wuhan
SDUHQWVQHHGWRVSHQGTXDOLW\WLPHFRQYHUVLQJZLWKWKHLURIIVSULQJ maritime security. However, with the new northern province and hand over Initiative (BRI). Under the initiative, Summit.
0RUHRIWHQWKDQQRWLQWKHLUDPELWLRQWRUDLVHVXSHUDFKLHYLQJ Government coming to power in the Maldives homes built with the help of Indian China managed to bring Nepal on With regard to Nepal, other than
FKLOGUHQPDQ\SDUHQWVWHQGWRORVHRXWRQFXOWLYDWLQJDKXPDQ in 2018 led by democratic President Ibrahim assistance. Continuing India’s attempt board despite initial hesitation in the BRI platform, relations have
FRQQHFWLRQZLWKWKHLU\RXQJ6RWKHNLGVVSHQGWKHHQWLUHGD\ Solih, the two countries have begun a new level to foster a strong relationship with its Kathmandu, which was reflected in the improved in the areas of security and
UXQQLQJIURPVFKRROWRFRDFKLQJDQGDFWLYLW\FODVVHV$WWKHHQG of engagement in the development and maritime neighbours under the “neighborhood last-minute decision by the Himalayan infrastructure development.
sectors. This bonhomie was reflected in first policy,” Modi visited Bhutan for kingdom just before the first BRI Considering the achievements
RIWKHGD\WKHUHLVOLWWOHWLPHOHIWIRUKDYLQJDUHDOFRQYHUVDWLRQ President-elect Solih’s invitation to Modi to the second time in August 2019 and Summit was to take place on May made at the Wuhan Summit that had
ZLWKWKHFKLOG,WLVLPSRUWDQWIRUSDUHQWVWRKDYHDFORVHQRWMXVW attend his swearing-in ceremony. held a comprehensive discussion with 2015. Though at first, cooperation helped India and China normalise
SDUHQWDOEXWIULHQGO\FRQQHFWLRQZLWKWKHLUFKLOGUHQDVGDLO\FRQ The challenges for India have not been lim- Bhutanese Prime Minister Lotay under the initiative proved to be their chaotic relations amid the
YHUVDWLRQVNHHSWKHPLQYHVWHGLQWKHLUJURZLQJXS3DUHQWVPXVW ited to Pakistan and the Maldives only. The Tshering. He pointed out that “Bhutan promising, especially in building the Doklam incident, the two leaders
DOVRHQFRXUDJHFKLOGUHQWRGHYHORSERQGVZLWKH[WHQGHGIDPLO\ increasing Chinese presence in Sri Lanka also has a special place in the heart of 130 trans-Himalayan railway corridor should be able to reaffirm their com-
PHPEHUVRQZKRPWKH\FDQIDOOEDFNXSRQLQWLPHVRIQHHG has New Delhi worried. The Chinese investment crore Indians” as time and again, between China and Nepal and provid- mitments to abide by the “strategic
3HRSOHPXVWJXDUGDJDLQVWWHFKQRORJLFDOO\LQGXFHGORQHOLQHVV in the Hambantota port and using it for strate- India’s friendship with it has stood firm ing access to Chinese ports to Nepal, guidance” issued at Wuhan to
(VSHFLDOO\IRUWKRVHOLYLQJDORQHLWLVDGYLVDEOHQRWWRVHHNH[FHV gic and commercial purposes is a well-account- against all odds. Despite the challenges the feasibility of these projects is still strengthen communication, under-
VLYHFRPIRUWLQWKHLUGLJLWDOGHYLFH,QVWHDGVWHSRXWRIWKHKRXVH ed Chinese debt-trap. After failing to repay the that had emerged during the Doklam in question. standing and trust-building during the
MRLQDFRPPXQLW\RUFXOWXUDORUJDQLVDWLRQDQGPDNHQHZIULHQGV loans taken from Beijing for building the port, dispute with China, the two countries On the other hand, the Chinese upcoming summit. On the other hand,
Sri Lanka leased it to China for 99 years. The managed to keep their relationship Foreign Minister and State Councillor Xi will try to expedite the completion
$OVRJLYHQWKHKHFWLFXUEDQMREFXOWXUHZRUNSODFHVPXVWVWULYH transfer of the port and 15,000 acres of land strong. India’s equation with Bhutan Wang Yi’s visit to Nepal last month saw of Chinese projects in Nepal that
WRRIIHUDEHWWHUZRUNOLIHEDODQFHWRHPSOR\HHVDQGLQVWLWXWHUHJ around it gave China control of territory just a has not only been a success cultural- advancement in Sino-Nepalese have been marred by delays and cor-
XODUDYDLODELOLW\RIDFRXQVHOORUWRKHOSVWDIIFRSHZLWKGLVSODFH few hundred miles off the shores of India and ly and historically but has also result- engagement in various sectors. The ruption.
PHQWDQGLVRODWLRQ a strategic foothold along a critical commercial ed in great cooperation in sectors like agenda of Xi’s impending visit to (The writer is doctoral candidate,
7KHZULWHULVDQH[SHUWLQPHQWDOKHDOWKDQGGLUHFWRURID and military waterway. The Hambantota port hydroelectricity and infrastructure India and Nepal is obvious. One is to Centre for South Asian Studies,
ZHOOQHVVFRPSDQ\ case is one of the most vivid examples of China’s development. Though over the years understand the regional environment Jawaharlal Nehru University)
,QGLDFDQVXUYLYHDSODVWLFEDQ
/TJ[YZX_HUJOKY]UXQOTMGZROMNZTOTMYVKKJNGJIN[XTKJ[VYZGZOYZOIGRXKVUXZYUTNU]GHGTUTYOTMRK[YKVRGYZOIY]U[RJNG\KS[RZOYKIZUXGR
KLLKIZY=UTJKX]N_ZNKYKVGTKRYTK\KXZNU[MNZULHXOTMOTMU[ZXKVUXZYUTNU]YOTMRK[YKVRGYZOIY]KXKIG[YOTMNGXSZUZNKKT\OXUTSKTZ%
single-use plastics are a 2020. Later, that dead- with stakeholders and begin a meaning- what neither the Government nor the cor-
prime threat to the environ- line was revised to ful research on alternatives for plastic pack- porate sector is able to do, bat for the envi-
ment due to the sheer vol- 2022, no doubt under aging. But instead of this, these bodies are ronment with no intention for profit and
umes in which they are used. pressure from indus- now lobbying for further postponing the no strings attached.
And, in the absence of a strict tries who have been up ban. This raises a pertinent question as to Once the people of the country begin
disposal policy and set-up, in arms against the ban. who is batting for the cause of the envi- the movement for a better and cleaner
the accumulation of this This is characteris- ronment? Could industry bodies not have environment, the vested profit-based
toxic substance is spiralling tic of an economy that worked closely with the Government and interests will have to take a backseat. The
beyond belief. puts prosperity ahead of the corporate sector and found a viable Government, too, will have to acknowledge
As a result, not only are environmental well- alternative to plastic till now? that since a clean environment is a basic
;?D1 BA8A09 birds, animals and even being. Industry bodies The Government and the National right of every citizen, it must take priori-
rime Minister Narendra Modi’s aquatic creatures suffering like the Federation of Green Tribunal must pull up these bod- ty over other concerns raised by various
DV_dVid_Rad'URjWR]] 9X^c^RWPaVT%_PXbT\X]
U^aRP[[bc^^cWTa]Tcf^aZb
1DB8=4BB2>A=4A
?:6D?C08B=4F2<3>5=122
=Tf3T[WX) ?:6d_cPcPZTb^eTaPbcWT
2WPXa\P]P\_*<P]PVX]V3XaTRc^a^U
,QGLD¶VUDQNVOLSV
Mittal-led Bharti Airtel came France’s leading Defence of $750 million 5.650 per cent
SODFHVWRWK I
?C8Q ?0A8B its facility to the minister who During the presentation, on the IUC issue while lighted the recent cut in cor- income security with
took a tour of the assembly CEO of the Safran Aircraft announcing a levy of 6 paise porate tax rate as well as the no maturity date that yields a
ndia should provide an line of the company near the Engines Olivier Andries per minute on voice calls made steps taken to improve the steady flow of interest
attractive business environ- French capital. revealed plans for nearly USD to rival phone networks. ease of doing business in India. payments.
ment and not “terrorise us” “Visited the Engine 150 million investment in the Jio has, however, also said
DZ_XRa`cV`_e`a size, India is ranked third, while with its tax and customs rules, Manufacturing Facility of country towards training and it will compensate customers
?C8Q =4F34;7864=4E0
it has got the same rank for
renewable energy regulation.
Besides, India also punch-
the CEO of the French engine
manufacturer behind the
Rafale fighter jet told Defence
Safran at Villaroche near Paris
today. Safran is known for its
engine making capabilities.
maintenance. However, the
CEO called on India for more
support on its tax structure.
for the IUC charge by giving
free data of equal value.
Without naming Jio, Airtel
5%,VD\VQRWR,QGLDEXOOV
ndia has moved down 10
Iannual
es above its development status
when it comes to innovation,
Minister Rajnath Singh on
Wednesday while announcing
They have also developed the
engine for Rafale,” Singh said in
“India is set to become the
third largest commercial mar-
in a statement said, "One of our
competitors has imposed a +RXVLQJ)LQDQFHPHUJHU
ZLWK/DNVKPL9LODV%DQN
places to rank 68th on an which is well ahead of most that the company plans to a tweet. ket for aviation and we are keen rate of 6 paise for all off net calls
global competitiveness emerging economies and on invest nearly USD 150 million “Happy to meet some of to create a strong maintenance made to other operators to
index, largely due to improve- par with several advanced in the country. the young and bright engineers and repair base in India to cover the termination charge of
ments witnessed by several economies, the report said. French multinational of Indian origin working at the serve customers,” Andries said. IUC (Interconnect Usage
other economies, while But, these positive metrics Safran, the manufacturer of the Safran manufacturing facility. “But we need to make sure Charge). ?C8Q =4F34;78 (LVB) cannot be approved,”
Singapore has replaced the US contrast with major shortcom- M88 state-of-the-art engines Their technical knowledge and that the Indian tax and They have gone on to sug- the bank said in a stock
as the world’s most competitive ings in some of the basic fitted in the Rafale jets acquired hard work is impressive and customs system is not teror- gest that TRAI has re-opened n a setback to Indiabulls exchange filing. The bank did
economy.
India, which was ranked
enablers of competitiveness in
case of India, the WEF said,
by India, gave a presentation of inspiring,” he said. rising us,” he said. this issue”. Ibanking
Group’s plans to enter the
space, the Reserve
not cite any reason for rejection
of the merger proposal.
58th in the annual Global while flagging limited ICT Bank on Wednesday rejected The Tamil Nadu-based
Competitiveness Index com-
piled by Geneva-based World
(information, communications
and technology) adoption,
&KLQDYRZVWRPDNH*ZDGDU µ5V>`R\Z_e`#!!SadcReV the proposed merger of
Indiabulls Housing Finance
bank had sought approval for
merger with Indiabulls
Economic Forum (WEF), is
among the worst-performing
poor health conditions and
low healthy life expectancy. PRUHYDOXDEOHWKDQ.DUDFKLE\ YZ\VTfe#Xc`heYZ_#!"'B%¶ with troubled private sector
lender Lakshmi Vilas Bank.
Housing Finance from the RBI
on May 7, 2019. The merger
BRICS nations along with
Brazil (ranked even lower than
The WEF said the healthy
life expectancy, where India has FUHDWLQJMREVLQ\HDUV Mumbai: A new research peak effect on output is com- Speculations were rife
about the fate of the merger,
proposal had received all nec-
essary approvals, but the all-
India at 71st this year). been ranked 109th out of total report co-authored by IMF parable to a roughly 200 basis announced in April this year, important nod from the RBI
Announcing its latest index, the 141 countries surveyed for ?C8Q 8B;0<0103 Gwadar Chairman Zhang chief economist Gita Gopinath point tightening of the mone- after the Reserve Bank of India was pending since May.
the WEF said on Wednesday the index, is one of the short- Baozhong said this on Tuesday claims that the demonetisation tary policy rate based on the (RBI) imposed restrictions on Last month, the bank was
India ranks high in terms of est outside Africa and signifi- he Chinese operators of after the Pakistan government exercise generated a decline in median of estimates reviewed Lakshmi Vilas Bank due to its placed under Prompt
macroeconomic stability and
market size, while its financial
cantly below the South Asian
average.
T Pakistan’s strategic Gwadar
Port and its free zone in the
stamped 23-year income tax
holiday and exemptions of
national economic activity of
roughly 2 percentage points in
in Ramey (2016) of economet-
ric studies of US data,” the
weak financial health.
