Você está na página 1de 204

REFORMA INTEGRAL DE LA EDUCACIÓN MEDIA SUPERIOR

INGLÉS 3
FORMACIÓN BÁSICA

MÓDULO DE APRENDIZAJE

TERCER
SEMESTRE
INGLÉS 3
FORMACIÓN BÁSICA

MÓDULO DE APRENDIZAJE

TERCER
SEMESTRE
COLEGIO DE BACHILLERES DEL ESTADO DE SONORA
DIRECCIÓN GENERAL

DIRECCIÓN ACADÉMICA

INGLÉS 3
Módulo de Aprendizaje.
Copyright© 2015 por Colegio de Bachilleres del Estado de Sonora.
Todos los derechos reservados.
Primera edición 2015.
Reimpresión 2016.
Reimpresión 2017.
Reimpresión 2018.
Edición y Reimpresión 2019. Impreso en México.

DEPARTAMENTO DE INNOVACIÓN EDUCATIVA


ůǀĚ͘ŐƵƐơŶĚĞsŝůĚſƐŽůĂ͕^ĞĐƚŽƌ^Ƶƌ͘
,ĞƌŵŽƐŝůůŽ͕^ŽŶŽƌĂ͕DĠdžŝĐŽ͘͘W͘ϴϯϮϴϬ

COMISIÓN ELABORADORA

Elaboración:
Jessica Ruíz Calvillo
Bertha Cecilia Calvillo Fimbres

Diseño y edición:
DĂƌşĂ:ĞƐƷƐ:ŝŵĠŶĞnjƵĂƌƚĞ

Diseño de portada:
DĂƌşĂ:ĞƐƷƐ:ŝŵĠŶĞnjƵĂƌƚĞ

&ŽƚŽŐƌĂİĂĚĞƉŽƌƚĂĚĂ͗
Ari Antonio Ocampo Hernández
,ĠĐƚŽƌ'ƵŝůůĞƌŵŽŽƌƌĂůĞƐ>ſƉĞnj
&ĠůŝdžDĂŐĚŝĞůsĂƌŐĂƐĂŵĂnjŽ

Coordinación técnica:
ůĨƌĞĚŽZŽĚƌşŐƵĞnj>ĞſŶ
ZƵďŝƐĞůĂDŽƌĂůĞƐ'ŝƐƉĞƌƚ

Supervisión académica
ĂƌĂŬŝĞůsĂůĚĞnjDĞŶĚşǀŝů

Coordinación general:
DĂƵƌŝĐŝŽ'ƌĂĐŝĂŽƌŽŶĂĚŽ

Esta publicación se terminó de imprimir durante el mes de julio de 2019.


ŝƐĞŹĂĚĂĞŶŝƌĞĐĐŝſŶĐĂĚĠŵŝĐĂĚĞůŽůĞŐŝŽĚĞĂĐŚŝůůĞƌĞƐĚĞůƐƚĂĚŽĚĞ^ŽŶŽƌĂ͘
ůǀĚ͘ŐƵƐơŶĚĞsŝůĚſƐŽůĂ͕^ĞĐƚŽƌ^Ƶƌ͘,ĞƌŵŽƐŝůůŽ͕^ŽŶŽƌĂ͕DĠdžŝĐŽ͘
>ĂĞĚŝĐŝſŶĐŽŶƐƚĂĚĞ11,271 ejemplares.
COMPONENTE: CAMPO DE CONOCIMIENTO:
FORMACIÓN BÁSICA COMUNICACIÓN

HORAS SEMANALES: CRÉDITOS:


4 8

DATOS DEL ALUMNO

Nombre:
Plantel:
Grupo: Turno: Teléfono:
E-mail:
Domicilio:

3 3
PRELIMINARES
ůŽůĞŐŝŽĚĞĂĐŚŝůůĞƌĞƐĚĞůƐƚĂĚŽĚĞ^ŽŶŽƌĂ;K,Ϳ͕ĚĞƐĚĞůĂŝŵƉůĞŵĞŶƚĂĐŝſŶĚĞůĂZĞĨŽƌŵĂ/ŶƚĞŐƌĂůĚĞ
ůĂĚƵĐĂĐŝſŶDĞĚŝĂ^ƵƉĞƌŝŽƌĞŶϮϬϬϳ͕ĚĞĨŽƌŵĂƐŽĐŝĂůŵĞŶƚĞƌĞƐƉŽŶƐĂďůĞ͕ĚŝŽŝŶŝĐŝŽĂůĂĂĚĞĐƵĂĐŝſŶĚĞƐƵWůĂŶ
ĚĞĞƐƚƵĚŝŽƐLJĂƐƵƐƉƌŽĐĞƐŽƐĚĞĞŶƐĞŹĂŶnjĂĂƉƌĞŶĚŝnjĂũĞLJĚĞĞǀĂůƵĂĐŝſŶƉĂƌĂƌĞĨŽƌnjĂƌƐƵŵŽĚĞůŽĚĞĚƵĐĂĐŝſŶ
ĂƐĂĚĂĞŶŽŵƉĞƚĞŶĐŝĂƐ͕LJĂƐşůŽŐƌĂƌƋƵĞƉƵĚŝĞƌĂŶƐƵƐũſǀĞŶĞƐĞƐƚƵĚŝĂŶƚĞƐĚĞƐĂƌƌŽůůĂƌƚĂŶƚŽůĂƐĐŽŵƉĞƚĞŶĐŝĂƐ
ŐĞŶĠƌŝĐĂƐĐŽŵŽůĂƐĚŝƐĐŝƉůŝŶĂƌĞƐ͕ĞŶĞůŵĂƌĐŽĚĞů^ŝƐƚĞŵĂEĂĐŝŽŶĂůĚĞůĂĐŚŝůůĞƌĂƚŽ͘

ƐƚĞŵŽĚĞůŽƉŽƌĐŽŵƉĞƚĞŶĐŝĂƐĐŽŶƐŝĚĞƌĂƋƵĞ͕ĂĚĞŵĄƐĚĞĐŽŶƚĂƌĐŽŶĐŽŶŽĐŝŵŝĞŶƚŽƐ͕ĞƐŝŵƉŽƌƚĂŶƚĞĞůƵƐŽƋƵĞ
ƐĞŚĂĐĞĚĞĞůůŽƐĞŶƐŝƚƵĂĐŝŽŶĞƐĞƐƉĞĐşĮĐĂƐĚĞůĂǀŝĚĂƉĞƌƐŽŶĂů͕ƐŽĐŝĂůLJƉƌŽĨĞƐŝŽŶĂů͘ŝĐŚŽĚĞŽƚƌĂĨŽƌŵĂ͕ĞůƐĞƌ
ĐŽŵƉĞƚĞŶƚĞƐĞĚĞŵƵĞƐƚƌĂĐƵĂŶĚŽ͕ĚĞĨŽƌŵĂǀŽůƵŶƚĂƌŝĂ͕ƐĞĂƉůŝĐĂŶĚŝĐŚŽƐĐŽŶŽĐŝŵŝĞŶƚŽƐĂůĂƌĞƐŽůƵĐŝſŶĚĞ
ƐŝƚƵĂĐŝŽŶĞƐƉĞƌƐŽŶĂůĞƐŽĂůĂĂĚƋƵŝƐŝĐŝſŶĚĞŶƵĞǀŽƐĐŽŶŽĐŝŵŝĞŶƚŽƐ͕ŚĂďŝůŝĚĂĚĞƐLJĚĞƐƚƌĞnjĂƐ͕ůŽƋƵĞŚĂĐĞƋƵĞƐĞ
ƌĞĨƵĞƌĐĞůĂĂĚƋƵŝƐŝĐŝſŶĚĞŶƵĞǀĂƐĐŽŵƉĞƚĞŶĐŝĂƐ͘

ŶĞƐĞƐĞŶƟĚŽĞůK,͕ĂƚƌĂǀĠƐĚĞƐƵƐĚŽĐĞŶƚĞƐ͕ƌĞĞƐƚƌƵĐƚƵƌĂůĂĨŽƌŵĂĚĞƐƵƐĐŽŶƚĞŶŝĚŽƐĐƵƌƌŝĐƵůĂƌĞƐLJůŽ
ƉůĂƐŵĂĞŶƐƵƐŵſĚƵůŽƐĚĞĂƉƌĞŶĚŝnjĂũĞ͕ƉĂƌĂĨĂĐŝůŝƚĂƌĞůĚĞƐĂƌƌŽůůŽĚĞĐŽŵƉĞƚĞŶĐŝĂƐ͘ŶĞůĐĂƐŽĚĞůĐŽŵƉŽŶĞŶƚĞ
ĚĞ&ŽƌŵĂĐŝſŶƉĂƌĂĞůdƌĂďĂũŽ͕ĂĚĞŵĄƐĚĞůĂƐĐŽŵƉĞƚĞŶĐŝĂƐŐĞŶĠƌŝĐĂƐ͕ĨŽƌƚĂůĞĐĞĞůƐĞŶƟĚŽĚĞĂƉƌĞĐŝĂĐŝſŶŚĂĐŝĂ
ƉƌŽĐĞƐŽƐƉƌŽĚƵĐƟǀŽƐ͕ƉŽƌƋƵĞĂƵŶƋƵĞĞůďĂĐŚŝůůĞƌĂƚŽƋƵĞƚĞĞŶĐƵĞŶƚƌĂƐĐƵƌƐĂŶĚŽĞƐŐĞŶĞƌĂůLJƚĞƉƌĞƉĂƌĂƉĂƌĂ
ŝƌĂůĂƵŶŝǀĞƌƐŝĚĂĚ͕ĞƐŝŵƉŽƌƚĂŶƚĞĞůƋƵĞĂƉƌĞŶĚĂƐƵŶŽĮĐŝŽLJƉŽƐĞĂƐƵŶĂĂĐƟƚƵĚƉŽƐŝƟǀĂƉĂƌĂĚĞƐĞŵƉĞŹĂƌůŽ͘

ĞƚĂůĨŽƌŵĂƋƵĞ͕ĞƐƚĞŵſĚƵůŽĚĞĂƉƌĞŶĚŝnjĂũĞĚĞůĂĂƐŝŐŶĂƚƵƌĂĚĞInglés 3͕ĞƐƵŶĂŚĞƌƌĂŵŝĞŶƚĂǀĂůŝŽƐĂƉŽƌƋƵĞ
ĐŽŶ ƐƵ ĐŽŶƚĞŶŝĚŽ LJ ĞƐƚƌƵĐƚƵƌĂ ƉƌŽƉŝĐŝĂƌĄ ƚƵ ĚĞƐĂƌƌŽůůŽ ĐŽŵŽ ƉĞƌƐŽŶĂ ǀŝƐŝŽŶĂƌŝĂ͕ ĐŽŵƉĞƚĞŶƚĞ Ğ ŝŶŶŽǀĂĚŽƌĂ͕
ĐĂƌĂĐƚĞƌşƐƟĐĂƐƋƵĞƐĞĞƐƚĂďůĞĐĞŶĞŶůŽƐŽďũĞƟǀŽƐĚĞůĂZĞĨŽƌŵĂ/ŶƚĞŐƌĂůĚĞĚƵĐĂĐŝſŶDĞĚŝĂ^ƵƉĞƌŝŽƌ͘

