Você está na página 1de 338

8QLYHUVLGDGH

  )HGHUDOGR5LRGH-DQHLUR
 Ì1',&(
Ì1',&(

LÍNGUA PORTUGUESA
Compreensão e interpretação de textos verbais e não verbais. Análise de discursos no
plano das relações entre Linguagem, Comunicação e Sociedade. . . . . . . . . . . . . . . . . . .1

Produção e recepção textuais nas práticas sociais. Usos da linguagem. . . . . . . . . . . . . . .6

Reconhecimento crítico das linguagens como elementos integradores dos sistemas


e processos de comunicação. Elementos da Comunicação. . . . . . . . . . . . . . . . . . . . . . . .9

Variedades linguísticas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .19

Gêneros e Tipologia textuais e seus elementos constituintes. . . . . . . . . . . . . . . . . . . . . .21

Coesão e coerência textuais. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .32

Equivalência e transformação de estruturas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .40

Relações de sinonímia e antonímia. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .42

Classe e emprego de palavras. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .42

Frase, oração e período. Período composto (coordenação e subordinação). . . . . . . . . .50

Regência nominal e verbal. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .61

Concordância nominal e verbal. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64

Colocação pronominal. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .67

Ortografia, acentuação gráfica e pontuação. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .69


Ì1',&( 8QLYHUVLGDGH
 )HGHUDOGR5LRGH-DQHLUR
 Ì1',&(

/(*,6/$d®2
/HL)HGHUDOQž                                       
//HL)HGHUDOQž
'HFUHWR)HGHUDOQž                                   
/'HFUHWR)HGHUDOQž
'HFUHWRQž                                         
/'HFUHWRQž
/HL)HGHUDOQž                                       
//HL)HGHUDOQž
/HL)HGHUDOQž                                       
//HL)HGHUDOQž
&RQVWLWXLomR)HGHUDOGH
/&RQVWLWXLomR)HGHUDOGH
7tWXOR,                                                     
7tWXOR,,                                                    
7tWXOR,,,
ÚFDStWXOR,                                                 
ÚFDStWXOR9,, 6Ho}HV,H,,                                    
7tWXOR9,,,FDStWXOR,,, 6HomR,                                 
3ULQFtSLRV&RQVWLWXFLRQDLV([SOtFLWRV                               
/3ULQFtSLRV&RQVWLWXFLRQDLV([SOtFLWRV
3ULQFtSLRV&RQVWLWXFLRQDLV,PSOtFLWRV                               
/3ULQFtSLRV&RQVWLWXFLRQDLV,PSOtFLWRV
$GPLQLVWUDomR3~EOLFD'LUHWDH,QGLUHWD                            
/$GPLQLVWUDomR3~EOLFD'LUHWDH,QGLUHWD

37(67(6FRP  

(VWD$SRVWLODIRLHODERUDGDULJRURVDPHQWHGHDFRUGRFRPR3URJUDPD2ILFLDOGR&RQFXUVR
(VWD$SRVWLODIRLHODERUDGDULJRURVDPHQWH
ULJRURVDPHQWHGHDFRUGRFRPR3URJUDPD2ILFLDOGR&RQFXUVR
'DWDGD(GLomR
2VVtPERORVHPEOHPDVGLVWLQWLYRVHGHQRPLQDo}HVXWLOL]DGRVVmRPHUDPHQWHLOXVWUDWLYRVQmRVLJQLILFDQGRDSRLR
FRODERUDomRDXWRUL]DomRRXDERQRGDUHVSHFWLYD(QWLGDGH 
HVyIRUDPHPSUHJDGRVSDUDEHPLGHQWLILFDUR&RQFXUVRDTXHVHUHIHUHHVWD$SRVWLOD
8QLYHUVLGDGH
  )HGHUDOGR5LRGH-DQHLUR
 Ì1',&(
Ì1',&(

NOÇÕES DE INFORMÁTICA
Conceitos e principais comandos e funções de sistemas operacionais. . . . . . . . . . . . . . . .1

Noções de aplicativos de edição de textos e planilhas. . . . . . . . . . . . . . . . . . . . . . . . . . . .9

Conceitos de Internet, Intranet e Extranet. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .30

Noções básicas de tecnologias, ferramentas, aplicativos e procedimentos


associados à Internet e Intranet. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .30

Noções de segurança e proteção. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37

Conceitos básicos e utilização de ferramentas e aplicativos de navegação . . . . . . . . . . .45

Correio eletrônico . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .57

Bateria de Testes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .68


Ì1',&( 8QLYHUVLGDGH
 )HGHUDOGR5LRGH-DQHLUR
 Ì1',&(

RACIOCÍNIO LÓGICO
Estruturas lógicas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1

Lógica de argumentação. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10

Diagramas lógicos. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .8

Princípios de contagem e probabilidade. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .24

Operações com conjuntos. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .30

Razão e proporção. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .42

Regra de três simples e composta. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .52

Cálculos com porcentagem. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .55

Juros simples e compostos . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58

CONHECIMENTOS ESPECÍFICOS
Sistema Nacional de Regulação - SISREG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1

Sistema Estadual de Regulação - SER. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1

Núcleo Integrado de Regulação - NIR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4

Legislação do SUS. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4

Questões . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .13
LÍNGUA PORTUGUESA
Contexto – um texto é constituído por diversas frases. Em
cada uma delas, há uma certa informação que a faz ligar-se
com a anterior e/ou com a posterior, criando condições para a
estruturação do conteúdo a ser transmitido. A essa interligação
dá-se o nome de contexto.

Intertexto - comumente, os textos apresentam referências


diretas ou indiretas a outros autores através de citações. Esse
tipo de recurso denomina-se intertexto.

Interpretação de Texto - o primeiro objetivo de uma


interpretação de um texto é a identificação de sua ideia
Compreensão e interpretação de textos principal. A partir daí, localizam-se as ideias secundárias, ou
verbais e não verbais. Análise de fundamentações, as argumentações, ou explicações, que levem
discursos no plano das relações entre ao esclarecimento das questões apresentadas na prova.
Linguagem, Comunicação e Sociedade.
Normalmente, numa prova, o candidato é convidado a:

Identificar - é reconhecer os elementos fundamentais


Apreensão e Compreensão do texto de uma argumentação, de um processo, de uma época (neste
caso, procuram-se os verbos e os advérbios, os quais definem
Apreensão - conceito: o entendimento do texto fica o tempo).
restrito aos limites físicos. Para entendermos a informação não Comparar - é descobrir as relações de semelhança ou de
recorremos às informações externas. diferenças entre as situações do texto.
Comentar - é relacionar o conteúdo apresentado com uma
Compreensão - conceito: fazemos confronto de sentidos realidade, opinando a respeito.
com o texto lido e outros elementos produzidos anteriormente Resumir - é concentrar as ideias centrais e/ou secundárias
no texto. Para um bom entendidmento há o uso de elementos em um só parágrafo.
adicionais. Parafrasear - é reescrever o texto com outras palavras.
Apreensão + Compreensão = Entendimento do texto
Condições Básicas para Interpretar
Para ler e entender um texto é preciso atingir dois níveis de
leitura: informativa e de reconhecimento. Faz-se necessário:
A primeira deve ser feita cuidadosamente por ser o primeiro - Conhecimento Histórico – literário (escolas e gêneros
contato com o texto, extraindo-se informações e se preparando literários, estrutura do texto), leitura e prática;
para a leitura interpretativa. Durante a interpretação grife - Conhecimento gramatical, estilístico (qualidades do texto)
palavras-chave, passagens importantes; tente ligar uma palavra e semântico; Na semântica (significado das palavras) incluem-
à ideia central de cada parágrafo. se: homônimos e parônimos, denotação e conotação, sinonímia
A última fase de interpretação concentra-se nas perguntas e antonímia, polissemia, figuras de linguagem, entre outros.
e opções de respostas. Marque palavras como não, exceto, - Capacidade de observação e de síntese e
respectivamente, etc., pois fazem diferença na escolha adequada. - Capacidade de raciocínio.
Retorne ao texto mesmo que pareça ser perda de tempo.
Leia a frase anterior e posterior para ter ideia do sentido global Algumas dicas para interpretar um texto:
proposto pelo autor. - O autor escreveu com uma intenção - tentar descobrir qual
Um texto para ser compreendido deve apresentar ideias é, qual é a chave.
seletas e organizadas, através dos parágrafos que é composto - Leia todo o texto uma primeira vez de forma despreocupada
pela ideia central, argumentação e/ou desenvolvimento e a - assim você verá apenas os aspectos superficiais primeiro.
conclusão do texto. - Na segunda leitura observe os detalhes, visualize em sua
A alusão histórica serve para dividir o texto em pontos mente o cenário, os personagens - Quanto mais real for a leitura
menores, tendo em vista os diversos enfoques. na sua mente, mais fácil será para interpretar o texto.
Uma das partes bem distintas do parágrafo é o tópico frasal, - Duvide do(a) autor(a), leia as entrelinhas, perceba o que
ou seja, a ideia central extraída de maneira clara e resumida. o(a) autor(a) te diz sem escrever no texto.
Atentando-se para a ideia principal de cada parágrafo, - Não tenha medo de opinar - Já vi terem medo de dizer o
asseguramos um caminho que nos levará à compreensão do que achavam e a resposta estaria correta se tivessem dito.
texto. - Visualize vários caminhos, várias opções e interpretações,
O ato de escrever toma de empréstimo uma série de palavras só não viaje muito na interpretação. Veja os caminhos apontados
e expressões amarrando, conectando uma palavra uma oração, pela escrita do(a) autor(a). Apegue-se aos caminhos que lhe
uma ideia à outra. O texto precisa ser coeso e coerente. são mostrados.
- Identifique as características físicas e psicológicas dos
Interpretação personagens - Se um determinado personagem tem como
característica ser mentiroso, por exemplo, o que ele diz no
A interpretação é o alargamento dos horizontes. E esse texto poderá ser mentira não é mesmo? Analisar e identificar os
alargamento acontece justamente quando há leitura. personagens são pontos necessários para uma boa interpretação
Texto – é um conjunto de ideias organizadas e relacionadas de texto.
entre si, formando um todo significativo capaz de produzir - Observe a linguagem, o tempo e espaço, a sequência dos
interação comunicativa (capacidade de codificar e decodificar). acontecimentos, o feedback, conta muito na hora de interpretar.

1
LÍNGUA PORTUGUESA
- Analise os acontecimentos de acordo com a época do institucional semelhante ao nosso ou que ostente igual conjunto
texto - É importante que você saiba ou pesquise sobre a época de atribuições.
narrada no texto, assim, certas contradições ou estranhamentos Do ponto de vista da localização institucional, há grande
vistos por você podem ser apenas a cultura da época sendo diversidade de situações no que se refere aos Ministérios
demonstrada. Públicos dos demais países da América Latina. Encontra-se, por
- Leia quantas vezes achar que deve - Não entendeu? Leia exemplo, Ministério Público dependente do Poder Judiciário
de novo. Nem todo dia estamos concentrados e a rapidez na na Costa Rica, na Colômbia e, no Paraguai, e ligado ao Poder
leitura vem com o hábito. Executivo, no México e no Uruguai.
Constata-se, entretanto, que, apesar da maior extensão de
Para ler e entender um texto é preciso atingir dois níveis de obrigações do Ministério Público brasileiro, a relação entre o
leitura: Informativa e de reconhecimento; número de integrantes da instituição e a população é uma das
mais desfavoráveis no quadro latino-americano. De fato, dados
Seguem algumas dicas para você analisar, compreender e recentes indicam que, no Brasil, com 4,2 promotores para cada
interpretar com mais proficiência. 100 mil habitantes, há uma situação de clara desvantagem
- Crie o hábito da leitura e o gosto por ela. Quando nós no que diz respeito ao número relativo de integrantes. No
passamos a gostar de algo, compreendemos melhor seu Panamá, por exemplo, o número é de 15,3 promotores para
funcionamento. Nesse caso, as palavras tornam-se familiares a cada cem mil habitantes; na Guatemala, de 6,9; no Paraguai,
nós mesmos. Não se deixe levar pela falsa impressão de que ler de 5,9; na Bolívia, de 4,5. Em situação semelhante ou ainda
não faz diferença. Também não se intimide caso alguém diga mais crítica do que o Brasil, estão, (l.11) por exemplo, o Peru,
que você lê porcaria. Leia tudo que tenha vontade, pois com com 3,0; a Argentina, com 2,9; e, por fim, o Equador, com a
o tempo você se tornará mais seleto e perceberá que algumas mais baixa relação: 2,4. É correto dizer que há nações (l.12)
leituras foram superficiais e, às vezes, até ridículas. Porém elas proporcionalmente com menos promotores que o Brasil. No
foram o ponto de partida e o estímulo para se chegar a uma entanto, as atribuições do Ministério Público brasileiro são
leitura mais refinada. Existe tempo para cada tempo de nossas muito mais (l.13) extensas do que as dos Ministérios Públicos
vidas. desses países.
- Seja curioso, investigue as palavras que circulam em seu
meio. Maria Tereza Sadek. A construção de um novo Ministério
- Aumente seu vocabulário e sua cultura. Além da leitura, um Públicoresolutivo. Internet: <https://aplicacao.mp.mg.gov.br>
bom exercício para ampliar o léxico é fazer palavras cruzadas. (l.11) – linha 11 no texto original
- Faça exercícios de sinônimos e antônimos. (l.12) – linha 12 no texto original
- Leia verdadeiramente. (l.13) – linha 13 no texto original
- Leia algumas vezes o texto, pois a primeira impressão pode
ser falsa. É preciso paciência para ler outras vezes. Antes de Julgue os itens seguintes com (C) quando a afirmativa
responder as questões, retorne ao texto para sanar as dúvidas. estiver Correta e com (E) quando a afirmativa estiver Errada.
- Atenção ao que se pede. Às vezes a interpretação está Itens relativos às ideias e a aspectos linguísticos do texto acima.
voltada a uma linha do texto e por isso você deve voltar ao
parágrafo para localizar o que se afirma. Outras vezes, a 01. Os dados expostos no terceiro parágrafo indicam que os
questão está voltada à ideia geral do texto. profissionais do Ministério Público brasileiro são mais eficientes
- Fique atento a leituras de texto de todas as áreas do que os dos órgãos equivalentes nos demais países da América
conhecimento, porque algumas perguntas extrapolam ao que do Sul.
está escrito.
02. Com base nos dados apresentados no texto, é correto
Tome cuidado com as vírgulas. Veja por exemplo a diferença concluir que a situação do Brasil, no que diz respeito ao número
de sentido nas frases a seguir. de promotores existentes no Ministério Público por habitante,
- Só, o Diego da M110 fez o trabalho de artes. está pior que a da Guatemala, mas melhor que a do Peru.
- Só o Diego da M110 fez o trabalho de artes.
- Os alunos dedicados passaram no vestibular. 03. Seriam mantidas a coerência e a correção gramatical
- Os alunos, dedicados, passaram no vestibular. do texto se, feitos os devidos ajustes nas iniciais maiúsculas e
- Marcão, canta Garçom, de Reginaldo Rossi. minúsculas, o período “É correto (...) o Brasil” (l.11-12) fosse
- Marcão canta Garçom, de Reginaldo Rossi. iniciado com um vocábulo de valor conclusivo, como logo, por
conseguinte, assim ou porquanto, seguido de vírgula.
Explicações:
- Diego fez sozinho o trabalho de artes. 04. O objetivo do texto é provar que o número total de
- Apenas o Diego fez o trabalho de artes. promotores no Brasil é menor que na maioria dos países da
- Havia, nesse caso, alunos dedicados e não dedicados e, América Latina.
passaram no vestibular, somente, os que se dedicaram, restringindo
o grupo de alunos. 05. No primeiro período do terceiro parágrafo, é
- Nesse outro caso, todos os alunos eram dedicados. estabelecido contraste entre a maior extensão das obrigações do
- Marcão é chamado para cantar. Ministério Público brasileiro, em comparação com as de órgãos
- Marcão pratica a ação de cantar. equivalentes em outros países, e o número de promotores em
relação à população do país, o que evidencia situação oposta à
Questões que se poderia esperar.

Se considerarmos o panorama internacional, perceberemos 06. No último período do texto, a palavra “atribuições” está
que o Ministério Público brasileiro é singular. Em nenhum subentendida logo após o vocábulo “as” (l.13), que poderia ser
outro país, há um Ministério Público que apresente perfil substituído por aquelas, sem prejuízo para a correção do texto.

2
LÍNGUA PORTUGUESA
07. Seriam mantidas a correção gramatical e a coerência (B) comercialização de uma prática que consiste no
do texto se o primeiro parágrafo fosse assim reescrito: Quando pagamento a uma pessoa para que ela fique em seu lugar em
se examina o contexto internacional, concluímos que não uma fila. O autor do texto discorda desse posicionamento de
há situação como a do Brasil no que se refere a existência e Sandel.
desempenho do Ministério Público. (C) criação de uma legislação que normatize a venda de
vagas de uma fila de uma pessoa a outra. O autor do texto
Leia o texto para responder às questões de números 08 a discorda desse posicionamento de Sandel.
10. (D) falta de incentivo para que a pessoa fique em uma vaga
e, posteriormente, comercialize-a com quem precise. O autor
A ética da fila do texto discorda desse posicionamento de Sandel.
SÃO PAULO – Escritórios da avenida Faria Lima, em São (E) falta de legislação específica no que se refere à venda de
Paulo, estão contratando flanelinhas para estacionar os carros uma vaga de uma pessoa que ficou em uma fila guardando lugar
de seus profissionais nas ruas das imediações. O custo mensal a outra. O autor do texto concorda com esse posicionamento de
fica bem abaixo do de um estacionamento regular. Imaginando Sandel.
que os guardadores não violem nenhuma lei nem regra de
trânsito, utilizar seus serviços seria o equivalente de pagar 10. Nas considerações de Sandel, o dinheiro
alguém para ficar na fila em seu lugar. Isso é ético? (A) cria caminhos alternativos para ações eficientes,
Como não resisto aos apelos do utilitarismo, não vejo minimizando as diferenças sociais e resguardando as
grandes problemas nesse tipo de acerto. Ele não prejudica instituições.
ninguém e deixa pelo menos duas pessoas mais felizes (quem (B) anda por diversos caminhos para ser eficiente,
evitou a espera e o sujeito que recebeu para ficar parado). Mas rechaçando as diferenças sociais e preservando as instituições.
é claro que nem todo o mundo pensa assim. (C) está na base dos caminhos eficientes, visando combater
Michael Sandel, em “O que o Dinheiro Não Compra”, levanta as diferenças sociais e a corrupção das instituições.
bons argumentos contra a prática. Para o professor de Harvard, (D) é eficiente e abre caminhos, mas reforça as desigualdades
dublês de fila, ao forçar que o critério de distribuição de vagas sociais e corrompe as instituições.
deixe de ser a ordem de chegada para tornar-se monetário, (E) percorre vários caminhos sem ser eficiente, pois deixa
acabam corrompendo as instituições. de lado as desigualdades sociais e a corrupção das instituições.
Diferentes bens são repartidos segundo diferentes regras.
Num leilão, o que vale é o maior lance, mas no cinema Respostas
prepondera a fila. Universidades tendem a oferecer vagas 01. E (Afirmativa Errada) / 02. C (Afirmativa
com base no mérito, já prontos-socorros ordenam tudo pela Correta) / 03. E (Afirmativa Errada) / 04. E
gravidade. O problema com o dinheiro é que ele é eficiente (Afirmativa Errada)/ 05. C (Afirmativa Correta) / 06.
demais. Sempre que entra por alguma fresta, logo se sobrepõe C (Afirmativa Correta) / 07. E (Afirmativa Errada) /
a critérios alternativos e o resultado final é uma sociedade na 08. B / 09. B/ 10. D
qual as diferenças entre ricos e pobres se tornam cada vez mais
acentuadas. Discurso Direto, Indireto e Indireto Livre
Não discordo do diagnóstico, mas vejo dificuldades. Para
começar, os argumentos de Sandel também recomendam a Num texto, as personagens falam, conversam entre si,
expõem ideias. Quando o narrador conta o que elas disseram,
proibição da prostituição e da barriga de aluguel, por exemplo,
insere na narrativa uma fala que não é de sua autoria, cita o
que me parecem atividades legítimas. Mais importante, para discurso alheio. Há três maneiras principais de reproduzir a
opor-se à destruição de valores ocasionada pela monetização, fala das personagens: o discurso direto, o discurso indireto e o
em muitos casos é preciso eleger um padrão universal a ser discurso indireto livre.
preservado, o que exige a criação de uma espécie de moral
oficial – e isso é para lá de problemático. Discurso Direto
(Hélio Schwartsman, A ética da fila. Folha de S.Paulo)
“Longe do olhos...”
08. Em sua argumentação, Hélio Schwartsman revela-se
(A) perturbado com a situação das grandes cidades, onde - Meu pai! Disse João Aguiar com um tom de ressentimento
que fez pasmar o comendador.
se acabam criando situações perversas à maioria dos cidadãos.
- Que é? Perguntou este.
(B) favorável aos guardadores de vagas nas filas, uma João Aguiar não respondeu. O comendador arrugou a testa
vez que o pacto entre as partes traduz-se em resultados que e interrogou o roto mudo do filho. Não leu, mais adivinhou
satisfazem a ambas. alguma coisa desastrosa; desastrosa, entenda-se, para os cálculos
(C) preocupado com os profissionais dos escritórios da Faria conjunto-políticos ou políticos-conjugais, como melhor nome haja.
Lima, que acabam sendo explorados pelos flanelinhas. - Dar-se-á caso que... começou a dizer comendador.
(D) indignado com a exploração sofrida pelos flanelinhas, - Que eu namore? Interrompeu galhofeiramente o filho.
que fazem trabalho semelhante ao dos estacionamentos e
recebem menos. Machado de Assis. Contos. 26ª Ed. São Paulo, Ática, 2002,
(E) indiferente às necessidades dos guardadores de vagas p. 43.
O narrador introduz a fala das personagens, um pai e um
nas filas, pois eles priorizam vantagens econômicas frente às
filho, e, em seguida, como quem passa a palavra a elas e as deixa
necessidades alheias. falar. Vemos que as partes introdutórias pertencem ao narrador
(por exemplo, disse João Aguiar com um tom de ressentimento
09. Ao citar Michael Sandel, o autor reproduz desse que faz pasmar o comendador) e as falas, às personagens, (por
professor uma ideia contrária à exemplo, Meu pai!).
(A) venda de uma vaga de uma pessoa a outra, sendo que O discurso direto é o expediente de citação do discurso
aquela ficou na fila com intenção comercial. O autor do texto alheio pela qual o narrador introduz o discurso do outro e,
concorda com esse posicionamento de Sandel. depois, reproduz literalmente a fala dele.

3
LÍNGUA PORTUGUESA
As marcas do discurso são: Ela me perguntou quem estava lá.

- A fala das personagens é, de princípio, anunciada por As interjeições e os vocativos do discurso direto desaparecem
um verbo (disse e interrompeu no caso do filho e perguntou no discurso indireto ou tem seu valor semântico explicitado,
e começou a dizer no caso do pai) denominado “verbo de isto é, traduz-se o significado que elas expressam.
dizer” (como: recrutar, retorquir, afirmar, declarar e outros do
mesmo tipo), que pode vir antes, no meio ou depois da fala das O papagaio disse: Oh! Lá vem a raposa.
personagens (no nosso caso, veio depois); O papagaio disse admirado (explicitação do valor
- A fala das personagens aparece nitidamente separada da semântico da interjeição oh!) que ao longe vinha a raposa.
fala do narrador, por aspas, dois pontos, travessão ou vírgula;
- Os pronomes pessoais, os tempos verbais e as palavras Se o discurso citado (fala da personagem) comporta um “eu”
que indicam espaço e tempo (por exemplo, pronomes ou um “tu” que não se encontram entre as pessoas do discurso
demonstrativos e advérbios de lugar e de tempo) são usados em citante (fala do narrador), eles são convertidos num “ele”, se o
relação à pessoa da personagem, ao momento em que ela fala discurso citado contém um “aqui” não corresponde ao lugar em
diz “eu”, o espaço em que ela se encontra é o aqui e o tempo que foi proferido o discurso citante, ele é convertido num “lá”.
em que fala é o agora.
Pedro disse lá em Paris: - Aqui eu me sinto bem.
Discurso Indireto
Eu (pessoa do discurso citado que não se encontra no
Observemos um fragmento do mesmo conto de Machado discurso citante) converte-se em ele; aqui (espaço do discurso
de Assis: citado que é diferente do lugar em que foi proferido o discurso
citante) transforma-se em lá:
“Um dia, Serafina recebeu uma carta de Tavares dizendo- - Pedro disse que lá ele se sentia bem.
lhe que não voltaria mais à casa de seu pai, por este lhe haver
mostrado má cara nas últimas vezes que ele lá estivera.” Se a pessoa do discurso citado, isto é, da fala da personagem
Idem. Ibidem, p. 48. (eu, tu, ele) tem um correspondente no discurso citante, ela
ocupa o estatuto que tem nesse último.
Nesse caso o narrador para citar que Tavares disse a
Serafina, usa o outro procedimento: não reproduz literalmente Maria declarou-me: - Eu te amo.
as palavras de Tavares, mas comunica, com suas palavras, o
que a personagem diz. A fala de Tavares não chega ao leitor O “te” do discurso citado corresponde ao “me” do citante.
diretamente, mas por via indireta, isto é, por meio das palavras Por isso, “te” passa a “me”:
do narrador. Por essa razão, esse expediente é chamado discurso
indireto. - Maria declarou-me que me amava.
As principais marcas do discurso indireto são:
No que se refere aos tempos, o mais comum é o que o verbo
- As falas das personagens também vêm introduzidas por de dizer esteja no presente ou no pretérito perfeito. Quando o
um verbo de dizer; verbo de dizer estiver no presente e o da fala da personagem
- As falas das personagens constituem oração subordinada estiver no presente, pretérito ou futuro do presente, os tempos
substantiva objetiva direta do verbo de dizer e, portanto, são mantêm-se na passagem do discurso direto para o indireto. Se
separadas da fala do narrador por uma partícula introdutória o verbo de dizer estiver no pretérito perfeito, as alterações que
normalmente “que” ou “se”; ocorrerão na fala da personagem são as seguintes:
- Os pronomes pessoais, os tempos verbais e as palavras
que indicam espaço e tempo (como pronomes demonstrativos
Discurso Direto – Discurso Indireto
e advérbios de lugar e de tempo) são usados em relação ao
narrador, ao momento em que ele fala e ao espaço em que está. Presente – Pretérito Imperfeito
Pretérito Perfeito – Pretérito mais-que-perfeito
Passagem do Discurso Direto para o Discurso
Indireto Futuro do Presente – Futuro do Pretérito

Pedro disse: Joaquim disse: - Compro tudo isso.


- Eu estarei aqui amanhã. - Joaquim disse que comprava tudo isso.

No discurso direto, o personagem Pedro diz “eu”; o “aqui” é Joaquim disse: - Comprei tudo isso.
o lugar em que a personagem está; “amanhã” é o dia seguinte - Joaquim disse que comprara tudo isso.
ao que ele fala. Se passarmos essa frase para o discurso indireto
ficará assim: Joaquim disse: - Comprarei tudo isso.
- Joaquim disse que compraria tudo isso.
Pedro disse que estaria lá no dia seguinte.
Discurso Indireto Livre
No discurso indireto, o “eu” passa a ele porque á alguém
de quem o narrador fala; estaria é futuro do pretérito: é um “(...) No dia seguinte Fabiano voltou à cidade, mas ao fechar
tempo relacionado ao pretérito da fala do narrador (disse), e o negócio notou que as operações de Sinhá Vitória, como de
não ao presente da fala do personagem, como estarei; lá é o costume, diferiam das do patrão. Reclamou e obteve a explicação
espaço em que a personagem (e não o narrador) havia de estar; habitual: a diferença era proveniente de juros.
no dia seguinte é o dia que vem após o momento da fala da Não se conformou: devia haver engano. Ele era bruto, sim
personagem designada por ele. senhor, via-se perfeitamente que era bruto, mas a mulher tinha
Na passagem do discurso direto para o indireto, deve- miolo. Com certeza havia um erro no papel do branco. Não se
se observar as frases que no discurso direto tem as formas descobriu o erro, e Fabiano perdeu os estribos. Passar a vida
interrogativas, exclamativa ou imperativa convertem-se, no inteira assim no toco, entregando o que era dele de mão beijada!
discurso indireto, em orações declarativas. Estava direito aquilo? Trabalhar como negro e nunca arranjar
carta de alforria!”
Ela me perguntou: quem está ai?

4
LÍNGUA PORTUGUESA
Graciliano Ramos. Vidas secas. como ele diz as coisas. Por isso é a forma preferida nos textos
28ª Ed. São Paulo, Martins, 1971, p. 136. de natureza filosófica, científica, política, etc., quando se expõe
as opiniões dos outros com finalidade de criticá-las, rejeitá-las
Nesse texto, duas vozes estão misturadas: a do narrador e a ou acolhê-las.
de Fabiano. Não há indicadores que delimitem muito bem onde
começa a fala do narrador e onde se inicia a da personagem. - Discurso Indireto que analisa a expressão: serve
Não se tem dúvida de que no período inicial está traduzida para destacar mais o modo de dizer do que o que se diz; por
a fala do narrador. A bem verdade, até não se conformou exemplo, as palavras típicas do vocabulário da personagem
(início do segundo parágrafo), é a voz do narrador que está citada, a sua maneira de pronunciá-las, etc. Nesse caso, as
comandando a narrativa. Na oração devia haver engano, já palavras ou expressões ressaltadas aparecem entre aspas.
começa haver uma mistura de vozes: sob o ponto de vista das O discurso indireto livre fica a meio caminho da
marcas gramaticais, não há nenhuma pista para se concluir, que subjetividade e da objetividade. Tem muitas funções. Por
a voz de Fabiano é que esteja sendo citada; sob o ponto de exemplo, dá verossimilhança a um texto que pretende
vista do significado, porém, pode-se pensar numa reclamação manifestar pensamentos, desejos, enfim, a vida interior de uma
atribuída a ele. personagem.
Tomemos agora esse trecho: “Ele era bruto, sim senhor, via- Em síntese, demonstra um envolvimento tal do narrador
se perfeitamente que era bruto, mas a mulher tinha miolo. Com com a personagem, que as vozes de ambos se misturam
certeza havia um erro no papel do branco.” Pelo conteúdo de como se eles fossem um só ou, falando de outro modo, como
verdade é pelo modo de dizer, tudo nos induz a vislumbrar aí se o narrador tivesse vestido completamente a máscara da
a voz de Fabiano ecoando por meio do discurso do narrador. personagem, aproximando-a do leitor sem a marca da sua
É como se o narrador, sem abandonar as marcas linguísticas intermediação.
próprias de sua fala, estivesse incorporando as reclamações Veja-se como, neste trecho: “O tímido José”, de Antônio
e suspeitas da personagem, a cuja linguagem pertencem de Alcântara Machado, o narrador, valendo-se do discurso
expressões do tipo bruto, sim senhor e a mulher tinha miolo. indireto livre, leva o leitor a partilhar do constrangimento da
Até a repetição de palavras e certa entonação presumivelmente personagem, simulando estar contaminado por ele:
exclamativa confirmam essa inferência.
Para perceber melhor o que é o discurso indireto livre, (...) Mais depressa não podia andar. Garoar, garoava sempre.
confrontemos uma frase do texto com a correspondente em Mas ali o nevoeiro já não era tanto felizmente. Decidiu. Iria
discurso direito e indireto: indo no caminho da Lapa. Se encontrasse a mulher bem. Se não
encontrasse paciência. Não iria procurar. Iria é para casa. Afinal
- Discurso Indireto Livre de contas era mesmo um trouxa. Quando podia não quis. Agora
Estava direito aquilo? que era difícil queria.
Laranja-da-china. In: Novelas Paulistanas.
- Discurso Direto 1ª Ed. Belo Horizonte, Itatiaia/ São Paulo, Edusp, 1998, p. 184.
Fabiano perguntou: - Está direito isto?
Questões
- Discurso Indireto
Fabiano perguntou se aquilo estava direito 01. Sobre o discurso indireto é correto afirmar, EXCETO:

Essa forma de citação do discurso alheio tem características (A) No discurso indireto, o narrador utiliza suas próprias
próprias que são tanto do discurso direto quanto do indireto. As palavras para reproduzir a fala de um personagem.
características do discurso indireto livre são: (B) O narrador é o porta-voz das falas e dos pensamentos
das personagens.
- Não há verbos de dizer anunciando as falas das (C) Normalmente é escrito na terceira pessoa. As falas são
personagens; iniciadas com o sujeito, mais o verbo de elocução seguido da
- Estas não são introduzidas por partículas como “que” e fala da personagem.
“se” nem separadas por sinais de pontuação; (D) No discurso indireto as personagens são conhecidas
- O discurso indireto livre contém, como o discurso direto, através de seu próprio discurso, ou seja, através de suas pró-
orações interrogativas, imperativas e exclamativas, bem como prias palavras.
interjeições e outros elementos expressivos;
- Os pronomes pessoais e demonstrativos, as palavras 02. Assinale a alternativa que melhor complete o seguinte
indicadoras de espaço e de tempo são usadas da mesma forma trecho:
que no discurso indireto. Por isso, o verbo estar, do exemplo No plano expressivo, a força da ____________ em
acima, ocorre no pretérito imperfeito, e não no presente _____________ provém essencialmente de sua capacidade de
(está), como no discurso direto. Da mesma forma o pronome _____________ o episódio, fazendo ______________ da situa-
demonstrativo ocorre na forma aquilo, como no discurso ção a personagem, tornando-a viva para o ouvinte, à maneira
indireto. de uma cena de teatro __________ o narrador desempenha a
Quanto ao discurso indireto, pode ser de dois tipos e cada mera função de indicador de falas.
um deles cria um efeito de sentido diverso. (A) narração - discurso indireto - enfatizar - ressurgir –
onde;
- Discurso Indireto que analisa o conteúdo: elimina (B) narração - discurso onisciente - vivificar - demonstrar-
os elementos emocionais ou afetivos presentes no discurso -se – donde;
direto, assim como as interrogações, exclamações ou formas (C) narração - discurso direto - atualizar - emergir - em que;
imperativas, por isso produz um efeito de sentido de objetividade (D) narração - discurso indireto livre - humanizar - imergir
analítica. Com efeito, nele o narrador revela somente o - na qual;
conteúdo do discurso da personagem, e não o modo como ela (E) dissertação - discurso direto e indireto - dinamizar - pro-
diz. Com isso estabelece uma distância entre sua posição e a da tagonizar - em que.
personagem, abrindo caminho para a réplica e o comentário. 03. Faça a associação entre os tipos de discurso e assinale
Esse tipo de discurso indireto despersonaliza discurso citado em a sequência correta.
nome de uma objetividade analítica. Cria, assim, a impressão
de que o narrador analisa o discurso citado de maneira racional 1. Reprodução fiel da fala da personagem, é demarcado
e isenta de envolvimento emocional. O discurso indireto, nesse pelo uso de travessão, aspas ou dois pontos. Nesse tipo de dis-
caso, não se interessa pela individualidade do falante no modo curso, as falas vêm acompanhadas por um verbo de elocução,

5
LÍNGUA PORTUGUESA
responsável por indicar a fala da personagem. Os concursos públicos e vestibulares atuais exploram com
2. Ocorre quando o narrador utiliza as próprias palavras certo peso essas atualidades, incorporando o aspecto do dia
para reproduzir a fala de um personagem. a dia. As provas de hoje estão todas intertextualizadas, com
3. Tipo de discurso misto no qual são associadas as ca- a integração de conteúdos comuns à prova de gramática,
racterísticas de dois discursos para a produção de outro. Nele a literatura e interpretação de texto (uma boa interpretação é
fala da personagem é inserida de maneira discreta no discurso 60% de garantia de se ter uma boa nota), além do qual o senso
do narrador. crítico e de compreensão do concursando farão a diferença.

( ) discurso indireto Uma redação bem feita é sinal que a pessoa tem um bom
( ) discurso indireto livre conhecimento da sua língua. É necessário também ter calma e
( ) discurso direto paciência, sempre prestar muita atenção nas propostas dadas
pelos examinadores.
(A) 3, 2 e 1.
(B) 2, 3 e 1. Faça um rascunho a lápis de sua redação, crie seu texto,
(C) 1, 2 e 3. revise para ver se não há erros, e passe a limpo na folha
(D) 3, 1 e 2. especificada a tinta. Depois disso é torcer para que você tenha
ido muito bem e conseguido uma boa nota, já que na maioria
04. “Impossível dar cabo daquela praga. Estirou os olhos dos concursos e vestibulares do Brasil, a prova de redação tem
pela campina, achou-se isolado. Sozinho num mundo coberto um peso muito alto.
de penas, de aves que iam comê-lo. Pensou na mulher e sus-
pirou. Coitada de Sinhá Vitória, novamente nos descampados, Na produção de um texto, o mais importante é como você
transportando o baú de folha.” organiza as ideias, muitas vezes o candidato sabe muito sobre
o assunto, todas as suas causas e consequências, porém ele não
O narrador desse texto mistura-se de tal forma à personagem tem a preocupação de organizar suas ideias, e esse, certamente
que dá a impressão de que não há diferença entre eles. A per- é o responsável pela reprovação de muitos na prova de redação.
sonagem fala misturada à narração. Esse discurso é chamado:
O modo de correção da prova é muito rígido, de modo que
(A) discurso indireto livre determinado professor não possa expor sua opinião julgando
(B) discurso direto o concursando ao espelho de seu pensamento. A correção
(C) discurso indireto abordará aspectos formais do texto, o emprego da gramática
(D) discurso implícito normativa, o senso crítico e a correlação tema/texto.
(E) discurso explícito Escrever bem não é coisa do outro mundo, é alcançável a
todos, basta apenas interesse.
Respostas
01. D / 02. C / 03. B / 04. A Tema e Título

Segundo Vânia Duarte, tecer um bom texto é uma tarefa


que requer competência por parte de quem a pratica, pois a
construção textual não pode ser vista como um emaranhado
de frases soltas e ideias desconexas. Pelo contrário, elas devem
Produção e recepção textuais nas estar organizadas e justapostas entre si, denotando clareza de
práticas sociais. Usos da linguagem. sentido em relação à mensagem que se deseja transmitir.
Como sabemos, a redação é um dos elementos mais
requisitados em processos seletivos de uma forma geral.
Por essa razão,devemos estar aptos para desenvolvê-la de
Ato de Escrever forma plausível e, consequentemente, alcançarmos o sucesso
almejado. Geralmente, a proposta é acompanhada de uma
“Escrever é expressar-se. coletânea de textos, que deve ser lida de forma atenta para
Escrever é lembrar-se. percebermos qual é o tema abordado em questão.
Uns escrevem para salvar a humanidade ou incitar lutas de Diante disso, é essencial que entendamos a diferença
classes, outros para se perpetuar nos manuais de literatura ou existente entre estes dois elementos: Título e Tema. Para tal,
conquistar posições e honrarias. aprofundaremos mais nossos conhecimentos sobre o assunto.
Os melhores são os que escrevem pelo prazer de escrever.”
Consideremos o exposto abaixo:
Lêdo Ivo apud Campedelli, 1998, p. 335
Tema:
Como sabemos, a redação é um dos elementos mais requisi- O crescente dinamismo que permeia a sociedade, aliado à
tados em processos seletivos de uma forma geral, e em virtude inovação tecnológica, requer um aperfeiçoamento profissional
disso é que devemos estar aptos para desenvolvê-la de forma constante.
plausível e, consequentemente, alcançarmos o sucesso almeja-
do. Título:
A importância da capacitação profissional no mundo
Escrever redação não é difícil! A primeira coisa que pode- contemporâneo.
mos salientar para que tenha um bom desempenho com o seu
trabalho é sempre priorizar as questões de coerência e também Como podemos perceber, o tema é algo mais abrangente e
coesão, em outras palavras, dar cabo no assunto, e não fugir consiste no assunto que deve ser explorado ao longo do texto.
dele em momento algum. Já o título é algo mais sintético, é como se fosse afunilando
o assunto que será posteriormente discutido.
É sempre importante estarmos atentos para a realidade O importante é sabermos que: do tema é que se extrai
mundial e em especial a brasileira, temos que ler e assistir o título, haja vista que o tema é um elemento-base, fonte
jornais, ler revistas, etc. em síntese, estar em sintonia com as norteadora para os demais passos.
notícias, pois manter-se sempre atualizado pode ser a chave Existem certos temas que não revelam uma nítida
para o sucesso. objetividade, como o exposto anteriormente. É o caso de

6
LÍNGUA PORTUGUESA
fragmentos literários, trechos musicais, frases de efeito, entre Você poderá pensar desta forma também ao admirar uma
outros. pintura, uma escultura, um grafite na rua, e se perguntar: o que
Nesse caso, exige-se mais do leitor quanto à questão da será que se quis dizer com essa representação? Enfim, consegue
interpretação, para daí chegar à ideia central, como podemos perceber a possibilidade de mais de uma leitura nas diferentes
identificar por meio deste excerto: linguagens? Os examinadores esperam que você seja analítico,
que faça associações, que entenda não ser mundo algo estático
“As ideias são apenas pedras postas a atravessar a corrente sócio-econômico-política e culturalmente. Então, guarde esses
de um rio, se estão ali é para que possamos chegar à outra conceitos:
margem, a outra margem é o que importa”. (José Saramago)
Denotação - palavra usada em sentido literal: objetividade:
Essa linguagem, quando analisada, leva-nos a inferir o Ex.: Meu coração está batendo acelerado.
seguinte e que este poderia ser o título:
A importância da coerência e da coesão para o sentido do Conotação - palavra usada em sentido figurado:
texto. subjetividade.
Fazendo parte também dessa composição estão os temas Ex.: Meu coração galopa quando te vê...
apoiados em imagens, como é o caso de gráficos, histórias em
quadrinhos, charges e pinturas. Tal ocorrência requer o mesmo
procedimento por parte do leitor, ou seja, que ele desenvolva
seu conhecimento de mundo e sua capacidade de interpretação
para desenvolver um bom texto.
O concurso ou o vestibular pode dar tanto o tema quanto o
título, de acordo com Gustavo Atallah Haun. Cabe ao redator
saber manejar as duas formas.
Caso seja dado o título, este se tornará obrigatório no início
da prova, centralizado, na primeira linha (se não houver um
lugar específico para ele!). Podem daí surgir duas possibilidades, Construindo um Texto a Partir de Um Tema
o tema estar inserido nos textos de apoio que acompanham o Objetivo e Um Subjetivo
enunciado da questão ou do título você terá que tirar o tema.
Se for dado o tema em destaque, durante ou após o Vimos anteriormente que, o tema é a proposta para a
enunciado da redação, você terá que falar especificamente redação. Você irá delimitar o assunto e a partir dessa delimitação
dele, independente do assunto tratado nos textos de apoio. irá formular sua tese (a afirmação central sobre o assunto, que
Muitas bancas examinadoras não exigem o título. Na será desenvolvida e comprovada no texto). Observe que há
maioria das vezes ele é opcional. Porém, quando for obrigatório uma tendência de os vestibulares apresentarem o tema e uma
vai ter sempre na instrução da prova: “Dê um título ao seu coletânea de textos, de todos os tipos: fragmentos filosóficos,
texto” ou “Seu texto deve ter título” e similares. Portanto, leia excertos literários; poemas; reportagens ou notícias de jornais
com atenção as instruções da sua prova de produção textual. e revistas; cartuns ou pinturas. Normalmente, o avaliador não
deseja um texto com visão limitada sobre o assunto. Caso tenha
PRINCIPAIS DIFERENÇAS ENTRE TEMA X TÍTULO: pela frente um tema subjetivo, haverá a necessidade de se
interpretar a proposta.

Observe os seguintes modelos:

Modelo com tema subjetivo


1º. Tema subjetivo: “Tudo o que é sólido desmancha no ar.”
(Karl Marx )

2º. Delimitação do Assunto:


Fique atento e não cometa esse erro! • a observação de como a história elimina estruturas
aparentemente eternas.
Delimitado ou não • trata-se de uma referência às instituições, comportamentos,
O tema pode vir amplo, genérico, ou já delimitado. Atenção modelos econômicos, que se modificam no tempo.
máxima quanto a isso. No primeiro caso, pode-se pedir para
escrever sobre “Violência”, por exemplo, e dentro desse tema 3º. Tese: Nosso cotidiano parece cercado por estruturas
tão universal, você ter que especificar, delimitá-lo: “A violência fixas, imutáveis, sejam instituições, relações de poder, formas
doméstica está crescendo no Brasil em pleno século XXI”. de vida. Mas, se dermos um passo atrás e olhamos a história,
Pronto, agora é só começar a escrever. o que encontramos é uma sucessão de transformações, em que
estas estruturas, que pareciam eternas, são criadas e destruídas.
Tema objetivo ou subjetivo?
Outro aspecto importante que se tem que ficar atento é se o Esse foi um exemplo com tema subjetivo. Vejamos um
tema é de âmbito objetivo ou subjetivo. exemplo de tema objetivo. Lê-se o tema e imediatamente se
Para entender a diferença entre um tema objetivo e um reconhece sobre o que se pode falar no texto.
tema subjetivo, faz-se necessário, antes, relembrar que há
mais de uma forma de usar as palavras: no sentido real ou no Modelo com tema objetivo
sentido figurado. Essa diferenciação não se faz apenas no uso 1º. Tema: Desenvolvimento e Meio Ambiente.
da linguagem escrita ou falada, mas também ao se fazer uso
de outras linguagens. Explico: quando se assiste a um filme, 2º. Delimitação do Assunto:
é possível associar seu enredo a outros significados que não • como conciliar desenvolvimento econômico e preservação
apenas aquele aparente; você assistiu a “Matrix”, por exemplo? do meio ambiente?
Será que aquela história de se viver um mundo falso, que • estar o meio ambiente em estado de degradação é sinal de
alguém programa para nós, não é uma grande metáfora? Vemos evolução da sociedade capitalista ou “involução”?
tudo o que existe? O que existe é real ou nossos sentidos nos
enganam? O verde que você vê é o verde que eu vejo? Como 3º. Tese: Depois de as grandes potências econômicas
saber? passarem pelo período de exploração da maior parte dos

7
LÍNGUA PORTUGUESA
recursos naturais existentes, e pelo completo descuido com 4. Adequação à situação de comunicação
o meio ambiente, surge a preocupação em se controlar esse Refere-se, esse critério, ao uso de vocábulos formais ou
processo, antes desordenado, para que se possa falar em informais e ainda aos estrangeirismos.
gerações futuras. Lembrando que palavras estrangeiras devem ser grafadas
Adequação Vocabular entre aspas nas redações e só devem ser usadas quando
necessárias, ou seja, quando forem importantes para o
Adequação Vocabular é obter das palavras os melhores entendimento; em uma situação de estilo ou quando não
efeitos. É conseguir usar as palavras adequadas ao contexto houver palavra equivalente na Língua Portuguesa.
em que elas são produzidas: para quem são produzidas, quem
produz, com que finalidade, em que ambiente e momento. 5. Adequação ao código
É conseguir usar as palavras corretamente e, como recurso, É relevante para esse critério a correção não só ortográfica,
conseguir substituí-las por outras sem prejuízo de sentido. mas também semântica, respeitando os significados
Como adequar as palavras? Uma das formas de adequação dicionarizados.
vocabular, é a substituição de um termo por um hipônimo ou Agostinho ressalta que os empregos “de moda” devem
hiperônimo. Hiperônimo é uma palavra que apresenta um evitados, pois “em nada contribuem para o real enriquecimento
significado mais abrangente que o seu hipônimo, palavra com de um idioma” e dá um exemplo: colocar em lugar de apresentar
significado mais restrito. É o que acontece com as palavras e assumir em lugar de responsabilizar-se:
doença (hiperônimo) e gripe (hipônimo). – Vou colocar aqui um problema…
Também podemos adequar bem as palavras usando e – Se der errado, eu assumo…
aplicando os conceitos de homonímia, paronímia, sinonímia,
antonímia, conotação e denotação, discutidos em aulas Somam-se a esse caso, os parônimos e os homônimos
anteriores. A adequação vocabular depende de uma boa (homógrafos e homófonos), já tratados em outra aula. ( tópico
escolha lexical. jà tratado aqui)
Adequação linguística 6. Adequação ao contexto
Fatores Contexto As situações textuais revelam-se nas relações desenvolvidas
entre as palavras do texto. Por exemplo, se há relação de causa
–‡”Ž‘…—–‘”‡• ‘“—‡‡•–ƒ‘•ˆƒŽƒ†‘ǫ e efeito – tropeçar / cair; se há relação de finalidade – livro
‹–—ƒ­ ‘ É uma situação formal ou / estudar; se há relação de parte e todo – rei / xadrez; se há
informal? relação de sinonímia – aroma / perfume; se há relação de
antonímia – entrar / sair; se há relação de unidade e coletivo
••—–‘ ”ƒ–ƒ‘•†‡ƒ••—–‘• – livro / biblioteca; se há relação de objeto e ação – cadeira /
†‹ˆ‡”‡–‡•…‘‘‡•‘–‹’‘ sentar e se há relação simbólica – pomba / paz.
†‡Ž‹‰—ƒ‰‡ǫƒ•…‹‡–‘ O uso do vocábulo fora de um desses critérios e até mesmo
—„‡„²±ƒ—…‹ƒ†‘†ƒ em critério inadequado à situação será erro.
‡•ƒˆ‘”ƒ“—‡—
˜‡Ž×”‹‘ǫ Fonte:s http://slideplayer.com.br/slide/1270845/
http://conversadeportugues.com.br/2015/11/adequacao-
„‹‡–‡ •–ƒ‘•‡—ƒˆ‡•–ƒ‘—‘
e-inadequacao-linguistica/
‡•…”‹–×”‹‘ǫ
Informações Implícitas e Explícitas
Agostinho Dias Carneiro em seu livro Redação em
Construção* descreve seis critérios de adequação vocabular, Para que seja possível compreender o que vem a ser
listados a seguir: informação explícita em um texto, é preciso compreender
que a linguagem verbal é polissêmica: um mesmo enunciado
1. A adequação ao referente pode assumir diferentes sentidos em diferentes contextos e
Esse critério baseia-se na utilização de vocábulos gerais diferentes leitores podem atribuir sentidos distintos a um texto,
frente a vocábulos específicos. O exemplo que o autor dá segundo Kátia Lomba Bräkling.
é a palavra ver, que tem emprego mais amplo que observar,
contemplar, distinguir, espiar, fitar etc. Vejamos a interação a seguir:
Se eu disser, por exemplo, Pedro estava muito triste com a Aluno: [levantando a mão] Professora, você pode me dizer
separação. Por isso, foi à praia, sentou-se na areia e viu o sol, que horas são?
certamente causará estranhamento no interlocutor. Ao passo Professora: [olha no relógio e responde] Podem guardar o
que se eu disser Pedro estava muito triste com a separação. material, pessoal!
Por isso, foi à praia, sentou-se na areia e contemplou o sol, Aluno: Êba! [rapidamente, guarda o material, seguido por
não haverá nenhum problema na comunicação, pois houve outros colegas]
adequação quanto ao uso do vocábulo. Podemos observar que o aluno não perguntou se poderia
guardar o material. No entanto, pela reação dele era o que queria
2. Adequação ao ponto de vista saber. A professora, interpretando a sua intenção, autorizou a
Aqui serão levados em consideração os vocábulos positivos, guarda do material, encerrando a aula. Nesse caso, o sentido
neutros e negativos. dos enunciados foi definido por fatores externos ao texto,
Em Você me deu um café gelado, a palavra gelado assume autorizados pelas características da situação comunicativa e
valor negativo, entretanto, assume valor positivo em Depois do pelo conhecimento mútuo dos interlocutores sobre si mesmos e
trabalho vamos tomar uma cerveja gelada? sobre as regras de convivência colocadas.
Se o texto tivesse sido compreendido no sentido literal –
3. Adequação aos interlocutores ou seja, se tivessem sido consideradas as suas informações
Há, nesse critério, quatro tipos de seleção vocabular: quanto explícitas– a resposta da professora teria que ser outra- como,
à atividade profissional com o uso dos jargões; quanto à imagem por exemplo, “São cinco para as 11”. Nesse caso, as autorizações
social de um dos interlocutores, ou seja, um chefe de Estado se não teriam sido dadas e os alunos continuariam executando as
expressa como o que se espera de alguém que ocupa tal cargo; tarefas.
quanto à idade com o uso de vocábulos modernos (luminária) Podemos dizer, então, que o sentido de um texto é constituído
ou antigos (abajur) ou quanto à origem dos interlocutores com tanto por informações que são apresentadas explicitamente na
emprego do vocábulo regional (piá – criança). superfície ou linearidade do texto, quanto por outras, que se

8
LÍNGUA PORTUGUESA
encontram implícitas. As primeiras são facilmente localizáveis e pensamentos da sociedade para criar subentendidos. Já a
no texto, pois se encontram escritas com todas as letras. Já anedota é um gênero textual cuja interpretação depende a
as segundas são dependentes do repertório prévio dos quebra de subentendidos.
interlocutores e das características da situação comunicativa.
A capacidade de localizar informações explícitas no texto é Fonte: http://educacao.globo.com/portugues/assunto/
fundamental para a constituição da proficiência leitora e deve estudo-do-texto/implicitos-e-pressupostos.html (Adaptado)
ser objeto de ensino, desde os primeiros anos de escolarização,
já no processo de alfabetização. Muitos consideram essa Questão
capacidade a mais simples de todas. No entanto, é preciso
considerar que nenhuma capacidade de leitura é mobilizada 01. Texto I
no vazio, mas sempre em função da materialidade textual.
Assim, se o texto for mais complexo ou extenso, o processo de
localização da informação solicitada – e a decorrente atribuição
de sentido - poderá ser igualmente mais complexo.

Informações Implícitas
Muitos candidatos ao ENEM se perguntam como melhorar
sua capacidade de interpretação dos textos. Primeiramente, é
preciso ter em mente que um texto é formado por informações
explícitas e implícitas. As informações explícitas são aquelas
manifestadas pelo autor no próprio texto. As informações
implícitas não são manifestadas pelo autor no texto, mas
podem ser subentendidas. Muitas vezes, para efetuarmos uma
leitura eficiente, é preciso ir além do que foi dito, ou seja, ler
nas entrelinhas.
Por exemplo, observe este enunciado:

- Patrícia parou de tomar refrigerante. Época. 12 out. 2009 (adaptado). (Foto: Reprodução/
A informação explícita é “Patrícia parou de tomar Enem)
refrigerante”. A informação implícita é “Patrícia tomava
refrigerante antes”. Texto II
CONEXÃO SEM FIO NO BRASIL
Agora, veja este outro exemplo: Onde haverá cobertura de telefonia celular para baixar
-Felizmente, Patrícia parou de tomar refrigerante. publicações para o Kindle
A informação explícita é “Patrícia parou de tomar
refrigerante”. A palavra “felizmente” indica que o falante
tem uma opinião positiva sobre o fato – essa é a informação
implícita.
Com esses exemplos, mostramos como podemos inferir
informações a partir de um texto. Fazer uma inferência significa
concluir alguma coisa a partir de outra já conhecida. Nos
vestibulares, fazer inferências é uma habilidade fundamental
para a interpretação adequada dos textos e dos enunciados.
A seguir, veremos dois tipos de informações que podem ser
inferidas: as pressupostas e as subentendidas.

Pressupostos
Uma informação é considerada pressuposta quando um
enunciado depende dela para fazer sentido. Época. 12 out. 2009. (Foto: Reprodução/Enem)
Considere, por exemplo, a seguinte pergunta: “Quando
Patrícia voltará para casa?”. Esse enunciado só faz sentido A capa da revista Época de 12 de outubro de 2009 traz um
se considerarmos que Patrícia saiu de casa, ao menos anúncio sobre o lançamento do livro digital no Brasil. Já o texto
temporariamente – essa é a informação pressuposta. Caso II traz informações referentes à abrangência de acessibilidade
Patrícia se encontre em casa, o pressuposto não é válido, o que das tecnologias de comunicação e informação nas diferentes
torna o enunciado sem sentido. regiões do país. A partir da leitura dos dois textos, infere-se que
Repare que as informações pressupostas estão marcadas o advento do livro digital no Brasil
através de palavras e expressões presentes no próprio enunciado a) possibilitará o acesso das diferentes regiões do país
e resultam de um raciocínio lógico. Portanto, no enunciado às informações antes restritas, uma vez que eliminará as
“Patrícia ainda não voltou para casa”, a palavra “ainda” indica distâncias, por meio da distribuição virtual.
que a volta de Patrícia para casa é dada como certa pelo falante. b) criará a expectativa de viabilizar a democratização da
leitura, porém esbarra na insuficiência do acesso à internet por
Subentendidos telefonia celular, ainda deficiente no país.
Ao contrário das informações pressupostas, as informações c) fará com que os livros impressos tornem-se obsoletos,
subentendidas não são marcadas no próprio enunciado, em razão da diminuição dos gastos com os produtos digitais
são apenas sugeridas, ou seja, podem ser entendidas como gratuitamente distribuídos pela internet.
insinuações. d) garantirá a democratização dos usos da tecnologia no
O uso de subentendidos faz com que o enunciador se país, levando em consideração as características de cada região
esconda atrás de uma afirmação, pois não quer se comprometer no que se refere aos hábitos de leitura e acesso à informação.
com ela. Por isso, dizemos que os subentendidos são de e) impulsionará o crescimento da qualidade da leitura dos
responsabilidade do receptor, enquanto os pressupostos são brasileiros, uma vez que as características do produto permitem
partilhados por enunciadores e receptores. que a leitura aconteça a despeito das adversidades geopolíticas.
Em nosso cotidiano, somos cercados por informações
subentendidas. A publicidade, por exemplo, parte de hábitos

9
LÍNGUA PORTUGUESA
Resposta Ao decorrer do texto vão sendo apresentados os argumentos
propriamente ditos, junto com exemplificações e citações (se
01. (B) Observe que o enunciado da questão usa o verbo existirem).
“inferir”, ou seja, espera-se que o candidato seja capaz de chegar No final do texto as idéias devem ser arrematadas com uma
a uma conclusão a partir da leitura dos dois textos. Nesse caso, tese (a conclusão). Essa conclusão deve vir sendo prevista pelo
a leitura dos textos separadamente pode levar o candidato ao leitor durante todo o texto, a medida que ele vai lendo e se
erro. A partir da leitura do gráfico, o candidato deve inferir direcionando para concordar com ela.
que a telefonia celular abrange apenas uma parte do território A argumentação não trabalha com fatos claros e evidentes,
brasileiro, o que atrapalha a democratização do livro digital. mas sim investiga fatos que geram opiniões diversas, sempre
em busca de encontrar fundamentos para localizar a opinião
Argumentação mais coerente.
Não se pode, em uma argumentação, afirmar a verdade ou
Argumentar é a capacidade de relacionar fatos, teses, negar a verdade afirmada por outra pessoa. O objetivo é fazer
estudos, opiniões, problemas e possíveis soluções a fim de com que o leitor concorde e não com que ele feche os olhos
embasar determinado pensamento ou ideia. para possíveis contra-argumentos.
Um texto argumentativo sempre é feito visando um Caso seja necessário se pode também fazer uma comparação
destinatário. O objetivo desse tipo de texto é convencer, entre vários ângulos de visão a respeito do assunto, isso poderá
persuadir, levar o leitor a seguir uma linha de raciocínio e a ajudar no processo de convencimento do leitor, pois não dará
concordar com ela. margens para contra-argumentos. Porém deve-se tomar muito
Para que a argumentação seja convincente é necessário cuidado para não se contradizer e para ser claro. Para isso é
levar o leitor a um “beco sem saída”, onde ele seja obrigado a necessário um bom domínio do assunto.
concordar com os argumentos expostos.
No caso da redação, por ser um texto pequeno, há uma Organização Textual
obrigatoriedade em ser conciso e preciso, para que o leitor possa O ser humano se comunica por meio de textos. Desde uma
ser levado direto ao ponto chave. Para isso é necessário que se simples e passageira interjeição como Olá até uma mensagem
exponha a questão ou proposta a ser discutida logo no início muitíssimo extensa. Em princípio, esses textos eram apenas
do texto, e a partir dela se tome uma posição, sempre de forma orais. Hoje, são também escritos. Nesse processo, os textos
impessoal. O envolvimento de opiniões pessoais, além de ser ganharam formas de organização distintas, com propósitos
terminantemente proibido em textos que serão analisados em nitidamente distintos também. As principais formas de
concursos, pode comprometer a veracidade dos fatos e o poder organização textual registradas na humanidade são, assim:
de convencimento dos argumentos utilizados. Por exemplo, é Narrativa: aquela que compreende textos que contam uma
muito mais aceitável uma afirmação de um autor renomado história, relatam um acontecimento.
ou de um livro conhecido do que o simples posicionamento do Argumentativa: a que visa ao convencimento do interlocutor.
redator a respeito de determinado assunto. Descritiva: cuja finalidade é apresentar concreta ou
Uma boa argumentação só é feita a partir de pequenas metaforicamente uma dada descrição.
regras as quais facilmente são encontradas em textos do dia- Cada uma dessas formas de organização textual desdobra-
a-dia, já que durante a nossa vida levamos um longo tempo se em inúmeros gêneros textuais distintos, que nada mais são
tentando convencer as outras pessoas de que estamos certos. do que cada concretizável possível a cada um dos objetivos
textuais. Assim, por exemplo, a diferentes formas e formatos
para se narrar: fábula, conto de fadas, romance, conto, notícia,
fofoca, etc.

Texto Argumentativo
Esse tipo de texto, que é aplicado nas redações do Enem,
inclui diferentes gêneros, tais quais, dissertação, artigo de
opinião, carta argumentativa, editorial, resenha argumentativa,
dentre outros.
Todo e qualquer texto argumentativo, como já dito, visa ao
convencimento de seu ouvinte/leitor. Por isso, ele sempre se
baseia em uma tese, ou seja, o ponto de vista central que se
pretende veicular e a respeito do qual se pretende convencer
Os argumentos devem ter um embasamento, nunca deve- esse interlocutor. Nos gêneros argumentativos escritos,
se afirmar algo que não venha de estudos ou informações sobretudo, convém que essa tese seja apresentada, de maneira
previamente adquiridas. clara, logo de início e que, depois, através duma argumentação
Os exemplos dados devem ser coerentes com a realidade, ou objetiva e de diversidade lexical seja sustentada/defendida,
seja, podem até ser fictícios, mas não podem ser inverossímeis. com vistas ao mencionado convencimento.
Caso haja citações de pessoas ou trechos de textos os A estrutura geral de um texto argumentativo consiste de
mesmos devem ser razoavelmente confiáveis, não se pode citar introdução, desenvolvimento e conclusão, nesta ordem. Cada
qualquer pessoa. uma dessas partes, por sua vez tem função distinta dentro da
Experiências que comprovem os argumentos devem ser composição do texto:
também coerentes com a realidade.
Há de se imaginar sempre os questionamentos, dúvidas e Introdução: é a parte do texto argumentativo em que
pensamentos contrários dos leitores quanto à sua argumentação, apresentamos o assunto de que trataremos e a tese a ser
para que a partir deles se possa construir melhores argumentos, desenvolvida a respeito desse assunto.
fundamentados em mais estudo e pesquisa. Desenvolvimento: é a argumentação propriamente dita,
Sobre a estrutura do texto: correspondendo aos desdobramentos da tese apresentada. Esse
Deve conter uma lógica de pensamentos. Os raciocínios é o coração do texto, por isso, comumente se desdobra em mais
devem ter uma relação entre si, e um deve continuar o que o de um parágrafo. De modo geral, cada argumentação em defesa
outro afirmava. da tese geral do texto corresponde a um parágrafo.
No início do texto deve-se apresentar o assunto e a Conclusão: a parte final do texto em que retomamos a tese
problemática que o envolve, sempre tomando cuidado para não central, agora já respaldada pelos argumentos desenvolvidos
se contradizer. ao longo do texto.

10
LÍNGUA PORTUGUESA
Relação entre tese e argumento Nesse tipo de citação o autor precisa de dados que
De modo geral, a relação entre tese e argumento pode ser demonstrem sua tese.
compreendida de duas maneiras principais:
Argumento, portanto, Tese (A՜ pt՜T) ou Tese porque Argumentação por raciocínio lógico
Argumento (T՜ pq՜A): A criação de relações de causa e efeito é um recurso
utilizado para demonstrar que uma conclusão (afirmada no
(A՜ pt՜T) texto) é necessária, e não fruto de uma interpretação pessoal
“O governo gasta, todos os anos, bilhões de reais no que pode ser contestada.
tratamento das mais diversas doenças relacionadas ao Veja:
tabagismo; os ganhos com os impostos nem de longe “O fumo é o mais grave problema de saúde pública no Brasil.
compensam o dinheiro gasto com essas doenças. Além disso Assim como não admitimos que os comerciantes de maconha,
(Ainda, e, também, relação de adição ՜ quando se enumeram crack ou heroína façam propaganda para os nossos filhos na
argumentos a favor de sua tese), as empresas têm grandes TV, todas as formas de publicidade do cigarro deveriam ser
prejuízos por causa de afastamentos de trabalhadores devido proibidas terminantemente. Para os desobedientes, cadeia.”
aos males causados pelo fumo. Portanto (logo, por conseguinte, VARELLA, Drauzio. In: Folha de S. Paulo, 20 de maio de
por isso, então ՜ observem a relação semântica de conclusão, 2000.
típica de um silogismo), é mister que sejam proibidas quaisquer
propagandas de cigarros em todos os meios de comunicação.” Para a construção de um bom texto argumentativo faz-
se necessário o conhecimento sobre a questão proposta,
(T՜ pq՜A) fundamentação para que seja realizado com sucesso.
O governo deve imediatamente proibir toda e qualquer
forma de propaganda de cigarro, porque (uma vez que, já que, Fonte: http://educacao.globo.com/portugues/assunto/
dado que, pois ՜ relação de causalidade) ele gasta, todos os texto-argumentativo/argumentacao.html
anos, bilhões de reais no tratamento das mais diversas doenças
relacionadas ao tabagismo; e, muito embora (ainda que, não Questão
obstante, mesmo que ՜ relação de oposição: usam-se as
concessivas para refutar o argumento oposto) os ganhos com 01. Identifique o sentido argumentativo dos seguintes
os impostos sejam vultosos, nem de longe eles compensam o textos, e separe, por meio de barras, a tese e o(s) argumento(s).
dinheiro gasto com essas doenças. a) “Meu carro não é grande coisa, mas é o bastante para
o que preciso. É econômico, nunca dá defeito e tem espaço
Há diferentes tipos de argumentos e a escolha certa suficiente para transportar toda a minha família.”
consolida o texto. b) “Veja bem, o Brasil a cada ano exporta mais e mais; além
disso, todo ano batemos recordes de produção agrícola. Sem
Argumentação por citação contar que nosso parque industrial é um dos mais modernos do
Sempre que queremos defender uma ideia, procuramos mundo. definitivamente, somos o país do futuro.”
pessoas ‘consagradas’, que pensam como nós acerca do tema c) “Embora a gente se ame muito, nosso namoro tem tudo
em evidência. para dar errado: nossa diferença de idade é grande e nossos
Apresentamos no corpo de nosso texto a menção de uma gostos são quase que opostos. Além disso, a família dela é
informação extraída de outra fonte. terrível.”
d) “Como o Brasil é um país muito injusto, toda política
A citação pode ser apresentada assim: social por aqui implementada é vista como demagogia,
Assim parece ser porque, para Piaget, “toda moral consiste paternalismo.”
num sistema de regras e a essência de toda moralidade deve ser
procurada no respeito que o indivíduo adquire por essas regras” Resposta
(Piaget, 1994, p.11). A essência da moral é o respeito às regras.
A capacidade intelectual de compreender que a regra expressa a) O sentido aí presente é (T՜ pq՜A), uma vez que, após
uma racionalidade em si mesma equilibrada. uma constatação, se seguem as motivações que a fundamentam.
O trecho citado deve estar de acordo com as ideias do texto, Meu carro não é grande coisa, mas é o bastante para o que
assim, tal estratégia poderá funcionar bem. preciso (TESE)./ É econômico (argumento 1), /nunca dá defeito
(argumento 2)/ e tem espaço suficiente para transportar toda a
Argumentação por comprovação minha família (argumento 3).
A sustentação da argumentação se dará a partir das b) Nesse exemplo, já encontramos a orientação (A՜ pt՜T),
informações apresentadas (dados, estatísticas, percentuais) uma vez que se parte de exemplificações para, a partir delas,
que a acompanham. enunciar uma proposição.
Esse recurso é explorado quando o objetivo é contestar um Veja bem, o Brasil a cada ano exporta mais e mais (argumento
ponto de vista equivocado. 1);/ além disso, todo ano batemos recordes de produção
agrícola (argumento 2)./ Sem contar que nosso parque
Veja: industrial é um dos mais modernos do mundo (argumento 3)./
O ministro da Educação, Cristovam Buarque, lança hoje o Definitivamente, somos o país do futuro. (TESE).
Mapa da Exclusão Educacional. O estudo do Inep, feito a partir c) Aqui, o sentido é (T՜ pq՜A), em que de uma afirmação
de dados do IBGE e do Censo Educacional do Ministério da inicial se desdobram exemplos que a justificam.
Educação, mostra o número de crianças de sete a catorze anos Embora a gente se ame muito, nosso namoro tem tudo
que estão fora das escolas em cada estado. para dar errado (TESE):/ nossa diferença de idade é grande
Segundo o mapa, no Brasil, 1,4 milhão de crianças, ou 5,5 (argumento 1) e nossos gostos são quase que opostos
% da população nessa faixa etária (sete a catorze anos), para (argumento 2). Além disso, a família dela é terrível (argumento
a qual o ensino é obrigatório, não frequentam as salas de aula. 3).
O pior índice é do Amazonas: 16,8% das crianças do estado, d) Nesse exemplo, o movimento é (A՜ pt՜T), já que se
ou 92,8 mil, estão fora da escola. O melhor, o Distrito Federal, parte de uma causa que funciona como justificativa a uma
com apenas 2,3% (7 200) de crianças excluídas, seguido por enunciação que, por sua vez, é a consequência constatada.
Rio Grande do Sul, com 2,7% (39 mil) e São Paulo, com 3,2% Como o Brasil é um país muito injusto (argumento),/ toda
(168,7 mil). política social por aqui implementada é vista como demagogia,
(Mônica Bergamo. Folha de S. Paulo, 3.12.2003) paternalismo (TESE).
ARTIGOS RELACIONADOS

11
LÍNGUA PORTUGUESA
Redação Enem 2014: apostas para o tema determinadas particularidades formais, isto é, tem que
Faça uma boa redação no Enem: dicas para prova de 2014 apresentam estrutura e elementos que construam uma relação
entre eles. Entre essas particularidades formais tem a coerência
Fontes: http://www.infoescola.com/redacao/ e a coesão, que oferecem forma e sentido ao texto. A coerência
argumentacao/ está ligada com a compreensão, ou seja, a interpretação daquilo
http://educacao.globo.com/portugues/assunto/texto- que está escrito ou que se fala. Já a coesão é a ligação entre as
argumentativo/argumentacao.html palavras ou frases do texto.
http://brasilescola.uol.com.br/redacao/a-argumentacao.
htm Um texto para ter sentido precisa possuir coerência. Apesar
da coesão não ser requisito suficiente para que as afirmações
Texto e Textualidade formem um texto, são os recursos coesivos que oferecem
Texto maios legitimidade e realçam as relações entre os seus vários
componentes. A partir disso, pode-se concluir que a coerência
É o grupamento de frases e palavras interligadas que depende da coesão.
possibilitam uma interpretação e emitem uma mensagem. É
toda obra original escrita e que pode formar um documento Textualidade
escrito ou um livro. O texto é um elemento linguístico de
dimensões maiores do que a frase1. Textualidade é o grupo de particularidades que faz com que
o texto seja reconhecido como tal, e não como um aglomerado
Em processos gráficos, o texto é o conteúdo escrito, por de frases e palavras. Uma interpretação possível indicaria
divergência a todos os outros conteúdos iconográficos, como como textualidade um argumento usado pelo interlocutor,
as ilustrações. É o componente central do livro, periódico fundamentada em seus antecipados conhecimentos funcionais
ou revista, formado por produções concretas, sem títulos, e estruturais de texto, que possibilita por meio da apreciação de
subtítulos, fórmulas, epígrafes e tabelas. diversos fatores exercer a textualização de uma mensagem em
uma situação já estabelecida.
Um texto pode ser cifrado, sendo criado conforme um De acordo com Dressler e Beaugrande, existem dois
código definitivamente suspenso após uma leitura direta. Ele conjuntos de sete elementos, que são encarregados pela
possui tamanhos diferentes e precisa ser redigido com coerência textualidade de todos os discursos:
e coesão. Pode ser considerado como não-literário e literário. 1) Elementos semânticos (coesão e coerência);
2) Elementos pragmáticos (aceitabilidade, intencionalidade,
informatividade, situacionabilidade e intertextualidade).