The regulator’s decision
Corrective Action (PCA)
framework of the RBI due to
sector is relatively deep and sta- Besides, India needs to restive Balochistan province sales tax and customs duties for the fourth quarter of 2016 and research report said. also comes against the back- high level of bad loans, lack of
ble despite the high delinquen- grow its skills base, while its have vowed to make the coastal the Gwadar Port and busi- was equivalent to a 200 basis The Modi government’s drop of both the entities being sufficient capital to manage
cy rate, which contributes to product market efficiency is city the single largest contrib- nesses to be set up at Gwadar point interest rate hike. key argument to justify demon- entangled in legal woes. risks and negative return on
weakening the soundness of its undermined by a lack of trade utor to the country’s national Free Zone, the Express Tribune The Reserve Bank of India etisation was to reduce the use “...This is to inform that RBI assets for two consecutive
banking system. openness and the labour mar- economic output in seven years reported. has since February 2019 deliv- of cash which makes financial vide their letter dated October years.
India is ranked also high at ket is characterised by a lack of by creating 47,000 jobs with “It (issuing of ordinance) is ered a 135 basis point rate cut transaction an expensive affair 9, 2019, informed that the The RBI move came
15th place in terms of corporate worker rights’ protections, new investments worth bil- a turning point for Pakistan’s in order to revive economic but the research report con- application for voluntary amal- amidst the Delhi Police’s
governance, while it is ranked insufficiently developed active lions of dollars, according to a economy and now billions of activity which fell to over a six- cluded that in modern India gamation of lndiabulls Housing Economic Offences Wing reg-
second globally for sharehold- labour market policies and media report. dollars will be invested in year low at 5 per cent during cash continues to serve an Finance Limited and lndiabulls istering a complaint against the
er governance, the WEF study critically low participation of China Overseas Ports Gwadar,” Zhang told the medi- the April-June quarter. essential role in facilitating Commercial Credit Limited board of LVB alleging cheating
showed. In terms of the market women. Holding Company (COPHC) apersons. “The magnitude of the economic activity. IANS with the Lakshmi Vilas Bank and misappropriation of funds.
=4F34;78k C7DAB30H k>2C>14A ! ( \^]Th
(IIHFWVRIJOREDOVORZGRZQPRUHSURQRXQFHGLQ,QGLD,0) D3:Tfed
]V_UZ_XcReVd
?C8Q F0B78=6C>= downward revisions for 2019 Germany, unemployment is at on Friday lowered India’s GDP achieving higher growth over as a crisis where no one is
and 2020. historic lows. Yet across growth estimate for the year to the medium and long-term. immune and everyone has a
he largest emerging market “In 2019, we expect slow- advanced economies, including 6.1 per cent from the earlier fig- “The right reforms in the responsibility to act, she said
T economies like India are
experiencing an even “more
er growth in nearly 90 per cent
of the world. The global econ-
in the US, Japan and especial-
ly the euro area, there is a soft-
ure of 6.9 per cent due to the
on-going period of economic
right sequence could double
the speed at which emerging
one of its priorities was to assist
countries as they reduce carbon
W`c'eYeZ^V
pronounced” effect of the glob- omy is now in a synchronized ening of economic activity, she slowdown. markets and developing emissions and become more
al downturn, new IMF chief slowdown,” Georgieva said on said. Georgieva called for using economies reach the living climate resilient.
Kristalina Georgieva has said, Tuesday in her curtain raiser “In some of the largest monetary policy wisely and standards of the advanced At the current average car-
warning that the global econ- speech for the IMF and World emerging market economies, enhancing financial stability. economies,” Georgieva said. bon price of USD 2 per ton,
omy is witnessing “synchro- Bank’s annual meeting here such as India and Brazil, the “Now is the time for coun- While the need for inter- most people and most compa-
nized slowdown” which will next week. slowdown is even more pro- tries with room in their budgets national cooperation is going nies have little financial incen-
result in slower growth for 90
per cent of the world this year.
The headline numbers
reflect a complex situation, she
nounced this year. In China,
growth is gradually coming
to deploy — or get ready to
deploy — fiscal firepower. In
up, the will to engage is going
down, she rued.
tive to make this transition.
Limiting global warming to a
'HSRVLWVUDWHV ments, we have reduced our
MCLR by 10 bps across all
The Managing Director of
International Monetary Fund
said.
Despite this overall decel-
down from the rapid pace it
saw for many years,” Georgieva
fact, low interest rates may
give some policymakers addi-
“Trade is a case in point.
And yet, we need to work
safe level requires a signifi-
cantly higher carbon price, she GRZQESV tenors,” the bank said in a
statement.
(IMF) pointed out that the eration, close to 40 emerging said. tional money to spend,” she together. From safely adapting added. The bank further said in
widespread deceleration means market and developing The precarious outlook said. to fintech, to fully implement- Bulgarian economist ?C8Q <D<108 view of the adequate liquidity
that growth this year will fall to economies are forecast to have presents challenges for coun- Referring to a new IMF ing the financial regulatory Georgieva was confirmed last in the system, it has also revised
its lowest rate since the begin- real GDP growth rates above 5 tries already facing difficulties research, which shows how reform agenda, to fighting month as Managing Director he State Bank Group on interest rate on savings bank
ning of the decade.
She said the World
per cent — including 19 in sub-
Saharan Africa, the IMF chief
— including some of the Fund’s
programme countries, she
structural reforms can raise
productivity and generate enor-
money laundering and the
financing of terrorism,”
of the IMF, becoming the first
person from an emerging
T Wednesday revised its mar-
ginal cost of funds-based lend-
deposits (with balances up to
C1 lakh) from 3.50 percent to
Economic Outlook to be said. noted. mous economic gains, she said Georgieva said. economy to head the global ing (MCLR) rates by a marginal 3.25 per cent effective
released next week will show In the United States and The Reserve Bank of India these changes are the key to Describing climate Change lender. 10 basis points across all tenors November 1.
but steeply revised down the SBI. Which controls a fifth
1^dabTbc^QTbWdc^] <PZT<hCaX_X]Zb_PRcfXcWCaX_0SeXb^a
pricing on savings deposits of the system, has also slashed
under C1 lakh by a 25 bps to its retail term deposits and bulk
3.25 per cent. term deposits rates by 10 bps
>Rc! SdTc^_^[[b
This is the sixth reduction and 30 bps respectively for one-
in the lending rates by the year to less than two-years
largest lender since April. effective October 10.
?C8Q =4F34;78 MakeMyTrip’s ‘Experiences details of the agreement. riences into their itineraries, While the MCLR reduc- MCLR reduction follows a
?C8Q =4F34;78 and Activities’ section, the In a similar vein, Ganju added. tion is effective October 10, the 25 bps cut in the repo rate by
akeMyTrip on company said in a statement. TripAdvisor’s Countr y MakeMyTrip aims to max- revision in savings bank RBI last week. But the effective
SCRIP OPEN
1,)7<
HIgh LOW LTP CHANGE
%6(
NIFTY 50 11152.95 11321.60 11090.15 11313.30 186.90 Script Open High Low LTP TVSMOTOR 394.15 400.55 388.50 397.05 ABCAPITAL 78.90 81.40 78.15 79.35 TIMKEN 776.00 799.00 758.45 785.75
INDUSINDBK 1241.00 1319.00 1235.60 1309.50 68.45 HDFC 1975.00 2004.90 1963.90 2001.50 EDELWEISS 78.70 78.70 72.20 72.85 SWANENERGY 106.35 106.35 103.75 106.00 MINDAIND 347.00 347.00 333.65 340.45
INFRATEL 246.85 261.00 244.50 259.20 13.15 YESBANK 45.55 45.55 41.05 43.20 DELTACORP 159.55 171.00 157.50 169.40 ADANITRANS 225.10 229.60 221.70 225.30 JKTYRE 67.65 68.55 66.35 68.30
BHARTIARTL 343.10 360.85 339.00 359.40 17.85 SBIN 250.10 262.00 244.35 260.90 GLENMARK 289.90 292.90 281.00 290.40 OMAXE 191.90 191.90 189.60 189.75 TTKPRESTIG 6220.75 6220.75 6055.15 6095.05
SBIN 250.10 262.00 244.35 261.80 12.70 ICICIBANK 418.00 438.40 417.40 436.60 DHFL 28.55 28.70 26.05 26.05 BLUESTARCO 811.00 828.20 803.05 811.90 WABAG 255.00 256.15 246.00 247.40
ULTRACEMCO 3868.00 4061.00 3868.00 4061.00 190.60 TITAN 1200.50 1236.05 1177.75 1229.65 MANAPPURAM 133.30 140.70 133.30 139.95 IDBI 29.25 30.15 28.85 29.85 GUJALKALI 419.65 423.60 400.00 410.10
ICICIBANK 420.25 438.40 417.10 436.50 20.40 RBLBANK 304.00 311.55 280.85 309.75 FEDERALBNK 84.90 86.35 84.05 85.90 INDIANB 118.70 120.00 114.60 117.55 JSL 33.20 35.85 32.65 35.00
M&M 556.00 578.80 550.95 576.90 23.95 IBULHSGFIN 239.95 246.80 232.20 240.30 CONCOR 579.00 579.00 563.25 570.90 ORIENTBANK 56.05 56.60 53.15 54.55 POLYCAB 669.60 674.95 664.65 666.55
TATASTEEL 323.35 338.00 320.35 338.00 13.20 INDUSINDBK 1241.80 1319.80 1236.75 1309.50 NMDC 90.05 97.10 90.05 96.50 HINDZINC 210.00 210.00 203.15 206.85 WELSPUNIND 50.85 50.85 49.10 50.00