ůŵſĚƵůŽĚĞĂƉƌĞŶĚŝnjĂũĞĞƐƵŶŽĚĞůŽƐĂƉŽLJŽƐĚŝĚĄĐƟĐŽƐƋƵĞĞůK,ƚĞŽĨƌĞĐĞĐŽŶůĂĮŶĂůŝĚĂĚĚĞŐĂƌĂŶƟnjĂƌ
ůĂĂĚĞĐƵĂĚĂƚƌĂŶƐŵŝƐŝſŶĚĞƐĂďĞƌĞƐĂĐƚƵĂůŝnjĂĚŽƐ͕ĂĐŽƌĚĞĂůĂƐŶƵĞǀĂƐƉŽůşƟĐĂƐĞĚƵĐĂƟǀĂƐ͕ĂĚĞŵĄƐĚĞůŽƋƵĞ
ĚĞŵĂŶĚĂŶůŽƐĞƐĐĞŶĂƌŝŽƐůŽĐĂů͕ŶĂĐŝŽŶĂůĞŝŶƚĞƌŶĂĐŝŽŶĂů͘ŶĐƵĂŶƚŽĂƐƵĞƐƚƌƵĐƚƵƌĂ͕ĞůŵſĚƵůŽƐĞĞŶĐƵĞŶƚƌĂ
ŽƌŐĂŶŝnjĂĚŽ ĞŶ ďůŽƋƵĞƐ ĚĞ ĂƉƌĞŶĚŝnjĂũĞ LJ ƐĞĐƵĞŶĐŝĂƐ ĚŝĚĄĐƟĐĂƐ͘ hŶĂ ƐĞĐƵĞŶĐŝĂ ĚŝĚĄĐƟĐĂ ĞƐ ƵŶ ĐŽŶũƵŶƚŽ ĚĞ
ĂĐƟǀŝĚĂĚĞƐ͕ŽƌŐĂŶŝnjĂĚĂƐĞŶƚƌĞƐŵŽŵĞŶƚŽƐ͗ŝŶŝĐŝŽ͕ĚĞƐĂƌƌŽůůŽLJĐŝĞƌƌĞ͘

ŶĞůŝŶŝĐŝŽĚĞƐĂƌƌŽůůĂƌĄƐĂĐƟǀŝĚĂĚĞƐƋƵĞƚĞƉĞƌŵŝƟƌĄŶŝĚĞŶƟĮĐĂƌLJƌĞĐƵƉĞƌĂƌůĂƐĞdžƉĞƌŝĞŶĐŝĂƐ͕ůŽƐƐĂďĞƌĞƐ͕ůĂƐ
ƉƌĞĐŽŶĐĞƉĐŝŽŶĞƐLJůŽƐĐŽŶŽĐŝŵŝĞŶƚŽƐƋƵĞLJĂŚĂƐĂĚƋƵŝƌŝĚŽĂƚƌĂǀĠƐĚĞƚƵĨŽƌŵĂĐŝſŶ͕ŵŝƐŵŽƐƋƵĞƚĞĂLJƵĚĂƌĄŶ
ĂĂďŽƌĚĂƌĐŽŶĨĂĐŝůŝĚĂĚĞůƚĞŵĂƋƵĞƐĞƉƌĞƐĞŶƚĂĞŶĞůĚĞƐĂƌƌŽůůŽ͕ĚŽŶĚĞƌĞĂůŝnjĂƌĄƐĂĐƟǀŝĚĂĚĞƐƋƵĞŝŶƚƌŽĚƵĐĞŶ
ŶƵĞǀŽƐĐŽŶŽĐŝŵŝĞŶƚŽƐĚĄŶĚŽƚĞůĂŽƉŽƌƚƵŶŝĚĂĚĚĞĐŽŶƚĞdžƚƵĂůŝnjĂƌůŽƐĞŶƐŝƚƵĂĐŝŽŶĞƐĚĞůĂǀŝĚĂĐŽƟĚŝĂŶĂ͕ĐŽŶ
ůĂĮŶĂůŝĚĂĚĚĞƋƵĞƚƵĂƉƌĞŶĚŝnjĂũĞƐĞĂƐŝŐŶŝĮĐĂƟǀŽ͘WŽƐƚĞƌŝŽƌŵĞŶƚĞƐĞĞŶĐƵĞŶƚƌĂĞůŵŽŵĞŶƚŽĚĞĐŝĞƌƌĞĚĞůĂ
ƐĞĐƵĞŶĐŝĂĚŝĚĄĐƟĐĂ͕ĚŽŶĚĞŝŶƚĞŐƌĂƌĄƐƚŽĚŽƐůŽƐƐĂďĞƌĞƐƋƵĞƌĞĂůŝnjĂƐƚĞĞŶůĂƐĂĐƟǀŝĚĂĚĞƐĚĞŝŶŝĐŝŽLJĚĞƐĂƌƌŽůůŽ͘

Ŷ ƚŽĚĂƐ ůĂƐ ĂĐƟǀŝĚĂĚĞƐ ĚĞ ůŽƐ ƚƌĞƐ ŵŽŵĞŶƚŽƐ ƐĞ ĐŽŶƐŝĚĞƌĂŶ ůŽƐ ƐĂďĞƌĞƐ ĐŽŶĐĞƉƚƵĂůĞƐ͕ ƉƌŽĐĞĚŝŵĞŶƚĂůĞƐ LJ
ĂĐƟƚƵĚŝŶĂůĞƐ͘ĞĂĐƵĞƌĚŽĂůĂƐĐĂƌĂĐƚĞƌşƐƟĐĂƐLJĚĞůƉƌŽƉſƐŝƚŽĚĞůĂƐĂĐƟǀŝĚĂĚĞƐ͕ĠƐƚĂƐƐĞĚĞƐĂƌƌŽůůĂŶĚĞĨŽƌŵĂ
ŝŶĚŝǀŝĚƵĂů͕ŐƌƵƉĂůŽĞƋƵŝƉŽƐ͘

WĂƌĂĞůĚĞƐĂƌƌŽůůŽĚĞƚƵƐĂĐƟǀŝĚĂĚĞƐĚĞůĂĐĂƉĂĐŝƚĂĐŝſŶƉĂƌĂĞůƚƌĂďĂũŽĚĞďĞƌĄƐƵƟůŝnjĂƌĚŝǀĞƌƐŽƐƌĞĐƵƌƐŽƐ͕ĚĞƐĚĞ
ŵĂƚĞƌŝĂů ďŝďůŝŽŐƌĄĮĐŽ͕ ǀŝĚĞŽƐ͕ ŝŶǀĞƐƟŐĂĐŝſŶ ĚĞ ĐĂŵƉŽ͕ ĞƚĐĠƚĞƌĂ͖ ĂƐş ĐŽŵŽ ƌĞĂůŝnjĂƌ ĂĐƟǀŝĚĂĚĞƐ ƉƌĄĐƟĐĂƐ ĚĞ
ĨŽƌŵĂŝŶĚŝǀŝĚƵĂůŽĞŶĞƋƵŝƉŽ͘
>ĂƌĞƚƌŽĂůŝŵĞŶƚĂĐŝſŶĚĞƚƵƐĐŽŶŽĐŝŵŝĞŶƚŽƐ ĞƐĚĞƐƵŵĂŝŵƉŽƌƚĂŶĐŝĂ͕ĚĞĂŚşƋƵĞƐĞƚĞ ŝŶǀŝƚĂĂƉĂƌƟĐŝƉĂƌĚĞ

4 PRELIMINARES
ĨŽƌŵĂĂĐƟǀĂĐƵĂŶĚŽĞůĚŽĐĞŶƚĞůŽŝŶĚŝƋƵĞ͕ĚĞĞƐƚĂĨŽƌŵĂĂĐůĂƌĂƌĄƐĚƵĚĂƐŽďŝĞŶĨŽƌƚĂůĞĐĞƌĄƐůŽĂƉƌĞŶĚŝĚŽ͖
ĂĚĞŵĄƐĞŶĞƐƚĞŵŽŵĞŶƚŽ͕ĞůĚŽĐĞŶƚĞƉŽĚƌĄƚĞŶĞƌƵŶĂǀŝƐŝſŶŐĞŶĞƌĂůĚĞůůŽŐƌŽĚĞůŽƐĂƉƌĞŶĚŝnjĂũĞƐĚĞůŐƌƵƉŽ͘

ZĞĐƵĞƌĚĂ ƋƵĞ ůĂ ĞǀĂůƵĂĐŝſŶ ĞŶ Ğů ĞŶĨŽƋƵĞ ĞŶ ĐŽŵƉĞƚĞŶĐŝĂƐ ĞƐ ƵŶ ƉƌŽĐĞƐŽ ĐŽŶƟŶƵŽ͕ ƋƵĞ ƉĞƌŵŝƚĞ ƌĞĐĂďĂƌ
ĞǀŝĚĞŶĐŝĂƐĂƚƌĂǀĠƐĚĞƚƵƚƌĂďĂũŽ͕ĚŽŶĚĞƐĞƚŽŵĂƌĄŶĞŶĐƵĞŶƚĂůŽƐƚƌĞƐƐĂďĞƌĞƐ͗ĐŽŶĐĞƉƚƵĂů͕ƉƌŽĐĞĚŝŵĞŶƚĂůLJ
ĂĐƟƚƵĚŝŶĂů͕ĐŽŶĞůƉƌŽƉſƐŝƚŽĚĞƋƵĞĂƉŽLJĂĚŽƉŽƌƚƵŵĂĞƐƚƌŽŵĞũŽƌĞƐĞůĂƉƌĞŶĚŝnjĂũĞ͘ƐŶĞĐĞƐĂƌŝŽƋƵĞƌĞĂůŝĐĞƐ
ůĂĂƵƚŽĞǀĂůƵĂĐŝſŶ͕ĞƐƚĞĞũĞƌĐŝĐŝŽƉĞƌŵŝƚĞƋƵĞǀĂůŽƌĞƐƚƵĂĐƚƵĂĐŝſŶLJƌĞĐŽŶŽnjĐĂƐƚƵƐƉŽƐŝďŝůŝĚĂĚĞƐ͕ůŝŵŝƚĂĐŝŽŶĞƐ
y cambios necesarios para mejorar tu aprendizaje.

ƐşƚĂŵďŝĠŶ͕ĞƐƌĞĐŽŵĞŶĚĂďůĞůĂĐŽĞǀĂůƵĂĐŝſŶ͕ƉƌŽĐĞƐŽĚŽŶĚĞĚĞŵĂŶĞƌĂĐŽŶũƵŶƚĂǀĂůŽƌĂŶƐƵĂĐƚƵĂĐŝſŶ͕ĐŽŶ
ůĂĮŶĂůŝĚĂĚĚĞĨŽŵĞŶƚĂƌůĂƉĂƌƟĐŝƉĂĐŝſŶ͕ƌĞŇĞdžŝſŶLJĐƌşƟĐĂĂŶƚĞƐŝƚƵĂĐŝŽŶĞƐĚĞƐƵƐĂƉƌĞŶĚŝnjĂũĞƐ͕ƉƌŽŵŽǀŝĞŶĚŽ
ůĂƐĂĐƟƚƵĚĞƐĚĞƌĞƐƉŽŶƐĂďŝůŝĚĂĚĞŝŶƚĞŐƌĂĐŝſŶĚĞůŐƌƵƉŽ͘

&ŝŶĂůŵĞŶƚĞ͕ ƐĞ ĚĞƐƚĂĐĂ ƋƵĞ͕ ĞŶ ĞƐƚĞ ŵŽĚĞůŽ͕ ƚƵ ƉƌŝŶĐŝƉĂů ĐŽŶƚƌŝďƵĐŝſŶ ĞƐ ƋƵĞ ĂĚŽƉƚĞƐ ƵŶ ƌŽů ĂĐƟǀŽ LJ
ƉĂƌƟĐŝƉĂƟǀŽƉĂƌĂůĂĐŽŶƐƚƌƵĐĐŝſŶĚĞƚƵƉƌŽƉŝŽĐŽŶŽĐŝŵŝĞŶƚŽLJĞůĚĞƐĂƌƌŽůůŽĚĞƚƵƐĐŽŵƉĞƚĞŶĐŝĂƐ͕ĂƚƌĂǀĠƐĚĞ
ůŽƋƵĞƉŽĚƌĄƐĚĂƌůĂƌĞƐƉƵĞƐƚĂLJůĂĐŽŶƚĞdžƚƵĂůŝnjĂĐŝſŶĂĚĞĐƵĂĚĂƐƉĂƌĂƌĞƐŽůǀĞƌůŽƐƉƌŽďůĞŵĂƐĚĞůĞŶƚŽƌŶŽĂůŽƐ
ƋƵĞƚĞĞŶĨƌĞŶƚĞƐ͕LJĂƐĞĂŶƉĞƌƐŽŶĂůĞƐŽƉƌŽĨĞƐŝŽŶĂůĞƐ͘

PRELIMINARES 5
ůŐůŽƐĂƌŝŽŝĐſŶŝĐŽĞƐůĂƌĞůĂĐŝſŶĚĞĮŐƵƌĂƐƋƵĞĞŶĐŽŶƚƌĂƌĄƐĞŶĚŝǀĞƌƐĂƐƉĂƌƚĞƐĚĞƚƵŵſĚƵůŽ͘ŶƐĞŐƵŝĚĂ͕ƐĞ
ŵƵĞƐƚƌĂŶũƵŶƚŽĐŽŶƐƵĚĞĮŶŝĐŝſŶ͕ůŽƋƵĞƚĞŽƌŝĞŶƚĂƌĄƐŽďƌĞůĂƐĂĐƟǀŝĚĂĚĞƐƋƵĞĚĞďĞƌĄƐƌĞĂůŝnjĂƌĚƵƌĂŶƚĞĞů
semestre en cada una de tus asignaturas.