A Linguística Textual passou a progredir no fim dos anos 60


na Europa, principalmente entre os anglo-germânicos, e tem
se empenhado a analisar os fundamentos característicos do
texto e os elementos implicados em sua recepção e produção.
Em paralelo ao progresso dessa teoria, do fim dos anos 60 até
os dias de hoje, tem se consolidado e se expandido, no ramo
da Linguística, as pesquisas relacionadas aos fenômenos que
transcendem as margens da frase, como o discurso e o texto,
abrangendo menos os produtos e mais os processos.

Elementos pragmáticos
Os textos literários possuem uma colocação estética.
Normalmente, são escritos com uma linguagem poética e -Intencionalidade: referente a comunicação efetiva, que
expressiva, com o intuito de conquistar o interesse e sensibilizar possibilita que os propósitos comunicativos fiquem com clareza
o leitor. Os autores dos textos literários acompanham um para o leitor.
certo estilo e utilizam as expressões de maneira elegante para
manifestar as suas ideias. Existe um domínio da linguagem – Aceitabilidade: o texto fica igual à expectativa formada
conotativa e da função poética. Os romances, contos, poesias, pelo receptor. É dependente da qualidade do texto.
novelas e textos sagrados, são exemplos de textos literários.
– Situacionalidade: o texto se adapta ao cenário da
Os textos não-literários, por sua vez, apresentam atividade comunicação. Conduz a direção do discurso.
utilitária ao explicar e informar o leitor de maneira objetiva
e clara. São modelos de textos informativos que não se – Informatividade: discurso mais informativo e menos
preocupam com a estética. Existe um domínio da linguagem previsível.
denotativa e da função referencial, diferentemente do estilo
literário. Alguns exemplos de textos não literários são, textos – Intertextualidade: combina contextos e textos.
científicos, didáticos, reportagens jornalísticas e notícias.
– Contextualidade: circunstância comunicativa precisa
Existem ainda os textos narrativos que contam uma certa em que o texto foi construído.
história. A história é descrita por um narrador, que pode ou não
participar de forma direta da história. Esse tipo de texto utiliza – Coesão: dispositivo linguístico que assegura a ordem do
uma estrutura específica e predeterminada. texto e o item semântico. A coesão gera a disposição formal do
texto.
Além desses, há ainda outro tipo de texto conhecido como
texto crítico. Esse modelo é uma exibição textual que começa – Coerência: menção e não contradição, a não redundância
a partir de um método analítico e reflexivo originando um e a importância.
conteúdo junto com uma crítica construtiva e bem demonstrado. Artigo de Opinião

De maneira geral, todos os textos precisam possuir O artigo de opinião, como o próprio nome já diz, é um texto
ͳ  ‘–‡ǣŠ––’ǣȀȀ™™™Ǥ”‡•—‘‡•…‘Žƒ”Ǥ…‘Ǥ„”Ȁ’‘”–—‰—‡•Ȁ–‡š–‘Ǧ‡Ǧ–‡š–—ƒŽ‹Ǧ em que o autor expõe seu posicionamento diante de algum
†ƒ†‡Ȁ tema atual e de interesse de muitos.

12
LÍNGUA PORTUGUESA
É um texto dissertativo que apresenta argumentos sobre o Argumento de Causa: Propor uma relação com uma
assunto abordado, portanto, o escritor além de expor seu ponto causa e conseqüência em sua argumentação.
de vista, deve sustentá-lo através de informações coerentes e
admissíveis. Argumento de Autoridade: Sempre usar uma fonte, ou
Logo, as ideias defendidas no artigo de opinião são de total um estudo confiável para ter uma credibilidade ao que você
responsabilidade do autor, e, por este motivo, o mesmo deve ter defende.
cuidado com a veracidade dos elementos apresentados, além
de assinar o texto no final. Argumento de Exemplificação: Mostrar inúmeras
Contudo, em vestibulares, a assinatura é desnecessária, uma comparações e exemplos para ilustrar o seu argumento.
vez que pode identificar a autoria e desclassificar o candidato.
É muito comum artigos de opinião em jornais e revistas. Fontes: http://mundoeducacao.bol.uol.com.br/redacao/
Portanto, se você quiser aprofundar mais seus conhecimentos a artigo-opiniao.htm
respeito desse tipo de produção textual, é só procurá-lo nestes http://brasilescola.uol.com.br/redacao/artigo-opiniao.htm
tipos de canais informativos. A leitura é breve e simples, pois http://portalbrasil10.com.br/artigo-de-opiniao/
são textos pequenos e a linguagem não é intelectualizada, uma
vez que a intenção é atingir todo tipo de leitor. Fato e Opinião
Uma característica muito peculiar deste tipo de gênero
textual é a persuasão, que consiste na tentativa do emissor Muitas vezes nos encontramos com pessoas dialogando
de convencer o destinatário, neste caso, o leitor, a adotar a sobre qualquer que seja o tópico em questão, porém no meio
opinião apresentada. Por este motivo, é comum presenciarmos do diálogo ouvimos “o fato é que...”, “mas na minha opinião...”
descrições detalhadas, apelo emotivo, acusações, humor - Será que todos sabemos distinguir o que é FATO e o que é
satírico, ironia e fontes de informações precisas. OPINIÃO? - É importante saber esta diferença?
Como dito anteriormente, a linguagem é objetiva e
aparecem repletas de sinais de exclamação e interrogação, os Fato: O fato é algo que é de conhecimento de todos. Sendo
quais incitam à posição de reflexão favorável ao enfoque do um fato, ele pode ser provado através de documentos, ou de
autor. outras formas de registros.
Outros aspectos persuasivos são as orações no imperativo
(seja, compre, ajude, favoreça, exija, etc.) e a utilização de O crescimento acelerado dos grandes centros econômicos
conjunções que agem como elementos articuladores (e, mas, mundiais, aumenta os problemas sociais;
contudo, porém, entretanto, uma vez que, de forma que, etc.) e O aumento dos estudantes estrangeiros nas universidades
dão maior clareza às ideias. brasileiras.
Geralmente, é escrito em primeira pessoa, já que trata-se de
um texto com marcas pessoais e, portanto, com indícios claros Opinião: A opinião é a maneira particular de olhar um
de subjetividade, porém, pode surgir em terceira pessoa. fato. A opinião vai divergir de acordo com inúmeros fatores
Para produzir um bom artigo de opinião é aconselhável socioculturais.
seguir algumas orientações. Observe: Se meu amigo não fosse tão baixinho, ele poderia jogar
a) Após a leitura de vários pontos de vista, anote num papel futebol;
os argumentos que mais lhe agradam, eles podem ser úteis para Homens que assistem novelas são bons maridos
fundamentar o ponto de vista que você irá desenvolver.
Quando é importante saber a diferença
b) Ao compor seu texto, leve em consideração o interlocutor:
quem irá ler a sua produção. A linguagem deve ser adequada ao Várias são as oportunidades de usar a diferença com
gênero e ao perfil do público leitor. propriedade, mas duas delas são principais.
1- Quando nos engajamos em um debate de algum tema
c) Escolha os argumentos, entre os que anotou, que polêmico;
podem fundamentar a ideia principal do texto de modo mais 2- Quando somos testados e devemos escrever um texto
consciente, e desenvolva-os. dissertativo.
d) Pense num enunciado capaz de expressar a ideia principal As variantes dissertativas são:
que pretende defender.

e) Pense na melhor forma possível de concluir seu texto: 1. Expositiva: Quando as ideias do texto estão claramente
retome o que foi exposto, ou confirme a ideia principal, ou faça vinculadas a alguma reportagem ou notícia de jornais, revistas
uma citação de algum escritor ou alguém importante na área impressas ou eletrônicas, cujo conteúdo é conhecido por
relativa ao tema debatido. todos através do rádio ou da televisão, sendo, por sua vez,
inquestionável. A dissertação expositiva tem como objetivo
f) Crie um título que desperte o interesse e a curiosidade expor o fato, ficando em segundo plano a discussão sobre ele.
do leitor.
2. Argumentativa: A dissertação argumentativa é aquela
g) Formate seu texto em colunas e coloque entre elas uma
chamada (um importante e pequeno trecho do seu texto). que exige de nós maior reflexão ao escrever sobre certos temas,
mas que possui por objetivo a exposição do ponto de vista
h) Após o término do texto, releia e observe se nele você se pessoal. Quem disserta, através de sua opinião bem embasada,
posiciona claramente sobre o tema; se a ideia está fundamentada faz com que os fatos ali apresentados e discutidos tenham uma
em argumentos fortes e se estão bem desenvolvidos; se a conclusão. Esta é uma das maneiras mais difíceis de dissertar
linguagem está adequada ao gênero; se o texto apresenta título por apresentar juízos de valores que endossam a análise crítica
e se é convidativo e, por fim, observe se o texto como um todo de quem escreve.
é persuasivo.
Reescreva-o, se necessário. 3- Mista: Esta é uma forma de dissertação que tem
inseridos nela os elementos dos dois outros tipos dissertativos.
Argumentações de Artigos de Opinião Nela podemos expor os fatos como forma de exemplo, ou
Para facilitar ainda mais a elaboração do seu artigo, os mesmo como argumento de autoridade para dar força às
argumentos são fixados a esta estrutura e podem e as dicas opiniões, juízos e análise crítica a serem feitos sobre o tópico
para elaborar são as de: ou tópicos discutidos.

13
LÍNGUA PORTUGUESA
Fontes: http://pt.slideshare.net/ElieteFarneda/diferena- Comparando social, geográfica ou historicamente
entre-fato-e-opinio Também é apresentar uma analogia entre elementos, po-
http://lingua-agem.blogspot.com.br/2011/06/fato-algo- rém sem buscar no passado a argumentação. É comparar dois
cuja-existencia-independe-de.html países, dois fatos, duas personagens, enfim, comparar dois ele-
mentos, para comprovar o tema.
Questões Lembre-se de que se trata da introdução, portanto a compa-
ração apenas será apresentada para, no desenvolvimento, ser
01. Leia o texto e responda à pergunta. discutido cada elemento da comparação em um parágrafo.

Um pouco da história de Cecília Meireles Conceituando ou definindo uma ideia ou situação


Em alguns temas de dissertação surgem palavras-chave
Cecília Meireles é uma das grandes escritoras da literatura de extrema importância para a argumentação. Nesses casos,
brasileira. Ela nasceu no dia 7 de novembro de 1901, na cidade pode-se iniciar a redação com a definição dessa palavra, com
do Rio de Janeiro e eu nome completo era Cecília Benevides de o significado dela, para, posteriormente, no desenvolvimento,
Carvalho Meireles. Sua infância foi marcada pela dor e solidão, trabalhar com exemplos de comprovação.
pois perdeu a mãe com apenas três anos de idade e o pai não
chegou a conhecer (morreu antes do seu nascimento). Foi Contestando uma ideia ou citação, contradizendo,
criada pela avó dona Jacinta. Por volta dos nove anos de idade, em partes
Cecília começou a escrever suas primeiras poesias. Estudiosos Quando o tema apresenta uma ideia com a qual não se con-
de sua obra dizem que seus poemas encantam os leitores de corda inteiramente, pode-se trabalhar com este método: con-
todas as idades. cordar com o tema, em partes, ou seja, argumentar que a ideia
do tema é verdadeira, mas que existem controvérsias; discutir
Qual frase apresenta uma opinião sobre Cecília Meireles? que o assunto do tema é polêmico, que há elementos que o
(A) Foi criada pela avó Dona Jacinta comprovem, e elementos que discordem dele, igualmente.
(B) Nasceu no dia 7 de novembro de 1901. Não se esqueça de que o desenvolvimento tem que ser con-
(C) Perdeu a sua mãe com apenas três anos de idade. dizente com a introdução, estar em harmonia com ela, ou seja,
(D) Seus poemas encantam os leitores de todas as idades. se trabalhar com esse método, o desenvolvimento deve conter
as duas comprovações, cada uma em um parágrafo.
02. Leia o fragmento do texto O outro príncipe sapo de Jon
Scieszka e responda o que se pede: Refutando o tema, contradizendo totalmente
Refutar significa rebater os argumentos; contestar as asser-
Era uma vez um sapo. ções; não concordar com algo; reprovar; ser contrário a algo;
contrariar com provas; desmentir; negar. Portanto refutar o
Certo dia, quando estava sentado na sua vitória-régia, viu tema é escrever, na introdução, o contrário do que foi apre-
uma linda princesa descansando a beira do lago. O sapo pulou sentado pelo tema. Deve-se tomar muito cuidado, pois não é
dentro da água, foi nadando até ela e mostrou a cabeça por só escrever o contrário, mas mostrar que se é contra o que está
cima das plantas aquáticas. “Perdão, ó linda princesa”, disse ele escrito. O ideal, nesse caso, é iniciar a introdução com “Ao con-
com sua voz mais triste e patética... trário do que se acredita...”
Não se esqueça, novamente, de que o desenvolvimento tem
Qual é a opinião do autor a respeito da voz do sapo: que ser condizente com a introdução, estar em harmonia com
(A)voz mansa e suave ela, ou seja, se trabalhar com esse método, o desenvolvimen-
(B)estridente e aguda to deve conter apenas elementos contrários ao tema. Cuidado
(C)triste e melancólica para não cair em contradição. Se for, na introdução, favorável
(D)triste e patética ao tema, apresente, no desenvolvimento, apenas elementos
favoráveis a ele; se for contrário, apresente apenas elementos
Respostas contrários.
01. (D) / 02. (D)
Elaborando uma série de interrogações
Introdução Pode-se iniciar a redação com uma série de perguntas. Po-
rém, cuidado! Devem ser perguntas que levem a questiona-
A Introdução é a informação do assunto sobre o qual a dis- mentos e reflexões, e não perguntas vazias que levem a nada
sertação tratará. O parágrafo introdutório é fundamental, pre- ou apenas a respostas genéricas. As perguntas devem ser res-
cisa ser bem claro e chamar a atenção para os tópicos mais pondidas, no desenvolvimento, com argumentações coerentes
importantes do desenvolvimento. e importantes, cada uma em um parágrafo. Portanto use esse
O primeiro parágrafo da redação pode ser feito de diversas método apenas quando já possuir as respostas, ou seja, esco-
maneiras diferentes: lha primeiramente os argumentos que serão utilizados no de-
senvolvimento e elabore perguntas sobre eles, para funcionar
Trajetória histórica como introdução da dissertação.
Traçar a trajetória histórica é apresentar uma analogia entre Pode-se transformar a introdução em uma pergunta. O mes-
elementos do passado e do presente. Já que uma analogia será mo já citado anteriormente, mas com apenas uma pergunta.
apresentada, então os elementos devem ser similares; há de
haver semelhança entre os argumentos apresentados, ou seja, Elaborando uma enumeração de informações
só usaremos a trajetória histórica, quando houver um fato no Quando se tem certeza de que as informações são verídicas,
passado que seja comparável, de alguma maneira, a outro no podem-se usá-las na introdução e, depois, discuti-las, uma a
presente. uma, no desenvolvimento.
Quando apresentar a trajetória histórica na introdução,
deve-se discutir, no desenvolvimento, cada elemento em um Caracterizando espaços ou aspectos
só parágrafo. Não misture elementos de épocas diferentes em Pode-se iniciar a introdução com uma descrição de lugares
um mesmo parágrafo. A trajetória histórica torna convincente ou de épocas, ou ainda com uma narração de fatos. Deve ser
a exemplificação; só se deve usar esse argumento, se houver uma curta descrição ou narração, somente para iniciar a reda-
conhecimento que legitime a fonte histórica. ção de maneira interessante, curiosa. Não se empolgue! Não
transforme a dissertação em descrição, muito menos em nar-
ração.

14
LÍNGUA PORTUGUESA
Resumo do que será apresentado no desenvolvi- língua dita culta, a correta, a ideal, não importa o nome que
mento se lhe dê.
Uma das maneiras mais fáceis de elaborar a introdução é O padrão de língua ideal a que as pessoas querem chegar é
apresentar o resumo do que se vai discutir no desenvolvimen- aquele convencionalmente utilizado nas instâncias públicas de
to. Nesse caso, é necessário planejar cuidadosamente a redação uso da linguagem, como livros, revistas, documentos, jornais,
toda, antes de começá-la, pois, na introdução, serão apresen- textos científicos e publicações oficiais; em suma, é a que circula
tados os tópicos a serem discutidos no desenvolvimento. Deve- nos meios de comunicação, no âmbito oficial, nas esferas de
-se tomar o cuidado para não se apresentarem muitos tópicos, pesquisa e trabalhos acadêmicos.
senão a dissertação será somente expositiva e não argumenta- Não obstante, os linguistas entendem haver uma língua
tiva. Cada tópico apresentado na introdução deve ser discutido circulante que é correta mas diferente da língua ideal e
no desenvolvimento em um parágrafo inteiro. Não se devem imaginária, fixada nas fórmulas e sistematizações da gramática.
misturá-los em um parágrafo só, nem utilizar dois ou mais pa- Eles fazem, pois, uma distinção entre o real e o ideal: a língua
rágrafos, para se discutir um mesmo assunto. O ideal é que concreta com todas suas variedades de um lado, e de outro
sejam apresentados somente dois ou três temas para discussão. um padrão ou modelo abstrato do que é “bom” e “correto”, o
que conformaria, no seu entender, uma língua artificial, situada
Paráfrase num nível hipotético.
Uma maneira de se elaborar a introdução é valendo-se da Para os cientistas da língua, portanto, fica claro que há
paráfrase, que consiste em reescrever o tema, utilizando suas dois estratos diferenciados: um praticamente intangível,
próprias palavras. Deve-se tomar o cuidado, para não apenas representado nas normas preconizadas pela gramática
substituírem as palavras do tema por sinônimos, pois isso será tradicional, que comporta as irregularidades e excrescências da
demonstração de falta de criatividade; o melhor é reestruturar língua, e outro concreto, o utilizado pelos falantes cultos, qual
totalmente o tema, realmente utilizando “suas” palavras. seja, a “linguagem concretamente empregada pelos cidadãos
Observe o que traz o Michaelis - Moderno Dicionário da Lín- que pertencem aos segmentos mais favorecidos da nossa
gua Portuguesa, quanto à definição da palavra paráfrase: Ex- população”, segundo Marcos Bagno.
plicação ou tradução mais desenvolvida de um texto por meio Convém esclarecer que para a ciência sociolinguística
de palavras diferentes das nele empregadas. Portanto sua frase somente a pessoa que tiver formação universitária completa
deve ser mais desenvolvida que a frase apresentada como tema, será caracterizada como falante culto(urbano).
e as palavras devem ser diferentes, e não sinônimas. Sendo assim, como são presumivelmente cultos os sujeitos
que produzem os jornais, a documentação oficial, os trabalhos
Frases-modelo, para o início da introdução científicos, só pode ser culta a sua linguagem, mesmo que a
Não tomem estas frases como receita infalível. Antes de usá- língua que tais pessoas falam e os textos que produzem nem
-las, analise bem o tema, planeje incansavelmente o desenvol- sempre se coadunem com as regras rígidas impostas pela
vimento, use sua inteligência, para ter certeza daquilo que será gramática normativa, divulgada na escola e em outras instâncias
incluso em sua dissertação. Só depois disso, use estas frases: (de repressão linguística) como o vestibular.
É de conhecimento geral que... Isso é o que pensam os linguistas. E o povo – saberá ele
Todos sabem que, em nosso país, há tempos, observa-se... fazer a distinção entre as duas modalidades e os dois termos
Nesse caso, utilizei circunstância de lugar (em nosso país) que as descrevem?
e de tempo (há tempos). Isso é só para mostrar que é possível Para os linguistas, a língua-padrão se estriba nas normas
acrescentar circunstâncias diversas na introdução, não necessa- e convenções agregadas num corpo chamado de gramática
riamente estas que aqui estão. Outro elemento com o qual se tradicional e que tem a veleidade de servir de modelo de
deve tomar muito cuidado é o pronome “se”. Nesse caso, ele é correção para toda e qualquer forma de expressão linguística.
partícula apassivadora, portanto o verbo deverá concordar com Querer que todos falem e escrevam da mesma forma e de
o elemento que vier à frente (singular ou plural). acordo com padrões gramaticais rígidos é esquecer-se que não
pode haver homogeneidade quando o mundo real apresenta
Cogita-se, com muita frequência, de... uma heterogeneidade de comportamentos linguísticos, todos
O mesmo raciocínio da anterior, agora com a circunstância de igualmente corretos (não se pode associar “correto” somente
modo (com muita frequência). a culto).
Muito se tem discutido, recentemente, acerca de... Em suma: há uma realidade heterogênea que, por abrigar
Muito se debate, hoje em dia... diferenças de uso que refletem a dinâmica social, exclui a
possibilidade de imposição ou adoção como única de uma
Partícula apassivadora novamente. Cuidado com a concor- língua-modelo baseada na gramática tradicional, a qual,
dância. por sua vez, está ancorada nos grandes escritores da língua,
sobretudo os clássicos , sendo pois conservadora. E justamente
O (A)... é de fundamental importância em... por se valer de escritores é que as prescrições gramaticais se
É de fundamental importância o (a)... impõem mais na escrita do que na fala.
É indiscutível que... / É inegável que... “ A cultura escrita, associada ao poder social , desencadeou
Muito se discute a importância de... também, ao longo da história, um processo fortemente
Comenta-se, com frequência, a respeito de... unificador (que vai alcançar basicamente as atividades verbais
Não raro, toma-se conhecimento, por meio de..., de escritas), que visou e visa uma relativa estabilização linguística,
Apesar de muitos acreditarem que... (refutação) buscando neutralizar a variação e controlar a mudança.
Ao contrário do que muitos acreditam... (refutação) Ao resultado desse processo, a esta norma estabilizada,
Pode-se afirmar que, em razão de... (devido a, pelo)... costumamos dar o nome de norma-padrão ou língua-padrão”
Ao fazer uma análise da sociedade, busca-se descobrir as cau- (Faraco, Carlos Alberto).
sas de... Aryon Rodrigues entra na discussão: “Frequentemente o
Talvez seja difícil dizer o motivo pelo qual... padrão ideal é uma regra de comportamento para a qual tendem
Ao analisar o (a, os, as)..., é possível conhecer o (a, os, as)...., os membros da sociedade, mas que nem todos cumprem, ou
pois... não cumprem integralmente”. Mais adiante, ao se referir à
Norma Culta e Língua-Padrão escola, ele professa que nem mesmo os professores de Língua
Portuguesa escapam a esse destino: “Comumente, entretanto,
De acordo com M. T. Piacentini, mesmo que não se mencione o mesmo professor que ensina essa gramática não consegue
terminologia específica, é evidente que se lida no dia-a-dia com observá-la em sua própria fala nem mesmo na comunicação
níveis diferentes de fala e escrita. É também verdade que as dentro de seu grupo profissional ”.
pessoas querem “falar e escrever melhor”, querem dominar a Vamos ilustrar os argumentos acima expostos. Não há

15
LÍNGUA PORTUGUESA
brasileiro – nem mesmo professores de português – que não cumpre o papel de impedir a fragmentação dialetal; ensinada
fale assim: pela escola; usada na escrita em gêneros discursivos em que há
– Me conta como foi o fim de semana… maior formalidade aproximando-a dos padrões da prescrição
– Te enganaram, com certeza! da gramática tradicional; a mais empregada na literatura
– Me explica uma coisa: você largou o emprego ou foi e também pelas pessoas cultas em diferentes situações de
mandado embora? formalidade; indicada precisamente nas marcas de gênero,
número e pessoa; usada em todas as pessoas verbais, com
Ou mesmo assim: exceção, talvez, da 2ª do plural, sendo utilizada principalmente
– Tive que levar os gatos, pois encontrei eles bem na linguagem dos sermões; empregada em todos os modos
machucados. verbais em relação verbal de tempos e modos; possuindo uma
– Conheço ela há muito tempo – é ótima menina. enorme riqueza de construção sintática, além de uma maior
– Acho que já lhe conheço, rapaz. utilização da voz passiva; grande o emprego de preposições nas
regências aproveitando a organização gramatical cuidada da
Então, se os falantes cultos, aquelas pessoas que têm acesso frase.
às regras padronizadas, incutidas no processo de escolarização, De modo geral, um falante culto, em situação comunicativa
se exprimem desse modo, essa é a norma culta. Já as formas formal, buscará seguir as regras da norma explícita de sua
propugnadas pela gramática tradicional e que provavelmente língua e ainda procurará seguir, no que diz respeito ao léxico,
só se encontrariam na escrita (conta-me como foi /enganaram- um repertório que, se não for erudito, também não será
te / explica-me uma coisa / pois os encontrei / conheço-a há vulgar. Isso configura o que se entende por norma culta. A
tempos / acho que já o conheço) configuram a norma-padrão Norma Padrão está vinculada a uma língua modelo. Segue
ou língua-padrão. prescrições representadas na gramática, mas é marcada pela
Se para os cientistas da língua, portanto, existe uma língua produzida em certo momento da história e em uma
polarização entre a norma-padrão (também denominada determinada sociedade. Como a língua está em constante
“norma canônica” por alguns linguistas) e o conjunto das mudança, diferentes formas de linguagem que hoje não são
variedades existentes no Brasil, aí incluída a norma culta, no consideradas pela Norma Padrão, com o tempo podem vir a se
senso comum não se faz distinção entre padrão e culta. Para os legitimar.
leigos, a população em geral, toda forma elevada de linguagem, Dentro da Norma Padrão define-se um modelo de língua
que se aproxime dos padrões de prestígio social, configura a idealizada prescrito pelas gramáticas normativas, como sendo
norma culta. uma receita que nenhum usuário da língua emprega na fala
e raramente utiliza na escrita. Sendo também uma referência
Norma culta, norma padrão e norma popular para os falantes da Norma Culta, mas não passam de um ideal a
ser alcançado, pois é um padrão extremamente enriquecido de
A Norma é um uso linguístico concreto e corresponde ao língua. Assim, as gramáticas tradicionais descrevem a Norma
dialeto social praticado pela classe de prestígio, representando Padrão, não refletindo o uso que se faz realmente do Português
a atitude que o falante assume em face da norma objetiva. A no Brasil.
normatização não existe por razões apenas linguísticas, mas Marcos Bagno propõe, como alternativa, uma triangulação:
também culturais, econômicas, sociais, ou seja, a Norma na onde a Norma Popular teria menos prestígio opondo-se à Norma
língua origina-se de fatores que envolvem diferenças de classes, Culta mais prestigiada, e a Norma Padrão se eleva sobre as duas
poder, acesso a educação escrita, e não da qualidade da forma anteriores servindo como um ideal imaginário e inatingível.
da língua. Há um conceito amplo e um conceito estreito de A Norma Padrão subdivide-se em: Formal e Coloquial. A
Norma. No primeiro caso, ela é entendida como um fator de Padrão Formal é o modelo culto utilizado na escrita, que segue
coesão social. No segundo, corresponde concretamente aos rigidamente as regras gramaticais.
usos e aspirações da classe social de prestígio. Num sentido Essa linguagem é mais elaborada, tanto porque o falante
amplo, a norma corresponde à necessidade que um grupo tem mais tempo para se pronunciar de forma refletida como
social experimenta de defender seu veículo de comunicação porque é supervalorizada na nossa cultura. É a história do vale o
das alterações que poderiam advir no momento do seu que está escrito. Já a Padrão Coloquial é a versão oral da língua
aprendizado. Num sentido restrito, a Norma corresponde aos culta e, por ser mais livre e espontânea, tem um pouco mais de
usos e atitudes de determinado seguimento da sociedade, liberdade e está menos presa à rigidez das regras gramaticais.
precisamente aquele que desfruta de prestígio dentro da Nação, Entretanto, a margem de afastamento dessas regras é estreita
em virtude de razões políticas, econômicas e culturais. Segundo e, embora exista, a permissividade com relação às transgressões
Lucchesi considera-se que a realidade linguística brasileira deve é pequena.
ser entendida como um contínuo de normas, dentro do quadro Assim, na linguagem coloquial, admitem-se sem grandes
de bipolarização do Português do Brasil. traumas, construções como: ainda não vi ele; me passe o
A existência da civilização dá-se com o surgimento da arroz e não te falei que você iria conseguir?. Inadmissíveis na
escrita. Suas regras são pautadas a partir da Norma Culta. língua escrita. O falante culto, de modo geral, tem consciência
Sendo esta importante nos documentos formais que exigem dessa distinção e ao mesmo tempo em que usa naturalmente
a correta expressão do Português para que não haja mal as construções acima na comunicação oral, evita-as na escrita.
entendido algum. Ela nada mais é do que a modalidade Contudo, como se disse, não são muitos os desvios admitidos
linguística escolhida pela elite de uma sociedade como modelo e muitas formas peculiares da Norma Popular são condenadas
de comunicação escrita e verbal. mesmo na linguagem oral. A Norma Popular é aquela linguagem
A Norma Culta é uma expressão empregada pelos linguistas que não é formal, ou seja, não segue padrões rígidos, é a
brasileiros para designar o conjunto de variantes linguísticas linguagem popular, falada no cotidiano.
efetivamente faladas, na vida cotidiana pelos falantes cultos, O nível popular está associado à simplicidade da utilização
sendo assim classificando os cidadãos nascidos e criados em linguística em termos lexicais, fonéticos, sintáticos e semânticos.
zonas urbanas e com grau de instrução superior completo. Esta decorrerá da espontaneidade própria do discurso oral
“Fundamentam-se as regras da Gramática Normativa nas obras e da natural economia linguística. É utilizado em contextos
dos grandes escritores, em cuja linguagem a classe ilustrada informais.
põe o seu ideal de perfeição, porque nela é que se espelha o que Dentre as características da Norma Popular podemos
o uso idiomático e consagrou”. (ROCHA LIMA). destacar: economia nas marcas de gênero, número e pessoa;
Dentre as características que são pertinentes à Norma Culta redução das pessoas gramaticais do verbo; mistura da 2ª com
podemos citar que é: a variante de maior prestígio social na a 3ª pessoa do singular; uso intenso da expressão a gente em
comunidade, sendo realizada com certa uniformidade pelos lugar de eu e nós; redução dos tempos da conjugação verbal
membros do grupo social de padrão cultural mais elevado; e de certas pessoas, como a perda quase total do futuro do

16
LÍNGUA PORTUGUESA
presente e do pretérito-mais-que-perfeito no indicativo; do Disponível em:. Acesso em:<http://1.folha.uol.com.br/
presente do subjuntivo; do infinitivo pessoal; falta de correlação colunas/gregorioduvivier/2016/04/1759507-festejando-no-
verbal entre os tempos; redução do processo subordinativo em precipiicio-.shtm,> 11 abr. 2016.
benefício da frase simples e da coordenação; maior emprego
da voz ativa em lugar da passiva; predomínio das regências Um dos fatores de textualidade usados pelo autor é a
verbais diretas; simplificação gramatical da frase; emprego dos intertextualidade, materializada
pronomes pessoais retos como objetos. a) nas referências aos traumas de sua infância.
Na visão de Preti, os falantes cultos “até em situação de b) na alusão à caótica crise brasileira
gravação consciente revelaram uma linguagem que, em geral, c) na citação da revista “The Economist”.
também pertence a falantes comuns”. Sendo mais espontânea d) na menção à sua prima e à sua irmã.
e criativa, a Norma Popular se afigura mais expressiva e
dinâmica. Temos, assim, alguns exemplos: estou preocupado 2. (Pref. De Teresina – PI – Professor – Português
(Norma Culta); to preocupado (Norma Popular); to grilado – NUCEPE/2016)
(gíria, limite da Norma Popular).
Não basta conhecer apenas uma modalidade de língua; urge
conhecer a língua popular, captando-lhe a espontaneidade,
expressividade e enorme criatividade para viver, necessitando
conhecer a língua culta para conviver.

Fonte:https://centraldefavoritos.wordpress.
com/2011/07/22/norma-padrao-e-nao-padrao/(Adaptado)

Questões

1. (Pref. De Goiânia – Auxiliar de Atividades


Educativas – CS-UFG/2016)

Festejando no precipício
Gregório Duvivier

Quando pequeno, a primeira coisa que fazia ao comprar


uma agenda era escrever em letras garrafais no dia 11 de abril:
“MEU NIVER”. Depois ia pro dia 11 de março: “FALTA UM
MÊS PRO MEU NIVER”. E depois me esquecia da existência
da agenda, até porque não tinha muitos compromissos naquela
época. Tenho umas cinco agendas que só contêm essas duas
informações fundamentais.
O aniversário era o grande dia do ano, a maior festa popular O quarto quadrinho do texto apresenta o conectivo mas,
do planeta, um Natal em que o Jesus era eu. Pulava da cama que normalmente opõe duas ideias contrárias. Esse recurso
e marcava minha altura no batente da porta. Era o dia de linguístico como fator de textualidade realiza uma
comemorar cada milímetro avançado nessa guerra que travo a) coesão referencial.
desde pequeno contra a gravidade. b) coerência argumentativa.
Meu pai abria a porta: “Hoje a gente vai pro lugar que você c) coesão sequencial.
quiser”. “Oba! Vamos pro Tivoli Park!” “Não, filho, pro Tivoli d) coerência narrativa.Parte inferior do formulário
Park não.” “Mas você falou qualquer lugar.” “No Tivoli Park tem
assalto no trem fantasma.” Era um argumento forte. Respostas
Acabava me levando pro clube, e depois minha mãe dava
uma festa lá em casa na qual eu era o centro das atenções e 1. (C)
podia comer brigadeiro e tomar litros de refrigerante — ambos Intertextualidade: é a relação que se estabelece entre
artigos proibidos, classificados como “porcaria” — e assistir dois textos quando um deles faz referência a elementos
ao show do meu artista predileto — o mágico Almik. Na hora existentes no outro. Esses elementos podem dizer respeito ao
do parabéns, me escondia debaixo da mesa quando cantavam conteúdo, à forma, ou mesmo forma e conteúdo.
“Com Quem Será?”, mas até que gostava da ideia de que um dia O texto “festejando no precipício”, no último parágrafo, faz
alguém talvez fosse querer se casar comigo. Para um garoto com referência a outro texto, presente na revista “The Economist”.
cabelo de cuia e uma dentição anárquica, um relacionamento
amoroso era um sonho tão distante quanto um McDonalds 2. (C)
dentro de casa. O tempo passou e a verdade veio à tona: ambas Coesão REFERENCIAL - faz referência a algo que JÁ FOI
as coisas talvez sejam possíveis, mas será que são desejáveis? DITO na frase/oração (coesão anafórica) ou algo que ainda
Hoje faço trinta. Dizem que com o passar dos anos deixa NAO foi dito e vai ser explicado a frente na frase (catafórica) e
de fazer sentido comemorar o passar dos anos. Afinal, cada também pode ser uma ideia FORA DO TEXTO (exofórica).
ano a mais é um ano a menos e na vida adulta não há nem EX: Atenção e ESTA ideia: fumar é prejudicial. (ESTA refere
mais a esperança de crescer algum centímetro. No batente da ao termo posterior “fumar é prejudicial” - catafórica)
porta, estacionei no 1.69 m, entre minha prima Helena e minha Fumar é prejudicial, atenção a ESSA ideia. (ESSA refere ao
irmã Barbara. Para piorar, o Brasil tá um caos, todo o mundo se termo a anterior” fumar é prejudicial” - anafórica)
odeia, e a temperatura do mundo não para de esquentar.
Lembro que a revista “The Economist” ficou chocada que o Língua falada e escrita
Brasil teria Carnaval mesmo na crise —estaríamos “festejando
no precipício”. A revista pode entender de crise, mas não Não devemos confundir língua com escrita, pois são dois
entende nada de Carnaval — acha que serve para comemorar meios de comunicação distintos. A escrita representa um estágio
a opulência. Toda festa boa serve pra esquecer, nem que seja posterior de uma língua. A língua falada é mais espontânea,
por um momento, o precipício. Debaixo da mesa do bolo, a abrange a comunicação linguística em toda sua totalidade.
felicidade parece tão possível, tão desejável. Além disso, é acompanhada pelo tom de voz, algumas vezes
por mímicas, incluindo-se fisionomias. A língua escrita não é

17
LÍNGUA PORTUGUESA
apenas a representação da língua falada, mas sim um sistema - A redundância é um recurso estilístico
mais disciplinado e rígido, uma vez que não conta com o jogo - Comunicação unilateral.
fisionômico, as mímicas e o tom de voz do falante. - Ganha em permanência
No Brasil, por exemplo, todos falam a língua portuguesa, - Mais correção na elaboração das frases.
mas existem usos diferentes da língua devido a diversos fatores. - Evita a improvisação
Dentre eles, destacam-se: - Pobreza de recursos não-linguísticos; uso de letras, sinais
de pontuação
Fatores regionais: é possível notar a diferença do - É mais precisa e elaborada.
português falado por um habitante da região nordeste e - Ausência de cacoetes linguísticos e vulgarismos
outro da região sudeste do Brasil. Dentro de uma mesma - O contexto extralinguístico tem menos influência
região, também há variações no uso da língua. No estado do
Rio Grande do Sul, por exemplo, há diferenças entre a língua Registros da língua falada
utilizada por um cidadão que vive na capital e aquela utilizada
por um cidadão do interior do estado. Há pelo menos dois níveis de língua falada: a culta ou
padrão e a coloquial ou popular. A linguagem coloquial também
Fatores culturais: o grau de escolarização e a formação aparece nas gírias, na linguagem familiar, na linguagem vulgar
cultural de um indivíduo também são fatores que colaboram e nos regionalismos e dialetos.
para os diferentes usos da língua. Uma pessoa escolarizada Essas variações são explicadas por vários fatores:
utiliza a língua de uma maneira diferente da pessoa que não - Diversidade de situações em que se encontra o falante:
teve acesso à escola. uma solenidade ou uma festa entre amigos.
- Grau de instrução do falante e também do ouvinte.
Fatores contextuais: nosso modo de falar varia de - Grupo a que pertence o falante. Este é um fator
acordo com a situação em que nos encontramos: quando determinante na formação da gíria.
conversamos com nossos amigos, não usamos os termos que - Localização geográfica: há muitas diferenças entre o
usaríamos se estivéssemos discursando em uma solenidade de falar de um nordestino e o de um gaúcho, por exemplo. Essas
formatura. diferenças constituem os regionalismos e os dialetos.

Fatores profissionais: o exercício de algumas atividades Atenção: o dialeto é a variedade regional de uma língua.
requer o domínio de certas formas de língua chamadas línguas Quando as diferenças regionais não são suficientes para
técnicas. Abundantes em termos específicos, essas formas constituir um dialeto, utiliza-se os termos regionalismos ou
têm uso praticamente restrito ao intercâmbio técnico de falares para designá-las. E as pichações têm características da
engenheiros, químicos, profissionais da área de direito e da linguagem falada.
informática, biólogos, médicos, linguistas e outros especialistas.
Linguagem Verbal e Não Verbal
Fatores naturais: o uso da língua pelos falantes sofre
influência de fatores naturais, como idade e sexo. Uma criança Linguagem é a capacidade que possuímos de expressar
não utiliza a língua da mesma maneira que um adulto, daí nossos pensamentos, ideias, opiniões e sentimentos. Está
falar-se em linguagem infantil e linguagem adulta. relacionada a fenômenos comunicativos; onde há comunicação,
há linguagem. Podemos usar inúmeros tipos de linguagens
Enquanto a língua falada é espontânea e natural, a língua para estabelecermos atos de comunicação, tais como: sinais,
escrita precisa seguir algumas regras. Embora sejam expressões símbolos, sons, gestos e regras com sinais convencionais
de um mesmo idioma, cada uma tem a sua especificidade. A (linguagem escrita e linguagem mímica, por exemplo). Num
língua falada é a mais natural, aprendemos a falar imitando sentido mais genérico, a linguagem pode ser classificada como
o que ouvimos. A língua escrita, por seu lado, só é aprendida qualquer sistema de sinais que se valem os indivíduos para
depois que dominamos a língua falada. E ela não é uma simples comunicar-se.
transcrição do que falamos; está mais subordinada às normas A linguagem pode ser:
gramaticais. Portanto requer mais atenção e conhecimento de
quem fala. Além disso, a língua escrita é um registro, permanece - Verbal: aquela que faz uso das palavras para comunicar
ao longo do tempo, não tem o caráter efêmero da língua falada. algo.

Diferenças existentes entre a língua falada e a


escrita

Língua Falada:

- Palavra sonora;
- Requer a presença dos interlocutores;
- Ganha em vivacidade; As figuras acima nos comunicam sua mensagem através da
- É espontânea e imediata; linguagem verbal (usa palavras para transmitir a informação).
- Uso de palavras-curinga, de frases feitas;
- É repetitiva e redundante; - Não Verbal: aquela que utiliza outros métodos de
- O contexto extralinguístico é importante; comunicação, que não são as palavras. Dentre elas estão: a
- A expressividade permite prescindir de certas regras; linguagem de sinais, as placas e sinais de trânsito, a linguagem
- A informação é permeada de subjetividade e influenciada corporal, uma figura, a expressão facial, um gesto, etc.
pela presença do interlocutor.
- Recursos: signos acústicos e extralinguísticos, gestos,
entorno físico e psíquico

Língua Escrita:
- Palavra gráfica
- É mais objetiva.
- É possível esquecer o interlocutor
- É mais sintética.

18
LÍNGUA PORTUGUESA
Essas figuras fazem uso apenas de imagens para comunicar Signo
o que representam.
É um elemento representativo que apresenta dois aspectos:
A Língua é um instrumento de comunicação, sendo o significado e o significante. Ao escutar a palavra
composta por regras gramaticais que possibilitam que “cachorro”, reconhecemos a sequência de sons que formam
determinado grupo de falantes consiga produzir enunciados essa palavra. Esses sons se identificam com a lembrança
que lhes permitam comunicar-se e compreender-se. Por deles que está em nossa memória. Essa lembrança constitui
exemplo: falantes da língua portuguesa. uma real imagem sonora, armazenada em nosso cérebro que
Não devemos confundir língua com escrita, pois são dois é o significante do signo “cachorro”. Quando escutamos essa
meios de comunicação distintos. A escrita representa um está- palavra, logo pensamos em um animal irracional de quatro
gio posterior de uma língua. A língua falada é mais espontâ- patas, com pelos, olhos, orelhas, etc. Esse conceito que nos
nea, abrange a comunicação linguística em toda sua totalidade. vem à mente é o significado do signo “cachorro” e também se
Além disso, é acompanhada pelo tom de voz, algumas vezes encontra armazenado em nossa memória.
por mímicas, incluindo-se fisionomias. A língua escrita não Ao empregar os signos que formam a nossa língua,
é apenas a representação da língua falada, mas sim um sistema devemos obedecer às regras gramaticais convencionadas pela
mais disciplinado e rígido, uma vez que não conta com o jogo própria língua. Desse modo, por exemplo, é possível colocar o
fisionômico, as mímicas e o tom de voz do falante. No Brasil, artigo indefinido “um” diante do signo “cachorro”, formando
por exemplo, todos falam a língua portuguesa, mas existem a sequência “um cachorro”, o mesmo não seria possível se
usos diferentes da língua devido a diversos fatores. Dentre eles, quiséssemos colocar o artigo “uma” diante do signo “cachorro”. A
destacam-se: sequência “uma cachorro” contraria uma regra de concordância
da língua portuguesa, o que faz com que essa sentença seja
- Fatores Regionais: é possível notar a diferença do por- rejeitada. Os signos que constituem a língua obedecem a
tuguês falado por um habitante da região nordeste e outro da padrões determinados de organização. O conhecimento de
região sudeste do Brasil. Dentro de uma mesma região, tam- uma língua engloba tanto a identificação de seus signos, como
bém há variações no uso da língua. No estado do Rio Grande do também o uso adequado de suas regras combinatórias.
Sul, por exemplo, há diferenças entre a língua utilizada por um Signo: elemento representativo que possui duas partes
cidadão que vive na capital e aquela utilizada por um cidadão indissolúveis: significado e significante. Significado (é o
do interior do estado. conceito, a ideia transmitida pelo signo, a parte
- Fatores Culturais: o grau de escolarização e a formação abstrata do signo) + Significante (é a imagem sonora,
cultural de um indivíduo também são fatores que colaboram a forma, a parte concreta do signo, suas letras e seus
para os diferentes usos da língua. Uma pessoa escolarizada uti- fonemas).
liza a língua de uma maneira diferente da pessoa que não teve Língua: conjunto de sinais baseado em palavras que
acesso à escola. obedecem às regras gramaticais.
- Fatores Contextuais: nosso modo de falar varia de acor- Fala: uso individual da língua, aberto à criatividade e ao
do com a situação em que nos encontramos: quando conversa- desenvolvimento da liberdade de expressão e compreensão.
mos com nossos amigos, não usamos os termos que usaríamos
se estivéssemos discursando em uma solenidade de formatura. Textos Não Verbais: Leituras de Imagens
- Fatores Profissionais: o exercício de algumas ativi-
dades requer o domínio de certas formas de língua chamadas Existem diversas formas de discursos e textos, para cada
línguas técnicas. Abundantes em termos específicos, essas um deles há características específicas e diferentes formas de
formas têm uso praticamente restrito ao intercâmbio técnico de interpretação. Os textos imagéticos, construídos por imagens
engenheiros, químicos, profissionais da área de direito e da in- e algumas vezes por imagens e palavras, ganharam grande
formática, biólogos, médicos, linguistas e outros especialistas. destaque nas últimas décadas e têm sido cada vez mais
- Fatores Naturais: o uso da língua pelos falantes sofre utilizados.
influência de fatores naturais, como idade e sexo. Uma crian- A simbologia é uma forma de comunicação não verbal que
ça não utiliza a língua da mesma maneira que um adulto, daí consegue, por meio de símbolos gráficos populares, transmitir
falar-se em linguagem infantil e linguagem adulta. mensagens e exprimir ideias e conceitos em uma linguagem
figurativa ou abstrata. A capacidade de reconhecimento e
Fala interpretação das imagens/símbolos é determinada pelo
conhecimento de cada pessoa.
É a utilização oral da língua pelo indivíduo. É um ato
individual, pois cada indivíduo, para a manifestação da fala,
pode escolher os elementos da língua que lhe convém, conforme
seu gosto e sua necessidade, de acordo com a situação, o
contexto, sua personalidade, o ambiente sociocultural em que
vive, etc. Desse modo, dentro da unidade da língua, há uma
grande diversificação nos mais variados níveis da fala. Cada Variedades linguísticas.
indivíduo, além de conhecer o que fala, conhece também o
que os outros falam; é por isso que somos capazes de dialogar
com pessoas dos mais variados graus de cultura, embora nem Comunicação
sempre a linguagem delas seja exatamente como a nossa.
Devido ao caráter individual da fala, é possível observar Comunicação é uma palavra derivada do termo latino
alguns níveis: “communicare”, que significa “partilhar, participar algo, tornar
comum”.
- Nível Coloquial-Popular: é a fala que a maioria das Através da comunicação, os seres humanos e os animais
pessoas utiliza no seu dia a dia, principalmente em situações partilham diferentes informações entre si, tornando o ato de
informais. Esse nível da fala é mais espontâneo, ao utilizá-lo, comunicar uma atividade essencial para a vida em sociedade.
não nos preocupamos em saber se falamos de acordo ou não Desde o princípio dos tempos, a comunicação foi de
com as regras formais estabelecidas pela língua. importância vital, sendo uma ferramenta de integração,
- Nível Formal-Culto: é o nível da fala normalmente instrução, de troca mútua e desenvolvimento. O processo de
utilizado pelas pessoas em situações formais. Caracteriza-se comunicação consiste na transmissão de informação entre
por um cuidado maior com o vocabulário e pela obediência às um emissor e um receptor que descodifica (interpreta) uma
regras gramaticais estabelecidas pela língua. determinada mensagem.

19
LÍNGUA PORTUGUESA
A mensagem é codificada num sistema de sinais definidos Mensagem – aquilo que se quer comunicar;
que podem ser gestos, sons, indícios, uma língua natural Canal – o veículo que leva a mensagem;
(português, inglês, espanhol, etc.), ou outros códigos que Receptor – quem recebe, decodifica e interpreta o
possuem um significado (por exemplo, as cores do semáforo), significado.
e transportada até o destinatário através de um canal de Sabe-se que existe hoje um sistema de comunicação
comunicação (o meio por onde circula a mensagem, seja por complexo, com transmissões de mensagens através de códigos
carta, telefone, comunicado na televisão, etc.). variados, canais e veículos cada vez mais rápidos e eficientes.
Nesse processo podem ser identificados os seguintes
elementos: emissor, receptor, código (sistema de sinais) e canal Comunicação humana
de comunicação. Um outro elemento presente no processo Na comunicação humana, o código é a linguagem, que na
comunicativo é o ruído, caracterizado por tudo aquilo que afeta conversação é complementada por elementos da comunicação
o canal, perturbando a perfeita captação da mensagem (por não-verbal (gestos, expressões faciais, movimentos dos olhos
exemplo, falta de rede no celular). e do corpo, etc) e o canal utilizado é o ar que respiramos. No
Quando a comunicação se realiza por meio de uma processo de conversação, existe o feedback, representado pela
linguagem falada ou escrita, denomina-se comunicação verbal. resposta do receptor no momento em que responde, o receptor
É uma forma de comunicação exclusiva dos seres humanos e a inverte o processo e passa a ser o emissor, e aquele que antes
mais importante nas sociedades humanas. emitia passa a ser o receptor, que irá decodificar e interpretar
As outras formas de comunicação que recorrem a sistemas a nova mensagem. É esta inversão do processo que permite a
de sinais não-linguísticos, como gestos, expressões faciais, uma pessoa saber se a outra entendeu a sua mensagem.
imagens, etc., são denominadas comunicação não-verbal.
Alguns ramos da comunicação são: a teoria da informação, Linguagem
comunicação intrapessoal, comunicação interpessoal, A linguagem é, ao mesmo tempo, uma função e um
marketing, publicidade, propaganda, relações públicas, análise aprendizado: uma função no sentido de que todo ser humano
do discurso, telecomunicações e Jornalismo. normal fala e a linguagem constitui um instrumento necessário
O termo “comunicação” também é usado no sentido de para ele; um aprendizado, pois o sistema simbólico lingüístico,
ligação entre dois pontos, por exemplo, os meios de transporte que a criança deve assimilar, é adquirido progressivamente
que fazem a comunicação entre duas cidades ou os meios pelo contato com o meio. Essa aquisição ocorre durante
técnicos de comunicação (telecomunicações). toda a infância, no que o aprendizado da linguagem difere,
fundamentalmente, do aprendizado da marcha ou da preensão,
Tipos de comunicação que constituem a seqüência necessária do desenvolvimento
É possível classificar a comunicação conforme o número de biológico; A linguagem é um aprendizado cultural e está ligada
pessoas que estão envolvidas por ela. ao meio da criança.

Comunicação Intrapessoal = a pessoa se comunica COMUNICAÇÃO VERBAL


com ela mesma por meio de pensamentos, ou da escrita em Existem inúmeras formas de se trocar informações, ou seja,
diários pessoais. de se comunicar. Uma das mais eficazes para o ser humano
é a comunicação verbal, que ocorre quando um grupo de
Comunicação Interpessoal = refere-se à troca de indivíduos com interesses comuns ou correlatos se reúne.
informações entre duas pessoas. Pode ocorrer em conversas
presenciais, por carta, e-mail ou telefone. A comunicação oral
Em reuniões sociais, sejam elas formais ou informais, as
Comunicação em Grupo = indica o processo de informações são trocadas através da comunicação oral, a mais
comunicação entre três pessoas ou mais. Acontece no ensino, importante para a transmissão das idéias. Existe a oportunidade
em palestras, teleconferências ou discursos. de aprofundar os detalhes de maior interesse relacionados à
informação oferecida, bem como a possibilidade de se obter
Comunicação de Massa = tem a pretensão de atingir um a repetição ou o detalhamento de uma informação não
grande público não especificamente identificado, é realizada de completamente entendida. Podem também ser apresentadas
forma coletiva e não focalizada a uma única pessoa. É conhecida observações ou pontos de vista capazes de enriquecer a
como sendo “um-para-muitos”, possibilitando respostas informação inicial, tornado-a mais clara, concisa e completa.
limitadas do público. Exemplos desse tipo de comunicação: O desembaraço na conversa informal do dia a dia, pouco
jornais, revistas, filmes e televisão. tem a ver com o desempenho na comunicação verbal, como
forma de intercambiar informações. É difícil para a maioria dos
Comunicação Dirigida = é caracterizada pela seleção profissionais de qualquer área, utilizar adequadamente essa
prévia de públicos (ou segmentos de mercado), ou seja, potente modalidade de comunicação. Isto é conseqüência do
direciona-se a um público homogêneo identificado (por simples fato de que a formação e o treinamento das pessoas são
exemplo, mala-direta para um grupo de gestores). incompletos. Nós não somos ensinados a organizar e registrar o
nosso trabalho diário, analisá-lo criticamente, tirar conclusões
Comunicação Integrada = por meio de uma única e discuti-las de forma ordenada.
mensagem ocorre a utilização de uma forma conjugada de todas De um modo geral, as pessoas evitam falar em público,
as formas de marketing, sendo elas: Publicidade e Propaganda, por uma série de razões, como vergonha, medo de enfrentar
Venda Pessoal, Promoção de Vendas, Relações Públicas, a audiência, medo de não saber responder a alguma pergunta,
Assessoria de Imprensa, Marketing Direto e Internet. Todas receio de parecer ridículo ou de dizer besteiras, etc. Essas
essas áreas do marketing irão contribuir de forma particular razões, contudo, não tem o menor fundamento; elas apenas
para o alcance dos objetivos. servem para esconder a única e real razão: a falta de treino ou
A comunicação integrada busca cercar o público-alvo em de familiaridade com a comunicação verbal. É perfeitamente
todos os canais comunicativos existentes, por isso utilizam-se normal que algumas pessoas pareçam mais naturais ou à
diversos tipos de mídia ao mesmo tempo e de forma conjugada. vontade do que outras, ao falar em grupo. A diferença, contudo,
reside apenas no quanto uns conseguem desligar dos falsos e
Elementos da comunicação infundados receios e concentrar-se na comunicação.
Todas as formas de comunicação envolvem os seguintes
elementos: A comunicação escrita
Emissor – quem inicia o processo; A leitura, por mais atenta que possa ser, não tem o poder
Código – sinais para se construir uma mensagem; de transmissão da informação que a comunicação verbal tem.

20
LÍNGUA PORTUGUESA
Na leitura, o autor é desconhecido ou distante; a sua idéia CONCORDÂNCIA E DISCORDÂNCIA ENTRE A
nem sempre é claramente entendida e, mais importante, não COMUNICAÇÃO VERBAL E A COMUNICAÇÃO NÃO-
existe a possibilidade do diálogo. A transmissão da informação VERBAL
é passiva. A comunicação verbal, ao contrário é mais poderosa O código verbal possui o objetivo de transmitir um conteúdo
e versátil. de valor informativo. Já o código não verbal é quase sempre
utilizado para manter a relação interpessoal.
COMUNICAÇÃO NÃO-VERBAL Se houver concordância entre elas, o impacto da mensagem
A comunicação verbal serve para transmitir informações é mais forte e a recepção é melhor.
entre indivíduos, tendo estas informações um caráter Se houver discordância entre elas, ocorre uma desorientação
informativo. Já a comunicação não-verbal é caracterizada do receptor, o sentido da mensagem é alterado e o conteúdo se
pelo uso de gestos, da mímica, do olhar, da voz e dos sinais torna preponderante.
paralingüísticos, da organização espacial e da localização. Exemplo: uma pessoa ao dar um abraço numa criança
Estes, que são determinantes de uma relação interpessoal dos demonstrando afeto por ela ao mesmo tempo que chama esta
indivíduos. de querida e meiga, fortalece a mensagem. O mesmo não
ocorre se, ao dar o abraço, a pessoa chama a criança de chata.
Organização espacial Para a criança, o abraço será mais significativo e ela fará uma
É a distância que separa o emissor do receptor e se distorção da palavra chata.
acha determinada por um conjunto de regras que refletem
a mensagem e as interações dos interlocutores. O espaço Fontes: http://www.portaleducacao.com.br/marketing/
é convencionado por todo um sistema de sinais que varia artigos/36851/tipos-de-comunicacao#ixzz3zyJfUYMH
conforme os grupos sociais e culturais. http://www.significados.com.br/comunicacao/
A distância é um grau regulador de intimidade na relação http://pedagogiaaopedaletra.com/comunicacao-verbal-e-
dos interlocutores, ela exerce influência na transmissão da nao-verbal/
informação pela utilização de diversos canais.

Localização
A localização é um indicador do tipo de relação que a
pessoa deseja ter com seu interlocutor, ela também modula
a mensagem transmitida e indica status privilegiado. Indica
também que estas pessoas gostariam ou detém um certo prazer
Gêneros e Tipologia textuais e seus
no grupo. elementos constituintes.

Os gestos
Os gestos precedem ou acompanham o comportamento Gêneros Textuais
verbal. São controlados pelas normas sociais e estão ligados
aos modos. Cada emoção exprime-se num modelo postural que Os Gêneros textuais são as estruturas com que se compõem
reflete essa tensão ou esse relaxamento. Por exemplo, pessoas os textos, sejam eles orais ou escritos. Essas estruturas são
em uma determinada postura que costumam freqüentemente socialmente reconhecidas, pois se mantêm sempre muito
mexer um ou os dois pés, é um dos indicativos de ansiedade. parecidas, com características comuns, procuram atingir
Assim como a postura dos braços cruzados é um indicativo de intenções comunicativas semelhantes e ocorrem em situações
fechamento racional. específicas. Pode-se dizer que se tratam das variadas formas
de linguagem que circulam em nossa sociedade, sejam eles
A mímica formais ou informais. Cada gênero textual tem seu estilo
As mímicas são os “gestos do rosto”. Um observador pode próprio, podendo então, ser identificado e diferenciado dos
ver no rosto informações sobre a personalidade e a história de demais através de suas características. Exemplos:
seu interlocutor, mas isso gera também muitos erros.
As mímicas são específicas do meio social, da região em que Carta: quando se trata de “carta aberta” ou “carta ao
a pessoa foi educada. leitor”, tende a ser do tipo dissertativo-argumentativo com uma
Por exemplo, é comum o japonês sorrir quando está linguagem formal, em que se escreve à sociedade ou a leitores.
embaraçado, enquanto no brasileiro o sorrir é uma manifestação Quando se trata de “carta pessoal”, a presença de aspectos
comum de alegria. narrativos ou descritivos e uma linguagem pessoal é mais
comum. No caso da “carta denúncia”, em que há o relato de um
O olhar fato que o autor sente necessidade de o expor ao seu público,
A expressão do olhar é tão variada e difícil de controlar que os tipos narrativos e dissertativo-expositivo são mais utilizados.
é também difícil dominar as intenções mais ocultas.
O olhar parece ter dupla função: Propaganda: é um gênero textual dissertativo-
Indica a quem se dirige a comunicação. expositivo onde há a o intuito de propagar informações
Constitui um indício da atenção dada. sobre algo, buscando sempre atingir e influenciar o leitor
Não existe interação na comunicação sem troca de olhar, o apresentando, na maioria das vezes, mensagens que despertam
contato com os olhos marca a interação intensa. as emoções e a sensibilidade do mesmo.
Um exemplo de interação feito com o do olhar é o do
vendedor frente a seus clientes. Ele fixa o olhar no seu cliente Bula de remédio: trata-se de um gênero
submetendo a este uma condição de submissão na comunicação. textual descritivo, dissertativo-expositivo e injuntivo que tem
por obrigação fornecer as informações necessárias para o
A voz e os sinais paralinguísticos correto uso do medicamento.
A voz transmite aspectos da personalidade assim como
estado de espírito da pessoa que se fala. Um indivíduo traz no Receita: é um gênero textual descritivo e injuntivo que
seu registro e voz a marca quase irreversível de seu grupo social tem por objetivo informar a fórmula para preparar tal
e cultural. comida, descrevendo os ingredientes e o preparo destes,
O timbre de voz, o ritmo, a fluência, a intensidade dependem além disso, com verbos no imperativo, dado o sentido de
do controle emotivo. ordem, para que o leitor siga corretamente as instruções.

21
LÍNGUA PORTUGUESA
Tutorial: é um gênero injuntivo que consiste num guia que Boletos, faturas, carnês: predomina o
tem por finalidade explicar ao leitor, passo a passo e de maneira tipo descrição nestes casos, relacionados a informações
simplificada, como fazer algo. de um indivíduo ou empresa. O tipo injuntivo também
se manifesta, através da orientação que cada um traz.
Editorial: é um gênero textual dissertativo-
argumentativo que expressa o posicionamento da empresa Profecia: em geral, estão em um contexto religioso, e
sobre determinado assunto, sem a obrigação da presença da tratam de eventos que podem ocorrer no futuro da época do
objetividade. autor. A predominância é a do tipo preditivo, havendo também
características dos tipos narrativo e descritivo.
Notícia: podemos perfeitamente identificar
características narrativas, o fato ocorrido que se deu em Gêneros literários:
um determinado momento e em um determinado lugar,
envolvendo determinadas personagens. Características do - Gênero Narrativo:
lugar, bem como dos personagens envolvidos são, muitas vezes, Na Antiguidade Clássica, os padrões literários reconhecidos
minuciosamente descritos. eram apenas o épico, o lírico e o dramático. Com o passar dos
anos, o gênero épico passou a ser considerado apenas uma
Reportagem: é um gênero textual jornalístico de variante do gênero literário narrativo, devido ao surgimento de
caráter dissertativo-expositivo. A reportagem tem, por objetivo, concepções de prosa com características diferentes: o romance,
informar e levar os fatos ao leitor de uma maneira clara, com a novela, o conto, a crônica, a fábula. Porém, praticamente
linguagem direta. todas as obras narrativas possuem elementos estruturais e
estilísticos em comum e devem responder a questionamentos,
Entrevista: é um gênero textual como: quem? o que? quando? onde? por quê? Vejamos a seguir:
fundamentalmente dialogal, representado pela conversação de
duas ou mais pessoas, o entrevistador e o(s) entrevistado(s), para Épico (ou Epopeia): os textos épicos são geralmente
obter informações sobre ou do entrevistado, ou de algum outro longos e narram histórias de um povo ou de uma nação,
assunto. Geralmente envolve também aspectos dissertativo- envolvem aventuras, guerras, viagens, gestos heroicos, etc.
expositivos, especialmente quando se trata de entrevista a Normalmente apresentam um tom de exaltação, isto é, de
imprensa ou entrevista jornalística. Mas pode também envolver valorização de seus heróis e seus feitos. Dois exemplos são Os
aspectos narrativos, como na entrevista de emprego, ou Lusíadas, de Luís de Camões, e Odisséia, de Homero.
aspectos descritivos, como na entrevista médica.
Romance: é um texto completo, com tempo, espaço e
História em quadrinhos: é um gênero narrativo que personagens bem definidos e de caráter mais verossímil. Também
consiste em enredos contados em pequenos quadros através de conta as façanhas de um herói, mas principalmente uma história
diálogos diretos entre seus personagens, gerando uma espécie de amor vivida por ele e uma mulher, muitas vezes, “proibida”
de conversação. para ele. Apesar dos obstáculos que o separam, o casal vive
sua paixão proibida, física, adúltera, pecaminosa e, por isso,
Charge: é um gênero textual narrativo onde se faz uma costuma ser punido no final. É o tipo de narrativa mais comum
espécie de ilustração cômica, através de caricaturas, com na Idade Média. Ex: Tristão e Isolda.
o objetivo de realizar uma sátira, crítica ou comentário
sobre algum acontecimento atual, em sua grande maioria. Novela: é um texto caracterizado por ser intermediário
entre a longevidade do romance e a brevidade do conto. Como
Poema: trabalho elaborado e estruturado em versos. Além exemplos de novelas, podem ser citadas as obras O Alienista, de
dos versos, pode ser estruturado em estrofes. Rimas e métrica Machado de Assis, e A Metamorfose, de Kafka.
também podem fazer parte de sua composição. Pode ou não
ser poético. Dependendo de sua estrutura, pode receber Conto: é um texto narrativo breve, e de ficção,
classificações específicas, como haicai, soneto, epopeia, geralmente em prosa, que conta situações rotineiras, anedotas
poema figurado, dramático, etc. Em geral, a presença de e até folclores. Inicialmente, fazia parte da literatura oral.
aspectos narrativos e descritivos são mais frequentes neste Boccacio foi o primeiro a reproduzi-lo de forma escrita com
gênero. Importante também é a distinção entre poema e poesia. a publicação de Decamerão. Diversos tipos do gênero textual
Poesia é o conteúdo capaz de transmitir emoções por meio de conto surgiram na tipologia textual narrativa: conto de fadas,
uma linguagem, ou seja, tudo o que toca e comove pode ser que envolve personagens do mundo da fantasia; contos de
considerado como poético. Assim, quando aplica-se a poesia ao aventura, que envolvem personagens em um contexto mais
gênero <poema>, resulta-se em um poema poético, quando próximo da realidade; contos folclóricos (conto popular);
aplicada à prosa, resulta-se na prosa poética (até mesmo uma contos de terror ou assombração, que se desenrolam em um
peça ou um filme podem ser assim considerados). contexto sombrio e objetivam causar medo no expectador;
Canção: possui muitas semelhanças com o gênero poema, contos de mistério, que envolvem o suspense e a solução de
como a estruturação em estrofes e as rimas. Ao contrário do um mistério.
poema, costuma apresentar em sua estrutura um refrão, parte
da letra que se repete ao longo do texto, e quase sempre Fábula: é um texto de caráter fantástico que busca ser
tem uma interação direta com os instrumentos musicais. A inverossímil. As personagens principais são não humanos e a
tipologia narrativa tem prevalência neste caso. finalidade é transmitir alguma lição de moral.
Adivinha: é um gênero cômico, o qual consiste
em perguntas cujas respostas exigem algum nível de Crônica: é uma narrativa informal, breve, ligada à vida
engenhosidade. Predominantemente dialogal. cotidiana, com linguagem coloquial. Pode ter um tom
Anais: um registro da história humorístico ou um toque de crítica indireta, especialmente, quando
resumido, estruturado ano a ano. Atualmente, é utilizado para aparece em seção ou artigo de jornal, revistas e programas da TV..
publicações científicas ou artísticas que ocorram de modo
periódico, não necessariamente a cada ano. Possui caráter Crônica narrativo-descritiva: Apresenta alternância entre
fundamentalmente dissertativo. os momentos narrativos e manifestos descritivos.
Anúncio publicitário: utiliza linguagem apelativa
para persuadir o público a desejar aquilo que é oferecido pelo Ensaio: é um texto literário breve, situado entre o poético
anúncio. Por meio do uso criativo das imagens e da linguagem, e o didático, expondo ideias, críticas e reflexões morais e
consegue utilizar todas as tipologias textuais com facilidade. filosóficas a respeito de certo tema. É menos formal e mais

22
LÍNGUA PORTUGUESA
flexível que o tratado. Consiste também na defesa de um ponto Acróstico: (akros = extremidade; stikos = linha),
de vista pessoal e subjetivo sobre um tema (humanístico, composição lírica na qual as letras iniciais de cada verso
filosófico, político, social, cultural, moral, comportamental, formam uma palavra ou frase;
etc.), sem que se paute em formalidades como documentos ou
provas empíricas ou dedutivas de caráter científico. Exemplo: Balada: uma das mais primitivas manifestações poéticas,
Ensaio sobre a tolerância, de John Locke. são cantigas de amigo (elegias) com ritmo característico e
refrão vocal que se destinam à dança;
· Gênero Dramático:
Trata-se do texto escrito para ser encenado no teatro. Nesse Canção (ou Cantiga, Trova): poema oral com
tipo de texto, não há um narrador contando a história. Ela acompanhamento musical;
“acontece” no palco, ou seja, é representada por atores, que
assumem os papéis das personagens nas cenas. Gazal (ou Gazel): poesia amorosa dos persas e árabes;
odes do oriente médio;
Tragédia: é a representação de um fato trágico, suscetível
de provocar compaixão e terror. Aristóteles afirmava que a Haicai: expressão japonesa que significa “versos cômicos”
tragédia era «uma representação duma ação grave, de alguma (=sátira). E o poema japonês formado de três versos que
extensão e completa, em linguagem figurada, com atores agindo, somam 17 sílabas assim distribuídas: 1° verso= 5 sílabas; 2°
não narrando, inspirando dó e terror”. Ex: Romeu e Julieta, de verso = 7 sílabas; 3° verso 5 sílabas;
Shakespeare. Soneto: é um texto em poesia com 14 versos, dividido em
dois quartetos e dois tercetos, com rima geralmente em a-ba-b
Farsa: A farsa consiste no exagero do cômico, graças ao a-b-b-a c-d-c d-c-d.
emprego de processos como o absurdo, as incongruências, os
equívocos, a caricatura, o humor primário, as situações ridículas Vilancete: são as cantigas de autoria dos poetas vilões
e, em especial, o engano. (cantigas de escárnio e de maldizer); satíricas, portanto.