GRASIM 650.00 677.90 642.90 675.00 26.00 AUROPHARMA 472.00 485.00 454.20 474.30 UNIONBANK 49.55 51.55 48.30 51.10 OIL 143.60 147.25 143.60 146.30 OFSS 3090.00 3111.50 3032.60 3100.00
CIPLA 408.30 427.00 407.50 423.35 15.10 ZEEL 250.25 257.80 240.70 245.90 NATIONALUM 43.80 46.05 43.75 44.90 RELINFRA 26.05 26.05 24.00 24.30 FINCABLES 365.30 366.35 352.70 359.25
HDFCBANK 1191.00 1230.30 1190.15 1228.50 UPL 581.00 584.45 574.00 581.70 OBEROIRLTY 480.10 503.50 467.40 500.15 NLCINDIA 55.80 55.80 53.50 53.80
BRITANNIA 2971.80 3074.65 2926.90 3060.10 106.75
BAJAJFINSV 8262.00 8345.00 8177.05 8312.55 NESTLEIND 13650.00 13908.40 13600.00 13875.50 PHILIPCARB 111.80 113.00 108.00 111.40 LALPATHLAB 1341.80 1344.55 1313.35 1321.80
KOTAKBANK 1559.30 1627.75 1547.75 1611.00 55.35
PEL 1470.05 1470.05 1330.20 1395.25 IGL 350.70 362.90 350.70 361.05 HSCL 74.45 75.85 73.30 75.25 KANSAINER 493.00 509.80 490.70 500.30
HDFCBANK 1197.10 1229.90 1190.00 1228.20 41.30
TATAMOTORS 118.90 121.60 115.50 120.85 VOLTAS 672.00 685.00 657.85 681.25 DBL 383.50 383.50 370.45 373.10 CENTURYPLY 156.50 167.35 156.50 166.00
BAJFINANCE 3915.00 4035.00 3880.05 4023.95 123.05 RELIANCE 1311.90 1330.00 1293.15 1325.75 SRF 2655.05 2759.95 2648.80 2745.65 EXIDEIND 186.00 191.65 184.25 190.70 PERSISTENT 576.00 582.20 553.00 574.35
TATAMOTORS 118.50 121.70 115.45 120.95 3.45 BAJFINANCE 3924.95 4043.60 3880.00 4025.35 AMBUJACEM 185.00 193.35 184.15 192.35 ENGINERSIN 107.00 109.80 106.60 109.05 WELCORP 122.40 126.70 121.25 126.00
JSWSTEEL 207.30 213.75 205.95 213.30 5.30 TATASTEEL 323.80 338.00 320.30 336.35 UJJIVAN 296.80 305.95 292.10 304.80 HEIDELBERG 186.00 189.75 184.25 185.30 SCHNEIDER 70.25 72.35 69.60 70.20
VEDL 142.00 146.50 141.15 146.20 3.55 M&M 557.00 578.80 551.95 576.10 HCLTECH 1074.20 1074.20 1040.65 1050.90 JINDALSAW 78.75 85.80 77.25 84.90 PARAGMILK 153.15 154.25 150.30 151.80 EIHOTEL 166.95 173.00 165.75 168.05
ASIANPAINT 1725.70 1778.00 1725.70 1767.20 42.05 MARUTI 6621.00 6741.85 6604.80 6721.10 PETRONET 256.45 259.30 255.50 257.45 AIAENG 1675.90 1678.50 1635.10 1643.95 ATUL 3955.00 3958.50 3930.00 3943.75 CERA 2528.40 2543.30 2480.00 2505.25
HINDALCO 182.05 187.15 180.70 186.35 4.05 BPCL 491.45 495.50 482.05 492.75 WIPRO 238.20 239.55 236.50 237.70 BALRAMCHIN 155.30 156.65 150.60 154.30 IPCALAB 875.35 875.40 851.25 863.75 TEJASNET 81.75 84.00 79.45 80.40
LT 1401.00 1433.40 1399.10 1428.00 30.15 AXISBANK 673.80 689.40 664.60 686.30 BEML 939.80 948.90 931.00 934.85 NOCIL 99.50 100.35 95.00 99.20 GUJGAS 175.00 180.00 170.00 174.80 CHOLAHLDNG 465.00 482.90 462.00 476.45
AXISBANK 671.90 689.50 664.30 686.95 13.50 JINDALSTEL 93.75 98.20 92.00 97.55 PFC 94.50 95.95 93.00 94.55 VIPIND 453.30 458.65 450.40 453.35 INOXLEISUR 324.15 327.55 320.00 326.50 ALKEM 1927.75 1949.95 1912.00 1932.10
HDFC 1974.85 2005.00 1964.35 2005.00 35.70 BIRLACORPN 533.25 542.55 525.65 527.65 HAVELLS 665.00 675.35 655.50 671.15 BASF 961.55 1020.00 961.55 996.50 JPASSOCIAT 2.40 2.40 2.25 2.33 FINEORG 1699.10 1748.85 1684.95 1714.75
NESTLEIND 13645.00 13910.00 13510.05 13816.00 212.65 CENTURYTEX 862.50 935.90 862.50 924.60 CHOLAFIN 291.00 298.00 285.05 296.10 CASTROLIND 130.30 133.05 130.25 132.90 TVSSRICHAK 1750.00 1758.80 1706.50 1756.60 LAXMIMACH 3330.00 3330.00 3275.00 3313.35
DRREDDY 2624.75 2676.00 2600.30 2656.20 39.75 ASHOKLEY 64.25 69.75 64.25 69.10 TECHM 705.20 713.50 702.10 711.45 SOBHA 425.00 467.60 405.30 456.55 KALPATPOWR 441.05 452.55 438.45 451.10 GICHSGFIN 139.40 139.40 133.05 137.10
MARUTI 6628.00 6743.80 6590.00 6730.00 100.15 LT 1401.00 1432.50 1399.20 1426.75 ESSELPRO 114.00 116.50 114.00 115.60 HEXAWARE 365.30 365.30 354.00 357.20 PFIZER 3162.60 3187.65 3132.00 3141.95 JCHAC 1900.00 1957.00 1882.25 1916.00
RELIANCE 1308.70 1329.95 1292.50 1328.70 18.60 BANKBARODA 86.55 91.50 86.05 91.05 IBREALEST 43.10 43.10 43.10 43.10 TORNTPHARM 1609.00 1670.35 1609.00 1666.15 GRUH 261.90 264.60 259.20 261.30 EIDPARRY 154.20 156.65 151.00 155.00
TCS 2052.85 2056.70 2015.80 2020.65 TATAMTRDVR 53.25 53.75 51.00 53.50 JUBILANT 474.70 491.20 470.05 483.65 HIMATSEIDE 140.00 142.80 139.00 140.85 JMFINANCIL 70.70 72.70 70.50 71.90
EICHERMOT 17950.05 18300.00 17833.10 18211.90 211.30
KOTAKBANK 1555.00 1626.80 1549.55 1608.30 INDIACEM 81.10 81.90 79.80 81.25 IDFC 31.00 31.40 30.80 31.00 GODREJAGRO 469.10 479.05 467.55 477.80 CRISIL 1309.05 1309.50 1276.10 1289.05
NTPC 116.00 118.00 115.40 117.30 1.35
ONGC 126.70 127.10 123.95 125.95 DABUR 432.95 445.35 431.50 443.25 FRETAIL 379.40 379.95 372.85 375.00 CHENNPETRO 165.00 167.70 164.20 165.20 TIMETECHNO 56.50 57.85 54.00 56.15
ADANIPORTS 396.35 402.85 391.55 399.80 4.55
IDEA 5.19 5.97 5.16 5.84 COLPAL 1465.00 1503.20 1458.50 1498.45 NAVINFLUOR 694.00 705.00 685.65 695.70 MAHLIFE 423.00 436.90 423.00 433.95 KRBL 220.00 220.85 215.00 217.20
SUNPHARMA 378.00 387.75 374.20 384.10 4.20 HATHWAY 19.00 19.75 18.80 19.25
HDFCAMC 2700.00 2798.00 2686.15 2707.05 SCI 39.35 43.00 38.20 42.20 BANDHANBNK 480.15 484.00 471.00 480.55 PGHL 4410.00 4505.00 4369.00 4457.30
POWERGRID 197.50 198.90 195.40 198.45 1.95 IRCON 370.00 370.00 358.00 361.70
JUSTDIAL 601.75 642.55 588.55 628.20 RNAM 279.90 281.90 270.60 273.25 RAIN 85.75 88.00 82.85 86.65 QUESS 461.00 473.90 460.25 470.30
BAJAJFINSV 8279.00 8349.90 8176.00 8300.00 80.00 INDOSTAR 223.90 232.00 209.40 218.10
ESCORTS 601.00 612.50 581.50 607.85 ADANIPORTS 401.80 402.75 391.75 400.20 RAMCOCEM 705.60 709.75 696.15 705.35 MRPL 50.00 50.80 49.30 50.55
GAIL 130.00 132.65 128.40 131.40 1.20 COROMANDEL 408.00 409.20 401.55 404.90
L&TFH 79.70 83.80 78.60 83.45 BOMDYEING 68.85 72.45 68.00 70.50 CARERATING 506.85 524.70 506.85 517.30 RELAXO 496.70 496.70 482.05 490.95
TECHM 702.80 713.90 701.85 711.00 6.20 TATAPOWER 59.00 61.90 58.05 61.45 ADANIGAS 131.50 138.30 131.05 136.25 INDHOTEL 156.00 158.45 153.00 154.05 AEGISLOG 163.40 169.30 160.05 166.60 JAGRAN 60.60 60.60 58.80 58.90
COALINDIA 184.80 186.70 183.00 185.70 1.30 HINDPETRO 308.50 319.55 302.20 314.45 BOSCHLTD 13050.30 13381.25 13016.30 13258.65 MFSL 409.50 417.50 405.45 415.55 DEEPAKFERT 91.20 92.40 88.20 89.80 MAHLOG 350.25 360.45 350.10 360.35
WIPRO 239.25 239.60 236.40 238.00 0.95 DLF 143.50 149.60 138.50 147.50 STRTECH 141.75 144.10 136.20 142.55 BLUEDART 2233.40 2305.00 2200.00 2275.95 JBCHEPHARM 367.00 371.00 357.00 362.50 JSLHISAR 59.80 65.70 59.75 64.60
HINDUNILVR 1950.00 1962.70 1941.25 1947.00 6.95 BRITANNIA 2960.00 3070.85 2929.40 3061.05 POWERGRID 197.85 198.90 195.50 197.45 RCF 44.25 45.70 43.50 44.95 VGUARD 225.00 226.85 224.20 225.75 SREINFRA 8.62 8.70 7.65 8.14
BPCL 490.00 495.75 481.65 491.00 0.35 EQUITAS 102.90 102.90 97.40 100.75 M&MFIN 325.05 334.90 325.00 333.80 KTKBANK 71.70 72.40 71.10 72.05 ISEC 262.00 278.00 261.10 267.25 DCAL 160.10 160.25 153.20 156.95
UPL 581.00 584.60 573.75 580.80 -0.25 TATAELXSI 683.70 683.70 621.10 637.80 MINDTREE 721.50 730.40 714.60 722.05 COFFEEDAY 45.90 45.90 41.90 43.65 THERMAX 1110.00 1148.65 1085.80 1141.30 GILLETTE 7038.00 7045.20 7013.00 7031.80
IOC 147.55 150.00 147.00 148.15 -0.55 SBILIFE 830.00 844.50 825.00 837.90 WHIRLPOOL 1996.30 2072.00 1996.30 2055.40 IBULISL 100.40 100.40 100.40 100.40 TATAMETALI 512.15 534.90 508.00 518.25 MAHABANK 11.08 11.08 10.70 10.80
ONGC 126.45 127.15 123.95 126.00 -0.55 INFY 793.50 796.00 779.00 784.00 SHANKARA 278.45 294.35 266.50 281.70 SANOFI 5810.00 5853.65 5763.25 5776.70 SUPREMEIND 1199.00 1215.00 1192.95 1210.50
BAJAJ-AUTO 2889.00 2915.00 2877.75 2879.50 -12.80 BHARTIARTL 342.90 360.70 339.10 359.25 ABFRL 207.30 209.35 204.95 207.50 TV18BRDCST 22.80 23.00 22.30 22.60 CAPPL 393.90 400.00 392.00 398.50
INFY 795.45 795.90 778.80 783.75 -5.80 NCC 47.45 52.70 46.40 52.20 CHALET 319.25 319.65 315.10 318.00 PGHH 11330.00 11491.00 11282.00 11348.15 NETWORK18 20.10 20.35 19.90 20.30
TCS 2060.00 2060.00 2015.50 2021.90 -25.80 HEG 920.30 933.35 858.00 912.95 JSWENERGY 61.95 63.40 60.00 61.55 BAJAJELEC 380.00 390.00 372.00 375.85 ORIENTELEC 160.05 166.00 158.20 161.90
ITC 251.30 252.20 246.30 247.00 -4.90 SAIL 31.80 32.90 31.30 32.70 AMARAJABAT 684.45 695.00 673.90 693.65 SJVN 24.05 24.05 23.90 23.95 HAL 692.10 706.00 692.05 699.90
HCLTECH 1070.05 1073.95 1040.15 1051.05 -23.35 HEROMOTOCO 2699.00 2699.00 2590.00 2603.80 SUVEN 262.40 267.00 260.00 261.30 AUBANK 652.30 652.60 638.95 641.10 CENTRUM 23.75 24.15 22.80 23.90
CANBK 179.60 185.55 174.40 184.05 RVNL 23.25 23.25 22.60 22.95 ORIENTCEM 88.35 90.45 86.15 88.75 VARROC 439.50 448.20 434.25 443.90
TITAN 1200.00 1236.25 1177.05 1230.40 -28.60
ITC 252.85 252.85 246.50 247.10 VMART 1912.20 1952.20 1912.20 1936.45 TATACOFFEE 74.40 74.40 71.65 73.10 BAJAJHLDNG 3606.00 3625.00 3549.00 3616.40
ZEEL 250.00 258.00 240.70 245.55 -5.95
SUNPHARMA 379.00 387.60 374.40 383.55 GODREJPROP 993.25 1021.00 980.00 996.70 TRIDENT 56.05 56.05 55.10 55.65 KPRMILL 574.00 591.00 522.85 548.85
HEROMOTOCO2680.00 2690.00 2583.00 2599.00 -75.00
MOTHERSUMI 98.00 98.25 96.00 97.20 SUZLON 2.47 2.47 2.24 2.41 CENTRALBK 17.80 17.80 15.55 17.35 PNCINFRA 177.60 178.00 171.10 171.95
YESBANK 45.45 45.45 41.05 43.30 -2.35 GDL 100.00 100.00 95.55 96.70
GRAPHITE 275.00 280.00 255.00 271.70 SHREECEM 17964.30 18526.20 17841.05 18496.20 KAJARIACER 556.45 566.10 554.70 559.10
BEL 105.80 106.60 104.05 105.30 LTTS 1603.00 1605.80 1563.95 1578.15 DCMSHRIRAM 378.00 394.20 375.05 387.30 NBVENTURES 78.50 79.00 76.55 77.95
1,)7<1(;7 MARICO 381.90 385.05 378.20 383.35 CUB 222.50 223.60 218.75 222.05 NESCO 565.20 575.00 558.95 564.90 VSTIND 3680.00 3733.70 3666.15 3732.40