EVALUACIÓN DIAGNÓSTICA COEVALUACIÓN


ƐƚĞƟƉŽĚĞĞǀĂůƵĂĐŝſŶƐĞŚĂĐĞĐŽŶƵŶŽŽǀĂƌŝŽƐĚĞƚƵƐ
^ĞƚƌĂƚĂĚĞůĂĞǀĂůƵĂĐŝſŶƋƵĞƐĞƌĞĂůŝnjĂƌĄĂůŝŶŝĐŝŽĚĞĐĂĚĂ ĐŽŵƉĂŹĞƌŽƐ͕ĞŶĞůůĂƚƷůŽƐĞǀĂůƷĂƐLJĞůůŽƐĂƟ͘>ĞƐƉĞƌŵŝƚĞ͕
ƐĞĐƵĞŶĐŝĂĚŝĚĄĐƟĐĂLJƋƵĞƚĞƉĞƌŵŝƟƌĄĞƐƚĂƌĐŽŶƐĐŝĞŶƚĞĚĞ ĂĚĞŵĄƐĚĞǀĂůŽƌĂƌƐƵƐĂƉƌĞŶĚŝnjĂũĞƐ͕ĐŽůĂďŽƌĂƌLJĂƉƌĞŶĚĞƌ
ƚƵƐĐŽŶŽĐŝŵŝĞŶƚŽƐĂĐĞƌĐĂĚĞůƚĞŵĂƋƵĞĂďŽƌĚĂƌĄƐ͘ unos de otros.

ACTIVIDAD INTEGRADORA
RÚBRICA DE EVALUACIÓN
ƐƚĂ ĂĐƟǀŝĚĂĚ ƌĞƐƵŵĞ ůŽƐ ĐŽŶŽĐŝŵŝĞŶƚŽƐ ĂĚƋƵŝƌŝĚŽƐ
ĚƵƌĂŶƚĞƵŶƉƌŽĐĞƐŽ͕LJĂƐĞĂƵŶĂƐĞĐƵĞŶĐŝĂĚŝĚĄĐƟĐĂ͕ƵŶ >Ă ƌƷďƌŝĐĂ ĞƐ ƵŶĂ ƚĂďůĂ ƋƵĞ ĐŽŶƟĞŶĞ ŶŝǀĞůĞƐ ĚĞ ůŽŐƌŽ
ďůŽƋƵĞŽůŽǀŝƐƚŽĞŶƵŶƐĞŵĞƐƚƌĞĐŽŵƉůĞƚŽ͘ƐůĂƐƵŵĂ Ž ĚĞƐĞŵƉĞŹŽ ĞƐƉĞĐŝĮĐĂĚŽƐ ĞŶ ĞƐƚĄŶĚĂƌĞƐ ŵşŶŝŵŽƐ
ƚĞſƌŝĐĂ LJ ƉƌĄĐƟĐĂ ĚĞ ƚƵƐ ĐŽŶŽĐŝŵŝĞŶƚŽƐ LJ ĞƐ ƷƟů ƉĂƌĂ LJ ŵĄdžŝŵŽƐ ĚĞ ůĂ ĐĂůŝĚĂĚ ƋƵĞ ĚĞďĞŶ ƚĞŶĞƌ ůŽƐ ĚŝǀĞƌƐŽƐ
fortalecer tu aprendizaje. ĞůĞŵĞŶƚŽƐ ƋƵĞ ĐŽŵƉŽŶĞŶ ƵŶ ƚƌĂďĂũŽ͘ ^ŝƌǀĞ ĐŽŵŽ ŐƵşĂ
ƉĂƌĂƐĂďĞƌƋƵĠĚĞďĞĐŽŶƚĞŶĞƌƵŶƚƌĂďĂũŽLJĐſŵŽĚĞďĞ
/ŶĚŝǀŝĚƵĂů ser realizado.
ACTIVIDAD 1 ƋƵŝƉŽ 'ƌƵƉĂů
SD1-B1

ŽŶĞƐƚĞŐƌĄĮĐŽŝĚĞŶƟĮĐĂƌĄƐůĂĐƟǀŝĚĂĚĚĞŶƚƌŽĚĞůƚĞdžƚŽ͕ PORTAFOLIO DE EVIDENCIAS


ŝŶĐůƵLJĞŶĚŽůĂŝŶĚŝĐĂĐŝſŶLJĞƐƉĞĐŝĮĐĂŶĚŽƐŝĚĞďĞƌĞĂůŝnjĂƌƐĞ
ĚĞŵĂŶĞƌĂŝŶĚŝǀŝĚƵĂů͕ĞŶĞƋƵŝƉŽŽŐƌƵƉĂů͘ ƵƌĂŶƚĞ Ğů ƐĞŵĞƐƚƌĞ͕ ƚƵ ƉƌŽĨĞƐŽƌ ƚĞ ŝƌĄ ŝŶĚŝĐĂŶĚŽ ƋƵĠ
evidencias (trabajos y ejercicios) debes ir resguardando
ƉĂƌĂ ŝŶƚĞŐƌĂƌůŽƐ ĞŶ ƵŶ ƉŽƌƚĂĨŽůŝŽ͕ ŵŝƐŵŽƐ ƋƵĞ ůĞ
EVALUACIÓN DE ACTIVIDADES ĞŶƚƌĞŐĂƌĄƐ ĐƵĂŶĚŽ ƚĞ ůŽ ŝŶĚŝƋƵĞ͕ Ă ƚƌĂǀĠƐ ĚĞů ĐƵĂů ƚĞ
evaluará.
Ŷ ĞƐƚĞ ĂƉĂƌƚĂĚŽ ĞŶĐŽŶƚƌĂƌĄƐ Ğů ĞƐƉĂĐŝŽ ƉĂƌĂ ĐĂůŝĮĐĂƌ
ƚƵ ĚĞƐĞŵƉĞŹŽ͕ ƋƵĞ ƐĞƌĄ ƉŽƌ ƉĂƌƚĞ ĚĞ ƚƵ ƉƌŽĨĞƐŽƌ͕ ƚƵƐ
ĐŽŵƉĂŹĞƌŽƐ;ĐŽĞǀĂůƵĂĐŝſŶͿŽƚƷŵŝƐŵŽ;ĂƵƚŽĞǀĂůƵĂĐŝſŶͿ͘
REFERENCIAS
AUTOEVALUACIÓN ƐĞůůŝƐƚĂĚŽĚĞƌĞĨĞƌĞŶĐŝĂƐƋƵĞƵƟůŝnjĂƌŽŶůŽƐƉƌŽĨĞƐŽƌĞƐ
ƋƵĞ ĞůĂďŽƌĂƌŽŶ Ğů ŵſĚƵůŽ ĚĞ ĂƉƌĞŶĚŝnjĂũĞ͕ ĐŽŶƟĞŶĞ ůĂ
ďŝďůŝŽŐƌĂİĂ͕ůĂƐƉĄŐŝŶĂƐĚĞŝŶƚĞƌŶĞƚĚĞůĂƐĐƵĂůĞƐƐĞƚŽŵſ
En este espacio realizarás una evaluación de tu propio ŝŶĨŽƌŵĂĐŝſŶ͕ůŽƐǀşĚĞŽƐLJŽƚƌĂƐĨƵĞŶƚĞƐƋƵĞŶƵƚƌŝĞƌŽŶůŽƐ
ƚƌĂďĂũŽ͕ŵŝƐŵĂƋƵĞĚĞďĞƌĄƐĞƌŚŽŶĞƐƚĂƉĂƌĂƋƵĞƉƵĞĚĂƐ ĐŽŶƚĞŶŝĚŽƐ͘ dĞ ƉĞƌŵŝƚĞ ƚĂŵďŝĠŶ ĂŵƉůŝĂƌ ůĂ ŝŶĨŽƌŵĂĐŝſŶ
ŝĚĞŶƟĮĐĂƌ ůŽƐ ĐŽŶŽĐŝŵŝĞŶƚŽƐ ƋƵĞ ŚĂƐ ĂĚƋƵŝƌŝĚŽ LJ ůĂƐ ƋƵĞƚĞƉƌŽƉŽƌĐŝŽŶĞƚƵƉƌŽĨĞƐŽƌŽůĂĚĞůŵſĚƵůŽŵŝƐŵŽ͘
ŚĂďŝůŝĚĂĚĞƐƋƵĞŚĂƐĚĞƐĂƌƌŽůůĂĚŽ͕ĂƐşĐŽŵŽůĂƐĄƌĞĂƐƋƵĞ
necesitas reforzar.

GLOSARIO
REACTIVOS DE CIERRE
Es la relación de palabras nuevas o de las cuales pudieras
^ŽŶ ƌĞĂĐƟǀŽƐ ƋƵĞ ĂƉĂƌĞĐĞŶ Ăů ĮŶĂů ĚĞ ƵŶ ďůŽƋƵĞ͕ Ăů ĚĞƐĐŽŶŽĐĞƌ ƐƵ ƐŝŐŶŝĮĐĂĚŽ͘ Ɛ ƷƟů ƉĂƌĂ ĐŽŶŽĐĞƌ ŶƵĞǀŽƐ
ƌĞĂůŝnjĂƌůŽƐ ƌĞĨŽƌnjĂƌĄƐ ůŽƐ ĐŽŶŽĐŝŵŝĞŶƚŽƐ ĂĚƋƵŝƌŝĚŽƐ ĐŽŶĐĞƉƚŽƐ͕ ĂŵƉůŝĂƌ ƚƵ ǀŽĐĂďƵůĂƌŝŽ LJ ĐŽŵƉƌĞŶĚĞƌ ŵĞũŽƌ
ĚƵƌĂŶƚĞĞůďůŽƋƵĞLJĚĞƐĂƌƌŽůůĂƌĄƐƚƵƐŚĂďŝůŝĚĂĚĞƐ͘ las lecturas.

6 PRELIMINARES
Presentación del libro .......................................................................................................................................................5
Glosario icónico ............................................................................................................................................................... 6
Competencias genéricas ............................................................................................................................................... 8
Competencias disciplinarias básicas ........................................................................................................................... 9
Mapa de contenido ......................................................................................................................................................... 10

“MAKING THE RIGHT DECISIONS” ..................................................................... 11


BLOCK 1

ŝĚĂĐƟĐƐĞƋƵĞŶĐĞϭ͘͞tŚĞŶLJŽƵŵŝdžǁĂƚĞƌĂŶĚŽŝů͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͟ϭϮ
ŝĚĂĐƟĐƐĞƋƵĞŶĐĞϮ͘͞/ĨŝƚƌĂŝŶƐƚŽĚĂLJ͕/͙͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͟Ϯϭ
ŝĚĂĐƟĐƐĞƋƵĞŶĐĞϯ͘͞/ŵŝŐŚƚǁŝŶ͕ŝĨ͙͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͟Ϯϵ
BLOCK 2

“MEMORABLE DAYS” ...................................................................................... 55


ŝĚĂĐƟĐ ƐĞƋƵĞŶĐĞ ϭ͘ ͞dŚŽƐĞ ŐŽŽĚ ŽůĚ ĚĂLJƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͟ϱϵ
ŝĚĂĐƟĐ ƐĞƋƵĞŶĐĞ Ϯ͘ ͞/ ƵƐĞĚ ƚŽ ƉůĂLJ ŬŝĐŬďĂůů͟ ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϲ

͞/t^>/^dE/E'dKDh^/͙͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͟ϵϳ
BLOCK 3

ŝĚĂĐƟĐƐĞƋƵĞŶĐĞϭ͘͞tŚĂƚĚŝĚLJŽƵĚŽLJĞƐƚĞƌĚĂLJ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͟ϭϬϬ
ŝĚĂĐƟĐƐĞƋƵĞŶĐĞϮ͘͞tŚĂƚǁĞƌĞƚŚĞLJĚŽŝŶŐ͍͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͟ϭϭϮ
ŝĚĂĐƟĐƐĞƋƵĞŶĐĞϯ͘͞/ǁĂƐǁĂƚĐŚŝŶŐĂŵŽǀŝĞǁŚĞŶ͙͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͟ϭϭϲ
BLOCK 4

͞/t^>/^dE/E'dKDh^/͙͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͟ϭϰϮ
ŝĚĂĐƟĐƐĞƋƵĞŶĐĞϭ͘͞dƵƌŶŝƚŽī͊͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͟ϭϰϲ
ŝĚĂĐƟĐƐĞƋƵĞŶĐĞϮ͘͞ŽƵůĚLJŽƵƉůĞĂƐĞ͙͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͟ϭϱϭ

Lecciones Construye-T ................................................................................................................................ 185

PRELIMINARES 7
1 Knows and values oneself. Deals with problems and challenges taking into
account the goals to be achieved.