Comédia: é a representação de um fato inspirado na vida Fonte: http://www.portuguesxconcursos.com.br/p/tipologia-


e no sentimento comum, de riso fácil. Sua origem grega está textual-tipos-generos.html
ligada às festas populares.
Questões
Tragicomédia: modalidade em que se misturam
elementos trágicos e cômicos. Originalmente, significava a 01.
mistura do real com o imaginário. (...) Há um pôr-do-sol de primavera e uma velha
casa abandonada. Está em ruínas.
Poesia de cordel: texto tipicamente brasileiro em que se A velha casa não mais abriga vidas em seu interior.
retrata, com forte apelo linguístico e cultural nordestinos, fatos Tudo é passado. Tudo é lembrança.
diversos da sociedade e da realidade vivida por este povo. Hoje, apenas almas juvenis brincam
despreocupadas e felizes entre suas paredes
· Gênero Lírico: trêmulas.
É certo tipo de texto no qual um eu lírico (a voz que fala Em seu chão, despido da madeira polida que a
no poema e que nem sempre corresponde à do autor) exprime cobriam, brotam ervas daninhas. Entre a vegetação
suas emoções, ideias e impressões em face do mundo exterior. que busca minimizar as doces recordações do
Normalmente os pronomes e os verbos estão em 1ª pessoa e há passado, surge a figura amarela e suave da
o predomínio da função emotiva da linguagem. margarida, flor-mulher. As nuanças de suas cores
sorriem e denunciam lembranças de seus
Elegia: é um texto de exaltação à morte de alguém, sendo ocupantes.
que a morte é elevada como o ponto máximo do texto. O emissor A velha casa está em ruínas. Pássaros saltitam e
expressa tristeza, saudade, ciúme, decepção, desejo de morte. É gorjeiam nas amuradas que a cercam. Seus trinados
um poema melancólico. Um bom exemplo é a peça Roan e Yufa, são melodias no altar do tempo à espera de
de William Shakespeare. redentoras orações. Raízes vorazes de grandes
árvores infiltraram-se entre as pedras do alicerce e
Epitalâmia: é um texto relativo às noites nupciais líricas, abalam suas estruturas.
ou seja, noites românticas com poemas e cantigas. Um bom Agoniza a velha casa. Agora, somente imagens
exemplo de epitalâmia é a peça Romeu e Julieta nas noites desfilam, ao longo das noites. As janelas são bocas
nupciais. escancaradas. A casa velha em ruínas clama por
vozes e movimentos...
Ode (ou hino): é o poema lírico em que o emissor faz (Geraldo M. de Carvalho)
uma homenagem à pátria (e aos seus símbolos), às divindades,
à mulher amada, ou a alguém ou algo importante para ele. O De acordo com a tipologia textual, o texto acima:
hino é uma ode com acompanhamento musical; (A) é descritivo, com traços dissertativos compondo um
ambiente nostálgico.
Idílio (ou écloga): é o poema lírico em que o emissor (B) possui descrição subjetiva apenas no trecho “A velha
expressa uma homenagem à natureza, às belezas e às riquezas casa não mais abriga vidas em seu interior. Tudo é passado.
que ela dá ao homem. É o poema bucólico, ou seja, que expressa Tudo é lembrança.”
o desejo de desfrutar de tais belezas e riquezas ao lado da (C) ocorre uma descrição objetiva narrativa no trecho todo.
amada (pastora), que enriquece ainda mais a paisagem, espaço (D) é formado basicamente de descrições subjetivas.
ideal para a paixão. A écloga é um idílio com diálogos (muito
rara); 02.
Como cuidar de seu dinheiro em 2015
Sátira: é o poema lírico em que o emissor faz uma crítica a Gustavo Cerbasi.
alguém ou a algo, em tom sério ou irônico.
Em 2015, cuidarei bem do meu dinheiro. Organizarei bem
Acalanto: ou canção de ninar; os números e as verbas. Esses números mudarão bastante ao
longo do ano. Um monstro chamado inflação ronda o país. Só

23
LÍNGUA PORTUGUESA
que, agora, ele usa um manto da invisibilidade, que ganhou feito não conseguido então por nenhuma companhia no
de seu criador, o governo. Quando morder meu bolso, eu nem mundo. Num gesto de ousadia, decidiu desenvolver no Brasil
saberei de onde terá vindo o ataque, não terei tempo de me a tecnologia necessária para produzir em águas até mil metros.
defender. Por isso, deixarei boas gorduras no orçamento para O sucesso foi total. Menos de uma década depois, a Petrobras
atirar a ele, quando aparecer. Essas gorduras serão chamadas dispõe de tecnologia comprovada para produção de petróleo
de verba para lazer e reservas de emergência. em águas muito profundas. O último recorde foi obtido em
Em 2015, não farei apostas. Já há gente demais apostando janeiro de 1999 no campo de Roncador, na bacia de Campos,
em imóveis, ações e outros investimentos especulativos. Farei produzindo a 1.853 metros de profundidade. Mas a escalada
escolhas certeiras. Deixarei a maior parte de meu investimento não para. Ao encerrar-se a década, a empresa prepara-se para
na renda fixa. Ela está com uma generosidade única no mundo. superar, mais uma vez, seus próprios limites. A meta, agora, são
Enquanto isso, estudo o desespero de especuladores que os 3 mil metros de profundidade, a serem alcançados mediante
aguardarão a improvável recuperação dos imóveis, da Petrobras, projetos que aliam a inovação tecnológica à redução de custos.
da credibilidade dos mercados. Quando esses especuladores “
jogarem a toalha, usarei parte de minhas reservas para fazer
investimentos bons e baratos. Mas não na Petrobras. Exposição PETROBRAS em 60 momentos. Agência Petrobras
Muita gente fala que, com a inflação e a recessão, pode
perder o emprego ou os clientes. Faltará renda, faltarão O tipo textual predominante que caracteriza o texto é a:
consumidores. O ano de 2015 será, mais uma vez, ruim para (A) narração.
quem vende. Será um ano bom para quem pensa em comprar. (B) predição
Estarei atento aos bons negócios para quem tem dinheiro na (C) instrução
mão. Se a renda fixa paga bem, a compra à vista tende a me (D) descrição.
dar descontos maiores. É por esse mesmo motivo que, em 2015, (E) argumentação
evitarei as dívidas. Os juros estão altos e isso me convida a
poupar, e não a alugar dinheiro dos bancos. Dívidas de longo 04.
prazo são corrigidas pela inflação, também em alta. Por isso, Por isso foi à luz de uma vela mortiça
aproveitarei os ganhos extras de fim de ano para liquidar Que li, inserto na cama,
dívidas e me policiar para não contrair novas. O que estava à mão para ler --
No ano que começa, também não quero fazer papel de otário (...)
e deixar nas mãos do governo mais impostos do que preciso. Em torno de mim o sossego excessivo de noite de província
Não sonegarei. Mas aproveitarei o fim do ano para organizar Fazia um grande Barulho ao contrário,
meus papéis e comprovantes, planejar a declaração de Imposto Dava-me uma tendência do choro para a desolação.
de Renda de março e tentar a maior restituição que puder, ou A “Primeira Epístola aos Coríntios” ...
o mínimo pagamento necessário. Listarei meus gastos com Relia-a à luz de uma vela subitamente antiquíssima,
dependentes, educação e saúde, doarei para instituições que E um grande mar de emoção ouvia-se dentro de mim...
fazem o bem, aplicarei num PGBL o que for necessário para o Sou nada...
máximo benefício. Entregarei minha declaração quanto antes, Sou uma ficção...
no início de março. Quero ver minha restituição na conta mais Que ando eu a querer de mim ou de tudo neste mundo?
cedo, já que 2015 será um ano bom para quem tiver dinheiro “Se eu não tivesse a caridade.”
na mão. E a soberana luz manda, e do alto dos séculos,
Para quem lamenta, recomendo cuidado com o monstro e A grande mensagem com que a alma é livre...
com o governo. Para quem está atento às oportunidades, desejo “Se eu não tivesse a caridade...”
boas compras. Meu Deus, e eu que não tenho a caridade.

(Disponívelem:http://epoca.globo.com/colunas-e-blogs/gustavo- CAMPOS, Álvaro de. (Heterônimo de Fernando Pessoa). Ali não


cerbasi/noticia/2015/01/como-cuidar-de-bseu-dinheirob-em-2015. havia eletricidade. In: “Poemas”. Disponível em:< http:// www.
html Acesso em: 06/02/2015.) citador.pt/poemas/>. Acesso em: 5 jan. 2015, com adaptações.

De acordo com a tipologia textual, o objetivo principal do A respeito da tipologia textual, é correto afirmar que o
autor é: poema representa uma
(A) narrar. (A) narração.
(B) instruir. (B) argumentação.
(C) descrever. (C) descrição.
(D) argumentar. (D) caracterização.
(E) dissertação.
03. Respostas
01. D / 02. D / 03. A. / 04. A.

Tipos Textuais

Para escrever um texto, necessitamos de técnicas que


implicam no domínio de capacidades linguísticas. Temos dois
momentos: o de formular pensamentos (o que se quer dizer)
e o de expressá-los por escrito (o escrever propriamente dito).
Fazer um texto, seja ele de que tipo for, não significa apenas
escrever de forma correta, mas sim, organizar ideias sobre
determinado assunto.
E para expressarmos por escrito, existem alguns modelos
de expressão escrita: Descrição – Narração – Dissertação.

Descrição
“Ao final dos anos 80, a Petrobras se encontrava diante do š’Ù‡…ƒ”ƒ…–‡”À•–‹…ƒ•†‘••‡”‡•‘—†ƒ•…‘‹•ƒ•ǡƒ’”‡•‡–ƒ—ƒ
desafio de produzir petróleo em águas abaixo de 500 metros, ˜‹• ‘Ǣ

24
LÍNGUA PORTUGUESA
sentido.
2—–‹’‘†‡–‡š–‘ϐ‹‰—”ƒ–‹˜‘Ǣ
Quando alteramos a ordem dos enunciados, precisamos
‡–”ƒ–‘†‡’‡••‘ƒ•ǡƒ„‹‡–‡•ǡ‘„Œ‡–‘•Ǣ fazer certas modificações no texto, pois este contém anafóricos
(palavras que retomam o que foi dito antes, como ele, os, aquele,
”‡†‘À‹‘†‡ƒ–”‹„—–‘•Ǣ
etc. ou catafóricos (palavras que anunciam o que vai ser dito,
•‘†‡˜‡”„‘•†‡Ž‹‰ƒ­ ‘Ǣ como este, etc.), que podem perder sua função e assim não ser
compreendidos. Se tomarmos uma descrição como As flores
 ”‡“—‡–‡‡’”‡‰‘†‡‡–žˆ‘”ƒ•ǡ…‘’ƒ”ƒ­Ù‡•‡‘—–”ƒ•
manifestavam todo o seu esplendor. O Sol fazia-as
ϐ‹‰—”ƒ•†‡Ž‹‰—ƒ‰‡Ǣ
brilhar, ao invertermos a ordem das frases, precisamos fazer
‡…‘‘”‡•—Ž–ƒ†‘ƒ‹ƒ‰‡ϐÀ•‹…ƒ‘—’•‹…‘Ž×‰‹…ƒǤ algumas alterações, para que o texto possa ser compreendido:
O Sol fazia as flores brilhar. Elas manifestavam todo
Narração o seu esplendor. Como, na versão original, o pronome
oblíquo as é um anafórico que retoma flores, se alterarmos
a ordem das frases ele perderá o sentido. Por isso, precisamos
š’Ù‡—ˆƒ–‘ǡ”‡Žƒ…‹‘ƒ—†ƒ­ƒ•†‡•‹–—ƒ­ ‘ǡƒ’‘–ƒƒ–‡•ǡ mudar a palavra flores para a primeira frase e retomá-la com
†—”ƒ–‡‡†‡’‘‹•†‘•ƒ…‘–‡…‹‡–‘•ȋ‰‡”ƒŽ‡–‡ȌǢ o anafórico elas na segunda.
2—–‹’‘†‡–‡š–‘•‡“—‡…‹ƒŽǢ Por todas essas características, diz-se que o fragmento do
conto de Machado é descritivo. Descrição é o tipo de texto
‡Žƒ–‘†‡ˆƒ–‘•Ǣ em que se expõem características de seres concretos (pessoas,
”‡•‡­ƒ†‡ƒ””ƒ†‘”ǡ’‡”•‘ƒ‰‡•ǡ‡”‡†‘ǡ…‡ž”‹‘ǡ–‡’‘Ǣ objetos, situações, etc.) consideradas fora da relação de
anterioridade e de posterioridade.
’”‡•‡–ƒ­ ‘†‡—…‘ϐŽ‹–‘Ǣ
•‘†‡˜‡”„‘•†‡ƒ­ ‘Ǣ Características:
- Ao fazer a descrição enumeramos características,

‡”ƒŽ‡–‡ǡ±‡•…Žƒ†ƒ†‡†‡•…”‹­Ù‡•Ǣ comparações e inúmeros elementos sensoriais;
†‹žŽ‘‰‘†‹”‡–‘±ˆ”‡“—‡–‡Ǥ - As personagens podem ser caracterizadas física e
psicologicamente, ou pelas ações;
Dissertação - A descrição pode ser considerada um dos elementos
constitutivos da dissertação e da argumentação;
- é impossível separar narração de descrição;
š’Ù‡—–‡ƒǡ‡š’Ž‹…ƒǡƒ˜ƒŽ‹ƒǡ…Žƒ••‹ϐ‹…ƒǡƒƒŽ‹•ƒǢ - O que se espera não é tanto a riqueza de detalhes, mas
2—–‹’‘†‡–‡š–‘ƒ”‰—‡–ƒ–‹˜‘Ǥ sim a capacidade de observação que deve revelar aquele que
a realiza;
‡ˆ‡•ƒ†‡—ƒ”‰—‡–‘ǣ - Utilizam, preferencialmente, verbos de ligação. Exemplo:
a) ƒ’”‡•‡–ƒ­ ‘†‡—ƒ–‡•‡“—‡•‡”ž†‡ˆ‡†‹†ƒǡ “(...) Ângela tinha cerca de vinte anos; parecia mais velha
b) †‡•‡˜‘Ž˜‹‡–‘‘—ƒ”‰—‡–ƒ­ ‘ǡ pelo desenvolvimento das proporções. Grande, carnuda,
c) ˆ‡…Šƒ‡–‘Ǣ sanguínea e fogosa, era um desses exemplares excessivos do
”‡†‘À‹‘†ƒŽ‹‰—ƒ‰‡‘„Œ‡–‹˜ƒǢ sexo que parecem conformados expressamente para esposas
da multidão (...)” (Raul Pompéia – O Ateneu);
”‡˜ƒŽ‡…‡ƒ†‡‘–ƒ­ ‘Ǥ - Como na descrição o que se reproduz é simultâneo, não
existe relação de anterioridade e posterioridade entre seus
Carta enunciados;
- Devem-se evitar os verbos e, se isso não for possível, que
 ••‡ ± — –‹’‘ †‡ –‡š–‘ “—‡ •‡ …ƒ”ƒ…–‡”‹œƒ ’‘” ‡˜‘Ž˜‡” — se usem então as formas nominais, o presente e o pretério
”‡‡–‡–‡‡—†‡•–‹ƒ–ž”‹‘Ǣ imperfeito do indicativo, dando-se sempre preferência aos
verbos que indiquem estado ou fenômeno.
2‘”ƒŽ‡–‡‡•…”‹–ƒ‡’”‹‡‹”ƒ’‡••‘ƒǡ‡•‡’”‡˜‹•ƒ— - Todavia deve predominar o emprego das comparações,
–‹’‘†‡Ž‡‹–‘”Ǣ dos adjetivos e dos advérbios, que conferem colorido ao texto.
2‡…‡••ž”‹‘“—‡•‡—–‹Ž‹œ‡—ƒŽ‹‰—ƒ‰‡ƒ†‡“—ƒ†ƒ…‘‘
–‹’‘†‡†‡•–‹ƒ–ž”‹‘‡“—‡†—”ƒ–‡ƒ…ƒ”–ƒ ‘•‡’‡”…ƒƒ˜‹• ‘ Para transformar uma descrição numa narração, bastaria
†ƒ“—‡Ž‡’ƒ”ƒ“—‡‘–‡š–‘‡•–ž•‡†‘‡•…”‹–‘Ǥ introduzir um enunciado que indicasse a passagem de um
estado anterior para um posterior. No caso do texto II inicial,
Descrição para transformá-lo em narração, bastaria dizer: Reunia a isso
grande medo do pai. Mais tarde, Iibertou-se desse medo...
É a representação com palavras de um objeto, lugar, situação
ou coisa, onde procuramos mostrar os traços mais particulares Características Linguísticas:
ou individuais do que se descreve. É qualquer elemento que
seja apreendido pelos sentidos e transformado, com palavras, O enunciado narrativo, por ter a representação de
em imagens. um acontecimento, fazer-transformador, é marcado pela
Sempre que se expõe com detalhes um objeto, uma pessoa temporalidade, na relação situação inicial e situação final,
ou uma paisagem a alguém, está fazendo uso da descrição. Não enquanto que o enunciado descritivo, não tendo transformação,
é necessário que seja perfeita, uma vez que o ponto de vista do é atemporal.
observador varia de acordo com seu grau de percepção. Dessa Na dimensão linguística, destacam-se marcas sintático-
forma, o que será importante ser analisado para um, não será semânticas encontradas no texto que vão facilitar a
para outro. compreensão:
A vivência de quem descreve também influencia na hora - Predominância de verbos de estado, situação ou
de transmitir a impressão alcançada sobre determinado objeto, indicadores de propriedades, atitudes, qualidades, usados
pessoa, animal, cena, ambiente, emoção vivida ou sentimento. principalmente no presente e no imperfeito do indicativo (ser,
Evidentemente, quando se diz que a ordem dos enunciados estar, haver, situar-se, existir, ficar).
pode ser invertida, está-se pensando apenas na ordem - Ênfase na adjetivação para melhor caracterizar o que é
cronológica, pois, como veremos adiante, a ordem em que descrito.
os elementos são descritos produz determinados efeitos de - Emprego de figuras (metáforas, metonímias, comparações,
sinestesias).

25
LÍNGUA PORTUGUESA
- Uso de advérbios de localização espacial. - Desenvolvimento: detalhes (2ª parte) material, peso, cor/
brilho, textura.
Recursos: - Conclusão: observações de caráter geral referentes a sua
utilidade ou qualquer outro comentário que envolva o objeto
- Usar impressões cromáticas (cores) e sensações térmicas. como um todo.
Ex: O dia transcorria amarelo, frio, ausente do calor alegre do
sol. Descrição de objetos constituídos por várias partes:
- Usar o vigor e relevo de palavras fortes, próprias, exatas, - Introdução: observações de caráter geral referentes à
concretas. Ex: As criaturas humanas transpareciam um céu procedência ou localização do objeto descrito.
sereno, uma pureza de cristal. - Desenvolvimento: enumeração e rápidos comentários das
- As sensações de movimento e cor embelezam o poder da partes que compõem o objeto, associados à explicação de como
natureza e a figura do homem. Ex: Era um verde transparente as partes se agrupam para formar o todo.
que deslumbrava e enlouquecia qualquer um. - Desenvolvimento: detalhes do objeto visto como um todo
- A frase curta e penetrante dá um sentido de rapidez (externamente) formato, dimensões, material, peso, textura,
do texto. Ex: Vida simples. Roupa simples. Tudo simples. O cor e brilho.
pessoal, muito crente. - Conclusão: observações de caráter geral referentes a sua
utilidade ou qualquer outro comentário que envolva o objeto
A descrição pode ser apresentada sob duas formas: em sua totalidade.

Descrição Objetiva: quando o objeto, o ser, a cena, a Descrição de ambientes:


passagem são apresentadas como realmente são, concretamente. - Introdução: comentário de caráter geral.
Ex: “Sua altura é 1,85m. Seu peso, 70 kg. Aparência atlética, - Desenvolvimento: detalhes referentes à estrutura global
ombros largos, pele bronzeada. Moreno, olhos negros, cabelos do ambiente: paredes, janelas, portas, chão, teto, luminosidade
negros e lisos”. e aroma (se houver).
Não se dá qualquer tipo de opinião ou julgamento. Exemplo: - Desenvolvimento: detalhes específicos em relação a objetos
“ A casa velha era enorme, toda em largura, com porta central lá existentes: móveis, eletrodomésticos, quadros, esculturas ou
que se alcançava por três degraus de pedra e quatro janelas de quaisquer outros objetos.
guilhotina para cada lado. Era feita de pau-a-pique barreado, - Conclusão: observações sobre a atmosfera que paira no
dentro de uma estrutura de cantos e apoios de madeira-de-lei. ambiente.
Telhado de quatro águas. Pintada de roxo-claro. Devia ser mais
velha que Juiz de Fora, provavelmente sede de alguma fazenda Descrição de paisagens:
que tivesse ficado, capricho da sorte, na linha de passagem - Introdução: comentário sobre sua localização ou qualquer
da variante do Caminho Novo que veio a ser a Rua Principal, outra referência de caráter geral.
depois a Rua Direita – sobre a qual ela se punha um pouco de - Desenvolvimento: observação do plano de fundo
esguelha e fugindo ligeiramente do alinhamento (...).” (Pedro (explicação do que se vê ao longe).
Nava – Baú de Ossos) - Desenvolvimento: observação dos elementos mais
próximos do observador explicação detalhada dos elementos
Descrição Subjetiva: quando há maior participação da que compõem a paisagem, de acordo com determinada ordem.
emoção, ou seja, quando o objeto, o ser, a cena, a paisagem são - Conclusão: comentários de caráter geral, concluindo acerca
transfigurados pela emoção de quem escreve, podendo opinar da impressão que a paisagem causa em quem a contempla.
ou expressar seus sentimentos. Ex: “Nas ocasiões de aparato é
que se podia tomar pulso ao homem. Não só as condecorações Descrição de pessoas (I):
gritavam-lhe no peito como uma couraça de grilos. Ateneu!
Ateneu! Aristarco todo era um anúncio; os gestos, calmos, - Introdução: primeira impressão ou abordagem de qualquer
soberanos, calmos, eram de um rei...” (“O Ateneu”, Raul aspecto de caráter geral.
Pompéia) - Desenvolvimento: características físicas (altura, peso, cor
“(...) Quando conheceu Joca Ramiro, então achou outra da pele, idade, cabelos, olhos, nariz, boca, voz, roupas).
esperança maior: para ele, Joca Ramiro era único homem, par- - Desenvolvimento: características psicológicas
de-frança, capaz de tomar conta deste sertão nosso, mandando (personalidade, temperamento, caráter, preferências,
por lei, de sobregoverno.” inclinações, postura, objetivos).
(Guimarães Rosa – Grande Sertão: Veredas) - Conclusão: retomada de qualquer outro aspecto de caráter
geral.
Os efeitos de sentido criados pela disposição dos elementos
descritivos: Descrição de pessoas (II):
Como se disse anteriormente, do ponto de vista da progressão - Introdução: primeira impressão ou abordagem de qualquer
temporal, a ordem dos enunciados na descrição é indiferente, aspecto de caráter geral.
uma vez que eles indicam propriedades ou características que - Desenvolvimento: análise das características físicas,
ocorrem simultaneamente. No entanto, ela não é indiferente do associadas às características psicológicas (1ª parte).
ponto de vista dos efeitos de sentido: descrever de cima para - Desenvolvimento: análise das características físicas,
baixo ou viceversa, do detalhe para o todo ou do todo para o associadas às características psicológicas (2ª parte).
detalhe cria efeitos de sentido distintos. - Conclusão: retomada de qualquer outro aspecto de caráter
Uma descrição deve privilegiar o uso frequente de adjetivos, geral.
também denominado adjetivação. Para facilitar o aprendizado
desta técnica, sugerese que o concursando, após escrever seu A descrição, ao contrário da narrativa, não supõe ação. É uma
texto, sublinhe todos os substantivos, acrescentando antes ou estrutura pictórica, em que os aspectos sensoriais predominam.
depois deste um adjetivo ou uma locução adjetiva. Porque toda técnica descritiva implica contemplação e
apreensão de algo objetivo ou subjetivo, o redator, ao descrever,
Descrição de objetos constituídos de uma só parte: precisa possuir certo grau de sensibilidade. Assim como o pintor
- Introdução: observações de caráter geral referentes à capta o mundo exterior ou interior em suas telas, o autor de
procedência ou localização do objeto descrito. uma descrição focaliza cenas ou imagens, conforme o permita
- Desenvolvimento: detalhes (lª parte) formato (comparação sua sensibilidade.
com figuras geométricas e com objetos semelhantes); dimensões Conforme o objetivo a alcançar, a descrição pode ser
(largura, comprimento, altura, diâmetro etc.) não-literária ou literária. Na descrição não-literária, há

26
LÍNGUA PORTUGUESA
maior preocupação com a exatidão dos detalhes e a precisão - Espaço: local da ação. Pode ser físico ou psicológico.
vocabular. Por ser objetiva, há predominância da denotação. - Tempo: época em que se passa a ação. Cronológico:
o tempo convencional (horas, dias, meses); Psicológico: o
Textos descritivos não-literários: A descrição técnica tempo interior, subjetivo.
é um tipo de descrição objetiva: ela recria o objeto usando uma
linguagem científica, precisa. Esse tipo de texto é usado para Elementos Estruturais (II):
descrever aparelhos, o seu funcionamento, as peças que os
compõem, para descrever experiências, processos, etc. Personagens Quem? Protagonista/Antagonista
Acontecimento O quê? Fato
Textos descritivos literários: Na descrição literária Tempo Quando? Época em que ocorreu o fato
predomina o aspecto subjetivo, com ênfase no conjunto de Espaço Onde? Lugar onde ocorreu o fato
associações conotativas que podem ser exploradas a partir de Modo Como? De que forma ocorreu o fato
descrições de pessoas; cenários, paisagens, espaço; ambientes; Causa Por quê? Motivo pelo qual ocorreu o fato
situações e coisas. Vale lembrar que textos descritivos também Resultado - previsível ou imprevisível.
podem ocorrer tanto em prosa como em verso. Final - Fechado ou Aberto.

Narração Esses elementos estruturais combinam-se e articulam-se de


tal forma, que não é possível compreendê-los isoladamente,
A Narração é um tipo de texto que relata uma história como simples exemplos de uma narração. Há uma relação
real, fictícia ou mescla dados reais e imaginários. O texto de implicação mútua entre eles, para garantir coerência e
narrativo apresenta personagens que atuam em um tempo e verossimilhança à história narrada.
em um espaço, organizados por uma narração feita por um Quanto aos elementos da narrativa, esses não estão,
narrador. É uma série de fatos situados em um espaço e no obrigatoriamente sempre presentes no discurso, exceto as
tempo, tendo mudança de um estado para outro, segundo personagens ou o fato a ser narrado.
relações de sequencialidade e causalidade, e não simultâneos
como na descrição. Expressa as relações entre os indivíduos, Existem três tipos de foco narrativo:
os conflitos e as ligações afetivas entre esses indivíduos e o
mundo, utilizando situações que contêm essa vivência. - Narrador-personagem: é aquele que conta a história
Todas as vezes que uma história é contada (é narrada), na qual é participante. Nesse caso ele é narrador e personagem
o narrador acaba sempre contando onde, quando, como e ao mesmo tempo, a história é contada em 1ª pessoa.
com quem ocorreu o episódio. É por isso que numa narração - Narrador-observador: é aquele que conta a história
predomina a ação: o texto narrativo é um conjunto de ações; como alguém que observa tudo que acontece e transmite ao
assim sendo, a maioria dos verbos que compõem esse tipo de leitor, a história é contada em 3ª pessoa.
texto são os verbos de ação. O conjunto de ações que compõem - Narrador-onisciente: é o que sabe tudo sobre o enredo
o texto narrativo, ou seja, a história que é contada nesse tipo de e as personagens, revelando seus pensamentos e sentimentos
texto recebe o nome de enredo. íntimos. Narra em 3ª pessoa e sua voz, muitas vezes, aparece
As ações contidas no texto narrativo são praticadas pelas misturada com pensamentos dos personagens (discurso
personagens, que são justamente as pessoas envolvidas indireto livre).
no episódio que está sendo contado. As personagens são
identificadas (nomeadas) no texto narrativo pelos substantivos Estrutura:
próprios.
Quando o narrador conta um episódio, às vezes (mesmo - Apresentação: é a parte do texto em que são
sem querer) ele acaba contando “onde” (em que lugar) as apresentados alguns personagens e expostas algumas
ações do enredo foram realizadas pelas personagens. O lugar circunstâncias da história, como o momento e o lugar onde a
onde ocorre uma ação ou ações é chamado de espaço, ação se desenvolverá.
representado no texto pelos advérbios de lugar. - Complicação: é a parte do texto em que se inicia
A história contada, por isso, passa por uma introdução propriamente a ação. Encadeados, os episódios se sucedem,
(parte inicial da história, também chamada de prólogo), pelo conduzindo ao clímax.
desenvolvimento do enredo (é a história propriamente dita, - Clímax: é o ponto da narrativa em que a ação atinge seu
o meio, o “miolo” da narrativa, também chamada de trama) e momento crítico, tornando o desfecho inevitável.
termina com a conclusão da história (é o final ou epílogo). - Desfecho: é a solução do conflito produzido pelas ações
Aquele que conta a história é o narrador, que pode ser dos personagens.
pessoal (narra em 1ª pessoa: Eu) ou impessoal (narra em
3ª pessoa: Ele). Tipos de Personagens:
Assim, o texto narrativo é sempre estruturado por verbos de
ação, por advérbios de tempo, por advérbios de lugar e pelos Os personagens têm muita importância na construção de
substantivos que nomeiam as personagens, que são os agentes um texto narrativo, são elementos vitais. Podem ser principais
do texto, ou seja, aquelas pessoas que fazem as ações expressas ou secundários, conforme o papel que desempenham no
pelos verbos, formando uma rede: a própria história contada. enredo, podem ser apresentados direta ou indiretamente.
Tudo na narrativa depende do narrador, da voz que conta A apresentação direta acontece quando o personagem
a história. aparece de forma clara no texto, retratando suas características
físicas e/ou psicológicas, já a apresentação indireta se dá
Elementos Estruturais (I): quando os personagens aparecem aos poucos e o leitor vai
construindo a sua imagem com o desenrolar do enredo, ou seja,
- Enredo: desenrolar dos acontecimentos. a partir de suas ações, do que ela vai fazendo e do modo como
- Personagens: são seres que se movimentam, se vai fazendo.
relacionam e dão lugar à trama que se estabelece na ação.
Revelam-se por meio de características físicas ou psicológicas. - Em 1ª pessoa:
Os personagens podem ser lineares (previsíveis), complexos,
tipos sociais (trabalhador, estudante, burguês etc.) ou tipos Personagem Principal: há um “eu” participante que
humanos (o medroso, o tímido, o avarento etc.), heróis ou conta a história e é o protagonista.
antiheróis, protagonistas ou antagonistas.
- Narrador: é quem conta a história. - Em 3ª pessoa:

27
LÍNGUA PORTUGUESA
Onisciente: não há um eu que conta; é uma terceira no romance machadiano Memórias póstumas de Brás Cubas,
pessoa. quando o narrador começa contando sua morte para em
seguida relatar sua vida, a sequência temporal foi modificada.
Narrador Objetivo: não se envolve, conta a história No entanto, o leitor reconstitui, ao longo da leitura, as relações
como sendo vista por uma câmara ou filmadora. de anterioridade e de posterioridade.
Resumindo: na narração, as três características explicadas
Tipos de Discurso: acima (transformação de situações, figuratividade e relações
de anterioridade e posterioridade entre os episódios relatados)
Discurso Direto: o narrador passa a palavra diretamente devem estar presentes conjuntamente. Um texto que tenha só
para o personagem, sem a sua interferência. uma ou duas dessas características não é uma narração.

Discurso Indireto: o narrador conta o que o personagem Esquema que pode facilitar a elaboração de seu texto
diz, sem lhe passar diretamente a palavra. narrativo:

Discurso Indireto-Livre: ocorre uma fusão entre a fala - Introdução: citar o fato, o tempo e o lugar, ou seja, o que
do personagem e a fala do narrador. É um recurso relativamente aconteceu, quando e onde.
recente. Surgiu com romancistas inovadores do século XX. - Desenvolvimento: causa do fato e apresentação dos
personagens.
Sequência Narrativa: - Desenvolvimento: detalhes do fato.
- Conclusão: consequências do fato.
Uma narrativa não tem uma única mudança, mas várias:
uma coordena-se a outra, uma implica a outra, uma subordina- Tipologia da Narrativa Ficcional:
se a outra.
A narrativa típica tem quatro mudanças de situação: - Romance
- uma em que uma personagem passa a ter um querer ou - Conto
um dever (um desejo ou uma necessidade de fazer algo); - Crônica
- uma em que ela adquire um saber ou um poder (uma - Fábula
competência para fazer algo); - Lenda
- uma em que a personagem executa aquilo que queria ou - Parábola
devia fazer (é a mudança principal da narrativa); - Anedota
- uma em que se constata que uma transformação se deu e - Poema Épico
em que se podem atribuir prêmios ou castigos às personagens
(geralmente os prêmios são para os bons, e os castigos, para Tipologia da Narrativa NãoFiccional:
os maus).
- Memorialismo
Toda narrativa tem essas quatro mudanças, pois elas se - Notícias
pressupõem logicamente. Com efeito, quando se constata a - Relatos
realização de uma mudança é porque ela se verificou, e ela - História da Civilização
efetua-se porque quem a realiza pode, sabe, quer ou deve fazê-
la. Tomemos, por exemplo, o ato de comprar um apartamento: Apresentação da Narrativa:
quando se assina a escritura, realiza-se o ato de compra;
para isso, é necessário poder (ter dinheiro) e querer ou dever - visual: texto escrito; legendas + desenhos (história em
comprar (respectivamente, querer deixar de pagar aluguel ou quadrinhos) e desenhos.
ter necessidade de mudar, por ter sido despejado, por exemplo). - auditiva: narrativas radiofonizadas; fitas gravadas e discos.
Algumas mudanças são necessárias para que outras se - audiovisual: cinema; teatro e narrativas televisionadas.
deem. Assim, para apanhar uma fruta, é necessário apanhar
um bambu ou outro instrumento para derrubá-la. Para ter um Dissertação
carro, é preciso antes conseguir o dinheiro.
A dissertação é uma exposição, discussão ou interpretação
Narrativa e Narração de uma determinada ideia. É, sobretudo, analisar algum tema.
Pressupõe um exame crítico do assunto, lógica, raciocínio,
Existe alguma diferença entre as duas? Sim. A narratividade clareza, coerência, objetividade na exposição, um planejamento
é um componente narrativo que pode existir em textos que não de trabalho e uma habilidade de expressão.
são narrações. A narrativa é a transformação de situações. Por É em função da capacidade crítica que se questionam
exemplo, quando se diz “Depois da abolição, incentivou-se a pontos da realidade social, histórica e psicológica do mundo
imigração de europeus”, temos um texto dissertativo, que, no e dos semelhantes. Vemos também, que a dissertação no seu
entanto, apresenta um componente narrativo, pois contém significado diz respeito a um tipo de texto em que a exposição
uma mudança de situação: do não incentivo ao incentivo da de uma ideia, através de argumentos, é feita com a finalidade
imigração européia. de desenvolver um conteúdo científico, doutrinário ou artístico.
Se a narrativa está presente em quase todos os tipos de
texto, o que é narração? Dissertação Expositiva e Argumentativa:
A narração é um tipo de narrativa. Tem ela três
características: A dissertação expositiva é voltada para aqueles fatos que
- é um conjunto de transformações de situação estão sendo focados e discutidos pela grande mídia. É um tipo
- é um texto figurativo, isto é, opera com personagens e de acontecimento inquestionável, mesmo porque todos os
fatos concretos detalhes já foram expostos na televisão, rádio e novas mídias.
- as mudanças relatadas estão organizadas de maneira tal Já o texto dissertativo argumentativo vai fazer uma reflexão
que, entre elas, existe sempre uma relação de anterioridade e maior sobre os temas. Os pontos de vista devem ser declarados
posterioridade. em terceira pessoa, há interações entre os fatos que se aborda.
Tais fatos precisam ser esclarecidos para que o leitor se sinta
Essa relação de anterioridade e posterioridade é sempre convencido por tal escrita. Quem escreve uma dissertação
pertinente num texto narrativo, mesmo que a sequência linear argumentativa deve saber persuadir a partir de sua crítica de
da temporalidade apareça alterada. Assim, por exemplo,

28
LÍNGUA PORTUGUESA
determinado assunto. A linguagem jamais poderá deixar de ser ou descrever uma cena.
objetiva, com fatos reais, evidências e concretudes. - Cifras e Dados Estatísticos: citar cifras e dados
estatísticos.
São partes da dissertação: Introdução / - Hipótese: antecipa uma previsão, apontando para
Desenvolvimento / Conclusão. prováveis resultados.
- Interrogação: Toda sucessão de interrogações deve
Introdução: em que se apresenta o assunto; se apresenta a apresentar questionamento e reflexão.
ideia principal, sem, no entanto, antecipar seu desenvolvimento. - Refutação: questiona-se praticamente tudo: conceitos,
Tipos: valores, juízos.
- Causa e Consequência: estruturar o texto através dos
- Divisão: quando há dois ou mais termos a serem porquês de uma determinada situação.
discutidos. Ex: “Cada criatura humana traz duas almas consigo: - Oposição: abordar um assunto de forma dialética.
uma que olha de dentro para fora, outra que olha de fora para - Exemplificação: dar exemplos.
dentro...”
- Alusão Histórica: um fato passado que se relaciona a um Conclusão: é uma avaliação final do assunto, um
fato presente. Ex: “A crise econômica que teve início no começo fechamento integrado de tudo que se argumentou. Para ela
dos anos 80, com os conhecidos altos índices de inflação que convergem todas as ideias anteriormente desenvolvidas.
a década colecionou, agravou vários dos históricos problemas
sociais do país. Entre eles, a violência, principalmente a urbana, - Conclusão Fechada: recupera a ideia da tese.
cuja escalada tem sido facilmente identificada pela população - Conclusão Aberta: levanta uma hipótese, projeta um
brasileira.” pensamento ou faz uma proposta, incentivando a reflexão de
- Proposição: o autor explicita seus objetivos. quem lê.
- Convite: proposta ao leitor para que participe de alguma
coisa apresentada no texto. Ex: Você quer estar “na sua”? Quer Alguns pontos essenciais desse tipo de texto são:
se sentir seguro, ter o sucesso pretendido? Não entre pelo cano!
Faça parte desse time de vencedores desde a escolha desse - toda dissertação é uma demonstração, daí a necessidade
momento! de pleno domínio do assunto e habilidade de argumentação;
- Contestação: contestar uma ideia ou uma situação. Ex: - em consequência disso, impõem-se à fidelidade ao tema;
“É importante que o cidadão saiba que portar arma de fogo não - a coerência é tida como regra de ouro da dissertação;
é a solução no combate à insegurança.” - impõem-se sempre o raciocínio lógico;
- Características: caracterização de espaços ou aspectos. - a linguagem deve ser objetiva, denotativa; qualquer
- Estatísticas: apresentação de dados estatísticos. Ex: ambiguidade pode ser um ponto vulnerável na demonstração
“Em 1982, eram 15,8 milhões os domicílios brasileiros com do que se quer expor. Deve ser clara, precisa, natural, original,
televisores. Hoje, são 34 milhões (o sexto maior parque de nobre, correta gramaticalmente. O discurso deve ser impessoal
aparelhos receptores instalados do mundo). Ao todo, existem (evitar-se o uso da primeira pessoa).
no país 257 emissoras (aquelas capazes de gerar programas) e
2.624 repetidoras (que apenas retransmitem sinais recebidos). O parágrafo é a unidade mínima do texto e deve apresentar:
(...)” uma frase contendo a ideia principal (frase nuclear) e uma ou
- Declaração Inicial: emitir um conceito sobre um fato. mais frases que explicitem tal ideia.
- Citação: opinião de alguém de destaque sobre o assunto do Exemplo: “A televisão mostra uma realidade idealizada
texto. Ex: “A principal característica do déspota encontra-se no (ideia central) porque oculta os problemas sociais realmente
fato de ser ele o autor único e exclusivo das normas e das regras graves. (ideia secundária)”.
que definem a vida familiar, isto é, o espaço privado. Seu poder, Vejamos:
escreve Aristóteles, é arbitrário, pois decorre exclusivamente de Ideia central: A poluição atmosférica deve ser combatida
sua vontade, de seu prazer e de suas necessidades.” urgentemente.
- Definição: desenvolve-se pela explicação dos termos que
compõem o texto. Desenvolvimento: A poluição atmosférica deve ser
- Interrogação: questionamento. Ex: “Volta e meia se faz combatida urgentemente, pois a alta concentração de elementos
a pergunta de praxe: afinal de contas, todo esse entusiasmo tóxicos põe em risco a vida de milhares de pessoas, sobretudo
pelo futebol não é uma prova de alienação?” daquelas que sofrem de problemas respiratórios:
- Suspense: alguma informação que faça aumentar a
curiosidade do leitor. - A propaganda intensiva de cigarros e bebidas tem levado
- Comparação: social e geográfica. muita gente ao vício.
- Enumeração: enumerar as informações. Ex: “Ação - A televisão é um dos mais eficazes meios de comunicação
à distância, velocidade, comunicação, linha de montagem, criados pelo homem.
triunfo das massas, Holocausto: através das metáforas e das - A violência tem aumentado assustadoramente nas cidades
realidades que marcaram esses 100 últimos anos, aparece a e hoje parece claro que esse problema não pode ser resolvido
verdadeira doença do século...” apenas pela polícia.
- Narração: narrar um fato. - O diálogo entre pais e filhos parece estar em crise
atualmente.
Desenvolvimento: é a argumentação da ideia inicial, - O problema dos sem-terra preocupa cada vez mais a
de forma organizada e progressiva. É a parte maior e mais sociedade brasileira.
importante do texto. Podem ser desenvolvidos de várias formas:
O parágrafo pode processar-se de diferentes maneiras:
- Trajetória Histórica: cultura geral é o que se prova
com este tipo de abordagem. Enumeração: Caracteriza-se pela exposição de uma
- Definição: não basta citar, mas é preciso desdobrar a ideia série de coisas, uma a uma. Presta-se bem à indicação
principal ao máximo, esclarecendo o conceito ou a definição. de características, funções, processos, situações, sempre
- Comparação: estabelecer analogias, confrontar oferecendo o complemento necessário à afirmação estabelecida
situações distintas. na frase nuclear. Pode-se enumerar, seguindo-se os critérios de
- Bilateralidade: quando o tema proposto apresenta importância, preferência, classificação ou aleatoriamente.
pontos favoráveis e desfavoráveis. Causa e Consequência: A frase nuclear, muitas vezes,
- Ilustração Narrativa ou Descritiva: narrar um fato encontra no seu desenvolvimento um segmento causal (fato

29
LÍNGUA PORTUGUESA
motivador) e, em outras situações, um segmento indicando Nesse tipo textual, não se faz a defesa de uma ideia. Exemplos
consequências (fatos decorrentes). de textos explicativos são os encontrados em manuais de
instruções.
- O espírito competitivo foi excessivamente exercido entre
nós, de modo que hoje somos obrigados a viver numa sociedade Informativo: Tem a função de informar o leitor a respeito
fria e inamistosa. de algo ou alguém, é o texto de uma notícia de jornal, de revista,
folhetos informativos, propagandas. Uso da função referencial
Tempo e Espaço: Muitos parágrafos dissertativos marcam da linguagem, 3ª pessoa do singular.
temporal e espacialmente a evolução de ideias, processos.
Argumentativo: Os textos argumentativos, ao contrário,
Explicitação: Num parágrafo dissertativo pode-se têm por finalidade principal persuadir o leitor sobre o ponto
conceituar, exemplificar e aclarar as ideias para torná-las mais de vista do autor a respeito do assunto. Quando o texto, além
compreensíveis. de explicar, também persuade o interlocutor e modifica seu
Exemplo: “Artéria é um vaso que leva sangue proveniente do comportamento, temos um texto dissertativo-argumentativo.
coração para irrigar os tecidos. Exceto no cordão umbilical e na Exemplos: texto de opinião, carta do leitor, carta de
ligação entre os pulmões e o coração, todas as artérias contém solicitação, deliberação informal, discurso de defesa e acusação
sangue vermelho-vivo, recém-oxigenado. Na artéria pulmonar, (advocacia), resenha crítica, artigos de opinião ou assinados,
porém, corre sangue venoso, mais escuro e desoxigenado, que editorial.
o coração remete para os pulmões para receber oxigênio e
liberar gás carbônico”. Exposição: Apresenta informações sobre assuntos, expõe
ideias, explica, avalia, reflete. Estrutura básica; ideia principal;
Antes de se iniciar a elaboração de uma dissertação, deve desenvolvimento; conclusão. Uso de linguagem clara. Ex:
delimitar-se o tema que será desenvolvido e que poderá ser ensaios, artigos científicos, exposições,etc.
enfocado sob diversos aspectos. Se, por exemplo, o tema é
a questão indígena, ela poderá ser desenvolvida a partir das Injunção: Indica como realizar uma ação. É também
seguintes ideias: utilizado para predizer acontecimentos e comportamentos.
Utiliza linguagem objetiva e simples. Os verbos são, na sua
- A violência contra os povos indígenas é uma constante na maioria, empregados no modo imperativo. Há também o uso
história do Brasil. do futuro do presente. Ex: Receita de um bolo e manuais.
- O surgimento de várias entidades de defesa das populações
indígenas. Diálogo: é uma conversação estabelecida entre duas ou
- A visão idealizada que o europeu ainda tem do índio mais pessoas. Pode conter marcas da linguagem oral, como
brasileiro. pausas e retomadas.
- A invasão da Amazônia e a perda da cultura indígena.
Entrevista: é uma conversação entre duas ou mais pessoas
Depois de delimitar o tema que você vai desenvolver, deve (o entrevistador e o entrevistado), na qual perguntas são feitas
fazer a estruturação do texto. pelo entrevistador para obter informação do entrevistado. Os
repórteres entrevistam as suas fontes para obter declarações
A estrutura do texto dissertativo constitui-se de: que validem as informações apuradas ou que relatem situações
vividas por personagens. Antes de ir para a rua, o repórter
Introdução: deve conter a ideia principal a ser recebe uma pauta que contém informações que o ajudarão
desenvolvida (geralmente um ou dois parágrafos). É a abertura a construir a matéria. Além das informações, a pauta sugere
do texto, por isso é fundamental. Deve ser clara e chamar a o enfoque a ser trabalhado assim como as fontes a serem
atenção para dois itens básicos: os objetivos do texto e o plano entrevistadas. Antes da entrevista o repórter costuma reunir
do desenvolvimento. Contém a proposição do tema, seus o máximo de informações disponíveis sobre o assunto a ser
limites, ângulo de análise e a hipótese ou a tese a ser defendida. abordado e sobre a pessoa que será entrevistada. Munido deste
Desenvolvimento: exposição de elementos que vão material, ele formula perguntas que levem o entrevistado a
fundamentar a ideia principal que pode vir especificada através fornecer informações novas e relevantes. O repórter também
da argumentação, de pormenores, da ilustração, da causa deve ser perspicaz para perceber se o entrevistado mente ou
e da consequência, das definições, dos dados estatísticos, manipula dados nas suas respostas, fato que costuma acontecer
da ordenação cronológica, da interrogação e da citação. principalmente com as fontes oficiais do tema. Por exemplo,
No desenvolvimento são usados tantos parágrafos quantos quando o repórter vai entrevistar o presidente de uma instituição
forem necessários para a completa exposição da ideia. E esses pública sobre um problema que está afetando o fornecimento de
parágrafos podem ser estruturados das cinco maneiras expostas serviços à população, ele tende a evitar as perguntas e a querer
acima. reverter a resposta para o que considera positivo na instituição.
Conclusão: é a retomada da ideia principal, que agora É importante que o repórter seja insistente. O entrevistador
deve aparecer de forma muito mais convincente, uma vez que deve conquistar a confiança do entrevistado, mas não tentar
já foi fundamentada durante o desenvolvimento da dissertação dominá-lo, nem ser por ele dominado. Caso contrário, acabará
(um parágrafo). Deve, pois, conter de forma sintética, o induzindo as respostas ou perdendo a objetividade.
objetivo proposto na instrução, a confirmação da hipótese As entrevistas apresentam com frequência alguns sinais
ou da tese, acrescida da argumentação básica empregada no de pontuação como o ponto de interrogação, o travessão,
desenvolvimento. aspas, reticências, parêntese e às vezes colchetes, que servem
para dar ao leitor maior informações que ele supostamente
Texto Literário: expressa a opinião pessoal do autor desconhece. O título da entrevista é um enunciado curto que
que também é transmitida através de figuras, impregnado chama a atenção do leitor e resume a ideia básica da entrevista.
de subjetivismo. Ex: um romance, um conto, uma poesia... Pode estar todo em letra maiúscula e recebe maior destaque
(Conotação, Figurado, Subjetivo, Pessoal). da página. Na maioria dos casos, apenas as preposições ficam
com a letra minúscula. O subtítulo introduz o objetivo principal
Texto Não-Literário: preocupa-se em transmitir uma da entrevista e não vem seguido de ponto final. É um pequeno
mensagem da forma mais clara e objetiva possível. Ex: uma texto e vem em destaque também. A fotografia do entrevistado
notícia de jornal, uma bula de medicamento. (Denotação, aparece normalmente na primeira página da entrevista e
Claro, Objetivo, Informativo). pode estar acompanhada por uma frase dita por ele. As frases
O objetivo do texto é passar conhecimento para o leitor. importantes ditas pelo entrevistado e que aparecem em

30
LÍNGUA PORTUGUESA
destaque nas outras páginas da entrevista são chamadas de Enquanto isso, estudo o desespero de especuladores que
“olho”. aguardarão a improvável recuperação dos imóveis, da Petrobras,
da credibilidade dos mercados. Quando esses especuladores
Crônica: Assim como a fábula e o enigma, a crônica é jogarem a toalha, usarei parte de minhas reservas para fazer
um gênero narrativo. Como diz a origem da palavra (Cronos investimentos bons e baratos. Mas não na Petrobras.
é o deus grego do tempo), narra fatos históricos em ordem Muita gente fala que, com a inflação e a recessão, pode
cronológica, ou trata de temas da atualidade. Mas não é só isso. perder o emprego ou os clientes. Faltará renda, faltarão
Lendo esse texto, você conhecerá as principais características consumidores. O ano de 2015 será, mais uma vez, ruim para
da crônica, técnicas de sua redação e terá exemplos. quem vende. Será um ano bom para quem pensa em comprar.
Uma das mais famosas crônicas da história da literatura luso- Estarei atento aos bons negócios para quem tem dinheiro na
brasileira corresponde à definição de crônica como “narração mão. Se a renda fixa paga bem, a compra à vista tende a me
histórica”. É a “Carta de Achamento do Brasil”, de Pero Vaz de dar descontos maiores. É por esse mesmo motivo que, em 2015,
Caminha, na qual são narrados ao rei português, D. Manuel, o evitarei as dívidas. Os juros estão altos e isso me convida a
descobrimento do Brasil e como foram os primeiros dias que poupar, e não a alugar dinheiro dos bancos. Dívidas de longo
os marinheiros portugueses passaram aqui. Mas trataremos, prazo são corrigidas pela inflação, também em alta. Por isso,
sobretudo, da crônica como gênero que comenta assuntos do aproveitarei os ganhos extras de fim de ano para liquidar
dia a dia. dívidas e me policiar para não contrair novas.
Questões No ano que começa, também não quero fazer papel de otário
e deixar nas mãos do governo mais impostos do que preciso.
01. Não sonegarei. Mas aproveitarei o fim do ano para organizar
(...) Há um pôr-do-sol de primavera e uma velha meus papéis e comprovantes, planejar a declaração de Imposto
casa abandonada. Está em ruínas. de Renda de março e tentar a maior restituição que puder, ou
A velha casa não mais abriga vidas em seu interior. o mínimo pagamento necessário. Listarei meus gastos com
Tudo é passado. Tudo é lembrança. dependentes, educação e saúde, doarei para instituições que
Hoje, apenas almas juvenis brincam fazem o bem, aplicarei num PGBL o que for necessário para o
despreocupadas e felizes entre suas paredes máximo benefício. Entregarei minha declaração quanto antes,
trêmulas. no início de março. Quero ver minha restituição na conta mais
Em seu chão, despido da madeira polida que a cedo, já que 2015 será um ano bom para quem tiver dinheiro
cobriam, brotam ervas daninhas. Entre a vegetação na mão.
que busca minimizar as doces recordações do Para quem lamenta, recomendo cuidado com o monstro e
passado, surge a figura amarela e suave da com o governo. Para quem está atento às oportunidades, desejo
margarida, flor-mulher. As nuanças de suas cores boas compras.
sorriem e denunciam lembranças de seus
ocupantes. 'LVSRQtYHOHPKWWSHSRFDJORERFRPFROXQDV H EORJV
A velha casa está em ruínas. Pássaros saltitam e JXVWDYR FHUEDVLQRWLFLDFRPR FXLGDU GH EVHX
gorjeiam nas amuradas que a cercam. Seus trinados GLQKHLURE HP KWPO$FHVVRHP
são melodias no altar do tempo à espera de
redentoras orações. Raízes vorazes de grandes De acordo com a tipologia textual, o objetivo principal do
árvores infiltraram-se entre as pedras do alicerce e autor é:
abalam suas estruturas. (A) narrar.
Agoniza a velha casa. Agora, somente imagens (B) instruir.
desfilam, ao longo das noites. As janelas são bocas (C) descrever.
escancaradas. A casa velha em ruínas clama por (D) argumentar.
vozes e movimentos...
(Geraldo M. de Carvalho) 03.

De acordo com a tipologia textual, o texto acima:


(A) é descritivo, com traços dissertativos compondo um
ambiente nostálgico.
(B) possui descrição subjetiva apenas no trecho “A velha
casa não mais abriga vidas em seu interior. Tudo é passado.
Tudo é lembrança.”
(C) ocorre uma descrição objetiva narrativa no trecho todo.
(D) é formado basicamente de descrições subjetivas.

02.
Como cuidar de seu dinheiro em 2015
Gustavo
Cerbasi.

Em 2015, cuidarei bem do meu dinheiro. Organizarei bem


os números e as verbas. Esses números mudarão bastante ao “Ao final dos anos 80, a Petrobras se encontrava diante do
longo do ano. Um monstro chamado inflação ronda o país. Só desafio de produzir petróleo em águas abaixo de 500 metros,
que, agora, ele usa um manto da invisibilidade, que ganhou feito não conseguido então por nenhuma companhia no
de seu criador, o governo. Quando morder meu bolso, eu nem mundo. Num gesto de ousadia, decidiu desenvolver no Brasil
saberei de onde terá vindo o ataque, não terei tempo de me a tecnologia necessária para produzir em águas até mil metros.
defender. Por isso, deixarei boas gorduras no orçamento para O sucesso foi total. Menos de uma década depois, a Petrobras
atirar a ele, quando aparecer. Essas gorduras serão chamadas dispõe de tecnologia comprovada para produção de petróleo
de verba para lazer e reservas de emergência. em águas muito profundas. O último recorde foi obtido em
Em 2015, não farei apostas. Já há gente demais apostando janeiro de 1999 no campo de Roncador, na bacia de Campos,
em imóveis, ações e outros investimentos especulativos. Farei produzindo a 1.853 metros de profundidade. Mas a escalada
escolhas certeiras. Deixarei a maior parte de meu investimento não para. Ao encerrar-se a década, a empresa prepara-se para
na renda fixa. Ela está com uma generosidade única no mundo. superar, mais uma vez, seus próprios limites. A meta, agora, são

31
LÍNGUA PORTUGUESA
os 3 mil metros de profundidade, a serem alcançados mediante orações, um fenômeno de coesão. Há dois tipos principais de
projetos que aliam a inovação tecnológica à redução de custos. mecanismos de coesão: retomada ou antecipação de palavras,
“ expressões ou frases e encadeamento de segmentos.

Exposição PETROBRAS em 60 momentos. Agência Retomada ou Antecipação por meio de uma


Petrobras palavra gramatical - (pronome, verbos ou advérbios)

O tipo textual predominante que caracteriza o texto é a: “No mercado de trabalho brasileiro, ainda hoje não há total
(A) narração. igualdade entre homens e mulheres: estas ainda ganham menos
(B) predição do que aqueles em cargos equivalentes.”
(C) instrução
(D) descrição. Nesse período, o pronome demonstrativo “estas” retoma o
(E) argumentação termo mulheres, enquanto “aqueles” recupera a palavra homens.
Os termos que servem para retomar outros são denominados
04. anafóricos; os que servem para anunciar, para antecipar outros
Por isso foi à luz de uma vela mortiça são chamados catafóricos. No exemplo a seguir, desta antecipa
Que li, inserto na cama, abandonar a faculdade no último ano:
O que estava à mão para ler --
(...) “Já viu uma loucura desta, abandonar a faculdade no último
Em torno de mim o sossego excessivo de noite de província ano?”
Fazia um grande Barulho ao contrário,
Dava-me uma tendência do choro para a desolação. São anafóricos ou catafóricos os pronomes demonstrativos,
A “Primeira Epístola aos Coríntios” ... os pronomes relativos, certos advérbios ou locuções adverbiais
Relia-a à luz de uma vela subitamente antiquíssima, (nesse momento, então, lá), o verbo fazer, o artigo definido, os
E um grande mar de emoção ouvia-se dentro de mim... pronomes pessoais de 3ª pessoa (ele, o, a, os, as, lhe, lhes), os
Sou nada... pronomes indefinidos. Exemplos:
Sou uma ficção...
Que ando eu a querer de mim ou de tudo neste mundo? “Ele era muito diferente de seu mestre, a quem sucedera na
“Se eu não tivesse a caridade.” cátedra de Sociologia na Universidade de São Paulo.”
E a soberana luz manda, e do alto dos séculos,
A grande mensagem com que a alma é livre... O pronome relativo “quem” retoma o substantivo mestre.
“Se eu não tivesse a caridade...”
Meu Deus, e eu que não tenho a caridade. “As pessoas simplificam Machado de Assis; elas o veem como
um descrente do amor e da amizade.”
CAMPOS, Álvaro de. (Heterônimo de Fernando Pessoa). Ali não
havia eletricidade. In: “Poemas”. Disponível em:< http:// www. O pronome pessoal “elas” recupera o substantivo pessoas; o
citador.pt/poemas/>. Acesso em: 5 jan. 2015, com adaptações. pronome pessoal “o” retoma o nome Machado de Assis.

A respeito da tipologia textual, é correto afirmar que o “Os dois homens caminhavam pela calçada, ambos trajando
poema representa uma roupa escura.”
(A) narração.
(B) argumentação. O numeral “ambos” retoma a expressão os dois homens.
(C) descrição.
(D) caracterização. “Fui ao cinema domingo e, chegando lá, fiquei desanimado
(E) dissertação. com a fila.”
Respostas
01. D / 02. D / 03. A. / 04. A. O advérbio “lá” recupera a expressão ao cinema.

“O governador vai pessoalmente inaugurar a creche dos


funcionários do palácio, e o fará para demonstrar seu apreço aos
servidores.”

A forma verbal “fará” retoma a perífrase verbal vai inaugurar


Coesão e coerência textuais. e seu complemento.

- Em princípio, o termo a que “o” anafórico se refere deve


Coesão estar presente no texto, senão a coesão fica comprometida,
como neste exemplo:
Uma das propriedades que distinguem um texto de um
amontoado de frases é a relação existente entre os elementos “André é meu grande amigo. Começou a namorá-la há vários
que os constituem. A coesão textual é a ligação, a relação, meses.”
a conexão entre palavras, expressões ou frases do texto. Ela
manifesta-se por elementos gramaticais, que servem para A rigor, não se pode dizer que o pronome “la” seja um
estabelecer vínculos entre os componentes do texto. Observe: anafórico, pois não está retomando nenhuma das palavras
citadas antes. Exatamente por isso, o sentido da frase fica
“O iraquiano leu sua declaração num bloquinho comum de totalmente prejudicado: não há possibilidade de se depreender
anotações, que segurava na mão.” o sentido desse pronome.
Pode ocorrer, no entanto, que o anafórico não se refira a
Nesse período, o pronome relativo “que” estabelece conexão nenhuma palavra citada anteriormente no interior do texto,
entre as duas orações. O iraquiano leu sua declaração num mas que possa ser inferida por certos pressupostos típicos da
bloquinho comum de anotações e segurava na mão, retomando cultura em que se inscreve o texto. É o caso de um exemplo
na segunda um dos termos da primeira: bloquinho. O pronome como este:
relativo é um elemento coesivo, e a conexão entre as duas

32
LÍNGUA PORTUGUESA
“O casamento teria sido às 20 horas. O noivo já estava “Um presidente da República tem uma agenda de trabalho
desesperado, porque eram 21 horas e ela não havia comparecido.” extremamente carregada. Deve receber ministros, embaixadores,
visitantes estrangeiros, parlamentares; precisa a todo o momento
Por dados do contexto cultural, sabe-se que o pronome “ela” tomar graves decisões que afetam a vida de muitas pessoas;
é um anafórico que só pode estar-se referindo à palavra noiva. necessita acompanhar tudo o que acontece no Brasil e no mundo.
Num casamento, estando presente o noivo, o desespero só pode Um presidente deve começar a trabalhar ao raiar do dia e terminar
ser pelo atraso da noiva (representada por “ela” no exemplo sua jornada altas horas da noite.”
citado).
A repetição do termo presidente estabelece a coesão entre o
- O artigo indefinido serve geralmente para introduzir último período e o que vem antes dele.
informações novas ao texto. Quando elas forem retomadas,
deverão ser precedidas do artigo definido, pois este é que tem a “Observava as estrelas, os planetas, os satélites. Os astros
função de indicar que o termo por ele determinado é idêntico, sempre o atraíram.”
em termos de valor referencial, a um termo já mencionado.
Os dois períodos estão relacionados pelo hiperônimo astros,
“O encarregado da limpeza encontrou uma carteira na sala que recupera os hipônimos estrelas, planetas, satélites.
de espetáculos. Curiosamente, a carteira tinha muito dinheiro
dentro, mas nem um documento sequer.” “Eles (os alquimistas) acreditavam que o organismo do homem
era regido por humores (fluidos orgânicos) que percorriam,
- Quando, em dado contexto, o anafórico pode referir-se a ou apenas existiam, em maior ou menor intensidade em nosso
dois termos distintos, há uma ruptura de coesão, porque ocorre corpo. Eram quatro os humores: o sangue, a fleuma (secreção
uma ambiguidade insolúvel. É preciso que o texto seja escrito pulmonar), a bile amarela e a bile negra. E eram também estes
de tal forma que o leitor possa determinar exatamente qual é a quatro fluidos ligados aos quatro elementos fundamentais: ao
palavra retomada pelo anafórico. Ar (seco), à Água (úmido), ao Fogo (quente) e à Terra (frio),
respectivamente.”
“Durante o ensaio, o ator principal brigou com o diretor por
causa da sua arrogância.” Ziraldo. In: Revista Vozes, nº3, abril de 1970, p.18.

O anafórico “sua” pode estar-se referindo tanto à palavra Nesse texto, a ligação entre o segundo e o primeiro períodos
ator quanto a diretor. se faz pela repetição da palavra humores; entre o terceiro e o
segundo se faz pela utilização do sinônimo fluidos.
“André brigou com o ex-namorado de uma amiga, que É preciso manejar com muito cuidado a repetição de
trabalha na mesma firma.” palavras, pois, se ela não for usada para criar um efeito de
sentido de intensificação, constituirá uma falha de estilo.
Não se sabe se o anafórico “que” está se referindo ao termo No trecho transcrito a seguir, por exemplo, fica claro o uso
amiga ou a ex-namorado. Permutando o anafórico “que” por “o da repetição da palavra vice e outras parecidas (vicissitudes,
qual” ou “a qual”, essa ambiguidade seria desfeita. vicejam, viciem), com a evidente intenção de ridicularizar a
condição secundária que um provável flamenguista atribui ao
Retomada por palavra lexical - (substantivo, Vasco e ao seu Vice-presidente:
adjetivo ou verbo)
“Recebi por esses dias um e-mail com uma série de piadas
Uma palavra pode ser retomada, que por uma repetição, sobre o pouco simpático Eurico Miranda. Faltam-me provas, mas
quer por uma substituição por sinônimo, hiperônimo, hipônimo tudo leva a crer que o remetente seja um flamenguista.”
ou antonomásia.
Sinônimo é o nome que se dá a uma palavra que possui Segundo o texto, Eurico nasceu para ser vice: é vice-
o mesmo sentido que outra, ou sentido bastante aproximado: presidente do clube, vice-campeão carioca e bi-vice-campeão
injúria e afronta, alegre e contente. mundial. E isso sem falar do vice no Carioca de futsal, no Carioca
Hiperônimo é um termo que mantém com outro uma de basquete, no Brasileiro de basquete e na Taça Guanabara.
relação do tipo contém/está contido; São vicissitudes que vicejam. Espero que não viciem.
Hipônimo é uma palavra que mantém com outra uma
relação do tipo está contido/contém. O significado do termo José Roberto Torero. In: Folha de S. Paulo, 08/03/2000, p.
rosa está contido no de flor e o de flor contém o de rosa, pois 4-7.
toda rosa é uma flor, mas nem toda flor é uma rosa. Flor é, pois,
hiperônimo de rosa, e esta palavra é hipônimo daquela. A elipse é o apagamento de um segmento de frase que
Antonomásia é a substituição de um nome próprio por pode ser facilmente recuperado pelo contexto. Também
um nome comum ou de um comum por um próprio. Ela ocorre, constitui um expediente de coesão, pois é o apagamento de um
principalmente, quando uma pessoa célebre é designada por termo que seria repetido, e o preenchimento do vazio deixado
uma característica notória ou quando o nome próprio de uma pelo termo apagado (=elíptico) exige, necessariamente, que se
personagem famosa é usado para designar outras pessoas que faça correlação com outros termos presentes no contexto, ou
possuam a mesma característica que a distingue: referidos na situação em que se desenrola a fala.
Vejamos estes versos do poema “Círculo vicioso”, de
“O rei do futebol (=Pelé) só podia ser um brasileiro.” Machado de Assis:

“O herói de dois mundos (=Garibaldi) foi lembrado numa (...)


recente minissérie de tevê.” Mas a lua, fitando o sol, com azedume:

Referência ao fato notório de Giuseppe Garibaldi haver “Mísera! Tivesse eu aquela enorme, aquela
lutado pela liberdade na Europa e na América. Claridade imorta, que toda a luz resume!”
Obra completa. Rio de Janeiro, Nova Aguilar, 1979, v.III,
“Ele é um Hércules.” (=um homem muito forte). p. 151.

Referência à força física que caracteriza o herói grego Nesse caso, o verbo dizer, que seria enunciado antes daquilo
Hércules. que disse a lua, isto é, antes das aspas, fica subentendido, é

33
LÍNGUA PORTUGUESA
omitido por ser facilmente presumível. Arrolam-se três argumentos em favor da tese que é o
Qualquer segmento da frase pode sofrer elipse. Veja que, interlocutor quem pode tomar uma dada decisão. O último
no exemplo abaixo, é o sujeito meu pai que vem elidido (ou deles é introduzido por “e também”, que indica um argumento
apagado) antes de sentiu e parou: final na mesma direção argumentativa dos precedentes.
Esses operadores introduzem novos argumentos; não
“Meu pai começou a andar novamente, sentiu a pontada no significam, em hipótese nenhuma, a repetição do que já foi dito.
peito e parou.” Ou seja, só podem ser ligados com conectores de conjunção
segmentos que representam uma progressão discursiva.
Pode ocorrer também elipse por antecipação. No exemplo É possível dizer “Disfarçou as lágrimas que o assaltaram e
que segue, aquela promoção é complemento tanto de querer continuou seu discurso”, porque o segundo segmento indica
quanto de desejar, no entanto aparece apenas depois do um desenvolvimento da exposição. Não teria cabimento
segundo verbo: usar operadores desse tipo para ligar dois segmentos como
“Disfarçou as lágrimas que o assaltaram e escondeu o choro
“Ficou muito deprimido com o fato de ter sido preferido. que tomou conta dele”.
Afinal, queria muito, desejava ardentemente aquela promoção.”
- Disjunção Argumentativa: há também operadores
Quando se faz essa elipse por antecipação com verbos que indicam uma disjunção argumentativa, ou seja, fazem uma
que têm regência diferente, a coesão é rompida. Por exemplo, conexão entre segmentos que levam a conclusões opostas, que
não se deve dizer “Conheço e gosto deste livro”, pois o verbo têm orientação argumentativa diferente: ou, ou então, quer...
conhecer rege complemento não introduzido por preposição, quer, seja... seja, caso contrário, ao contrário.
e a elipse retoma o complemento inteiro, portanto teríamos
uma preposição indevida: “Conheço (deste livro) e gosto deste “Não agredi esse imbecil. Ao contrário, ajudei a separar a
livro”. Em “Implico e dispenso sem dó os estranhos palpiteiros”, briga, para que ele não apanhasse.”
diferentemente, no complemento em elipse faltaria a preposição
“com” exigida pelo verbo implicar. O argumento introduzido por ao contrário é diametralmente
Nesses casos, para assegurar a coesão, o recomendável é oposto àquele de que o falante teria agredido alguém.
colocar o complemento junto ao primeiro verbo, respeitando
sua regência, e retomá-lo após o segundo por um anafórico, - Conclusão: existem operadores que marcam uma
acrescentando a preposição devida (Conheço este livro e conclusão em relação ao que foi dito em dois ou mais enunciados
gosto dele) ou eliminando a indevida (Implico com estranhos anteriores (geralmente, uma das afirmações de que decorre a
palpiteiros e os dispenso sem dó). conclusão fica implícita, por manifestar uma voz geral, uma
verdade universalmente aceita): logo, portanto, por conseguinte,
Coesão por Conexão pois (o pois é conclusivo quando não encabeça a oração).

Há na língua uma série de palavras ou locuções que são “Essa guerra é uma guerra de conquista, pois visa ao
responsáveis pela concatenação ou relação entre segmentos controle dos fluxos mundiais de petróleo. Por conseguinte, não é
do texto. Esses elementos denominam-se conectores ou moralmente defensável.”
operadores discursivos. Por exemplo: visto que, até, ora, no
entanto, contudo, ou seja. Por conseguinte introduz uma conclusão em relação à
Note-se que eles fazem mais do que ligar partes do texto: afirmação exposta no primeiro período.
estabelecem entre elas relações semânticas de diversos tipos,
como contrariedade, causa, consequência, condição, conclusão, - Comparação: outros importantes operadores discursivos
etc. Essas relações exercem função argumentativa no texto, são os que estabelecem uma comparação de igualdade,
por isso os operadores discursivos não podem ser usados superioridade ou inferioridade entre dois elementos, com vistas
indiscriminadamente. a uma conclusão contrária ou favorável a certa ideia: tanto...
Na frase “O time apresentou um bom futebol, mas não quanto, tão... como, mais... (do) que.
alcançou a vitória”, por exemplo, o conector “mas” está
adequadamente usado, pois ele liga dois segmentos com “Os problemas de fuga de presos serão tanto mais graves
orientação argumentativa contrária. Se fosse utilizado, nesse quanto maior for a corrupção entre os agentes penitenciários.”
caso, o conector “portanto”, o resultado seria um paradoxo
semântico, pois esse operador discursivo liga dois segmentos O comparativo de igualdade tem no texto uma função
com a mesma orientação argumentativa, sendo o segmento argumentativa: mostrar que o problema da fuga de presos
introduzido por ele a conclusão do anterior. cresce à medida que aumenta a corrupção entre os agentes
penitenciários; por isso, os segmentos podem até ser permutáveis
- Gradação: há operadores que marcam uma gradação do ponto de vista sintático, mas não o são do ponto de vista
numa série de argumentos orientados para uma mesma argumentativo, pois não há igualdade argumentativa proposta,
conclusão. Dividem-se eles, em dois subtipos: os que indicam “Tanto maior será a corrupção entre os agentes penitenciários
o argumento mais forte de uma série: até, mesmo, até mesmo, quanto mais grave for o problema da fuga de presos”.
inclusive, e os que subentendem uma escala com argumentos Muitas vezes a permutação dos segmentos leva a conclusões
mais fortes: ao menos, pelo menos, no mínimo, no máximo, opostas: Imagine-se, por exemplo, o seguinte diálogo entre o
quando muito. diretor de um clube esportivo e o técnico de futebol:

- Conjunção Argumentativa: há operadores que “__Precisamos promover atletas das divisões de base para
assinalam uma conjunção argumentativa, ou seja, ligam um reforçar nosso time.
conjunto de argumentos orientados em favor de uma dada __Qualquer atleta das divisões de base é tão bom quanto os
conclusão: e, também, ainda, nem, não só... mas também, do time principal.”
tanto... como, além de, a par de.
Nesse caso, o argumento do técnico é a favor da promoção,
“Se alguém pode tomar essa decisão é você. Você é o diretor da pois ele declara que qualquer atleta das divisões de base
escola, é muito respeitado pelos funcionários e também é muito tem, pelo menos, o mesmo nível dos do time principal, o que
querido pelos alunos.” significa que estes não primam exatamente pela excelência em
relação aos outros.

34
LÍNGUA PORTUGUESA
Suponhamos, agora, que o técnico tivesse invertido os que introduzem um argumento decisivo para derrubar a
segmentos na sua fala: argumentação contrária, mas apresentando-o como se fosse
um acréscimo, como se fosse apenas algo mais numa série
“__Qualquer atleta do time principal é tão bom quanto os das argumentativa: além do mais, além de tudo, além disso, ademais.
divisões de base.”
“Ele está num período muito bom da vida: começou a namorar
Nesse caso, seu argumento seria contra a necessidade da a mulher de seus sonhos, foi promovido na empresa, recebeu um
promoção, pois ele estaria declarando que os atletas do time prêmio que ambicionava havia muito tempo e, além disso, ganhou
principal são tão bons quanto os das divisões de base. uma bolada na loteria.”