PNB 57.20 58.85 56.30 58.50 JISLJALEQS 17.40 17.40 16.00 16.15 PRESTIGE 273.90 282.00 272.20 278.45 PRSMJOHNSN 76.40 78.45 76.20 78.00
SCRIP OPEN HIgh LOW LTP CHANGE BANKINDIA 60.50 62.15 57.45 61.65 GNFC 191.60 199.50 190.00 198.90 ASTRAZEN 2153.50 2218.00 2130.00 2196.10 UNITEDBNK 7.99 7.99 7.55 7.67
NIFTY NEXT 50 26320.90 26681.25 26169.05 26660.30 365.25 JUBLFOOD 1320.00 1320.00 1251.90 1308.40 FORCEMOT 1080.00 1109.20 1075.00 1091.60 BALMLAWRIE 165.05 169.10 164.80 166.55 SOLARINDS 1120.00 1166.00 1060.05 1093.15
IDEA 5.20 6.00 5.15 5.85 0.70 HINDUNILVR 1942.65 1962.00 1941.40 1947.40 3MINDIA 19500.00 20300.00 19500.00 20202.70 DALBHARAT 784.00 786.80 765.00 770.90 SOMANYCERA 180.00 180.00 174.50 178.05
ASHOKLEY 64.60 69.75 64.45 68.60 4.20 SIEMENS 1481.05 1594.80 1481.05 1588.20 UFLEX 204.90 207.85 204.15 206.15 MHRIL 210.00 215.00 209.80 212.10 THOMASCOOK 142.00 144.95 139.40 144.00
SRTRANSFIN 1064.00 1140.00 1052.00 1128.00 66.05 DMART 1855.00 1871.80 1803.90 1820.10 REPCOHOME 296.40 303.75 293.50 302.85 SKFINDIA 2143.70 2143.70 2080.40 2087.35 ASTERDM 121.00 121.00 115.20 117.05
NMDC 90.00 97.15 90.00 96.25 4.70 SRTRANSFIN 1065.00 1130.00 1052.20 1123.50 RITES 262.30 263.80 259.80 261.00 ZYDUSWELL 1552.15 1583.90 1503.00 1558.15 CCL 235.70 235.70 225.25 229.20
BANKBARODA 86.20 91.60 86.00 91.10 3.85 RAYMOND 560.00 613.00 560.00 601.85 NATCOPHARM 561.15 561.85 549.75 552.80 APLAPOLLO 1301.00 1375.00 1301.00 1358.10 NH 238.00 240.30 234.00 234.00
CADILAHC 226.10 238.90 225.65 237.80 9.85 APOLLOHOSP 1418.00 1431.70 1398.05 1423.80 DEEPAKNI 286.30 295.00 285.10 294.00 BDL 289.95 290.00 284.75 286.70 RATNAMANI 929.00 929.00 920.00 924.35
L&TFH 80.00 83.80 78.60 83.70 3.45 HDFCLIFE 576.20 586.70 573.90 580.40 ITDC 236.00 268.00 236.00 245.75 REDINGTON 109.90 113.00 109.00 110.10 CORPBANK 14.25 14.35 14.05 14.15
SIEMENS 1521.40 1595.00 1515.50 1586.00 64.60 ULTRACEMCO 3876.00 4060.00 3872.80 4041.00 GRANULES 104.50 104.50 101.05 101.60 GEPIL 748.00 750.00 732.55 743.10 FDC 168.05 168.80 165.10 166.15
SHREECEM 17937.70 18539.35 17733.30 18451.50 625.20 VEDL 142.65 146.50 141.40 145.75 FCONSUMER 24.15 24.25 22.60 23.30 SYNGENE 303.85 306.50 300.80 304.70 GET&D 168.00 177.70 167.60 174.35
AMBUJACEM 185.50 193.35 184.10 192.30 6.35 BERGEPAINT 437.85 452.15 432.85 449.80 TATAGLOBAL 273.50 273.50 264.60 269.85 AVANTI 352.00 358.00 344.00 354.95 ALLCARGO 99.70 100.40 98.25 99.60 JKLAKSHMI 291.15 291.15 283.00 286.25
BERGEPAINT 436.50 451.90 432.05 450.00 14.65 STAR 310.75 316.60 288.00 312.85 GMRINFRA 16.40 17.40 16.40 17.30 TRENT 490.00 506.85 480.25 503.05 UCOBANK 12.84 12.90 12.30 12.46 CARBORUNIV 289.05 298.65 286.95 291.25
AUROPHARMA 474.15 485.00 454.15 474.40 14.55 JSWSTEEL 207.70 213.70 206.00 212.85 SUNTECK 405.95 405.95 391.65 402.40 NILKAMAL 1190.00 1190.00 1170.00 1179.20 ASTRAL 1198.95 1198.95 1178.90 1191.10 JSWHL 2750.00 2787.00 2700.00 2784.20
BIOCON 229.00 234.80 223.75 234.50 5.90 BHEL 43.00 43.95 42.35 43.65 BAJAJ-AUTO 2892.00 2913.25 2880.10 2894.95 AJANTPHARM 980.00 989.40 969.00 974.25 ENDURANCE 954.05 975.00 953.25 970.50 IFBIND 651.50 665.70 648.65 663.35
ACC 1430.00 1473.95 1416.45 1469.30 34.20 LUPIN 667.70 684.80 660.00 681.75 GODREJCP 670.65 675.00 658.30 672.45 RADICO 295.30 297.95 292.00 293.45 RCOM 0.75 0.77 0.75 0.77 FLFL 421.15 423.00 408.00 411.60
COLPAL 1462.75 1503.90 1457.40 1499.90 34.65 ADANIGREEN 68.00 74.30 67.50 71.30 PCJEWELLER 32.50 32.60 30.90 31.55 SONATSOFTW 297.00 299.10 282.50 292.55 IOB 10.00 10.45 9.53 9.57 SHK 128.30 129.95 127.05 127.55
LUPIN 664.90 685.00 660.00 683.10 15.50 ASIANPAINT 1723.00 1777.40 1723.00 1773.15 BLISSGVS 105.90 105.90 97.50 102.90 JAMNAAUTO 35.00 36.25 34.90 35.45 GHCL 205.00 211.90 198.95 210.05 HERITGFOOD 356.60 356.65 350.35 352.40
HINDPETRO 307.95 319.80 302.10 314.40 7.05 ADANIPOWER 59.90 61.10 58.40 60.75 BHARATFORG 428.80 438.20 418.90 432.25 CHAMBLFERT 145.00 148.95 144.60 147.10 CGPOWER 14.40 14.48 13.85 14.17 SCHAEFFLER 4125.00 4125.00 4108.00 4117.35
DLF 143.90 149.75 138.35 147.15 3.25 VENKYS 1607.00 1675.50 1588.75 1644.25 GAIL 130.00 133.00 128.55 132.20 ABBOTINDIA 10700.00 11052.10 10650.00 10994.55 RALLIS 164.50 168.60 163.85 168.15 MINDACORP 90.70 90.70 86.40 87.65
IBULHSGFIN 239.00 246.65 232.05 239.45 5.20 ADANIENT 136.00 139.60 134.20 138.95 INFRATEL 246.60 259.80 244.70 255.50 GSKCONS 8320.00 8390.00 8265.00 8348.55 GSPL 209.90 209.90 202.65 206.90 KNRCON 219.00 223.10 216.30 220.50
PNB 57.25 58.80 56.40 58.50 1.25 RAJESHEXPO 671.50 676.75 671.00 672.55 ITI 82.80 87.70 82.15 82.80 CROMPTON 254.05 261.70 252.20 259.15 VBL 612.40 621.80 612.40 618.75 ECLERX 395.00 405.15 385.20 398.90
DABUR 432.80 445.75 431.25 441.65 9.10 IOC 147.80 150.05 147.10 148.15 DCBBANK 177.00 184.80 176.00 184.10 GSFC 74.95 75.50 72.70 75.15 MAHSEAMLES 361.00 363.50 350.80 358.70 ANDHRABANK 16.70 17.00 16.10 16.45
UBL 1254.15 1300.00 1246.00 1280.00 26.25 SPICEJET 119.50 120.00 114.90 117.20 WOCKPHARMA 239.35 243.50 230.00 238.05 INFIBEAM 39.70 40.25 39.30 39.75 TIINDIA 380.10 380.80 372.00 375.10 LINDEINDIA 502.75 514.90 502.75 510.45
PAGEIND 21019.10 21631.45 20888.50 21360.05 341.90 IDFCFIRSTB 37.50 38.75 37.10 38.40 PVR 1792.00 1815.00 1782.00 1799.15 MASFIN 677.00 724.55 669.05 706.90 EMAMILTD 301.45 301.45 297.60 299.20 APLLTD 535.00 543.85 531.00 536.10
BOSCHLTD 13001.10 13441.75 13001.10 13250.30 196.30 BATAINDIA 1681.90 1735.70 1662.30 1723.20 SADBHAV 131.00 134.00 125.40 131.80 PNBHOUSING 553.75 554.05 540.30 547.55 BAJAJCON 239.05 244.55 236.00 242.70 LAKSHVILAS 27.00 27.00 27.00 27.00
OFSS 3070.00 3120.00 3032.00 3120.00 44.85 COALINDIA 185.00 186.60 183.00 185.20 IRB 67.80 68.30 64.75 65.95 GMDCLTD 59.30 59.30 57.60 58.05 IEX 121.50 124.70 120.75 124.00 ZENSARTECH 204.80 206.60 203.40 204.00
HAVELLS 662.75 676.00 655.65 671.75 9.00 EICHERMOT 17990.00 18295.10 17847.75 18236.75 PAGEIND 21025.00 21641.75 20919.00 21514.85 MOTILALOFS 615.00 615.60 580.65 589.70 AKZOINDIA 1872.05 1873.20 1833.70 1853.05 GPPL 82.55 82.80 80.15 81.20
MARICO 379.00 385.05 378.00 383.85 4.60 GRASIM 653.95 677.50 644.70 670.70 CUMMINSIND 563.50 578.00 562.05 568.80 PHOENIXLTD 716.10 716.80 703.25 712.85 MMTC 15.90 15.90 15.30 15.45 GRINDWELL 592.20 602.95 592.15 596.95
SBILIFE 826.00 843.90 826.00 836.60 8.70 IBVENTURES 109.85 109.85 103.30 109.10 UBL 1275.00 1299.55 1246.50 1279.70 GODREJIND 386.05 387.45 381.40 384.25 BAYERCROP 3258.05 3373.40 3258.05 3311.45 MAXINDIA 63.55 66.85 63.45 64.85
BAJAJHLDNG 3590.05 3625.00 3575.00 3624.00 36.40 ICICIPRULI 458.00 458.00 441.95 449.75 RELCAPITAL 22.90 22.90 20.10 21.05 KEC 265.55 269.10 265.00 266.75 IFCI 6.80 6.91 6.75 6.82 SUPRAJIT 180.00 183.70 176.00 180.15
HINDZINC 205.45 208.40 203.00 207.50 2.05 LICHSGFIN 373.15 380.50 363.00 378.35 APOLLOTYRE 164.00 169.80 162.70 168.75 KEI 535.00 535.00 527.00 529.65 SUNDRMFAST 454.00 458.00 451.75 454.50 MAGMA 50.00 50.00 48.90 49.90
MCDOWELL-N 617.30 625.80 612.70 622.50 5.20 ACC 1429.80 1472.85 1417.00 1466.70 BALKRISIND 721.00 735.00 707.50 733.45 COCHINSHIP 330.90 338.40 330.45 335.80 TATAINVEST 797.00 797.50 779.70 793.30 STARCEMENT 92.00 92.00 88.90 90.15
ICICIGI 1157.00 1173.50 1146.35 1168.05 8.90 LTI 1497.00 1510.95 1461.20 1501.05 GODFRYPHLP 936.30 988.00 930.10 970.05 SUDARSCHEM 369.05 386.75 368.00 378.00 NIACL 102.15 102.75 101.30 102.15 SHILPAMED 255.10 270.00 255.10 263.10
HDFCLIFE 575.20 586.75 573.70 579.40 3.95 MGL 900.00 917.90 894.40 912.60 MCX 964.00 970.00 944.50 962.85 FSL 46.05 46.75 45.60 46.50 GICRE 219.00 219.00 209.80 214.50 VTL 872.00 919.40 866.00 905.50
DIVISLAB 1650.55 1655.00 1621.20 1654.00 7.35 INDIGO 1820.00 1820.00 1764.10 1795.80 CANFINHOME 376.70 393.25 376.20 390.70 PIIND 1287.00 1316.20 1286.00 1306.95 EVEREADY 42.30 44.00 42.10 42.75 JYOTHYLAB 159.60 163.15 158.95 159.35
HDFCAMC 2715.00 2798.20 2685.10 2703.00 11.25 RECLTD 124.00 125.80 119.40 125.05 MUTHOOTFIN 671.55 689.50 665.10 685.45 INTELLECT 179.20 183.80 176.40 181.50 TNPL 184.00 184.00 176.40 181.75 INOXWIND 33.80 33.90 31.95 32.30
PFC 94.65 95.95 92.90 95.00 0.35 ABB 1483.00 1507.10 1465.80 1486.85 BBTC 1082.10 1110.35 1074.70 1092.45 J&KBANK 32.30 33.10 31.95 32.20 FINOLEXIND 578.00 584.00 570.00 583.45 DBCORP 141.55 145.40 140.30 141.85
NIACL 102.50 102.80 100.95 102.30 0.35 HINDALCO 182.00 186.95 181.15 186.00 MRF 61143.70 61440.50 60355.00 61125.10 TAKE 101.60 103.80 98.55 100.95 LUXIND 1150.30 1185.00 1131.70 1175.10 APARINDS 515.40 515.40 505.10 515.00
PETRONET 256.65 259.35 255.10 257.25 0.60 CREDITACC 672.75 674.10 647.60 667.20 ICICIGI 1162.45 1174.00 1145.85 1168.10 SOUTHBANK 10.60 10.60 10.34 10.40 WABCOINDIA 6131.00 6190.85 6131.00 6163.05 LAOPALA 170.50 170.55 168.10 168.75
GODREJCP 670.65 675.95 658.00 671.75 1.10 NIITTECH 1380.00 1386.20 1361.95 1371.15 DIVISLAB 1646.00 1654.65 1622.15 1650.75 MEGH 47.10 50.20 47.10 49.85 ADVENZYMES 149.65 151.10 147.55 148.90 ERIS 426.00 428.40 420.00 423.65
BANDHANBNK 482.10 484.40 471.15 480.00 0.45 HONAUT 27505.00 27920.00 27500.00 27793.30 PTC 54.00 55.60 53.20 55.40 VINATIORGA 2197.00 2197.00 2143.20 2165.05 CYIENT 449.00 453.85 445.00 447.85 TCNSBRANDS 723.00 744.60 714.75 740.45
INDIGO 1800.00 1804.00 1763.05 1795.45 0.30 DISHTV 16.90 18.70 16.60 18.40 SPARC 117.00 117.80 113.40 114.30 MPHASIS 950.00 950.00 925.00 929.15 LEMONTREE 56.25 57.00 55.35 55.70 TVTODAY 308.45 314.90 296.95 312.45