2 Sensitive to the arts. Participates in the appreciation and interpretation of its


expressions in different genres.

3 Chooses and practices a healthy lifestyle.

4 Listens, interprets and communicates appropriate messages in different contexts


through the use of precise resources, codes and tools.

5 Develops innovations and suggests problem-solving solutions taking into


consideration the acknowledged system.

6 Supports a personal point of view on general and relevant issues.

7 Learns through one´s interest and initiative throughout one´s life.

8 Participates and collaborates effectively with diverse teams.

9 Participates through civic and ethical awareness in the life of the community,
region, country (Mexico) and the world.

10 Maintains a courteous attitude towards different cultures and the diversity of


beliefs, values, ideas and social behavior.

11 Contributes to a sustainable development in a decisive manner and with


accountable actions.

8 PRELIMINARES
COMPETENCIAS DISCIPLINARES BÁSICAS BLOQUES DE APRENDIZAJE
DEL CAMPO DE LA COMUNICACIÓN I II III IV

1 Identifica, ordena e interpret las ideas, datos y conceptos explícitos e implícitos


en un texto, considerando el contexto en el que se generó y en el que se recibe.

2 Evalúa un texto mediante la comparación de un contenido con el de otros, en


función de sus conocimientos previos y nuevos.

3 Plantea supuestos sobre los fenómenos naturales y culturales de su entorno con


base en la consulta de diversas fuentes.

4 Produce textos con base en el uso normativo de la lengua, considerando la


intención y situación comunicativa.

5 Expresa ideas y concepts en composiciones coherentes y creativas, con


introducciones, desarrollo y conclusiones claras.

6 Argumenta un punto de vista en público de manera precisa, coherente y


creativa.

7
Valora y describe el papel del arte, la literatura y los medios de comunicación
en la recreación o la transformación de una cultura, teniendo en cuenta los
propósitos comunicativos de distintos géneros.

8 Valora el pensamiento lógico en el proceso comunicativo en su vida cotidiana


y académica.

9 Analiza y compara el origen, desarrollo y diversidad de los sistemas y medios


de comunicación.

10
7
Identificar e interpretar la idea general y posible desarrollo de un mensaje oral o
escrito en una segunda lengua, recurriendo a conocimientos previos, elementos
no verbales y contexto.

11 Se comunica en una lengua extranjera mediante un discurso lógico, oral o


escrito, congruente con la situación comunicativa.

12 Utiliza las tecnologías de la información y comunicación para investigar,


resolver problemas, producir materiales y transmitir información.

PRELIMINARES 9
English 3
1
“Making ͞tŚĞŶLJŽƵ
͞/ĨŝƚƌĂŝŶƐ ͞/ŵŝŐŚƚ
ŵŝdžǁĂƚĞƌ
the right and oil”
ƚŽĚĂLJ͕/͙͟ ǁŝŶ͕ŝĨ͙͟

decisions”

2 ͞dŚŽƐĞ “I used
“Memorable good old to play
days” ŬŝĐŬďĂůů͟
days”

3
“I was ͞tŚĂƚĚŝĚ ͞tŚĂƚ
͞/ǁĂƐ
ǁĂƚĐŚŝŶŐ
you do ǁĞƌĞƚŚĞLJ
listening to yesterday” ĚŽŝŶŐ͍͟
a movie
ǁŚĞŶ͙͟
music…”

4
“Turn it “Could you
“Could I Žī͊͟ ƉůĞĂƐĞ͙͟
borrow…”

10 10
10
PRELIMINARES
BLOCK 1
Making the right decisions

^ƚƵĚĞŶƚƐ͛ƉĞƌĨŽƌŵĂŶĐĞĂƚƚŚĞ
ĞŶĚŽĨďůŽĐŬ Learning objects
/ĚĞŶƟĮĞƐƚŚĞŵĂŝŶŝĚĞĂƐŽĨĂǁƌŝƩĞŶŽƌ ĞƌŽĐŽŶĚŝƟŽŶĂůŝĨнƐŝŵƉůĞƉƌĞƐĞŶƚ ƚŚƌŽƵŐŚ ŝŶĨŽƌŵĂƟŽŶ ƚĞĐŚŶŽůŽŐLJ ĂŶĚ
verbal text. &ŝƌƐƚĐŽŶĚŝƟŽŶĂůŝĨнǁŝůů ĐŽŵŵƵŶŝĐĂƟŽŶ ŝŶ ŽƌĚĞƌ ƚŽ ŽďƚĂŝŶ
ĞƐĐƌŝďĞƐ ĐĂƵƐĞͲĞīĞĐƚ ƚƌƵƚŚƐ ͬ ĨĂĐƚƐ &ŝƌƐƚĐŽŶĚŝƟŽŶĂůŝĨнŵŽĚĂůƐŽĨƉŽƐƐŝďŝůŝƚLJ ŝŶĨŽƌŵĂƟŽŶ ŽŶ ďŽƚŚ ƚŚĞ ŐƌĂŵŵĂƟĐĂů
ĐŝƌĐƵŵƐƚĂŶĐĞƐŽƌĂůůLJŽƌŝŶǁƌŝƩĞŶĨŽƌŵ͘ DŽĚĂůƐ͗ƉŽƐƐŝďŝůŝƚLJ;ŵĂLJͬŵŝŐŚƚͿ ĨŽƌŵƐ ĂŶĚ ƵƐĞƐ ŽĨ njĞƌŽ ĂŶĚ ĮƌƐƚ ƚLJƉĞ
hƐĞƐ ƚŚĞ njĞƌŽ ĐŽŶĚŝƟŽŶĂů ĂŶĚ ĮƌƐƚ DŽĚĂů͗ĂĚǀŝĐĞ;ƐŚŽƵůĚͿ ĐŽŶĚŝƟŽŶĂůƐ͘
ĐŽŶĚŝƟŽŶĂů ƐƚƌƵĐƚƵƌĞƐ ƚŽ ĞdžĐŚĂŶŐĞ /ĚĞŶƟĮĞƐ ĂŶĚ ŝŶƚĞƌƉƌĞƚƐ ŝŶ Ă ĨŽƌĞŝŐŶ
ŝŶĨŽƌŵĂƟŽŶƌĞŐĂƌĚŝŶŐĐĂƵƐĞͲĞīĞĐƚ͘ language, the main idea and possible
Competences to be developed ŽƵƚĐŽŵĞƐŽĨĂŶŽƌĂůŽƌǁƌŝƩĞŶŵĞƐƐĂŐĞ͕
ďLJ ŵĞĂŶƐ ŽĨ ƉƌŝŽƌ ŬŶŽǁůĞĚŐĞ ĂŶĚ ŶŽŶͲ
/ĚĞŶƟĮĞƐ ĂŶĚ ŝŶƚĞƌƉƌĞƚƐ ŝŶ Ă ĨŽƌĞŝŐŶ verbal elements in context.
language, the general idea and possible /Ɛ ƐĞŶƐŝƟǀĞ ĂŶĚ ĐŽŶƐĐŝŽƵƐ ĂďŽƵƚ ƚŚĞ
happenings regarding diverse cause- ĐŽŶƐĞƋƵĞŶĐĞƐ ŽĨ ĞŶǀŝƌŽŶŵĞŶƚĂů ŚĂƌŵ
ĞīĞĐƚ ĐŽŶƚĞdžƚƐ ŝŶ ŽƌĂů ĂŶĚ ǁƌŝƩĞŶ ŝŶ ǁŽƌůĚͲǁŝĚĞ ĂŶĚ ŵƵƚƵĂůůLJ ĚĞƉĞŶĚĞŶƚ
messages. circumstances.
ŽŵŵƵŶŝĐĂƚĞƐ ŝŶ Ă ĨŽƌĞŝŐŶ ůĂŶŐƵĂŐĞ hƐĞƐ ƚŚĞ ŝŶĨŽƌŵĂƟŽŶ ĂŶĚ
ďLJ ŵĞĂŶƐ ŽĨ ůŽŐŝĐĂů͕ ŽƌĂů Žƌ ǁƌŝƩĞŶ ĐŽŵŵƵŶŝĐĂƟŽŶ ƚĞĐŚŶŽůŽŐLJ ƚŽ ƐĞĂƌĐŚ͕
ĚŝƐĐŽƵƌƐĞ͕ƚŽĐŽŵƉĂƌĞĐĂƵƐĞƐĂŶĚĞīĞĐƚƐ solve problems, create materials and to
ŽĨ ĞŶǀŝƌŽŶŵĞŶƚĂů ĐŽŶƚĞdžƚƐ ŝŶ ůŽĐĂů͕ ĐŽŶǀĞLJŝŶĨŽƌŵĂƟŽŶ͘
ŶĂƟŽŶĂů ĂŶĚ ŝŶƚĞƌŶĂƟŽŶĂů ƐŝƚƵĂƟŽŶƐ ĂƐ Produces texts based on the standard
ǁĞůůĂƐĚĂŝůLJĞǀĞŶƚƐ͘ ƵƐĞŽĨƚŚĞůĂŶŐƵĂŐĞ͕ƚĂŬŝŶŐŝŶƚŽĂĐĐŽƵŶƚ
Evaluates a passage by comparing its ŵĞĂŶŝŶŐ͕ ŝŶƚĞŶƟŽŶ͕ ĐŽŵŵƵŶŝĐĂƟǀĞ
ĐŽŶƚĞŶƚ ǁŝƚŚ ŽƚŚĞƌƐ͕ ŵĂŬŝŶŐ ƵƐĞ ŽĨ ĐŝƌĐƵŵƐƚĂŶĐĞƐ͕ĂŶĚĨŽƌŵĂůďĂƐŝĐƐŽĨƚŚĞ
ůůŽƩĞĚƟŵĞ͗ 12 hours. ƐƚƵĚĞŶƚƐ͛ƉƌŝŽƌĂŶĚŶĞǁŬŶŽǁůĞĚŐĞ͘ ůĂŶŐƵĂŐĞ ƐƵĐŚ ĂƐ ƉƵŶĐƚƵĂƟŽŶ͕ ƐƉĞůůŝŶŐ͕
hƐĞƐ ƐĞůĨͲ ůĞĂƌŶŝŶŐ ƐƚƌĂƚĞŐŝĞƐ͕ coherence and cohesion.
Classroom language.