- Explicação ou Justificativa: há operadores que O operador discursivo introduz o que se considera a prova
introduzem uma explicação ou uma justificativa em relação ao mais forte de que “Ele está num período muito bom da vida”; no
que foi dito anteriormente: porque, já que, que, pois. entanto, essa prova é apresentada como se fosse apenas mais
uma.
“Já que os Estados Unidos invadiram o Iraque sem autorização
da ONU, devem arcar sozinhos com os custos da guerra.” - Generalização ou Amplificação: existem operadores
que assinalam uma generalização ou uma amplificação do que
Já que inicia um argumento que dá uma justificativa para foi dito antes: de fato, realmente, como aliás, também, é verdade
a tese de que os Estados Unidos devam arcar sozinhos com o que.
custo da guerra contra o Iraque.
“O problema da erradicação da pobreza passa pela geração de
- Contrajunção: os operadores discursivos que assinalam empregos. De fato, só o crescimento econômico leva ao aumento
uma relação de contrajunção, isto é, que ligam enunciados de renda da população.”
com orientação argumentativa contrária, são as conjunções
adversativas (mas, contudo, todavia, no entanto, entretanto, O conector introduz uma amplificação do que foi dito antes.
porém) e as concessivas (embora, apesar de, apesar de que,
conquanto, ainda que, posto que, se bem que). “Ele é um técnico retranqueiro, como aliás o são todos os que
Qual é a diferença entre as adversativas e as concessivas, atualmente militam no nosso futebol.
se tanto umas como outras ligam enunciados com orientação
argumentativa contrária? O conector introduz uma generalização ao que foi
Nas adversativas, prevalece a orientação do segmento afirmado: não “ele”, mas todos os técnicos do nosso futebol são
introduzido pela conjunção. retranqueiros.

“O atleta pode cair por causa do impacto, mas se levanta mais - Especificação ou Exemplificação: também
decidido a vencer.” há operadores que marcam uma especificação ou uma
exemplificação do que foi afirmado anteriormente: por exemplo,
Nesse caso, a primeira oração conduz a uma conclusão como.
negativa sobre um processo ocorrido com o atleta, enquanto a
começada pela conjunção “mas” leva a uma conclusão positiva. “A violência não é um fenômeno que está disseminado apenas
Essa segunda orientação é a mais forte. entre as camadas mais pobres da população. Por exemplo, é
Compare-se, por exemplo, “Ela é simpática, mas não é crescente o número de jovens da classe média que estão envolvidos
bonita” com “Ela não é bonita, mas é simpática”. No primeiro em toda sorte de delitos, dos menos aos mais graves.”
caso, o que se quer dizer é que a simpatia é suplantada pela falta
de beleza; no segundo, que a falta de beleza perde relevância Por exemplo assinala que o que vem a seguir especifica,
diante da simpatia. Quando se usam as conjunções adversativas, exemplifica a afirmação de que a violência não é um fenômeno
introduz-se um argumento com vistas à determinada conclusão, adstrito aos membros das “camadas mais pobres da população”.
para, em seguida, apresentar um argumento decisivo para uma
conclusão contrária. - Retificação ou Correção: há ainda os que indicam uma
Com as conjunções concessivas, a orientação argumentativa retificação, uma correção do que foi afirmado antes: ou melhor,
que predomina é a do segmento não introduzido pela conjunção. de fato, pelo contrário, ao contrário, isto é, quer dizer, ou seja, em
outras palavras. Exemplo:
“Embora haja conexão entre saber escrever e saber gramática,
trata-se de capacidades diferentes.” “Vou-me casar neste final de semana. Ou melhor, vou passar a
viver junto com minha namorada.”
A oração iniciada por “embora” apresenta uma orientação
argumentativa no sentido de que saber escrever e saber O conector inicia um segmento que retifica o que foi dito
gramática são duas coisas interligadas; a oração principal antes.
conduz à direção argumentativa contrária. Esses operadores servem também para marcar um
Quando se utilizam conjunções concessivas, a estratégia esclarecimento, um desenvolvimento, uma redefinição do
argumentativa é a de introduzir no texto um argumento que, conteúdo enunciado anteriormente. Exemplo:
embora tido como verdadeiro, será anulado por outro mais
forte com orientação contrária. “A última tentativa de proibir a propaganda de cigarros nas
A diferença entre as adversativas e as concessivas, portanto, corridas de Fórmula 1 não vingou. De fato, os interesses dos
é de estratégia argumentativa. Compare os seguintes períodos: fabricantes mais uma vez prevaleceram sobre os da saúde.”

“Por mais que o exército tivesse planejado a operação O conector introduz um esclarecimento sobre o que foi dito
(argumento mais fraco), a realidade mostrou-se mais complexa antes.
(argumento mais forte).” Servem ainda para assinalar uma atenuação ou um reforço
“O exército planejou minuciosamente a operação (argumento do conteúdo de verdade de um enunciado. Exemplo:
mais fraco), mas a realidade mostrou-se mais complexa
(argumento mais forte).” “Quando a atual oposição estava no comando do país, não fez
o que exige hoje que o governo faça. Ao contrário, suas políticas
- Argumento Decisivo: há operadores discursivos iam na direção contrária do que prega atualmente.

35
LÍNGUA PORTUGUESA
O conector introduz um argumento que reforça o que foi A língua tem um grande número de conectores e
dito antes. sequenciadores. Apresentamos os principais e explicamos
sua função. É preciso ficar atento aos fenômenos de coesão.
- Explicação: há operadores que desencadeiam uma Mostramos que o uso inadequado dos conectores e a utilização
explicação, uma confirmação, uma ilustração do que foi inapropriada dos anafóricos ou catafóricos geram rupturas na
afirmado antes: assim, desse modo, dessa maneira. coesão, o que leva o texto a não ter sentido ou, pelo menos, a
não ter o sentido desejado. Outra falha comum no que tange
“O exército inimigo não desejava a paz. Assim, enquanto se a coesão é a falta de partes indispensáveis da oração ou do
processavam as negociações, atacou de surpresa.” período. Analisemos este exemplo:

O operador introduz uma confirmação do que foi afirmado “As empresas que anunciaram que apoiariam a campanha de
antes. combate à fome que foi lançada pelo governo federal.”
Coesão por Justaposição
O período compõe-se de:
É a coesão que se estabelece com base na sequência dos - As empresas
enunciados, marcada ou não com sequenciadores. Examinemos - que anunciaram (oração subordinada adjetiva restritiva da
os principais sequenciadores. primeira oração)
- que apoiariam a campanha de combate à fome (oração
- Sequenciadores Temporais: são os indicadores de subordinada substantiva objetiva direta da segunda oração)
anterioridade, concomitância ou posterioridade: dois meses - que foi lançada pelo governo federal (oração subordinada
depois, uma semana antes, um pouco mais tarde, etc. (são adjetiva restritiva da terceira oração).
utilizados predominantemente nas narrações).
Observe-se que falta o predicado da primeira oração. Quem
“Uma semana antes de ser internado gravemente doente, escreveu o período começou a encadear orações subordinadas
ele esteve conosco. Estava alegre e cheio de planos para o futuro.” e “esqueceu-se” de terminar a principal.
Quebras de coesão desse tipo são mais comuns em períodos
- Sequenciadores Espaciais: são os indicadores de longos. No entanto, mesmo quando se elaboram períodos curtos
posição relativa no espaço: à esquerda, à direita, junto de, etc. é preciso cuidar para que sejam sintaticamente completos e
(são usados principalmente nas descrições). para que suas partes estejam bem conectadas entre si.
Para que um conjunto de frases constitua um texto, não
“A um lado, duas estatuetas de bronze dourado, basta que elas estejam coesas: se não tiverem unidade de
representando o amor e a castidade, sustentam uma cúpula oval sentido, mesmo que aparentemente organizadas, elas não
de forma ligeira, donde se desdobram até o pavimento bambolins passarão de um amontoado injustificado. Exemplo:
de cassa finíssima. (...) Do outro lado, há uma lareira, não
de fogo, que o dispensa nosso ameno clima fluminense, ainda na “Vivo há muitos anos em São Paulo. A cidade tem excelentes
maior força do inverno.” restaurantes. Ela tem bairros muito pobres. Também o Rio de
José de Alencar. Senhora. São Paulo, FTD, 1992, p. 77. Janeiro tem favelas.”

- Sequenciadores de Ordem: são os que assinalam Todas as frases são coesas. O hiperônimo cidade retoma
a ordem dos assuntos numa exposição: primeiramente, em o substantivo São Paulo, estabelecendo uma relação entre o
segunda, a seguir, finalmente, etc. segundo e o primeiro períodos. O pronome “ela” recupera a
palavra cidade, vinculando o terceiro ao segundo período.
“Para mostrar os horrores da guerra, falarei, inicialmente, O operador também realiza uma conjunção argumentativa,
das agruras por que passam as populações civis; em seguida, relacionando o quarto período ao terceiro. No entanto, esse
discorrerei sobre a vida dos soldados na frente de batalha; conjunto não é um texto, pois não apresenta unidade de sentido,
finalmente, exporei suas consequências para a economia mundial isto é, não tem coerência. A coesão, portanto, é condição
e, portanto, para a vida cotidiana de todos os habitantes do necessária, mas não suficiente, para produzir um texto.
planeta.”
Questões
- Sequenciadores para Introdução: são os que, na
conversação principalmente, servem para introduzir um tema 1. Texto 1 – Bem tratada, faz bem
ou mudar de assunto: a propósito, por falar nisso, mas voltando
ao assunto, fazendo um parêntese, etc. Sérgio Magalhães, O Globo

“Joaquim viveu sempre cercado do carinho de muitas pessoas. O arquiteto Jaime Lerner cunhou esta frase premonitória:
A propósito, era um homem que sabia agradar às mulheres.” “O carro é o cigarro do futuro.” Quem poderia imaginar a
reversão cultural que se deu no consumo do tabaco?
- Operadores discursivos não explicitados: se o
texto for construído sem marcadores de sequenciação, o leitor Talvez o automóvel não seja descartável tão facilmente. Este
deverá inferir, a partir da ordem dos enunciados, os operadores jornal, em uma série de reportagens, nestes dias, mostrou o
discursivos não explicitados na superfície textual. Nesses casos, privilégio que os governos dão ao uso do carro e o desprezo ao
os lugares dos diferentes conectores estarão indicados, na transporte coletivo. Surpreendentemente, houve entrevistado
escrita, pelos sinais de pontuação: ponto-final, vírgula, ponto- que opinou favoravelmente, valorizando Los Angeles – um caso
e-vírgula, dois-pontos. típico de cidade rodoviária e dispersa.
Ainda nestes dias, a ONU reafirmou o compromisso desta
“A reforma política é indispensável. Sem a existência da geração com o futuro da humanidade e contra o aquecimento
fidelidade partidária, cada parlamentar vota segundo seus global – para o qual a emissão de CO2 do rodoviarismo é
interesses e não de acordo com um programa partidário. Assim, agente básico. (A USP acaba de divulgar estudo advertindo que
não há bases governamentais sólidas.” a poluição em São Paulo mata o dobro do que o trânsito.)
O transporte também esteve no centro dos protestos de
Esse texto contém três períodos. O segundo indica a causa junho de 2013. Lembremos: ele está interrelacionado com a
de a reforma política ser indispensável. Portanto o ponto-final moradia, o emprego, o lazer. Como se vê, não faltam razões
do primeiro período está no lugar de um porque. para o debate do tema.

36
LÍNGUA PORTUGUESA
“Como se vê, não faltam razões para o debate do tema.” Assinale a opção em que se indica, INCORRETAMENTE, o
referente do termo em destaque.
Substituindo o termo sublinhado por uma oração (A) “quase US$ 1 bilhão de seu orçamento bianual” (5º§)
desenvolvida, a forma correta e adequada seria: – organização
(A) para que se debatesse o tema; (B) “A agência passou a dar mais ênfase” (6º§) – OMS
(B) para se debater o tema; (C) “Pesa contra o órgão da ONU”(7º§) – OMS
(C) para que se debata o tema; (D) “Seus esforços iniciais foram limitados” (7º§) –
(D) para debater-se o tema; gravidade da situação
(E) para que o tema fosse debatido. (E) “A comunidade tem diante de si” (10º§) – comunidade
internacional
02. “A USP acaba de divulgar estudo advertindo que a
poluição em São Paulo mata o dobro do que o trânsito”. 04.
A oração em forma desenvolvida que substitui correta e Leia o texto para responder a questão.
adequadamente o gerúndio “advertindo” é: As cotas raciais deram certo porque seus beneficiados são,
(A) com a advertência de; sim, competentes. Merecem, sim, frequentar uma universidade
(B) quando adverte; pública e de qualidade. No vestibular, que é o princípio de tudo,
(C) em que adverte; os cotistas estão só um pouco atrás. Segundo dados do Sistema
(D) no qual advertia; de Seleção Unificada, a nota de corte para os candidatos
(E) para advertir. convencionais a vagas de medicina nas federais foi de 787,56
pontos. Para os cotistas, foi de 761,67 pontos. A diferença
03. entre eles, portanto, ficou próxima de 3%. IstoÉ entrevistou
Texto III - Corrida contra o ebola educadores e todos disseram que essa distância é mais do que
razoável. Na verdade, é quase nada. Se em uma disciplina
Já faz seis meses que o atual surto de ebola na África tão concorrida quanto medicina um coeficiente de apenas 3%
Ocidental despertou a atenção da comunidade internacional, separa os privilegiados, que estudaram em colégios privados,
mas nada sugere que as medidas até agora adotadas para dos negros e pobres, que frequentaram escolas públicas, então
refrear o avanço da doença tenham sido eficazes. é justo supor que a diferença mínima pode, perfeitamente, ser
Ao contrário, quase metade das cerca de 4.000 igualada ou superada no decorrer dos cursos. Depende só da
contaminações registradas neste ano ocorreram nas últimas disposição do aluno. Na Universidade Federal do Rio de Janeiro
três semanas, e as mais de 2.000 mortes atestam a força da (UFRJ), uma das mais conceituadas do País, os resultados do
enfermidade. A escalada levou o diretor do CDC (Centro de último vestibular surpreenderam. “A maior diferença entre as
Controle e Prevenção de Doenças) dos EUA, Tom Frieden, a notas de ingresso de cotistas e não cotistas foi observada no curso
afirmar que a epidemia está fora de controle. de economia”, diz Ângela Rocha, pró-reitora da UFRJ. “Mesmo
O vírus encontrou ambiente propício para se propagar. assim, essa distância foi de 11%, o que, estatisticamente, não
De um lado, as condições sanitárias e econômicas dos países é significativo”.
afetados são as piores possíveis. De outro, a Organização (www.istoe.com.br)
Mundial da Saúde foi incapaz de mobilizar com celeridade
um contingente expressivo de profissionais para atuar nessas Para responder a questão, considere a passagem – A
localidades afetadas. diferença entre eles, portanto, ficou próxima de 3%.
Verdade que uma parcela das debilidades da OMS se explica O pronome eles tem como referente:
por problemas financeiros. Só 20% dos recursos da entidade (A) candidatos convencionais e cotistas.
vêm de contribuições compulsórias dos países-membros – o (B) beneficiados.
restante é formado por doações voluntárias. (C) dados do Sistema de Seleção Unificada.
A crise econômica mundial se fez sentir também nessa área, (D) dados do Sistema de Seleção Unificada e pontos.
e a organização perdeu quase US$ 1 bilhão de seu orçamento (E) pontos.
bianual, hoje de quase US$ 4 bilhões. Para comparação, o CDC
dos EUA contou, somente no ano de 2013, com cerca de US$ 05. Leia os quadrinhos para responder a questão.
6 bilhões.
Os cortes obrigaram a OMS a fazer escolhas difíceis. A agência
passou a dar mais ênfase à luta contra enfermidades globais
crônicas, como doenças coronárias e diabetes. O departamento
de respostas a epidemias e pandemias foi dissolvido e integrado
a outros. Muitos profissionais experimentados deixaram seus
cargos.
Pesa contra o órgão da ONU, de todo modo, a demora
para reconhecer a gravidade da situação. Seus esforços iniciais
foram limitados e mal liderados.
O surto agora atingiu proporções tais que já não é mais Um enunciado possível em substituição à fala do terceiro
possível enfrentá-lo de Genebra, cidade suíça sede da OMS. quadrinho, em conformidade com a norma- padrão da língua
Tornou-se crucial estabelecer um comando central na África portuguesa, é:
Ocidental, com representantes dos países afetados. (A) Se você ir pelos caminhos da verdade, leve um capacete.
Espera-se também maior comprometimento das potências (B) Caso você vá pelos caminhos da verdade, lembra-se de
mundiais, sobretudo Estados Unidos, Inglaterra e França, levar um capacete.
que possuem antigos laços com Libéria, Serra Leoa e Guiné, (C) Se você se mantiver nos caminhos da verdade, leve um
respectivamente. capacete.
A comunidade internacional tem diante de si um desafio (D) Caso você se mantém nos caminhos da verdade, lembre
enorme, mas é ainda maior a necessidade de agir com rapidez. de levar um capacete.
Nessa batalha global contra o ebola, todo tempo perdido conta (E) Ainda que você se mantêm nos caminhos da verdade,
a favor da doença. leva um capacete.
(Disponível em: http://www1.folha.uol.com.br/ Respostas
opiniao/2014/09/1512104-editorial-corrida-contra-o-ebola.shtml: 01. (C) / 02. (C) / 03. (D) / 04. (A) / 05. (C)
Acesso em: 08/09/2014)

37
LÍNGUA PORTUGUESA
Coerência apenas como um mecanismo auxiliar na produção da unidade
de sentido, pois esta depende, na verdade, das relações
Infância subjacentes ao texto, da não-contradição entre as partes, da
continuidade semântica, em síntese, da coerência.
O camisolão A coerência é um fator de interpretabilidade do texto, pois
O jarro possibilita que todas as suas partes sejam englobadas num
O passarinho único significado que explique cada uma delas. Quando esse
O oceano sentido não pode ser alcançado por faltar relação de sentido
A vista na casa que a gente sentava no sofá entre as partes, lemos um texto incoerente.

Adolescência Coerência Narrativa

Aquele amor A coerência narrativa consiste no respeito às implicações


Nem me fale lógicas entre as partes do relato. Por exemplo, para que um
sujeito realize uma ação, é preciso que ele tenha competência
Maturidade para tanto, ou seja, que saiba e possa efetuá-la. Constitui, então,
incoerência narrativa o seguinte exemplo: o narrador conta
O Sr. e a Sra. Amadeu que foi a uma festa onde todos fumavam e, por isso, a espessa
Participam a V. Exa. fumaça impedia que se visse qualquer coisa; de repente, sem
O feliz nascimento mencionar nenhuma mudança dessa situação, ele diz que se
De sua filha encostou a uma coluna e passou a observar as pessoas, que
Gilberta eram ruivas, loiras, morenas. Se o narrador diz que não podia
enxergar nada, é incoerente dizer que via as pessoas com
Velhice tanta nitidez. Em outros termos, se nega a competência para a
realização de um desempenho qualquer, esse desempenho não
O netinho jogou os óculos pode ocorrer. Isso por respeito às leis da coerência narrativa.
Na latrina
Coerência Argumentativa
Oswaldo de Andrade. Poesias reunidas.
4ª Ed. Rio de Janeiro A coerência argumentativa diz respeito às relações de
Civilização Brasileira, 1974, p. 160-161. implicação ou de adequação entre premissas e conclusões ou
entre afirmações e consequências. Não é possível alguém dizer
Talvez o que mais chame a atenção nesse poema, ao menos que é a favor da pena de morte porque é contra tirar a vida
à primeira vista, seja a ausência de elementos de coesão, quer de alguém. Da mesma forma, é incoerente defender o respeito
retomando o que foi dito antes, quer encadeando segmentos à lei e à Constituição Brasileira e ser favorável à execução de
textuais. No entanto, percebemos nele um sentido unitário, assaltantes no interior de prisões.
sobretudo se soubermos que o seu título é “As quatro gares”, ou Muitas vezes, as conclusões não são adequadas às premissas.
seja, as quatro estações. Não há coerência, por exemplo, num raciocínio como este:
Com essa informação, podemos imaginar que se trata
de flashes de cada uma das quatro grandes fases da vida: a Há muitos servidores públicos no Brasil que são verdadeiros
infância, a adolescência, a maturidade e a velhice. A primeira é marajás.
caracterizada pelas descobertas (o oceano), por ações (o jarro, O candidato a governador é funcionário público.
que certamente a criança quebrara; o passarinho que ela caçara) Portanto o candidato é um marajá.
e por experiências marcantes (a visita que se percebia na sala
apropriada e o camisolão que se usava para dormir); a segunda Segundo uma lei da lógica formal, não se pode concluir
é caracterizada por amores perdidos, de que não se quer mais nada com certeza baseado em duas premissas particulares.
falar; a terceira, pela formalidade e pela responsabilidade Dizer que muitos servidores públicos são marajás não permite
indicadas pela participação formal do nascimento da filha; a concluir que qualquer um seja.
última, pela condescendência para com a traquinagem do neto A falta de relação entre o que se diz e o que foi dito
(a quem cabe a vez de assumir a ação). A primeira parte é uma anteriormente também constitui incoerência.
sucessão de palavras; a segunda, uma frase em que falta um
nexo sintático; a terceira, a participação do nascimento de uma Coerência Figurativa
filha; e a quarta, uma oração completa, porém aparentemente A coerência figurativa refere-se à compatibilidade das
desgarrada das demais. figuras que manifestam determinado tema. Para que o leitor
Como se explica que sejamos capazes de entender possa perceber o tema que está sendo veiculado por uma série
esse poema em seus múltiplos sentidos, apesar da falta de de figuras encadeadas, estas precisam ser compatíveis umas com
marcadores de coesão entre as partes? as outras. Seria estranho (para dizer o mínimo) que alguém, ao
A explicação está no fato de que ele tem uma qualidade descrever um jantar oferecido no palácio do Itamarati a um
indispensável para a existência de um texto: a coerência. governador estrangeiro, depois de falar de baixela de prata,
Que é a unidade de sentido resultante da relação que porcelana finíssima, flores, candelabros, toalhas de renda,
se estabelece entre as partes do texto. Uma ideia ajuda a incluísse no percurso figurativo guardanapos de papel.
compreender a outra, produzindo um sentido global, à luz do
qual cada uma das partes ganha sentido. No poema acima, os Coerência Temporal
subtítulos “Infância”, “Adolescência”, “Maturidade” e “Velhice” Por coerência temporal entende-se aquela que concerne à
garantem essa unidade. Colocar a participação formal do sucessão dos eventos e à compatibilidade dos enunciados do
nascimento da filha, por exemplo, sob o título “Maturidade” dá ponto de vista de sua localização no tempo. Não se poderia, por
a conotação da responsabilidade habitualmente associada ao exemplo, dizer: “O assassino foi executado na câmara de gás e,
indivíduo adulto e cria um sentido unitário. depois, condenado à morte”.
Esse texto, como outros do mesmo tipo, comprova que um
conjunto de enunciados pode formar um todo coerente mesmo Coerência Espacial
sem a presença de elementos coesivos, isto é, mesmo sem a A coerência espacial diz respeito à compatibilidade dos
presença explícita de marcadores de relação entre as diferentes enunciados do ponto de vista da localização no espaço. Seria
unidades linguísticas. Em outros termos, a coesão funciona incoerente, por exemplo, o seguinte texto: “O filme ‘A Marvada

38
LÍNGUA PORTUGUESA
Carne’ mostra a mudança sofrida por um homem que vivia lá no __ O empregado da companhia telefônica que vinha consertar
interior e encanta-se com a agitação e a diversidade da vida na o telefone está aí.
capital, pois aqui já não suportava mais a mesmice e o tédio”. __ Era hoje que ele viria?
Dizendo lá no interior, o enunciador dá a entender que seu
pronunciamento está sendo feito de algum lugar distante do - O conhecimento de mundo:
interior; portanto ele não poderia usar o advérbio “aqui” para
localizar “a mesmice” e “o tédio” que caracterizavam a vida 31 de março / 1º de abril
interiorana da personagem. Em síntese, não é coerente usar Dúvida Revolucionária
“lá” e “aqui” para indicar o mesmo lugar.
Ontem foi hoje?
Coerência do Nível de Linguagem Utilizado Ou hoje é que foi ontem?

A coerência do nível de linguagem utilizado é aquela Aparentemente, falta coerência temporal a esse poema: o
que concerne à compatibilidade do léxico e das estruturas que significa “ontem foi hoje” ou “hoje é que foi ontem?”. No
morfossintáticas com a variante escolhida numa dada situação entanto, as duas datas colocadas no início do poema e o título
de comunicação. Ocorre incoerência relacionada ao nível de remetem a um episódio da História do Brasil, o golpe militar de
linguagem quando, por exemplo, o enunciador utiliza um 1964, chamado Revolução de 1964. Esse fato deve fazer parte
termo chulo ou pertencente à linguagem informal num texto de nosso conhecimento de mundo, assim como o detalhe de
caracterizado pela norma culta formal. Tanto sabemos que isso que ele ocorreu no dia 1º de abril, mas sua comemoração foi
não é permitido que, quando o fazemos, acrescentamos uma mudada para 31 de março, para evitar relações entre o evento
ressalva: com perdão da palavra, se me permitem dizer. e o “dia da mentira”.
Ninguém há de negar a incoerência de um texto como
este: Saltou para a rua, abriu a janela do 5º andar e deixou - As regras do gênero:
um bilhete no parapeito explicando a razão de seu suicídio, em
que há evidente violação da lei sucessivamente dos eventos. “O homem olhou através das paredes e viu onde os bandidos
Entretanto talvez nem todo mundo concorde que seja incoerente escondiam a vítima que havia sido sequestrada.”
incluir guardanapos de papel no jantar do Itamarati descrito
no item sobre coerência figurativa, alguém poderia objetivar Essa frase é incoerente no discurso cotidiano, mas é
que é preconceito considerá-los inadequados. Então, justifica- completamente coerente no mundo criado pelas histórias de
se perguntar: o que, afinal, determina se um texto é ou não super-heróis, em que o Super-Homem, por exemplo, tem força
coerente? praticamente ilimitada; pode voar no espaço a uma velocidade
A natureza da coerência está relacionada a dois conceitos igual à da luz; quando ultrapassa essa velocidade, vence a
básicos de verdade: adequação à realidade e conformidade barreira do tempo e pode transferir-se para outras épocas; seus
lógica entre os enunciados. olhos de raios X permitem-lhe ver através de qualquer corpo, a
Vimos que temos diferentes níveis de coerência: narrativa, distâncias infinitas, etc.
argumentativa, figurativa, etc. Em cada nível, temos duas Nosso conhecimento de mundo não é restrito ao que
espécies diversas de coerência: efetivamente existe, ao que se pode ver, tocar, etc.: ele inclui
- extratextual: aquela que diz respeito à adequação entre também os mundos criados pela linguagem nos diferentes
o texto e uma “realidade” exterior a ele. gêneros de texto, ficção científica, contos maravilhosos, mitos,
- intratextual: aquela que diz respeito à compatibilidade, discurso religioso, etc., regidos por outras lógicas. Assim, o que é
à adequação, à não-contradição entre os enunciados do texto. incoerente num determinado gênero não o é, necessariamente,
em outro.
A exterioridade a que o conteúdo do texto deve ajustar-se
pode ser: - O sentido não literal:
- o conhecimento do mundo: o conjunto de dados
referentes ao mundo físico, à cultura de um povo, ao conteúdo “As verdes ideias incolores dormem, mas poderão explodir
das ciências, etc. que constitui o repertório com que se produzem a qualquer momento.”
e se entendem textos. O período “O homem olhou através das
paredes e viu onde os bandidos escondiam a vítima que havia sido Tomando em seu sentido literal, esse texto é absurdo,
sequestrada” é incoerente, pois nosso conhecimento do mundo pois, nessa acepção, o termo ideias não pode ser qualificado
diz que homens não veem através das paredes. Temos, então, por adjetivos de cor; não se podem atribuir ao mesmo ser, ao
uma incoerência figurativa extratextual. mesmo tempo, as qualidades verde e incolor; o verbo dormir
- os mecanismos semânticos e gramaticais da deve ter como sujeito um substantivo animado. No entanto,
língua: o conjunto dos conhecimentos sobre o código se entendermos ideias verdes em sentido não literal, como
linguístico necessário à codificação de mensagens decodificáveis concepções ambientalistas, o período pode ser lido da seguinte
por outros usuários da mesma língua. maneira: “As ideias ambientalistas sem atrativo estão latentes,
mas poderão manifestar-se a qualquer momento.”
Fatores de Coerência
- O intertexto:
- O contexto: para uma dada unidade linguística, funciona
como contexto a unidade linguística maior que ela: a sílaba é Falso diálogo entre Pessoa e Caeiro
contexto para o fonema; a palavra, para a sílaba; a oração, para
a palavra; o período, para a oração; o texto, para o período, e __ a chuva me deixa triste...
assim por diante. __ a mim me deixa molhado.
José Paulo Paes. Op. Cit., p 79.
- A situação de comunicação:
Muitos textos retomam outros, constroem-se com base em
__A telefônica. outros e, por isso, só ganham coerência nessa relação com o
__Era hoje? texto sobre o qual foram construídos, ou seja, na relação de
intertextualidade. É o caso desse poema. Para compreendê-lo, é
Esse diálogo não seria compreendido fora da situação de preciso saber que Alberto Caeiro é um dos heterônimos do poeta
interlocução, porque deixa implícitos certos enunciados que, Fernando Pessoa; que heterônimo não é pseudônimo, mas uma
dentro dela, são perfeitamente compreendidos: individualidade lírica distinta da do autor (o ortônimo); que

39
LÍNGUA PORTUGUESA
para Caeiro o real é a exterioridade e não devemos acrescentar- basta conhecer bem um determinado assunto, temos que o
lhe impressões subjetivas; que sua posição é antimetafísica; que transmitir de maneira clara aos leitores.
não devemos interpretar a realidade pela inteligência, pois essa O estudo da pontuação pode se tornar um valioso aliado
interpretação conduz a simples conceitos vazios, em síntese, é para organizarmos as ideias de maneira clara em frases. Para
preciso ter lido textos de Caeiro. Por outro lado, é preciso saber tanto, é necessário ter alguma noção de sintaxe. “Sintaxe”,
que o ortônimo (Fernando Pessoa ele mesmo) exprime suas
conforme o dicionário Aurélio, é a “parte da gramática que
emoções, falando da solidão interior, do tédio, etc.
estuda a disposição das palavras na frase e a das frases no
Incoerência Proposital discurso, bem como a relação lógica das frases entre si”; ou
em outras palavras, sintaxe quer dizer “mistura”, isto é, saber
Existem textos em que há uma quebra proposital da misturar as palavras de maneira a produzirem um sentido
coerência, com vistas a produzir determinado efeito de sentido, evidente para os receptores das nossas mensagens. Observe:
assim como existem outros que fazem da não coerência o
próprio princípio constitutivo da produção de sentido. Poderia 1) A desemprego globalização no Brasil e no na está Latina
alguém perguntar, então, se realmente existe texto incoerente. América causando.
Sem dúvida existe: é aquele em que a incoerência é produzida 2) A globalização está causando desemprego no Brasil e na
involuntariamente, por inabilidade, descuido ou ignorância do
América Latina.
enunciador, e não usada funcionalmente para construir certo
sentido.
Quando se trata de incoerência proposital, o enunciador Ora, no item 1 não temos uma ideia, pois não há uma
dissemina pistas no texto, para que o leitor perceba que ela frase, as palavras estão amontoadas sem a realização de “uma
faz parte de um programa intencionalmente direcionado sintaxe”, não há um contexto linguístico nem relação inteligível
para veicular determinado tema. Se, por exemplo, num texto com a realidade; no caso 2, a sintaxe ocorreu de maneira perfeita
que mostra uma festa muito luxuosa, aparecem figuras como e o sentido está claro para receptores de língua portuguesa
pessoas comendo de boca aberta, falando em voz muito alta e inteirados da situação econômica e cultural do mundo atual.
em linguagem chula, ostentando suas últimas aquisições, o
enunciador certamente não está querendo manifestar o tema do A Ordem dos Termos na Frase
luxo, do requinte, mas o da vulgaridade dos novos-ricos. Para
ficar no exemplo da festa: em filmes como “Quero ser grande”
(Big, dirigido por Penny Marshall em 1988, com Tom Hanks) Leia novamente a frase contida no item 2. Note que ela é
e “Um convidado bem trapalhão” (The party, Blake Edwards, organizada de maneira clara para produzir sentido. Todavia,
1968, com Peter Sellers), há cenas em que os respectivos há diferentes maneiras de se organizar gramaticalmente tal
protagonistas exibem comportamento incompatível com a frase, tudo depende da necessidade ou da vontade do redator
ocasião, mas não há incoerência nisso, pois todo o enredo em manter o sentido, ou mantê-lo, porém, acrescentado ênfase
converge para que o espectador se solidarize com eles, por sua a algum dos seus termos. Significa dizer que, ao escrever,
ingenuidade e falta de traquejo social. Mas, se aparece num podemos fazer uma série de inversões e intercalações em
texto uma figura incoerente uma única vez, o leitor não pode ter nossas frases, conforme a nossa vontade e estilo. Tudo depende
certeza de que se trata de uma quebra de coerência proposital, da maneira como queremos transmitir uma ideia, do nosso
com vistas a criar determinado efeito de sentido, vai pensar
estilo. Por exemplo, podemos expressar a mensagem da frase
que se trata de contradição devida a inabilidade, descuido ou
ignorância do enunciador. 2 da seguinte maneira:
Dissemos também que há outros textos que fazem da
inversão da realidade seu princípio constitutivo; da incoerência, - No Brasil e na América Latina, a globalização está causando
um fator de coerência. São exemplos as obras de Lewis desemprego.
Carrol “Alice no país das maravilhas” e “Através do espelho”,
que pretendem apresentar paradoxos de sentido, subverter o Neste caso, a mensagem é praticamente a mesma, apenas
princípio da realidade, mostrar as aporias da lógica, confrontar mudamos a ordem das palavras para dar ênfase a alguns termos
a lógica do senso comum com outras. (neste caso: No Brasil e na A. L.). Repare que, para obter a
clareza tivemos que fazer o uso de vírgulas.
Entre os sinais de pontuação, a vírgula é o mais usado e
o que mais nos auxilia na organização de um período, pois
facilita as boas “sintaxes”, boas misturas, ou seja, a vírgula
Equivalência e transformação de ajuda-nos a não “embolar” o sentido quando produzimos frases
estruturas. complexas. Com isto, “entregamos” frases bem organizadas aos
nossos leitores.
O básico para a organização sintática das frases é a ordem
direta dos termos da oração. Os gramáticos estruturam tal
Equivalência e transformação de estruturas ordem da seguinte maneira:

“Ideias confusas geram redações confusas”. Esta frase leva- SUJEITO + VERBO+ COMPLEMENTO VERBAL+
nos a refletir sobre a organização das ideias em um texto. CIRCUNSTÂNCIAS
Significa dizer que, antes da redação, naturalmente devemos A globalização + está causando+ desemprego +
dominar o assunto sobre o qual iremos tratar e, posteriormente, no Brasil nos dias de hoje.
planejar o modo como iremos expô-lo, do contrário haverá
dificuldade em transmitir ideias bem acabadas. Portanto, Nem todas as orações mantêm esta ordem e nem todas
a leitura, a interpretação de textos e a experiência de vida contêm todos estes elementos, portanto cabem algumas
antecedem o ato de escrever. observações:
Obtido um razoável conhecimento sobre o que iremos
escrever, feito o esquema de exposição da matéria, é necessário 1) As circunstâncias (de tempo, espaço, modo, etc.)
saber ordenar as ideias em frases bem estruturadas. Logo, não normalmente são representadas por adjuntos adverbiais

40
LÍNGUA PORTUGUESA
de tempo, lugar, etc. Note que, no mais das vezes, quando Aqui um aposto à globalização foi intercalado entre o
queremos recordar algo ou narrar uma história, existe a sujeito e o verbo.
tendência a colocar os adjuntos nos começos das frases:
Outros exemplos
“No Brasil e na América…” “Nos dias de hoje…” “Nas
minhas férias…”, “No Brasil…”. e logo depois os verbos e outros A globalização, que é um fenômeno econômico e cultural,
elementos: “Nas minhas férias fui…”; “No Brasil existe…” está causando desemprego no Brasil e na América Latina.

Observações Neste caso, há uma oração adjetiva intercalada.


As orações adjetivas explicativas desempenham
a) tais construções não estão erradas, mas rompem com a frequentemente um papel semelhante ao do aposto explicativo,
ordem direta; por isto são também isoladas por vírgula.
b) é preciso notar que em Língua Portuguesa, há muitas
frases que não têm sujeito, somente predicado. Por exemplo: A globalização causa, caro leitor, desemprego no Brasil…
Está chovendo em Porto Alegre. Faz frio em Friburgo. São
quatro horas agora; Neste outro caso, há um vocativo entre o verbo e o seu
c) Outras frases são construídas com verbos intransitivos, complemento.
que não têm complemento:
O menino morreu na Alemanha, (sujeito +verbo+ adjunto A globalização causa desemprego, e isto é lamentável, no
adverbial) Brasil…
A globalização nasceu no século XX. (idem)
d) Há ainda frases nominais que não possuem verbos: cada Aqui, há uma oração intercalada (note que ela não pertence
macaco no seu galho. Nestes tipos de frase, a ordem direta faz- ao assunto: globalização, da frase principal, tal oração é apenas
um comentário à parte entre o complemento verbal e os
se naturalmente. Usam-se apenas os termos existentes nelas.
adjuntos.
Levando em consideração a ordem direta, podemos
Obs: a simples negação em uma frase não exige vírgula:
estabelecer três regras básicas para o uso da vírgula:
A globalização não causou desemprego no Brasil e na
1) Se os termos estão colocados na ordem direta não haverá
América Latina.
a necessidade de vírgulas. A frase (2) é um exemplo disto:
Quando “quebramos” a ordem direta, invertendo-a, tal
- A globalização está causando desemprego no Brasil e na
quebra torna a vírgula necessária.
América Latina. Esta é a regra nº3 da colocação da vírgula.
Todavia, ao repetir qualquer um dos termos da oração por No Brasil e na América Latina, a globalização está causando
três vezes ou mais, então é necessário usar a vírgula, mesmo desemprego…
que estejamos usando a ordem direta. Esta é a regra básica nº1 No fim do século XX, a globalização causou desemprego
para a colocação da vírgula. Veja: no Brasil…
A globalização, a tecnologia e a “ciranda financeira” causam Nota-se que a quebra da ordem direta frequentemente se
desemprego… dá com a colocação das circunstâncias antes do sujeito. Trata-
(três núcleos do sujeito) se da ordem inversa. Estas circunstâncias, em gramática, são
A globalização causa desemprego no Brasil, na América representadas pelos adjuntos adverbiais. Muitas vezes, elas
Latina e na África.
são colocadas em orações chamadas adverbiais que têm uma
(três adjuntos adverbiais)
função semelhante a dos adjuntos adverbiais, isto é, denotam
tempo, lugar, etc. Exemplos:
A globalização está causando desemprego, insatisfação e
sucateamento industrial no Brasil e na América Latina. (três
Quando o século XX estava terminando, a globalização
complementos verbais)
começou a causar desemprego.
2) Em princípio, não devemos, na ordem direta, separar com
Enquanto os países portadores de alta tecnologia
vírgula o sujeito e o verbo, nem o verbo e o seu complemento,
desenvolvem-se, a globalização causa desemprego nos países
nem o complemento e as circunstâncias, ou seja, não devemos
separar com vírgula os termos da oração. Veja exemplos de tal pobres.
incorreção: Durante o século XX, a Globalização causou desemprego no
Brasil.
O Brasil, será feliz. A globalização causa, o desemprego.
Obs1: alguns gramáticos, Sacconi, por exemplo,
Ao intercalarmos alguma palavra ou expressão entre os consideram que as orações subordinadas adverbiais devem ser
termos da oração, cabe isolar tal termo entre vírgulas, assim o isoladas pela vírgula também quando colocadas após as suas
sentido da ideia principal não se perderá. Esta é a regra básica orações principais, mas só quando a) a oração principal tiver
nº2 para a colocação da vírgula. Dito em outras palavras: uma extensão grande: por exemplo: A globalização causa…
quando intercalamos expressões e frases entre os termos da , enquanto os países…(vide frase acima); b) Se houver uma
oração, devemos isolar os mesmos com vírgulas. Vejamos: outra oração após a principal e antes da oração adverbial: A
globalização causa desemprego no Brasil e as pessoas aqui
A globalização, fenômeno econômico deste fim de século estão morrendo de fome , enquanto nos países portadores de
XX, causa desemprego no Brasil. alta tecnologia…

41
LÍNGUA PORTUGUESA
Obs2: quando os adjuntos adverbiais são mínimos, isto é, A antonímia pode originar-se de um prefixo de sentido
têm apenas uma ou duas palavras não há necessidade do uso oposto ou negativo. Exemplos: bendizer/maldizer, simpático/
da vírgula: antipático, progredir/regredir, concórdia/discórdia, explícito/
implícito,
Questões
Hoje a globalização causa desemprego no Panamá.
Ali a globalização também causou… TEXTO
A não ser que queiramos dar ênfase: Aqui, a globalização… 1 O governo do estado do Ceará, por meio da Secretaria de
Planejamento e Gestão, apresenta a segunda edição, revisada,
do Manual do Servidor Público Estadual, com o 4 objetivo de
Obs3: na língua escrita, normalmente, ao realizarmos a orientar e facilitar o entendimento de assuntos relacionados
ordem inversa, emprestamos ênfase aos termos que principiam à área de pessoal no que concerne aos direitos e deveres,
as frases. Veja este exemplo de Rui Barbosa destacado por às concessões e obrigações, tendo em vista as 7 constantes
Garcia: alterações da legislação aplicável ao servidor. As informações
“A mim, na minha longa e aturada e continua prática do inseridas no documento apresentam-se de forma objetiva e
escrever, me tem sucedido inúmeras vezes, depois de considerar em linguagem clara, garantindo às pessoas o 10 conhecimento
por muito tempo necessária e insuprível uma locução nova, permanente dessas informações para que não venham a
encontrar vertida em expressões antigas mais clara, expressiva sofrer prejuízo de qualquer natureza. Importa ressaltar que
e elegante a mesma ideia.” esse instrumento está aberto a 13 mudanças, para evitar a
obsolescência e de modo a proporcionar aos servidores uma
Estas três regras básicas não solucionam todos os problemas dinâmica eficiente das atividades e a possibilidade de cooperação
de organização das frases, mas já dão um razoável suporte intelectual. 16 O governo espera que o manuseio deste manual
para que possamos começar a ordenar a expressão das nossas possa servir como importante instrumento de fortalecimento
ideias. Em suma: o importante é não separar os termos básicos da conduta ética no trato dos assuntos relacionados ao serviço
das orações, mas, se assim o fizermos, seja intercalando ou 19 público estadual, como fonte permanente de consulta para
invertendo elementos, então devemos usar a vírgula. dirimir dúvidas e também como mecanismo facilitador dos
procedimentos administrativos.
Observação: quanto à equivalência e transformação de
estruturas, outro exemplo muito comum cobrado em provas é Internet: <www.gestaodoservidor.ce.gov.br> (com
o enunciado trazer uma frase no singular, por exemplo, e pedir adaptações).
que o aluno passe a frase para o plural, mantendo o sentido.
Outro exemplo é o enunciado dar a frase em um tempo verbal, 01. A expressão “tendo em vista” (L.6) poderia ser
e pedir para que o aluno passe-a para outro tempo verbal. substituída por haja vista, sem prejuízo para os sentidos do
texto, uma vez que ambas as expressões estabelecem relação
http://ricardovigna.wordpress.com/2009/02/02/estudos-de- de causalidade entre ideias.
-linguagem-1-estrutura-frasal-e-pontuacao/ A) Certo B) Errado

02. Leia o trecho do primeiro parágrafo para responder à


questão.
Meu amigo lusitano, Diniz, está traduzindo para o francês
meus dois primeiros romances, Os Éguas e Moscow. Temos
trocado e-mails muito interessantes, por conta de palavras e
Relações de sinonímia e antonímia. gírias comuns no meu Pará e absolutamente sem sentido para
ele. Às vezes é bem difícil explicar, como na cena em que alguém
empina papagaio e corta o adversário “no gasgo”.
A expressão por conta de, em destaque, tem sentido
Significação das Palavras equivalente ao de.
(A) a despeito de.
Sinônimos: são palavras de sentido igual ou aproximado. (B) com o intuito de.
Exemplo: (C) em contrapartida a.
- Alfabeto, abecedário. (D) em detrimento de
- Justo, certo, exato, reto, íntegro, imparcial. (E) em virtude de.
Respostas
Na maioria das vezes não é indiferente usar um sinônimo 01. B / 02. E / 03. A
pelo outro. Embora irmanados pelo sentido comum, os
sinônimos diferenciam-se, entretanto, uns dos outros, por
matizes de significação e certas propriedades que o escritor
não pode desconhecer. Com efeito, estes têm sentido mais
amplo, aqueles, mais restrito (animal e quadrúpede); uns são
próprios da fala corrente, desataviada, vulgar, outros, ao invés,
pertencem à esfera da linguagem culta, literária, científica ou
poética (orador e tribuno, oculista e oftalmologista, cinzento e Classe e emprego de palavras.
cinéreo).
A contribuição Greco-latina é responsável pela existência,
em nossa língua, de numerosos pares de sinônimos.

Exemplos: Classe de Palavras


- Adversário e antagonista.
- Contraveneno e antídoto. ARTIGO
- Moral e ética.
- Transformação e metamorfose. Artigo é uma palavra que antepomos aos substantivos para
- Oposição e antítese. determiná-los, indicando, ao mesmo tempo, gênero e número.
O fato linguístico de existirem sinônimos chama-se sinonímia, Dividem-se os artigos em: definidos: o, a, os, as e
palavra que também designa o emprego de sinônimos. indefinidos: um, uma, uns, umas.
Os definidos determinam os substantivos de modo preciso,
Antônimos: são palavras de significação oposta. Exemplos:
- Ordem e anarquia. particular: Viajei com o médico.
- Soberba e humildade. Os indefinidos determinam os substantivos de modo vago,
- Mal e bem. impreciso, geral: Viajei com um médico.

42
LÍNGUA PORTUGUESA
- Ambas as mãos. Usa-se o artigo entre o numeral ambas e Substantivo Concreto: Substantivo concreto é aquele
o substantivo: Ambas as mãos são perfeitas. que designa seres que existem por si só ou apresentam-se em
nossa imaginação como se existissem por si. Por exemplo: ar,
- Estou em Paris / Estou na famosa Paris. Não se usa artigo som, Deus, computador, Ester.
antes dos nomes de cidades, a menos que venham determinados
por adjetivos ou locuções adjetivas. Substantivo Abstrato: Substantivo abstrato é aquele
Vim de Paris que designa prática de ações verbais, existência de
Vim da luminosa Paris. qualidades ou sentimentos humanos. Por exemplo:
saída (prática de sair), beleza (existência do belo), saudade.
Mas com alguns nomes de cidades conservamos o artigo.
O Rio de Janeiro, O Cairo, O Porto. Formação dos substantivos

Pode ou não ocorrer crase antes dos nomes de cidade, Substantivo Primitivo: É primitivo o substantivo que
conforme venham ou não precedidos de artigo. não se origina de outra palavra existente na língua portuguesa.
Vou a Paris. Por exemplo: pedra, jornal, gato, homem.
Vou à Paris dos museus.
Substantivo Derivado: É derivado o substantivo que
- Toda cidade / toda a cidade. Todo, toda designam provém de outra palavra da língua portuguesa. Por exemplo:
qualquer, cada. pedreiro, jornalista, gatarrão, homúnculo.
Toda cidade pode concorrer (qualquer cidade).
Todo o, toda a designam totalidade, inteireza. Substantivo Simples: É simples o substantivo formado
Conheci toda a cidade (a cidade inteira). por um único radical. Por exemplo: pedra, pedreiro, jornal,
jornalista.
No plural, usa-se todos os, todas as, exceto antes de
numeral não seguido de substantivo. Substantivo Composto: É composto o substantivo
Todas as cidades vieram. formado por dois ou mais radicais. Por exemplo: pedra-
Todos os cinco clubes disputarão o título. sabão, homem-rã, passatempo.
Todos cinco são concorrentes.
Substantivo Coletivo: É coletivo o substantivo no
- Tua decisão / a tua decisão. De maneira geral, é facultativo singular que indica diversos elementos de uma mesma espécie.
o uso do artigo antes dos possessivos. - abelha - enxame, cortiço, colmeia
Aplaudimos tua decisão. - acompanhante - comitiva, cortejo, séquito
Aplaudimos a tua decisão. - alho - (quando entrelaçados) réstia, enfiada, cambada
- aluno - classe
Se o possessivo não vier seguido de substantivo explícito é - amigo - (quando em assembleia) tertúlia
obrigatória a ocorrência do artigo.
Aplaudiram a tua decisão e não a minha. ADJETIVO

- Decisões as mais oportunas / as mais oportunas decisões. É a classe gramatical de palavras que exprimem qualidade,
No superlativo relativo, não se usa o artigo antes e depois do defeito, origem, estado do ser.
substantivo.
Tomou decisões as mais oportunas. Classificação dos Adjetivos
Tomou as decisões mais oportunas. Explicativo - exprime qualidade própria do ser. Por exemplo:
É errado: Tomou as decisões as mais oportunas. neve fria.
Restritivo - exprime qualidade que não é própria do ser. Ex:
- Faz uns dez anos. O artigo indefinido, posto antes de um fruta madura.
numeral, designa quantidade aproximada: Faz uns dez anos que Primitivo - não vem de outra palavra portuguesa. Por exem-
saí de lá. plo: bom e mau.
Derivado - tem origem em outra palavra portuguesa. Por
- Em um / num. Os artigos definidos e indefinidos contraem- exemplo: bondoso.
se com preposições: de + o= do, de + a= da, etc. As formas Simples - formado de um só radical. Por exemplo: brasileiro.
de + um e em + um podem-se usar contraídas (dum e num) Composto - formado de mais de um radical. Por exemplo:
ou separadas (de um, em um). Estava em uma cidade grande. franco-brasileiro.
Estava numa cidade grande. Pátrio - é o adjetivo que indica a naturalidade ou a naciona-
lidade do ser. Por exemplo: brasileiro, cambuiense, etc.
SUBSTANTIVO
Locução Adjetiva
Substantivo é tudo o que nomeia as “coisas” em geral. É toda expressão formada de uma preposição mais um
Substantivo é tudo o que pode ser visto, pego ou sentido. substantivo, equivalente a um adjetivo. Por exemplo, homens
Substantivo é tudo o que pode ser precedido de artigo. com aptidão (aptos), bandeira da Irlanda (irlandesa).

Classificação e Formação Gêneros dos Adjetivos


Biformes - têm duas formas, sendo uma para o masculino e
Substantivo Comum: Substantivo comum é aquele que outra para o feminino. Por exemplo, mau e má, judeu e judia.
designa os seres de uma espécie de forma genérica. Por exemplo: Se o adjetivo é composto e biforme, ele flexiona no feminino so-
pedra, computador, cachorro, homem, caderno. mente o último elemento. Por exemplo, o motivo sócio-literário
e a causa sócio-literária. Exceção = surdo-mudo e surda-muda.
Substantivo Próprio: Substantivo próprio é aquele que
designa um ser específico, determinado, individualizando-o. NUMERAL
Por exemplo: Maxi, Londrina, Dílson, Ester. O substantivo
próprio sempre deve ser escrito com letra maiúscula.
      
2 

43
LÍNGUA PORTUGUESA
  
   
2 
3      
2 
   
2 
     
2 
    2 
 2      
2 
      2 
     2 
 2    !   2 

Faz-se a leitura do numeral cardinal, dispondo-se a


palavra “e” entre as centenas e as dezenas e entre as dezenas Pronomes Oblíquos
e unidades. Por exemplo, 1.203.726 = um milhão duzentos e
três mil setecentos e vinte e seis. - Associação de pronomes a verbos: Os pronomes oblíquos
o, a, os, as, quando associados a verbos terminados em -r, -s, -z,
PRONOME assumem as formas lo, la, los, las, caindo as consoantes. Ex.:
Carlos quer convencer seu amigo a fazer uma viagem; Carlos
A palavra que acompanha (determina) ou substitui um quer convencê-lo a fazer uma viagem.
nome é denominada pronome. Ex.: Ana disse para sua irmã: -
Eu preciso do meu livro de matemática. Você não o encontrou? - Quando associados a verbos terminados em ditongo nasal
Ele estava aqui em cima da mesa. (-am, -em, -ão, -õe), assumem as formas no, na, nos, nas. Ex.:
- eu substitui “Ana” Fizeram um relatório; Fizeram-no.
- meu acompanha “o livro de matemática”
- o substitui “o livro de matemática” - Os pronomes oblíquos podem ser reflexivos e quando isso
- ele substitui “o livro de matemática” ocorre se referem ao sujeito da oração. Ex.: Maria olhou-se no
espelho; Eu não consegui controlar-me diante do público.
Flexão: Quanto à forma, o pronome varia em gênero,
número e pessoa: - Antes do infinitivo precedido de preposição, o pronome
usado deverá ser o reto, pois será sujeito do verbo no infinitivo.
Gênero (masculino/feminino) Ex.: O professor trouxe o livro para mim. (pronome oblíquo,
Ele saiu/Ela saiu pois é um complemento); O professor trouxe o livro para eu ler.
Meu carro/Minha casa (pronome reto, pois é sujeito)

Número (singular/plural) Pronomes de Tratamento: São aqueles que substituem


Eu saí/Nós saímos a terceira pessoa gramatical. Alguns são usados em tratamento
Minha casa/Minhas casas cerimonioso e outros em situações de intimidade. Conheça
alguns:
Pessoa (1ª/2ª/3ª) - você (v.): tratamento familiar
Eu saí/Tu saíste/Ele saiu - senhor (Sr.), senhora (Srª.): tratamento de respeito
Meu carro/Teu carro/Seu carro - senhorita (Srta.): moças solteiras
- Vossa Senhoria (V.Sª.): para pessoa de cerimônia
Função: O pronome tem duas funções fundamentais: - Vossa Excelência (V.Exª.): para altas autoridades
- Vossa Reverendíssima (V. Revmª.): para sacerdotes
Substituir o nome: Nesse caso, classifica-se como - Vossa Eminência (V.Emª.): para cardeais
pronome substantivo e constitui o núcleo de um grupo nominal. - Vossa Santidade (V.S.): para o Papa
Ex.: Quando cheguei, ela se calou. (ela é o núcleo do sujeito da - Vossa Majestade (V.M.): para reis e rainhas
segunda oração e se trata de um pronome substantivo porque - Vossa Majestade Imperial (V.M.I.): para imperadores
está substituindo um nome) - Vossa Alteza (V.A.): para príncipes, princesas e duques

Referir-se ao nome: Nesse caso, classifica-se como Pronomes Possessivos: São aqueles que indicam ideia
pronome adjetivo e constitui uma palavra dependente do grupo de posse. Além de indicar a coisa possuída, indicam a pessoa
nominal. Ex.: Nenhum aluno se calou. (o sujeito “nenhum gramatical possuidora.
aluno” tem como núcleo o substantivo “aluno” e como palavra
dependente o pronome adjetivo “nenhum”)

Pronomes Pessoais: São aqueles que substituem os


nomes e representam as pessoas do discurso:
1ª pessoa - a pessoa que fala - eu/nós
2ª pessoa - a pessoa com que se fala - tu/vós
3ª pessoa - a pessoa de quem se fala - ele/ela/eles/elas

Pronomes pessoais retos: são os que têm por função


principal representar o sujeito ou predicativo.
Existem palavras que eventualmente funcionam como
pronomes possessivos. Ex.: Ele afagou-lhe (seus) os cabelos.
Pronomes pessoais oblíquos: são os que podem exercer
função de complemento.
Pronomes Demonstrativos: Os pronomes
demonstrativos possibilitam localizar o substantivo em relação
às pessoas, ao tempo, e sua posição no interior de um discurso.

44
LÍNGUA PORTUGUESA
2º COJUGAÇÃO 3º
Pronomes Espaço Tempo Ao dito
1º COJUGAÇÃO
Enumeração verbos terminados CONJUGAÇÃO
verbos terminados
em ER verbos terminados
‡”–‘†‡ ”‡•‡–‡ ‡ˆ‡”‡–‡ ‡ˆ‡”‡–‡ƒ‘ em AR
em IR
“—‡ ƒ“—‹Ž‘“—‡ ‹‘‡Ž‡‡–‘ cantar vender partir
ˆƒŽƒȋͳ͐ ƒ‹†ƒ ‘ …‹–ƒ†‘‡—ƒ amar chover sorrir
este, ’‡••‘ƒȌǤ ˆ‘‹†‹–‘Ǥ ‡—‡Ǧ”ƒ­ ‘Ǥ
sonhar sofrer abrir
esta, šǤǣ ‘ šǤǣ‡•–‡ šǤǣ•–ƒ šǤǣŠ‘‡
isto, OBS: O verbo pôr, assim como seus derivados (compor,
‰‘•–‡‹ ƒ‘ǡ–‡Š‘ ƒϐ‹”ƒ­ ‘ ‡ƒ—ŽŠ‡”• ‘
repor, depor, etc.), pertence à 2º conjugação, porque na sua
estes, †‡•–‡ ”‡ƒŽ‹œƒ†‘ ‡†‡‹š‘— ƒ••ƒǦ
estas forma antiga a sua terminação era em er: poer. A vogal “e”, ape-
Ž‹˜”‘ „‘• •—”’”‡•ƒǣ …”ƒ†‘•
sar de haver desaparecido do infinitivo, revela-se em algumas
ƒ“—‹Ǥ ‡‰×…‹‘•Ǥ ‰‘•–ƒ˜ƒ†‡ ’‡Žƒ…—Ž–—”ƒƒ–—ƒŽǡ
formas de verbo: põe, pões, põem etc.
“—À‹…ƒǤ ƒ•‡•–ƒ±ƒ‹•
‘’”‹‹†ƒǤ
Pessoas: 1ª, 2ª e 3ª pessoa são abordadas em 2 situações:
‡”–‘†‡ ƒ••ƒ†‘ ‡ˆ‡”‡–‡ 
singular e plural.
“—‡ ‘—ˆ—–—”‘ ƒ“—‹Ž‘“—‡ Primeira pessoa do singular – eu; ex: eu canto
‘—˜‡ȋʹ͐ ’”ך‹‘• Œžˆ‘‹†‹–‘Ǥ Segunda pessoa do singular – tu; ex: tu cantas
’‡••‘ƒȌǤ Terceira pessoa do singular – ele; ex ele: canta
esse, Primeira pessoa do plural – nós; ex: nós cantamos
essa, šǤǣ ‘ šǤǣ‡••‡ šǤǣ 
‰‘•–‡‹ ‹‘ƒ‘ǡ
‘•–ƒ˜ƒ†‡ Segunda pessoa do plural – vós; ex: vós cantais
esses, Terceira pessoa do plural – eles; ex: eles cantam
essas †‡••‡ ”‡ƒŽ‹œ‡‹„‘• “—À‹…ƒǤ
Ž‹˜”‘ ‡‰×…‹‘• ••ƒ
“—‡‡•–ž ƒϐ‹”ƒ­ ‘ Tempos e Modo de Verbo
‡–—ƒ• ‡†‡‹š‘—
 ‘•Ǥ •—”’”‡•ƒ - Presente. Fato ocorrido no momento em que se fala. Ex:
Faz
‡”–‘ ƒ••ƒ†‘‘—  ‡ˆ‡”‡–‡
- Pretérito. Fato ocorrido antes. Ex: Fez
†ƒ͵͐ ˆ—–—”‘ ƒ‘’”‹‡‹”‘
- Futuro. Fato ocorrido depois. Ex: Fará
’‡••‘ƒǡ ”‡‘–‘• ‡Ž‡‡–‘
†‹•–ƒ–‡ …‹–ƒ†‘‡—ƒ
O pretérito subdivide-se em perfeito, imperfeito e mais-
†‘• ‡—‡”ƒ­ ‘Ǥ
-que-perfeito.
aquele, ‹–‡”Ž‘…—Ǧ - Perfeito. Ação acabada. Ex: Eu li o ultimo romance de
aquela, –‘”‡•Ǥ Rubens Fonseca.
aquilo, šǤǣ ‘ šǤǣ‡Š‘  šǤǣŠ‘‡ - Imperfeito. Ação inacabada no momento a que se refere
aqueles, ‰‘•–‡‹ „‘ƒ• ‡ƒ—ŽŠ‡”• ‘ à narração. Ex: Ele olhava o mar durante horas e horas.
aquelas †ƒ“—‡Ž‡ ”‡…‘”†ƒ­Ù‡• ƒ••ƒ…”ƒ†‘•’‡Žƒ - Mais-que-perfeito. Ação acabada, ocorrida antes de ou-
Ž‹˜”‘“—‡ †‡ͳͻ͸Ͳǡ …—Ž–—”ƒƒ–—ƒŽǡ tro fato passado. Ex: Para poder trabalhar melhor, ela dividira
ƒ‘„‡”–ƒ ’‘‹•ƒ“—‡Ž‡ ƒ•‡•–ƒ±ƒ‹• a turma em dois grupos.
–”‘—š‡Ǥ ƒ‘”‡ƒŽ‹œ‡‹ ‘’”‹‹†ƒ“—‡
„‘• ƒ“—‡Ž‡Ǥ O futuro subdivide-se em futuro do presente e futuro do
‡‰×…‹‘•Ǥ pretérito.
- Futuro do Presente. Refere-se a um fato imediato e
Pronomes Indefinidos: São pronomes que acompanham certo. Ex: Comprarei ingressos para o teatro.
o substantivo, mas não o determinam de forma precisa: algum, - Futuro do Pretérito. Pode indicar condição, referindo-
bastante, cada, certo, diferentes, diversos, demais, mais, -se a uma ação futura, vinculada a um momento já passado. Ex:
menos, muito nenhum, outro, pouco, qual, qualquer, quanto, Aprenderia tocar violão, se tivesse ouvido para a música (indica
tanto, todo, tudo, um, vários. condição); Eles gostariam de convidá-la para a festa.

Algumas locuções pronominais indefinidas: cada Modos Verbais


qual, qualquer um, tal e qual, seja qual for, sejam quem for,
todo aquele, quem (que), quer uma ou outra, todo aquele - Indicativo. Apresenta o fato de manei-
(que), tais e tais, tal qual, seja qual for. ra real, certa, positiva. Ex: Eu estudo geografia
Iremos ao cinema; Voltou para casa.
VERBO - subjuntivo. Pode exprimir um desejo e apresenta o fato
como possível ou duvidoso, hipotético. Ex: Queria que me le-
Quando se pratica uma ação, a palavra que representa essa vasses ao teatro; Se eu tivesse dinheiro, compraria um carro;
ação e indica o momento em que ela ocorre é o verbo. Exem- Quando o relógio despertar, acorda-me.
plos: - Imperativo. Exprime ordem, conselho ou súplica. Ex:
- Aquele pedreiro trabalhou muito. (ação – pretérito)
- Venta muito na primavera. (fenômeno – presente) Limpa a cozinha, Maria; Descanse bastante nestas férias; Se-
- Ana ficará feliz com a tua chegada. (estado - futuro) nhor tende piedade de nós.
- Maria enviuvou na semana passada. (mudança de estado
– pretérito) As formas nominais do verbo são Três: infinitivo, gerún-
- A serra azula o horizonte. (qualidade – presente) dio e particípio.

Conjugação Verbal: Existem 3 conjugações verbais: Infinitivo:


- A 1ª que tem como vogal temática o ‘’a’’. Ex: cantar, pular, Pessoal - cantar (eu), cantares (tu), vender (eu), venderes
sonhar etc... (tu), partir (eu), partires (tu)
- A 2ª que tem como vogal temática o ‘’e’’. Ex: vender, comer, Impessoal - cantar, vender, partir.
chover, sofrer etc... Gerúndio - cantando, vendendo, partindo.
- A 3ª que tem como vogal temática o ‘’i’’. Ex: partir, dividir, Particípio - cantado, vendido, partido.
sorrir, abrir etc...

45
LÍNGUA PORTUGUESA
Impessoal: Uma forma em que o verbo não se refere a
nenhuma pessoa gramatical: é o infinitivo impessoal quando 1º 2º 3º
não se refere às pessoas do discurso. Exemplos: viver é bom. (a CONJUGAÇAO CONJUGAÇÃO CONJUGAÇÃO
vida é boa); É proibido fumar. (é proibido o fumo) CANT - AR VEND - ER PART - IR
Pessoal: Quando se refere às pessoas do discurso. Neste Não cantes Não vendas Não partas
caso, não é flexionado nas 1ª e 3ª pessoas do singular e flexio-
nadas nas demais: Não cante Não venda Não parta
Falar (eu) – não flexionado
Falares (tu) – flexionado Não cantemos Não vendamos Não partamos
Falar (ele) – não flexionado
Falarmos (nós) – flexionado Não canteis Não vendais Não partais
Falardes (voz) – flexionado
Falarem (eles) – flexionado Não cantem Não vendam Não partam
Ex: É conveniente estudares (é conveniente o estudo); É útil Imperativo afirmativo: Também é formado do presente
pesquisarmos (é útil a nossa pesquisa) do subjuntivo, com exceção da 2º pessoa do singular e da 2º
pessoa do plural, que são retiradas do presente do indicativo
Aspecto: Aspecto é a maneira de ser ação. sem o “s”. Ex: Canta – Cante – Cantemos – Cantai – Cantem

O Pretérito Perfeito Composto: indica um fato con- O imperativo não possui a 1º pessoa do singular, pois não se
cluído, revela de certa forma a ideia de continuidade. Ex: Eu te- prevê a ordem, o pedido ou o conselho a si mesmo.
nho estudado (eu estudei até o presente momento). Os verbos
invocativos (terminados em “ecer” ou “escer”) indica uma con- Tempos são compostos quando formados pelos auxilia-
tinuidade gradual. Ex: embranquecer é começar a ficar grisalho res ter ou haver.
e envelhecer é ir ficando velho.
Indicativo:
O Presente do Indicativo pode: Pretérito perfeito composto - tenho cantado, tenho vendido,
- indicar frequência. Ex: O sol nasce para todos. tenho partido, etc.
- ser empregado no lugar do futuro. Ex: amanhã vou ao tea- Pretérito mais-que-perfeito composto - tinha cantado, tinha
tro. (irei); Se continuam as indiretas, perco a paciência. (conti- vendido, tinha partido, etc.
nuarem; perderei) Futuro do presente composto - terei cantado, terei vendido,
- ser empregado no lugar do pretérito (presente histórico). terei partido, etc.
Ex: É 1939: alemães invadem o território polonês (era; inva- Futuro do pretérito composto - teria cantado, teria vendido,
diram) teria partido, etc.

O Pretérito Imperfeito do Indicativo pode: Subjuntivo:


- Substituir o futuro do pretérito. Ex: Se eu soubesse, não Pretérito perfeito composto - tenha cantado, tenha vendido,
dizia aquilo. (diria) tenha partido, etc.
- Expressar cortesia ou timidez. Ex: O senhor podia fazer o Pretérito mais-que-perfeito composto - tivesse cantado, ti-
favor de me emprestar uma caneta? (pode) vesse vendido, tivesse partido, etc.
Futuro composto - tiver cantado, tiver vendido, tiver parti-
Futuro do Presente pode: do, etc.
- Indicar probabilidade. Ex: Ele terá, no máximo, uns 70
quilos. Infinitivo:
- Substituir o imperativo. Ex: Não matarás. (não mates) Pretérito impessoal composto - ter cantado, ter vendido, ter
partido, etc.
Tempos Simples e Tempos Compostos: Os tempos Pretérito pessoal composto - ter (teres) cantado, ter (teres)
são simples quando formados apenas pelo verbo principal. vendido, ter (teres) partido.
Gerúndio pretérito composto - tendo cantado, tendo vendi-
Indicativo: do, tendo partido.
Presente - canto, vendo, parto, etc. Regulares: Regulares são verbos que se conjugam de acor-
Pretérito perfeito - cantei, vendi, parti, etc. do com o paradigma (modelo) de cada conjugação. Cantar (1ª
Pretérito imperfeito - cantava, vendia, partia, etc. conjugação) vender (2ª conjugação) partir (3ª conjugação) to-
Pretérito mais-que-perfeito - cantara, vendera, partira, etc. dos que se conjugarem de acordo com esses verbos serão re-
Futuro do presente - cantarei, venderei, partirei, etc. gulares.
Futuro do pretérito - cantaria, venderia, partiria, etc.
ADVÉRBIO
Subjuntivo:
Presente - cante, venda, parta, etc. Palavra invariável que modifica essencialmente o verbo,
Pretérito imperfeito - cantasse, vendesse, partisse, etc. exprimindo uma circunstância.
Futuro - cantar, vender, partir.
Advérbio modificando um verbo ou adjetivo:
Imperativo: Ao indicar ordem, conselho, pedido, o fato Ocorre quando o advérbio modifica um verbo ou um adjetivo
verbal pode expressar negação ou afirmação. São, portanto, acrescentando a eles uma circunstância. Por circunstância
duas as formas do imperativo: entende-se qualquer particularidade que determina um fato,
- Imperativo Negativo: Não falem alto. ampliando a informação nele contida. Ex.: Antônio construiu
- Imperativo Afirmativo: Falem mais alto. seu arraial popular ali; Estradas tão ruins.

Imperativo negativo: É formado do presente do Advérbio modificando outro advérbio: Ocorre


subjuntivo. quando o advérbio modifica um adjetivo ou outro advérbio,
geralmente intensificando o significado. Ex.: Grande parte da
população adulta lê muito mal.