PGHH 11400.00 11458.00 11250.00 11300.00 -49.85 BIOCON 229.25 235.00 223.80 233.55 HINDCOPPER 31.70 32.30 28.65 28.95 ALBK 26.60 26.70 25.80 26.50 JKCEMENT 1035.00 1052.40 1027.50 1049.55 LAURUSLABS 345.00 345.00 329.85 331.95
ICICIPRULI 455.90 457.00 441.45 450.00 -2.50 CIPLA 408.55 427.25 408.00 423.50 JAICORPLTD 75.40 76.85 73.80 76.10 SYMPHONY 1283.50 1313.30 1267.00 1296.95 AAVAS 1592.60 1617.00 1592.30 1601.90 GULFOILLUB 860.70 860.70 845.00 855.75
MOTHERSUMI 98.00 98.40 95.80 97.35 -0.75 NAUKRI 2321.55 2420.10 2292.20 2395.55 TATACHEM 577.05 589.65 574.80 588.00 GLAXO 1340.00 1361.00 1335.90 1358.30 SYNDIBANK 25.85 25.85 25.20 25.60 SIS 835.20 857.85 826.80 848.70
CONCOR 576.10 579.50 562.25 568.70 -5.10 PIDILITIND 1370.00 1371.85 1333.80 1336.70 NHPC 23.05 23.10 22.40 22.60 MAHSCOOTER 4467.95 4528.00 4461.40 4517.25 WESTLIFE 318.00 323.00 310.55 315.00 DHANUKA 300.10 315.00 300.10 312.00
NHPC 22.90 23.15 22.40 22.55 -0.30 SUNTV 460.00 473.30 452.70 471.30 CADILAHC 229.00 238.80 226.00 236.50 GESHIP* 291.00 294.00 280.05 292.15 MAHINDCIE 152.65 152.65 147.35 149.65 TRITURBINE 100.00 100.00 100.00 100.00
DMART 1853.85 1869.00 1801.60 1817.00 -30.30 TORNTPOWER 277.85 284.65 277.85 282.85 TEAMLEASE 2976.05 3028.00 2944.80 2996.50 HUDCO 32.50 33.50 32.05 33.15 THYROCARE 496.35 504.00 487.20 500.75 SHOPERSTOP 418.25 418.25 411.30 413.85
PIDILITIND 1371.80 1376.00 1334.00 1334.60 -31.40 DRREDDY 2635.00 2674.50 2600.10 2663.20 HFCL 17.70 17.80 17.20 17.60 GREAVESCOT 135.05 139.85 133.70 136.85 GALAXYSURF 1440.25 1489.15 1440.25 1474.45 SFL 1246.00 1252.35 1230.00 1250.00
GICRE 216.20 220.05 209.55 212.25 -6.25 NBCC 33.50 34.15 32.25 33.85 RPOWER 2.41 2.46 2.30 2.32 MOIL 132.00 134.80 130.10 133.90 ITDCEM 42.05 45.75 42.05 45.20 SHRIRAMCIT 1333.70 1344.00 1320.00 1327.10
PEL 1470.00 1470.00 1328.80 1380.00 -102.55 NTPC 116.50 118.05 115.50 117.35 CEATLTD 927.00 946.45 917.90 937.90 FORTIS 137.50 141.30 137.50 140.05 ASHOKA 98.15 99.25 97.00 97.50 GAYAPROJ 106.70 107.00 105.90 106.05
=4F34;78kC7DAB30H k>2C>14A ! ( f^a[S !
:^aVRTY^V_eac`SV+ HYZeV9`fdVcf]Vd`feT``aVcReZ`_
?C8Q F0B78=6C>=
6;>14
F?Z_cVUdeRWW G8´B=4?0;E8B8C 8_^W;_^W`b_dUcdUbc 3cZeRZ_6Fe`
Y`]U]RdeUZeTY
CA>CC8=6
1HZEOXHSULQWIRU
B;>A34ABA40AA4BC>5
S\Q]_ebV_bbU\UQcU 4G?>;82427845345B42H
dR]RcZVdRecZd\ _VTUdQY^UTQSdYfYcd
3cViZeeR]\dRd 2^[^\Q^)CWT2^[^\Q^7XVW
2^dac^]FTS]TbSPh^aSTaTS
SURMHFWVD\V&KLQD
operating budget of several bil- and Iran.In all, 64 countries 0?Q 7>=6:>=6 wishes.The fate of his appeal European Union on
lion dollars, covering every- owe money to the UN. Also on was not immediately clear. Wednesday agreed to hold last- BHA80:DA3B)!34038=
thing from humanitarian work the list of budget delinquents undreds of masked pro- Leung emerged as one of ditch talks aimed at securing a
to disarmament, but right now,
it’s just trying to make sure its
are Venezuela, North Korea,
South Korea, the Democratic
H testers yelling “Revolution
Now!” crammed the sidewalk
the figureheads of protest in
Hong Kong after 2014’s failed
Brexit deal with just days left to
thrash out an agreement, as
CDA:8B71>A34A0CC02:
1TXadc)CdaZXbWQ^\QPaS\T]c
^]]^acWTPbcBhaXPWPbZX[[TSPc
employees get paid after this Republic of Congo, Israel and Beijing: China on Wednesday The USD 2.75 billion trans- in front of Hong Kong’s High nonviolent demonstrations each side trades accusations of [TPbccf^RXeX[XP]bP:daSXbW
month. How did the world Saudi Arabia. said President Xi Jinping’s Himalayan project under the Court and spilled onto the over Beijing’s decision to a failure to compromise. \X[XcXPbPXS^]FTS]TbSPhPb
body end up more than USD The last country to have forthcoming Nepal visit would controversial Belt and Road street in an impassioned show restrict elections. Brexit Secretary Steve 0]ZPaP[Pd]RWTSPRa^bbQ^aSTa
200 million in the red? The paid up is war-wracked Syria, result in “historic outcomes”, Initiative is considered to be one of support on Wednesday for Among supporters who Barclay will meet his EU coun- PbbPd[c
answer: member states who UN spokesman Stephane including a new blueprint of the most ambitious infra- an activist appealing a six-year gathered outside the hearing terpart Michel Barnier in
have not paid their expected Dujarric said Tuesday at his for the trans-Himalayan con- structure plans ever undertak- prison sentence for his part in was Kenny Lee, 23, who said Brussels on Thursday in an 42D03>AA40384B
contributions, including the US. daily press conference.In a let- nectivity network. en by the Chinese Government a violent nightlong clash Leung “has inspired a lot of attempt to break the impasse 5>A<0BB?A>C4BC
On Tuesday, Secretary- ter sent Monday to the 37,000 Xi will arrive in abroad. Xi’s visit will consolidate with police. Hong Kong people, especially before an October 17-18 sum- @dXc^)4RdPS^a³bRP_XcP[QaPRTS
General Antonio Guterres employees at the UN secre- Kathmandu for an overnight the political foundation for As a prison service bus our young people.” Even jailed, mit. “We’ve put forward serious U^a\Pbb_a^cTbcb^]
warned of the “worst cash cri- tariat, which was obtained by visit on October 12 from China-Nepal bilateral ties and with mesh-covered windows Leung’s activism still resonates proposals and have been willing FTS]TbSPhSTb_XcTcP[Zb
sis facing the United Nations in AFP, Guterres said the UN had Chennai after his informal provide a new blueprint for the drove Edward Leung away after as Hong Kong is again gripped to be flexible. Now it’s time for QTcfTT]cWT6^eTa]\T]cP]S
nearly a decade.” a deficit of USD 230 million as summit with Prime Minister joint development of the BRI the hearing, supporters pressed by protests that started in June the EU to do the same,” Barclay X]SXVT]^db[TPSTabPbP]VTa
He cautioned the UN “runs of the end of September. Narendra Modi. This would be cooperation, Luo said. up against the vehicle, briefly and have snowballed. tweeted. But Barnier appeared U[PaTSP]Tf^eTaPUdT[_aXRT
the risk of depleting its liquid- On Tuesday, he indicated if the first official visit by a He said the two sides will blocking traffic, and held five “He started spreading his more downbeat, playing down WXZTD]X^]bP]S^cWTaVa^d_b
ity reserves by the end of the the world body had not taken Chinese president in the strengthen the BRI cooperation fingers up in their air. idea a few years ago but at hopes of a breakthrough before P]VahPccWT_aXRTaXbTPaT
month and defaulting on pay- initiative to cut spending since Himalayan nation after 23 and accelerate the trans- That symbolises the five that time, not many EU leaders meet, even as he Tg_TRcTSX]cWTbcaTTcb^U@dXc^
ments to staff and vendors.” start of the year, the hole would years. “It is a historic visit. The Himalayan multi-dimensional demands of Hong Kong’s latest people really understood him promised to work around the P[^]VbXSTcW^dbP]Sb^UUPa\Tab
Several member states are have been even bigger in visit will yield historic outcome connectivity network. “The protest movement for univer- and some even criticised him,” clock to the deadline. P]SX]SXVT]^db_T^_[T
behind in their dues payments. October — possibly USD 600 with historic significance and cross-Himalayan multi-con- sal suffrage, amnesty for arrest- said J Sze, a supporter in He said the EU could not
The UN will not publicly million and could have affect- implications,” Chinese Vice nectivity network is taking ed demonstrators and other her 20s. accept Britain’s proposals as CF>:8;;438=
identify those countries, but ed last month’s General Foreign Minister Luo Zhaohui shape,” he said, adding the two they stand, arguing they would B7>>C8=68=64A<0=H
sources told AFP the main Assembly. AFP told a media briefing here. countries are working towards undermine peace and weaken 1Ta[X])0bW^^cX]VTad_cTSX]
expanding border ports, railway, the European single market. cWTTPbcTa]6Ta\P]RXch^U
road, aviation and telecommu- “As I speak to you now, we’re not 7P[[T^]FTS]TbSPh[TPeX]V
nications networks. The BRI on the point of envisioning and cf^_T^_[TSTPSPbcWT
project, critics say, is saddling finding a deal,” he said. Britain bdb_TRcTSPbbPX[P]cbU[TS
nations with debt. India has is due to leave the EU on _^[XRTbPXS
been severely critical of the October 31, more than three
BRI, the pet project of the years after a landmark referen- 4DF0A=B7>BC8;4
Chinese President, as it com- dum that has dominated domes- 2>D=CA84B0A4$6A8B:
prises the USD 60 billion China- tic politics and divided the ;^]S^])CWT4D fPa]TS^]
Pakistan Economic Corridor, nation. British Prime Minister FTS]TbSPhcWPc$6]Tcf^aZb
which passes through Pakistan- Boris Johnson has promised to UPRTPaP]VT^URhQTacWaTPcb
occupied Kashmir. PTI take the country out of the bloc X]R[dSX]VUa^\W^bcX[T
after nearly five decades of inte- R^d]caXTbCWTaT_^acSXS]³c
gration — with or without a ]P\Tb_TRXUXRR^d]caXTb
withdrawal agreement. AFP
=4F34;78kC7DAB30H k>2C>14A ! (
eXePRXch "
B44:4A>57D<0=BC>A84B
3^]]X]VbTeTaP[WPcb^UQTX]VPSXaTRc^aPRc^a_a^SdRTabRaTT]_[PhfaXcTaP]SbX]VTa50A70=0:7C0A
0]d_P\aTRP[[b
BA:´b<PX]7^^]=P WPbQTT]P]X]b_XaPcX^]c^P]T]cXaTVT]TaPcX^]cWa^dVWWXb[PaVTacWP][XUThTcaT[PcPQ[Ta^[Tb7TRW^^bTb
bRaX_cbcWPc\^eTWX\7TcT[[b27070: <8CC0; W^fcWTbc^ah^UCWTBZhXb?X]ZX]b_XaTSWX\PbXc
ETcTaP]PRc^a0=D?0<:74A
caTPcTSBA:bUP]bfXcWPb_TRXP[ _aTbT]cbPUaTbWcPZT^][XUTP]SaT[PcX^]bWX_b
<PX]7^^]=PeXST^
he Sky is Pink, the title of direc- from real life makes it even more spe- er and longer life.”