Read Write Listen Dialogue WƌŽŶƵŶĐŝĂƟŽŶ

Track #20

Homework 1
Open your Close the Grammar Vocabulary
books books

Raise your Stand up ^ŝƚĚŽǁŶ Be quiet I don’t May I go to May I come I have a
hand please understand the restroom? in, please? ƋƵĞƐƟŽŶ

Start Up Activities Didactic Sequence 1


͞t,EzKhD/ytdZEK/>͙͟

DIAGNOSTIC EVALUATION

You are a political prisoner who has been sentenced to spend the remainder of
\RXUOLIHRQDQXQLQKDELWHGLVODQGLQWKH3DFL¿F2FHDQ \RXDUH\HDUVROG 
The island is 4000 miles from any land, and the chances of escaping are
H[WUHPHO\VPDOOEHFDXVHRIVWURQJRFHDQFXUUHQWV)RUWXQDWHO\WKHLVODQG
VTPL KDVYHU\PRGHUDWHFOLPDWHWHPSHUDWXUHVQHYHUJREHORZ
GHJUHHV)DKUHQKHLWLQWKHZLQWHURUDERYHGHJUHHV)LQWKHVXPPHU
7KHUDLQIDOORQWKHLVODQGLVPRGHUDWHDOVRDERXWLQFKHVVSUHDGHYHQO\
WKURXJKRXWWKH\HDU$VDUHVXOWWKHUHLVOXVKYHJHWDWLRQDQGGLYHUVHDQLPDO
OLIHWKHUHIRUHIRRGLVQRSUREOHP
$VLGH IURP WKLV \RXU JRYHUQPHQW KDV DOORZHG \RX WR WDNH  LWHPV WR WKH
LVODQGDQGKDVVDLGWKDWLWZLOOSURYLGH\RXZLWKDSRUWDEOHVRODUJHQHUDWRULI\RX
ZDQWWRWDNHHOHFWULFDOGHYLFHV7KHRQO\UHVWULFWLRQVDUHWKDW\RXPD\QRWVHOHFWDSHUVRQ
WRDFFRPSDQ\\RXDQG\RXPD\QRWWDNHDPHDQVRIWUDQVSRUWDWLRQWRWKHLVODQG ERDWDLUSODQHHWF 

12 12
12
Colegio de Bachilleres del Estado de Sonora
Inglés 3

What Articles Should I Take?

+HUHDUHVRPHSRVVLEOHDUWLFOHVWRWDNHZLWK\RX

a compass scissors a radio a music player*


DQDUP\NQLIH toothbrush /toothpaste*
an article a TV a horse
a refrigerator non-alcoholic
a telescope a mirror a rope
sunglasses EHYHUDJHV
a comb / brush DGHFNRIFDUGV an axe
a thermometer soap*
a frying pan hammer / nails DERRN
a barometer pencils*
VXQEORFN a microscope a net
an old type-writer paper*
DVWRYH D¿VKLQJSROH matches
DODUJHFRRNLQJSRW candles*
DODPS RURWKHU a gun / ammunition a ball
VRXUFHVRIOLJKW antiseptic*
* Lifetime supply

5HPHPEHUWKDW\RXPLJKWEHDEOHWRPDNHPDQ\LWHPV 5HPHPEHUWKDW\RXDUHQRWOLPLWHGWRWKHOLVW
IURPWKHQDWXUDOUHVRXUFHVRQWKHLVODQG)RUH[DPSOH
\RXPLJKWEHDEOHWRPDNHDQD[HIURPDVKDUSURFN At least one article you choose must not be on the list!
DQGDVWLFN+RZHYHUDVWHHOD[HPLJKWEHPRUHUHOLDEOH
DQGXVHIXO

Article Reason chosen Article Reason chosen

; ;

; ;

; ;

; ;

; ;

133 13
BLOCK 1 Making the right decisions
Development Activities

ACTIVITY 1
SD1-B1

'HFLGHDQGZULWHVHQWHQFHVOLNHWKHRQHLQWKHH[DPSOH

,I,WDNHDPXVLFSOD\HU,FDQOLVWHQWRP\ ________________________________
IDYRULWHPXVLF __________________________________
__________________________________
________________________________ ________________________________
__________________________________ __________________________________
__________________________________ __________________________________
________________________________ ________________________________
__________________________________ __________________________________
__________________________________ __________________________________
________________________________ ________________________________
__________________________________ __________________________________
__________________________________ __________________________________
________________________________ _______________________________
__________________________________ __________________________________
__________________________________ __________________________________
________________________________
__________________________________
__________________________________

$&7,9,7<
SD1-B1

3DLUZRUN1RZFRPSDUH\RXUDQVZHUVZLWK\RXUFODVVPDWHV'R\RXDJUHHZLWKWKHDUWLFOHVWKH\FKRVH":K\RU
ZK\QRW"Ask and answer$VNWKUHHRI\RXUFODVVPDWHVZK\WKH\FKRVHWKHLUDUWLFOHV([DPSOH

:K\GLG\RX
FKRRVHWRWDNHD I chose the telescope
“telescope” to the because I will feel less
LVODQG" lonely when I gaze at the
VWDUVDQGSODQHWVDWQLJKW

14 14 Colegio de Bachilleres del Estado de Sonora


Inglés 3

ACTIVITY 3
SD1-B1

1. Cause
and effec
t
D 3DLUZ
RUN7DlN
WR\RXUS
DUWQHUDE
RXWWKHIR
OORZLQJV
LWXDWLRQV

+RZP
XF
GR\RXG KZDWHU
ULQNLQD
GD\":K
DW
WKLQNKDS GR\RX
S
\RXGRQ¶W HQVLI 'R\RX
H
G
HQRXJKZ ULQN IRRG":K DWMXQN
DWHU" D
WKLQNKDS WGR\RX
SH
HDWWRRP QVLI\RX
XFKMXQN
IRRG"

'R\RX
H
GR\RXWK [HUFLVH":KDW
LQN
\RXGRQ¶W KDSSHQVLI
H[HUFLVH
"

155 15
BLOCK 1 Making the right decisions
E /RRNDWWKHIROORZLQJVHQWHQFHWKDWVKRZVWKHcause
/ condition and effect / result

Cause / condition: Effect / result:

When you mix water and oil, They separate

F 1RZDQVZHUWKHIROORZLQJTXHVWLRQV H /RRNDWWKHIROORZLQJVHQWHQFH
Circle the cause / condition and underline
:KDWLVDFDXVHFRQGLWLRQ" WKHUHVXOW

([DPSOH

:KHQ\RXPL[WKH
blue and yellow,
:KDWLVDQHIIHFWUHVXOW"
DJUHHQFRORUDSSHDUV

G &KHFN\RXUDQVZHUVZLWK\RXUSDUWQHU

:DWHUERLOVLI\RXKHDWLW ,I\RXVWXG\\RXJHW ,FHPHOWVLI\RXOHDYHLW


JRRGJUDGHV RXWVLGHWKHIUHH]HU

16 16
16
Colegio de Bachilleres del Estado de Sonora
Inglés 3

I *URXSWHDP,QWHDPVRIIRXU¿JXUHLWRXW

Can we use “cause” and “effect” clauses at the


beginning of the sentence?

Does it have the same meaning?

1RZUHDGGLVFRYHUDQGFKHFN\RXU¿QGLQJVWRWKHTXHVWLRQDERYH

2. – Conditional type Zero “0”

Grammar reference
&RQGLWLRQDO7\SH=HUR³´

:HXVHWKHFRQGLWLRQDOW\SH=HUR³0” to express general truths or facts, when the result of the condition
is always trueOLNHDVFLHQWL¿FIDFW

([DPSOH
Water and oil separate if/when you mix them together.

1RWHZHFDQXVHwhen instead of if.

:KHQWKHVHQWHQFHVWDUWVZLWKWKH³if/when” clause, we use a comma ( , ) to separate the two clauses


RUSDUWV
If/when – clause (condition) (result / effect) clause

If/when you mix water and oil, they separate.

177 17
BLOCK 1 Making the right decisions
ACTIVITY 4
SD1-B1

D $QVZHUWKHIROORZLQJTXHVWLRQ

:KDWWHQVHGRZHXVHIRUWKH³if /when – clause” and what tense can we use


for the “resultFODXVH´"

_______________________________________________________________
_______________________________________________________________
___________________________________________________

E &RPSOHWHWKHVHQWHQFHV:ULWHWKHYHUEVLQSDUHQWKHVLVLQWKHFRUUHFWWHQVH&KHFNJUDPPDUUHIHUHQFHIRU
UHYLHZRQVLPSOHSUHVHQWWHQVH

,I'LDQDBBBBBBBBBBBBODWHIRUVFKRRO,DPXVXDOO\ODWH EH

 ,I 'DOLD BBBBBBBBBBBBB KDUG IRU WKH H[DPV VKH DOZD\V BBBBBBBBBBBBB JRRG JUDGHV DW WKH HQG RI WKH
VHPHVWHU VWXG\JHW

,I,BBBBBBBBBKRPH,PXVWORRNDIWHUP\GRJDOOGD\ VWD\  ORRNDIWHU WDNHFDUHRI

,I9LDQQH\BBBBBBBBBBBBWRWKHPDOOVKHBBBBBBBBBBBBBWRWDNHPRQH\ JRQHHG

18 18
18
Colegio de Bachilleres del Estado de Sonora
Inglés 3

ACTIVITY 5
SD1-B1

&KDQJHWKHRUGHURIWKHVHQWHQFHVLQH[HUFLVHE 6XEVWLWXWHWKH³if “ / condition clause” for “when”

([If Diana is late for school, I amXVXDOO\ODWHWRR

When Diana is late for school, I amXVXDOO\ODWHWRR

Homework 1: Go to page 39

Grammar reference
Simple present form

:HXVHWKHsimple present formWRWDONDERXWWKHcondition and we also use the simple present form to
WDONDERXWWKHresult or effect of that condition+RZHYHUZHFDQDOVRXVHWKHQHJDWLYHIRUPWRH[SUHVV
JHQHUDOWUXWKVRUIDFWV certainty 7KHPDLQLGHDDERXWWKHzero conditional is that the condition always
has the same result.

Example
Simple Present Simple Present

If / when you heat water, it boils(+)


:DWHUdoesn’t boil if / when you don’t heat it. (-)

199 19
BLOCK 1 Making the right decisions
ACTIVITY 6
SD1-B1

D 0DWFKWKHSLFWXUHZLWKWKHQDPHRIWKHODEPDWHULDO

3ODVWLFFXSV 

9LWDPLQ&WDEOHW 

7LQFWXUHRILRGLQH 

+\GURJHQSHUR[LGH 

/LTXLGODXQGU\VWDUFK 

Safety goggles 

0HDVXULQJVSRRQV 

0HDVXULQJFXS 

20 20
20
Colegio de Bachilleres del Estado de Sonora
Inglés 3

E 3DLUZRUN7U\WR¿QGRXWZKDWWKHODELWHPVLQH[HUFLVH“c”DUHXVHGIRUDQGDVNDQGDQVZHUZLWK\RXUFODVVPDWH

You can use it to


:KDWLVDPHDVXULQJFXS
PHDVXUHOLTXLGVRU
XVHGIRU"
VROLGV

F 3DLUZRUN7DNHDORRNDW+RPHZRUN&KDQJH\RXUVWDWHPHQWVRIJHQHUDOWUXWKVIDFWVLQWRWKHQHJDWLYH
IRUP:ULWHWKHPGRZQLQ\RXUQRWHERRN6KDUHDQGH[FKDQJH\RXUVWDWHPHQWVZLWKDFODVVPDWH

G 3DLUZRUN/LVWHQDQGUHDGWKHIROORZLQJLQIRUPDWLRQ QH[WSDJH 'RWKLVH[SHULPHQWLQ\RXUVFKRROZLWKWKH


KHOSRI\RXUWHDFKHURULQ\RXUKRXVHZLWKWKHKHOSRIDQDGXOW7DNHSLFWXUHVRI\RXUH[SHULPHQWDQGZULWHDERXW
WKHUHVXOW

H )LJXUHRXWWKHDQVZHUVWRWKHIROORZLQJTXHVWLRQV

1. What happens if you change the temperature of the water? Does the temperature affect how quickly
the liquids turn blue?

___________________________________________________________________________________
___________________________________________________________________________________

2. What happens if you add less vitamin c, does it affect how fast the liquid turns blue?

___________________________________________________________________________________
___________________________________________________________________________________

21 21
21
BLOCK 1 Making the right decisions
Track #1

Rapid Color Changing Chemistry!