46
LÍNGUA PORTUGUESA
- Aproximação: quase, lá por, bem, uns, cerca de, por
Advérbio modificando uma oração inteira: Ocorre volta de.
quando o advérbio está modificando o grupo formado por todos - Designação: Ex.: Eis nosso novo carro. Eis.
os outros elementos da oração, indicando uma circunstância. - Exclusão: Ex.: Todos irão, menos ele. Apenas, salvo,
Ex.: Lamentavelmente o Brasil ainda tem 19 milhões de menos, exceto, só, somente, exclusive, sequer, senão.
analfabetos. - Explicação: Ex.: Viajaremos em julho, ou seja, nas férias.
Isto é, por exemplo, a saber, ou seja.
Locução Adverbial: É um conjunto de palavras que pode - Inclusão: Ex.: Até ele irá viajar. Até, inclusive, também,
exercer a função de advérbio. Ex.: De modo algum irei lá. mesmo, ademais.
- Limitação: Ex.: Apenas um me respondeu. Só, somente,
Tipos de Advérbios unicamente, apenas.
- Realce: Ex.: E você lá sabe essa questão? É que, cá, lá,
- de modo: Ex.: Sei muito bem que ninguém deve passar não, mas, é porque, só, ainda, sobretudo.
atestado da virtude alheia. Bem, mal, assim, adrede, melhor, - Retificação: Ex.: Somos três, ou melhor, quatro. Aliás,
pior, depressa, acinte, debalde, devagar, ás pressas, às claras, isto é, ou melhor, ou antes.
às cegas, à toa, à vontade, às escondas, aos poucos, desse jeito, - Situação: Ex.: Afinal, quem perguntaria a ele? Então,
desse modo, dessa maneira, em geral, frente a frente, lado a mas, se, agora, afinal.
lado, a pé, de cor, em vão e a maior parte dos que terminam
em -mente: calmamente, tristemente, propositadamente, Grau dos Advérbios: Os advérbios, embora pertençam à
pacientemente, amorosamente, docemente, escandalosamente, categoria das palavras invariáveis, podem apresentar variações
bondosamente, generosamente. com relação ao grau. Além do grau normal, o advérbio pode-se
- de intensidade: Ex.: Acho que, por hoje, você já ouviu apresentar no grau comparativo e no superlativo.
bastante. Muito, demais, pouco, tão, menos, em excesso,
bastante, pouco, mais, menos, demasiado, quanto, quão, tanto, - Grau Comparativo: quando a circunstância expressa
assaz, que (equivale a quão), tudo, nada, todo, quase, de todo, pelo advérbio aparece em relação de comparação. O advérbio
de muito, por completo, bem (quando aplicado a propriedades não é flexionado no grau comparativo. Para indicar esse grau
graduáveis). utilizam as formas tão…quanto, mais…que, menos…que. Pode
- de tempo: Ex.: Leia e depois me diga quando pode sair ser:
na gazeta. Hoje, logo, primeiro, ontem, tarde, outrora, amanhã, - comparativo de igualdade. Ex.: Chegarei tão cedo quanto
cedo, dantes, depois, ainda, antigamente, antes, doravante, você.
nunca, então, ora, jamais, agora, sempre, já, enfim, afinal, - comparativo de superioridade. Ex.: Chegarei mais cedo
amiúde, breve, constantemente, entrementes, imediatamente, que você.
primeiramente, provisoriamente, sucessivamente, às vezes, - comparativo de inferioridade. Ex.: Chegaremos menos
à tarde, à noite, de manhã, de repente, de vez em quando, cedo que você.
de quando em quando, a qualquer momento, de tempos em
tempos, em breve, hoje em dia. - Grau Superlativo: nesse caso, a circunstância expressa
- de lugar: Ex.: A senhora sabe aonde eu posso encontrar pelo advérbio aparecerá intensificada. O grau superlativo
esse pai-de-santo? Aqui, antes, dentro, ali, adiante, fora, acolá, do advérbio pode ser formado tanto pelo processo sintético
atrás, além, lá, detrás, aquém, cá, acima, onde, perto, aí, abaixo, (acréscimo de sufixo), como pelo processo analítico (outro
aonde, longe, debaixo, algures, defronte, nenhures, adentro, advérbio estará indicando o grau superlativo).
afora, alhures, nenhures, aquém, embaixo, externamente, a - superlativo (ou absoluto) sintético: formado com o
distancia, a distancia de, de longe, de perto, em cima, à direita, acréscimo de sufixo. Ex.: Cheguei tardíssimo.
à esquerda, ao lado, em volta. - superlativo (ou absoluto) analítico: expresso com o auxilio
- de negação: Ex.: De modo algum irei lá. Não, nem, de um advérbio de intensidade. Ex.: Cheguei muito tarde.
nunca, jamais, de modo algum, de forma nenhuma, tampouco,
de jeito nenhum. Quando se empregam dois ou mais advérbios terminados
- de dúvida: Ex.: Talvez ela volte hoje. Acaso, porventura, em –mente, pode-se acrescentar o sufixo apenas no ultimo.
possivelmente, provavelmente, quiçá, talvez, casualmente, por Ex.: Nada omitiu de seu pensamento; falou clara, franca e
certo, quem sabe. nitidamente.
- de afirmação: Ex.: Realmente eles sumiram. Sim, Quando se quer realçar o advérbio, pode-se antecipá-lo.
certamente, realmente, decerto, efetivamente, certo, Ex.: Imediatamente convoquei os alunos.
decididamente, realmente, deveras, indubitavelmente.
- de exclusão: Apenas, exclusivamente, salvo, senão, PREPOSIÇÃO
somente, simplesmente, só, unicamente.
- de inclusão: Ex.: Emocionalmente o indivíduo também É uma palavra invariável que serve para ligar termos ou
amadurece durante a adolescência. Ainda, até, mesmo, orações. Quando esta ligação acontece normalmente há uma
inclusivamente, também. subordinação do segundo termo em relação ao primeiro. As
- de ordem: Depois, primeiramente, ultimamente. preposições são muito importantes na estrutura da língua, pois
- de designação: Eis estabelecem a coesão textual e possuem valores semânticos
- de interrogação: Ex.: E então? Quando é que embarca? indispensáveis para a compreensão do texto.
onde? (lugar), como? (modo), quando? (tempo), porque?
(causa), quanto? (preço e intensidade), para que? (finalidade). Tipos de Preposição

Palavras Denotativas: Há, na língua portuguesa, - Preposições essenciais: palavras que atuam
uma série de palavras que se assemelham a advérbios. exclusivamente como preposições. A, ante, perante, após, até,
A Nomenclatura Gramatical Brasileira não faz nenhuma com, contra, de, desde, em, entre, para, por, sem, sob, sobre,
classificação especial para essas palavras, por isso elas são trás, atrás de, dentro de, para com.
chamadas simplesmente de palavras denotativas. - Preposições acidentais: palavras de outras classes
- Adição: Ex.: Comeu tudo e ainda queria mais. Ainda, gramaticais que podem atuar como preposições. Como,
além disso. durante, exceto, fora, mediante, salvo, segundo, senão, visto.
- Afastamento: Ex.: Foi embora daqui. Embora. - Locuções prepositivas: duas ou mais palavras valendo
- Afetividade: Ex.: Ainda bem que passei de ano. Ainda como uma preposição, sendo que a última palavra é uma delas.
bem, felizmente, infelizmente. Abaixo de, acerca de, acima de, ao lado de, a respeito de, de

47
LÍNGUA PORTUGUESA
acordo com, em cima de, embaixo de, em frente a, ao redor de, termos e estabelece relação de subordinação entre eles.
graças a, junto a, com, perto de, por causa de, por cima de, por Cheguei a sua casa ontem pela manhã.
trás de. Não queria, mas vou ter que ir a outra cidade para procurar
um tratamento adequado.
A preposição é invariável. No entanto pode unir-se a outras - Se for pronome pessoal oblíquo estará ocupando o lugar
palavras e assim estabelecer concordância em gênero ou em e/ou a função de um substantivo.
número. Ex: por + o = pelo; por + a = pela. Temos Maria como parte da família. / A temos como parte
Vale ressaltar que essa concordância não é característica da da família.
preposição e sim das palavras a que se ela se une. Esse processo Creio que conhecemos nossa mãe melhor que ninguém. / Creio
de junção de uma preposição com outra palavra pode se dar a que a conhecemos melhor que ninguém.
partir de dois processos:
2. Algumas relações semânticas estabelecidas por meio das
- Combinação: A preposição não sofre alteração. preposições:
preposição a + artigos definidos o, os Destino: Irei para casa.
a + o = ao Modo: Chegou em casa aos gritos.
preposição a + advérbio onde Lugar: Vou ficar em casa;
a + onde = aonde Assunto: Escrevi um artigo sobre adolescência.
Tempo: A prova vai começar em dois minutos.
- Contração: Quando a preposição sofre alteração. Causa: Ela faleceu de derrame cerebral.
Preposição + Artigos Fim ou finalidade: Vou ao médico para começar o
De + o(s) = do(s) tratamento.
De + a(s) = da(s) Instrumento: Escreveu a lápis.
De + um = dum Posse: Não posso doar as roupas da mamãe.
De + uns = duns Autoria: Esse livro de Machado de Assis é muito bom.
De + uma = duma Companhia: Estarei com ele amanhã.
De + umas = dumas Matéria: Farei um cartão de papel reciclado.
Em + o(s) = no(s) Meio: Nós vamos fazer um passeio de barco.
Em + a(s) = na(s) Origem: Nós somos do Nordeste, e você?
Em + um = num Conteúdo: Quebrei dois frascos de perfume.
Em + uma = numa Oposição: Esse movimento é contra o que eu penso.
Em + uns = nuns Preço: Essa roupa sai por R$ 50 à vista.
Em + umas = numas
A + à(s) = à(s) INTERJEIÇÃO
Por + o = pelo(s)
Por + a = pela(s) É a palavra que expressa emoções, sentimentos ou pensa-
mentos súbitos. Trata-se de um recurso da linguagem afetiva,
- Preposição + Pronomes em que não há uma ideia organizada de maneira lógica, como
De + ele(s) = dele(s) são as sentenças da língua, mas sim a manifestação de um sus-
De + ela(s) = dela(s) piro, um estado da alma decorrente de uma situação particular,
De + este(s) = deste(s) um momento ou um contexto específico. Exemplos:
De + esta(s) = desta(s) - Ah, como eu queria voltar a ser criança! (ah: expressão de
De + esse(s) = desse(s) um estado emotivo = interjeição)
De + essa(s) = dessa(s) - Hum! Esse cuscuz estava maravilhoso! (hum: expressão
De + aquele(s) = daquele(s) de um pensamento súbito = interjeição)
De + aquela(s) = daquela(s)
De + isto = disto As sentenças da língua costumam se organizar de forma ló-
De + isso = disso gica: há uma sintaxe que estrutura seus elementos e os distribui
De + aquilo = daquilo em posições adequadas a cada um deles. As interjeições, por
De + aqui = daqui outro lado, são uma espécie de palavra-frase, ou seja, há uma
De + aí = daí idéia expressa por uma palavra (ou um conjunto de palavras
De + ali = dali - locução interjetiva) que poderia ser colocada em termos de
De + outro = doutro(s) uma sentença. Observe:
De + outra = doutra(s) - Bravo! Bravo! Bis! (bravo e bis: interjeição). Sentença
Em + este(s) = neste(s) sugestão: “Foi muito bom! Repitam!”
Em + esta(s) = nesta(s) - Ai! Ai! Ai! Machuquei meu pé. (ai: interjeição). Sentença
Em + esse(s) = nesse(s) sugestão: “Isso está doendo!” ou “Estou com dor!”
Em + aquele(s) = naquele(s)
Em + aquela(s) = naquela(s) O significado das interjeições está vinculado à maneira
Em + isto = nisto como elas são proferidas. Desse modo, o tom da fala é que dita
Em + isso = nisso o sentido que a expressão vai adquirir em cada contexto de
Em + aquilo = naquilo enunciação. Exemplos:
A + aquele(s) = àquele(s) - Psiu! (contexto: alguém pronunciando essa expressão na
A + aquela(s) = àquela(s) rua). Significado da interjeição (sugestão): “Estou te chaman-
A + aquilo = àquilo do! Ei, espere!”.
- Psiu! (contexto: alguém pronunciando essa expressão em
1. O “a” pode funcionar como preposição, pronome pessoal um hospital). Significado da interjeição (sugestão): “Por favor,
oblíquo e artigo. Como distingui-los? faça silêncio!”.
- Caso o “a” seja um artigo, virá precedendo a um - Puxa! Ganhei o maior prêmio do sorteio! (puxa: interjei-
substantivo. Ele servirá para determiná-lo como um substantivo ção) (tom da fala: euforia)
singular e feminino. - Puxa! Hoje não foi meu dia de sorte! (puxa: interjeição)
A dona da casa não quis nos atender. (tom da fala: decepção)
Como posso fazer a Joana concordar comigo?
- Quando é preposição, além de ser invariável, liga dois As interjeições são palavras invariáveis, isto é, não sofrem

48
LÍNGUA PORTUGUESA
variação em gênero, número e grau como os nomes, nem de Principais conjunções causais: porque, visto que, já que,
número, pessoa, tempo, modo, aspecto e voz como os verbos. uma vez que, como (= porque).
No entanto, em uso específico, algumas interjeições sofrem va- Ele não fez o trabalho porque não tem livro.
riação em grau. Deve-se ter claro, neste caso, que não se trata - COMPARATIVAS
de um processo natural dessa classe de palavra, mas tão só uma Principais conjunções comparativas: que, do que, tão...
variação que a linguagem afetiva permite. Exemplos: oizinho, como, mais...do que, menos...do que.
bravíssimo, até loguinho. Ela fala mais que um papagaio.
- CONCESSIVAS
CONJUNÇÃO Principais conjunções concessivas: embora, ainda que,
mesmo que, apesar de, se bem que.
Conjunção é a palavra invariável que liga duas orações ou Indicam uma concessão, admitem uma contradição, um
dois termos semelhantes de uma mesma oração. Por exemplo: fato inesperado. Traz em si uma ideia de “apesar de”.
Embora estivesse cansada, fui ao shopping. (= apesar de estar
A menina segurou a boneca e mostrou quando viu as cansada)
amiguinhas. Apesar de ter chovido fui ao cinema.
Deste exemplo podem ser retiradas três informações: - CONFORMATIVAS
Principais conjunções conformativas: como, segundo,
1-) segurou a boneca 2-) a menina mostrou 3-) viu conforme, consoante
as amiguinhas Cada um colhe conforme semeia.
Expressam uma ideia de acordo, concordância,
Cada informação está estruturada em torno de um verbo: conformidade.
segurou, mostrou, viu. Assim, há nessa frase três orações: - CONSECUTIVAS
1ª oração: A menina segurou a boneca 2ª oração: e mostrou Expressam uma ideia de consequência.
3ª oração: quando viu as amiguinhas. Principais conjunções consecutivas: que (após “tal”, “tanto”,
A segunda oração liga-se à primeira por meio do “e”, e a “tão”, “tamanho”).
terceira oração liga-se à segunda por meio do “quando”. As Falou tanto que ficou rouco.
palavras “e” e “quando” ligam, portanto, orações. - FINAIS
Expressam ideia de finalidade, objetivo.
Observe: Gosto de natação e de futebol. Todos trabalham para que possam sobreviver.
Nessa frase as expressões de natação, de futebol são partes Principais conjunções finais: para que, a fim de que, porque
ou termos de uma mesma oração. Logo, a palavra “e” está (=para que),
ligando termos de uma mesma oração. - PROPORCIONAIS
Principais conjunções proporcionais: à medida que, quanto
Conjunção é a palavra invariável que liga duas mais, ao passo que, à proporção que.
orações ou dois termos semelhantes de uma mesma À medida que as horas passavam, mais sono ele tinha.
oração. - TEMPORAIS
Principais conjunções temporais: quando, enquanto, logo
Morfossintaxe da Conjunção que.
Quando eu sair, vou passar na locadora.
As conjunções, a exemplo das preposições, não exercem
propriamente uma função sintática: são conectivos. Importante:
Diferença entre orações causais e explicativas
Classificação - Conjunções Coordenativas- Conjunções Quando estudamos Orações Subordinadas Adverbiais
Subordinativas (OSA) e Coordenadas Sindéticas (CS), geralmente nos
deparamos com a dúvida de como distinguir uma oração causal
Conjunções coordenativas de uma explicativa. Veja os exemplos:
Dividem-se em: 1º) Na frase “Não atravesse a rua, porque você pode ser
atropelado”:
- ADITIVAS: expressam a ideia de adição, soma. a) Temos uma CS Explicativa, que indica uma justificativa
Ex. Gosto de cantar e de dançar. ou uma explicação do fato expresso na oração anterior.
Principais conjunções aditivas: e, nem, não só...mas b) As orações são coordenadas e, por isso, independentes
também, não só...como também. uma da outra. Neste caso, há uma pausa entre as orações que
- ADVERSATIVAS: Expressam ideias contrárias, de oposição, vêm marcadas por vírgula.
de compensação. Não atravesse a rua. Você pode ser atropelado.
Ex. Estudei, mas não entendi nada. b) Outra dica é, quando a oração que antecede a OC
Principais conjunções adversativas: mas, porém, contudo, (Oração Coordenada) vier com verbo no modo imperativo, ela
todavia, no entanto, entretanto. será explicativa.
- ALTERNATIVAS: Expressam ideia de alternância. Façam silêncio, que estou falando. (façam= verbo imperativo)
Ou você sai do telefone ou eu vendo o aparelho.
Principais conjunções alternativas: Ou...ou, ora...ora, quer... 2º) Na frase “Precisavam enterrar os mortos em outra cidade
quer, já...já. porque não havia cemitério no local.”
- CONCLUSIVAS: Servem para dar conclusões às orações. a) Temos uma OSA Causal, já que a oração subordinada
Ex. Estudei muito, por isso mereço passar. (parte destacada) mostra a causa da ação expressa pelo
Principais conjunções conclusivas: logo, por isso, pois verbo da oração principal. Outra forma de reconhecê-
(depois do verbo), portanto, por conseguinte, assim. la é colocá-la no início do período, introduzida pela
- EXPLICATIVAS: Explicam, dão um motivo ou razão. Ex. É conjunção como - o que não ocorre com a CS Explicativa.
melhor colocar o casaco porque está fazendo muito frio lá fora. Como não havia cemitério no local, precisavam enterrar os mortos
Principais conjunções explicativas: que, porque, pois (antes em outra cidade.
do verbo), porquanto. b) As orações são subordinadas e, por isso, totalmente
dependentes uma da outra.
Conjunções subordinativas

- CAUSAIS

49
LÍNGUA PORTUGUESA
Questões (E) futuro composto do subjuntivo.

01. Assinale o par de frases em que as palavras sublinhadas Respostas


são substantivo e pronome, respectivamente: 01. E / 02. A / 03. C / 04. E / 05. D / 06. E / 07. B
(A) A imigração tornou-se necessária. / É dever cristão / 08. D
praticar o bem.
(B) A Inglaterra é responsável por sua economia. / Havia
muito movimento na praça.
(C) Fale sobre tudo o que for preciso. / O consumo de
drogas é condenável.
(D) Pessoas inconformadas lutaram pela abolição. / Frase, oração e período. Período
Pesca-se muito em Angra dos Reis. composto (coordenação e
(E) Os prejudicados não tinham o direito de reclamar. / subordinação).
Não entendi o que você disse.

02. Assinale o item que só contenha preposições: Análise Sintática


(A) durante, entre, sobre
(B) com, sob, depois A Análise Sintática examina a estrutura do período,
(C) para, atrás, por divide e classifica as orações que o constituem e reconhece a
(D) em, caso, após
função sintática dos termos de cada oração.
(E) após, sobre, acima

03. Observe as palavras grifadas da seguinte frase: Oração: é todo enunciado linguístico dotado de sentido,
“Encaminhamos a V. Senhoria cópia autêntica do Edital porém há, necessariamente, a presença do verbo. A oração
nº 19/82.” Elas são, respectivamente: encerra uma frase (ou segmento de frase), várias frases ou
(A) verbo, substantivo, substantivo um período, completando um pensamento e concluindo o
(B) verbo, substantivo, advérbio enunciado através de ponto final, interrogação, exclamação e,
(C) verbo, substantivo, adjetivo em alguns casos, através de reticências.
(D) pronome, adjetivo, substantivo Em toda oração há um verbo ou locução verbal (às vezes
(E) pronome, adjetivo, adjetivo elípticos). Não têm estrutura sintática, portanto não são
orações, não podem ser analisadas sintaticamente frases como:
04. Assinale a opção em que a locução grifada tem valor
adjetivo: Socorro!
(A) “Comprei móveis e objetos diversos que entrei a utilizar Com licença!
com receio.” Que rapaz impertinente!
(B) “Azevedo Gondim compôs sobre ela dois artigos.”
(C) “Pediu-me com voz baixa cinquenta mil réis.” Na oração as palavras estão relacionadas entre si, como
(D) “Expliquei em resumo a prensa, o dínamo, as serras...” partes de um conjunto harmônico: elas formam os termos
(E) “Resolvi abrir o olho para que vizinhos sem escrúpulos ou as unidades sintáticas da oração. Cada termo da oração
não se apoderassem do que era delas.” desempenha uma função sintática. Geralmente apresentam dois
grupos de palavras: um grupo sobre o qual se declara alguma
05. O “que” está com função de preposição na alternativa:
coisa (o sujeito), e um grupo que apresenta uma declaração
(A) Veja que lindo está o cabelo da nossa amiga!
(B) Diz-me com quem andas, que eu te direi quem és. (o predicado), e, excepcionalmente, só o predicado. Exemplo:
(C) João não estudou mais que José, mas entrou na
Faculdade. A menina banhou-se na cachoeira.
(D) O Fiscal teve que acompanhar o candidato ao banheiro. A menina – sujeito
(E) Não chore que eu já volto. banhou-se na cachoeira – predicado

06. “Saberão que nos tempos do passado o doce amor era O sujeito é o termo da frase que concorda com o verbo em
julgado um crime.” número e pessoa. É normalmente o «ser de quem se declara
(A) 1 preposição algo”, “o tema do que se vai comunicar”.
(B) 3 adjetivos
O predicado é a parte da oração que contém “a informação
(C) 4 verbos
(D) 7 palavras átonas nova para o ouvinte”. Normalmente, ele se refere ao sujeito,
(E) 4 substantivos constituindo a declaração do que se atribui ao sujeito.

07. As expressões sublinhadas correspondem a um adjetivo, Núcleo de um termo é a palavra principal (geralmente
exceto em: um substantivo, pronome ou verbo), que encerra a essência
(A) João Fanhoso anda amanhecendo sem entusiasmo. de sua significação. Nos exemplos seguintes as palavras
(B) Demorava-se de propósito naquele complicado “amigo” e “revestiu” são o núcleo do sujeito e do predicado,
banho. respectivamente
(C) Os bichos da terra fugiam em desabalada carreira.
(D) Noite fechada sobre aqueles ermos perdidos da caatinga
Os termos da oração da língua portuguesa são classificados
sem fim.
(E) E ainda me vem com essa conversa de homem da roça. em três grandes níveis:
- Termos Essenciais da Oração: Sujeito e Predicado.
08. Em “__ como se tivéssemos vivido sempre juntos”, a - Termos Integrantes da Oração: Complemento
forma verbal está no: Nominal e Complementos Verbais (Objeto Direto, Objeto
(A) imperfeito do subjuntivo; indireto e Agente da Passiva).
(B) futuro do presente composto; - Termos Acessórios da Oração: Adjunto Adnominal,
(C) mais-que-perfeito composto do indicativo; Adjunto Adverbial, Aposto e Vocativo.
(D) mais-que-perfeito composto do subjuntivo;

50
LÍNGUA PORTUGUESA
Termos Essenciais da Oração: São dois os termos O sujeito pode ser:
essenciais (ou fundamentais) da oração: sujeito e predicado. Simples: quando tem um só núcleo: As rosas tem
espinhos; “Um bando de galinhas-d’angola atravessa a rua em
Sujeito: é equivocado dizer que o sujeito é aquele que fila indiana.”
pratica uma ação ou é aquele (ou aquilo) do qual se diz alguma Composto: quando tem mais de um núcleo: “O burro e o
coisa. Ao fazer tal afirmação estamos considerando o aspecto cavalo nadavam ao lado da canoa.”
semântico do sujeito (agente de uma ação) ou o seu aspecto Expresso: quando está explícito, enunciado: Eu viajarei
estilístico (o tópico da sentença). Já que o sujeito é depreendido amanhã.
de uma análise sintática, vamos restringir a definição apenas Oculto (ou elíptico): quando está implícito, isto é,
ao seu papel sintático na sentença: aquele que estabelece quando não está expresso, mas se deduz do contexto: Viajarei
concordância com o núcleo do predicado. Quando se trata amanhã. (sujeito: eu, que se deduz da desinência do verbo);
de predicado verbal, o núcleo é sempre um verbo; sendo um “Um soldado saltou para a calçada e aproximou-se.” (o sujeito,
predicado nominal, o núcleo é sempre um nome. Então têm por soldado, está expresso na primeira oração e elíptico na segunda:
características básicas: e (ele) aproximou-se.); Crianças, guardem os brinquedos.
- estabelecer concordância com o núcleo do predicado; (sujeito: vocês)
- apresentar-se como elemento determinante em relação ao Agente: se faz a ação expressa pelo verbo da voz ativa: O
predicado; Nilo fertiliza o Egito.
- constituir-se de um substantivo, ou pronome substantivo Paciente: quando sofre ou recebe os efeitos da ação
ou, ainda, qualquer palavra substantivada. expressa pelo verbo passivo: O criminoso é atormentado
pelo remorso; Muitos sertanistas foram mortos pelos índios;
Exemplo: Construíram-se açudes. (= Açudes foram construídos.)
A padaria está fechada hoje. Agente e Paciente: quando o sujeito realiza a ação
está fechada hoje: predicado nominal expressa por um verbo reflexivo e ele mesmo sofre ou recebe
fechada: nome adjetivo = núcleo do predicado os efeitos dessa ação: O operário feriu-se durante o trabalho;
a padaria: sujeito Regina trancou-se no quarto.
padaria: núcleo do sujeito - nome feminino singular Indeterminado: quando não se indica o agente da ação
verbal: Atropelaram uma senhora na esquina. (Quem atropelou
No interior de uma sentença, o sujeito é o termo determinante, a senhora? Não se diz, não se sabe quem a atropelou.); Come-
ao passo que o predicado é o termo determinado. Essa posição se bem naquele restaurante.
de determinante do sujeito em relação ao predicado adquire
sentido com o fato de ser possível, na língua portuguesa, uma Sem Sujeito: constituem a enunciação pura e absoluta de
sentença sem sujeito, mas nunca uma sentença sem predicado. um fato, através do predicado; o conteúdo verbal não é atribuído
Exemplo: a nenhum ser. São construídas com os verbos impessoais, na 3ª
pessoa do singular: Havia ratos no porão; Choveu durante o
As formigas invadiram minha casa. jogo.
as formigas: sujeito = termo determinante Observação: São verbos impessoais: Haver (nos sentidos
invadiram minha casa: predicado = termo determinado de existir, acontecer, realizar-se, decorrer), Fazer, passar, ser
e estar, com referência ao tempo e Chover, ventar, nevar, gear,
O sujeito sempre se manifesta em termos de sintagma relampejar, amanhecer, anoitecer e outros que exprimem
nominal, isto é, seu núcleo é sempre um nome. Quando esse fenômenos meteorológicos.
nome se refere a objetos das primeira e segunda pessoas,
o sujeito é representado por um pronome pessoal do caso Predicado: assim como o sujeito, o predicado é um
reto (eu, tu, ele, etc.). Se o sujeito se refere a um objeto da segmento extraído da estrutura interna das orações ou das
terceira pessoa, sua representação pode ser feita através de frases, sendo, por isso, fruto de uma análise sintática. Nesse
um substantivo, de um pronome substantivo ou de qualquer sentido, o predicado é sintaticamente o segmento linguístico
conjunto de palavras, cujo núcleo funcione, na sentença, como que estabelece concordância com outro termo essencial
um substantivo. da oração, o sujeito, sendo este o termo determinante
(ou subordinado) e o predicado o termo determinado (ou
Além dessas formas, o sujeito também pode se constituir principal). Não se trata, portanto, de definir o predicado como
de uma oração inteira. Nesse caso, a oração recebe o nome de “aquilo que se diz do sujeito” como fazem certas gramáticas
oração substantiva subjetiva: da língua portuguesa, mas sim estabelecer a importância do
É difícil optar por esse ou aquele doce... fenômeno da concordância entre esses dois termos essenciais
É difícil: oração principal da oração. Então têm por características básicas: apresentar-se
optar por esse ou aquele doce: oração substantiva subjetiva como elemento determinado em relação ao sujeito; apontar um
atributo ou acrescentar nova informação ao sujeito. Exemplos:
O sujeito é constituído por um substantivo ou pronome, ou
por uma palavra ou expressão substantivada. Exemplos: Carolina conhece os índios da Amazônia.
O sino era grande. sujeito: Carolina = termo determinante
Ela tem uma educação fina. predicado: conhece os índios da Amazônia = termo
determinado
O núcleo (isto é, a palavra base) do sujeito é, pois, um
substantivo ou pronome. Em torno do núcleo podem aparecer Todos nós fazemos parte da quadrilha de São João.
palavras secundárias (artigos, adjetivos, locuções adjetivas, sujeito: todos nós = termo determinante
etc.) Exemplo: predicado: fazemos parte da quadrilha de São João = termo
“Todos os ligeiros rumores da mata tinham uma voz para determinado
a selvagem filha do sertão.” (José de Alencar)

51
LÍNGUA PORTUGUESA
Nesses exemplos podemos observar que a concordância é João puxou a rede.
estabelecida entre algumas poucas palavras dos dois termos “Não invejo os ricos, nem aspiro à riqueza.” (Oto Lara
essenciais. No primeiro exemplo, entre “Carolina” e “conhece”; Resende)
no segundo exemplo, entre “nós” e “fazemos”. Isso se dá porque
a concordância é centrada nas palavras que são núcleos, isto Observe que, sem os seus complementos, os verbos puxou,
é, que são responsáveis pela principal informação naquele invejo, aspiro, etc., não transmitiriam informações completas:
segmento. No predicado o núcleo pode ser de dois tipos: um puxou o quê? Não invejo a quem? Não aspiro a quê?
nome, quase sempre um atributo que se refere ao sujeito da Os verbos de predicação completa denominam-se
oração, ou um verbo (ou locução verbal). No primeiro caso, intransitivos e os de predicação incompleta, transitivos.
temos um predicado nominal (seu núcleo significativo é um Os verbos transitivos subdividem-se em: transitivos diretos,
nome, substantivo, adjetivo, pronome, ligado ao sujeito por um transitivos indiretos e transitivos diretos e indiretos
verbo de ligação) e, no segundo, um predicado verbal (seu (bitransitivos).
núcleo é um verbo, seguido, ou não, de complemento(s) ou Além dos verbos transitivos e intransitivos, quem encerram
termos acessórios). Quando, num mesmo segmento o nome e o uma noção definida, um conteúdo significativo, existem os
verbo são de igual importância, ambos constituem o núcleo do verbos de ligação que entram na formação do predicado
predicado e resultam no tipo de predicado verbo-nominal nominal, relacionando o predicativo com o sujeito.
(tem dois núcleos significativos: um verbo e um nome). Quanto à predicação classificam-se, pois os verbos em:
Exemplos:
Minha empregada é desastrada. Intransitivos: são os que não precisam de complemento,
predicado: é desastrada pois têm sentido completo.
núcleo do predicado: desastrada = atributo do sujeito “Três contos bastavam, insistiu ele.” (Machado de Assis)
tipo de predicado: nominal “Os guerreiros Tabajaras dormem.” (José de Alencar)

O núcleo do predicado nominal chama-se predicativo Observações: Os verbos intransitivos podem vir
do sujeito, porque atribui ao sujeito uma qualidade ou acompanhados de um adjunto adverbial e mesmo de um
característica. Os verbos de ligação (ser, estar, parecer, etc.) predicativo (qualidade, características): Fui cedo; Passeamos
funcionam como um elo entre o sujeito e o predicado. pela cidade; Cheguei atrasado; Entrei em casa
aborrecido. As orações formadas com verbos intransitivos
A empreiteira demoliu nosso antigo prédio. não podem “transitar” (= passar) para a voz passiva. Verbos
predicado: demoliu nosso antigo prédio intransitivos passam, ocasionalmente, a transitivos quando
núcleo do predicado: demoliu = nova informação sobre o construídos com o objeto direto ou indireto.
sujeito - “Inutilmente a minha alma o chora!” (Cabral do
tipo de predicado: verbal Nascimento)
- “Depois me deitei e dormi um sono pesado.” (Luís
Nos predicados verbais e verbo-nominais o verbo é Jardim)
responsável também por definir os tipos de elementos que - “Morrerás morte vil da mão de um forte.” (Gonçalves
aparecerão no segmento. Em alguns casos o verbo sozinho Dias)
basta para compor o predicado (verbo intransitivo). Em outros - “Inútil tentativa de viajar o passado, penetrar no
casos é necessário um complemento que, juntamente com mundo que já morreu...” (Ciro dos Anjos)
o verbo, constituem a nova informação sobre o sujeito. De
qualquer forma, esses complementos do verbo não interferem Alguns verbos essencialmente intransitivos: anoitecer,
na tipologia do predicado. crescer, brilhar, ir, agir, sair, nascer, latir, rir, tremer, brincar,
Entretanto, é muito comum a elipse (ou omissão) do verbo, chegar, vir, mentir, suar, adoecer, etc.
quando este puder ser facilmente subentendido, em geral por
estar expresso ou implícito na oração anterior. Exemplos: Transitivos Diretos: são os que pedem um objeto direto,
isto é, um complemento sem preposição. Pertencem a esse
“A fraqueza de Pilatos é enorme, a ferocidade dos algozes grupo: julgar, chamar, nomear, eleger, proclamar, designar,
inexcedível.” (Machado de Assis) (Está subentendido o verbo é considerar, declarar, adotar, ter, fazer, etc. Exemplos:
depois de algozes) Comprei um terreno e construí a casa.
“Mas o sal está no Norte, o peixe, no Sul” (Paulo Moreira da “Trabalho honesto produz riqueza honrada.” (Marquês de
Silva) (Subentende-se o verbo está depois de peixe) Maricá)
“Então, solenemente Maria acendia a lâmpada de sábado.”
Chama-se predicação verbal o modo pelo qual o verbo (Guedes de Amorim)
forma o predicado.
Há verbos que, por natureza, tem sentido completo, Dentre os verbos transitivos diretos merecem destaque os
podendo, por si mesmos, constituir o predicado: os verbos que formam o predicado verbo nominal e se constrói com o
de predicação completa são denominados intransitivos. complemento acompanhado de predicativo. Exemplos:
Exemplo: Consideramos o caso extraordinário.
Inês trazia as mãos sempre limpas.
As flores murcharam.
Os animais correm. Observações: Os verbos transitivos diretos, em geral,
podem ser usados também na voz passiva; Outra característica
Outros verbos, pelo contrário, para integrarem o predicado desses verbos é a de poderem receber como objeto direto, os
necessitam de outros termos: são os verbos de predicação pronomes o, a, os, as: convido-o, encontro-os, incomodo-a,
incompleta, denominados transitivos. Exemplos: conheço-as; Os verbos transitivos diretos podem ser construídos
acidentalmente com preposição, a qual lhes acrescenta novo

52
LÍNGUA PORTUGUESA
matiz semântico: arrancar da espada; puxar da faca; pegar de fixa, imutável. Conforme a regência e o sentido que apresentam
uma ferramenta; tomar do lápis; cumprir com o dever; Alguns na frase, podem pertencer ora a um grupo, ora a outro.
verbos transitivos diretos: abençoar, achar, colher, avisar,
abraçar, comprar, castigar, contrariar, convidar, desculpar, Predicativo: Há o predicativo do sujeito e o predicativo
dizer, estimar, elogiar, entristecer, encontrar, ferir, imitar, levar, do objeto.
perseguir, prejudicar, receber, saldar, socorrer, ter, unir, ver, etc.
Predicativo do Sujeito: é o termo que exprime um
Transitivos Indiretos: são os que reclamam um atributo, um estado ou modo de ser do sujeito, ao qual se prende
complemento regido de preposição, chamado objeto indireto. por um verbo de ligação, no predicado nominal. Exemplos:
Exemplos: A bandeira é o símbolo da Pátria.
“Ninguém perdoa ao quarentão que se apaixona por uma A mesa era de mármore.
adolescente.” (Ciro dos Anjos)
“Populares assistiam à cena aparentemente apáticos e Além desse tipo de predicativo, outro existe que entra na
neutros.” (Érico Veríssimo) constituição do predicado verbo-nominal. Exemplos:
“Lúcio não atinava com essa mudança instantânea.” (José O trem chegou atrasado. (=O trem chegou e estava
Américo) atrasado.)
“Do que eu mais gostava era do tempo do retiro espiritual.” O menino abriu a porta ansioso.
(José Geraldo Vieira)
Observações: O predicativo subjetivo às vezes está
Observações: Entre os verbos transitivos indiretos importa preposicionado; Pode o predicativo preceder o sujeito e até
distinguir os que se constroem com os pronomes objetivos mesmo ao verbo: São horríveis essas coisas!; Que linda
lhe, lhes. Em geral são verbos que exigem a preposição a: estava Amélia!; Completamente feliz ninguém é.; Raros são
agradar-lhe, agradeço-lhe, apraz-lhe, bate-lhe, desagrada-lhe, os verdadeiros líderes.; Quem são esses homens?; Lentos
desobedecem-lhe, etc. Entre os verbos transitivos indiretos e tristes, os retirantes iam passando.; Novo ainda, eu não
importa distinguir os que não admitem para objeto indireto entendia certas coisas.; Onde está a criança que fui?
as formas oblíquas lhe, lhes, construindo-se com os pronomes
retos precedidos de preposição: aludir a ele, anuir a ele, assistir Predicativo do Objeto: é o termo que se refere ao objeto
a ela, atentar nele, depender dele, investir contra ele, não ligar de um verbo transitivo. Exemplos:
para ele, etc. O juiz declarou o réu inocente.
Em princípio, verbos transitivos indiretos não comportam a O povo elegeu-o deputado.
forma passiva. Excetuam-se pagar, perdoar, obedecer, e pouco
mais, usados também como transitivos diretos: João paga Observações: O predicativo objetivo, como vemos dos
(perdoa, obedece) o médico. O médico é pago (perdoado, exemplos acima, às vezes vem regido de preposição. Esta, em
obedecido) por João. Há verbos transitivos indiretos, como certos casos, é facultativa; O predicativo objetivo geralmente
atirar, investir, contentar-se, etc., que admitem mais de uma se refere ao objeto direto. Excepcionalmente, pode referir-se
preposição, sem mudança de sentido. Outros mudam de sentido ao objeto indireto do verbo chamar. Chamavam-lhe poeta;
com a troca da preposição, como nestes exemplos: Trate de Podemos antepor o predicativo a seu objeto: O advogado
sua vida. (tratar=cuidar). É desagradável tratar com gente considerava indiscutíveis os direitos da herdeira.; Julgo
grosseira. (tratar=lidar). Verbos como aspirar, assistir, dispor, inoportuna essa viagem.; “E até embriagado o vi muitas
servir, etc., variam de significação conforme sejam usados como vezes.”; “Tinha estendida a seus pés uma planta rústica da
transitivos diretos ou indiretos. cidade.”; “Sentia ainda muito abertos os ferimentos que
aquele choque com o mundo me causara.”
Transitivos Diretos e Indiretos: são os que se usam com
dois objetos: um direto, outro indireto, concomitantemente. Termos Integrantes da Oração
Exemplos:
No inverso, Dona Cléia dava roupas aos pobres. Chamam-se termos integrantes da oração os que completam
Ceda o lugar aos mais velhos. a significação transitiva dos verbos e nomes. Integram (inteiram,
completam) o sentido da oração, sendo por isso indispensável à
De Ligação: Os que ligam ao sujeito uma palavra ou compreensão do enunciado. São os seguintes:
expressão chamada predicativo. Esses verbos entram na - Complemento Verbais (Objeto Direto e Objeto
formação do predicado nominal. Exemplos: Indireto);
A Terra é móvel. - Complemento Nominal;
A água está fria. - Agente da Passiva.
A Lua parecia um disco.
Objeto Direto: é o complemento dos verbos de predicação
Observações: Os verbos de ligação não servem apenas de incompleta, não regido, normalmente, de preposição. Exemplos:
anexo, mas exprimem ainda os diversos aspectos sob os quais As plantas purificaram o ar.
se considera a qualidade atribuída ao sujeito. O verbo ser, por “Nunca mais ele arpoara um peixe-boi.” (Ferreira Castro)
exemplo, traduz aspecto permanente e o verbo estar, aspecto Procurei o livro, mas não o encontrei.
transitório: Ele é doente. (aspecto permanente); Ele está O objeto direto tem as seguintes características:
doente. (aspecto transitório). Muito desses verbos passam à - Completa a significação dos verbos transitivos diretos;
categoria dos intransitivos em frases como: Era (=existia) uma - Normalmente, não vem regido de preposição;
vez uma princesa.; Eu não estava em casa.; Fiquei à sombra.; - Traduz o ser sobre o qual recai a ação expressa por um
Anda com dificuldades.; Parece que vai chover. verbo ativo: Caim matou Abel.
- Torna-se sujeito da oração na voz passiva: Abel foi morto
Os verbos, relativamente à predicação, não têm classificação por Caim.

53
LÍNGUA PORTUGUESA
O objeto direto pode ser constituído: a outros?; Aumente a sua felicidade, tornando felizes também
- Por um substantivo ou expressão substantivada: O lavrador aos outros.; A quantos a vida ilude!.
cultiva a terra.; Unimos o útil ao agradável. - Em certas construções enfáticas, como puxar (ou arrancar)
- Pelos pronomes oblíquos o, a, os, as, me, te, se, nos, vos: da espada, pegar da pena, cumprir com o dever, atirar com
Espero-o na estação.; Estimo-os muito.; Sílvia olhou-se ao os livros sobre a mesa, etc.: “Arrancam das espadas de aço
espelho.; Não me convidas?; Ela nos chama.; Avisamo-lo a fino...”; “Chegou a costureira, pegou do pano, pegou da
tempo.; Procuram-na em toda parte.; Meu Deus, eu vos amo.; agulha, pegou da linha, enfiou a linha na agulha e entrou a
“Marchei resolutamente para a maluca e intimei-a a ficar coser.”; “Imagina-se a consternação de Itaguaí, quando soube
quieta.”; “Vós haveis de crescer, perder-vos-ei de vista.” do caso.”
- Por qualquer pronome substantivo: Não vi ninguém
na loja.; A árvore que plantei floresceu. (que: objeto direto Observações: Nos quatro primeiros casos estudados a
de plantei); Onde foi que você achou isso? Quando vira as preposição é de rigor, nos cinco outros, facultativa. A substituição
folhas do livro, ela o faz com cuidado.; “Que teria o homem do objeto direto preposicionado pelo pronome oblíquo átono,
percebido nos meus escritos?” quando possível, se faz com as formas o(s), a(s) e não lhe,
lhes: amar a Deus (amá-lo); convencer ao amigo (convencê-
Frequentemente transitivam-se verbos intransitivos, dando- lo); O objeto direto preposicionado, é obvio, só ocorre com
se-lhes por objeto direto uma palavra cognata ou da mesma verbo transitivo direto; Podem resumir-se em três as razões
esfera semântica: ou finalidades do emprego do objeto direto preposicionado: a
“Viveu José Joaquim Alves vida tranquila e patriarcal.” clareza da frase; a harmonia da frase; a ênfase ou a força da
(Vivaldo Coaraci) expressão.
“Pela primeira vez chorou o choro da tristeza.” (Aníbal
Machado) Objeto Direto Pleonástico: Quando queremos dar
“Nenhum de nós pelejou a batalha de Salamina.” destaque ou ênfase à idéia contida no objeto direto, colocamo-
(Machado de Assis) lo no início da frase e depois o repetimos ou reforçamos por
Em tais construções é de rigor que o objeto venha meio do pronome oblíquo. A esse objeto repetido sob forma
acompanhado de um adjunto. pronominal chama-se pleonástico, enfático ou redundante.
Exemplos:
Objeto Direto Preposicionado: Há casos em que o O dinheiro, Jaime o trazia escondido nas mangas da
objeto direto, isto é, o complemento de verbos transitivos camisa.
diretos, vem precedido de preposição, geralmente a preposição O bem, muitos o louvam, mas poucos o seguem.
a. Isto ocorre principalmente: “Seus cavalos, ela os montava em pêlo.” (Jorge Amado)
- Quando o objeto direto é um pronome pessoal tônico:
Deste modo, prejudicas a ti e a ela.; “Mas dona Carolina Objeto Indireto: É o complemento verbal regido de
amava mais a ele do que aos outros filhos.”; “Pareceu-me que preposição necessária e sem valor circunstancial. Representa,
Roberto hostilizava antes a mim do que à ideia.”; “Ricardina ordinariamente, o ser a que se destina ou se refere à ação verbal:
lastimava o seu amigo como a si própria.”; “Amava-a tanto “Nunca desobedeci a meu pai”. O objeto indireto completa a
como a nós”. significação dos verbos:
- Quando o objeto é o pronome relativo quem: “Pedro
Severiano tinha um filho a quem idolatrava.”; “Abraçou - Transitivos Indiretos: Assisti ao jogo; Assistimos à
a todos; deu um beijo em Adelaide, a quem felicitou pelo missa e à festa; Aludiu ao fato; Aspiro a uma vida calma.
desenvolvimento das suas graças.”; “Agora sabia que podia
manobrar com ele, com aquele homem a quem na realidade - Transitivos Diretos e Indiretos (na voz ativa
também temia, como todos ali”. ou passiva): Dou graças a Deus; Ceda o lugar aos mais
- Quando precisamos assegurar a clareza da frase, evitando velhos; Dedicou sua vida aos doentes e aos pobres; Disse-
que o objeto direto seja tomado como sujeito, impedindo lhe a verdade. (Disse a verdade ao moço.)
construções ambíguas: Convence, enfim, ao pai o filho amado.;
“Vence o mal ao remédio.”; “Tratava-me sem cerimônia, como O objeto indireto pode ainda acompanhar verbos de outras
a um irmão.”; A qual delas iria homenagear o cavaleiro? categorias, os quais, no caso, são considerados acidentalmente
- Em expressões de reciprocidade, para garantir a clareza e a transitivos indiretos: A bom entendedor meia palavra basta;
eufonia da frase: “Os tigres despedaçam-se uns aos outros.”; Sobram-lhe qualidades e recursos. (lhe=a ele); Isto não lhe
“As companheiras convidavam-se umas às outras.”; “Era o convém; A proposta pareceu-lhe aceitável.
abraço de duas criaturas que só tinham uma à outra”.
- Com nomes próprios ou comuns, referentes a pessoas, Observações: Há verbos que podem construir-se com dois
principalmente na expressão dos sentimentos ou por amor da objetos indiretos, regidos de preposições diferentes: Rogue a
eufonia da frase: Judas traiu a Cristo.; Amemos a Deus sobre Deus por nós.; Ela queixou-se de mim a seu pai.; Pedirei
todas as coisas. “Provavelmente, enganavam é a Pedro.”; “O para ti a meu senhor um rico presente; Não confundir o
estrangeiro foi quem ofendeu a Tupã”. objeto direto com o complemento nominal nem com o adjunto
- Em construções enfáticas, nas quais antecipamos o objeto adverbial; Em frases como “Para mim tudo eram alegrias”,
direto para dar-lhe realce: A você é que não enganam!; Ao “Para ele nada é impossível”, os pronomes em destaque podem
médico, confessor e letrado nunca enganes.; “A este ser considerados adjuntos adverbiais.
confrade conheço desde os seus mais tenros anos”.
- Sendo objeto direto o numeral ambos(as): “O aguaceiro O objeto indireto é sempre regido de preposição, expressa
caiu, molhou a ambos.”; “Se eu previsse que os matava a ou implícita. A preposição está implícita nos pronomes objetivos
ambos...”. indiretos (átonos) me, te, se, lhe, nos, vos, lhes. Exemplos:
- Com certos pronomes indefinidos, sobretudo referentes a Obedece-me. (=Obedece a mim.); Isto te pertence. (=Isto
pessoas: Se todos são teus irmãos, por que amas a uns e odeias pertence a ti.); Rogo-lhe que fique. (=Rogo a você...); Peço-

54
LÍNGUA PORTUGUESA
vos isto. (=Peço isto a vós.). Nos demais casos a preposição assobiavam-se as canções dele pelos pedestres. (errado);
é expressa, como característica do objeto indireto: Recorro a Nas ruas eram assobiadas as canções dele pelos pedestres.
Deus.; Dê isto a (ou para) ele.; Contenta-se com pouco.; Ele (certo); Assobiavam-se as canções dele nas ruas. (certo)
só pensa em si.; Esperei por ti.; Falou contra nós.; Conto
com você.; Não preciso disto.; O filme a que assisti agradou Termos Acessórios da Oração
ao público.; Assisti ao desenrolar da luta.; A coisa de
que mais gosto é pescar.; A pessoa a quem me refiro você a Termos acessórios são os que desempenham na oração
conhece.; Os obstáculos contra os quais luto são muitos.; As uma função secundária, qual seja a de caracterizar um ser,
pessoas com quem conto são poucas. determinar os substantivos, exprimir alguma circunstância.
São três os termos acessórios da oração: adjunto adnominal,
Como atestam os exemplos acima, o objeto indireto é adjunto adverbial e aposto.
representado pelos substantivos (ou expressões substantivas)
ou pelos pronomes. As preposições que o ligam ao verbo são: a, Adjunto adnominal: É o termo que caracteriza ou
com, contra, de, em, para e por. determina os substantivos. Exemplo: Meu irmão veste roupas
vistosas. (Meu determina o substantivo irmão: é um adjunto
Objeto Indireto Pleonástico: à semelhança do objeto adnominal – vistosas caracteriza o substantivo roupas: é
direto, o objeto indireto pode vir repetido ou reforçado, por também adjunto adnominal).
ênfase. Exemplos: “A mim o que me deu foi pena.”; “Que me O adjunto adnominal pode ser expresso: Pelos adjetivos:
importa a mim o destino de uma mulher tísica...? “E, aos água fresca, terras férteis, animal feroz; Pelos artigos: o
brigões, incapazes de se moverem, basta-lhes xingarem-se à mundo, as ruas, um rapaz; Pelos pronomes adjetivos: nosso
distância.” tio, este lugar, pouco sal, muitas rãs, país cuja história
conheço, que rua?; Pelos numerais: dois pés, quinto ano,
Complemento Nominal: é o termo complementar capítulo sexto; Pelas locuções ou expressões adjetivas que
reclamado pela significação transitiva, incompleta, de certos exprimem qualidade, posse, origem, fim ou outra especificação:
substantivos, adjetivos e advérbios. Vem sempre regido de - presente de rei (=régio): qualidade
preposição. Exemplos: A defesa da pátria; Assistência às - água da fonte, filho de fazendeiros: origem
aulas; “O ódio ao mal é amor do bem, e a ira contra o mal, - fio de aço, casa de madeira: matéria
entusiasmo divino.”; “Ah, não fosse ele surdo à minha voz!” - casa de ensino, aulas de inglês: fim, especialidade
- criança com febre (=febril): característica
Observações: O complemento nominal representa o
recebedor, o paciente, o alvo da declaração expressa por um Observações: Não confundir o adjunto adnominal formado
nome: amor a Deus, a condenação da violência, o medo de por locução adjetiva com complemento nominal. Este
assaltos, a remessa de cartas, útil ao homem, compositor representa o alvo da ação expressa por um nome transitivo:
de músicas, etc. É regido pelas mesmas preposições usadas a eleição do presidente, aviso de perigo, declaração de
no objeto indireto. Difere deste apenas porque, em vez de guerra, empréstimo de dinheiro, plantio de árvores,
complementar verbos, complementa nomes (substantivos, colheita de trigo, destruidor de matas, descoberta de
adjetivos) e alguns advérbios em –mente. Os nomes que petróleo, amor ao próximo, etc. O adjunto adnominal
requerem complemento nominal correspondem, geralmente, a formado por locução adjetiva representa o agente da ação, ou
verbos de mesmo radical: amor ao próximo, amar o próximo; a origem, pertença, qualidade de alguém ou de alguma coisa:
perdão das injúrias, perdoar as injúrias; obediente aos o discurso do presidente, aviso de amigo, declaração do
pais, obedecer aos pais; regresso à pátria, regressar à ministro, empréstimo do banco, a casa do fazendeiro,
pátria; etc. folhas de árvores, farinha de trigo, beleza das matas,
cheiro de petróleo, amor de mãe.
Agente da Passiva: é o complemento de um verbo na voz
passiva. Representa o ser que pratica a ação expressa pelo verbo Adjunto adverbial: É o termo que exprime uma
passivo. Vem regido comumente pela preposição por, e menos circunstância (de tempo, lugar, modo, etc.) ou, em outras
frequentemente pela preposição de: Alfredo é estimado pelos palavras, que modifica o sentido de um verbo, adjetivo ou
colegas; A cidade estava cercada pelo exército romano; advérbio. Exemplo: “Meninas numa tarde brincavam de
“Era conhecida de todo mundo a fama de suas riquezas.” roda na praça”. O adjunto adverbial é expresso: Pelos
advérbios: Cheguei cedo.; Ande devagar.; Maria é mais
O agente da passiva pode ser expresso pelos substantivos alta.; Não durma ao volante.; Moramos aqui.; Ele fala bem,
ou pelos pronomes: fala corretamente.; Volte bem depressa.; Talvez esteja
As flores são umedecidas pelo orvalho. enganado.; Pelas locuções ou expressões adverbiais: Às vezes
A carta foi cuidadosamente corrigida por mim. viajava de trem.; Compreendo sem esforço.; Saí com
meu pai.; Júlio reside em Niterói.; Errei por distração.;
O agente da passiva corresponde ao sujeito da oração na Escureceu de repente.
voz ativa:
A rainha era chamada pela multidão. (voz passiva) Observações: Pode ocorrer a elipse da preposição antes
A multidão aclamava a rainha. (voz ativa) de adjuntos adverbiais de tempo e modo: Aquela noite,
não dormi. (=Naquela noite...); Domingo que vem não
Observações: Frase de forma passiva analítica sem sairei. (=No domingo...); Ouvidos atentos, aproximei-me
complemento agente expresso, ao passar para a ativa, terá da porta. (=De ouvidos atentos...); Os adjuntos adverbiais
sujeito indeterminado e o verbo na 3ª pessoa do plural: Ele classificam-se de acordo com as circunstâncias que exprimem:
foi expulso da cidade. (Expulsaram-no da cidade.); adjunto adverbial de lugar, modo, tempo, intensidade, causa,
As florestas são devastadas. (Devastam as florestas.); companhia, meio, assunto, negação, etc; É importante saber
Na passiva pronominal não se declara o agente: Nas ruas distinguir adjunto adverbial de adjunto adnominal, de objeto

55
LÍNGUA PORTUGUESA
indireto e de complemento nominal: sair do mar (ad.adv.); Observação: Profere-se o vocativo com entoação
água do mar (adj.adn.); gosta do mar (obj.indir.); ter medo exclamativa. Na escrita é separado por vírgula(s). No exemplo
do mar (compl.nom.). inicial, os pontos interrogativo e exclamativo indicam um
chamado alto e prolongado. O vocativo se refere sempre à
Aposto: É uma palavra ou expressão que explica ou 2ª pessoa do discurso, que pode ser uma pessoa, um animal,
esclarece, desenvolve ou resume outro termo da oração. uma coisa real ou entidade abstrata personificada. Podemos
Exemplos: antepor-lhe uma interjeição de apelo (ó, olá, eh!):
D. Pedro II, imperador do Brasil, foi um monarca sábio. O vocativo é um tempo à parte. Não pertence à estrutura
“Nicanor, ascensorista, expôs-me seu caso de consciência.” da oração, por isso não se anexa ao sujeito nem ao predicado.
(Carlos Drummond de Andrade)
Questões
O núcleo do aposto é um substantivo ou um pronome
substantivo: 01. O termo em destaque é adjunto adverbial de intensidade
Foram os dois, ele e ela. em:
Só não tenho um retrato: o de minha irmã. (A) pode aprender e assimilar MUITA coisa
(B) enfrentamos MUITAS novidades
O aposto não pode ser formado por adjetivos. Nas frases (C) precisa de um parceiro com MUITO caráter
seguintes, por exemplo, não há aposto, mas predicativo do (D) não gostam de mulheres MUITO inteligentes
sujeito: (E) assumimos MUITO conflito e confusão
Audaciosos, os dois surfistas atiraram-se às ondas.
As borboletas, leves e graciosas, esvoaçavam num balé 02. Assinale a alternativa correta: “para todos os males, há
de cores. dois remédios: o tempo e o silêncio”, os termos grifados
são respectivamente:
Os apostos, em geral, destacam-se por pausas, indicadas, na (A) sujeito – objeto direto;
escrita, por vírgulas, dois pontos ou travessões. Não havendo (B) sujeito – aposto;
pausa, não haverá vírgula, como nestes exemplos: (C) objeto direto – aposto;
Minha irmã Beatriz; o escritor João Ribeiro; o romance (D) objeto direto – objeto direto;
Tóia; o rio Amazonas; a Rua Osvaldo Cruz; o Colégio (E) objeto direto – complemento nominal.
Tiradentes, etc.
“Onde estariam os descendentes de Amaro vaqueiro?” 03. Assinale a alternativa em que o termo destacado é
(Graciliano Ramos) objeto indireto.
O aposto pode preceder o termo a que se refere, o qual, às (A) “Quem faz um poema abre uma janela.” (Mário
vezes, está elíptico. Exemplos: Quintana)
Rapaz impulsivo, Mário não se conteve. (B) “Toda gente que eu conheço e que fala comigo /
Mensageira da idéia, a palavra é a mais bela expressão Nunca teve um ato ridículo / Nunca sofreu enxovalho (...)”
da alma humana. (Fernando Pessoa)
(C) “Quando Ismália enlouqueceu / Pôs-se na torre a sonhar
O aposto, às vezes, refere-se a toda uma oração. Exemplos: / Viu uma lua no céu, / Viu uma lua no mar.” (Alphonsus de
Nuvens escuras borravam os espaços silenciosos, sinal de Guimarães)
tempestade iminente. (D) “Mas, quando responderam a Nhô Augusto: ‘– É a
O espaço é incomensurável, fato que me deixa atônito. jagunçada de seu Joãozinho Bem-Bem, que está descendo para
Simão era muito espirituoso, o que me levava a preferir sua a Bahia.’ – ele, de alegre, não se pôde conter.” (Guimarães Rosa)
companhia.
04. “Recebeu o prêmio o jogador que fez o gol”. Nessa frase
Um aposto pode referir-se a outro aposto: o sujeito de “fez”?
“Serafim Gonçalves casou-se com Lígia Tavares, filha do (A) o prêmio;
velho coronel Tavares, senhor de engenho.” (Ledo Ivo) (B) o jogador;
(C) que;
O aposto pode vir precedido das expressões explicativas isto (D) o gol;
é, a saber, ou da preposição acidental como: (E) recebeu.
Dois países sul-americanos, isto é, a Bolívia e o
Paraguai, não são banhados pelo mar. 05. Numa noite em que voltei para casa muito bêbado de
uma de minhas andanças pela cidade, achei que o gato evitava
O aposto que se refere a objeto indireto, complemento minha presença.
nominal ou adjunto adverbial vem precedido de preposição:
O rei perdoou aos dois: ao fidalgo e ao criado. POE, Edgar Allan. Histórias extraordinárias. São Paulo: Larousse
Jovem, 2005.
Vocativo: (do latim vocare = chamar) é o termo (nome,
título, apelido) usado para chamar ou interpelar a pessoa, o A oração “que o gato evitava minha presença”,
animal ou a coisa personificada a que nos dirigimos: sintaticamente, é
“Elesbão? Ó Elesbão! Venha ajudar-nos, por favor!” (Maria (A) o sujeito do verbo “achar”.
de Lourdes Teixeira) (B) um complemento verbal.
“A ordem, meus amigos, é a base do governo.” (Machado (C) um complemento nominal.
de Assis) (D) um predicativo.
“Correi, correi, ó lágrimas saudosas!” (fagundes Varela) (E) um aposto.
“Ei-lo, o teu defensor, ó Liberdade!” (Mendes Leal)

56
LÍNGUA PORTUGUESA
Respostas - Orações coordenadas sindéticas aditivas: e, nem,
01. D / 02. C / 03. D / 04. C / 05. B não só... mas também, não só... mas ainda.
Saí da escola / e fui à lanchonete.
Período: Toda frase com uma ou mais orações constitui OCA OCS Aditiva
um período, que se encerra com ponto de exclamação, ponto
de interrogação ou com reticências. Observe que a 2ª oração vem introduzida por uma conjunção
O período é simples quando só traz uma oração, chamada que expressa ideia de acréscimo ou adição com referência à
absoluta; o período é composto quando traz mais de uma oração anterior, ou seja, por uma conjunção coordenativa
oração. aditiva.
Existe uma maneira prática de saber quantas orações há
num período: é contar os verbos ou locuções verbais. Num A doença vem a cavalo e volta a pé.
período haverá tantas orações quantos forem os verbos ou as As pessoas não se mexiam nem falavam.
locuções verbais nele existentes. Exemplos: “Não só findaram as queixas contra o alienista, mas até
Pegou fogo no prédio. (um verbo, uma oração) nenhum ressentimento ficou dos atos que ele praticara.”
Quero que você aprenda. (dois verbos, duas orações) (Machado de Assis)
Está pegando fogo no prédio. (uma locução verbal, uma
oração) - Orações coordenadas sindéticas adversativas:
Deves estudar para poderes vencer na vida. (duas mas, porém, todavia, contudo, entretanto, no entanto.
locuções verbais, duas orações) Estudei bastante / mas não passei no teste.
OCA OCS Adversativa
Há três tipos de período composto: por coordenação, por
subordinação e por coordenação e subordinação ao mesmo Observe que a 2ª oração vem introduzida por uma conjunção
tempo (também chamada de misto). que expressa ideia de oposição à oração anterior, ou seja, por
uma conjunção coordenativa adversativa.
Período Composto por Coordenação – Orações
Coordenadas A espada vence, mas não convence.
“É dura a vida, mas aceitam-na.” (Cecília Meireles)
Considere, por exemplo, este período composto: Tens razão, contudo não te exaltes.
Passeamos pela praia, / brincamos, / recordamos os tempos Havia muito serviço, entretanto ninguém trabalhava.
de infância.
1ª oração: Passeamos pela praia - Orações coordenadas sindéticas conclusivas:
2ª oração: brincamos portanto, por isso, pois, logo.
3ª oração: recordamos os tempos de infância Ele me ajudou muito, / portanto merece minha gratidão.
OCA OCS Conclusiva
As três orações que compõem esse período têm sentido
próprio e não mantêm entre si nenhuma dependência sintática: Observe que a 2ª oração vem introduzida por uma conjunção
elas são independentes. Há entre elas, é claro, uma relação de que expressa ideia de conclusão de um fato enunciado na oração
sentido, mas, como já dissemos, uma não depende da outra anterior, ou seja, por uma conjunção coordenativa conclusiva.
sintaticamente.
As orações independentes de um período são chamadas Vives mentindo; logo, não mereces fé.
de orações coordenadas (OC), e o período formado só de Ele é teu pai: respeita-lhe, pois, a vontade.
orações coordenadas é chamado de período composto por Raimundo é homem são, portanto deve trabalhar.
coordenação.
As orações coordenadas são classificadas em assindéticas e - Orações coordenadas sindéticas alternativas:
sindéticas. ou,ou... ou, ora... ora, seja... seja, quer... quer.
Seja mais educado / ou retire-se da reunião!
- As orações coordenadas são assindéticas (OCA) quando OCA OCS Alternativa
não vêm introduzidas por conjunção. Exemplo:
Os torcedores gritaram, / sofreram, / vibraram. Observe que a 2ª oração vem introduzida por uma conjunção
OCA OCA OCA que estabelece uma relação de alternância ou escolha com
referência à oração anterior, ou seja, por uma conjunção
“Inclinei-me, apanhei o embrulho e segui.” (Machado de coordenativa alternativa.
Assis)
“A noite avança, há uma paz profunda na casa deserta.” Venha agora ou perderá a vez.
(Antônio Olavo Pereira) “Jacinta não vinha à sala, ou retirava-se logo.” (Machado
“O ferro mata apenas; o ouro infama, avilta, desonra.” de Assis)
(Coelho Neto) “Em aviação, tudo precisa ser bem feito ou custará preço
muito caro.” (Renato Inácio da Silva)
- As orações coordenadas são sindéticas (OCS) quando “A louca ora o acariciava, ora o rasgava
vêm introduzidas por conjunção coordenativa. Exemplo: freneticamente.” (Luís Jardim)
O homem saiu do carro / e entrou na casa.
OCA OCS - Orações coordenadas sindéticas explicativas: que,
porque, pois, porquanto.
As orações coordenadas sindéticas são classificadas de Vamos andar depressa / que estamos atrasados.
acordo com o sentido expresso pelas conjunções coordenativas OCA OCS Explicativa
que as introduzem. Pode ser:

57
LÍNGUA PORTUGUESA
Observe que a 2ª oração é introduzida por uma conjunção “Que diria o pai se soubesse disso?” (Carlos Drummond
que expressa ideia de explicação, de justificativa em relação de Andrade)
à oração anterior, ou seja, por uma conjunção coordenativa A cápsula do satélite será recuperada, caso a experiência
explicativa. tenha êxito.

Leve-lhe uma lembrança, que ela aniversaria amanhã. - Concessivas: Expressam ideia ou fato contrário ao da
“A mim ninguém engana, que não nasci ontem.” (Érico oração principal, sem, no entanto, impedir sua realização.
Veríssimo) Conjunções: embora, ainda que, apesar de, se bem que, por mais
“Qualquer que seja a tua infância, conquista-a, que te que, mesmo que.
abençoo.” (Fernando Sabino) Ela saiu à noite / embora estivesse doente.
O cavalo estava cansado, pois arfava muito. OP OSA Concessiva

Período Composto por Subordinação Admirava-o muito, embora (ou conquanto ou posto
que ou se bem que) não o conhecesse pessoalmente.
Observe os termos destacados em cada uma destas orações: Embora não possuísse informações seguras, ainda
Vi uma cena triste. (adjunto adnominal) assim arriscou uma opinião.
Todos querem sua participação. (objeto direto) Cumpriremos nosso dever, ainda que (ou mesmo
Não pude sair por causa da chuva. (adjunto adverbial quando ou ainda quando ou mesmo que) todos nos
de causa) critiquem.
Por mais que gritasse, não me ouviram.
Veja, agora, como podemos transformar esses termos em
orações com a mesma função sintática: - Conformativas: Expressam a conformidade de um fato
Vi uma cena / que me entristeceu. (oração subordinada com outro. Conjunções: conforme, como (=conforme), segundo.
com função de adjunto adnominal) O trabalho foi feito / conforme havíamos planejado.
Todos querem / que você participe. (oração subordinada OP OSA Conformativa
com função de objeto direto)
Não pude sair / porque estava chovendo. (oração O homem age conforme pensa.
subordinada com função de adjunto adverbial de causa) Relatei os fatos como (ou conforme) os ouvi.
Como diz o povo, tristezas não pagam dívidas.
Em todos esses períodos, a segunda oração exerce uma O jornal, como sabemos, é um grande veículo de
certa função sintática em relação à primeira, sendo, portanto, informação.
subordinada a ela. Quando um período é constituído de pelo
menos um conjunto de duas orações em que uma delas (a - Temporais: Acrescentam uma circunstância de tempo
subordinada) depende sintaticamente da outra (principal), ele ao que foi expresso na oração principal. Conjunções: quando,
é classificado como período composto por subordinação. As assim que, logo que, enquanto, sempre que, depois que, mal
orações subordinadas são classificadas de acordo com a função (=assim que).
que exercem: adverbiais, substantivas e adjetivas. Ele saiu da sala / assim que eu cheguei.
OP OSA Temporal
Orações Subordinadas Adverbiais
Formiga, quando quer se perder, cria asas.
As orações subordinadas adverbiais (OSA) são “Lá pelas sete da noite, quando escurecia, as casas se
aquelas que exercem a função de adjunto adverbial da oração esvaziam.” (Carlos Povina Cavalcânti)
principal (OP). São classificadas de acordo com a conjunção “Quando os tiranos caem, os povos se levantam.”
subordinativa que as introduz: (Marquês de Maricá)
Enquanto foi rico, todos o procuravam.
- Causais: Expressam a causa do fato enunciado na oração
principal. Conjunções: porque, que, como (= porque), pois que, - Finais: Expressam a finalidade ou o objetivo do que foi
visto que. enunciado na oração principal. Conjunções: para que, a fim de
Não fui à escola / porque fiquei doente. que, porque (=para que), que.
OP OSA Causal Abri a porta do salão / para que todos pudessem entrar.
OP OSA Final
O tambor soa porque é oco.
Como não me atendessem, repreendi-os severamente. “O futuro se nos oculta para que nós o imaginemos.”
Como ele estava armado, ninguém ousou reagir. (Marquês de Maricá)
“Faltou à reunião, visto que esteve doente.” (Arlindo Aproximei-me dele a fim de que me ouvisse melhor.
de Sousa) “Fiz-lhe sinal que se calasse.” (Machado de Assis) (que
= para que)
- Condicionais: Expressam hipóteses ou condição para a “Instara muito comigo não deixasse de frequentar as
ocorrência do que foi enunciado na principal. Conjunções: se, recepções da mulher.” (Machado de Assis) (não deixasse =
contanto que, a menos que, a não ser que, desde que. para que não deixasse)
Irei à sua casa / se não chover.
OP OSA Condicional - Consecutivas: Expressam a consequência do que foi
enunciado na oração principal. Conjunções: porque, que, como
Deus só nos perdoará se perdoarmos aos nossos (= porque), pois que, visto que.
ofensores. A chuva foi tão forte / que inundou a cidade.
Se o conhecesses, não o condenarias. OP OSA Consecutiva

58
LÍNGUA PORTUGUESA
Fazia tanto frio que meus dedos estavam endurecidos. Não me oponho a que você viaje. (= Não me oponho à
“A fumaça era tanta que eu mal podia abrir os olhos.” sua viagem.)
(José J. Veiga) Aconselha-o a que trabalhe mais.
De tal sorte a cidade crescera que não a reconhecia Daremos o prêmio a quem o merecer.
mais. Lembre-se de que a vida é breve.
As notícias de casa eram boas, de maneira que pude
prolongar minha viagem. - Oração Subordinada Substantiva Subjetiva:
É aquela que exerce a função de sujeito do verbo da oração
- Comparativas: Expressam ideia de comparação com principal. Observe: É importante sua colaboração. (sujeito)
referência à oração principal. Conjunções: como, assim como, É importante / que você colabore.
tal como, (tão)... como, tanto como, tal qual, que (combinado OP OSS Subjetiva
com menos ou mais).
Ela é bonita / como a mãe. A oração subjetiva geralmente vem:
OP OSA Comparativa - depois de um verbo de ligação + predicativo, em
construções do tipo é bom, é útil, é certo, é conveniente, etc.
A preguiça gasta a vida como a ferrugem consome o Ex.: É certo que ele voltará amanhã.
ferro.” (Marquês de Maricá) - depois de expressões na voz passiva, como sabe-se, conta-
Ela o atraía irresistivelmente, como o imã atrai o ferro. se, diz-se, etc. Ex.: Sabe-se que ele saiu da cidade.
Os retirantes deixaram a cidade tão pobres como vieram. - depois de verbos como convir, cumprir, constar, urgir,
Como a flor se abre ao Sol, assim minha alma se abriu ocorrer, quando empregados na 3ª pessoa do singular e
à luz daquele olhar. seguidos das conjunções que ou se. Ex.: Convém que todos
participem da reunião.
Obs.: As orações comparativas nem sempre apresentam
claramente o verbo, como no exemplo acima, em que está É necessário que você colabore. (= Sua colaboração é
subentendido o verbo ser (como a mãe é). necessária.)
Parece que a situação melhorou.
- Proporcionais: Expressam uma ideia que se relaciona Aconteceu que não o encontrei em casa.
proporcionalmente ao que foi enunciado na principal. Importa que saibas isso bem.
Conjunções: à medida que, à proporção que, ao passo que,
quanto mais, quanto menos. - Oração Subordinada Substantiva Completiva
Quanto mais reclamava / menos atenção recebia. Nominal: É aquela que exerce a função de complemento
OSA Proporcional OP nominal de um termo da oração principal. Observe: Estou
convencido de sua inocência. (complemento nominal)
À medida que se vive, mais se aprende. Estou convencido / de que ele é inocente.
À proporção que avançávamos, as casas iam rareando. OP OSS Completiva Nominal
O valor do salário, ao passo que os preços sobem, vai
diminuindo. Sou favorável a que o prendam. (= Sou favorável à
prisão dele.)
Orações Subordinadas Substantivas Estava ansioso por que voltasses.
Sê grato a quem te ensina.
As orações subordinadas substantivas (OSS) são “Fabiano tinha a certeza de que não se acabaria tão
aquelas que, num período, exercem funções sintáticas próprias cedo.” (Graciliano Ramos)
de substantivos, geralmente são introduzidas pelas conjunções
integrantes que e se. Elas podem ser: - Oração Subordinada Substantiva Predicativa:
É aquela que exerce a função de predicativo do sujeito da
- Oração Subordinada Substantiva Objetiva Direta: oração principal, vindo sempre depois do verbo ser. Observe: O
É aquela que exerce a função de objeto direto do verbo da importante é sua felicidade. (predicativo)
oração principal. Observe: O grupo quer a sua ajuda. (objeto O importante é / que você seja feliz.
direto) OP OSS Predicativa
O grupo quer / que você ajude.
OP OSS Objetiva Direta Seu receio era que chovesse. (Seu receio era a chuva.)
Minha esperança era que ele desistisse.
O mestre exigia que todos estivessem presentes. (= Meu maior desejo agora é que me deixem em paz.
O mestre exigia a presença de todos.) Não sou quem você pensa.
Mariana esperou que o marido voltasse.
Ninguém pode dizer: Desta água não beberei. - Oração Subordinada Substantiva Apositiva: É
O fiscal verificou se tudo estava em ordem. aquela que exerce a função de aposto de um termo da oração
principal. Observe: Ele tinha um sonho: a união de todos
- Oração Subordinada Substantiva Objetiva em benefício do país. (aposto)
Indireta: É aquela que exerce a função de objeto indireto do Ele tinha um sonho / que todos se unissem em benefício
verbo da oração principal. Observe: Necessito de sua ajuda. do país.
(objeto indireto) OP OSS Apositiva

Necessito / de que você me ajude. Só desejo uma coisa: que vivam felizes. (Só desejo uma
OP OSS Objetiva Indireta coisa: a sua felicidade)
Só lhe peço isto: honre o nosso nome.