0]d_P\bWPaTScWPcWTdbTS
BA:bbXV]PcdaT[X]T<PX]7^^]
=PX]WXb0\TaXRP]bW^f=Tf
T tor Shonali Bose’s forthcoming
film, reminds me of my early
school days when I used to paint the sky
cial. In the film, all the scenes actual-
ly did happen. It was great to join
Shonali’s film.”
Self-admittedly, Farhan chooses
roles that are inspirational. Be it the role
of an athlete, fighting from his traumat-
0\bcTaSP\ purple in my colouring books. I imag- The film is a love story of a real- ic past and emerging victorious, in
°3TPaTbcBWPWAdZW ined it to be in my favourite colour as life couple, which is told through the Bhaag Milkha Bhaag, or a vulnerable
:WP]WTaTXb\hcaXQ I didn’t want the sky to be convention- lens of their teenage daughter, Aisha poet who expressed his pain through
ally and literally blue. Little did I Chaudhary, who had succumbed to writing in Zindagi Na Milegi Dobara, or
dcTc^P]Tg_aTb know that this idea would match that pulmonary fibrosis. Despite her suffer- a musician passionate enough to make
bX^]\PST of a filmmaker’s vision. ing, Aisha’s optimistic view towards life his dream come alive in Rock On!!,
UP\^dbQhh^dX] So when I dig deeper and ask became an inspiration for many and every now and then, he has tried to be
^daRX]T\P8 actor Farhan Akhtar the reason, he she delivered several motivational versatile and, in turn, inspired many. He
fPbST[XVWcTSc^ laughs and gives me an “inside speeches before her death at TEDx says, “When I hear or read something,
scoop” and reveals that in the film, Talks. it has to have something humane about
dbT<PX]7^^] the younger version of Ishaan — the So had Farhan heard of Aisha it in order to appeal me. If I read some-
=PX]\h son of Aditi Chaudhary (played by before the film? No. “I had not heard thing and it moves me, inspires me or
0\TaXRP]bTaXTb Priyanka Chopra) and Niren of Aisha or the Chaudhary family until speaks to me in a way that it makes me
=Tf0\bcTaSP\ Chaudhary (played by Farhan) Siddharth (Roy Kapoor, producer) feel things, I want to experience being
— calls his mother, who is in told me that Shonali would like to meet a part of it through the film. It matters
8cXbP[fPhbPY^hc^ London, and tells her how his me for the film. He told me about the most to me.”
QaX]VX]P[Xcc[TQXc^U teacher at school was upset Aisha’s talks, which were available Well, certainly, with so many hats
8]SXPX]\hf^aZ^] with him because he coloured online. I watched a few of them and — that of a director, actor, producer,
cWXbbXST^UcWTf^a[S the sky pink in his drawing. found them incredibly moving. I read screenplay writer and even a singer —
CWP]Zbc^cWTf^] “That’s when Aditi tells him, the script and instantly agreed. I just felt a film could be made with Farhan alone!
‘Don’t let anyone tell you what that I am doing it!” says he. He laughs and wants the question to be
STaUd[RaTPc^abU^a colour your sky should be. If you ³8WPS]^cWTPaS The film revolves around Niren and repeated, “Haanji?” He then says, “No.
h^daVT]Ta^bXchX][Tc want it to be pink, you should paint it ^U0XbWP^acWT Aditi, who, as a couple, are very open A film requires a team. I guess I am very
cX]V\TS^cWPc± pink.’ And that is what the philosophy of and don’t restrict their daughter for fortunate to have been working around
0]d_P\fa^cT the film and the Chaudhary family too is,” 2WPdSWPahUP\X[h anything or cry over the fact that she such people who are sensitive to the fact
says Farhan. This certainly gave meaning to QTU^aT8fPcRWTS is going to die soon. Instead, they that I enjoy doing various things. So
my idea, which was otherwise looked at as enable her to keep her spirits up. whenever I am focussed on one aspect,
flawed, and answered the long-lost query — PUTf^UWTacP[Zb “Aditi and Niren are extremely for example, music or writing or acting,
³4PRW why can’t I paint my sky purple? fWXRWfTaT forward-thinking people but at the I always find people who are support-
cTRW]^[^Vh This is also something that Farhan per- PePX[PQ[T^][X]T same time, they also maintain their ive of it. They are constantly filling in
R^\TbfXcW sonally agrees with and is evident in his
words when he tells us how he finds space P]SU^d]ScWT\
connection with their roots. They are
very family-oriented. They want to stay
spaces that are left vacant while I am
doing something else. I am very thank-
PRWP[[T]VT between his reel and real life as he is always X]RaTSXQ[h connected with each other. This, in a ful for this support structure, it allows
P]SXc surrounded with multiple projects. He way, shows how there are all kinds of me to be me,” says the actor.
\^eX]V8aTPScWT
ST_T]Sb^] says, “I think you always somehow find India and not just one kind of it. An It has been 18 years since Dil
dbW^fc^ time to be able to do things, which you like bRaX_cP]S Indian could be as modern or contem- Chahta Hai, with which Farhan had
to do and think are important. Currently, porary or forward-thinking as much as made his debut as a director. Did he
cPRZ[TcWPc I have this joy of The Sky is Pink releasing X]bcP]c[hPVaTTS´ s/he could be traditional or conserva- sense its cult appeal at the time? He
RWP[[T]VTBP\TcWX]V and also shooting for my next project, tive. That’s also what makes this coun- never imagined it. “When you’re work-
Toofan, which is very interesting. But amid try so amazing,” he says. ing on a project, you put in so much to
X\_[XTbc^=TcU[Xg all this, I do find time to spend with my kids. Farhan was bowled over by the fact it, you don’t know or think how it would
bTaXTbc^^fWXRWWPeT I make space for things which I want to do.” that the duo had such an open turn out to be. It’s only later that
QTT]bTaeX]VP[[ZX]Sb Explaining what drew him to the film, approach to deal with every situation you’re happy and also, surprised, that
Farhan says, “Apart from being a very well- and were “ready to put every possibil- it turned out so well. I am grateful that
^UR^]cT]cc^P[[PVT written and constructed script, the fact that ity into consideration to keep their the audience loved Dil Chahta Hai,” says
RPcTV^aXTbd]PUUTRcTS it is an amazing story of people inspired daughter alive and give her a healthi- he, signing off.
QhP]hRTacXUXRPcX^]
7RQDWXUH
FWX[T^da\^eXTbPaT
VXeT]0DRTacXUXRPcX^]
ST_T]SX]V^]Xcb
ZLWKORYH
R^]cT]cfT]TTSc^
SXbRdbbT[PQ^aPcT[h
cWTR^]cT]cQTX]V
bTaeTS^]=TcU[Xg´
°?aPb^^]9^bWX
3TbXV]TabPc3Ph ^UcWT8]SXP5PbWX^]
FTTZSaPfcWTXaX]b_XaPcX^]Ua^\ePaX^db
bX[W^dTccTbcWPc]PcdaP[[P]SbRP_Tb^UUTa
limate change isn’t just
C becoming the talk for
environment activists. The
debate around plastic ban
and zero-waste policy has
0\TaXRP]bX]VTa=82:9>=0BWPb reached fashion designers
bWPaTSPb_TRXP[_^bcc^R^]VaPc too. Designers at FDCI’s
d[PcTWXbfXUTP]SPRc^a India Fashion Week 2019
?A8H0=:027>?A09>=0B^] focussed on sustainable
development and drew
WTaU^acWR^\X]VUX[\CWTBZh8b inspiration from nature in
?X]Z their designs and motifs.
°CWXbUX[\c^dRWTS\hWTPacX] Designer Amita Gupta
b^\P]hfPhbCWTbc^ahXbQ^[S Sustainable’s collection,
P]SQTPdcXUd[8cWPbQTT]c^[S Prith-WE, attempted sus-
tainability in every step of
_TaUTRc[hcWa^dVWP]X]RaTSXQ[T the way — yarn to yardage
RPbcP]SQhBW^]P[X1^bTbSXaTR until the final garment.
cX^]?aXhP]ZP2W^_aP8P\b^ Using techniques of
_a^dS^Uh^daf^aZPbQ^cWP] Jamdani and Batik, Amita
PRc^aP]S_a^SdRTaX]cWXbUX[\± created a variety of handwo-
ven khadi fabrics and trans-
=XRZfa^cT^]b^RXP[\TSXPP]S lates them into fun, and easy
bWPaTSP_^bcTa^UcWTUX[\ to wear silhouettes.
Promoting the idea of ‘zero
waste’, the collection utilised
1TRZWP\ba^dcT the warp wastage from the
c^WTP[cWh[XUT
looms and converted it into
a range of exclusive gar- come alive. Leftover scrap lection by Ragini Ahuja,
BX]VTaUPbWX^]STbXV]TaE82C>A80 ments. yarns have also been dip- was inspired by various
142:70< bPhbbWTbcPhbWTP[cWh Designer Diksha dyed and used in creating cultures of the world —
Khanna’s collection Pine unique fringe patterns to Persian, Tibetan, Arabic,
QhSaX]ZX]VaTSfX]TP]ScT`dX[P Breeze, on the other hand, depict motion with tran- Uzbek — and recognises
°8cahc^QTaTP[[hWTP[cWh8 took one back to one’s child- quility. itself with the women of
Tg_TRcP[^c^U\hbT[UP]S\h hood memories as she drew There are ivory linen fire, who empower, liberate
Q^Sh8WPeTU^daZXSbP]Sf^aZP inspiration from her days fringe saris, denim jersey and inspire each other to
[^c8TPcUaTbWeTVTcP spent in Almora and paint- kurtas with sheer joggers wander more and build
ed the quaint picturesque set, organic handwoven their own tribe. Ragini
Q[TbUadXcP]SSaX]ZP town nestled in lap of khadi denim, scrap hand used dark colours to
[^c^UfPcTa8P\]^c Himalayas in her designs. distress denim, breezy signify rebellion and
bPhX]V8\]^cUd]8P\ She said, “It is a perfect silk Chanderi, Ahimsa silk strength like deep navy,
Z]^f]c^SaX]ZP escapade from our fast- and handwoven linen. autumnal rust,
UTfcT`dX[PbP]SP paced and mundane city Another collec- mint tea and
life. However, life in the hills tion, Dastaan by beige with slate
UTfaTSfX]TbXcb is slow but calming and Pramaa by blue as accent.
cWPcQP[P]RT beautiful.” Taking inspira- P r a t i m a Through meticu-
F^aZX]V^dcQdc tion from the cool morn- Pandey narrat- lously graphed
P[b^WPeX]VUd] ings, lush green mountains, ed how the label florals and multi-
bX\d[cP]T^db[hXb cobbled pathway steps, array embodies the thread stripes, she
of pine trees, and the nuances and the created her
bd_TaX\_^acP]c± nuances in the local region- shades of the rich designs keeping
bWTbPXS al costumes, her designs Indian hand- in mind a fierce,
CP[ZX]VPQ^dc have been interpreted with loom. Using the defiant and soul-
WTacX_bU^aV^^S new shapes and silhouettes delicate and lux- ful woman. The
bZX]cWTbcPabPXS that fall within the androg- uriously rich silhouettes were
ynous range and are com- Chanderi fabric, relaxed with soft
°3TUX]XcT[hcPZT plemented with nature- Pratima layered it tailoring and vol-
\PZTd_^UUTeTah inspired motifs. Hilly, with opulent umes.
]XVWcQTU^aTQTS uneven pathways are embroider y of Her collec-
dbTPaTP[[hV^^S reimagined with loosely- flora and fauna tion featured
\^XbcdaXbTacWPc pleated denims, patched motifs. Her col- long a-lined
with languid sheer Chanderi lection featured jackets, multi-
f^aZbU^ah^dabZX] layers. Through dramatic classic layered thread saris,
ch_TP]SbcPh tie-dyed ribbed hoodies and kurtas, drapes, h y b r i d
WhSaPcTS± placement shibori panels, saris and dresses. kameez, shirt
she made the sunset skies Quwa, col- and kurtas.
=4F34;78kC7DAB30H k>2C>14A ! (
db_ #
@B?=?D5B?6@5135
8 = B 7 > A C
7RFHOHEUDWHWKHWK3UDNDVKELUWKDQQLYHUVDU\RI*XUX1DQDN'HYML35,73$/6,1*+
3$118&KDLUPDQRI1DWLRQDO,QWHJUDWHG)RUXPRI$UWLVWVDQG$FWLYLVWVRUJDQLVHG*XUX
1DQDN6DGEKDZQD<DWUD LQIRXUSKDVHVRQURXWHVWUDYHOOHGE\KLPWRVSUHDGKLVPHVVDJHRI
KDUPRQ\SHDFHDQGJRRGZLOO
peace but the politics is what
divides them.