Sometimes it’s hard to tell SCIENCE from MAGICDQGWKLVOLWWOHGHPRQVWUDWLRQLVDJUHDWH[DPSOHRIWKDW
,QWKLVH[SHULPHQW\RXZLOOZDWFKDQDOPRVWFOHDUOLTXLGVXGGHQO\WXUQGDUNEOXHLQDÀDVK,WWDNHVDELWRI
SUHSDUDWLRQDQGSUREDEO\DWULSWRWKHSKDUPDF\IRUPDWHULDOVEXWZHWKLQNLW¶VZRUWKLW

 Important Safety Information:


7KLVH[SHULPHQWVKRXOGRQO\EHGRQHZLWKWKHKHOSRIDQDGXOW,RGLQH
ZLOO VWDLQ MXVW DERXW DQ\WKLQJ LW WRXFKHV DQG LW FDQ EH KD]DUGRXV
+\GURJHQSHUR[LGHFDQFDXVHH\HDQGVNLQLUULWDWLRQVDIHW\JRJJOHV
DUHQHHGHGWKURXJKRXWWKHH[SHULPHQW%HVXUH\RXUKHOSIXODGXOWUHDGV
WKHFDXWLRQODEHOVRQHDFKFRQWDLQHU
 You will need:  What to do:
· 3 clear plastic cups 4 ounces or  Put on those safety goggles and mash the 1000 mg Vitamin
larger C tablet by placing it into a plastic bag and crushing it with
· A 1000 mg Vitamin C tablet DUROOLQJSLQRUWKHEDFNRIDODUJHVSRRQ*HWLWLQWRDVPXFK
IURPWKHSKDUPDF\ \RXFDQ RID¿QHSRZGHUDVSRVVLEOH7KHQSXWDOOWKHSRZGHULQWKH
DOVRXVHWZRPJ ¿UVWFXSDQGDGGRXQFHV PO RIZDUPZDWHU6WLUIRU
· 7LQFWXUHRILRGLQH  DOVR DWOHDVWVHFRQGV 7KHZDWHUPD\EHDOLWWOHFORXG\ /HW¶V
from the pharmacy call this “LIQUID A”
· +\GURJHQSHUR[LGH  \HS  1RZSXWWHDVSRRQ PO RI\RXU/,48,'$LQWRDQHZ
also from the pharmacy FXSDQGDGGWRLWR] PO RIZDUPZDWHUDQGWHDVSRRQ
· /LTXLGODXQGU\VWDUFK VHH PO RIWKHLRGLQH1RWLFHWKHEURZQLRGLQHWXUQHGFOHDU
EHORZIRUDOWHUQDWLYHV /HW¶VFDOOWKLV³/,48,'%´%\WKHZD\\RX¶UHGRQHZLWK
· Safety goggles /,48,'$\RXFDQSXWLWDVLGH
· 0HDVXULQJVSRRQV  ,QWKHODVWFXSPL[R]RIZDUPZDWHU7DEOHVSRRQ 
· 0HDVXULQJFXS PO RIWKHK\GURJHQSHUR[LGHDQGWHDVSRRQ PO RI
· An adult helper WKHOLTXLGVWDUFK7KLVLV\RXJXHVVHGLW³/,48,'&´
Note,I\RXGRQRWKDYHOLTXLGVWDUFK\RX  2ND\ WKDW ZDV D ORW RI SUHSDUDWLRQ RQ WR WKH IXQ SDUW
FDQ DOVR XVH  WHDVSRRQ RI FRUQ VWDUFK Gather the friends and family and pour all of LIQUID B
RUSRWDWRVWDUFK7KHOLTXLGVZLOOEHPRUH LQWR/,48,'&7KHQSRXUWKHPEDFNDQGIRXUWKEHWZHHQ
cloudy and the reaction will happen a bit WKHFXSVDIHZWLPHV3ODFHWKHFXSGRZQDQGREVHUYH«
PRUHVORZO\EXWLW¶VVWLOOLPSUHVVLYH
EHSDWLHQWVRPHZKHUHEHWZHHQDIHZVHFRQGVDQGDIHZ
PLQXWHVWKHOLTXLGZLOOVXGGHQO\WXUQGDUNEOXH
 How does it work?
7KLVLVDQH[DPSOHRIWKHFKHPLFDOUHDFWLRQNQRZDVWKH,2',1(&/2&.5($&7,21,WLVFDOOHGDFORFN
UHDFWLRQEHFDXVH\RXFDQFKDQJHWKHDPRXQWLIWLPHLWWDNHVIRUWKHOLTXLGVWRWXUQEOXH7KHFKHPLVWU\RI
the demonstration gets a bit complicated, but basically it is a battle of chemistry between the starch which
LVWU\LQJWRWXUQWKHLRGLQHEOXHDQGWKH9LWDPLQ&ZKLFKLVNHHSLQJLWIURPWXUQLQJEOXH(YHQWXDOO\WKH
9LWDPLQ&ORVHVDQGEDP\RXJHWLQVWDQWEOXHQHVV
 Clean up&DUHIXOO\SRXUDOOOLTXLGVGRZQWKHGUDLQZLWKSOHQW\RIZDWHUDQGZDVK\RXUKDQGV
5HF\FOHWKHFXSVRUGLVSRVHRIWKHPLQWKHWUDVK

7DNHQDQGDGDSWHGIURPKWWSZZZVFLHQFHEREFRPH[SHULPHQWVLRGLQHBFORFNBUHDFWLRQSKS

22 22
22
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Start Up Activities Didactic Sequence 2


͞/&/dZ/E^dKz͕/͙͟

ACTIVITY 7 Track #2
6'%

1. Nature (will).

D /LVWHQDQGUHDGDERXWWKHHIIHFWVRIJOREDOZDUPLQJ7U\WRGLVFRYHUWKHPHDQLQJRIWKHZRUGVLQLWDOLFV:ULWH
DV\QRQ\PIRUHDFKZRUGLQH[HUFLVHD8VH\RXUGLFWLRQDU\

Effects of Global Warming: Signs Are Everywhere


Some impacts from increasing temperatures are
DOUHDG\KDSSHQLQJ

• Ice is melting worldwide, especially at the


(DUWK¶V SROHV 7KLV LQFOXGHV PRXQWDLQ JODFLHUV
ice sheets FRYHULQJ :HVW $QWDUFWLFD DQG
*UHHQODQGDQG$UFWLFVHDLFH

‡5HVHDUFKHU%LOO)UDVHUKDVWUDFNHGWKHdecline
of the Adélie penguins on Antarctica, where their
QXPEHUVKDYHIDOOHQIURPbreeding pairs
WRLQ\HDUV

‡ 6HD OHYHO ULVH EHFDPH faster RYHU WKH ODVW


FHQWXU\

The planet is warming, from North Pole to South


3ROH DQG HYHU\ZKHUH LQ EHWZHHQ *OREDOO\ WKH
mercury is already up more than 1 degree Fahrenheit
GHJUHH&HOVLXV DQGHYHQPRUHLQVHQVLWLYH3RODU
5HJLRQV$QGWKHeffects of rising temperatures aren’t
waiting for some IDUÀXQJIXWXUH7KH\¶UHKDSSHQLQJ
ULJKW QRZ 6LJQV DUH DSSHDULQJ all over, and some
RIWKHPDUHVXUSULVLQJ7KHKHDWLVQRWRQO\PHOWLQJ
JODFLHUV DQG VHD LFH LW¶V DOVR shifting precipitation
patterns and setting animals on the move

23 23
23
BLOCK 1 Making the right decisions
‡+XUULFDQHVDQGRWKHUVWRUPVDUHOLNHO\WREHFRPH
stronger

Species that depend on one another may become out


of sync )RU H[DPSOH SODQWV FRXOG EORRP earlier
WKDQWKHLUSROOLQDWLQJLQVHFWVEHFRPHDFWLYH

• Floods and droughts ZLOOEHFRPHPRUHFRPPRQ


Rainfall in Ethiopia, where droughts are already
FRPPRQFRXOGGHFOLQHE\SHUFHQWRYHUWKHQH[W
\HDUV

‡ 6RPH EXWWHUÀLHV IR[HV DQG DOSLQH SODQWV KDYH


PRYHGIDUWKHUQRUWKRUWRKLJKHU coolerDUHDV

• Precipitation UDLQ DQG VQRZIDOO  KDV LQFUHDVHG


DFURVVWKHJOREHRQDYHUDJH

‡ 6SUXFH EDUN EHHWOHV KDYH boomed LQ $ODVND • Less fresh water will be available,IWKH4XHOFFD\D
WKDQNVWR\HDUVRIZDUPVXPPHUV7KHLQVHFWV ice cap in Peru continues to melt at its current rate,
KDYHchewed upPLOOLRQDFUHVRIVSUXFHWUHHV LWZLOOEHJRQHE\OHDYLQJWKRXVDQGVRISHRSOH
ZKR UHO\ RQ LW IRU GULQNLQJ ZDWHU DQG HOHFWULFLW\
without a sourceRIHLWKHU

• Some diseases will spread such as malaria carried


E\PRVTXLWRHV

‡(FRV\VWHPVZLOOFKDQJH²VRPHVSHFLHVZLOOPRYH
farther 1RUWK RU EHFRPH PRUH VXFFHVVIXO RWKHUV
ZRQ¶W EH DEOH WR PRYH DQG FRXOG EHFRPH H[WLQFW
:LOGOLIHUHVHDUFKVFLHQWLVW0DUW\Q2EEDUGKDVIRXQG
WKDW VLQFH WKH PLGV ZLWK OHVV LFH RQ ZKLFK
WR OLYH DQG ¿VK IRU IRRG SRODU EHDUV KDYH JRWWHQ
FRQVLGHUDEO\ VNLQQLHU  3RODU EHDU ELRORJLVW ,DQ
6WLUOLQJKDVIRXQGDVLPLODUSDWWHUQLQ+XGVRQ%D\
He fears that if sea ice disappears, the polar bears
Other effects could happen later this century, if
will as well
ZDUPLQJFRQWLQXHV

‡6HDOHYHOVDUHH[SHFWHGWRULVHEHWZHHQDQG
LQFKHV DQGFHQWLPHWHUV E\WKHHQGRIWKH
century, and continued melting at the poles could
DGGEHWZHHQDQGLQFKHV WRFHQWLPHWHUV 
7DNHQIURPKWWSHQYLURQPHQWQDWLRQDOJHRJUDSKLF
FRPHQYLURQPHQWJOREDOZDUPLQJJZHIIHFWV

24 24
24
Colegio de Bachilleres del Estado de Sonora
Inglés 3

1a:ULWHDV\QRQ\PIRUHDFKZRUGIURPWKHWH[W
already up ____________________ earlier _____________________ effects _______________________
IDUÀXQJ_____________________ Rainfall ____________________ all over ______________________
shifting ______________________ source _____________________ on the move___________________
impacts______________________ farther _____________________ sheets _______________________
decline ______________________ as well _____________________ breeding _____________________
cooler _______________________ spread _____________________ precipitation __________________
boomed ______________________ available ___________________ chewed up ____________________
faster _______________________ droughts ___________________ other ________________________
stronger _____________________ out of sync __________________

1b.&RPSOHWHWKHFKDUWZLWKLQIRUPDWLRQIURPWKHUHDGLQJ(IIHFWVRI*OREDO:DUPLQJ
_________________ hurricanes and
VWRUPV
• ____________________ blooming of
SODQWVEHIRUHWKHLUDFWLYHSROOLQDWLRQ
•______________________________
New effects

ÀRRGVDQGBBBBBBBBBBBBBBBGURXJKWV
• The dispersion of
_____________________ transmitted
E\BBBBBBBBBBBBBBBBBBBB
• Quelccaya ice cap in Peru will
GLVDSSHDU E\  FDXVLQJ D ODFN
of___________________________
DQGBBBBBBBBBBBBBBBBBBBB
‡7UDQVIRUPDWLRQRIBBBBBBBBBBBBBBBB
Temperature_________________ D QXPEHU RI VSHFLHV ZLOO WUDYHO
farther___________________ - others
___________________ disappear and
BBBBBBBBBBBBBBBBBBZLOOWRR