59
LÍNGUA PORTUGUESA
“Talvez o que eu houvesse sentido fosse o presságio disto: - Orações reduzidas de gerúndio
de que virias a morrer...” (Osmã Lins) - Orações reduzidas de particípio
“Mas diga-me uma cousa, essa proposta traz algum
motivo oculto?” (Machado de Assis) Orações Reduzidas de Infinitivo:
Infinitivo: terminações –ar, -er, -ir.
As orações apositivas vêm geralmente antecedidas de dois-
pontos. Podem vir, também, entre vírgulas, intercaladas à oração Reduzida: É preciso comer frutas e legumes.
principal. Exemplo: Seu desejo, que o filho recuperasse a Desenvolvida: É preciso que se coma frutas e legumes.
saúde, tornou-se realidade. (Oração Subordinada Substantiva Subjetiva)

Orações Subordinadas Adjetivas Reduzida: Meu desejo era ganhar uma viagem.
Desenvolvida: Meu desejo era que eu ganhasse uma
As orações subordinadas Adjetivas (OSA) exercem viagem. (Oração Subordinada Substantiva Predicativa)
a função de adjunto adnominal de algum termo da oração
principal. Observe como podemos transformar um adjunto Orações Reduzidas de Particípio:
adnominal em oração subordinada adjetiva: Particípio: terminações –ado, -ido.
Desejamos uma paz duradoura. (adjunto adnominal)
Desejamos uma paz / que dure. (oração subordinada Reduzida: Temos apenas um filho, criado com muito amor.
adjetiva) Desenvolvida: Temos apenas um filho, que criamos com
muito amor. (Oração Subordinada Adjetiva Explicativa)
As orações subordinadas adjetivas são sempre introduzidas
por um pronome relativo (que , qual, cujo, quem, etc.) e podem Reduzida: A criança sequestrada foi resgatada.
ser classificadas em: Desenvolvida: A criança que sequestraram foi resgatada.
(Oração Subordinada Adjetiva Restritiva)
- Subordinadas Adjetivas Restritivas: São restritivas
quando restringem ou especificam o sentido da palavra a que Orações Reduzidas de Gerúndio:
se referem. Exemplo: Gerúndio: terminação –ndo.

O público aplaudiu o cantor / que ganhou o 1º lugar. Reduzida: Não enviando o relatório a tempo, perdeu a
OP OSA Restritiva bolsa de estudos.
Desenvolvida: Porque não enviou o relatório a tempo,
Nesse exemplo, a oração que ganhou o 1º lugar perdeu a bolsa de estudos. (Oração Subordinada Adverbial
especifica o sentido do substantivo cantor, indicando que Causal)
o público não aplaudiu qualquer cantor mas sim aquele que
ganhou o 1º lugar. Questões

Pedra que rola não cria limo. 01. Assinale a opção que apresenta explicação correta para
Os animais que se alimentam de carne chamam-se a inserção de “que é” antes do segmento grifado no texto.
carnívoros.
Rubem Braga é um dos cronistas que mais belas páginas A Secretaria de Aviação Civil da Presidência da República
escreveram. divulgou recentemente a pesquisa O Brasil que voa – Perfil dos
“Há saudades que a gente nunca esquece.” (Olegário Passageiros, Aeroportos e Rotas do Brasil, o mais completo
Mariano) levantamento sobre transporte aéreo de passageiros do País.
Mais de 150 mil passageiros, ouvidos durante 2014 nos 65
- Subordinadas Adjetivas Explicativas: São aeroportos responsáveis por 98% da movimentação aérea do
explicativas quando apenas acrescentam uma qualidade à País, revelaram um perfil inédito do setor.
palavra a que se referem, esclarecendo um pouco mais seu
sentido, mas sem restringi-lo ou especificá-lo. Exemplo: <http://www.anac.gov.br/Noticia.aspx?ttCD_
O escritor Jorge Amado, / que mora na Bahia, / lançou um CHAVE=1957&slCD_ ORIGEM=29>. Acesso em: 13/12/2015 (com
novo livro. adaptações).
OP OSA Explicativa OP
a) Prejudica a correção gramatical do período, pois provoca
Deus, que é nosso pai, nos salvará. truncamento sintático.
Valério, que nasceu rico, acabou na miséria. b) Transforma o aposto em oração subordinada adjetiva
Ele tem amor às plantas, que cultiva com carinho. explicativa.
Alguém, que passe por ali à noite, poderá ser assaltado. c) Altera a oração subordinada explicativa para oração
restritiva.
Orações Reduzidas d) Transforma o segmento grifado em oração principal do
período.
As orações reduzidas são caracterizadas por possuírem o e) Corrige erro de estrutura sintática inserido no período.
verbo nas formas de gerúndio, particípio ou infinitivo.
Ao contrário das demais orações subordinadas, as orações 02. É indiscutível que no mundo contemporâneo o
reduzidas não são ligadas através dos conectivos ambiente do futebol é dos mais intensos do ponto de vista
psicológico. Nos estádios a concentração é total. Vive-se ali
Há três tipos de orações reduzidas: situação de incessante dialética entre o metafórico e o literal,
- Orações reduzidas de infinitivo entre o lúdico e o real. O que varia conforme o indivíduo

60
LÍNGUA PORTUGUESA
considerado é a passagem de uma condição a outra. Passagem Do rio da minha aldeia.
rápida no caso do torcedor, cuja regressão psíquica do lúdico
dura algumas horas e funciona como escape para as pressões do O rio da minha aldeia não faz pensar em nada.
cotidiano. Passagem lenta no caso do futebolista profissional, Quem está ao pé dele está só ao pé dele.
que vive quinze ou vinte anos em ambiente de fantasia, que
geralmente torna difícil a inserção na realidade global quando (Alberto Caeiro)
termina a carreira. A solução para muitos é a reconversão em
técnico, que os mantém sob holofote. Lothar Matthäus, por E o Tejo entra no mar em Portugal
exemplo, recordista de partidas em Copas do Mundo, com a O elemento que exerce a mesma função sintática que o
seleção alemã, Ballon d’Or de 1990, tornou-se técnico porque sublinhado acima encontra-se em
“na verdade, para mim, o futebol é mais importante do que a (A) a fortuna. (4a estrofe)
família”. [...] (B) A memória das naus. (2a estrofe)
Sendo esporte coletivo, o futebol tem implicações e (C) grandes navios. (2a estrofe)
significações psicológicas coletivas, porém calcadas, pelo (D) menos gente. (3a estrofe)
menos em parte, nas individualidades que o compõem. O jogo (E) a América. (4a estrofe)
é coletivo, como a vida social, porém num e noutra a atuação
de um só indivíduo pode repercutir sobre o todo. Como em Respostas
qualquer sociedade, na do futebol vive-se o tempo inteiro em 01. B / 02. B / 03. B
equilíbrio precário entre o indivíduo e o grupo. O jogador busca
o sucesso pessoal, para o qual depende em grande parte dos
companheiros; há um sentimento de equipe, que depende das
qualidades pessoais de seus membros. O torcedor lúcido busca
o prazer do jogo preservando sua individualidade; todavia, a
própria condição de torcedor acaba por diluí-lo na massa. Regência nominal e verbal.
(JÚNIOR, Hilário Franco. A dança dos deuses: futebol, cultura,
sociedade. São Paulo: Companhia das letras, 2007, p. 303-304, com Regência Nominal e Verbal
adaptações)
Regência Nominal
*Ballon d’Or 1990 - prêmio de melhor jogador do ano
Assim como há verbos de sentido incompleto (transitivos),
O jogador busca o sucesso pessoal ... há também nomes de sentido incompletos. Substantivos,
adjetivos, e, certos advérbios, também podem, como no caso dos
A mesma relação sintática entre verbo e complemento, verbos, solicitarem um complemento (complemento nominal)
sublinhados acima, está em: para ampliar, ou mesmo, completar seu sentido: Tenho amor
(A) É indiscutível que no mundo contemporâneo... (nome de sentido incompleto) aos livros (compl. Nominal).
(B) ... o futebol tem implicações e significações psicológicas O substantivo amor rege um complemento nominal
coletivas ... precedido da preposição (a). Portanto, a relação particular,
(C) ... e funciona como escape para as pressões do cotidiano. entre o nome e seu complemento, vem sempre marcada por
(D) A solução para muitos é a reconversão em técnico ... uma preposição: Estava ansioso para ouvir música.
(E) ... que depende das qualidades pessoais de seus Contudo, cabe observar, que certos substantivos e adjetivos
membros. admitem mais de uma regência, ou seja, mais de uma
preposição. A escolha desta ou daquela preposição deve,
03. O Tejo é mais belo que o rio que corre pela minha aldeia, no entanto, obedecer às exigências da clareza, da eufonia e
Mas o Tejo não é mais belo que o rio que corre pela minha adequar-se as diferentes nuanças do pensamento.
aldeia Ao aprender a regência do verbo, você estará praticamente
Porque o Tejo não é o rio que corre pela minha aldeia. aprendendo a regência do nome cognato (que vem da mesma
raiz do verbo). É o caso, por exemplo, do verbo obedecer e
O Tejo tem grandes navios do nome obediência. O verbo obedecer exige a preposição (a),
E navega nele ainda, que é a mesma exigida pelo nome obediência. De maneira,
Para aqueles que veem em tudo o que lá não está, que a regência deste verbo e deste nome resume-se na mesma
A memória das naus. preposição (a).
Na regência nominal, não há tantos desencontros entre a
O Tejo desce de Espanha norma culta e a fala popular. Em todo caso, segue aqui uma lista
E o Tejo entra no mar em Portugal de alguns nomes acompanhados das respectivas preposições:
Toda a gente sabe isso.
Mas poucos sabem qual é o rio da minha aldeia Acesso (a) - acessível [a, para] - acostumado [a, com] -
E para onde ele vai adequado [a] - admiração [a, por] - afável [com, para com]
E donde ele vem - afeição [a, por] - aflito [com, por] - alheio [a, de] - aliado
E por isso, porque pertence a menos gente, [a, com] - alusão [a] – amante [de] – amigo [de] - amor [a,
É mais livre e maior o rio da minha aldeia. de, para com, por] – amoroso [com] - análogo [a] - ansioso
[de, para, por] - antipatia [a, contra, por] – aparentado [com]
Pelo Tejo vai-se para o Mundo - apologia [de] - apto [a, para] - assíduo [a, em] - atenção [a]
Para além do Tejo há a América - atento [a, em] - atencioso [com, para com] - aversão [a, para,
E a fortuna daqueles que a encontram por] - avesso [a] - ávido [de, por] - benéfico [a] - benefício [a]
Ninguém nunca pensou no que há para além – bom [para].

61
LÍNGUA PORTUGUESA
Equivalente [a] - empenho [de, em, por] – entendido [em] Regência Verbal
– erudito [em] – escasso [de] – essencial [para] – estreito [de]
- exato [em] - fácil [a, de, para] - facilidade [de, em, para] - O estudo da regência verbal nos ajuda a escrever melhor.
falho [de, em] - falta [a] - fanático [por] - favorável [a] - fiel Quanto à regência verbal, os verbos podem ser:
[a] - feliz [de, com, em, por] - fértil [de, em] – forte [em] - fraco - Verbos Transitivos: Exigem complemento (objetos) para
[em, de] – furioso [com] - grato [a] - graduado [a] - guerra que tenham sentido completo. Podem ser: Transitivos Diretos;
[a] - hábil [em] - habituado [a] - horror [a, de, por] - hostil Transitivos Indiretos; Transitivos Diretos e Indiretos.
[a, contra, para com] - ida [a] – idêntico [a] - impaciência - Verbos Intransitivos.
[com] – impossibilidade [de, em] - impotente [para, contra]
- impróprio [para] - imune [a, de] - inábil [para] - inacessível Transitivos Diretos: Não possuem sentido completo, logo
[a] – incansável [em] - incapaz [de, para] – incerto [em] - precisam de um complemento (objeto). Esses complementos
inconsequente [com] – indeciso [em] - indiferente [a] – indigno (sem preposição) são chamados de objetos diretos. Ex.: Maria
[de] - indulgente [com, para com] - inerente [a] – infiel [a] – comprou um livro.
influência [sobre] - ingrato [com] – insensível [a] - intolerante “Um livro” é o complemento exigido pelo verbo. Ele não
[com] - invasão [de] – inútil [para] - isento [de] - junto [a, de] está acompanhado de preposição. “Um livro” é o objeto direto.
- leal [a] - lento [em] – liberal [com]. Note que se disséssemos: “Maria comprou.” a frase estaria
Regência de Advérbios: Merecem menção estes três incompleta, pois quem compra, compra alguma coisa. O verbo
advérbios: longe [de], perto [de] e proximamente [a, de]. Todos comprar é transitivo direto.
os advérbios formados de adjetivos + sufixo [-mente], tendem
a apresentar a mesma preposição dos adjetivos: Compatível Transitivos Indiretos: Também não possuem sentido
[com]; compativelmente [com]. Relativo [a]; relativamente [a] completo, logo precisam de um complemento, só que desta
vez este complemento é acompanhado de uma preposição. São
Questões chamados de objetos indiretos. Ex. Gosto de filmes.
“De filmes” é o complemento exigido pelo verbo gostar, e ele
01. O projeto.....estão dando andamento é incompatível..... está acompanhado por uma preposição (de). Este complemento
tradições da firma. é chamado de objeto indireto. O verbo gostar é transitivo
(A) de que, com as indireto
(B) a que, com as
(C) que, as Transitivos Diretos e Indiretos: Exigem 2
(D) à que, às complementos. Um com preposição, e outro sem. Ex. O garoto
(E) que, com as ofereceu um livro ao colega.
O verbo oferecer é transitivo direto e indireto. Quem
02. Quanto a amigos, prefiro João.....Paulo,.....quem oferece, oferece alguma coisa a alguém. Ofereceu alguma coisa
sinto......simpatia. = Um brinquedo (sem preposição). Ofereceu para alguém =
(A) a, por, menos ao colega (com preposição). ao = combinação da preposição a
(B) do que, por, menos com o artigo definido o.
(C) a, para, menos
(D) do que, com, menos Intransitivos: não possuem complemento. Ou seja,
(E) do que, para, menos os verbos intransitivos possuem sentido completo. Ex: “Ele
morreu.” O verbo morrer tem sentido completo. Algumas vezes
03. Assinale a opção em que todos adjetivos podem ser o verbo intransitivo pode vir acompanhado de algum termo
seguidos pela mesma preposição: que indica modo, lugar, tempo, etc. Estes termos são chamados
(A) ávido, bom, inconsequente de adjuntos adverbiais. Ex. Ele morreu dormindo. Dormindo
(B) indigno, odioso, perito foi a maneira, o modo que ele morreu. Dormindo é o adjunto
(C) leal, limpo, oneroso adverbial de modo.
(D) orgulhoso, rico, sedento
(E) oposto, pálido, sábio Existem verbos intransitivos que precisam vir acompanhados
de adjuntos adverbiais apenas para darem um sentido completo
04. “As mulheres da noite,......o poeta faz alusão a colorir para a frase. Ex. Moro no Rio de Janeiro.
Aracaju,........coração bate de noite, no silêncio”. A opção que O verbo morar é intransitivo, porém precisa do complemento
completa corretamente as lacunas da frase acima é: “no RJ’ para que a frase tenha um sentido completo. “No RJ” é
(A) as quais, de cujo o adj. adverbial de lugar.
(B) a que, no qual
(C) de que, o qual Aspirar: O verbo aspirar pode ser transitivo direto ou tran-
(D) às quais, cujo sitivo indireto.
(E) que, em cujo Transitivo direto: quando significa “sorver”, “tragar”, “inspi-
rar” e exige complemento sem preposição.
05. Assinale a alternativa correta quanto à regência: - Ela aspirou o aroma das flores.
(A) A peça que assistimos foi muito boa. - Todos nós gostamos de aspirar o ar do campo.
(B) Estes são os livros que precisamos. Transitivo indireto: quando significa “pretender”, “desejar”,
(C) Esse foi um ponto que todos se esqueceram. “almejar” e exige complemento com a preposição “a”.
(D) Guimarães Rosa é o escritor que mais aprecio. - O candidato aspirava a uma posição de destaque.
(E) O ideal que aspiramos é conhecido por todos. - Ela sempre aspirou a esse emprego.

Respostas Quando é transitivo indireto não admite a substituição pelos


01. B / 02. A / 03. D / 04. D / 05. D pronomes lhe(s). Devemos substituir por “a ele(s)”, “a ela(s)”.

62
LÍNGUA PORTUGUESA
- Aspiras a este cargo? sitivos indiretos.
- Sim, aspiro a ele. (e não “aspiro-lhe”). - Ele se esqueceu do caderno.
- Eu me esqueci da chave.
Assistir: O verbo assistir pode ser transitivo indireto, tran- - Eles se esqueceram da prova.
sitivo direto e intransitivo. - Nós nos lembramos de tudo o que aconteceu.
Transitivo indireto: quando significa “ver”, “presenciar”,
“caber”, “pertencer” e exige complemento com a preposição Há uma construção em que a coisa esquecida ou lembrada
“a”. passa a funcionar como sujeito e o verbo sofre leve alteração
- Assisti a um filme. (ver) de sentido. É uma construção muito rara na língua contem-
- Ele assistiu ao jogo. porânea, porém, é fácil encontrá-la em textos clássicos tanto
- Este direito assiste aos alunos. (caber) brasileiros como portugueses. Machado de Assis, por exemplo,
Transitivo direto: quando significa “socorrer”, “ajudar” e fez uso dessa construção várias vezes.
exige complemento sem preposição. - Esqueceu-me a tragédia. (cair no esquecimento)
- O médico assiste o ferido. (cuida) - Lembrou-me a festa. (vir à lembrança)
O verbo lembrar também pode ser transitivo direto e in-
Nesse caso o verbo “assistir” pode ser usado com a prepo- direto (lembrar alguma coisa a alguém ou alguém de alguma
sição “a”. coisa).
- Assistir ao paciente.
Preferir: É transitivo direto e indireto, ou seja, possui
Intransitivo: quando significa “morar” exige a preposição um objeto direto (complemento sem preposição) e um objeto
“em”. indireto (complemento com preposição)
- O papa assiste no Vaticano. (no: em + o) - Prefiro cinema a teatro.
- Eu assisto no Rio de Janeiro. - Prefiro passear a ver TV.
“No Vaticano” e “no Rio de Janeiro” são adjuntos adverbiais Não é correto dizer: “Prefiro cinema do que teatro”.
de lugar.
Simpatizar: Ambos são transitivos indiretos e exigem a
Chamar: O verbo chamar pode ser transitivo direto ou preposição “com”.
transitivo indireto. - Não simpatizei com os jurados.
É transitivo direto quando significa “convocar”, “fazer vir” e
exige complemento sem preposição. Querer: Pode ser transitivo direto (no sentido de “desejar”)
- O professor chamou o aluno. ou transitivo indireto (no sentido de “ter afeto”, “estimar”).
É transitivo indireto quando significa “invocar” e é usado - A criança quer sorvete.
com a preposição “por”. - Quero a meus pais.
- Ela chamava por Jesus.
Com o sentido de “apelidar” pode exigir ou não a preposi- Namorar: É transitivo direto, ou seja, não admite
ção, ou seja, pode ser transitivo direto ou transitivo indireto. preposição.
Admite as seguintes construções: - Maria namora João.
- Chamei Pedro de bobo. (chamei-o de bobo) Não é correto dizer: “Maria namora com João”.
- Chamei a Pedro de bobo. (chamei-lhe de bobo)
- Chamei Pedro bobo. (chamei-o bobo) Obedecer: É transitivo indireto, ou seja, exige complemento
- Chamei a Pedro bobo. (chamei-lhe bobo) com a preposição “a” (obedecer a).
- Devemos obedecer aos pais.
Visar: Pode ser transitivo direto (sem preposição) ou tran- Embora seja transitivo indireto, esse verbo pode ser usado
sitivo indireto (com preposição). na voz passiva.
Quando significa “dar visto” e “mirar” é transitivo direto. - A fila não foi obedecida.
- O funcionário já visou todos os cheques. (dar visto)
- O arqueiro visou o alvo e atirou. (mirar) Ver: É transitivo direto, ou seja, não exige preposição.
Quando significa “desejar”, “almejar”, “pretender”, “ter em - Ele viu o filme.
vista” é transitivo indireto e exige a preposição “a”.
- Muitos visavam ao cargo. Questões
- Ele visa ao poder.
Nesse caso não admite o pronome lhe(s) e deverá ser substi- 01. (IFC - Auxiliar Administrativo - IFC). Todas as
tuído por a ele(s), a ela(s). Ou seja, não se diz: viso-lhe. alternativas estão corretas quanto ao emprego correto da
regência do verbo, EXCETO:
Quando o verbo “visar” é seguido por um infinitivo, a pre- (A) Faço entrega em domicílio.
posição é geralmente omitida. (B) Eles assistem o espetáculo.
- Ele visava atingir o posto de comando. (C) João gosta de frutas.
(D) Ana reside em São Paulo.
Esquecer – Lembrar: (E) Pedro aspira ao cargo de chefe.
- Lembrar algo – esquecer algo
- Lembrar-se de algo – esquecer-se de algo (pronominal) 02. Assinale a opção em que o verbo
No 1º caso, os verbos são transitivos diretos, ou seja exigem chamar é empregado com o mesmo sentido que
complemento sem preposição. apresenta em __ “No dia em que o chamaram de Ubirajara,
- Ele esqueceu o livro. Quaresma ficou reservado, taciturno e mudo”:
No 2º caso, os verbos são pronominais (-se, -me, etc) e exi- (A) pelos seus feitos, chamaram-lhe o salvador da pátria;
gem complemento com a preposição “de”. São, portanto, tran- (B) bateram à porta, chamando Rodrigo;

63
LÍNGUA PORTUGUESA
(C) naquele momento difícil, chamou por Deus e pelo do tipo é bom, é claro, é evidente, etc., há duas construções
Diabo; possíveis:
(D) o chefe chamou-os para um diálogo franco; 1- se o sujeito não vem precedido de nenhum modificador,
(E) mandou chamar o médico com urgência. tanto o verbo quanto o adjetivo ficam invariáveis: Pizza é
bom; É proibido entrada.
Respostas 2- se o sujeito vem precedido de modificador, tanto o verbo
01.B / 02. A quanto o predicativo concordam regularmente: A pizza é boa;
É proibida a entrada.

- Palavras adverbiais x palavras adjetivas: há


palavras que ora têm função de advérbio, ora de adjetivo.
Quando funcionam como advérbio são invariáveis: Há
Concordância nominal e verbal. ocasiões bastante oportunas.
Quando funcionam como adjetivo, concordam com o nome
a que se referem: Há bastantes razões para confiarmos na
Concordância Nominal e Verbal proposta.
Estão nesta classificação palavras como pouco, muito,
Concordância é o mecanismo pelo qual algumas palavras bastante, barato, caro, meio, longe, etc.
alteram suas terminações para adequar-se à terminação de
outras palavras. Em português, distinguimos dois tipos de - Expressões “anexo” e “obrigado”: são palavras
concordância: nominal, que trata das alterações do artigo, adjetivas e, como tais, devem concordar com o nome a que se
do numeral, dos pronomes adjetivos e dos adjetivos para referem. Exemplos:
concordar com o nome a que se referem, e verbal, que trata Seguem anexas as listas de preços.
das alterações do verbo, para concordar com o sujeito. Seguem anexos os planos de aula.

Concordância Nominal Podemos colocar sob a mesma regra palavras como incluso,
quite, leso, mesmo e próprio.
- Regra Geral: o adjetivo e as palavras adjetivas (artigo,
numeral, pronome adjetivo) concordam em gênero e número 1- Alerta e menos são sempre invariáveis:
com o nome a que se referem. Estamos alerta.
Há situações menos complicadas.
Esta / observação / curta / desfaz o equívoco. Há menos pessoas no local.
Esta (pronome adjetivo – feminino – singular)
observação (substantivo – feminino – singular) 2- Em anexo é sempre invariável:
curta (adjetivo – feminino – singular) Seguem, em anexo, as fotografias.

- Um só adjetivo qualificando mais de um - Expressões só e sós: quando equivale a somente, é


substantivo. advérbio e invariável; quando equivale a sozinho, é adjetivo e
Adjetivo posposto: quando um mesmo adjetivo qualifica dois variável.
ou mais substantivos e vem depois destes, há duas construções: Só eles não concordam.
1- o adjetivo vai para o plural: Agia com calma e Eles saíram sós.
pontualidade britânicas.
2- o adjetivo concorda com o substantivo mais próximo: A expressão a sós é invariável: Gostaria de ficar a sós por
Agia com calma e pontualidade britânica. uns momentos.
Questões
Sempre que se optar pelo plural, é preciso notar o seguinte:
se entre os substantivos houver ao menos um no masculino, o 01. Se usadas no plural as palavras destacadas nas frases
adjetivo assumirá a terminação do masculino: Fez tudo com – Talvez seja programa de quem vive em uma cidade cinzenta,
entusiasmo e paixão arrebatadores. na qual é difícil enxergar o céu. / Duvido que exista paisagem
Quando o adjetivo exprime uma qualidade tal que só dominical mais urbana. – elas assumem versão correta em
cabe ao último substantivo, é óbvio que a concordância (A) Talvez seja programa de quem vive em cidades cinzenta
obrigatoriamente se efetuará com este último: Alimentavam-se na qual é difícil enxergar o céu./ Duvido que exista paisagens
de arroz e carne bovina. dominical mais urbanas.
(B) Talvez seja programa de quem vive em cidades cinzentas,
Adjetivo anteposto: quando um adjetivo qualifica dois nas quais é difícil enxergar o céu./ Duvido que exista paisagens
ou mais substantivos e vem antes destes, concorda com o dominicais mais urbanas.
substantivo mais próximo: Escolhestes má ocasião e lugar. (C) Talvez seja programa de quem vive em cidades
cinzentas, na qual é difícil enxergar o céu./ Duvido que existam
Quando o adjetivo anteposto aos substantivos funcionar paisagens dominicais mais urbana.
como predicativo, pode concordar com o mais próximo ou ir (D) Talvez seja programa de quem vive em cidades
para o plural: cinzentas, nas quais são difíceis enxergar o céu./ Duvido que
Estava quieta a casa, a vila e o campo. existam paisagens dominical mais urbana.
Estavam quietos a casa, a vila e o campo. (E) Talvez seja programa de quem vive em cidades
cinzentas, nas quais é difícil enxergar o céu./ Duvido que
- Verbo ser + adjetivo: Nos predicados nominais em existam paisagens dominicais mais urbanas.
que ocorre o verbo ser mais um adjetivo, formando expressões

64
LÍNGUA PORTUGUESA
02. Assinale a alternativa correta quanto à concordância 1- quando o sujeito é formado de palavras sinônimas ou que
nominal. formam unidade de sentido: A coragem e o destemor fez dele
(A) Ela mesmo fez a entrega da encomenda. um herói. É bom notar que, no mesmo caso, vale também o
(B) Estou meia preocupada, disse a jovem senhora ao seu plural. O singular, aqui, talvez se explique pela facilidade que
colega de trabalho. temos em juntar, numa só unidade, conceitos sinônimos.
(C) É proibida a entrada de mercadorias ilegais nesta 2- quando o sujeito é formado por núcleos dispostos em
cidade. gradação (ascendente ou descendente): Uma palavra, um
(D) “Muito obrigado”, respondeu-me aquela senhora. gesto, um mínimo sinal bastava. No mesmo caso, cabe
(E) Custou muito caro, naquele contexto, as despesas também o plural. A construção com o verbo no singular é
assumidas pelo casal. compreensível: nas sequências gradativas, o último elemento é
sempre mais enfático, o que leva o verbo a concordar com ele.
03. Complete os espaços com um dos nomes colocados nos 3- quando o sujeito vem resumido por palavras como
parênteses. alguém, ninguém, cada um, tudo, nada: Alunos, mestres,
(A) Será que é ____ essa confusão toda? (necessário/ diretores, ninguém faltou. Aqui não ocorre plural. É que o
necessária) valor sintetizante do pronome (ninguém) é tão marcante que só
(B) Quero que todos fiquem ____. (alerta/ alertas) nos fica a ideia do conjunto e não das partes que o compõem.
(C) Houve ____ razões para eu não voltar lá. (bastante/
bastantes) - Sujeito composto posposto ao verbo: quando o
(D) Encontrei ____ a sala e os quartos. (vazia/vazios) sujeito composto vem depois do verbo, há duas construções
(E) A dona do imóvel ficou ____ desiludida com o inquilino. igualmente certas.
(meio/ meia)
1- o verbo vai para o plural: Brilhavam o sol e a lua.
04. “Na reunião do Colegiado, não faltou, no momento em 2- o verbo concorda com o núcleo mais próximo: Brilhava
que as discussões se tornaram mais violentas, argumentos e o sol e a lua.
opiniões veementes e contraditórias.” No trecho acima, há uma
infração as normas de concordância. Quando, porém, o sujeito composto vem posposto e o núcleo
(A) Reescreva-o com devida correção. mais próximo está no plural, o verbo só pode, obviamente, ir
(B) Justifique a correção feita. para o plural: Já chegaram as revistas e o jornal.

05. Reescrever as frases abaixo, corrigindo-as quando - Sujeito composto de pessoas gramaticais
necessário. diferentes: quando o sujeito composto é formado de pessoas
(A) “Recebei, Vossa Excelência, os processos de nossa estima, gramaticais diferentes, o verbo vai para o plural, sempre na
pois não podem haver cidadãos conscientes sem educação.” pessoa gramatical de número mais baixo. Assim, quando
(B) “Os projetos que me enviaram estão em ordem; devolvê- ocorrer:
los-ei ainda hoje, conforme lhes prometi.” 1ª e 2ª – o verbo vai para a 1ª do plural.
2ª e 3ª – o verbo vai para a 2ª do plural.
Respostas 1ª e 3ª – o verbo vai para a 1ª do plural.

01. E / 02. C Eu, tu e ele ficaremos aqui.

03. a) necessária b) alerta c) bastantes d) vazia Quando o sujeito é formado pelo pronome tu mais uma 3ª
e) meio pessoa, o verbo pode ir também para a 3ª pessoa do plural. Isto
se deve à baixa frequência de uso da segunda pessoa do plural:
04. a) “Na reunião do colegiado, não faltaram, no momento Tu e ele chegaram (ou chegastes) a tempo.
em que as discussões se tornaram mais violentas, argumentos e
opiniões veementes e contraditórias.” - Verbo acompanhado do pronome se apassivador:
b) Concorda com o sujeito “argumentos e opiniões”. quando o pronome se funciona como partícula apassivadora, o
verbo concorda regularmente com o sujeito, que estará sempre
05. a) “Receba, Vossa Excelência, os protestos de nossa presente na oração.
estima, pois não pode haver cidadãos conscientes sem a Vende-se apartamento.
educação.” Vendem-se apartamentos.
b) A frase está correta.
- Verbo acompanhado do pronome se indicador de
Concordância Verbal indeterminação do sujeito: quando a indeterminação do
sujeito é marcada pelo pronome se, o verbo fica necessariamente
- Regra Geral: o verbo concorda com seu sujeito em no singular: Precisa-se de reforços (sujeito indeterminado).
pessoa e número.
Eu contarei convosco. - Verbos dar, bater, soar: na indicação de horas,
Tu estavas enganado. concordam com a palavra horas, que é o sujeito dos respectivos
verbos.
- Sujeito composto anteposto ao verbo: quando Bateram dez horas.
o sujeito composto vem anteposto ao verbo, este vai para o Soou uma hora.
plural: O sol e a lua brilhavam. Há casos em que, mesmo com
o sujeito composto anteposto, justifica-se o singular. Isto ocorre Pode ser que o sujeito deixe de ser o número das horas e
basicamente em três situações: passe a ser outro elemento da oração, o instrumento que bate
as horas, por exemplo. No caso, a concordância mudará: O

65
LÍNGUA PORTUGUESA
relógio bateu dez horas. diferente do mesmo enunciador.
- Sujeito coletivo: quando o sujeito é formado por um Ele é um dentre aqueles que mais falaram.
substantivo coletivo no singular, o verbo fica no singular, Ele é um que mais falou dentre aqueles.
concordando com a forma do substantivo e não com a ideia: A
multidão aplaudiu o orador. Nesse caso, pode ocorrer também - Expressões mais de, menos de: quando o sujeito for
o plural em duas situações: constituído das expressões mais de, menos de, o verbo concorda
1- quando o coletivo vier distanciado do verbo: O povo, com o numeral que se segue à expressão.
apesar de toda a insistência e ousadia, não conseguiram Mais de um aluno saiu.
evitar a catástrofe. Mais de dois alunos saíram.
2- quando o coletivo, antecipado ao verbo, vier seguido
de um adjunto adnominal no plural: A multidão dos Com a expressão mais de um pode ocorrer o plural em duas
peregrinos caminhavam lentamente. situações:
1- quando o verbo dá ideia de ação recíproca: Mais de um
- Nomes próprios plurais: quando o sujeito é formado veículo se entrechocaram.
por nomes próprios de lugar que só têm a forma plural, há duas 2- quando a expressão mais de vem repetida: Mais de
construções: um padre, mais de um bispo estavam presentes.
1- se tais nomes vierem precedidos de artigo, o verbo
concordará com o artigo. - Expressões um e outro, nem um nem outro: quando
Os Estados Unidos progrediram muito. o sujeito é formado pelas expressões um e outro, nem um nem
O Amazonas corre volumoso pela floresta. outro, o verbo fica no singular ou plural.
Nem um nem outro concordou.
2- se tais nomes não vierem precedidos de artigo, o verbo Nem um nem outro concordaram.
ficará sempre no singular: Ø Minas Gerais elegeu seu senador.
O substantivo que segue a essas expressões deve ficar no
Quanto aos títulos de livros e nomes de obras, mesmo singular: Uma e outra coisa me atrai.
precedidos de artigo, são admissíveis duas construções: Quando núcleos de pessoas diferentes vêm precedidos de
Os lusíadas foi a glória das letras lusitanas. nem, o mais usual é o verbo no plural, na pessoa gramatical
Os lusíadas foram a glória das letras lusitanas. prioritária (a de número mais baixo): Nem eu nem ele
faltamos com a palavra.
- Sujeito constituído pelo pronome relativo que:
quando o sujeito for o pronome relativo que, o verbo concorda - Sujeito constituído por pronome de tratamento:
com o antecedente desse pronome. quando o sujeito é formado por pronomes de tratamento, o
Fui eu que prometi. verbo vai sempre para a 3ª pessoa (singular ou plural).
Foste tu que prometeste. Vossa Excelência se enganou.
Vossas Excelências se enganaram.
- Sujeito constituído pelo pronome relativo quem:
quando o sujeito de um verbo for o pronome relativo quem, há - Núcleos ligados por ou: quando os núcleos do sujeito
duas construções possíveis: vêm ligados pela conjunção ou, há duas construções:
1- o verbo fica na 3ª pessoa do singular, concordando 1- o verbo fica no singular quando o ou tem valor
regularmente com o sujeito (quem): Fui eu quem falou. excludente: Pedro ou Paulo será eleito papa. (a eleição de um
2- o verbo concorda com o antecedente: Fui eu quem falei. implica necessariamente a exclusão do outro)
2- o verbo vai para o plural, quando o ou não for excludente:
- Pronome indefinido plural seguido de pronome Maça ou figo me agradam à sobremesa. (ambas as frutas me
pessoal preposicionado: quando o sujeito é formado de agradam)
um pronome indefinido (ou interrogativo) no plural seguido de
um pronome pessoal preposicionado, há possibilidade de duas - Silepse: ocorre concordância siléptica quando o verbo
construções: não concorda com o sujeito que aparece expresso na frase,
1- o verbo vai para a 3ª pessoa do plural, concordando mas com um elemento implícito na mente de quem fala: Os
com o pronome indefinido ou interrogativo: Alguns de nós brasileiros somos improvisadores. Está implícito que o
partiram. falante (eu ou nós) está incluído entre os brasileiros.
2- o verbo concorda com o pronome pessoal que se segue - Expressão haja vista: na expressão haja vista, a
ao indefinido (ou interrogativo): Alguns de nós partimos. palavra vista é sempre invariável. O verbo haja pode ficar
invariável ou concordar com o substantivo que se segue à
Quando o pronome interrogativo ou indefinido estiver expressão.
no singular, o verbo ficará, necessariamente, na 3ª pessoa do Haja vista os últimos acontecimentos.
singular. Hajam vista os últimos acontecimentos.
Alguém de nós falhou?
Qual de nós sairá? Admite-se ainda a construção:
Haja vista aos últimos acontecimentos.
- Expressões um dos que, uma das que: quando o
sujeito de um verbo for o pronome relativo que, nas expressões - Verbo parecer seguido de infinitivo: o verbo
um dos que, uma das que, o verbo vai para o plural (construção parecer, seguido de infinitivo, admite duas construções:
dominante) ou fica no singular. 1- flexiona-se o verbo parecer e não se flexiona o infinitivo:
Ele foi um dos que mais falaram. Os montes parecem cair.
Ele foi um dos que mais falou. 2- flexiona-se o infinitivo e não se flexiona o verbo parecer:
Cada uma das construções corresponde a uma interpretação Os montes parece caírem.

66
LÍNGUA PORTUGUESA
- Verbo impessoais: os verbos impessoais ficam sempre seria:
na 3ª pessoa do singular. (A) hão.
Haverá sóis mais brilhantes. (B) haviam.
Também não se flexiona o verbo auxiliar que se põe junto a (C) há.
um verbo impessoal, formando uma locução verbal. (D) houveram.
Deve fazer umas cinco horas que estou esperando. (E) houve.

O verbo haver no sentido de existir ou de tempo passado e 03. Considerando a concordância verbal, assinale a
o verbo fazer na indicação de tempo transcorrido ou fenômeno alternativa em que a frase do texto, reescrita, obedece à norma-
da natureza são impessoais. padrão da língua portuguesa.
O verbo existir nunca é impessoal: tem sempre sujeito, com (A) Chamou a minha atenção, nos dois sujeitos altos,
o qual concorda normalmente: Existirão protestos; Poderão esguios e endinheirados, um trambolho grande.
existir dúvidas. (B) À minha frente, no caixa, haviam dois holandeses com
Quando o verbo haver funciona como auxiliar de vestes diferentes.
outro verbo, deve concordar normalmente com o sujeito: Os (C) As verdadeiras intenções do forasteiro era conhecida da
convidados já haviam saído. comissária de bordo brasileira.
(D) Seria de muito valor se algumas lições do Mundial fosse
- Verbo ser: a concordância do verbo ser oscila aproveitadas pelo povo brasileiro.
frequentemente entre o sujeito e o predicativo. Entre tantos (E) A lição que os japoneses nos deixaram trarão um ganho
casos, podemos ressaltar: histórico para o país.
Quando o sujeito e o predicativo são nomes de coisas de Respostas
números diferentes, o verbo concorda, de preferência, com o 01. E / 02. C / 03. A
que está no plural.
Tua vida são essas ilusões.
Essas vaidades são o teu segredo.

Nesse caso, muitas vezes, faz-se a concordância com o


elemento a que se quer dar destaque.
Colocação pronominal.
Quando um dos dois (predicativo ou sujeito) é nome de
pessoa, a concordância se faz com a pessoa.
Você é suas decisões. Colocação dos Pronomes Oblíquos Átonos
Suas preocupações era a filha.
Um dos aspectos da harmonia da frase refere-se à colocação
O verbo concorda com o pronome pessoal, seja este sujeito, dos pronomes oblíquos átonos. Tais pronomes situam-se em
seja predicativo. três posições:
O professor sou eu. - Antes do verbo (próclise): Não te conheço.
Eu sou o professor. - No meio do verbo (mesóclise): Avisar-te-ei.
- Depois do verbo (ênclise): Sente-se, por favor.
Nas indicações de hora, data e distância, o verbo ser,
impessoal, concorda com o predicativo. Próclise
É uma hora.
São duas horas. Por atração: usa-se a próclise quando o verbo vem
precedido das seguintes partículas atrativas:
Neste último caso (dias do mês) o verbo ser admite duas - Palavras ou expressões negativas: Não te afastes de mim.
construções: - Advérbios: Agora se negam a depor. Se houver pausa (na
É (dia) treze de maio. escrita, vírgula) entre o advérbio e o verbo, usa-se a ênclise:
São treze (dias) de maio. Agora, negam-se a depor.
- Pronomes Relativos: Apresentaram-se duas pessoas que
O verbo ser, seguido de um quantificador, nas expressões se identificaram com rapidez.
de peso, distância ou preço, fica invariável. - Pronomes Indefinidos: Poucos se negaram ao trabalho.
Quinze quilos é bastante. - Conjunções subordinativas: Soube que me dariam a
autorização solicitada.
Questões
Com certas frases: há casos em que a próclise é motivada
01. Aponte a alternativa cuja concordância verbal está pelo próprio tipo de frase em que se localiza o pronome.
correta: - Frases Interrogativas: Quem se atreveria a isso?
(A) A alta dos preços dos combustíveis irritam o povo. - Frases Exclamativas: Quanto te arriscas com esse
(B) Os Estados Unidos fica na América do Norte. procedimento!
(C) Minhas costas está doendo. - Frases Optativas (exprimem desejo): Deus nos proteja.
(D) Ela foi uma das que chegou a tempo Se, nas frases optativas, o sujeito vem depois do verbo, usa-se a
(E) A maioria dos brasileiros gosta de futebol. ênclise: Proteja-nos Deus.

02. “existe um protocolo para identificar os focos”. Se Com certos verbos: a próclise pode ser motivada também
colocássemos o termo “um protocolo” no plural, uma forma pela forma verbal a que se prende o pronome.
verbal adequada para a substituição da forma verbal “existe” - Com o gerúndio precedido de preposição ou de negação:

67
LÍNGUA PORTUGUESA
Em se ausentando, complicou-se; Não se satisfazendo com os qualquer colocação do pronome.
resultados, mudou de método. Exemplos:
- Com o infinito pessoal precedido de preposição: Por se A vida lhe pode trazer surpresas.
acharem infalíveis, caíram no ridículo. A vida pode-lhe trazer surpresas.
A vida pode trazer-lhe surpresas.
Mesóclise
Observações
Usa-se a mesóclise tão somente com duas formas verbais, o
futuro do presente e o futuro do pretérito, assim quando não - Quando o verbo auxiliar de uma locução verbal estiver no
vierem precedidos de palavras atrativas. Exemplos: futuro do presente ou no futuro do pretérito, o pronome pode
Confrontar-se-ão os resultados. vir em mesóclise em relação a ele: Ter-nos-ia aconselhado a
Confrontar-se-iam os resultados. partir.
- Nas locuções verbais, jamais se usa pronome oblíquo átono
Mas: depois do particípio. Não o haviam convidado. (correto); Não
Não se confrontarão os resultados. haviam convidado-o. (errado).
Não se confrontariam os resultados. - Há uma colocação pronominal, restrita a contextos
literários, que deve ser conhecida: Há males que se não
Não se usa a ênclise com o futuro do presente ou com o curam com remédios. Quando há duas partículas atraindo o
futuro do pretérito sob hipótese alguma. Será contrária à norma pronome oblíquo átono, este pode vir entre elas. Poderíamos
culta escrita, portanto, uma colocação do tipo: dizer também: Há males que não se curam com remédios.
Diria-se que as coisas melhoraram. (errado) - Os pronomes oblíquos átonos combinam-se entre si em
Dir-se-ia que as coisas melhoraram. (correto) casos como estes:
me + o/a = mo/ma
Ênclise te + o/a = to/ta
lhe + o/a = lho/lha
Usa-se a ênclise nos seguintes casos: nos + o/a = no-lo/no-la
- Imperativo Afirmativo: Prezado amigo, informe-se vos + o/a = vo-lo/vo-la
de seus compromissos.
- Gerúndio não precedido da preposição “em” ou Tais combinações podem vir:
de partícula negativa: Falando-se de comércio exterior, - Proclítica: Eu não vo-lo disse?
progredimos muito. - Mesoclítica: Dir-vo-lo-ei já.
- Enclítica: A correspondência, entregaram-lha há muito
Mas tempo.
Em se plantando no Brasil, tudo dá.
Não se falando em futebol, ninguém briga. Segundo a norma culta, a regra é a ênclise, ou seja, o
pronome após o verbo. Isso tem origem em Portugal, onde essa
- Infinitivo Impessoal: Não era minha intenção colocação é mais comum. No Brasil, o uso da próclise é mais
magoar-te. Se o infinitivo vier precedido de palavra atrativa, frequente, por apresentar maior informalidade. Mas, como
ocorre tanto a próclise quanto a ênclise. devemos abordar os aspectos formais da língua, a regra será
Espero com isto não te magoar. ênclise, usando próclise em situações excepcionais, que são:
Espero com isto não magoar-te. - Palavras invariáveis (advérbios, alguns pronomes,
conjunção) atraem o pronome. Por “palavras invariáveis”,
- No início de frases ou depois de pausa: Vão-se entendemos os advérbios, as conjunções, alguns
os anéis, ficam os dedos. Decorre daí a afirmação de que, na pronomes que não se flexionam, como o pronome relativo
variante culta escrita, não se inicia frase com pronome oblíquo que, os pronomes indefinidos quanto/como, os pronomes
átono. Causou-me surpresa a tua reação. demonstrativos isso, aquilo, isto. Exemplos: “Ele não
se encontrou com a namorada.” – próclise obrigatória por
O Pronome Oblíquo Átono nas Locuções Verbais força do advérbio de negação. “Quando se encontra com a
namorada, ele fica muito feliz.” – próclise obrigatória por força
- Com palavras atrativas: quando a locução vem da conjunção;
precedida de palavra atrativa, o pronome se coloca antes do - Orações exclamativas (“Vou te matar!”) ou que expressam
verbo auxiliar ou depois do verbo principal. Exemplo: Nunca desejo, chamadas de optativas (“Que Deus o abençoe!”) –
te posso negar isso; Nunca posso negar-te isso. É possível, próclise obrigatória.
nesses casos, o uso da próclise antes do verbo principal. Nesse - Orações subordinadas – (“... e é por isso que nele se
caso, o pronome não se liga por hífen ao verbo auxiliar: Nunca acentua o pensador político” – uma oração subordinada causal,
posso te negar isso. como a da questão, exige a próclise.).
- No início da oração ou depois de pausa: quando
a locução se situa no início da oração, não se usa o pronome Emprego Proibido:
antes do verbo auxiliar. Exemplo: Posso-lhe dar garantia - Iniciar período com pronome (a forma correta é: Dá-me
total; Posso dar-lhe garantia total. A mesma norma é válida um copo d’água; Permita-me fazer uma observação.);
para os casos em que a locução verbal vem precedida de pausa. - Após verbo no particípio, no futuro do presente e no futuro
Exemplo: Em dias de lua cheia, pode-se ver a estrada mesmo do pretérito. Com essas formas verbais, usa-se a próclise (desde
com faróis apagados; Em dias de lua cheia, pode ver-se a que não caia na proibição acima), modifica-se a estrutura (troca
estrada mesmo com os faróis apagados. o “me” por “a mim”) ou, no caso dos futuros, emprega-se o
- Sem atração nem pausa: quando a locução verbal não pronome em mesóclise. Exemplos: “Concedida a mim a licença,
vem precedida de palavra atrativa nem de pausa, admite-se pude começar a trabalhar.” (Não poderia ser “concedida-me”

68
LÍNGUA PORTUGUESA
– após particípio é proibido - nem “me concedida” – iniciar etimologia e da tradição escrita. Grafa-se, por exemplo, hoje,
período com pronome é proibido). “Recolher-me-ei à minha porque esta palavra vem do latim hodie.
insignificância” (Não poderia ser “recolherei-me” nem “Me Emprega-se o H:
recolherei”). - Inicial, quando etimológico: hábito, hélice, herói, hérnia,
hesitar, haurir, etc.
- Medial, como integrante dos dígrafos ch, lh e nh: chave,
Questões
boliche, telha, flecha companhia, etc.
- Final e inicial, em certas interjeições: ah!, ih!, hem?, hum!,
01. Considerada a norma culta escrita, há correta etc.
substituição de estrutura nominal por pronome em: - Algumas palavras iniciadas com a letra H: hálito,
(A) Agradeço antecipadamente sua Resposta // Agradeço- harmonia, hangar, hábil, hemorragia, hemisfério, heliporto,
lhes antecipadamente. hematoma, hífen, hilaridade, hipocondria, hipótese, hipocrisia,
(B) do verbo fabricar se extraiu o substantivo fábrica. // do homenagear, hera, húmus;
verbo fabricar se extraiu-lhe. - Sem h, porém, os derivados baiano, baianinha, baião,
(C) não faltam lexicógrafos // não faltam-os. baianada, etc.
(D) Gostaria de conhecer suas considerações // Gostaria de
Emprego das letras E, I, O e U
conhecê-las.
(E) incluindo a palavra ‘aguardo’ // incluindo ela. Na língua falada, a distinção entre as vogais átonas /e/ e /i/,
/o/ e /u/ nem sempre é nítida. É principalmente desse fato que
02. Caso fosse necessário substituir o termo destacado em nascem as dúvidas quando se escrevem palavras como quase,
“Basta apresentar um documento” por um pronome, de acordo intitular, mágoa, bulir, etc., em que ocorrem aquelas vogais.
com a norma-padrão, a nova redação deveria ser
(A) Basta apresenta-lo. Escrevem-se com a letra E
(B) Basta apresentar-lhe.
(C) Basta apresenta-lhe. - A sílaba final de formas dos verbos terminados em –uar:
(D) Basta apresentá-la. continue, habitue, pontue, etc.
- A sílaba final de formas dos verbos terminados em –oar:
(E) Basta apresentá-lo.
abençoe, magoe, perdoe, etc.
- As palavras formadas com o prefixo ante– (antes, anterior):
03. Em qual período, o pronome átono que substitui o antebraço, antecipar, antedatar, antediluviano, antevéspera,
sintagma em destaque tem sua colocação de acordo com a etc.
norma-padrão? - Os seguintes vocábulos: Arrepiar, Cadeado, Candeeiro,
(A) O porteiro não conhecia o portador do embrulho – Cemitério, Confete, Creolina, Cumeeira, Desperdício, Destilar,
conhecia-o Disenteria, Empecilho, Encarnar, Indígena, Irrequieto,
(B) Meu pai tinha encontrado um marinheiro na praça Lacrimogêneo, Mexerico, Mimeógrafo, Orquídea, Peru, Quase,
Mauá – tinha encontrado-o. Quepe, Senão, Sequer, Seriema, Seringa, Umedecer.
(C) As pessoas relatarão as suas histórias para o registro no
Emprega-se a letra I
Museu – relatá-las-ão.
(D) Quem explicou às crianças as histórias de seus - Na sílaba final de formas dos verbos terminados em –air/–
antepassados? – explicou-lhes. oer /–uir: cai, corrói, diminuir, influi, possui, retribui, sai, etc.
(E) Vinham perguntando às pessoas se aceitavam a ideia de - Em palavras formadas com o prefixo anti- (contra):
um museu virtual – Lhes vinham perguntando. antiaéreo, Anticristo, antitetânico, antiestético, etc.
- Nos seguintes vocábulos: aborígine, açoriano, artifício,
Respostas artimanha, camoniano, Casimiro, chefiar, cimento, crânio,
01. D / 02. E / 03. C criar, criador, criação, crioulo, digladiar, displicente, erisipela,
escárnio, feminino, Filipe, frontispício, Ifigênia, inclinar,
incinerar, inigualável, invólucro, lajiano, lampião, pátio,
penicilina, pontiagudo, privilégio, requisito, Sicília (ilha),
silvícola, siri, terebintina, Tibiriçá, Virgílio.

Grafam-se com a letra O


Ortografia, acentuação gráfica e
pontuação. abolir, banto, boate, bolacha, boletim, botequim, bússola,
chover, cobiça, concorrência, costume, engolir, goela, mágoa,
mocambo, moela, moleque, mosquito, névoa, nódoa, óbolo,
Ortografia ocorrência, rebotalho, Romênia, tribo.

A palavra ortografia é formada pelos elementos gregos Grafam-se com a letra U


orto “correto” e grafia “escrita” sendo a escrita correta das
palavras da língua portuguesa, obedecendo a uma combinação bulir, burburinho, camundongo, chuviscar, cumbuca,
de critérios etimológicos (ligados à origem das palavras) e cúpula, curtume, cutucar, entupir, íngua, jabuti, jabuticaba,
fonológicos (ligados aos fonemas representados). lóbulo, Manuel, mutuca, rebuliço, tábua, tabuada, tonitruante,
Somente a intimidade com a palavra escrita, é que acaba trégua, urtiga.
trazendo a memorização da grafia correta. Deve-se também
criar o hábito de consultar constantemente um dicionário. Parônimos: Registramos alguns parônimos que se
diferenciam pela oposição das vogais /e/ e /i/, /o/ e /u/.
Emprego da letra H Fixemos a grafia e o significado dos seguintes:

Esta letra, em início ou fim de palavras, não tem valor área = superfície
fonético; conservou-se apenas como símbolo, por força da ária = melodia, cantiga
arrear = pôr arreios, enfeitar

69
LÍNGUA PORTUGUESA
arriar = abaixar, pôr no chão, cair jérsei, jiu-jítsu, majestade, majestoso, manjedoura, manjericão,
comprido = longo ojeriza, pegajento, rijeza, sabujice, sujeira, traje, ultraje,
cumprido = particípio de cumprir varejista.
comprimento = extensão - Atenção: Moji, palavra de origem indígena, deve ser escrita
cumprimento = saudação, ato de cumprir com J. Por tradição algumas cidades de São Paulo adotam a
costear = navegar ou passar junto à costa grafia com G, como as cidades de Mogi das Cruzes e Mogi-
custear = pagar as custas, financiar Mirim.
deferir = conceder, atender
diferir = ser diferente, divergir Representação do fonema /S/
delatar = denunciar
dilatar = distender, aumentar O fonema /s/, conforme o caso, representa-se por:
descrição = ato de descrever - C, Ç: acetinado, açafrão, almaço, anoitecer, censura,
discrição = qualidade de quem é discreto cimento, dança, dançar, contorção, exceção, endereço, Iguaçu,
emergir = vir à tona maçarico, maçaroca, maço, maciço, miçanga, muçulmano,
imergir = mergulhar muçurana, paçoca, pança, pinça, Suíça, suíço, vicissitude.
emigrar = sair do país - S: ânsia, ansiar, ansioso, ansiedade, cansar, cansado,
imigrar = entrar num país estranho descansar, descanso, diversão, excursão, farsa, ganso,
emigrante = que ou quem emigra hortênsia, pretensão, pretensioso, propensão, remorso, sebo,
imigrante = que ou quem imigra tenso, utensílio.
eminente = elevado, ilustre - SS: acesso, acessório, acessível, assar, asseio, assinar,
iminente = que ameaça acontecer carrossel, cassino, concessão, discussão, escassez, escasso,
recrear = divertir essencial, expressão, fracasso, impressão, massa, massagista,
recriar = criar novamente missão, necessário, obsessão, opressão, pêssego, procissão,
soar = emitir som, ecoar, repercutir profissão, profissional, ressurreição, sessenta, sossegar, sossego,
suar = expelir suor pelos poros, transpirar submissão, sucessivo.
sortir = abastecer - SC, SÇ: acréscimo, adolescente, ascensão, consciência,
surtir = produzir (efeito ou resultado) consciente, crescer, cresço, descer, desço, desça, disciplina,
sortido = abastecido, bem provido, variado discípulo, discernir, fascinar, florescer, imprescindível,
surtido = produzido, causado néscio, oscilar, piscina, ressuscitar, seiscentos, suscetível,
vadear = atravessar (rio) por onde dá pé, passar a vau suscetibilidade, suscitar, víscera.
vadiar = viver na vadiagem, vagabundear, levar vida de - X: aproximar, auxiliar, auxílio, máximo, próximo,
vadio proximidade, trouxe, trouxer, trouxeram, etc.
- XC: exceção, excedente, exceder, excelência, excelente,
Emprego das letras G e J excelso, excêntrico, excepcional, excesso, excessivo, exceto,
excitar, etc.
Para representar o fonema /j/ existem duas letras; g e j.
Grafa-se este ou aquele signo não de modo arbitrário, mas de Homônimos
acordo com a origem da palavra. Exemplos: gesso (do grego
gypsos), jeito (do latim jactu) e jipe (do inglês jeep). acento = inflexão da voz, sinal gráfico
assento = lugar para sentar-se
Escrevem-se com G acético = referente ao ácido acético (vinagre)
ascético = referente ao ascetismo, místico
- Os substantivos terminados em –agem, -igem, -ugem: cesta = utensílio de vime ou outro material
garagem, massagem, viagem, origem, vertigem, ferrugem, sexta = ordinal referente a seis
lanugem. Exceção: pajem círio = grande vela de cera
- As palavras terminadas em –ágio, -égio, -ígio, -ógio, sírio = natural da Síria
-úgio: contágio, estágio, egrégio, prodígio, relógio, refúgio. cismo = pensão
- Palavras derivadas de outras que se grafam com g: sismo = terremoto
massagista (de massagem), vertiginoso (de vertigem), empoçar = formar poça
ferruginoso (de ferrugem), engessar (de gesso), faringite (de empossar = dar posse a
faringe), selvageria (de selvagem), etc. incipiente = principiante
- Os seguintes vocábulos: algema, angico, apogeu, auge, insipiente = ignorante
estrangeiro, gengiva, gesto, gibi, gilete, ginete, gíria, giz, intercessão = ato de interceder
hegemonia, herege, megera, monge, rabugento, sugestão, interseção = ponto em que duas linhas se cruzam
tangerina, tigela. ruço = pardacento
russo = natural da Rússia
Escrevem-se com J
Emprego de S com valor de Z
- Palavras derivadas de outras terminadas em –já: laranja
(laranjeira), loja (lojista, lojeca), granja (granjeiro, granjense), - Adjetivos com os sufixos –oso, -osa: gostoso, gostosa,
gorja (gorjeta, gorjeio), lisonja (lisonjear, lisonjeiro), sarja gracioso, graciosa, teimoso, teimosa, etc.
(sarjeta), cereja (cerejeira). - Adjetivos pátrios com os sufixos –ês, -esa: português,
- Todas as formas da conjugação dos verbos terminados em portuguesa, inglês, inglesa, milanês, milanesa, etc.
–jar ou –jear: arranjar (arranje), despejar (despejei), gorjear - Substantivos e adjetivos terminados em –ês, feminino –
(gorjeia), viajar (viajei, viajem) – (viagem é substantivo). esa: burguês, burguesa, burgueses, camponês, camponesa,
- Vocábulos cognatos ou derivados de outros que têm j: camponeses, freguês, freguesa, fregueses, etc.
laje (lajedo), nojo (nojento), jeito (jeitoso, enjeitar, projeção, - Verbos derivados de palavras cujo radical termina em –s:
rejeitar, sujeito, trajeto, trejeito). analisar (de análise), apresar (de presa), atrasar (de atrás),
- Palavras de origem ameríndia (principalmente tupi- extasiar (de êxtase), extravasar (de vaso), alisar (de liso), etc.
guarani) ou africana: canjerê, canjica, jenipapo, jequitibá, - Formas dos verbos pôr e querer e de seus derivados: pus,
jerimum, jiboia, jiló, jirau, pajé, etc. pusemos, compôs, impuser, quis, quiseram, etc.
- As seguintes palavras: alfanje, alforje, berinjela, cafajeste, - Os seguintes nomes próprios de pessoas: Avis, Baltasar,
cerejeira, intrujice, jeca, jegue, Jeremias, Jericó, Jerônimo, Brás, Eliseu, Garcês, Heloísa, Inês, Isabel, Isaura, Luís, Luísa,

70
LÍNGUA PORTUGUESA
Queirós, Resende, Sousa, Teresa, Teresinha, Tomás, Valdês. Emprego do X
- Os seguintes vocábulos e seus cognatos: aliás, anis, arnês,
ás, ases, através, avisar, besouro, colisão, convés, cortês, - Esta letra representa os seguintes fonemas:
cortesia, defesa, despesa, empresa, esplêndido, espontâneo, Ch – xarope, enxofre, vexame, etc.
evasiva, fase, frase, freguesia, fusível, gás, Goiás, groselha, CS – sexo, látex, léxico, tóxico, etc.
heresia, hesitar, manganês, mês, mesada, obséquio, obus, Z – exame, exílio, êxodo, etc.
paisagem, país, paraíso, pêsames, pesquisa, presa, presépio, SS – auxílio, máximo, próximo, etc.
presídio, querosene, raposa, represa, requisito, rês, reses, S – sexto, texto, expectativa, extensão, etc.
retrós, revés, surpresa, tesoura, tesouro, três, usina, vasilha,
vaselina, vigésimo, visita. - Não soa nos grupos internos –xce- e –xci-: exceção, exceder,
excelente, excelso, excêntrico, excessivo, excitar, inexcedível,
Emprego da letra Z etc.
- Os derivados em –zal, -zeiro, -zinho, -zinha, -zito, -zita: - Grafam-se com x e não com s: expectativa, experiente,
cafezal, cafezeiro, cafezinho, avezinha, cãozito, avezita, etc. expiar, expirar, expoente, êxtase, extasiado, extrair, fênix, texto,
- Os derivados de palavras cujo radical termina em –z: etc.
cruzeiro (de cruz), enraizar (de raiz), esvaziar (de vazio), etc. - Escreve-se x e não ch:
- Os verbos formados com o sufixo –izar e palavras cognatas: Em geral, depois de ditongo: caixa, baixo, faixa, feixe,
fertilizar, fertilizante, civilizar, civilização, etc. frouxo, ameixa, rouxinol, seixo, etc. Excetuam-se caucho e os
- Substantivos abstratos em –eza, derivados de adjetivos derivados cauchal, recauchutar e recauchutagem.
e denotando qualidade física ou moral: pobreza (de pobre), Geralmente, depois da sílaba inicial en-: enxada, enxame,
limpeza (de limpo), frieza (de frio), etc. enxamear, enxaguar, enxaqueca, enxergar, enxerto, enxoval,
- As seguintes palavras: azar, azeite, azáfama, azedo, enxugar, enxurrada, enxuto, etc. Excepcionalmente, grafam-
amizade, aprazível, baliza, buzinar, bazar, chafariz, cicatriz, se com ch: encharcar (de charco), encher e seus derivados
ojeriza, prezar, prezado, proeza, vazar, vizinho, xadrez. (enchente, preencher), enchova, enchumaçar (de chumaço),
enfim, toda vez que se trata do prefixo en- + palavra iniciada
Sufixo –ÊS e –EZ por ch.
Em vocábulos de origem indígena ou africana: abacaxi,
- O sufixo –ês (latim –ense) forma adjetivos (às vezes xavante, caxambu, caxinguelê, orixá, maxixe, etc.
substantivos) derivados de substantivos concretos: montês (de Nas seguintes palavras: bexiga, bruxa, coaxar, faxina, graxa,
monte), cortês (de corte), burguês (de burgo), montanhês (de lagartixa, lixa, lixo, mexer, mexerico, puxar, rixa, oxalá, praxe,
montanha), francês (de França), chinês (de China), etc. vexame, xarope, xaxim, xícara, xale, xingar, xampu.
- O sufixo –ez forma substantivos abstratos femininos
derivados de adjetivos: aridez (de árido), acidez (de ácido), Emprego do dígrafo CH
rapidez (de rápido), estupidez (de estúpido), mudez (de mudo)
avidez (de ávido) palidez (de pálido) lucidez (de lúcido), etc. Escreve-se com ch, entre outros os seguintes vocábulos:
bucha, charque, charrua, chavena, chimarrão, chuchu, cochilo,
Sufixo –ESA e –EZA fachada, ficha, flecha, mecha, mochila, pechincha, tocha.

Usa-se –esa (com s): Homônimos


- Nos seguintes substantivos cognatos de verbos terminados
em –ender: defesa (defender), presa (prender), despesa Bucho = estômago
(despender), represa (prender), empresa (empreender), Buxo = espécie de arbusto
surpresa (surpreender), etc. Cocha = recipiente de madeira
- Nos substantivos femininos designativos de títulos Coxa = capenga, manco
nobiliárquicos: baronesa, dogesa, duquesa, marquesa, princesa, Tacha = mancha, defeito; pequeno prego; prego de cabeça
consulesa, prioresa, etc. larga e chata, caldeira.
- Nas formas femininas dos adjetivos terminados em –ês: Taxa = imposto, preço de serviço público, conta, tarifa
burguesa (de burguês), francesa (de francês), camponesa (de Chá = planta da família das teáceas; infusão de folhas do
camponês), milanesa (de milanês), holandesa (de holandês), chá ou de outras plantas
etc. Xá = título do soberano da Pérsia (atual Irã)
- Nas seguintes palavras femininas: framboesa, indefesa, Cheque = ordem de pagamento
lesa, mesa, sobremesa, obesa, Teresa, tesa, toesa, turquesa, etc. Xeque = no jogo de xadrez, lance em que o rei é atacado
por uma peça adversária
Usa-se –eza (com z):
- Nos substantivos femininos abstratos derivados de Consoantes dobradas
adjetivos e denotando qualidades, estado, condição: beleza (de
belo), franqueza (de franco), pobreza (de pobre), leveza (de - Nas palavras portuguesas só se duplicam as consoantes
leve), etc. C, R, S.
- Escreve-se com CC ou CÇ quando as duas consoantes soam
Verbos terminados em –ISAR e –IZAR distintamente: convicção, occipital, cocção, fricção, friccionar,
facção, sucção, etc.
Escreve-se –isar (com s) quando o radical dos nomes - Duplicam-se o R e o S em dois casos: Quando,
correspondentes termina em –s. Se o radical não terminar em intervocálicos, representam os fonemas /r/ forte e /s/
–s, grafa-se –izar (com z): avisar (aviso + ar), analisar (análise sibilante, respectivamente: carro, ferro, pêssego, missão, etc.
+ ar), alisar (a + liso + ar), bisar (bis + ar), catalisar (catálise Quando a um elemento de composição terminado em vogal
+ ar), improvisar (improviso + ar), paralisar (paralisia + ar), seguir, sem interposição do hífen, palavra começada com /r/
pesquisar (pesquisa + ar), pisar, repisar (piso + ar), frisar ou /s/: arroxeado, correlação, pressupor, bissemanal, girassol,
(friso + ar), grisar (gris + ar), anarquizar (anarquia + izar), minissaia, etc.
civilizar (civil + izar), canalizar (canal + izar), amenizar
(ameno + izar), colonizar (colono + izar), vulgarizar (vulgar Questões
+ izar), motorizar (motor + izar), escravizar (escravo + izar),
cicatrizar (cicatriz + izar), deslizar (deslize + izar), matizar 01. Assinale a alternativa em que todas as palavras estão
(matiz + izar). grafadas segundo a ortografia oficial.

71
LÍNGUA PORTUGUESA
(A) Diante da paralização das atividades dos agentes dos Exemplo: cedo, flores, bote, pessoa, senhor, caju, tatus,
correios, pede-se a compreenção de todos, pois ouve exceções siri, abacaxis.
na distribuição dos processos. As sílabas que não são tônicas chamam-se átonas (=fracas),
(B) O revesamento dos funcionarios entre o Natal e o e podem ser pretônicas ou postônicas, conforme apareçam antes
Ano Novo será feito mediante sorteio, para que não ocorra ou depois da sílaba tônica. Exemplo: montanha, facilmente,
descriminação.
heroizinho.
(C) Durante o período de recessão, os chefes serão
encumbidos de controlar a imissão de faxes e copias xerox. De acordo com a posição da sílaba tônica, os vocábulos com
(D) A concessão de férias obedece a critérios legais, o mais de uma sílaba classificam-se em:
mesmo ocorrendo com os casos de rescisão contratual.
(E) É certo que os cuidados com o educando devem dobrar Oxítonos: quando a sílaba tônica é a última: café, rapaz,
durante a adolecencia, para que o jovem haja sempre de acordo escritor, maracujá.
com a lei. Paroxítonos: quando a sílaba tônica é a penúltima: mesa,
lápis, montanha, imensidade.
02. Proparoxítonos: quando a sílaba tônica é a
O “gilete” dos tablets antepenúltima: árvore, quilômetro, México.
Num mundo capitalista como este em que vivemos, onde
as empresa concorrem para posicionar suas marcas e fixar Monossílabos são palavras de uma só sílaba, conforme a
logotipos e slogans na cabeça dos consumidores, a síndrome do intensidade com que se proferem, podem ser tônicos ou átonos.
“Gillete” pode ser decisiva para a perpetuação de um produto. É
isso que preocupa a concorrência do iPad, tablet da Apple. Monossílabos tônicos são os que têm autonomia
Assim como a marca de Lâminas de barbear tornou-se fonética, sendo proferidos fortemente na frase em que
sinônimo de todas categoria de barbeadores, eclipsando o aparecem: é, má, si, dó, nó, eu, tu, nós, ré, pôr, etc.
nome das marcas que ofericiam produtos similares, o mesmo
pode estar acontecendo com o tablet, lançado por Steve Jobs. O Monossílabos átonos são os que não têm autonomia
maior temor do mercado é que as pessoas passem a se referir fonética, sendo proferidos fracamente, como se fossem sílabas
aos tablets como “iPad” em geral, dizendo “iPad da Samsung” ou
átonas do vocábulo a que se apoiam. São palavras vazias de
“iPad da Motorola”, e assim por diante.
[...] O mesmo se deu com os lenços Kleenex, os curativos sentido como artigos, pronomes oblíquos, elementos de ligação,
Band-aid e as fotocopiadoras Xerox. Resta saber se os preposições, conjunções: o, a, os, as, um, uns, me, te, se, lhe,
consumidores se habituarão com outros nomes para o produto nos, de, em, e, que.
tecnológico.
Acentuação dos Vocábulos Proparoxítonos
No texto I, a palavra “gilete” (com inicial minúscula e Todos os vocábulos proparoxítonos são acentuados na vogal
apenas uma letra “L” na segunda sílaba) compõe o título, ao tônica:
passo que no primeiro parágrafo tem-se a forma “Gillette” (com - Com acento agudo se a vogal tônica for i, u ou a, e, o
inicial maiúscula e duas letras “L” na segunda sílaba). Julgue as abertos: xícara, úmido, queríamos, lágrima, término, déssemos,
afirmativas a respeito dessa diferença.
lógico, binóculo, colocássemos, inúmeros, polígono, etc.
I. A diferença de grafia entre as duas formas é fruto de um
erro de ortografia. - Com acento circunflexo se a vogal tônica for fechada
II. A diferença de grafia se dá devido “gilete”, do título, ser ou nasal: lâmpada, pêssego, esplêndido, pêndulo, lêssemos,
um nome comum e “Gillette”, do primeiro parágrafo, um nome estômago, sôfrego, fôssemos, quilômetro, sonâmbulo etc.
próprio.
III. Há diferença entre as formas por “Gillette” ser parte Acentuação dos Vocábulos Paroxítonos
do nome de um problema recorrente em economia chamado Acentuam-se com acento adequado os vocábulos
síndrome do “Gillette”. paroxítonos terminados em:
IV. Há diferença entre as formas por “gilete” ser a designação - ditongo crescente, seguido, ou não, de s: sábio, róseo,
de qualquer lâmina descartável de barbear e “Gillette”, uma planície, nódua, Márcio, régua, árdua, espontâneo, etc.
lâmina descartável de uma marca específica.
- i, is, us, um, uns: táxi, lápis, bônus, álbum, álbuns, jóquei,
Estão corretas apenas as afirmativas vôlei, fáceis, etc.
(A) I e III. - l, n, r, x, ons, ps: fácil, hífen, dólar, látex, elétrons, fórceps,
(B) II e III. etc.
(C) II e IV. - ã, ãs, ão, ãos, guam, guem: ímã, ímãs, órgão, bênçãos,
(D) III e IV. enxáguam, enxáguem, etc.
Respostas Não se acentua um paroxítono só porque sua vogal tônica
01. D / 02. C é aberta ou fechada. Descabido seria o acento gráfico, por
exemplo, em cedo, este, espelho, aparelho, cela, janela, socorro,
Acentuação gráfica pessoa, dores, flores, solo, esforços.