7PaX]STa:Pda?aTbXST]c^U=^acWTa]APX[fPhF^\T]FT[UPaT>aVP]XbPcX^]
YHow do you connect with =AFF>P[^]VfXcW3aAT]d:P_^^aBTRaTcPah=AFF>APZWX9PX]
people for your objectives? ?aTbXST]c^U=AFF>3T[WX3XeXbX^]P]S\T\QTab^U=AFF>X]PdVdaPcTS
It’s a continuous process. R^\_[TcTWTP[cWRWTRZd_\PRWX]TPc3A<^UUXRT=Tf3T[WXU^acWTQT]TUXc
Many people volunteer on their ^UaPX[fPhbcPUUST_[^hTSPccWT^UUXRTCWT\PRWX]TRWTRZbWTP[cWeXcP[b°
own. And we ask some of the WTXVWcfTXVWc1<8_d[bTcT\_TaPcdaTPcPR^bc^UC ^][h
people to join us. We have asked
a few people to plant the trees
at various places. Now, we are
doing a follow up on them. We
eputed youth leader, regularly keep a check a on
R philanthropist, trainer
and social activist,
Pritpal Singh Pannu is deeply
them by asking for the number
of trees planted, videos and
photos. We are also connected
committed to improve the with people of different coun-
quality of living for people all tries through social media, who
around the world. He started are interested in our mission.
in his very young age to make This helps us to gather people
palpable differences in the from all across the globe, who
society and guided thousands are interested in spreading love
of youth for a better career and and brotherhood.
life. His qualification gives
him uncanny ability to relate to YHow did the government of
people. A mammoth step in his other countries respond to DccPaPZWP]SXbP]XS^[UX[\c^daXb\STbcX]PcX^]X]8]SXPPbXcaT_[TcT
quest for helping underprivi- your mission? fXcW]PcdaP[RWPa\P]SWPb]d\Ta^dbd]Tg_[^aTSSTbcX]PcX^]b
leged youth was taken when he We did not connect much ATRT]c[hDccPaPZWP]SWPbP[b^QPVVTScWTW^]^da^UQTX]VcWTQTbc
became instrumental in form- with them. Since this is a social UX[\_a^\^cX^]UaXT]S[hbcPcTX]cWTR^d]cah
ing National Integrated Forum work, so we did not wanted to DccPaPZWP]SUX[\_^[XRhWPbTPbTSUX[\bW^^cX]VQhUPRX[XcPcX]V
of Artists and Activists, involve the government. And R[TPaP]RTbcWa^dVWBX]V[TFX]S^fBhbcT\°TgT\_cX^]^]bW^^cX]V
NIFAA, formerly known as we knew that if we would UTTb^]UX[\b\PSTX]cWTbcPcT_a^eXbX^]^UbdQbXSXTb^Ud_c^C!$
National Institute of Fine Arts include them, they will have [PZWU^aaTVX^]P[UX[\bd_c^C $Ra^aTbU^a1^[[hf^^SUX[\bP]S$
Samiti. their separate agenda. So we did _TaRT]cSXbR^d]c^]6<E=P]S:<E=VdTbcW^dbTbSdaX]VcWT
To celebrate 550th Prakash not even take any sponsorship bW^^cX]V_TaX^S
Birth anniversary of Guru from them. The government’s
9ULGKL-DLQFURZQHG
Nanak Dev ji, NIFAA have role was only to provide us with
decided to organise Guru covered. understand the different cul- see as it brings unity and har- Guru Nanak Dev Ji. They said Visa and other local facilities. So
Nanak Sadbhawna Yatra in tures and our neighbouring mony among everybody. I that because the land is of we did not face any problem
four phases on routes travelled YYou have visited Pakistan, countries better. know a Christian, who was Guru Nanak ji, there should be and in fact got immense love
by Guru Nanak Dev ji in his Bangladesh, Nepal and other offered a government job but he a Gurudwara instead of the uni- from them. ridhi Jain, 19-year-old-girl
life time to spread his message
of harmony, peace and good-
countries too. How would you
describe your experience?
YWhile you were on your
trip, you did live from the
refused it and he chose to pro-
vide his service to the
versity. And they won the case.
But then the people took advan- YYour next trip is to the Arab
Vcrowned
from New Delhi, was
as Miss Teen India
will among all. Guru Nanak The trip to Bangladesh and Gurudwara. There were peo- Gurudwara. There are some tage of the 1971 fight and killed countries. Provide us with a Universe 2019 by the
Dev Ji, the great social Nepal was great. In Pakistan ple from all religions. What Muslim families, too, who serve both of them. Later, the gov- deeper insight into this. Chairman of the Glamanand
reformer and humanitarian too, the people were very wel- would you say about such a the Gurudwara. I can clearly ernment acquired the land. A Yes, we have planned to go group, Nikhil Anand, at Miss
travelled more than 40,000 coming. As I spoke to them, it positive sight? recall an incident when a Sikh part of it was given to the to the Arab countries. We want- Teen International India 2019
miles during his four Udasis in was evident in their attitude Yes, there were people from and a Muslim together fought Gurudwara, where now stands ed to go to Saudi Arabia but finale held at Jaibagh
all four directions. Apart from how they desire peace. But almost all the religions. The a case for the Gurudwara’s land Nanak Shahi Gurudwara. unfortunately, they don’t allow Palace in Jaipur recent-
giving his message, NIFAA somehow, people are not able to population of Sikhs is very less in Kolkata High Court. But the However, to sum up my jour- non-muslims to Mecca. So we ly.
have planned to plant 55,000 portray their real emotions. there so the other communities, Dhaka University in ney, I would say that during my are sending two of our Muslim She will now be
saplings at 100 important Overall, the trip was a great too, take care of the Gurudwara, Bangladesh is made on that trip, I felt that the citizens of friends there. I will go to Iraq representing India in
places throughout the routes experience and it made me which is something so good to land, which was named after every country want love and and Afghanistan. Mexico at Miss Teen
Universe 2019 which is
4eP[dPcX^]^U8208`dP[XUXRPcX^]QhD:=0A82
going to held from
November 1 to 7. Her cos-
tume is being designed by
Anu Solanki. She did her
schooling from St.
Thomas School, Mandir
he Institute of Chartered benchmarking, CA Prafulla P Marg, New Delhi. And is
T Accountants of India (ICAI) has
always strived for academic and pro-
Chhajed, President ICAI, said, “The
benchmarking of the CA qualification
now doing her gradua-
tion in Banking and
fessional excellence for its key stake- is comparable to RQF Level 7, Master’s Insurance from Maharaja
holders — students and members. degree standard. It would not only Surajmal Institute, New
With the aim of expanding the oppor- strengthen the position of ICAI mem- Delhi. A Management stu-
tunities for professionals in foreign bers but would also help aspiring CAs, dent by profession, Vridhi is
jurisdictions, the Institute had engaged corporates to gain a better under- also a trained Kathak and
UK NARIC (The National standing on the relevance and stand- Bharatnatyam classical dancer,
Recognition Information Centre for ing of the CA qualification.” she likes to carve her ideas
the United Kingdom), a renowned UK He further added that ICAI mem- through poetry. Her hobbies
national agency responsible for pro- bers are facing difficulty in settling are to swim and skate.
viding information and expert opin- abroad. This evaluation would help In 2018, she won the Miss
ion on qualifications and skills world- them in deciding the stage of a pro- Teen India pageant and was
wide to conduct an independent fessional qualification for ICAI mem- the 1st runner’s up. Vridhi
benchmarking study, evaluating the bers because now they know that has keen interest in being an
comparability of the ICAI they not only possess a profession- IAS officer in future. The
Intermediate and Final level in the al qualification of relevance very congenial Miss Teen
context of the UK and UAE education but a qualification that is India World is focussed
systems. comparable to RQF and is never seen
Speaking on the UK NARIC Level 7. beating the bush.
B7>CB58A43B7>CB<8BB43
he Union Territory of Jammu and
T Kashmir has been a top news trend
with the sudden revocation of Article
370. Numerous petitions have been filed
before the Supreme Court criticising the
development so much that Ranjan Gogoi,
the present Chief Justice of India, hint-
ed he would visit the Valley to assess mer-
DXUbUS_e\T^_dXQfURUU^Q^iceRcdYdedUd_dXUS_^cU^d_VdXU<UWYc\QdYfU1ccU]R\i_V:Q]]e;QcX]YbgXUbU
its himself. In such times of political tur-
bulence, creating waves in the geo-polit-
dXUQ``\YSQRY\Ydi_V1bdYS\U#' gQcS_^SUb^UTcQicQTf_SQdU>9C8381I1>971=4U\XY8YWX3_ebd
ical, regional and territorial dynamics of there. On the other hand, India, although matter of the repeal of the Article. Since unilateral control of the territory. Instrument of Accession, signed by
the UT, almost every strata of the soci- a country with no official religion, chose the Constituent Assembly did not make Unfortunately, this breach of mutual bona Maharaja Hari Singh, declares that the
ety had an opinion about it. For many it to adopt a democratic form of gover- such a recommendation before its disso- fide has opened fresh gateway to enter- State could not be compelled to accept
was another trending topic to create nance where political rulers would be lution in 1957, Article 370 has taken on tain the “theory of Deeming Fiction”, thus any future Constitution of India, i.e. nei-
memes while for some it was a matter of elected by direct voting. Hence Maharaja the features of a “permanent provision” resulting in a one-sided decision-making ther India nor the State of Jammu and
nationalism and courage. In this whole Hari Singh feared being thrown out of despite being titled a temporary provi- authority. Kashmir can unilaterally amend or abro-
exercise of decoding Article 370, many power since Jammu & Kashmir was a sion in the Constitution. The present government has made gate Article 370, except in accordance
chose to be lawyers, by taking both sides Muslim-dominated state. Being stuck in On April 3, 2018, the Supreme Court way for future government and leaders with the terms of the Article 370, com-
of the equation. I will try to be rational. a “cliff and fire” situation, the Maharaja of India gave a similar opinion declaring to entertain possibilities and outcomes plying all the provisions contained in it.
When the rulers of the princely prioritised self-interest over and above that Article 370 had acquired a perma- which may not be desired by the people Art370(3): Notwithstanding any-
states were asked to accede to any one of public interest, creating a political earth- nent status. It stated that since the State of India. It further creates a situation thing in the foregoing provisions of this
the two dominions — India or Pakistan quake of statelessness and an abyss for Constituent Assembly had ceased to where, by arm-twisting the sensitive article, the President may, by public noti-
— by signing the Instrument of generations to suffer. exist, the President of India would not be states, one can ensure monopoly. With fication, declare that this article shall
Accession, nobody could have imagined On plain reading, the Constitution of able to fulfill the mandatory provisions past instances of unfair practices by polit- cease to be operative or shall be opera-
a third option to the situation, i.e. con- Jammu & Kashmir had focussed how the required for its abrogation. Subsequently, ical parties and coalitions at the Centre, tive only with such exceptions and mod-
ducting a plebiscite to determine which last man to provide a representation for via the presidential order 2019, proviso examples being the misuse of Article 356 ifications and from such date as he may
way they would go. Before continuing state of Jammu and Kashmir in times of to clause (3) of article 370 of the (State Emergency) and Governor’s role in specify.
further, a quick digression towards failure of the Constitutional machinery Constitution, the expression “Constituent forming State Governments, this too, Provided that the recommendation of
Alighieri Dante, the renowned Italian would be the Governor, duly aided by the Assembly of the State referred to in clause runs antithetical to democracy. the Legislative Assembly of the State
poet, shall be helpful in setting the cor- Cabinet Ministers of the Legislative (2)” was replaced with “Legislative Article 92 of the Constitution of referred to in clause (2) shall be neces-
rect backdrop. In his famous work, The Assembly of the State. In situations of Assembly of the State”, thus allowing fresh Jammu & Kashmir and Article 370 of the sary before the President issues such a
Divine Comedy, Dante described a close President’s rule, the “theory of Deeming power to the elected legislature of the Constitution of India clearly show the notification.
reflection of hell with his famous design Fiction” would come into play, allowing state to give assent to the Governor, for legislative intent of the framers that the Such bullish approach to single
— a funnel-shaped structure with layers the Parliament to discharge the functions “abrogating, repealing and amending” the last word on sovereignty of Jammu handedly crushing the immunity provi-
depicting stages of hell. In describing so, of the State Assembly of Jammu and effectiveness of Article 370. &Kashmir vests with its people i.e. the sion of the state’s sovereignty is a clever
Dante quoted, “The darkest places in hell Kashmir. However, on arriving at this In the case of Mohd Maqbool Legislative Assembly of Jammu and solution bypassing the prescribed solu-
are reserved for those who maintain their stage, a mischief was played which made the parties to the dispute, leaving scope Damnoo vs State of Jammu and Kashmir Kashmir. In the light of recent develop- tion. In my opinion, there could not have
neutrality in the times of moral crisis.” way for the Government of India to uni- for only one possible solution, i.e. the [(1972) 1 SCC 536] the petitioner chal- ments, it would be criminal to ignore the been any substitute to the consent of the
The fate of Jammu and Kashmir, a place laterally outlaw the Constitutional temporary status of Article 370 shall be lenged the constitutionality of inter- difference in the words “under Article Legislative Assembly of Jammu &
attributed to be heaven on earth, was Sovereignty of the State of Jammu and revoked only after being approved by the preting and replacing the Sadar-i-Riyasat 370” and “on Article 370.” While in the Kashmir, in the case where the applica-
sealed when Maharaja Hari Singh main- Kashmir. It cannot be the case that the Government of Jammu & Kashmir, rep- with the Governor of the state. The former case, the President can pursue bility of the Article 370 of the
tained a state of neutrality on the anticipation of framers never reached this resented through its Constituent Supreme Court of India held that the unilateral decisions under Article 370, the Constitution of India was concerned.