• Glaciers and_______________________ ice are


BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

‡ 9DULDEOH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

‡ 5DSLG PRYHPHQW RIBBBBBBBBBBBBBBBBBBBBBB

25 25
25
BLOCK 1 Making the right decisions
E  /RRN EDFN DQG UHDG ³6RPH LPSDFWV IURP LQFUHDVLQJ WHPSHUDWXUH DUH DOUHDG\ KDSSHQLQJ´ DJDLQ DQG WU\ WR
FRPSOHWHWKHSDUDJUDSKZLWKZRUGVIURPWKHER[

'XHWRDUHDVGHFUHDVLQJWKLUW\PRUHUDSLGWUDYHOHGIUHVKHULQJHQHUDODVDUHVXOWRI

________________ current high temperatures around the globe, The mountain glaciers and the ice
BBBBBBBBBBBBBBBBWKDWFRYHUV:HVW$QWDUFWLFD*UHHQODQGDQG$UFWLFVHDLFHDUHPHOWLQJ

AdélieSHQJXLQVRQ$QWDUFWLFDDUHGHFUHDVLQJUDSLGO\LQWKHODVWBBBBBBBBBBBBBBBB6HDOHYHOLQFUHDVHZDV
DOVRBBBBBBBBBBBBBBBBGXULQJWKHODVWFHQWXU\%XWWHUÀLHVIR[HVDQGDOSLQHSODQWVBBBBBBBBBBBBBBBBWR
BBBBBBBBBBBBBBBBORFDWLRQV5DLQDQGVQRZDXJPHQWHGDURXQGWKHJOREHBBBBBBBBBBBBBBBB%DUNEHHWOHV
ÀRXULVKHGLQ$ODVNDBBBBBBBBBBBBBBBBWZHQW\\HDUVRIKRWVXPPHUV7KHLQVHFWVBBBBBBBBBBBBBBBBIRXU
PLOOLRQDFUHVRIVSUXFHWUHHV

Grammar reference
:LOO

:HXVHwillIRUSURPLVHVRIIHUVRUWKUHDWV([DPSOH
· Mom, I promise I will clean my bedroom.
· You will earn a lot of money when you sell this product.
· You won’t go to the party tonight.
:HDOVRXVHwillIRUSUHGLFWLRQVEDVHGRQZKDWZHVHHRUNQRZ([DPSOH
· I will get a better grade on English, once I study harder.
· I will give you a call if I go to Navojoa tomorrow.
:HXVHwillRQWKHVSRWGHFLVLRQ([DPSOH
· I’m thirsty. I’ll have some water.

1RWH
)RUDI¿UPDWLYHVHQWHQFHVZHXVHZLOOWKHYHUELQLQ¿QLWLYHI will get a better grade on English…
)RUQHJDWLYHZHXVHwon’t or will notYou won’t go to the party tonight.
'RQ¶WIRUJHWWKDW\RXFDQXVHFRQWUDFWLRQVI’m thirsty. I’ll have some water.

Homework 2: Go to page 40

26 26
26
Colegio de Bachilleres del Estado de Sonora
Inglés 3

F $VNDQGDQVZHUJREDFNWRWKH5HDGLQJ: Effects of
global warming:KDWGR\RXWKLQNwill happenLI«
G :ULWLQJ7KLQNRIKRZ7KH(DUWKZLOOEHLQ
\HDUV:KDWW\SHRIGLVHDVHVwillZHKDYH"
• 6HDOHYHOVULVHVEHWZHHQDQGLQFKHV"
• /HVVIUHVKZDWHULVDYDLODEOH"
• 6RPHGLVHDVHVVXFKDVPDODULDVSUHDG"

H &RPSOHWHWKHVHQWHQFHV8VHWKHYHUEVLQSDUHQWKHVHVXVLQJwill or won’t.

%\WKHHQGRIWKHFHQWXU\VRPHGLVHDVHVBBBBBBBBBBBBBBBBBBBDURXQGWKHZRUOG VSUHDG

,IJOREDOZDUPLQJFRQWLQXHVOHVVIUHVKZDWHUBBBBBBBBBBBBBBBDYDLODEOH EH

,IZHGRQ¶WVWRSJOREDOZDUPLQJHFRV\VWHPVBBBBBBBBBBBBB FKDQJH

%\WKH\HDUWKH4XHOFFD\DLFHFDSLQSHUXBBBBBBBBBBBBBBBBB PHOW

)ORRGVDQGGURXJKWVBBBBBBBBBBBBBBBBBBBBBBBOHVVFRPPRQ EHFRPH 

$&7,9,7< Track #3
6'%

PRONUNCIATION PRACTICE: Th sounds:


1/LVWHQDQGUHSHDWWKHVHZRUGV
/ ð / voiced șYRLFHOHVV
Vocal cords vibrate Vocal cords do not vibrate
the thDQN
there thLQN
they thermometer
this theory
their thought
:HDther healthy
Brother through

27 27
27
BLOCK 1 Making the right decisions
ACTIVITY 9
6'%

D8VH\RXUGLFWLRQDU\DQGDGGPRUHZRUGVRQWKHOLVWIRUHDFKVRXQG$UHWKH\voiced"/ð / unvoiced"ť

E3UDFWLFHVD\LQJWKHVHVHQWHQFHV:KLFK³th” sound is voiced":KLFKLVvoiceless"

:ULWHWKHFRUUHFW³th´SKRQHWLFV\PERODERYHHDFKZRUG/RRNDWWKHH[DPSOHEHORZ6KDUH\RXUDQVZHUVZLWKD
SDUWQHU
êťê
([This is the fourth time you bother me!

1. We are healthy, but do you think we are wealthy as well?


2. These three teeth hurt my mouth.
3. They went with their brothers to the theater.
4. My birthday is on Thursday December fifth
5. That’s right. Find another toothbrush and toothpaste, open your mouth, and brush your teeth

Grammar reference
Conditional Type 1

:HXVHFRQGLWLRQDOtype 1WRH[SUHVVIXWXUHHYHQWVWKDWDUHOLNHO\WRKDSSHQ([DPSOH
• If global warming continues, less fresh water will be available.
• Less fresh water will be available if global warming continues.
• If we don’t stop global warming, ecosystems will change.
• Ecosystems will change if we don’t stop global warming.

1RWHZHFDQXVHunless instead of if not.([DPSOH


Unless we stop global warming, ecosystems will change.
Ecosystems will change unless we stop global warming.

If clause (cause / condition) Main clause (result /effect)


If – clause + simple present Will + base form of the verb
If we don’t stop global warming, ecosystems will change.

28 28
28
Colegio de Bachilleres del Estado de Sonora
Inglés 3

ACTIVITY 10
6'%

D $QVZHUWKHIROORZLQJTXHVWLRQ
:KDWWHQVHGRZHXVHIRUWKHLI±FODXVH":KDWWHQVHGRZHXVHIRUWKHUHVXOWHIIHFWFODXVH"
________________________________________________________________________

E &RPSOHWHWKHVHQWHQFH:ULWHWKHYHUEVLQSDUHQWKHVLVLQWKHFRUUHFWWHQVH7ZRVHQWHQFHVDUHQHJDWLYH

,ILWBBBBBBBBBBBB UDLQ WRGD\,BBBBBBBBJRWRVFKRRO JR

-HVVLFDBBBBBBBBBBBBBBB ORVH ZHLJKWLIVKHBBBBBBBBBBH[HUFLVH GR

,I,BBBBBBBBBBBBBBB VWXG\ KDUG,BBBBBBBBBBBBBBP\(QJOLVKH[DP SDVV

2XUPRPBBBBBBBBBBBB EH GLVDSSRLQWHGLIZHBBBBBBBBBBBBBRXUURRP FOHDQ

,I,BBBBBBBBBBBB JHW JRRGJUDGHV,BBBBBBBBBWRWKHSDUW\ JR

F &KDQJHWKHVHQWHQFHVLQH[HUFLVHE &KDQJHWKH³LI´LQWKHFRQGLWLRQFODXVHIRU³XQOHVV´7KH¿UVWRQHLV
GRQHIRU\RX&LUFOHWKHFRQGLWLRQDQGXQGHUOLQHWKHUHVXOW

If it doesn’t rain today, I will goWRVFKRROUnless it rains today, I’ll goWRVFKRRO









29 29
29
BLOCK 1 Making the right decisions
Track #4

G /LVWHQDQGUHDGWKHIROORZLQJLQIRUPDWLRQDERXWZKDW\RXVKRXOG\RXGRLIVRPHRQHLVFKRNLQJ

Severe choking in adults and children over one year old

:KHUHFKRNLQJLVVHYHUHWKHSHUVRQZLOOQRWEHDEOH  /HDQWKHSHUVRQIRUZDUGVRWKDWWKHREMHFW


WRVSHDNFU\FRXJKRUEUHDWKH:LWKRXWKHOSWKH\ EORFNLQJWKHLUDLUZD\ZLOOFRPHRXWRIWKHLU
ZLOOHYHQWXDOO\EHFRPHXQFRQVFLRXV PRXWKUDWKHUWKDQJRLQJIXUWKHUGRZQ

 *LYH XS WR ¿YH VKDUS EORZV EHWZHHQ WKH


person’s shoulder blades with the heel of
\RXUKDQG 7KHKHHOLVEHWZHHQWKHSDOPRI
\RXUKDQGDQG\RXUZULVW 

 6WRSDIWHUHDFKEORZWRFKHFNLIWKHEORFNDJH
KDVFOHDUHG

7RKHOSDQDGXOWRUFKLOGRYHURQH\HDUROGZKRLV
FKRNLQJVHYHUHO\MXVWIROORZWKHVHVWHSV

 6WDQGVOLJKWO\EHKLQGWKHSHUVRQWRRQHVLGH
5LJKWKDQGHGSHUVRQVWDQGWRWKHOHIWOHIW
KDQGHGVWDQGWRWKHULJKW
7DNHQDQGDGDSWHGIURPKWWSZZZQKVXNFKT
 6XSSRUWWKHLUFKHVWZLWKRQHKDQG SDJHVDVS["&DWHJRU\,'  6XE&DWHJRU\,' 

H 5HZULWHWKHVXJJHVWLRQVJLYHQLQWKHWH[W&KDQJHWKHPXVLQJWKH¿UVWW\SHFRQGLWLRQDO<RXFDQXVH³LI´RU
³XQOHVV´

([:KHQFKRNLQJLVVHYHUHWKHSHUVRQZLOOQRWEHDEOHWRVSHDNFU\FRXJKRUEUHDWKH
8QOHVVFKRNLQJLVVHYHUHWKHSHUVRQZLOOEHDEOHWRVSHDNFU\FRXJKRUEUHDWKH

30 30
30
Colegio de Bachilleres del Estado de Sonora
Inglés 3

I  3DLU ZRUN$FW RXW DQG H[SODLQ VWHS E\ VWHS WR WKH FODVV ZKDW WR GR LI  \RX H[SHULHQFH D ³VHYHUH FKRNLQJ´
VLWXDWLRQ

J  3DLU ZRUN$VN DQG DQVZHU 7KLQN RI VLWXDWLRQV DQG DVN DQG DQVZHU ZLWK \RXU SDUWQHU ZKDW ZLOO KDSSHQ
([DPSOHJRRGJUDGHV

:KDWwill you do if you get good grades on the If I get good grades, my mom will be YHU\KDSS\
¿UVWSDUWLDO" and she mightWDNHPHWRWKHPRYLHV

Homework 3: Go to page 41

Start Up Activities Didactic Sequence 3


͞/D/',dt/E/&͙͟

1. Modals of possibility (may, might) and advice (should).

31 31
31
BLOCK 1 Making the right decisions
Grammar reference
0RGDOVRISRVVLELOLW\ PD\PLJKW

:HXVHmay/mightWRH[SUHVVSRVVLELOLW\LQWKHIXWXUH([DPSOH

• It may/might rain this evening.

• ,PD\PLJKWDUULYHODWH,KDYHWRJRWRWKHVWRUH¿UVW

5HPHPEHUZHFDQDOVRXVHQHJDWLYHIRUPV([DPSOH

• It may not /might not rain this evening.

• I may not/might not arrive late.