Tonicidade Acentuação dos Vocábulos Oxítonos


Acentuam-se com acento adequado os vocábulos oxítonos
Num vocábulo de duas ou mais sílabas, há, em geral, uma terminados em:
que se destaca por ser proferida com mais intensidade que as - a, e, o, seguidos ou não de s: xará, serás, pajé, freguês,
outras: é a sílaba tônica. Nela recai o acento tônico, também vovô, avós, etc. Seguem esta regra os infinitivos seguidos de
chamado acento de intensidade ou prosódico. Exemplos: café, pronome: cortá-los, vendê-los, compô-lo, etc.
janela, médico, estômago, colecionador. - em, ens: ninguém, armazéns, ele contém, tu conténs, ele
O acento tônico é um fato fonético e não deve ser confundido convém, ele mantém, eles mantêm, ele intervém, eles intervêm,
com o acento gráfico (agudo ou circunflexo) que às vezes o etc.
assinala. A sílaba tônica nem sempre é acentuada graficamente.

72
LÍNGUA PORTUGUESA
Acentuação dos Monossílabos - pôlo (substantivo - gavião ou falcão com menos de um
Acentuam-se os monossílabos tônicos: a, e, o, seguidos ou ano) - para diferenciar de polo (combinação popular regional
não de s: há, pá, pé, mês, nó, pôs, etc. de por com os artigos o, os);

Acentuação dos Ditongos Emprego do Til


Acentuam-se a vogal dos ditongos abertos éi, éu, ói, quando O til sobrepõe-se às letras “a” e “o” para indicar vogal nasal.
tônicos. Pode figurar em sílaba:
Segundo as novas regras os ditongos abertos “éi” e “ói” não - tônica: maçã, cãibra, perdão, barões, põe, etc;
são mais acentuados em palavras paroxítonas: assembléia, - pretônica: ramãzeira, balõezinhos, grã-fino, cristãmente,
platéia, idéia, colméia, boléia, Coréia, bóia, paranóia, jibóia, etc;
apóio, heróico, paranóico, etc. Ficando: Assembleia, plateia, - átona: órfãs, órgãos, bênçãos, etc.
ideia, colmeia, boleia, Coreia, boia, paranoia, jiboia, apoio,
heroico, paranoico, etc. Trema (o trema não é acento gráfico)
Nos ditongos abertos de palavras oxítonas terminadas Desapareceu o trema sobre o /u/ em todas as palavras
em éi, éu e ói e monossílabas o acento continua: herói, do português: Linguiça, averiguei, delinquente, tranquilo,
constrói, dói, anéis, papéis, troféu, céu, chapéu. linguístico. Exceto em palavras de línguas estrangeiras: Günter,
Gisele Bündchen, müleriano.
Acentuação dos Hiatos
A razão do acento gráfico é indicar hiato, impedir a Questões
ditongação. Compare: caí e cai, doído e doido, fluído e fluido.
- Acentuam-se em regra, o /i/ e o /u/ tônicos em hiato 01.
com vogal ou ditongo anterior, formando sílabas sozinhas ou Um estudo feito pela Universidade de Michigan constatou
com s: saída (sa-í-da), saúde (sa-ú-de), faísca, caíra, saíra, que o que mais se faz no Facebook, depois de interagir com
egoísta, heroína, caí, Xuí, Luís, uísque, balaústre, juízo, país, amigos, é olhar os perfis de pessoas que acabamos de conhecer.
cafeína, baú, baús, Grajaú, saímos, eletroímã, reúne, construía, Se você gostar do perfil, adicionará aquela pessoa, e estará
proíbem, influí, destruí-lo, instruí-la, etc. formado um vínculo. No final, todo mundo vira amigo de
- Não se acentua o /i/ e o /u/ seguidos de nh: rainha, fuinha, todo mundo. Mas, não é bem assim. As redes sociais têm o
moinho, lagoinha, etc; e quando formam sílaba com letra que poder de transformar os chamados elos latentes (pessoas
não seja s: cair (ca-ir), sairmos, saindo, juiz, ainda, diurno, que frequentam o mesmo ambiente social, mas não são suas
Raul, ruim, cauim, amendoim, saiu, contribuiu, instruiu, etc. amigas) em elos fracos – uma forma superficial de amizade.
De acordo com as novas regras da Língua Portuguesa não se Pois é, por mais que existam exceções _______qualquer regra,
acentua mais o /i/ e /u/ tônicos formando hiato quando vierem todos os estudos mostram que amizades geradas com a ajuda
depois de ditongo: baiúca, boiúna, feiúra, feiúme, bocaiúva, da Internet são mais fracas, sim, do que aquelas que nascem
etc. Ficaram: baiuca, boiuna, feiura, feiume, bocaiuva, etc. e se desenvolvem fora dela. Isso não é inteiramente ruim.
Os hiatos “ôo” e “êe” não são mais acentuados: enjôo, vôo, Os seus amigos do peito geralmente são parecidos com você:
perdôo, abençôo, povôo, crêem, dêem, lêem, vêem, relêem. pertencem ao mesmo mundo e gostam das mesmas coisas. Os
Ficaram: enjoo, voo, perdoo, abençoo, povoo, creem, deem, elos fracos, não. Eles transitam por grupos diferentes do seu e,
leem, veem, releem. por isso, podem lhe apresentar novas pessoas e ampliar seus
horizontes – gerando uma renovação de ideias que faz bem
Acento Diferencial a todos os relacionamentos, inclusive às amizades antigas. O
Emprega-se o acento diferencial como sinal distintivo de problema é que a maioria das redes na Internet é simétrica: se
vocábulos homógrafos, nos seguintes casos: você quiser ter acesso às informações de uma pessoa ou mesmo
- pôr (verbo) - para diferenciar de por (preposição). falar reservadamente com ela, é obrigado a pedir a amizade
- verbo poder (pôde, quando usado no passado) dela. Como é meio grosseiro dizer “não” ________ alguém que
- é facultativo o uso do acento circunflexo para diferenciar você conhece, todo mundo acaba adicionando todo mundo. E
as palavras forma/fôrma. Em alguns casos, o uso do acento isso vai levando ________ banalização do conceito de amizade.
deixa a frase mais clara. Exemplo: Qual é a forma da fôrma do É verdade. Mas, com a chegada de sítios como o Twitter, ficou
bolo? diferente. Esse tipo de sítio é uma rede social completamente
assimétrica. E isso faz com que as redes de “seguidores” e
Segundo as novas regras da Língua Portuguesa não existe “seguidos” de alguém possam se comunicar de maneira muito
mais o acento diferencial em palavras homônimas (grafia igual, mais fluida. Ao estudar a sua própria rede no Twitter, o sociólogo
som e sentido diferentes) como: Nicholas Christakis, da Universidade de Harvard, percebeu
- côa(s) (do verbo coar) - para diferenciar de coa, coas (com que seus amigos tinham começado a se comunicar entre si
+ a, com + as); independentemente da mediação dele. Pessoas cujo único
- pára (3ª pessoa do singular do presente do indicativo do ponto em comum era o próprio Christakis acabaram ficando
verbo parar) - para diferenciar de para (preposição); amigas. No Twitter, eu posso me interessar pelo que você tem a
- péla (do verbo pelar) e em péla (jogo) - para diferenciar dizer e começar a te seguir. Nós não nos conhecemos. Mas você
de pela (combinação da antiga preposição per com os artigos saberá quando eu o retuitar ou mencionar seu nome no sítio,
ou pronomes a, as); e poderá falar comigo. Meus seguidores também podem se
- pêlo (substantivo) e pélo (v. pelar) - para diferenciar de interessar pelos seus tuítes e começar a seguir você. Em suma,
pelo (combinação da antiga preposição per com os artigos o, nós continuaremos não nos conhecendo, mas as pessoas que
os); estão ________ nossa volta podem virar amigas entre si.
- péra (substantivo - pedra) - para diferenciar de pera
(forma arcaica de para - preposição) e pêra (substantivo); Adaptado de: COSTA, C. C.. Disponível em:
- pólo (substantivo) - para diferenciar de polo (combinação <http://super.abril.com.br/cotidiano/como-internet-estamudando-
popular regional de por com os artigos o, os); amizade-619645.shtml>.Acesso em: 1º de outubro de 2012.

73
LÍNGUA PORTUGUESA
Considere as seguintes afirmações sobre acentuação gráfica. Pontuação
I. A palavra têm recebe acento gráfico pela mesma regra
que prescreve o uso do acento em alguém. Os sinais de pontuação são sinais gráficos empregados na
II. A palavra você é acentuada pela mesma regra que língua escrita para tentar recuperar recursos específicos da
determina o uso do acento em saberá. língua falada, tais como: entonação, jogo de silêncio, pausas,
III. A palavra tuítes, distintamente da palavra fluida, recebe etc.
acento gráfico porque apresenta duas vogais contíguas que
pertencem a sílabas diferentes. Ponto ( . )
- indicar o final de uma frase declarativa: Lembro-me muito
Quais estão corretas bem dele.
(A) Apenas I. - separar períodos entre si: Fica comigo. Não vá embora.
(B) Apenas II. - nas abreviaturas: Av.; V. Ex.ª
(C) Apenas III.
(D) Apenas II e III. Vírgula ( , ): É usada para marcar uma pausa do enunciado
(E) I, II e III. com a finalidade de nos indicar que os termos por ela separados,
apesar de participarem da mesma frase ou oração, não formam
02. uma unidade sintática: Lúcia, esposa de João, foi a ganhadora
A água, ingrediente essencial à vida, certamente é o única da Sena.
recurso mais precioso de que a humanidade dispõe. Embora Podemos concluir que, quando há uma relação sintática
se observe pelo mundo tanta negligência e falta de visão com entre termos da oração, não se pode separá-los por meio de
relação a esse bem vital, é de se esperar que os seres humanos vírgula. Não se separam por vírgula:
procurem preservar e manter os reservatórios naturais desse - predicado de sujeito;
líquido precioso. De fato, o futuro da espécie humana e de - objeto de verbo;
muitas outras espécies pode ficar comprometido, a menos - adjunto adnominal de nome;
que haja uma melhora significativa no gerenciamento dos - complemento nominal de nome;
recursos hídricos. Entre esses fatores que mais têm afetado esse - predicativo do objeto;
recurso estão o crescimento populacional e a grande expansão - oração principal da subordinada substantiva (desde que
dos setores produtivos, como a agricultura e a indústria. Essa esta não seja apositiva nem apareça na ordem inversa).
situação, responsável pelo consumo e também pela poluição da
água em escala exponencial, tem conduzido à necessidade de Ponto-e-Vírgula ( ; )
reformulação do seu gerenciamento. No ambiente agrícola, as
perspectivas de mudança decorrem das alterações do clima, - separar os itens de uma lei, de um decreto, de uma petição,
que afetarão sensivelmente não só a disponibilidade de água, de uma sequência, etc:
mas também a sobrevivência de diversas espécies de animais Art. 127 – São penalidades disciplinares:
e vegetais. O atual estado de conhecimento técnico-científico I- advertência;
nesse âmbito já permite a adoção e implementação de ténicas II- suspensão;
direcionadas para o equilíbrio ambiental, porém o desafio está III- demissão;
em colocá-las em prática, uma vez que isso implica mudança IV- cassação de aposentadoria ou disponibilidade;
de comportamento e de atitude por parte do produtor, aliadas V- destituição de cargo em comissão;
à necessidade de uma política pública que valorize a adoção VI- destituição de função comissionada. (cap. V das
dessas medidas. penalidades Direito Administrativo)
Marco Antonio Ferreira Gomes e Lauro Charlet Pereira. Água no século XXI:
desafios e oportunidade. Internet: www.agsolve.com.br (com adaptações) - separar orações coordenadas muito extensas ou orações
coordenadas nas quais já tenham tido utilizado a vírgula:
As palavras “negligência”, “reservatórios”, “espécie” e “O rosto de tez amarelenta e feições inexpressivas, numa
“equilíbrio” apresentam acentuação gráfica em decorrência da quietude apática, era pronunciadamente vultuoso, o que mais
mesma regra gramatical. se acentuava no fim da vida, quando a bronquite crônica de
Certo ( ) Errado ( ) que sofria desde moço se foi transformando em opressora asma
cardíaca; os lábios grossos, o inferior um tanto tenso (...)”
03.Observe as palavras acentuadas, em destaque no (Visconde de Taunay)
seguinte texto:
A Itália empreende atualmente uma revolução em sua Dois-Pontos ( : )
indústria vinícola, apresentando modernos e dinâmicos vinhos, - iniciar a fala dos personagens: Então o padre respondeu:
não abandonando seu inigualável caráter gastronômico. - Parta agora.
- antes de apostos ou orações apositivas, enumerações ou
Assinale a alternativa cujas palavras são acentuadas, sequência de palavras que explicam, resumem ideias anteriores:
respectivamente, segundo as regras que determinam a Meus amigos são poucos: Fátima, Rodrigo e Gilberto.
acentuação das palavras destacadas no texto. - antes de citação: Como já dizia Vinícius de Morais: “Que o
(A) Saída; mostrará; hífen. amor não seja eterno posto que é chama, mas que seja infinito
(B) Comprá-la; político; nível. enquanto dure.”
(C) Ócio; fenômeno; inútil.
(D) Dá-lo; anônima; estéril. Ponto de Interrogação ( ? )
(E) Eólica; órfã; ninguém. - Em perguntas diretas: Como você se chama?
- Às vezes, juntamente com o ponto de exclamação: Quem
Respostas ganhou na loteria? Você. Eu?!
01. D / 02. “CERTA” / 03. C

74
LÍNGUA PORTUGUESA
Ponto de Exclamação ( ! ) Colchetes ( [] )
- Após vocativo: “Parte, Heliel!” ( As violetas de Nossa Sra.- Utilizados na linguagem científica.
Humberto de Campos).
- Após imperativo: Cale-se! Asterisco ( * )
- Após interjeição: Ufa! Ai! Empregado para chamar a atenção do leitor para alguma
- Após palavras ou frases que denotem caráter emocional: nota (observação).
Que pena!
Barra ( / )
Reticências ( ... ) Aplicada nas abreviações das datas e em algumas
- indicar dúvidas ou hesitação do falante: Sabe...eu queria abreviaturas.
te dizer que...esquece.
- interrupção de uma frase deixada gramaticalmente +tIHQ ï
incompleta: Alô! João está? Agora não se encontra. Quem sabe Usado para ligar elementos de palavras compostas e para
se ligar mais tarde... unir pronomes átonos a verbos. Exemplo: guarda-roupa
- ao fim de uma frase gramaticalmente completa com a
intenção de sugerir prolongamento de ideia: “Sua tez, alva e Questões
pura como um foco de algodão, tingia-se nas faces duns longes
cor-de-rosa...” (Cecília- José de Alencar) 01. Assinale dentre as alternativas a frase que apresenta
- indicar supressão de palavra (s) numa frase transcrita: pontuação adequada:
“Quando penso em você (...) menos a felicidade.” (Canteiros - (A) Mãe, venha até meu quarto.
Raimundo Fagner) (B) Curitiba 27 de outubro de 2012.
(C) O menino, sentia-se mal.
Aspas ( “ ” ) (D) Onde estão os nossos: pais, vizinhos.
- isolar palavras ou expressões que fogem à norma culta, (E) Assim permite-se roupas, curtas.
como gírias, estrangeirismos, palavrões, neologismos, arcaísmos
e expressões populares: Maria ganhou um apaixonado “ósculo” 02. Assinale a opção em que o uso da vírgula é utilizado em
do seu admirador; A festa na casa de Lúcio estava “chocante”; uma expressão conclusiva.
Conversando com meu superior, dei a ele um “feedback” do (A) O tempo está feio, isto é, choverá ainda esta manhã.
serviço a mim requerido. (B) Daqui a pouco, iremos todos ao mercado.
- indicar uma citação textual: “Ia viajar! Viajei. Trinta e (C) O tempo está feio, portanto, choverá em breve.
quatro vezes, às pressas, bufando, com todo o sangue na face, (D) Gabriela, a bonita garota, está cheia de alegria.
desfiz e refiz a mala”. (O prazer de viajar - Eça de Queirós) (E) Cheios de esperança, os meninos saíram alegres.

Se, dentro de um trecho já destacado por aspas, se fizer 03. Indique a opção em que o trecho está incorreto
necessário a utilização de novas aspas, estas serão simples. ( gramaticalmente.
‘ ‘) (A) As transformações tecnológicas, já que não existe
sociedade civilizada sem lei, apenas tornam mais complexas
Parênteses ( () ) as regras que, muitas vezes, incomodam e atrapalham,
- isolar palavras, frases intercaladas de caráter explicativo mas que continuarão sendo uma garantia fundamental de
e datas: Na 2ª Guerra Mundial (1939-1945), ocorreu inúmeras desenvolvimento com justiça.
perdas humanas; “Uma manhã lá no Cajapió (Joca lembrava- (B) Não existe sociedade civilizada sem lei e as
se como se fora na véspera), acordara depois duma grande transformações tecnológicas apenas tornam mais complexas
tormenta no fim do verão”. (O milagre das chuvas no nordeste- as regras que, muitas vezes, incomodam e atrapalham,
Graça Aranha) mas que continuarão sendo uma garantia fundamental de
desenvolvimento com justiça.
Os parênteses também podem substituir a vírgula ou o (C) Não existe sociedade civilizada sem lei, por isso as
travessão. transformações tecnológicas apenas tornam mais complexas
as regras que, muitas vezes, incomodam e atrapalham, mas,
Travessão (__ ) no entanto, continuarão sendo uma garantia fundamental de
- dar início à fala de um personagem: O filho perguntou: desenvolvimento com justiça.
__Pai, quando começarão as aulas? (D) Não existe sociedade civilizada sem lei. As
- indicar mudança do interlocutor nos diálogos. __Doutor, o transformações tecnológicas apenas tornam mais complexas as
que tenho é grave? __Não se preocupe, é uma simples infecção. regras que, muitas vezes incomodam e atrapalham, mas que,
É só tomar um antibiótico e estará bom. continuarão sendo garantias fundamentais de desenvolvimento
- unir grupos de palavras que indicam itinerário: A rodovia com justiça.
Belém-Brasília está em péssimo estado. (E) As transformações tecnológicas apenas tornam
Também pode ser usado em substituição à virgula, em mais complexas as regras que, muitas vezes, incomodam
expressões ou frases explicativas: Xuxa – a rainha dos baixinhos e atrapalham, mas que continuarão sendo uma garantia
– é loira. fundamental de desenvolvimento com justiça. Não existe
sociedade civilizada sem lei.
Parágrafo
Constitui cada uma das secções de frases de um escritor; 04. Uma outra maneira igualmente correta de reescrever-
começa por letra maiúscula, um pouco além do ponto em que se a frase “Os riscos da inflação podem ser calculados, e o
começam as outras linhas. prejuízo financeiro deles, previsto”, mantendo-se o seu sentido
original é:
(A) Podem ser calculados e previstos os riscos da inflação e

75
LÍNGUA PORTUGUESA
seu prejuízo financeiro. ————————————————————————
(B) Os riscos da inflação e seu prejuízo financeiro podem
ser calculados e previstos. ————————————————————————
(C) Podem ser calculados os riscos da inflação e pode ser ————————————————————————
previsto seu prejuízo financeiro.
(D) Podem ser calculados os prejuízos financeiros e ————————————————————————
calculados seus riscos inflacionários.
(E) Podem ser calculados os prejuízos financeiros advindos ————————————————————————
dos riscos inflacionários. ————————————————————————
05. Está inteiramente adequada a pontuação da seguinte ————————————————————————
frase:
(A) A LRF permite, entre outras coisas que, a oposição e a ————————————————————————
população, fiscalizem a administração das verbas públicas.
————————————————————————
(B) Alegam alguns prefeitos, que encontram dificuldades,
para fazer frente aos gastos que a Constituição determina, nas ————————————————————————
áreas da saúde e da educação.
(C) São graves as penas previstas para quem descumpre, ————————————————————————
por negligência ou má fé, as normas de responsabilidade fiscal
————————————————————————
da lei promulgada em 2000.
(D) Fazem parte da LRF, as instruções que definem os ————————————————————————
limites para as despesas de pessoal, e as regras para a criação
de dívidas. ————————————————————————
(E) Qualquer cidadão pode, graças à promulgação da LRF
————————————————————————
entrar com ação judicial para fazê-la cumprir, conforme sua
regulamentação. ————————————————————————
Respostas ————————————————————————
01. A / 02. C / 03. D / 04. C / 05. C
————————————————————————
————————————————————————
————————————————————————
————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————
———————————————————————— ————————————————————————--

76
8QLYHUVLGDGH )HGHUDOGR5LRGH-DQHLUR
 /HJLVODomR 

/(*,6/$d®2
,, DVDXWDUTXLDVDVIXQGDo}HVS~EOLFDVDVHPSUHVDV
/HLQž S~EOLFDV DV VRFLHGDGHV GH HFRQRPLD PLVWD H
GHPDLVHQWLGDGHVFRQWURODGDVGLUHWDRXLQGLUHWD
/HLGH$FHVVRj,QIRUPDomR PHQWH SHOD 8QLmR (VWDGRV 'LVWULWR )HGHUDO H
0XQLFtSLRV

5HJXOD R DFHVVR D LQIRUPDo}HV SUHYLVWR QR LQFLVR $UWž $SOLFDPVH DV GLVSRVLo}HV GHVWD /HL QRTXH
;;;,,,GRDUWžQRLQFLVR,,GR†žGRDUWHQR†žGR FRXEHUjVHQWLGDGHVSULYDGDVVHPILQVOXFUDWLYRV
DUWGD&RQVWLWXLomR)HGHUDODOWHUDD/HLQžGH TXHUHFHEDPSDUDUHDOL]DomRGHDo}HVGHLQWHUHV
GHGH]HPEURGHUHYRJDD/HLQžGHGH VH S~EOLFR UHFXUVRV S~EOLFRV GLUHWDPHQWH GR
PDLRGHHGLVSRVLWLYRVGD/HLQžGHGHMDQHLUR RUoDPHQWR RX PHGLDQWH VXEYHQo}HV VRFLDLV
GHHGiRXWUDVSURYLGrQFLDV FRQWUDWRGHJHVWmRWHUPRGHSDUFHULDFRQYrQLRV
DFRUGRDMXVWHVRXRXWURVLQVWUXPHQWRVFRQJrQH
&$3Ì78/2, UHV
',6326,d¯(6*(5$,6
†~QLFR $SXEOLFLGDGHDTXHHVWmRVXEPHWLGDVDVHQWLGD
$UWž (VWD/HLGLVS}HVREUHRVSURFHGLPHQWRVDVHUHP GHV FLWDGDV QR FDSXW UHIHUHVH j SDUFHOD GRV
REVHUYDGRVSHOD8QLmR(VWDGRV'LVWULWR)HGHUDO UHFXUVRVS~EOLFRVUHFHELGRVHjVXDGHVWLQDomR
H0XQLFtSLRVFRPRILPGHJDUDQWLURDFHVVRD VHP SUHMXt]R GDV SUHVWDo}HV GH FRQWDV D TXH
LQIRUPDo}HVSUHYLVWRQRLQFLVR;;;,,,GRDUWR HVWHMDPOHJDOPHQWHREULJDGDV
QRLQFLVR,,GR†žGRDUWHQR†žGRDUW
GD&RQVWLWXLomR)HGHUDO $UWž 2VSURFHGLPHQWRVSUHYLVWRVQHVWD/HLGHVWLQDPVH
D DVVHJXUDU R GLUHLWR IXQGDPHQWDO GH DFHVVR j
†~QLFR 6XERUGLQDPVHDRUHJLPHGHVWD/HL LQIRUPDomRHGHYHPVHUH[HFXWDGRVHPFRQIRUPL
GDGHFRPRVSULQFtSLRVEiVLFRVGDDGPLQLVWUDomR
, RVyUJmRVS~EOLFRVLQWHJUDQWHVGDDGPLQLVWUDomR S~EOLFDHFRPDVVHJXLQWHVGLUHWUL]HV
GLUHWDGRV3RGHUHV([HFXWLYR/HJLVODWLYRLQFOXLQ
GRDV&RUWHVGH&RQWDVH-XGLFLiULRHGR0LQLVWp , REVHUYkQFLDGDSXEOLFLGDGHFRPRSUHFHLWRJHUDO
HGRVLJLORFRPRH[FHomR
ULR3~EOLFR
 /HJLVODomR 8QLYHUVLGDGH)HGHUDOGR5LRGH-DQHLUR


,, GLYXOJDomRGHLQIRUPDo}HVGHLQWHUHVVHS~EOLFR &$3Ì78/2,,


LQGHSHQGHQWHPHQWHGHVROLFLWDo}HV '2$&(662$,1)250$d¯(6
('$68$',98/*$d®2
,,, XWLOL]DomRGHPHLRVGHFRPXQLFDomRYLDELOL]DGRV
SHODWHFQRORJLDGDLQIRUPDomR $UWž &DEH DRV yUJmRV H HQWLGDGHV GR SRGHUS~EOLFR
REVHUYDGDVDVQRUPDVHSURFHGLPHQWRVHVSHFtIL
,9 IRPHQWRDRGHVHQYROYLPHQWRGDFXOWXUDGHWUDQV FRVDSOLFiYHLVDVVHJXUDUD
SDUrQFLDQDDGPLQLVWUDomRS~EOLFD
, JHVWmRWUDQVSDUHQWHGDLQIRUPDomRSURSLFLDQGR
9 GHVHQYROYLPHQWRGRFRQWUROHVRFLDOGDDGPLQLV DPSORDFHVVRDHODHVXDGLYXOJDomR
WUDomRS~EOLFD
,, SURWHomRGDLQIRUPDomRJDUDQWLQGRVHVXDGLVSR
$UWž 3DUDRVHIHLWRVGHVWD/HLFRQVLGHUDVH QLELOLGDGHDXWHQWLFLGDGHHLQWHJULGDGHH

, LQIRUPDomR GDGRV SURFHVVDGRVRXQmRTXH ,,, SURWHomRGDLQIRUPDomRVLJLORVDHGDLQIRUPDomR


SRGHPVHUXWLOL]DGRVSDUDSURGXomRHWUDQVPLV SHVVRDOREVHUYDGDDVXDGLVSRQLELOLGDGHDXWHQWL
VmR GH FRQKHFLPHQWR FRQWLGRV HP TXDOTXHU FLGDGHLQWHJULGDGHHHYHQWXDOUHVWULomRGHDFHV
PHLRVXSRUWHRXIRUPDWR VR

,, GRFXPHQWRXQLGDGHGHUHJLVWURGHLQIRUPDo}HV $UWž 2 DFHVVR j LQIRUPDomR GH TXH WUDWD HVWD/HL


TXDOTXHUTXHVHMDRVXSRUWHRXIRUPDWR FRPSUHHQGHHQWUHRXWURVRVGLUHLWRVGHREWHU

,,, LQIRUPDomRVLJLORVDDTXHODVXEPHWLGDWHPSRUDUL , RULHQWDomRVREUHRVSURFHGLPHQWRVSDUDDFRQVH


DPHQWHjUHVWULomRGHDFHVVRS~EOLFRHPUD]mRGH FXomRGHDFHVVREHPFRPRVREUHRORFDORQGH
VXD LPSUHVFLQGLELOLGDGH SDUD D VHJXUDQoD GD SRGHUi VHU HQFRQWUDGD RX REWLGD D LQIRUPDomR
VRFLHGDGHHGR(VWDGR DOPHMDGD

,9 LQIRUPDomRSHVVRDODTXHODUHODFLRQDGDjSHVVRD ,, LQIRUPDomRFRQWLGDHPUHJLVWURVRXGRFXPHQWRV


QDWXUDOLGHQWLILFDGDRXLGHQWLILFiYHO SURGX]LGRV RX DFXPXODGRV SRU VHXV yUJmRV RX
HQWLGDGHVUHFROKLGRVRXQmRDDUTXLYRVS~EOLFRV
9 WUDWDPHQWR GD LQIRUPDomR FRQMXQWRGHDo}HV
UHIHUHQWHV j SURGXomR UHFHSomR FODVVLILFDomR ,,, LQIRUPDomRSURGX]LGDRXFXVWRGLDGDSRUSHVVRD
XWLOL]DomRDFHVVRUHSURGXomRWUDQVSRUWHWUDQV ItVLFDRXHQWLGDGHSULYDGDGHFRUUHQWHGHTXDOTXHU
YtQFXOR FRP VHXV yUJmRV RX HQWLGDGHV PHVPR
PLVVmR GLVWULEXLomR DUTXLYDPHQWR DUPD]HQD
TXHHVVHYtQFXORMiWHQKDFHVVDGR
PHQWR HOLPLQDomR DYDOLDomR GHVWLQDomR RX
FRQWUROHGDLQIRUPDomR
,9 LQIRUPDomRSULPiULDtQWHJUDDXWrQWLFDHDWXDOL
]DGD
9, GLVSRQLELOLGDGH TXDOLGDGH GD LQIRUPDomRTXH
SRGH VHU FRQKHFLGD H XWLOL]DGD SRU LQGLYtGXRV
9 LQIRUPDomR VREUH DWLYLGDGHVH[HUFLGDVSHORV
HTXLSDPHQWRVRXVLVWHPDVDXWRUL]DGRV
yUJmRV H HQWLGDGHV LQFOXVLYH DV UHODWLYDV j VXD
SROtWLFDRUJDQL]DomRHVHUYLoRV
9,, DXWHQWLFLGDGH TXDOLGDGH GD LQIRUPDomRTXH
WHQKD VLGR SURGX]LGD H[SHGLGD UHFHELGD RX 9, LQIRUPDomRSHUWLQHQWHjDGPLQLVWUDomRGRSDWUL
PRGLILFDGDSRUGHWHUPLQDGRLQGLYtGXRHTXLSD P{QLR S~EOLFR XWLOL]DomR GH UHFXUVRV S~EOLFRV
PHQWRRXVLVWHPD OLFLWDomRFRQWUDWRVDGPLQLVWUDWLYRVH

9,,, LQWHJULGDGHTXDOLGDGHGDLQIRUPDomRQmRPRGLIL 9,, LQIRUPDomRUHODWLYD


FDGDLQFOXVLYHTXDQWRjRULJHPWUkQVLWRHGHVWL
QR D jLPSOHPHQWDomRDFRPSDQKDPHQWRHUHVXOWD
GRV GRV SURJUDPDV SURMHWRV H Do}HV GRV
,; SULPDULHGDGHTXDOLGDGHGDLQIRUPDomRFROHWDGD yUJmRVHHQWLGDGHVS~EOLFDVEHPFRPRPHWDV
QDIRQWHFRPRPi[LPRGHGHWDOKDPHQWRSRVVt HLQGLFDGRUHVSURSRVWRV
YHOVHPPRGLILFDo}HV
E DRUHVXOWDGRGHLQVSHo}HVDXGLWRULDVSUHVWD
$UWž eGHYHUGR(VWDGRJDUDQWLURGLUHLWRGHDFHVVRj o}HV H WRPDGDV GH FRQWDV UHDOL]DGDV SHORV
LQIRUPDomR TXH VHUi IUDQTXHDGD PHGLDQWH yUJmRVGHFRQWUROHLQWHUQRHH[WHUQRLQFOXLQ
SURFHGLPHQWRVREMHWLYRVHiJHLVGHIRUPDWUDQV GRSUHVWDo}HVGHFRQWDVUHODWLYDVDH[HUFtFLRV
SDUHQWHFODUDHHPOLQJXDJHPGHIiFLOFRPSUHHQ DQWHULRUHV
VmR
8QLYHUVLGDGH )HGHUDOGR5LRGH-DQHLUR
 /HJLVODomR 

†ž 2 DFHVVR j LQIRUPDomR SUHYLVWR QRFDSXWQmR 9, UHVSRVWDVDSHUJXQWDVPDLVIUHTXHQWHVGDVRFLHGD


FRPSUHHQGHDVLQIRUPDo}HVUHIHUHQWHVDSURMHWRV GH
GH SHVTXLVD H GHVHQYROYLPHQWR FLHQWtILFRV RX
WHFQROyJLFRV FXMR VLJLOR VHMD LPSUHVFLQGtYHO j †ž 3DUD FXPSULPHQWR GR GLVSRVWR QRFDSXWRV
VHJXUDQoDGDVRFLHGDGHHGR(VWDGR yUJmRVHHQWLGDGHVS~EOLFDVGHYHUmRXWLOL]DUWRGRV
RVPHLRVHLQVWUXPHQWRVOHJtWLPRVGHTXHGLVSXVH
†ž 4XDQGR QmR IRU DXWRUL]DGR DFHVVRLQWHJUDOj UHP VHQGR REULJDWyULD D GLYXOJDomR HP VtWLRV
LQIRUPDomR SRU VHU HOD SDUFLDOPHQWH VLJLORVD p RILFLDLVGDUHGHPXQGLDOGHFRPSXWDGRUHV LQWHU
DVVHJXUDGRRDFHVVRjSDUWHQmRVLJLORVDSRUPHLR QHW 
GHFHUWLGmRH[WUDWRRXFySLDFRPRFXOWDomRGD
SDUWHVREVLJLOR †ž 2VVtWLRVGHTXHWUDWDR†RGHYHUmRQDIRUPDGH
UHJXODPHQWRDWHQGHUHQWUHRXWURVDRVVHJXLQWHV
†ž 2GLUHLWRGHDFHVVRDRVGRFXPHQWRVRXjVLQIRU UHTXLVLWRV
PDo}HVQHOHVFRQWLGDVXWLOL]DGRVFRPRIXQGDPHQ
WRGDWRPDGDGHGHFLVmRHGRDWRDGPLQLVWUDWLYR , FRQWHUIHUUDPHQWDGHSHVTXLVDGHFRQWH~GRTXH
VHUi DVVHJXUDGR FRP D HGLomR GR DWR GHFLVyULR SHUPLWDRDFHVVRjLQIRUPDomRGHIRUPDREMHWLYD
UHVSHFWLYR WUDQVSDUHQWH FODUD H HP OLQJXDJHP GH IiFLO
FRPSUHHQVmR
†ž $ QHJDWLYD GH DFHVVR jV LQIRUPDo}HVREMHWRGH
SHGLGRIRUPXODGRDRVyUJmRVHHQWLGDGHVUHIHUL ,, SRVVLELOLWDUDJUDYDomRGHUHODWyULRVHPGLYHUVRV
GDVQRDUWRTXDQGRQmRIXQGDPHQWDGDVXMHL IRUPDWRV HOHWU{QLFRV LQFOXVLYH DEHUWRV H QmR
WDUiRUHVSRQViYHODPHGLGDVGLVFLSOLQDUHVQRV SURSULHWiULRV WDLV FRPR SODQLOKDV H WH[WR GH
WHUPRVGRDUWGHVWD/HL PRGRDIDFLOLWDUDDQiOLVHGDVLQIRUPDo}HV

†ž ,QIRUPDGRGRH[WUDYLRGDLQIRUPDomRVROLFLWDGD ,,, SRVVLELOLWDURDFHVVRDXWRPDWL]DGRSRUVLVWHPDV


SRGHUi R LQWHUHVVDGR UHTXHUHU j DXWRULGDGH H[WHUQRV HP IRUPDWRV DEHUWRV HVWUXWXUDGRV H
FRPSHWHQWH D LPHGLDWD DEHUWXUD GH VLQGLFkQFLD OHJtYHLVSRUPiTXLQD
SDUD DSXUDU R GHVDSDUHFLPHQWR GD UHVSHFWLYD
GRFXPHQWDomR ,9 GLYXOJDUHPGHWDOKHVRVIRUPDWRVXWLOL]DGRVSDUD
HVWUXWXUDomRGDLQIRUPDomR
†ž 9HULILFDGD D KLSyWHVH SUHYLVWD QR †RGHVWH
DUWLJRRUHVSRQViYHOSHODJXDUGDGDLQIRUPDomR 9 JDUDQWLU D DXWHQWLFLGDGH H DLQWHJULGDGHGDV
H[WUDYLDGD GHYHUi QR SUD]R GH  GH]  GLDV LQIRUPDo}HVGLVSRQtYHLVSDUDDFHVVR
MXVWLILFDURIDWRHLQGLFDUWHVWHPXQKDVTXHFRP
SURYHPVXDDOHJDomR 9, PDQWHU DWXDOL]DGDV DV LQIRUPDo}HVGLVSRQtYHLV
SDUDDFHVVR
$UWž eGHYHUGRVyUJmRVHHQWLGDGHVS~EOLFDVSURPR
YHU LQGHSHQGHQWHPHQWH GH UHTXHULPHQWRV D 9,, LQGLFDUORFDOHLQVWUXo}HVTXHSHUPLWDPDRLQWH
GLYXOJDomRHPORFDOGHIiFLODFHVVRQRkPELWRGH UHVVDGRFRPXQLFDUVHSRUYLDHOHWU{QLFDRXWHOHI{
VXDVFRPSHWrQFLDVGHLQIRUPDo}HVGHLQWHUHVVH QLFDFRPRyUJmRRXHQWLGDGHGHWHQWRUDGRVtWLR
FROHWLYRRXJHUDOSRUHOHVSURGX]LGDVRXFXVWRGLD H
GDV
9,,, DGRWDU DV PHGLGDV QHFHVViULDV SDUD JDUDQWLUD
†ž 1DGLYXOJDomRGDVLQIRUPDo}HVDTXHVHUHIHUHR
DFHVVLELOLGDGH GH FRQWH~GR SDUD SHVVRDV FRP
FDSXWGHYHUmRFRQVWDUQRPtQLPR
GHILFLrQFLD QRV WHUPRV GR DUW  GD /HL QR
GHGHGH]HPEURGHHGRDUWR
, UHJLVWURGDVFRPSHWrQFLDVHHVWUXWXUDRUJDQL]DFL
GD&RQYHQomRVREUHRV'LUHLWRVGDV3HVVRDVFRP
RQDOHQGHUHoRVHWHOHIRQHVGDVUHVSHFWLYDVXQLGD
'HILFLrQFLDDSURYDGDSHOR'HFUHWR/HJLVODWLYRQR
GHVHKRUiULRVGHDWHQGLPHQWRDRS~EOLFR
GHGHMXOKRGH
,, UHJLVWURVGHTXDLVTXHUUHSDVVHVRXWUDQVIHUrQFLDV
†ž 2V0XQLFtSLRVFRPSRSXODomRGHDWp GH]
GHUHFXUVRVILQDQFHLURV
PLO KDELWDQWHVILFDPGLVSHQVDGRVGDGLYXOJDomR
REULJDWyULD QD LQWHUQHW D TXH VH UHIHUH R † R
,,, UHJLVWURVGDVGHVSHVDV
PDQWLGD D REULJDWRULHGDGH GH GLYXOJDomR HP
WHPSRUHDOGHLQIRUPDo}HVUHODWLYDVjH[HFXomR
,9 LQIRUPDo}HV FRQFHUQHQWHV DSURFHGLPHQWRV
RUoDPHQWiULDHILQDQFHLUDQRVFULWpULRVHSUD]RV
OLFLWDWyULRV LQFOXVLYH RV UHVSHFWLYRV HGLWDLV H
UHVXOWDGRVEHPFRPRDWRGRVRVFRQWUDWRVFHOH SUHYLVWRVQRDUW%GD/HL&RPSOHPHQWDUQR
EUDGRV GHGHPDLRGH /HLGH5HVSRQVDELOL
GDGH)LVFDO 
9 GDGRVJHUDLVSDUDRDFRPSDQKDPHQWRGHSURJUD
PDVDo}HVSURMHWRVHREUDVGHyUJmRVHHQWLGD $UWž 2DFHVVRDLQIRUPDo}HVS~EOLFDVVHUiDVVHJXUDGR
GHVH PHGLDQWH
 /HJLVODomR 8QLYHUVLGDGH)HGHUDOGR5LRGH-DQHLUR


, FULDomRGHVHUYLoRGHLQIRUPDo}HVDRFLGDGmRQRV ,,, FRPXQLFDUTXHQmRSRVVXLDLQIRUPDomRLQGLFDU


yUJmRV H HQWLGDGHV GR SRGHU S~EOLFR HP ORFDO VHIRUGRVHXFRQKHFLPHQWRRyUJmRRXDHQWLGD
FRPFRQGLo}HVDSURSULDGDVSDUD GHTXHDGHWpPRXDLQGDUHPHWHURUHTXHULPHQ
WR D HVVH yUJmR RX HQWLGDGH FLHQWLILFDQGR R
D DWHQGHUHRULHQWDURS~EOLFRTXDQWRDRDFHVVR LQWHUHVVDGRGDUHPHVVDGHVHXSHGLGRGHLQIRUPD
DLQIRUPDo}HV omR

E LQIRUPDU VREUH D WUDPLWDomR GH GRFXPHQWRV †ž 2SUD]RUHIHULGRQR†RSRGHUiVHUSURUURJDGR


QDVVXDVUHVSHFWLYDVXQLGDGHV SRU PDLV  GH]  GLDV PHGLDQWH MXVWLILFDWLYD
H[SUHVVDGDTXDOVHUiFLHQWLILFDGRRUHTXHUHQWH
F SURWRFROL]DUGRFXPHQWRVHUHTXHULPHQWRVGH
DFHVVRDLQIRUPDo}HVH †ž 6HP SUHMXt]R GD VHJXUDQoD H GDSURWHomRGDV
LQIRUPDo}HV H GR FXPSULPHQWR GD OHJLVODomR
,, UHDOL]DomR GH DXGLrQFLDV RX FRQVXOWDVS~EOLFDV DSOLFiYHO R yUJmR RX HQWLGDGH SRGHUi RIHUHFHU
LQFHQWLYR j SDUWLFLSDomR SRSXODU RX D RXWUDV PHLRVSDUDTXHRSUySULRUHTXHUHQWHSRVVDSHV
IRUPDVGHGLYXOJDomR TXLVDUDLQIRUPDomRGHTXHQHFHVVLWDU

†ž 4XDQGRQmRIRUDXWRUL]DGRRDFHVVRSRUVHWUDWDU
&$3Ì78/2,,,
GHLQIRUPDomRWRWDORXSDUFLDOPHQWHVLJLORVDR
'2352&(',0(172'($&(662­,1)250$d®2
UHTXHUHQWHGHYHUiVHULQIRUPDGRVREUHDSRVVLEL
OLGDGH GH UHFXUVR SUD]RV H FRQGLo}HV SDUD VXD
6HomR,
LQWHUSRVLomRGHYHQGRDLQGDVHUOKHLQGLFDGDD
'R3HGLGRGH$FHVVR
DXWRULGDGHFRPSHWHQWHSDUDVXDDSUHFLDomR
$UW 4XDOTXHULQWHUHVVDGRSRGHUiDSUHVHQWDUSHGLGR
GHDFHVVRDLQIRUPDo}HVDRVyUJmRVHHQWLGDGHV †ž $ LQIRUPDomR DUPD]HQDGD HPIRUPDWRGLJLWDO
UHIHULGRVQRDUWRGHVWD/HLSRUTXDOTXHUPHLR VHUiIRUQHFLGDQHVVHIRUPDWRFDVRKDMDDQXrQFLD
OHJtWLPRGHYHQGRRSHGLGRFRQWHUDLGHQWLILFDomR GRUHTXHUHQWH
GR UHTXHUHQWH H D HVSHFLILFDomR GD LQIRUPDomR
UHTXHULGD †ž &DVRDLQIRUPDomRVROLFLWDGDHVWHMDGLVSRQtYHODR
S~EOLFRHPIRUPDWRLPSUHVVRHOHWU{QLFRRXHP
†ž 3DUDRDFHVVRDLQIRUPDo}HVGHLQWHUHVVHS~EOLFR TXDOTXHURXWURPHLRGHDFHVVRXQLYHUVDOVHUmR
D LGHQWLILFDomR GR UHTXHUHQWH QmR SRGH FRQWHU LQIRUPDGRVDRUHTXHUHQWHSRUHVFULWRROXJDUH
H[LJrQFLDVTXHLQYLDELOL]HPDVROLFLWDomR DIRUPDSHODTXDOVHSRGHUiFRQVXOWDUREWHURX
UHSURGX]LUDUHIHULGDLQIRUPDomRSURFHGLPHQWR
†ž 2VyUJmRVHHQWLGDGHVGRSRGHUS~EOLFRGHYHP HVVHTXHGHVRQHUDUiRyUJmRRXHQWLGDGHS~EOLFD
YLDELOL]DU DOWHUQDWLYD GH HQFDPLQKDPHQWR GH GDREULJDomRGHVHXIRUQHFLPHQWRGLUHWRVDOYRVH
SHGLGRVGHDFHVVRSRUPHLRGHVHXVVtWLRVRILFLDLV RUHTXHUHQWHGHFODUDUQmRGLVSRUGHPHLRVSDUD
QDLQWHUQHW UHDOL]DUSRUVLPHVPRWDLVSURFHGLPHQWRV

†ž 6mR YHGDGDV TXDLVTXHU H[LJrQFLDVUHODWLYDVDRV $UW 2VHUYLoRGHEXVFDHIRUQHFLPHQWRGDLQIRUPDomR


PRWLYRVGHWHUPLQDQWHVGDVROLFLWDomRGHLQIRUPD pJUDWXLWRVDOYRQDVKLSyWHVHVGHUHSURGXomRGH
o}HVGHLQWHUHVVHS~EOLFR GRFXPHQWRV SHOR yUJmR RX HQWLGDGH S~EOLFD
FRQVXOWDGDVLWXDomRHPTXHSRGHUiVHUFREUDGR
$UW 2yUJmRRXHQWLGDGHS~EOLFDGHYHUiDXWRUL]DURX H[FOXVLYDPHQWH R YDORU QHFHVViULR DR UHVVDUFL
FRQFHGHURDFHVVRLPHGLDWRjLQIRUPDomRGLVSRQt PHQWR GR FXVWR GRV VHUYLoRV H GRV PDWHULDLV
YHO XWLOL]DGRV

†ž 1mRVHQGRSRVVtYHOFRQFHGHURDFHVVRLPHGLDWR †~QLFR (VWDUiLVHQWRGHUHVVDUFLURVFXVWRVSUHYLVWRVQR


QDIRUPDGLVSRVWDQRFDSXWRyUJmRRXHQWLGDGH FDSXWWRGRDTXHOHFXMDVLWXDomRHFRQ{PLFDQmR
TXH UHFHEHU R SHGLGR GHYHUi HP SUD]R QmR OKH SHUPLWD ID]rOR VHP SUHMXt]R GR VXVWHQWR
VXSHULRUD YLQWH GLDV SUySULRRXGDIDPtOLDGHFODUDGDQRVWHUPRVGD
/HLQžGHGHDJRVWRGH
, FRPXQLFDUDGDWDORFDOHPRGRSDUDVHUHDOL]DUD
FRQVXOWDHIHWXDUDUHSURGXomRRXREWHUDFHUWL $UW 4XDQGRVHWUDWDUGHDFHVVRjLQIRUPDomRFRQWLGD
GmR HPGRFXPHQWRFXMDPDQLSXODomRSRVVDSUHMXGLFDU
VXDLQWHJULGDGHGHYHUiVHURIHUHFLGDDFRQVXOWD
,, LQGLFDUDVUD]}HVGHIDWRRXGHGLUHLWRGDUHFXVD GH FySLD FRP FHUWLILFDomR GH TXH HVWD FRQIHUH
WRWDORXSDUFLDOGRDFHVVRSUHWHQGLGRRX
FRPRRULJLQDO
8QLYHUVLGDGH )HGHUDOGR5LRGH-DQHLUR
 /HJLVODomR 

†~QLFR 1D LPSRVVLELOLGDGH GH REWHQomR GHFySLDVR $UW 1RFDVRGHLQGHIHULPHQWRGHSHGLGRGHGHVFODVVL


LQWHUHVVDGRSRGHUiVROLFLWDUTXHDVXDVH[SHQVDV ILFDomRGHLQIRUPDomRSURWRFRODGRHPyUJmRGD
HVREVXSHUYLVmRGHVHUYLGRUS~EOLFRDUHSURGX DGPLQLVWUDomRS~EOLFDIHGHUDOSRGHUiRUHTXHUHQ
omRVHMDIHLWDSRURXWURPHLRTXHQmRSRQKDHP WHUHFRUUHU DR0LQLVWURGH(VWDGRGDiUHDVHP
ULVFRDFRQVHUYDomRGRGRFXPHQWRRULJLQDO SUHMXt]RGDVFRPSHWrQFLDVGD&RPLVVmR0LVWDGH
5HDYDOLDomRGH,QIRUPDo}HVSUHYLVWDVQRDUW
$UW e GLUHLWR GR UHTXHUHQWH REWHU R LQWHLUR WHRUGH HGRGLVSRVWRQRDUW
GHFLVmR GH QHJDWLYD GH DFHVVR SRU FHUWLGmR RX
FySLD †ž 2UHFXUVRSUHYLVWRQHVWHDUWLJRVRPHQWHSRGHUi
6HomR,, VHUGLULJLGRjVDXWRULGDGHVPHQFLRQDGDVGHSRLV
'RV5HFXUVRV GHVXEPHWLGRjDSUHFLDomRGHSHORPHQRVXPD
DXWRULGDGHKLHUDUTXLFDPHQWHVXSHULRUjDXWRULGD
$UW 1RFDVRGHLQGHIHULPHQWRGHDFHVVRDLQIRUPD GHTXHH[DURXDGHFLVmRLPSXJQDGDHQRFDVR
o}HVRXjVUD]}HVGDQHJDWLYDGRDFHVVRSRGHUi GDV)RUoDV$UPDGDVDRUHVSHFWLYR&RPDQGR
RLQWHUHVVDGRLQWHUSRUUHFXUVRFRQWUDDGHFLVmRQR
SUD]RGH GH] GLDVDFRQWDUGDVXDFLrQFLD †ž ,QGHIHULGRRUHFXUVRSUHYLVWRQRFDSXWTXHWHQKD
FRPR REMHWR D GHVFODVVLILFDomR GH LQIRUPDomR
†~QLFR 2UHFXUVRVHUiGLULJLGRjDXWRULGDGHKLHUDUTXLFD VHFUHWDRXXOWUDVVHFUHWDFDEHUiUHFXUVRj&RPLV
PHQWHVXSHULRUjTXHH[DURXDGHFLVmRLPSXJQD VmR0LVWDGH5HDYDOLDomRGH,QIRUPDo}HVSUHYLVWD
GD TXH GHYHUi VH PDQLIHVWDU QR SUD]R GH  QRDUW
FLQFR GLDV
$UW 2VSURFHGLPHQWRVGHUHYLVmRGHGHFLV}HVGHQHJD
$UW 1HJDGRRDFHVVR D LQIRUPDomRSHORVyUJmRVRX WyULDVSURIHULGDVQRUHFXUVRSUHYLVWRQRDUWH
HQWLGDGHVGR3RGHU([HFXWLYR)HGHUDORUHTXH GHUHYLVmRGHFODVVLILFDomRGHGRFXPHQWRVVLJLOR
UHQWHSRGHUiUHFRUUHUj&RQWURODGRULD*HUDOGD VRVVHUmRREMHWRGHUHJXODPHQWDomRSUySULDGRV
8QLmRTXHGHOLEHUDUiQRSUD]RGH FLQFR GLDV 3RGHUHV/HJLVODWLYRH-XGLFLiULRHGR0LQLVWpULR
VH 3~EOLFRHPVHXVUHVSHFWLYRVkPELWRVDVVHJXUDGR
DRVROLFLWDQWHHPTXDOTXHUFDVRRGLUHLWRGHVHU
, R DFHVVR j LQIRUPDomRQmRFODVVLILFDGDFRPR LQIRUPDGRVREUHRDQGDPHQWRGHVHXSHGLGR
VLJLORVDIRUQHJDGR
$UW 9(7$'2 

,, D GHFLVmR GH QHJDWLYD GH DFHVVRjLQIRUPDomR †ž 9(7$'2 


WRWDORXSDUFLDOPHQWHFODVVLILFDGDFRPRVLJLORVD
QmR LQGLFDU D DXWRULGDGH FODVVLILFDGRUD RX D †ž 2V yUJmRV GR 3RGHU -XGLFLiULR HGR0LQLVWpULR
KLHUDUTXLFDPHQWH VXSHULRU D TXHP SRVVD VHU 3~EOLFR LQIRUPDUmR DR &RQVHOKR 1DFLRQDO GH
GLULJLGRSHGLGRGHDFHVVRRXGHVFODVVLILFDomR -XVWLoD H DR &RQVHOKR 1DFLRQDO GR 0LQLVWpULR
3~EOLFR UHVSHFWLYDPHQWH DV GHFLV}HV TXH HP
,,, RVSURFHGLPHQWRVGHFODVVLILFDomRGHLQIRUPDomR JUDXGHUHFXUVRQHJDUHPDFHVVRDLQIRUPDo}HV
VLJLORVDHVWDEHOHFLGRVQHVWD/HLQmRWLYHUHPVLGR GHLQWHUHVVHS~EOLFR
REVHUYDGRVH
$UW $SOLFDVHVXEVLGLDULDPHQWHQRTXHFRXEHUD/HL
,9 HVWLYHUHPVHQGRGHVFXPSULGRVSUD]RVRXRXWURV QRGHGHMDQHLURGHDRSURFHGL
SURFHGLPHQWRVSUHYLVWRVQHVWD/HL PHQWRGHTXHWUDWDHVWH&DStWXOR

†ž 2UHFXUVRSUHYLVWRQHVWHDUWLJRVRPHQWHSRGHUi &$3Ì78/2,9


VHU GLULJLGR j &RQWURODGRULD*HUDO GD 8QLmR '$65(675,d¯(6'($&(662
GHSRLVGHVXEPHWLGRjDSUHFLDomRGHSHORPHQRV ­,1)250$d®2
XPD DXWRULGDGH KLHUDUTXLFDPHQWH VXSHULRU
jTXHOD TXH H[DURX D GHFLVmR LPSXJQDGD TXH 6HomR,
GHOLEHUDUiQRSUD]RGH FLQFR GLDV 'LVSRVLo}HV*HUDLV
†ž 9HULILFDGDDSURFHGrQFLDGDVUD]}HVGRUHFXUVRD $UW 1mR SRGHUi VHU QHJDGR DFHVVR jLQIRUPDomR
&RQWURODGRULD*HUDO GD 8QLmR GHWHUPLQDUi DR QHFHVViULDjWXWHODMXGLFLDORXDGPLQLVWUDWLYDGH
yUJmR RX HQWLGDGH TXH DGRWH DV SURYLGrQFLDV GLUHLWRVIXQGDPHQWDLV
QHFHVViULDV SDUD GDU FXPSULPHQWR DR GLVSRVWR
QHVWD/HL †~QLFR $VLQIRUPDo}HVRXGRFXPHQWRVTXHYHUVHPVREUH
FRQGXWDV TXH LPSOLTXHP YLRODomR GRV GLUHLWRV
†ž 1HJDGRRDFHVVRjLQIRUPDomRSHOD&RQWURODGR KXPDQRV SUDWLFDGD SRU DJHQWHV S~EOLFRV RX D
ULD*HUDOGD8QLmRSRGHUiVHULQWHUSRVWRUHFXUVR PDQGRGHDXWRULGDGHVS~EOLFDVQmRSRGHUmRVHU
j&RPLVVmR0LVWDGH5HDYDOLDomRGH,QIRUPDo}HV REMHWRGHUHVWULomRGHDFHVVR
DTXHVHUHIHUHRDUW
 /HJLVODomR 8QLYHUVLGDGH)HGHUDOGR5LRGH-DQHLUR


$UW 2GLVSRVWRQHVWD/HLQmRH[FOXLDVGHPDLVKLSyWH ,,, UHVHUYDGD FLQFR DQRV


VHVOHJDLVGHVLJLORHGHVHJUHGRGHMXVWLoDQHPDV
KLSyWHVHV GH VHJUHGR LQGXVWULDO GHFRUUHQWHV GD †ž $VLQIRUPDo}HVTXHSXGHUHPFRORFDUHPULVFRD
H[SORUDomR GLUHWD GH DWLYLGDGH HFRQ{PLFD SHOR VHJXUDQoD GR 3UHVLGHQWH H 9LFH3UHVLGHQWH GD
(VWDGRRXSRUSHVVRDItVLFDRXHQWLGDGHSULYDGD 5HS~EOLFD H UHVSHFWLYRV F{QMXJHV H ILOKRV DV
TXHWHQKDTXDOTXHUYtQFXORFRPRSRGHUS~EOLFR VHUmRFODVVLILFDGDVFRPRUHVHUYDGDVHILFDUmRVRE
VLJLORDWpRWpUPLQRGRPDQGDWRHPH[HUFtFLRRX
GR~OWLPRPDQGDWRHPFDVRGHUHHOHLomR
6HomR,,
'D&ODVVLILFDomRGD,QIRUPDomR †ž $OWHUQDWLYDPHQWH DRV SUD]RV SUHYLVWRV QR†R
TXDQWRDR*UDXH3UD]RVGH6LJLOR SRGHUi VHU HVWDEHOHFLGD FRPR WHUPR ILQDO GH
UHVWULomRGHDFHVVRDRFRUUrQFLDGHGHWHUPLQDGR
$UW 6mRFRQVLGHUDGDVLPSUHVFLQGtYHLVjVHJXUDQoDGD HYHQWRGHVGHTXHHVWHRFRUUDDQWHVGRWUDQVFXUVR
VRFLHGDGHRXGR(VWDGRHSRUWDQWRSDVVtYHLVGH GRSUD]RPi[LPRGHFODVVLILFDomR
FODVVLILFDomRDVLQIRUPDo}HVFXMDGLYXOJDomRRX
DFHVVRLUUHVWULWRSRVVDP †ž 7UDQVFRUULGRRSUD]RGHFODVVLILFDomRRXFRQVX
PDGR R HYHQWRTXHGHILQDRVHXWHUPRILQDOD
, S{UHPULVFRDGHIHVDHDVREHUDQLDQDFLRQDLVRX LQIRUPDomR WRUQDUVHi DXWRPDWLFDPHQWH GH
DLQWHJULGDGHGRWHUULWyULRQDFLRQDO DFHVVRS~EOLFR

,, SUHMXGLFDURXS{UHPULVFRDFRQGXomRGHQHJRFL †ž 3DUDDFODVVLILFDomRGDLQIRUPDomRHPGHWHUPLQD


Do}HVRXDVUHODo}HVLQWHUQDFLRQDLVGR3DtVRXDV GRJUDXGHVLJLORGHYHUiVHUREVHUYDGRRLQWHUHV
TXHWHQKDPVLGRIRUQHFLGDVHPFDUiWHUVLJLORVR VH S~EOLFR GD LQIRUPDomR H XWLOL]DGR R FULWpULR
SRURXWURV(VWDGRVHRUJDQLVPRVLQWHUQDFLRQDLV PHQRVUHVWULWLYRSRVVtYHOFRQVLGHUDGRV

,,, S{UHPULVFRDYLGDDVHJXUDQoDRXDVD~GHGD , D JUDYLGDGH GR ULVFR RX GDQRjVHJXUDQoDGD


SRSXODomR VRFLHGDGHHGR(VWDGRH

,9 RIHUHFHUHOHYDGRULVFRjHVWDELOLGDGHILQDQFHLUD ,, R SUD]R Pi[LPR GH UHVWULomR GH DFHVVR RXR
HFRQ{PLFDRXPRQHWiULDGR3DtV HYHQWRTXHGHILQDVHXWHUPRILQDO

9 SUHMXGLFDURXFDXVDUULVFRDSODQRVRXRSHUDo}HV
HVWUDWpJLFRVGDV)RUoDV$UPDGDV 6HomR,,,
'D3URWHomRHGR&RQWUROHGH,QIRUPDo}HV6LJLORVDV
9, SUHMXGLFDURXFDXVDUULVFRDSURMHWRVGHSHVTXLVD
H GHVHQYROYLPHQWR FLHQWtILFR RX WHFQROyJLFR $UW eGHYHUGR(VWDGRFRQWURODURDFHVVRHDGLYXOJD
DVVLPFRPRDVLVWHPDVEHQVLQVWDODo}HVRXiUHDV omRGHLQIRUPDo}HVVLJLORVDVSURGX]LGDVSRUVHXV
GHLQWHUHVVHHVWUDWpJLFRQDFLRQDO yUJmRVHHQWLGDGHVDVVHJXUDQGRDVXDSURWHomR

9,, S{U HP ULVFR D VHJXUDQoD GH LQVWLWXLo}HV RXGH †ž 2DFHVVRDGLYXOJDomRHRWUDWDPHQWRGHLQIRU
DOWDVDXWRULGDGHVQDFLRQDLVRXHVWUDQJHLUDVHVHXV PDomRFODVVLILFDGDFRPRVLJLORVDILFDUmRUHVWULWRV
IDPLOLDUHVRX DSHVVRDVTXHWHQKDPQHFHVVLGDGHGHFRQKHFrOD
HTXHVHMDPGHYLGDPHQWHFUHGHQFLDGDVQDIRUPD
9,,, FRPSURPHWHU DWLYLGDGHV GH LQWHOLJrQFLDEHP GRUHJXODPHQWRVHPSUHMXt]RGDVDWULEXLo}HVGRV
FRPR GH LQYHVWLJDomR RX ILVFDOL]DomR HP DQGD DJHQWHVS~EOLFRVDXWRUL]DGRVSRUOHL
PHQWRUHODFLRQDGDVFRPDSUHYHQomRRXUHSUHV
VmRGHLQIUDo}HV †ž 2DFHVVRjLQIRUPDomRFODVVLILFDGDFRPRVLJLORVD
FULD D REULJDomR SDUD DTXHOH TXH D REWHYH GH
$UW $LQIRUPDomRHPSRGHUGRVyUJmRVHHQWLGDGHV UHVJXDUGDURVLJLOR
S~EOLFDVREVHUYDGRRVHXWHRUHHPUD]mRGHVXD
LPSUHVFLQGLELOLGDGHjVHJXUDQoDGDVRFLHGDGHRX †ž 5HJXODPHQWR GLVSRUi VREUHSURFHGLPHQWRVH
GR(VWDGRSRGHUiVHUFODVVLILFDGDFRPRXOWUDVVH PHGLGDVDVHUHPDGRWDGRVSDUDRWUDWDPHQWRGH
FUHWDVHFUHWDRXUHVHUYDGD LQIRUPDomRVLJLORVDGHPRGRDSURWHJrODFRQWUD
SHUGDDOWHUDomRLQGHYLGDDFHVVRWUDQVPLVVmRH
†ž 2V SUD]RV Pi[LPRV GH UHVWULomR GHDFHVVRj GLYXOJDomRQmRDXWRUL]DGRV
LQIRUPDomRFRQIRUPHDFODVVLILFDomRSUHYLVWDQR
FDSXWYLJRUDPDSDUWLUGDGDWDGHVXDSURGXomR $UW $VDXWRULGDGHVS~EOLFDVDGRWDUmRDVSURYLGrQFLDV
HVmRRVVHJXLQWHV QHFHVViULDVSDUDTXHRSHVVRDODHODVVXERUGLQDGR
KLHUDUTXLFDPHQWHFRQKHoDDVQRUPDVHREVHUYHDV
, XOWUDVVHFUHWD YLQWHHFLQFR DQRV PHGLGDV H SURFHGLPHQWRV GH VHJXUDQoD SDUD
,, VHFUHWD TXLQ]H DQRVH WUDWDPHQWRGHLQIRUPDo}HVVLJLORVDV
8QLYHUVLGDGH )HGHUDOGR5LRGH-DQHLUR
 /HJLVODomR 

†~QLFR $SHVVRDItVLFDRXHQWLGDGHSULYDGDTXHHPUD]mR †ž $DXWRULGDGHRXRXWURDJHQWHS~EOLFRTXHFODVVLIL


GHTXDOTXHUYtQFXORFRPRSRGHUS~EOLFRH[HFX FDULQIRUPDomRFRPRXOWUDVVHFUHWDGHYHUiHQFD
WDU DWLYLGDGHV GH WUDWDPHQWR GH LQIRUPDo}HV PLQKDUDGHFLVmRGHTXHWUDWDRDUWj&RPLV
VLJLORVDVDGRWDUiDVSURYLGrQFLDVQHFHVViULDVSDUD VmR0LVWDGH5HDYDOLDomRGH,QIRUPDo}HVDTXH
TXHVHXVHPSUHJDGRVSUHSRVWRVRXUHSUHVHQWDQ VHUHIHUHRDUWQRSUD]RSUHYLVWRHPUHJXOD
WHV REVHUYHP DV PHGLGDV H SURFHGLPHQWRV GH PHQWR
VHJXUDQoDGDVLQIRUPDo}HVUHVXOWDQWHVGDDSOLFD
omRGHVWD/HL $UW $FODVVLILFDomRGHLQIRUPDomRHPTXDOTXHUJUDX
GHVLJLORGHYHUiVHUIRUPDOL]DGDHPGHFLVmRTXH
6HomR,9 FRQWHUiQRPtQLPRRVVHJXLQWHVHOHPHQWRV
'RV3URFHGLPHQWRVGH&ODVVLILFDomR
5HFODVVLILFDomRH'HVFODVVLILFDomR , DVVXQWRVREUHRTXDOYHUVDDLQIRUPDomR

$UW $FODVVLILFDomRGRVLJLORGHLQIRUPDo}HVQRkPEL ,, IXQGDPHQWR GD FODVVLILFDomRREVHUYDGRVRV


WRGDDGPLQLVWUDomRS~EOLFDIHGHUDOpGHFRPSH FULWpULRVHVWDEHOHFLGRVQRDUW
WrQFLD
,,, LQGLFDomRGRSUD]RGHVLJLORFRQWDGRHPDQRV
, QRJUDXGHXOWUDVVHFUHWRGDVVHJXLQWHVDXWRULGD PHVHV RX GLDV RX GR HYHQWR TXH GHILQD R VHX
GHV WHUPRILQDOFRQIRUPHOLPLWHVSUHYLVWRVQRDUW
H
D 3UHVLGHQWHGD5HS~EOLFD
,9 LGHQWLILFDomRGDDXWRULGDGHTXHDFODVVLILFRX
E 9LFH3UHVLGHQWHGD5HS~EOLFD
†~QLFR $ GHFLVmR UHIHULGD QR FDSXW VHUiPDQWLGDQR
F 0LQLVWURV GH (VWDGR H DXWRULGDGHV FRP DV PHVPRJUDXGHVLJLORGDLQIRUPDomRFODVVLILFDGD
PHVPDVSUHUURJDWLYDV
$UW $ FODVVLILFDomR GDV LQIRUPDo}HV VHUiUHDYDOLDGD
G &RPDQGDQWHV GD 0DULQKD GR ([pUFLWR H GD SHODDXWRULGDGHFODVVLILFDGRUDRXSRUDXWRULGDGH
$HURQiXWLFDH KLHUDUTXLFDPHQWHVXSHULRUPHGLDQWHSURYRFDomR
RX GH RItFLR QRV WHUPRV H SUD]RV SUHYLVWRV HP
H &KHIHVGH0LVV}HV'LSORPiWLFDVH&RQVXODUHV UHJXODPHQWRFRPYLVWDVjVXDGHVFODVVLILFDomRRX
SHUPDQHQWHVQRH[WHULRU jUHGXomRGRSUD]RGHVLJLORREVHUYDGRRGLVSRV
WRQRDUW
,, QRJUDXGHVHFUHWRGDVDXWRULGDGHVUHIHULGDVQR
LQFLVR,GRVWLWXODUHVGHDXWDUTXLDVIXQGDo}HVRX †ž 2 UHJXODPHQWR D TXH VH UHIHUH RFDSXWGHYHUi
HPSUHVDV S~EOLFDV H VRFLHGDGHV GH HFRQRPLD FRQVLGHUDU DV SHFXOLDULGDGHV GDV LQIRUPDo}HV
PLVWDH SURGX]LGDVQRH[WHULRUSRUDXWRULGDGHVRXDJHQ
WHVS~EOLFRV
,,, QRJUDXGHUHVHUYDGRGDVDXWRULGDGHVUHIHULGDV
QRVLQFLVRV,H,,HGDVTXHH[HUoDPIXQo}HVGH †ž 1DUHDYDOLDomRDTXHVHUHIHUHRFDSXWGHYHUmR
GLUHomRFRPDQGRRXFKHILDQtYHO'$6RX VHU H[DPLQDGDV D SHUPDQrQFLD GRV PRWLYRV GR
VXSHULRU GR *UXSR'LUHomR H $VVHVVRUDPHQWR VLJLORHDSRVVLELOLGDGHGHGDQRVGHFRUUHQWHVGR
DFHVVRRXGDGLYXOJDomRGDLQIRUPDomR
6XSHULRUHV RX GH KLHUDUTXLD HTXLYDOHQWH GH
DFRUGR FRP UHJXODPHQWDomR HVSHFtILFD GH FDGD
†ž 1D KLSyWHVH GH UHGXomR GR SUD]R GHVLJLORGD
yUJmR RX HQWLGDGH REVHUYDGR R GLVSRVWR QHVWD
LQIRUPDomRRQRYRSUD]RGHUHVWULomRPDQWHUi
/HL
FRPRWHUPRLQLFLDODGDWDGDVXDSURGXomR
†ž $FRPSHWrQFLDSUHYLVWDQRVLQFLVRV,H,,QRTXH
$UW $DXWRULGDGHPi[LPDGHFDGDyUJmRRXHQWLGDGH
VH UHIHUH j FODVVLILFDomR FRPR XOWUDVVHFUHWD H
SXEOLFDUiDQXDOPHQWHHPVtWLRjGLVSRVLomRQD
VHFUHWD SRGHUi VHU GHOHJDGD SHOD DXWRULGDGH
LQWHUQHW H GHVWLQDGR j YHLFXODomR GH GDGRV H
UHVSRQViYHODDJHQWHS~EOLFRLQFOXVLYHHPPLVVmR
LQIRUPDo}HV DGPLQLVWUDWLYDV QRV WHUPRV GH
QRH[WHULRUYHGDGDDVXEGHOHJDomR
UHJXODPHQWR
†ž $FODVVLILFDomRGHLQIRUPDomR QR JUDXGHVLJLOR
, UROGDVLQIRUPDo}HVTXHWHQKDPVLGRGHVFODVVLIL
XOWUDVVHFUHWR SHODV DXWRULGDGHV SUHYLVWDV QDV
FDGDVQRV~OWLPRV GR]H PHVHV
DOtQHDV´GµH´HµGRLQFLVR,GHYHUiVHUUDWLILFDGD
SHORVUHVSHFWLYRV0LQLVWURVGH(VWDGRQRSUD]R
,, UROGHGRFXPHQWRVFODVVLILFDGRVHPFDGDJUDXGH
SUHYLVWRHPUHJXODPHQWR
VLJLORFRPLGHQWLILFDomRSDUDUHIHUrQFLDIXWXUD
 /HJLVODomR 8QLYHUVLGDGH)HGHUDOGR5LRGH-DQHLUR