Instrument of Accession in 1947. In what possibility of mischievous unilateral Assembly. However, in October 2015, the “Governor is the successor to the Sadar- latter does not allow the President, act- Such manufactured acceptance by the
could be tagged as the perfect political shift in power towards the Union of High Court of Jammu and Kashmir ruled e-Riyasat and is able to give the State ing in the shoes of Sadar-e-Riyasat of the Parliament, followed by the resolution
oxymoron, the situation before Maharaja India. that Article 370 cannot be “abrogated, Government’s concurrence to any State, to iron out the very legality of passed by the President, issued under
Hari Singh was nothing close to what To end the confusion, at the time of repealed or even amended.” It explained amendments under Article 370.” With Article 370. This would completely frus- Article 370(3) rendering all clauses of
other rulers had faced. Since Pakistan was introducing Article 370 and framing the that the clause (3) of the Article conferred removal of the last firewall, no special sta- trate the pious agreement of sovereign- Article 370 inoperative does not reflect
a Muslim country, Maharaja Hari Singh, Constitution of Jammu & Kashmir, power to the State’s Constituent Assembly tus condition was left to be entertained, ty noted in the Instrument of Accession the will of the people of Jammu &
being a Hindu ruler, feared for his life framers assumed a bona fide from both to recommend to the President on the allowing the President of India to be in dated October 26, 1947. Clause 7 of this Kashmir.
=4F 34;78kC7DAB30H k>2C>14A ! ( b_^ac $
=^_[PRTU^aaPRXb\
05?Q ;>=3>=
BX]SWdcPaVTcbC^Zh^6^[S
?C8QC78ADE0=0=C70?DA0< hope to get a gold,” she told the roar-
ing crowd of students and youngsters.
GQbbY_bcbUQSXd_`
_V@;<dQR\U
:_UZRVjVdVcZVdhcRa
0fPhCTbcfX]b
bW^d[SQTPfPaSTS
S^dQ[T_^X]cb):^W[X
0UcTaQXVfX]X] bcCTbcEXaPc2^cda]?d]Tc^\PX]cPX]_TaUTRcCTbcRWP\_X^]bWX_aTR^aS ?C8Q ?D=4
?C8Q ?D=4
9^TYQfc C_edX1VbYSQ Bumrah was hardly missed despite his
phenomenal presence in red ball crick-
ndia captain Virat Kohli on Wednesday proposed
IChampionship
that points for an away victory in the World Test
mproving on near perfection would <YfUVb_])*# Q]9CD et over the last 18 months. should be doubled while reiterating
.XOGHHSNQRZV B0_PRTabRP][TPa]Ua^\BWP\X)5PU
ZK\KHKDVEHHQ ?C8Q ?D=4
GURSSHG.RKOL
younger South African fast angles of the crease and how does he there could be a change in the play- Du Plessis was part of the Proteas
can learn a lot from Indian reverse the ball. So yeah there’s def- ing XI, going into the next Test side that was whipped by India in
pacer Mohammed Shami as to initely something to learn from.” match. 2015 during a Nagpur Test which was
how one can be so devastating What Du Plessis found fascinat- “For me, it is about picking the over within two and half days. In fact,
in home con- ing was the intensity with which team, trying to find guys that can win the Nagpur pitch was later rated
?C8Q ?D=4 flexible but as I said it can't be ditions. Shami bowled on the fifth day. you matches. So we’ve to find out “poor” by the ICC.
possible if the team doesn’t buy Shami “There’s a huge intensity about who are the guys that can pick 20 "With the Test championship, it
ndia captain Virat Kohli is into it. The guys have bought bowled a his bowling. You are going to bowl wickets and who are the guys that can has changed. Even in South Africa,
I“bought”
happy that his team has
into the philosophy of
into it,” said Kohli, who has lost
only one Test (vs Australia at
lethal spell
on the fifth
short spells in the heat but when you
bowl you have to ensure that you
put up their hands and score runs.
“Obviously, we didn’t get 20
if you had a below-average pitch, you
probably got a warning whereas
“selfless attitude” and “flexible Pune in 2017) at home as the day in bowl with a lot of intensity and max- wickets in the previous match and now, you have points deducted,” he
thinking” which has led to a Indian captain. Visakhapatnam imize it,” the Proteas skipper said. that is something we are trying to fix said.
transformed Mohammed Talking about Shami, the that went a long There is in fact a lot to learn from and get better at in this match. End “From the home conditions point
Shami and an aware Kuldeep skipper once again spoke about way in India win- the lengths he bowled, reckons Du of the day, that’s what wins you test of view, I think it is not as obvious as
Yadav. how Shami’s ability to get ning the first Test by Plessis. match. Our thinking will be to pick making wickets like the one in 2015.
From an injury prone tal- movement off the pitch makes 203 runs. “He’s a guy that hits the stumps players that will influence the game Knowing Indian conditions, the turf
ent to the most potent seam him deadly even on the most “I spoke to one of a lot. That’s something from a bowl- and win matches for the team.” is a little more red, so I expect the ball
bowler on flat decks, according unsuitable surfaces for fast our young bowlers too and said to ing point of view, we have to make In 2017, Pune Test witnessed a to spin a little more than the first Test.
to the skipper, Shami's journey bowling. him that it’s a good learning oppor- sure, we are better at. In the first rank turner where India lost (vs “We’ll have to see how the pitch
has been nothing short of fas- “I think on the pitches we tunity for you to sit and watch what innings especially, we bowled wide Australia) its last home game in the behaves. I am not a pitch expert but
cinating. play, I don't see anyone with so someone does when they’re on top and therefore they scored frequent- longer version in recent times. I think it'll take more turn than the
“Now, he (Shami) is taking much seam movement apart of their game in home conditions,” ly square of the wicket. So there are However, Du Plessis insisted first Test.”
the responsibility. We don’t from him (Shami),” the skipper
need to push Shami anymore. said.
7PeTc^QTRPaTUd[PQ^dc1d\aPWbf^aZ[^PS)BWPbcaX ?d]XP_^fTab8]SXPc^S^\X]PcX]VfX]
We don’t need to tell him What makes Shami stand
‘come on, you need to bowl this apart is his ability to do it reg-
spell for us’. He wants the ball, ularly when situations look
he understands the situation hopeless. ?C8Q E03>30A0 Goswami (3/33), Shikha chance to play her
when he’s given the ball,” Kohli “He is someone who can 80=BQ ?D=4 because he plays all three man is cut out for that role. Pandey (2/38), Ekta maiden ODI after star
said on the eve of the second change the complexion of the formats,” Shastri was quot- “I would hate to see a ebutant Priya Bisht (2/8) and Poonam opener Mandhana was
Test here on Wednesday.
If Shami is at one end of
match totally when you don’t
see it coming. His skill is obvi- “C oncerned” about his
injury, head coach
ed as saying by The Hindu
in an interview.
player of his quality sitting
in the reserves. In the
D Punia starred in
injured Smriti
Yadav (2/33) sharing
the bulk of the wickets.
ruled out on the eve of
the game due to a frac-
the spectrum, there is young ously there for everyone to see. Ravi Shastri has said that Bumrah is out with a West Indies I was very Mandhana’s absence India cantered to ture on her right toe.
chinaman Kuldeep, who must Especially, in the second the Indian team needs to stress fracture and is cur- clear that he should open following a fine bowling victory in 41.4 overs The 23-year-old from
be wondering where he has innings, when the situations are be careful about Jasprit rently in the UK to consult and had a chat with Kohli performance to set up with openers Punia (75 Jaipur hit eight bound-
gone wrong after having picked difficult he comes in and does Bumrah’s workload man- specialists. While Bumrah about it. This was his India’s emphatic eight- not out off 124) and aries.
up five wickets in the last Test the job everytime. It’s great,” agement as the ace pacer has already been ruled out opportunity. wicket win over South Jeminah Rodrigues (55 Rodrigues was back
that he played (against said Kohli. plays in all three formats. till the Bangladesh series “Opening is about the Africa in the first ODI off 65) laying the foun- among runs after a lean
Australia at Sydney). Players accepting responsi- “Ver y concerned. in November, the team mindset. You got to here on Wednesday. dation for a resounding run in the preceding
The skipper said that even bilities at different stages of the Because he is precious, management doesn’t want respect the new ball. A lot South Africa strug- win. The three-match five-match T20 series
Kuldeep knows the reason why game is something that has special, different, and a to take any chance and will of guys in India should gled with the bat after series is not part of the and shared an 83-run
he is not in the Test eleven. “amazed”the captain. match-winner. They are consult the best. have opened in the last 20 winning the toss, Women's ODI stand with Punia. It was
“No one is self-centered taking opinions on Shastri also spoke on years for the sake of team bowled out for 164 in Championship. a second ODI half-cen-
and everyone is thinking about whether he needs surgery. Rohit Sharma opening the balance, but they didn’t 45.1 overs. It was an all- Punia, who has tury for the highly tal-
what I can do for the team. It’s We have to be careful batting in test cricket and have the stomach for it round bowling effort played three T20 ented 19-year-old, who
the same about Kuldeep. He about his workload said the star Mumbai bats- Shastri said." from India with Jhulan Internationals, got the smashed seven fours.
understands that in India,
:Q]e^Q<_f\Y^QbUQSXaeQbdUbc
Ashwin and Jadeja will be our
first choices because they give ?C8Q D;0=D34ADBB80
us so much more with the bat
as well.” ast edition’s bronze-winner
In the past few years, the
Indian team management has
L Lovlina Borgohain (69kg)
and debutant Jamuna Boro
often changed their (54kg) on Wednesday nals on Thursday, Boro will mother worked as a vegetable Borgohain had last laugh with
combinations marched into the quarter- take on Germany’s Ursula seller to financially support counter-attacks, which were
going into finals of the World Gottlob, who upstaged her sporting aspirations, is a more effective in garnering
successive Women’s B oxing European Championship gold-winner from this year’s scoring punches.
Tests and Championships with bronze-medallist and fourth India Open. She was a bronze- “It wasn’t particularly
skipper Kohli comprehensive vic- seed Yuliya Apanasovich of medallist at the 2015 Youth tough for me. I think I fought
wants every- tories in the pre- Belarus in her pre-quarterfi- World Championships. just the way I had planned and
one to see the quarters here. nal bout in a split 3-2 verdict. “I was a bit confused to I am hopeful of continuing
results and B oro out- The referee mistakenly raised start with but then I figured this form in the quarters too,”
understand why punched fifth- Apanasovich’s hand at the end how to push her and managed Borgohain said.
it has been done. seeded Algerian of the fight but later correct- to pull off a victory,” Boro said. In all, five Indians have
“Lot has been Ouidad Sfouh, ed himself. The last bout of the first made the quarterfinals of the
spoken and said an African Next up for Borgohain is session featured Borgohain mega-event.
about the system that Games gold- sixth-seeded Karolina and she also took time to find Six-time champion and
we have followed over medallist, in a Koszewska, who defeated her rhythm against Ahbib. third seed M C Mary Kom
the last two years. The unanimous ver- Uzbekistan’s Shakhnoza What was striking about (51kg), Manju Rani (48kg)
only thing that matters to us is dict, while the third- Yunusova. Borgohain’s gameplan was her and Kavita Chahal (+81kg) are
wanting to win as many games seeded Borgohain got Poland’s Koszewska had resolve to keep distance from the other Indians to have
as we can and have been able the better of a spright- claimed a Gold medal at this However, she became the ter impression with her clean- Ahbib, who tried her best to made the last-eight stage.
to do that,” said Kohli. ly opponent in year’s European Games. dominating aggressor as the ly-struck straight punches. draw the Indian in with Chahal is yet to take the
“We have the least losing Morocco's Oumayma Boro opened the proceed- bout progressed. The third round belonged aggressive posturing. ring and has got direct entry
percentage in the last three Bel Ahbib, also a 5-0 ings for India and the 22-year- During an engaging battle entirely to Boro with Sfouh The Moroccan did suc- into the quarters thanks to the
years and there is a good rea- win. old Assam Rifles’ employee in the second and third round, coming short for most part. ceed in flinging her arms for small size of the draw in her
son for that. We obviously are In the quarterfi- was slow off the blocks. it was Boro who made a bet- The Assamese, whose a few impactful jabs but weight category.