,,, UHODWyULR HVWDWtVWLFR FRQWHQGR D TXDQWLGDGHGH †ž $UHVWULomRGHDFHVVRjLQIRUPDomRUHODWLYDjYLGD


SHGLGRV GH LQIRUPDomR UHFHELGRV DWHQGLGRV H SULYDGDKRQUDHLPDJHPGHSHVVRDQmRSRGHUi
LQGHIHULGRV EHP FRPR LQIRUPDo}HV JHQpULFDV VHULQYRFDGDFRPRLQWXLWRGHSUHMXGLFDUSURFHVVR
VREUHRVVROLFLWDQWHV GHDSXUDomRGHLUUHJXODULGDGHVHPTXHRWLWXODU
GDVLQIRUPDo}HVHVWLYHUHQYROYLGREHPFRPRHP
†ž 2VyUJmRVHHQWLGDGHVGHYHUmRPDQWHUH[HPSODU Do}HV YROWDGDV SDUD D UHFXSHUDomR GH IDWRV
GD SXEOLFDomR SUHYLVWD QR FDSXW SDUD FRQVXOWD KLVWyULFRVGHPDLRUUHOHYkQFLD
S~EOLFDHPVXDVVHGHV
†ž 5HJXODPHQWR GLVSRUi VREUHRVSURFHGLPHQWRV
†ž 2V yUJmRV H HQWLGDGHVPDQWHUmRH[WUDWRFRPD SDUDWUDWDPHQWRGHLQIRUPDomRSHVVRDO
OLVWDGHLQIRUPDo}HVFODVVLILFDGDVDFRPSDQKDGDV
GDGDWDGRJUDXGHVLJLORHGRVIXQGDPHQWRVGD &$3Ì78/29
FODVVLILFDomR '$65(63216$%,/,'$'(6

6HomR9 $UW &RQVWLWXHPFRQGXWDVLOtFLWDVTXHHQVHMDPUHVSRQ


'DV,QIRUPDo}HV3HVVRDLV VDELOLGDGHGRDJHQWHS~EOLFRRXPLOLWDU

$UW 2WUDWDPHQWRGDVLQIRUPDo}HVSHVVRDLVGHYHVHU , UHFXVDUVHDIRUQHFHULQIRUPDomRUHTXHULGDQRV


WHUPRVGHVWD/HLUHWDUGDUGHOLEHUDGDPHQWHRVHX
IHLWR GH IRUPD WUDQVSDUHQWH H FRP UHVSHLWR j
IRUQHFLPHQWRRXIRUQHFrODLQWHQFLRQDOPHQWHGH
LQWLPLGDGH YLGD SULYDGD KRQUD H LPDJHP GDV
IRUPDLQFRUUHWDLQFRPSOHWDRXLPSUHFLVD
SHVVRDV EHP FRPR jV OLEHUGDGHV H JDUDQWLDV
LQGLYLGXDLV
,, XWLOL]DU LQGHYLGDPHQWH EHPFRPRVXEWUDLU
GHVWUXLULQXWLOL]DUGHVILJXUDUDOWHUDURXRFXOWDU
†ž $V LQIRUPDo}HV SHVVRDLV D TXH VHUHIHUHHVWH WRWDORXSDUFLDOPHQWHLQIRUPDomRTXHVHHQFRQ
DUWLJRUHODWLYDVjLQWLPLGDGHYLGDSULYDGDKRQUD WUH VRE VXD JXDUGD RX D TXH WHQKD DFHVVR RX
HLPDJHP FRQKHFLPHQWRHPUD]mRGRH[HUFtFLRGDVDWULEXL
o}HVGHFDUJRHPSUHJRRXIXQomRS~EOLFD
, WHUmRVHXDFHVVRUHVWULWRLQGHSHQGHQWHPHQWHGH
FODVVLILFDomR GH VLJLOR H SHOR SUD]R Pi[LPR GH ,,, DJLUFRPGRORRXPiIpQDDQiOLVHGDVVROLFLWDo}HV
 FHP DQRVDFRQWDUGDVXDGDWDGHSURGX GHDFHVVRjLQIRUPDomR
omRDDJHQWHVS~EOLFRVOHJDOPHQWHDXWRUL]DGRVH
jSHVVRDDTXHHODVVHUHIHULUHPH ,9 GLYXOJDURXSHUPLWLUDGLYXOJDomRRXDFHVVDURX
SHUPLWLUDFHVVRLQGHYLGRjLQIRUPDomRVLJLORVDRX
,, SRGHUmRWHUDXWRUL]DGDVXDGLYXOJDomRRXDFHVVR LQIRUPDomRSHVVRDO
SRUWHUFHLURVGLDQWHGHSUHYLVmROHJDORXFRQVHQWL
PHQWRH[SUHVVRGDSHVVRDDTXHHODVVHUHIHULUHP 9 LPSRU VLJLOR j LQIRUPDomR SDUDREWHUSURYHLWR
SHVVRDORXGHWHUFHLURRXSDUDILQVGHRFXOWDomR
†ž $TXHOHTXHREWLYHUDFHVVRjVLQIRUPDo}HVGHTXH GHDWRLOHJDOFRPHWLGRSRUVLRXSRURXWUHP
WUDWDHVWHDUWLJRVHUiUHVSRQVDELOL]DGRSRUVHXXVR
LQGHYLGR 9, RFXOWDUGDUHYLVmRGHDXWRULGDGHVXSHULRUFRPSH
WHQWHLQIRUPDomRVLJLORVDSDUDEHQHILFLDUDVLRX
†ž 2FRQVHQWLPHQWRUHIHULGRQRLQFLVR,,GR†RQmR DRXWUHPRXHPSUHMXt]RGHWHUFHLURVH
VHUiH[LJLGRTXDQGRDVLQIRUPDo}HVIRUHPQHFHV
ViULDV 9,, GHVWUXLU RX VXEWUDLU SRU TXDOTXHU PHLRGRFX
PHQWRV FRQFHUQHQWHV D SRVVtYHLV YLRODo}HV GH
GLUHLWRVKXPDQRVSRUSDUWHGHDJHQWHVGR(VWDGR
, j SUHYHQomR H GLDJQyVWLFRPpGLFRTXDQGRD
SHVVRD HVWLYHU ItVLFD RX OHJDOPHQWH LQFDSD] H
†ž $WHQGLGRRSULQFtSLRGRFRQWUDGLWyULRGDDPSOD
SDUD XWLOL]DomR ~QLFD H H[FOXVLYDPHQWH SDUD R
GHIHVD H GR GHYLGR SURFHVVR OHJDO DV FRQGXWDV
WUDWDPHQWRPpGLFR
GHVFULWDVQRFDSXWVHUmRFRQVLGHUDGDV
,, jUHDOL]DomRGHHVWDWtVWLFDVHSHVTXLVDVFLHQWtILFDV , SDUD ILQV GRVUHJXODPHQWRVGLVFLSOLQDUHVGDV
GHHYLGHQWHLQWHUHVVHS~EOLFRRXJHUDOSUHYLVWRV )RUoDV$UPDGDVWUDQVJUHVV}HVPLOLWDUHVPpGLDV
HPOHLVHQGRYHGDGDDLGHQWLILFDomRGDSHVVRDD RXJUDYHVVHJXQGRRVFULWpULRVQHOHVHVWDEHOHFL
TXHDVLQIRUPDo}HVVHUHIHULUHP GRVGHVGHTXHQmRWLSLILFDGDVHPOHLFRPRFULPH
RXFRQWUDYHQomRSHQDORX
,,, DRFXPSULPHQWRGHRUGHPMXGLFLDO
,, SDUDILQVGRGLVSRVWRQD/HLQRGHGH
,9 jGHIHVDGHGLUHLWRVKXPDQRVRX GH]HPEURGHHVXDVDOWHUDo}HVLQIUDo}HV
DGPLQLVWUDWLYDV TXH GHYHUmR VHU DSHQDGDV QR
9 jSURWHomRGRLQWHUHVVHS~EOLFRHJHUDOSUHSRQGH PtQLPRFRPVXVSHQVmRVHJXQGRRVFULWpULRVQHOD
UDQWH HVWDEHOHFLGRV
8QLYHUVLGDGH )HGHUDOGR5LRGH-DQHLUR
 /HJLVODomR 

†ž 3HODV FRQGXWDV GHVFULWDV QR FDSXWSRGHUiR †ž eLQVWLWXtGDD&RPLVVmR0LVWDGH5HDYDOLDomRGH


PLOLWDURXDJHQWHS~EOLFRUHVSRQGHUWDPEpPSRU ,QIRUPDo}HVTXHGHFLGLUiQRkPELWRGDDGPLQLV
LPSURELGDGHDGPLQLVWUDWLYDFRQIRUPHRGLVSRVWR WUDomR S~EOLFD IHGHUDO VREUH R WUDWDPHQWR H D
QDV /HLV QRV  GH  GH DEULO GH  H FODVVLILFDomR GH LQIRUPDo}HV VLJLORVDV H WHUi
GHGHMXQKRGH FRPSHWrQFLDSDUD

$UW $SHVVRDItVLFDRXHQWLGDGHSULYDGDTXHGHWLYHU , UHTXLVLWDUGDDXWRULGDGHTXHFODVVLILFDULQIRUPD


LQIRUPDo}HVHPYLUWXGHGHYtQFXORGHTXDOTXHU omRFRPRXOWUDVVHFUHWDHVHFUHWDHVFODUHFLPHQWR
QDWXUH]DFRPRSRGHUS~EOLFRHGHL[DUGHREVHU RXFRQWH~GRSDUFLDORXLQWHJUDOGDLQIRUPDomR
YDURGLVSRVWRQHVWD/HLHVWDUiVXMHLWDjVVHJXLQWHV
VDQo}HV ,, UHYHUDFODVVLILFDomRGHLQIRUPDo}HVXOWUDVVHFUHWDV
RXVHFUHWDVGHRItFLRRXPHGLDQWHSURYRFDomRGH
, DGYHUWrQFLD SHVVRDLQWHUHVVDGDREVHUYDGRRGLVSRVWRQRDUW
RHGHPDLVGLVSRVLWLYRVGHVWD/HLH
,, PXOWD
,,, SURUURJDURSUD]RGHVLJLORGHLQIRUPDomRFODVVLIL
,,, UHVFLVmRGRYtQFXORFRPRSRGHUS~EOLFR FDGDFRPRXOWUDVVHFUHWDVHPSUHSRUSUD]RGHWHU
PLQDGR HQTXDQWR R VHX DFHVVR RX GLYXOJDomR
,9 VXVSHQVmRWHPSRUiULDGHSDUWLFLSDUHPOLFLWDomR SXGHU RFDVLRQDU DPHDoD H[WHUQD j VREHUDQLD
HLPSHGLPHQWRGHFRQWUDWDUFRPDDGPLQLVWUDomR QDFLRQDORXjLQWHJULGDGHGRWHUULWyULRQDFLRQDO
S~EOLFDSRUSUD]RQmRVXSHULRUD GRLV DQRVH RXJUDYHULVFRjVUHODo}HVLQWHUQDFLRQDLVGR3DtV
REVHUYDGRRSUD]RSUHYLVWRQR†RGRDUW
9 GHFODUDomRGHLQLGRQHLGDGHSDUDOLFLWDURXFRQWUD
WDU FRP D DGPLQLVWUDomR S~EOLFD DWp TXH VHMD †ž 2SUD]RUHIHULGRQRLQFLVR,,,pOLPLWDGRDXPD
SURPRYLGD D UHDELOLWDomR SHUDQWH D SUySULD ~QLFDUHQRYDomR
DXWRULGDGHTXHDSOLFRXDSHQDOLGDGH
†ž $UHYLVmRGHRItFLRDTXHVHUHIHUHRLQFLVR,,GR†
†ž $VVDQo}HVSUHYLVWDVQRVLQFLVRV,,,,H,9SRGHUmR RGHYHUiRFRUUHUQRPi[LPRDFDGD TXDWUR
VHU DSOLFDGDV MXQWDPHQWH FRP D GR LQFLVR ,, DQRV DSyV D UHDYDOLDomR SUHYLVWD QR DUW 
DVVHJXUDGRRGLUHLWRGHGHIHVDGRLQWHUHVVDGRQR TXDQGRVHWUDWDUGHGRFXPHQWRVXOWUDVVHFUHWRVRX
UHVSHFWLYRSURFHVVRQRSUD]RGH GH] GLDV VHFUHWRV

†ž $UHDELOLWDomRUHIHULGDQRLQFLVR9VHUiDXWRUL]DGD †ž $QmRGHOLEHUDomRVREUHDUHYLVmRSHOD&RPLVVmR


VRPHQWHTXDQGRRLQWHUHVVDGRHIHWLYDURUHVVDUFL 0LVWDGH5HDYDOLDomRGH,QIRUPDo}HVQRVSUD]RV
PHQWRDRyUJmRRXHQWLGDGHGRVSUHMXt]RVUHVXO SUHYLVWRV QR † R LPSOLFDUi D GHVFODVVLILFDomR
WDQWHVHDSyVGHFRUULGRRSUD]RGDVDQomRDSOLFD DXWRPiWLFDGDVLQIRUPDo}HV
GDFRPEDVHQRLQFLVR,9
†ž 5HJXODPHQWRGLVSRUiVREUHDFRPSRVLomRRUJDQL
†ž $DSOLFDomRGDVDQomRSUHYLVWDQRLQFLVR9pGH ]DomR H IXQFLRQDPHQWR GD &RPLVVmR 0LVWD GH
FRPSHWrQFLDH[FOXVLYDGDDXWRULGDGHPi[LPDGR 5HDYDOLDomRGH,QIRUPDo}HVREVHUYDGRRPDQGD
yUJmRRXHQWLGDGHS~EOLFDIDFXOWDGDDGHIHVDGR WRGH GRLV DQRVSDUDVHXVLQWHJUDQWHVHGHPD
LQWHUHVVDGRQRUHVSHFWLYRSURFHVVRQRSUD]RGH LVGLVSRVLo}HVGHVWD/HL
 GH] GLDVGDDEHUWXUDGHYLVWD
$UW 2WUDWDPHQWRGHLQIRUPDomRVLJLORVDUHVXOWDQWH
$UW 2VyUJmRVHHQWLGDGHVS~EOLFDVUHVSRQGHPGLUHWD GH WUDWDGRV DFRUGRV RX DWRV LQWHUQDFLRQDLV
PHQWHSHORVGDQRVFDXVDGRVHPGHFRUUrQFLDGD DWHQGHUijVQRUPDVHUHFRPHQGDo}HVFRQVWDQWHV
GLYXOJDomRQmRDXWRUL]DGDRXXWLOL]DomRLQGHYLGD GHVVHVLQVWUXPHQWRV
GHLQIRUPDo}HVVLJLORVDVRXLQIRUPDo}HVSHVVRDLV
FDEHQGRDDSXUDomRGHUHVSRQVDELOLGDGHIXQFLR $UW eLQVWLWXtGRQRkPELWRGR*DELQHWHGH6HJXUDQoD
QDO QRV FDVRV GH GROR RX FXOSD DVVHJXUDGR R ,QVWLWXFLRQDO GD 3UHVLGrQFLD GD 5HS~EOLFD R
UHVSHFWLYRGLUHLWRGHUHJUHVVR 1~FOHRGH6HJXUDQoDH&UHGHQFLDPHQWR 16& 
TXHWHPSRUREMHWLYRV
†~QLFR 2GLVSRVWRQHVWHDUWLJRDSOLFDVHjSHVVRDItVLFD
RXHQWLGDGHSULYDGDTXHHPYLUWXGHGHYtQFXOR , SURPRYHUHSURSRUDUHJXODPHQWDomRGRFUHGHQ
GHTXDOTXHUQDWXUH]DFRPyUJmRVRXHQWLGDGHV FLDPHQWRGHVHJXUDQoDGHSHVVRDVItVLFDVHPSUH
WHQKDDFHVVRDLQIRUPDomRVLJLORVDRXSHVVRDOHD VDVyUJmRVHHQWLGDGHVSDUDWUDWDPHQWRGHLQIRU
VXEPHWDDWUDWDPHQWRLQGHYLGR PDo}HVVLJLORVDVH
&$3Ì78/29,
,, JDUDQWLU D VHJXUDQoD GH LQIRUPDo}HVVLJLORVDV
',6326,d¯(6),1$,6(75$16,7Ð5,$6
LQFOXVLYH DTXHODV SURYHQLHQWHV GH SDtVHV RX
$UW 9(7$'2  RUJDQL]Do}HV LQWHUQDFLRQDLV FRP RV TXDLV D
 /HJLVODomR 8QLYHUVLGDGH)HGHUDOGR5LRGH-DQHLUR


5HS~EOLFD )HGHUDWLYD GR %UDVLO WHQKD ILUPDGR ,9 RULHQWDUDVUHVSHFWLYDVXQLGDGHVQRTXHVHUHIHUH


WUDWDGRDFRUGRFRQWUDWRRXTXDOTXHURXWURDWR DR FXPSULPHQWR GR GLVSRVWR QHVWD /HL H VHXV
LQWHUQDFLRQDO VHP SUHMXt]R GDV DWULEXLo}HV GR UHJXODPHQWRV
0LQLVWpULRGDV5HODo}HV([WHULRUHVHGRVGHPDLV
yUJmRVFRPSHWHQWHV $UW 2 3RGHU ([HFXWLYR )HGHUDO GHVLJQDUi yUJmRGD
DGPLQLVWUDomRS~EOLFDIHGHUDOUHVSRQViYHO
†~QLFR 5HJXODPHQWRGLVSRUiVREUHDFRPSRVLomRRUJDQL
]DomRHIXQFLRQDPHQWRGR16& , SHOD SURPRomR GHFDPSDQKDGHDEUDQJrQFLD
QDFLRQDOGHIRPHQWRjFXOWXUDGDWUDQVSDUrQFLD
$UW $SOLFDVHQRTXHFRXEHUD/HLQRGHGH QD DGPLQLVWUDomR S~EOLFD H FRQVFLHQWL]DomR GR
QRYHPEURGHHPUHODomRjLQIRUPDomRGH GLUHLWRIXQGDPHQWDOGHDFHVVRjLQIRUPDomR
SHVVRDItVLFDRXMXUtGLFDFRQVWDQWHGHUHJLVWURRX
EDQFRGHGDGRVGHHQWLGDGHVJRYHUQDPHQWDLVRX ,, SHORWUHLQDPHQWRGHDJHQWHVS~EOLFRVQRTXHVH
GHFDUiWHUS~EOLFR UHIHUHDRGHVHQYROYLPHQWRGHSUiWLFDVUHODFLRQD
GDVjWUDQVSDUrQFLDQDDGPLQLVWUDomRS~EOLFD
$UW 2VyUJmRVHHQWLGDGHVS~EOLFDVGHYHUmRSURFHGHU
jUHDYDOLDomRGDVLQIRUPDo}HVFODVVLILFDGDVFRPR ,,, SHORPRQLWRUDPHQWRGDDSOLFDomRGDOHLQRkPEL
XOWUDVVHFUHWDVHVHFUHWDVQRSUD]RPi[LPRGH WRGDDGPLQLVWUDomRS~EOLFDIHGHUDOFRQFHQWUDQ
GRLV DQRVFRQWDGRGRWHUPRLQLFLDOGHYLJrQFLD GRHFRQVROLGDQGRDSXEOLFDomRGHLQIRUPDo}HV
GHVWD/HL HVWDWtVWLFDVUHODFLRQDGDVQRDUW

†ž $UHVWULomRGHDFHVVRDLQIRUPDo}HVHPUD]mRGD ,9 SHORHQFDPLQKDPHQWRDR&RQJUHVVR1DFLRQDOGH


UHDYDOLDomRSUHYLVWDQRFDSXWGHYHUiREVHUYDURV UHODWyULR DQXDO FRP LQIRUPDo}HV DWLQHQWHV j
SUD]RVHFRQGLo}HVSUHYLVWRVQHVWD/HL LPSOHPHQWDomRGHVWD/HL

†ž 1R kPELWR GD DGPLQLVWUDomR S~EOLFDIHGHUDOD $UW 2 3RGHU ([HFXWLYR UHJXODPHQWDUi RGLVSRVWR
UHDYDOLDomRSUHYLVWDQRFDSXWSRGHUiVHUUHYLVWD QHVWD/HLQRSUD]RGH FHQWRHRLWHQWD GLDV
DTXDOTXHUWHPSRSHOD&RPLVVmR0LVWDGH5HDYD DFRQWDUGDGDWDGHVXDSXEOLFDomR
OLDomR GH ,QIRUPDo}HV REVHUYDGRV RV WHUPRV
GHVWD/HL $UW 2LQFLVR9,GRDUWGD/HLQRGHGH
GH]HPEURGHSDVVDDYLJRUDUFRPDVHJXLQ
†ž (QTXDQWRQmRWUDQVFRUULGRRSUD]RGHUHDYDOLDomR WHUHGDomR
SUHYLVWRQRFDSXWVHUiPDQWLGDDFODVVLILFDomRGD ´$UW 
LQIRUPDomRQRVWHUPRVGDOHJLVODomRSUHFHGHQWH


9, OHYDUDVLUUHJXODULGDGHVGHTXHWLYHUFLrQFLDHPUD]mRGRFDUJRDRFRQKHFL
†ž $V LQIRUPDo}HV FODVVLILFDGDV FRPRVHFUHWDVH PHQWRGDDXWRULGDGHVXSHULRURXTXDQGRKRXYHUVXVSHLWDGHHQYROYLPHQWR
XOWUDVVHFUHWDVQmRUHDYDOLDGDVQRSUD]RSUHYLVWR GHVWDDRFRQKHFLPHQWRGHRXWUDDXWRULGDGHFRPSHWHQWHSDUDDSXUDomR

QRFDSXWVHUmRFRQVLGHUDGDVDXWRPDWLFDPHQWH µ 15 
GHDFHVVRS~EOLFR
$UW 2&DStWXOR,9GR7tWXOR,9GD/HLQRGH
$UW 1R SUD]R GH  VHVVHQWD  GLDV D FRQWDUGD SDVVDDYLJRUDUDFUHVFLGRGRVHJXLQWHDUW
YLJrQFLDGHVWD/HLRGLULJHQWHPi[LPRGHFDGD $
yUJmR RX HQWLGDGH GD DGPLQLVWUDomR S~EOLFD ´$UW$ 1HQKXP VHUYLGRU SRGHUi VHU UHVSRQVDELOL]DGR FLYLO SHQDO RX
IHGHUDOGLUHWDHLQGLUHWDGHVLJQDUiDXWRULGDGHTXH DGPLQLVWUDWLYDPHQWH SRU GDU FLrQFLD j DXWRULGDGH VXSHULRU RX
TXDQGRKRXYHUVXVSHLWDGHHQYROYLPHQWRGHVWDDRXWUDDXWRULGD
OKHVHMDGLUHWDPHQWHVXERUGLQDGDSDUDQRkPELWR GHFRPSHWHQWHSDUDDSXUDomRGHLQIRUPDomRFRQFHUQHQWHjSUiWLFD
GHFULPHVRXLPSURELGDGHGHTXHWHQKDFRQKHFLPHQWRDLQGDTXH
GR UHVSHFWLYR yUJmR RX HQWLGDGH H[HUFHU DV HPGHFRUUrQFLDGRH[HUFtFLRGHFDUJRHPSUHJRRXIXQomRS~EOL
VHJXLQWHVDWULEXLo}HV FDµ

, DVVHJXUDURFXPSULPHQWRGDVQRUPDVUHODWLYDVDR $UW &DEHDRV(VWDGRVDR'LVWULWR)HGHUDOHDRV0XQL


DFHVVRDLQIRUPDomRGHIRUPDHILFLHQWHHDGHTXD FtSLRV HP OHJLVODomR SUySULD REHGHFLGDV DV
GDDRVREMHWLYRVGHVWD/HL QRUPDV JHUDLV HVWDEHOHFLGDV QHVWD /HL GHILQLU
UHJUDV HVSHFtILFDV HVSHFLDOPHQWH TXDQWR DR
,, PRQLWRUDUDLPSOHPHQWDomRGRGLVSRVWRQHVWD/HL GLVSRVWRQRDUWRHQD6HomR,,GR&DStWXOR,,,
H DSUHVHQWDU UHODWyULRV SHULyGLFRV VREUH R VHX
$UW 5HYRJDPVH
FXPSULPHQWR
, D/HLQRGHGHPDLRGHH
,,, UHFRPHQGDUDVPHGLGDVLQGLVSHQViYHLVjLPSOH
PHQWDomR H DR DSHUIHLoRDPHQWR GDV QRUPDV H ,, RVDUWVDGD/HLQRGHGHMDQHLURGH
SURFHGLPHQWRV QHFHVViULRV DR FRUUHWR FXPSUL
$UW (VWD/HLHQWUDHPYLJRU FHQWRHRLWHQWD GLDVDSyVDGDWD
PHQWRGRGLVSRVWRQHVWD/HLH GHVXDSXEOLFDomR
8QLYHUVLGDGH )HGHUDOGR5LRGH-DQHLUR
 /HJLVODomR 

9,, GLVSRQLELOLGDGH  TXDOLGDGH GD LQIRUPDomRTXH


'HFUHWR)HGHUDOQž SRGH VHU FRQKHFLGD H XWLOL]DGD SRU LQGLYtGXRV
HTXLSDPHQWRVRXVLVWHPDVDXWRUL]DGRV
5HJXODPHQWDD/HLQž
TXHGLVS}HVREUHRDFHVVRDLQIRUPDo}HV
9,,,DXWHQWLFLGDGH  TXDOLGDGH GD LQIRUPDomRTXH
WHQKD VLGR SURGX]LGD H[SHGLGD UHFHELGD RX
PRGLILFDGDSRUGHWHUPLQDGRLQGLYtGXRHTXLSD
&DStWXOR,
',6326,d¯(6*(5$,6 PHQWRRXVLVWHPD

$UWž (VWH'HFUHWRUHJXODPHQWDQR kPELWRGR3RGHU ,; LQWHJULGDGHTXDOLGDGHGDLQIRUPDomRQmRPRGL


([HFXWLYR IHGHUDO RV SURFHGLPHQWRV SDUD D ILFDGD LQFOXVLYH TXDQWR j RULJHP WUkQVLWR H
JDUDQWLDGRDFHVVRjLQIRUPDomRHSDUDDFODVVLIL GHVWLQR
FDomR GH LQIRUPDo}HV VRE UHVWULomR GH DFHVVR
REVHUYDGRV JUDX H SUD]R GH VLJLOR FRQIRUPH R ; SULPDULHGDGHTXDOLGDGHGDLQIRUPDomRFROHWDGD
GLVSRVWRQD/HLQRGHGHQRYHPEURGH QDIRQWHFRPRPi[LPRGHGHWDOKDPHQWRSRVVt
TXHGLVS}HVREUHRDFHVVRDLQIRUPDo}HV YHOVHPPRGLILFDo}HV
SUHYLVWRQRLQFLVR;;;,,,GRFDSXWGRDUWRQR
LQFLVR,,GR†RGRDUWHQR†RGRDUW ;, LQIRUPDomRDWXDOL]DGDLQIRUPDomRTXHUH~QHRV
GD&RQVWLWXLomR GDGRVPDLVUHFHQWHVVREUHRWHPDGHDFRUGRFRP
VXDQDWXUH]DFRPRVSUD]RVSUHYLVWRVHPQRUPDV
$UWž 2V yUJmRV H DV HQWLGDGHV GR 3RGHU([HFXWLYR HVSHFtILFDVRXFRQIRUPHDSHULRGLFLGDGHHVWDEHOH
IHGHUDODVVHJXUDUmRjVSHVVRDVQDWXUDLVHMXUtGL FLGD QRV VLVWHPDV LQIRUPDWL]DGRV TXH D RUJDQL
FDVRGLUHLWRGHDFHVVRjLQIRUPDomRTXHVHUi ]DPH
SURSRUFLRQDGRPHGLDQWHSURFHGLPHQWRVREMHWLYRV
HiJHLVGHIRUPDWUDQVSDUHQWHFODUDHHPOLQJXD ;,, GRFXPHQWR SUHSDUDWyULR  GRFXPHQWRIRUPDO
JHPGHIiFLOFRPSUHHQVmRREVHUYDGRVRVSULQFt XWLOL]DGRFRPRIXQGDPHQWRGDWRPDGDGHGHFLVmR
SLRV GD DGPLQLVWUDomR S~EOLFD H DV GLUHWUL]HV RXGHDWRDGPLQLVWUDWLYRDH[HPSORGHSDUHFHUHV
SUHYLVWDVQD/HLQRGH HQRWDVWpFQLFDV

$UWž 3DUDRVHIHLWRVGHVWH'HFUHWRFRQVLGHUDVH $UWž $ EXVFD H R IRUQHFLPHQWR GD LQIRUPDomRVmR


JUDWXLWRVUHVVDOYDGDDFREUDQoDGRYDORUUHIHUHQ
, LQIRUPDomR  GDGRV SURFHVVDGRVRXQmRTXH WHDRFXVWRGRVVHUYLoRVHGRVPDWHULDLVXWLOL]DGRV
SRGHPVHUXWLOL]DGRVSDUDSURGXomRHWUDQVPLV WDLV FRPR UHSURGXomR GH GRFXPHQWRV PtGLDV
VmR GH FRQKHFLPHQWR FRQWLGRV HP TXDOTXHU GLJLWDLVHSRVWDJHP
PHLRVXSRUWHRXIRUPDWR
†~QLFR (VWiLVHQWRGHUHVVDUFLURVFXVWRVGRVVHUYLoRVH
,, GDGRVSURFHVVDGRVGDGRVVXEPHWLGRVDTXDOTXHU GRV PDWHULDLV XWLOL]DGRV DTXHOH FXMD VLWXDomR
RSHUDomR RX WUDWDPHQWR SRU PHLR GH SURFHVVD HFRQ{PLFDQmROKHSHUPLWDID]rORVHPSUHMXt]R
PHQWRHOHWU{QLFRRXSRUPHLRDXWRPDWL]DGRFRP GRVXVWHQWRSUySULRRXGDIDPtOLDGHFODUDGDQRV
RHPSUHJRGHWHFQRORJLDGDLQIRUPDomR WHUPRVGD/HLQRGHGHDJRVWRGH
,,, GRFXPHQWRXQLGDGHGHUHJLVWURGHLQIRUPDo}HV
TXDOTXHUTXHVHMDRVXSRUWHRXIRUPDWR
&DStWXOR,,
'$$%5$1*È1&,$
,9 LQIRUPDomR VLJLORVD  LQIRUPDomRVXEPHWLGD
WHPSRUDULDPHQWH j UHVWULomR GH DFHVVR S~EOLFR
$UWž 6XMHLWDPVHDRGLVSRVWRQHVWH'HFUHWRRVyUJmRV
HP UD]mR GH VXD LPSUHVFLQGLELOLGDGH SDUD D
VHJXUDQoD GD VRFLHGDGH H GR (VWDGR H DTXHODV GDDGPLQLVWUDomRGLUHWDDVDXWDUTXLDVDVIXQGD
DEUDQJLGDV SHODV GHPDLV KLSyWHVHV OHJDLV GH o}HVS~EOLFDVDVHPSUHVDVS~EOLFDVDVVRFLHGDGHV
VLJLOR GHHFRQRPLDPLVWDHDVGHPDLVHQWLGDGHVFRQWUR
ODGDVGLUHWDRXLQGLUHWDPHQWHSHOD8QLmR
9 LQIRUPDomR SHVVRDO  LQIRUPDomRUHODFLRQDGDj
SHVVRD QDWXUDO LGHQWLILFDGD RX LGHQWLILFiYHO †ž $GLYXOJDomRGHLQIRUPDo}HVGHHPSUHVDVS~EOL
UHODWLYD j LQWLPLGDGH YLGD SULYDGD KRQUD H FDV VRFLHGDGH GH HFRQRPLD PLVWD H GHPDLV
LPDJHP HQWLGDGHVFRQWURODGDVSHOD8QLmRTXHDWXHPHP
UHJLPHGHFRQFRUUrQFLDVXMHLWDVDRGLVSRVWRQR
9, WUDWDPHQWR GD LQIRUPDomR  FRQMXQWR GHDo}HV $UW GD &RQVWLWXLomR HVWDUi VXEPHWLGD jV
UHIHUHQWHV j SURGXomR UHFHSomR FODVVLILFDomR QRUPDV SHUWLQHQWHV GD &RPLVVmR GH 9DORUHV
XWLOL]DomRDFHVVRUHSURGXomRWUDQVSRUWHWUDQV 0RELOLiULRVDILPGHDVVHJXUDUVXDFRPSHWLWLYLGD
PLVVmR GLVWULEXLomR DUTXLYDPHQWR DUPD]HQD GHJRYHUQDQoDFRUSRUDWLYDHTXDQGRKRXYHURV
PHQWR HOLPLQDomR DYDOLDomR GHVWLQDomR RX LQWHUHVVHVGHDFLRQLVWDVPLQRULWiULRV
FRQWUROHGDLQIRUPDomR
 /HJLVODomR 8QLYHUVLGDGH)HGHUDOGR5LRGH-DQHLUR


†ž 1mR VH VXMHLWDP DR GLVSRVWR QHVWH'HFUHWRDV ,,, UHSDVVHVRXWUDQVIHUrQFLDVGHUHFXUVRVILQDQFHL


LQIRUPDo}HVUHODWLYDVjDWLYLGDGHHPSUHVDULDOGH URV
SHVVRDV ItVLFDV RX MXUtGLFDV GH GLUHLWR SULYDGR
REWLGDVSHOR%DQFR&HQWUDOGR%UDVLOSHODVDJrQ ,9 H[HFXomRRUoDPHQWiULDHILQDQFHLUDGHWDOKDGD
FLDVUHJXODGRUDVRXSRURXWURVyUJmRVRXHQWLGD
GHVQRH[HUFtFLRGHDWLYLGDGHGHFRQWUROHUHJXOD 9 OLFLWDo}HVUHDOL]DGDVHHPDQGDPHQWRFRPHGLWD
omR H VXSHUYLVmR GD DWLYLGDGH HFRQ{PLFD FXMD LVDQH[RVHUHVXOWDGRVDOpPGRVFRQWUDWRVILUPD
GLYXOJDomRSRVVDUHSUHVHQWDUYDQWDJHPFRPSHWL GRVHQRWDVGHHPSHQKRHPLWLGDV
WLYDDRXWURVDJHQWHVHFRQ{PLFRV
9, UHPXQHUDomRHVXEVtGLRUHFHELGRVSRURFXSDQWH
$UWž 2DFHVVRjLQIRUPDomRGLVFLSOLQDGRQHVWH'HFUHWR GH FDUJR SRVWR JUDGXDomR IXQomR H HPSUHJR
QmRVHDSOLFD S~EOLFR LQFOXLQGR DX[tOLRV DMXGDV GH FXVWR
MHWRQVHTXDLVTXHURXWUDVYDQWDJHQVSHFXQLiULDV
, jV KLSyWHVHV GH VLJLORSUHYLVWDVQDOHJLVODomR EHPFRPRSURYHQWRVGHDSRVHQWDGRULDHSHQV}HV
FRPRILVFDOEDQFiULRGHRSHUDo}HVHVHUYLoRVQR GDTXHOHV TXH HVWLYHUHP QD DWLYD GH PDQHLUD
PHUFDGR GH FDSLWDLV FRPHUFLDO SURILVVLRQDO LQGLYLGXDOL]DGDFRQIRUPHDWRGR0LQLVWpULRGR
LQGXVWULDOHVHJUHGRGHMXVWLoDH 3ODQHMDPHQWR2UoDPHQWRH*HVWmR

,, jVLQIRUPDo}HVUHIHUHQWHVDSURMHWRVGHSHVTXLVD 9,, UHVSRVWDVDSHUJXQWDVPDLVIUHTXHQWHVGDVRFLHGD


H GHVHQYROYLPHQWR FLHQWtILFRV RX WHFQROyJLFRV GH 5HGDomRGDGDSHOR'HFUHWRQžGH
FXMR VLJLOR VHMD LPSUHVFLQGtYHO j VHJXUDQoD GD
VRFLHGDGHHGR(VWDGRQDIRUPDGR†RGR$UWR 9,,, FRQWDWRGDDXWRULGDGHGHPRQLWRUDPHQWRGHVLJ
GD/HLQRGH QDGDQRVWHUPRVGR$UWGD/HLQRGH
HWHOHIRQHHFRUUHLRHOHWU{QLFRGR6HUYLoR
&DStWXOR,,, GH,QIRUPDo}HVDR&LGDGmR 6,&
'$75$163$5È1&,$$7,9$
,; SURJUDPDVILQDQFLDGRVSHOR)XQGRGH$PSDURDR
$UWž eGHYHUGRVyUJmRVHHQWLGDGHVSURPRYHULQGH 7UDEDOKDGRU)$7 ,QFOXtGRSHOR'HFUHWRQžGH
SHQGHQWHGHUHTXHULPHQWRDGLYXOJDomRHPVHXV
VtWLRV QD ,QWHUQHW GH LQIRUPDo}HV GH LQWHUHVVH †ž $VLQIRUPDo}HVSRGHUmRVHUGLVSRQLELOL]DGDVSRU
FROHWLYRRXJHUDOSRUHOHVSURGX]LGDVRXFXVWRGLD PHLR GH IHUUDPHQWD GH UHGLUHFLRQDPHQWR GH
GDVREVHUYDGRRGLVSRVWRQRVDUWVRHRGD/HL SiJLQDQD,QWHUQHWTXDQGRHVWLYHUHPGLVSRQtYHLV
QRGH HPRXWURVVtWLRVJRYHUQDPHQWDLV

†ž 2VyUJmRVHHQWLGDGHVGHYHUmRLPSOHPHQWDUHP †ž 1R FDVR GDV HPSUHVDV S~EOLFDVVRFLHGDGHVGH


VHXV VtWLRV QD ,QWHUQHW VHomR HVSHFtILFD SDUD D HFRQRPLDPLVWDHGHPDLVHQWLGDGHVFRQWURODGDV
GLYXOJDomRGDVLQIRUPDo}HVGHTXHWUDWDRFDSXW SHOD8QLmRTXHDWXHPHPUHJLPHGHFRQFRUUrQ
FLDVXMHLWDVDRGLVSRVWRQR$UWGD&RQVWLWXL
†ž 6HUmRGLVSRQLELOL]DGRVQRVVtWLRVQD,QWHUQHWGRV omRDSOLFDVHRGLVSRVWRQR†RGR$UWR
yUJmRVHHQWLGDGHVFRQIRUPHSDGUmRHVWDEHOHFLGR
SHOD6HFUHWDULDGH&RPXQLFDomR6RFLDOGD3UHVL †ž 2 %DQFR &HQWUDO GR %UDVLOGLYXOJDUiSHULRGLFD
GrQFLDGD5HS~EOLFD PHQWH LQIRUPDo}HV UHODWLYDV jV RSHUDo}HV GH
FUpGLWRSUDWLFDGDVSHODVLQVWLWXLo}HVILQDQFHLUDV
, EDQQHUQDSiJLQDLQLFLDOTXHGDUiDFHVVRjVHomR LQFOXVLYH DV WD[DV GH MXURV PtQLPD Pi[LPD H
HVSHFtILFDGHTXHWUDWDR†RH PpGLDHDVUHVSHFWLYDVWDULIDVEDQFiULDV

,, EDUUDGHLGHQWLGDGHGR*RYHUQRIHGHUDOFRQWHQ †ž $GLYXOJDomRGDVLQIRUPDo}HVSUHYLVWDVQR†R


GR IHUUDPHQWD GH UHGLUHFLRQDPHQWR GH SiJLQD QmR H[FOXL RXWUDV KLSyWHVHV GH SXEOLFDomR H
SDUDR3RUWDO%UDVLOHSDUDRVtWLRSULQFLSDOVREUH GLYXOJDomR GH LQIRUPDo}HV SUHYLVWDV QD OHJLVOD
D/HLQRGH omR

†ž 'HYHUmR VHU GLYXOJDGDV QD VHomRHVSHFtILFDGH †ž $WRFRQMXQWRGRV0LQLVWURVGH(VWDGRGD&RQWUR


TXHWUDWDR†RLQIRUPDo}HVVREUH ODGRULD*HUDOGD8QLmRGR3ODQHMDPHQWR2UoD
PHQWRH*HVWmRHGR7UDEDOKRH(PSUHJRGLVSRUi
, HVWUXWXUDRUJDQL]DFLRQDOFRPSHWrQFLDVOHJLVOD VREUHDGLYXOJDomRGRVSURJUDPDVGHTXHWUDWDR
omRDSOLFiYHOSULQFLSDLVFDUJRVHVHXVRFXSDQWHV LQFLVR ,; GR † ž TXH VHUi IHLWD REVHUYDGR R
HQGHUHoRHWHOHIRQHVGDVXQLGDGHVKRUiULRVGH GLVSRVWRQR&DStWXOR9,, ,QFOXtGR SHOR 'HFUHWR Qž  GH

DWHQGLPHQWRDRS~EOLFR

,, SURJUDPDV SURMHWRV Do}HV REUDVHDWLYLGDGHV , GHPDQHLUDLQGLYLGXDOL]DGD


FRPLQGLFDomRGDXQLGDGHUHVSRQViYHOSULQFLSDLV
PHWDVHUHVXOWDGRVHTXDQGRH[LVWHQWHVLQGLFD ,, SRUPHLRGHLQIRUPDo}HVFRQVROLGDGDVGLVSRQLEL
GRUHVGHUHVXOWDGRHLPSDFWR OL]DGDV QR VtWLR QD ,QWHUQHW GR 0LQLVWpULR GR
7UDEDOKRH(PSUHJRH
8QLYHUVLGDGH )HGHUDOGR5LRGH-DQHLUR
 /HJLVODomR 

,,, SRU PHLR GH GLVSRQLELOL]DomR GH YDULiYHLVGDV , RUHFHELPHQWRGRSHGLGRGHDFHVVRHVHPSUHTXH


EDVHVGHGDGRVSDUDH[HFXomRGHFUX]DPHQWRV SRVVtYHORIRUQHFLPHQWRLPHGLDWRGDLQIRUPDomR
SDUD ILQV GH HVWXGRV H SHVTXLVDV REVHUYDGR R
GLVSRVWRQRDUW ,, RUHJLVWURGRSHGLGRGHDFHVVRHPVLVWHPDHOHWU{
QLFRHVSHFtILFRHDHQWUHJDGHQ~PHURGRSURWRFR
$UWž 2V VtWLRV QD ,QWHUQHW GRV yUJmRV HHQWLGDGHV ORTXHFRQWHUiDGDWDGHDSUHVHQWDomRGRSHGLGR
GHYHUmRHPFXPSULPHQWRjVQRUPDVHVWDEHOHFL H
GDVSHOR0LQLVWpULRGR3ODQHMDPHQWR2UoDPHQWR
H*HVWmRDWHQGHUDRVVHJXLQWHVUHTXLVLWRVHQWUH ,,, RHQFDPLQKDPHQWRGRSHGLGRUHFHELGRHUHJLVWUD
RXWURV GRjXQLGDGHUHVSRQViYHOSHORIRUQHFLPHQWRGD
LQIRUPDomRTXDQGRFRXEHU
, FRQWHUIRUPXOiULRSDUDSHGLGRGHDFHVVRjLQIRU
PDomR $UW 26,&VHUiLQVWDODGRHPXQLGDGHItVLFDLGHQWLILFD
GDGHIiFLODFHVVRHDEHUWDDRS~EOLFR
,, FRQWHUIHUUDPHQWDGHSHVTXLVDGHFRQWH~GRTXH
SHUPLWDRDFHVVRjLQIRUPDomRGHIRUPDREMHWLYD †ž 1DVXQLGDGHVGHVFHQWUDOL]DGDVHPTXHQmRKRX
WUDQVSDUHQWH FODUD H HP OLQJXDJHP GH IiFLO YHU6,&VHUiRIHUHFLGRVHUYLoRGHUHFHELPHQWRH
UHJLVWURGRVSHGLGRVGHDFHVVRjLQIRUPDomR
FRPSUHHQVmR
†ž 6H D XQLGDGH GHVFHQWUDOL]DGD QmRGHWLYHUD
,,, SRVVLELOLWDU JUDYDomR GH UHODWyULRV HPGLYHUVRV
LQIRUPDomRRSHGLGRVHUiHQFDPLQKDGRDR6,&
IRUPDWRV HOHWU{QLFRV LQFOXVLYH DEHUWRV H QmR
GRyUJmRRXHQWLGDGHFHQWUDOTXHFRPXQLFDUiDR
SURSULHWiULRV WDLV FRPR SODQLOKDV H WH[WR GH
UHTXHUHQWH R Q~PHUR GR SURWRFROR H D GDWD GH
PRGRDIDFLOLWDUDDQiOLVHGDVLQIRUPDo}HV
UHFHELPHQWRGRSHGLGRDSDUWLUGDTXDOVHLQLFLD
RSUD]RGHUHVSRVWD
,9 SRVVLELOLWDU DFHVVR DXWRPDWL]DGR SRUVLVWHPDV
H[WHUQRV HP IRUPDWRV DEHUWRV HVWUXWXUDGRV H 6HomR,,
OHJtYHLVSRUPiTXLQD 'R3HGLGRGH$FHVVRj,QIRUPDomR

9 GLYXOJDUHPGHWDOKHVRVIRUPDWRVXWLOL]DGRVSDUD $UW 4XDOTXHU SHVVRD QDWXUDO RX MXUtGLFDSRGHUi


HVWUXWXUDomRGDLQIRUPDomR IRUPXODUSHGLGRGHDFHVVRjLQIRUPDomR

9, JDUDQWLUDXWHQWLFLGDGHHLQWHJULGDGHGDVLQIRUPD †ž 2SHGLGRVHUiDSUHVHQWDGRHPIRUPXOiULRSDGUmR


o}HVGLVSRQtYHLVSDUDDFHVVR GLVSRQLELOL]DGR HP PHLR HOHWU{QLFR H ItVLFR QR
VtWLRQD,QWHUQHWHQR6,&GRVyUJmRVHHQWLGDGHV
9,, LQGLFDU LQVWUXo}HV TXH SHUPLWDP DRUHTXHUHQWH
FRPXQLFDUVH SRU YLD HOHWU{QLFD RX WHOHI{QLFD †ž 2SUD]RGHUHVSRVWDVHUiFRQWDGRDSDUWLUGDGDWD
FRPRyUJmRRXHQWLGDGHH GHDSUHVHQWDomRGRSHGLGRDR6,&

9,,, JDUDQWLUDDFHVVLELOLGDGHGHFRQWH~GRSDUDSHVVR †ž eIDFXOWDGRDRVyUJmRVHHQWLGDGHVRUHFHELPHQWR


DVFRPGHILFLrQFLD GHSHGLGRVGHDFHVVRjLQIRUPDomRSRUTXDOTXHU
RXWUR PHLR OHJtWLPR FRPR FRQWDWR WHOHI{QLFR
FRUUHVSRQGrQFLDHOHWU{QLFDRXItVLFDGHVGHTXH
&DStWXOR,9 DWHQGLGRVRVUHTXLVLWRVGR$UW
'$75$163$5È1&,$3$66,9$
†ž 1DKLSyWHVHGR†RVHUiHQYLDGDDRUHTXHUHQWH
6HomR, FRPXQLFDomRFRPRQ~PHURGHSURWRFRORHDGDWD
'R6HUYLoRGH,QIRUPDomRDR&LGDGmR GRUHFHELPHQWRGRSHGLGRSHOR6,&DSDUWLUGD
TXDOVHLQLFLDRSUD]RGHUHVSRVWD
$UWž 2VyUJmRVHHQWLGDGHVGHYHUmRFULDU6HUYLoRGH
,QIRUPDo}HVDR&LGDGmR 6,&FRPRREMHWLYRGH $UW 2SHGLGRGHDFHVVRjLQIRUPDomRGHYHUiFRQWHU

, DWHQGHUHRULHQWDURS~EOLFRTXDQWRDRDFHVVRj , QRPHGRUHTXHUHQWH


LQIRUPDomR
,, Q~PHURGHGRFXPHQWRGHLGHQWLILFDomRYiOLGR
,, LQIRUPDUVREUHDWUDPLWDomRGHGRFXPHQWRVQDV
XQLGDGHVH ,,, HVSHFLILFDomRGHIRUPDFODUDHSUHFLVDGDLQIRU
PDomRUHTXHULGDH
,,, UHFHEHUHUHJLVWUDUSHGLGRVGHDFHVVRjLQIRUPD
,9 HQGHUHoRItVLFRRXHOHWU{QLFRGRUHTXHUHQWHSDUD
omR
UHFHELPHQWRGHFRPXQLFDo}HVRXGDLQIRUPDomR
†~QLFR &RPSHWHDR6,& UHTXHULGD
 /HJLVODomR 8QLYHUVLGDGH)HGHUDOGR5LRGH-DQHLUR


$UW 1mRVHUmRDWHQGLGRVSHGLGRVGHDFHVVRjLQIRUPD †ž 1DLPSRVVLELOLGDGHGHREWHQomRGHFySLDGHTXH


omR WUDWDR†RRUHTXHUHQWHSRGHUiVROLFLWDUTXHjV
VXDVH[SHQVDVHVREVXSHUYLVmRGHVHUYLGRUS~EOL
, JHQpULFRV FRDUHSURGXomR VHMDIHLWDSRURXWURPHLRTXH
QmRSRQKDHPULVFRDLQWHJULGDGHGRGRFXPHQWR
,, GHVSURSRUFLRQDLVRXGHVDUUD]RDGRVRX RULJLQDO

,,, TXHH[LMDPWUDEDOKRVDGLFLRQDLVGHDQiOLVHLQWHU $UW 2 SUD]R SDUD UHVSRVWD GR SHGLGR SRGHUiVHU


SUHWDomR RX FRQVROLGDomR GH GDGRV H LQIRUPD SURUURJDGR SRU GH] GLDV PHGLDQWH MXVWLILFDWLYD
o}HVRXVHUYLoRGHSURGXomRRXWUDWDPHQWRGH HQFDPLQKDGDDRUHTXHUHQWHDQWHVGRWpUPLQRGR
GDGRVTXHQmRVHMDGHFRPSHWrQFLDGRyUJmRRX SUD]RLQLFLDOGHYLQWHGLDV
HQWLGDGH
$UW &DVR D LQIRUPDomR HVWHMD GLVSRQtYHO DRS~EOLFR
†~QLFR 1D KLSyWHVH GR LQFLVR ,,, GR FDSXW RyUJmRRX HP IRUPDWR LPSUHVVR HOHWU{QLFR RX HP RXWUR
HQWLGDGH GHYHUi FDVR WHQKD FRQKHFLPHQWR PHLR GH DFHVVR XQLYHUVDO R yUJmR RX HQWLGDGH
LQGLFDURORFDORQGHVHHQFRQWUDPDVLQIRUPDo}HV GHYHUiRULHQWDUR UHTXHUHQWHTXDQWRDRORFDOH
DSDUWLUGDVTXDLVRUHTXHUHQWHSRGHUiUHDOL]DUD PRGR SDUD FRQVXOWDU REWHU RX UHSURGX]LU D
LQWHUSUHWDomR FRQVROLGDomR RX WUDWDPHQWR GH LQIRUPDomR
GDGRV
†~QLFR 1DKLSyWHVHGRFDSXWRyUJmRRXHQWLGDGHGHVR
$UW 6mRYHGDGDVH[LJrQFLDVUHODWLYDVDRVPRWLYRVGR EULJDVHGRIRUQHFLPHQWRGLUHWRGDLQIRUPDomR
SHGLGRGHDFHVVRjLQIRUPDomR VDOYR VH R UHTXHUHQWH GHFODUDU QmR GLVSRU GH
PHLRV SDUD FRQVXOWDU REWHU RX UHSURGX]LU D
6HomR,,, LQIRUPDomR
'R3URFHGLPHQWRGH$FHVVRj,QIRUPDomR
$UW 4XDQGRRIRUQHFLPHQWRGDLQIRUPDomRLPSOLFDU
$UW 5HFHELGRRSHGLGRHHVWDQGRDLQIRUPDomRGLVSR UHSURGXomRGHGRFXPHQWRVRyUJmRRXHQWLGDGH
QtYHORDFHVVRVHUiLPHGLDWR REVHUYDGRRSUD]RGHUHVSRVWDDRSHGLGRGLVSR
QLELOL]DUiDRUHTXHUHQWH*XLDGH5HFROKLPHQWRGD
8QLmR  *58 RX GRFXPHQWR HTXLYDOHQWH SDUD
†ž &DVRQmRVHMDSRVVtYHORDFHVVRLPHGLDWRRyUJmR
SDJDPHQWRGRVFXVWRVGRVVHUYLoRVHGRVPDWHULD
RXHQWLGDGHGHYHUiQRSUD]RGHDWpYLQWHGLDV
LVXWLOL]DGRV
, HQYLDUDLQIRUPDomRDRHQGHUHoRItVLFRRXHOHWU{ †~QLFR $UHSURGXomRGHGRFXPHQWRVRFRUUHUiQRSUD]R
QLFRLQIRUPDGR GHGH]GLDVFRQWDGRGDFRPSURYDomRGRSDJD
PHQWRSHORUHTXHUHQWHRXGDHQWUHJDGHGHFODUD
,, FRPXQLFDU GDWD ORFDO H PRGRSDUDUHDOL]DU omRGHSREUH]DSRUHOHILUPDGDQRVWHUPRVGD/HL
FRQVXOWD j LQIRUPDomR HIHWXDU UHSURGXomR RX QRGHUHVVDOYDGDVKLSyWHVHVMXVWLILFD
REWHUFHUWLGmRUHODWLYDjLQIRUPDomR GDVHPTXHGHYLGRDRYROXPHRXDRHVWDGRGRV
GRFXPHQWRVDUHSURGXomRGHPDQGHSUD]RVXSH
,,, FRPXQLFDUTXHQmRSRVVXLDLQIRUPDomRRXTXH ULRU
QmRWHPFRQKHFLPHQWRGHVXDH[LVWrQFLD
$UW 1HJDGR R SHGLGR GH DFHVVR j LQIRUPDomRVHUi
,9 LQGLFDU FDVR WHQKD FRQKHFLPHQWR R yUJmRRX HQYLDGD DR UHTXHUHQWH QR SUD]R GH UHVSRVWD
HQWLGDGHUHVSRQViYHOSHODLQIRUPDomRRXTXHD FRPXQLFDomRFRP
GHWHQKDRX
, UD]}HVGDQHJDWLYDGHDFHVVRHVHXIXQGDPHQWR
9 LQGLFDUDVUD]}HVGDQHJDWLYDWRWDORXSDUFLDOGR OHJDO
DFHVVR
,, SRVVLELOLGDGHHSUD]RGHUHFXUVRFRPLQGLFDomR
†ž 1DVKLSyWHVHVHPTXHRSHGLGRGHDFHVVRGHPDQ GDDXWRULGDGHTXHRDSUHFLDUiH
GDUPDQXVHLRGHJUDQGHYROXPHGHGRFXPHQWRV
RXDPRYLPHQWDomRGRGRFXPHQWRSXGHUFRP ,,, SRVVLELOLGDGH GH DSUHVHQWDomR GH SHGLGRGH
SURPHWHUVXDUHJXODUWUDPLWDomRVHUiDGRWDGDD GHVFODVVLILFDomR GD LQIRUPDomR TXDQGR IRU R
PHGLGDSUHYLVWDQRLQFLVR,,GR†R FDVRFRPLQGLFDomRGDDXWRULGDGHFODVVLILFDGRUD
TXHRDSUHFLDUi
†ž 4XDQGRDPDQLSXODomRSXGHUSUHMXGLFDUDLQWH
JULGDGHGDLQIRUPDomRRXGRGRFXPHQWRRyUJmR †ž $V UD]}HV GH QHJDWLYD GH DFHVVR DLQIRUPDomR
RX HQWLGDGH GHYHUi LQGLFDU GDWD ORFDO H PRGR FODVVLILFDGD LQGLFDUmR R IXQGDPHQWR OHJDO GD
SDUD FRQVXOWD RX GLVSRQLELOL]DU FySLD FRP FODVVLILFDomRDDXWRULGDGHTXHDFODVVLILFRXHR
FHUWLILFDomRGHTXHFRQIHUHFRPRRULJLQDO FyGLJRGHLQGH[DomRGRGRFXPHQWRFODVVLILFDGR
8QLYHUVLGDGH )HGHUDOGR5LRGH-DQHLUR
 /HJLVODomR 

†ž 2VyUJmRVHHQWLGDGHVGLVSRQLELOL]DUmRIRUPXOiULR $UW 1RFDVRGHQHJDWLYDGHDFHVVRjLQIRUPDomRRX


SDGUmRSDUDDSUHVHQWDomRGHUHFXUVRHGHSHGLGR jVUD]}HVGDQHJDWLYDGRDFHVVRGHTXHWUDWD R
GHGHVFODVVLILFDomR FDSXWGR$UWGHVSURYLGRRUHFXUVRSHOD&RQ
WURODGRULD*HUDOGD8QLmRRUHTXHUHQWHSRGHUi
$UW 2DFHVVRDGRFXPHQWRSUHSDUDWyULRRXLQIRUPD DSUHVHQWDU QR SUD]R GH GH] GLDV FRQWDGR GD
omRQHOHFRQWLGDXWLOL]DGRVFRPRIXQGDPHQWRGH FLrQFLDGDGHFLVmRUHFXUVRj&RPLVVmR0LVWDGH
WRPDGDGHGHFLVmRRXGHDWRDGPLQLVWUDWLYRVHUi 5HDYDOLDomR GH ,QIRUPDo}HV REVHUYDGRV RV
DVVHJXUDGRDSDUWLUGDHGLomRGRDWRRXGHFLVmR SURFHGLPHQWRVSUHYLVWRVQR&DStWXOR9,
†~QLFR 2 0LQLVWpULR GD )D]HQGD H R %DQFR&HQWUDOGR
&DStWXOR9
%UDVLOFODVVLILFDUmRRVGRFXPHQWRVTXHHPEDVD
'$6,1)250$d¯(6
UHP GHFLV}HV GH SROtWLFD HFRQ{PLFD WDLV FRPR
&/$66,),&$'$6(0*5$8'(6,*,/2
ILVFDOWULEXWiULDPRQHWiULDHUHJXODWyULD
6HomR,
6HomR,9
'D&ODVVLILFDomRGH,QIRUPDo}HVTXDQWR
'RV5HFXUVRV
DR*UDXH3UD]RVGH6LJLOR
$UW 1RFDVRGHQHJDWLYDGHDFHVVRjLQIRUPDomRRX
GHQmRIRUQHFLPHQWRGDVUD]}HVGDQHJDWLYDGR $UW 6mR SDVVtYHLV GH FODVVLILFDomR DVLQIRUPDo}HV
DFHVVRSRGHUiRUHTXHUHQWHDSUHVHQWDUUHFXUVR FRQVLGHUDGDV LPSUHVFLQGtYHLV j VHJXUDQoD GD
QR SUD]R GH GH] GLDV FRQWDGR GD FLrQFLD GD VRFLHGDGH RX GR (VWDGR FXMD GLYXOJDomR RX
GHFLVmRjDXWRULGDGHKLHUDUTXLFDPHQWHVXSHULRU DFHVVRLUUHVWULWRSRVVDP
jTXHDGRWRXDGHFLVmRTXHGHYHUiDSUHFLiORQR
SUD]RGHFLQFRGLDVFRQWDGRGDVXDDSUHVHQWDomR , S{UHPULVFRDGHIHVDHDVREHUDQLDQDFLRQDLVRX
DLQWHJULGDGHGRWHUULWyULRQDFLRQDO
†~QLFR 'HVSURYLGRRUHFXUVRGHTXHWUDWDRFDSXWSRGH
UiRUHTXHUHQWHDSUHVHQWDUUHFXUVRQRSUD]RGH ,, SUHMXGLFDURXS{UHPULVFRDFRQGXomRGHQHJRFL
GH]GLDVFRQWDGRGDFLrQFLDGDGHFLVmRjDXWRUL Do}HVRXDVUHODo}HVLQWHUQDFLRQDLVGR3DtV
GDGHPi[LPDGRyUJmRRXHQWLGDGHTXHGHYHUi
VHPDQLIHVWDUHPFLQFRGLDVFRQWDGRVGRUHFHEL ,,, SUHMXGLFDURXS{UHPULVFRLQIRUPDo}HVIRUQHFL
PHQWRGRUHFXUVR GDV HP FDUiWHU VLJLORVR SRU RXWURV (VWDGRV H
RUJDQLVPRVLQWHUQDFLRQDLV
$UW 1R FDVR GH RPLVVmR GH UHVSRVWD DR SHGLGRGH
DFHVVRjLQIRUPDomRRUHTXHUHQWHSRGHUiDSUH ,9 S{UHPULVFRDYLGDDVHJXUDQoDRXDVD~GHGD
VHQWDUUHFODPDomRQRSUD]RGHGH]GLDVjDXWRUL SRSXODomR
GDGHGHPRQLWRUDPHQWRGHTXHWUDWDR$UWGD
/HLQRGHTXHGHYHUiVHPDQLIHVWDU 9 RIHUHFHUHOHYDGRULVFRjHVWDELOLGDGHILQDQFHLUD
QRSUD]RGHFLQFRGLDVFRQWDGRGRUHFHELPHQWR HFRQ{PLFDRXPRQHWiULDGR3DtV
GDUHFODPDomR
9, SUHMXGLFDURXFDXVDUULVFRDSODQRVRXRSHUDo}HV
†ž 2 SUD]R SDUD DSUHVHQWDUUHFODPDomRFRPHoDUi HVWUDWpJLFRVGDV)RUoDV$UPDGDV
WULQWDGLDVDSyVDDSUHVHQWDomRGRSHGLGR
9,, SUHMXGLFDURXFDXVDUULVFRDSURMHWRVGHSHVTXLVD
†ž $ DXWRULGDGH Pi[LPD GR yUJmRRXHQWLGDGH
H GHVHQYROYLPHQWR FLHQWtILFR RX WHFQROyJLFR
SRGHUi GHVLJQDU RXWUD DXWRULGDGH TXH OKH VHMD
DVVLPFRPRDVLVWHPDVEHQVLQVWDODo}HVRXiUHDV
GLUHWDPHQWHVXERUGLQDGDFRPRUHVSRQViYHOSHOR
GH LQWHUHVVH HVWUDWpJLFR QDFLRQDO REVHUYDGR R
UHFHELPHQWRHDSUHFLDomRGDUHFODPDomR
GLVSRVWRQRLQFLVR,,GRFDSXWGR$UWR
$UW 'HVSURYLGR R UHFXUVR GH TXH WUDWD RSDUiJUDIR
~QLFR GR $UW RX LQIUXWtIHUD D UHFODPDomR GH 9,,,S{U HP ULVFR D VHJXUDQoD GH LQVWLWXLo}HV RXGH
TXHWUDWDR$UWSRGHUiRUHTXHUHQWHDSUHVHQ DOWDVDXWRULGDGHVQDFLRQDLVRXHVWUDQJHLUDVHVHXV
WDU UHFXUVR QR SUD]R GH GH] GLDV FRQWDGR GD IDPLOLDUHVRX
FLrQFLD GD GHFLVmR j &RQWURODGRULD*HUDO GD
8QLmR TXH GHYHUi VH PDQLIHVWDU QR SUD]R GH ,; FRPSURPHWHU DWLYLGDGHV GH LQWHOLJrQFLDGH
FLQFRGLDVFRQWDGRGRUHFHELPHQWRGRUHFXUVR LQYHVWLJDomR RX GH ILVFDOL]DomR HP DQGDPHQWR
UHODFLRQDGDV FRP SUHYHQomR RX UHSUHVVmR GH
†ž $&RQWURODGRULD*HUDOGD8QLmRSRGHUiGHWHUPL LQIUDo}HV
QDUTXHRyUJmRRXHQWLGDGHSUHVWHHVFODUHFLPHQ
WRV $UW $LQIRUPDomRHPSRGHUGRVyUJmRVHHQWLGDGHV
REVHUYDGRRVHXWHRUHHPUD]mRGHVXDLPSUHV
†ž 3URYLGR R UHFXUVR D&RQWURODGRULD*HUDOGD FLQGLELOLGDGH j VHJXUDQoD GD VRFLHGDGH RX GR
8QLmRIL[DUiSUD]RSDUDRFXPSULPHQWRGDGHFL (VWDGRSRGHUiVHUFODVVLILFDGDQRJUDXXOWUDVVH
VmRSHORyUJmRRXHQWLGDGH FUHWRVHFUHWRRXUHVHUYDGR
 /HJLVODomR 8QLYHUVLGDGH)HGHUDOGR5LRGH-DQHLUR


$UW 3DUD D FODVVLILFDomR GD LQIRUPDomR HP JUDXGH †ž eYHGDGDDVXEGHOHJDomRGDFRPSHWrQFLDGHTXH


VLJLORGHYHUiVHUREVHUYDGRRLQWHUHVVHS~EOLFR WUDWDR†R
GDLQIRUPDomRHXWLOL]DGRRFULWpULRPHQRVUHVWUL
WLYRSRVVtYHOFRQVLGHUDGRV †ž 2VDJHQWHVS~EOLFRVUHIHULGRVQR†RGHYHUmRGDU
FLrQFLD GR DWR GH FODVVLILFDomR j DXWRULGDGH
, D JUDYLGDGH GR ULVFR RX GDQRjVHJXUDQoDGD GHOHJDQWHQRSUD]RGHQRYHQWDGLDV
VRFLHGDGHHGR(VWDGRH
†ž $FODVVLILFDomRGHLQIRUPDomRQRJUDXXOWUDVVHFUH
,, RSUD]RPi[LPRGHFODVVLILFDomRHPJUDXGHVLJLOR WRSHODVDXWRULGDGHVSUHYLVWDVQDVDOtQHDV´GµH
RXRHYHQWRTXHGHILQDVHXWHUPRILQDO ´HµGRLQFLVR,GRFDSXWGHYHUiVHUUDWLILFDGDSHOR
0LQLVWURGH(VWDGRQRSUD]RGHWULQWDGLDV
$UW 2VSUD]RVPi[LPRVGHFODVVLILFDomRVmRRVVHJXLQ
WHV †ž (QTXDQWR QmR UDWLILFDGD D FODVVLILFDomRGHTXH
WUDWD R † R FRQVLGHUDVH YiOLGD SDUD WRGRV RV
, JUDXXOWUDVVHFUHWRYLQWHHFLQFRDQRV HIHLWRVOHJDLV
,, JUDXVHFUHWRTXLQ]HDQRVH
,,, JUDXUHVHUYDGRFLQFRDQRV
6HomR,,
†~QLFR 3RGHUi VHU HVWDEHOHFLGD FRPR WHUPRILQDOGH 'RV3URFHGLPHQWRVSDUD&ODVVLILFDomRGH,QIRUPDomR
UHVWULomRGHDFHVVRDRFRUUrQFLDGHGHWHUPLQDGR
HYHQWRREVHUYDGRVRVSUD]RVPi[LPRVGHFODVVLIL $UW $GHFLVmRTXHFODVVLILFDUDLQIRUPDomRHPTXDO
FDomR TXHU JUDX GH VLJLOR GHYHUi VHU IRUPDOL]DGD QR
7HUPR GH &ODVVLILFDomR GH ,QIRUPDomR  7&,
$UW $VLQIRUPDo}HVTXHSXGHUHPFRORFDUHPULVFRD FRQIRUPHPRGHORFRQWLGRQR$QH[RHFRQWHUiR
VHJXUDQoD GR 3UHVLGHQWH GD 5HS~EOLFD 9L VHJXLQWH
FH3UHVLGHQWH H VHXV F{QMXJHV H ILOKRV VHUmR
FODVVLILFDGDV QR JUDX UHVHUYDGR H ILFDUmR VRE , FyGLJRGHLQGH[DomRGHGRFXPHQWR
VLJLORDWpRWpUPLQRGRPDQGDWRHPH[HUFtFLRRX
GR~OWLPRPDQGDWRHPFDVRGHUHHOHLomR ,, JUDXGHVLJLOR

$UW $FODVVLILFDomRGHLQIRUPDomRpGHFRPSHWrQFLD ,,, FDWHJRULDQDTXDOVHHQTXDGUDDLQIRUPDomR

, QRJUDXXOWUDVVHFUHWRGDVVHJXLQWHVDXWRULGDGHV ,9 WLSRGHGRFXPHQWR

D 3UHVLGHQWHGD5HS~EOLFD 9 GDWDGDSURGXomRGRGRFXPHQWR


E 9LFH3UHVLGHQWHGD5HS~EOLFD
F 0LQLVWURV GH (VWDGR H DXWRULGDGHV FRP DV 9, LQGLFDomRGHGLVSRVLWLYROHJDOTXHIXQGDPHQWDD
PHVPDVSUHUURJDWLYDV FODVVLILFDomR
G &RPDQGDQWHV GD 0DULQKD GR ([pUFLWR GD
$HURQiXWLFDH 9,, UD]}HV GD FODVVLILFDomR REVHUYDGRV RVFULWpULRV
H &KHIHVGH0LVV}HV'LSORPiWLFDVH&RQVXODUHV HVWDEHOHFLGRVQR$UW
SHUPDQHQWHVQRH[WHULRU
9,,,LQGLFDomRGRSUD]RGHVLJLORFRQWDGRHPDQRV
,, QR JUDX VHFUHWR GDV DXWRULGDGHVUHIHULGDVQR PHVHV RX GLDV RX GR HYHQWR TXH GHILQD R VHX
LQFLVR , GR FDSXW GRV WLWXODUHV GH DXWDUTXLDV WHUPR ILQDO REVHUYDGRV RV OLPLWHV SUHYLVWRV QR
IXQGDo}HV HPSUHVDV S~EOLFDV H VRFLHGDGHV GH $UW
HFRQRPLDPLVWDH
,; GDWDGDFODVVLILFDomRH
,,, QRJUDXUHVHUYDGRGDVDXWRULGDGHVUHIHULGDVQRV
LQFLVRV,H,,GRFDSXWHGDVTXHH[HUoDPIXQo}HV ; LGHQWLILFDomR GD DXWRULGDGH TXHFODVVLILFRXD
GHGLUHomRFRPDQGRRXFKHILDGR*UXSR'LUHomR LQIRUPDomR
H $VVHVVRUDPHQWR 6XSHULRUHV  '$6 QtYHO '$6
RXVXSHULRUHVHXVHTXLYDOHQWHV †ž 27&,VHJXLUiDQH[RjLQIRUPDomR

†ž eYHGDGDDGHOHJDomRGDFRPSHWrQFLDGHFODVVLIL †ž $VLQIRUPDo}HVSUHYLVWDVQRLQFLVR9,,GRFDSXW


FDomRQRVJUDXVGHVLJLORXOWUDVVHFUHWRRXVHFUHWR GHYHUmR VHU PDQWLGDV QR PHVPR JUDX GH VLJLOR
TXHDLQIRUPDomRFODVVLILFDGD
†ž 2GLULJHQWHPi[LPRGRyUJmRRXHQWLGDGHSRGHUi
GHOHJDUDFRPSHWrQFLDSDUDFODVVLILFDomRQRJUDX †ž $UDWLILFDomRGDFODVVLILFDomRGHTXHWUDWDR†R
UHVHUYDGRDDJHQWHS~EOLFRTXHH[HUoDIXQomRGH GR$UWGHYHUiVHUUHJLVWUDGDQR7&,
GLUHomRFRPDQGRRXFKHILD
8QLYHUVLGDGH )HGHUDOGR5LRGH-DQHLUR
 /HJLVODomR 

$UW $DXWRULGDGHRXRXWURDJHQWHS~EOLFRTXHFODVVLIL ,9 DSRVVLELOLGDGHGHGDQRVRXULVFRVGHFRUUHQWHVGD


FDULQIRUPDomRQRJUDXXOWUDVVHFUHWRRXVHFUHWR GLYXOJDomRRXDFHVVRLUUHVWULWRGDLQIRUPDomRH
GHYHUi HQFDPLQKDU FySLD GR 7&, j &RPLVVmR
0LVWDGH5HDYDOLDomRGH,QIRUPDo}HVQRSUD]RGH 9 D SHFXOLDULGDGHGDVLQIRUPDo}HVSURGX]LGDVQR
WULQWDGLDVFRQWDGRGDGHFLVmRGHFODVVLILFDomRRX H[WHULRUSRUDXWRULGDGHVRXDJHQWHVS~EOLFRV
GHUDWLILFDomR
$UW 2SHGLGRGHGHVFODVVLILFDomRRXGHUHDYDOLDomRGD
$UW 1DKLSyWHVHGHGRFXPHQWRTXHFRQWHQKDLQIRU FODVVLILFDomRSRGHUiVHUDSUHVHQWDGRDRVyUJmRVH<