ACTIVITY 11
SD3-B1

D /RRNDWWKHIROORZLQJVHQWHQFHV:KDWLVWKHGLIIHUHQFH":KLFKVHQWHQFHH[SUHVVHVDQLQWHQWLRQRUSODQ":KLFK
VHQWHQFHH[SUHVVHVSRVVLELOLW\":ULWH\RXUFRQFOXVLRQLQWKHER[

,¶PJRLQJWRSOD\VRFFHUZLWK6DQWLDJRWKLVDIWHUQRRQ
,PLJKWPD\SOD\VRFFHUZLWK6DQWLDJRWKLVDIWHUQRRQ

32 32
32
Colegio de Bachilleres del Estado de Sonora
Inglés 3

E 5HZULWHWKHVHVHQWHQFHVXVLQJDPRGDOYHUERISRVVLELOLW\

7KH¿UVWRQHLVGRQHIRU\RX

,¶PJRLQJWREX\DQHZFDUWKLV\HDU,might buyDQHZFDUWKLV\HDU

______________________________________________________________________________________

+HLVJRLQJWRZRUNRQ6XQGD\

______________________________________________________________________________________

:HDUHJRLQJWRWKHPRYLHVWRPRUURZ

______________________________________________________________________________________

&HFLOLDLVJRLQJWR6DQ&DUORVWKLVZHHNHQG

______________________________________________________________________________________

$QD)HUQDQGDLVJRLQJVKRSSLQJODWHUWKLVDIWHUQRRQ

______________________________________________________________________________________

Grammar reference
0RGDORIDGYLFH VKRXOG

:HXVHshouldWRJLYHDQDGYLFHWRVRPHRQH([DPSOH

· You should study more for the test.

· I feel stressed, so I think I should go to San Carlos this weekend.

5HPHPEHUZHFDQDOVRXVHQHJDWLYHIRUPV([DPSOH

· You should not / shouldn’t go to that restaurant .

· You shouldn’t go to San Carlos this weekend, it is very cold.

33 33
33
BLOCK 1 Making the right decisions
F *LYHDQDGYLFHWRVRPHRQH
n
,QVWUXFWLRQV2QDSLHFHRISDSHUZULWHDERXWDSUREOHP Problem or situatio
RUDVLWXDWLRQ)ROGLWDQGJLYHLWWRWKHWHDFKHU

Once the teacher has all the papers folded, he or she


ZLOOKDQGWKHPRXWWRWKHVWXGHQWVUDQGRPO\6WXGHQWV
ZLOOUHDGDQGJLYHDGYLFHRUSRVVLEOHVROXWLRQVWRWKHVH
SUREOHPV

Group Story G &UHDWHDVWRU\

If… ,QVWUXFWLRQVWKH¿UVWVWXGHQWRIHDFKURZZLOOWKLQN
RIDJRRGEHJLQQLQJIRUDVWRU\XVLQJDQ³LIFODXVH´
He or she will write it down, and pass it to the person
who is behind him or her so the student can continue
WKHVWRU\7KHODVWSHUVRQLQWKHURZZLOOHQGWKHVWRU\
DQGUHDGLWRXWORXGWRWKHFODVV

$&7,9,7< Track #5
SD3-B1

D 6NLPWH[W³$´DQGWH[W³%´DQGDQVZHUWKHVHTXHVWLRQV

&20($1'9(1785(,172$/$02662125$«
$WRZQWKDWSURYLGHVPHPRUDEOHDXWKHQWLFFXOWXUDOH[SHULHQFHVWKDWDUHSHUVRQDOHQJDJHWKHVHQVHVDQGPDNH
FRQQHFWLRQVRQDQHPRWLRQDOVSLULWXDODQGLQWHOOHFWXDOOHYHO

34 34
34
Colegio de Bachilleres del Estado de Sonora
Inglés 3

 :KDWLVWKHLQWHQWLRQRIWH[W³$´"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB7H[W³%´"BBBBB
_______________________________________________________________

 :KHUHGR\RXWKLQN\RXFRXOG¿QGHDFKWH[W"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
___________________________________________________________

 :KLFKRIWKHWZRWH[WVSURYLGHVDGGLWLRQDOLQIRUPDWLRQ"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
___________________________________________________________

 :KLFKRIWKHWZRWH[WVLQYLWHVWRXULVWVWRYLVLW"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
___________________________________________________________

Text “A”
<RXZLOOEHGD]]OHGDQGFKDUPHGZKHQYLVLWLQJWKHPDJLFDOWRZQRI$ODPRVGXULQJ
MXVWDERXWDQ\WLPHRIWKH\HDU\RX
OO¿QG\RXUVHOIVXUURXQGHGE\RQHRIWKHPDQ\
¿HVWDVDQGIHVWLYDOVWKDWDUHFHOHEUDWHGKHUH7KHQRWDEOHQLQHGD\IHVWLYDO)HVWLYDO
$OIRQVR2UWL]7LUDGRWKDWWDNHVSODFHHYHU\-DQXDU\LVRQHQRWWREHPLVVHG1DWLRQDO
DQG ,QWHUQDWLRQDO PXVLFLDQV DQG FHOHEULWLHV JDORUH DWWHQG WKLV IHVWLYDO WR KRQRU 'U
$OIRQVR 2UWL] 7LUDGR RQH RI 0H[LFR
V PRVW IDPRXV WHQRU
V ZKR JUDFHG WKH RSHUD
GXULQJ0H[LFR
VJROGHQ\HDUV7KH3OD]DDERXQGVZLWK3DSSDUD]]L2QHWKLQJ\RX
FHUWDLQO\ ZRQ
W ZDQW WR IRUJHW LV \RXU DXWRJUDSK ERRN SHQ DQG FDPHUD /LJKWV
Camera, Action!

:KHQ \RX YLVLW 0XVHR &RVWXPEULVWD GH 6RQRUD \RX


OO KDYH D WDVWH RI DQG
LQWURGXFWLRQ WR WKH OLIHVW\OHV DQG FXOWXUH RI WKH SHRSOH OLYLQJ LQ DQG DURXQG WKLV
VLOYHUPLQLQJWRZQGXULQJLW
VJROGHQ\HDUV,QWULJXLQJDQGKLVWRULFDOSKRWRJUDSKV
GHWDLOHGDQGDUWLVWLFGLRUDPDVPDFKLQHU\DQGHTXLSPHQWSHULRGKRXVHKROGGLVSOD\V
DQGIXUQLWXUHDOOORYLQJO\GLVSOD\HGWREROVWHUWKHPLQGDQGVRXOWRHDFKYLVLWRUZKR
HQWHUVLWVGRRUV

$ URPDQWLF VWUROO WKURXJK WKH PDJLFDO WRZQ RI $ODPRV ZLWK \RXU ORYHG RQH ZLOO
DOZD\VLQFOXGHDYLVLWWRWKH&DOOHMRQGHO%HVRZKHUHORYHUVGHOLJKWLQNHHSLQJWKH
OHJHQGDOLYH2IFRXUVHWRXULVWJXLGHVIDPLO\DQGIULHQGVPD\DFFRPSDQ\\RXGXULQJ
WKLVOHLVXUHO\VWUROOZKLOH\RXOHDUQWKHIDVFLQDWLQJWDOHWKDWFUHDWHGWKLVOLYLQJOHJHQG

'XULQJ\RXUVWD\LQ$ODPRVDWWUDFWLRQVDQGDGYHQWXUHVWKDWDUHQRWWREHPLVVHG
LQFOXGH (O 3DVHR GHO &KDODWRQ (O 0XVHR &RVWXPEULVWD DQG WKH $UUR\R
&XFKXMDTXLZKHUH\RXUVDIHULYHUMRXUQH\LQWRWKLVOLWWOHNQRZQ6RQRUDQZHWZRQGHU
ZLOOOHDYH\RXDPD]HG

35 35
35
BLOCK 1 Making the right decisions
Text “B”
ÈODPRV LV ORFDWHG LQ WKH VRXWKHDVWHUQ SDUW RI 6RQRUD
ÈODPRV LV DOVR NQRZQ DV /D &LXGDG GH ORV 3RUWDOHV
SRUWDOHVDUHWDOODUFKHGFRYHUHGYHUDQGDVRUZDONZD\V
IURQWLQJ PDQ\ RI WKH FREEOHVWRQHG VWUHHWV RU FDOOHV 
Alamos boasts numerous buildings exhibiting classic
DUFKLWHFWXUHIURP0H[LFR
V&RORQLDOSHULRGLQFOXGLQJWKH
Plaza de Armas, the Church of La Purísima Concepción,
/D &DSLOOD DQG WKH 3DODFLR 0XQLFLSDO FLW\ KDOO 
7KH JUHDW ZHDOWK FUHDWHG E\ WKH VLOYHU PLQHV IURP WKH
VXUURXQGLQJPLQLQJWRZQVRI/D$GXDQD0LQDV1XHYDV
and San Bernardo enabled the founders and residents of
$ODPRVWRHDUO\WK&HQWXU\DQGUHVWRUHGE\$PHULFDQV
DQG&DQDGLDQV
The Plaza de Armas 7DNHQDQGDGDSWHGIURP
KWWSHQZLNLSHGLDRUJZLNL&ODPRV

36 36
36
Colegio de Bachilleres del Estado de Sonora
Inglés 3

INTEGRATING ACTIVITY

CLASS DEBATE. The environment, what will happen if…

,QVWUXFWLRQV'LYLGHWKHJURXSLQWHDP$DQGWHDP%,QYHVWLJDWHZLWK\RXUWHDPWKHIROORZLQJWRSLFV7KLQNRI
KRZZHFDQSUHYHQWWKHVHSUREOHPV8VHPD\DQGPLJKW

• *OREDOZDUPLQJ
• :KDWZLOOKDSSHQLIJOREDOZDUPLQJFRQWLQXHVZHZLOOKDYHDFKDQJHRIFOLPDWHZHPLJKW«
• (QYLURQPHQWDOGHJUDGDWLRQ
• 2YHUSRSXODWLRQ
• 3ROOXWLRQ
• 2]RQHGHSOHWLRQ
• :DVWH

Example:

• *OREDOZDUPLQJ

7HDP$:KDWZLOOKDSSHQLIJOREDOZDUPLQJFRQWLQXHVZHZLOOKDYHDFOLPDWHFKDQJHZHPLJKW«

37 37
37
BLOCK 1 Making the right decisions
5(9,(:

1. Match the causes to their appropriate effects.

CAUSE EFFECT

 air heats ______ D it falls


 a seed has no oxygen______ E it rises
 air cools______ F it doesn’t germinate
 ice melts ______ G LWOLTXH¿HV
 DOLTXLGFRROVBBBBBB H LWVROLGL¿HV
 DOLTXLGKHDWVBBBBBB I LWHYDSRUDWHV

2. Answer “true” or “false” next to each sentence. Choose the correct answer and write it in the
parenthesis. 1. When a seed has no oxygen, it will not germinate. _______

2. Air will heat if it rises. _______

3. When a liquid heats, it will evaporate. _______

4. A liquid solidifies when it is cooled. _______

5. When ice melts, it liquefies. _______

6. Air falls when it is cooled. _______

a) 1f,2t,3t,4t,5f,6f

b) 1f,2f,3t,4t,5t,6f ( )

c) 1t,2f,3t,4t,5t,6t

d) 1t,2t,3f,4f,5f,6t

e) 1f,2t,3f,4t,5f,6t

38 38
38
Colegio de Bachilleres del Estado de Sonora
Inglés 3

HOMEWORK 1 Didactic sequence 1. “When you mix water and oil…”

1. Cause and effect

Instructions: Write statements about facts or general truths. Use the vocabulary from the box. Use your
dictionary if needed.

([DPSOHIf you throw a rock in the water, it sinks.

%XUQ  ÀRDW  ERLO  PHOW  PL[

2. Conditional type 0

Instructions: In teams of four, search on the Internet for universal facts and write them down. Share the
information to the class. Think about your physics and chemistry classes.

([DPSOHIf you heat water, it boils.

39 39
39
BLOCK 1 Making the right decisions
HOMEWORK 2 Didactic sequence 2. “If it rains today, I…”

1. Nature (will).

Instructions: Write a paragraph of what you will be doing in 10 years.

__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
_________________________________________________________________________________________
_________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________

2. Conditional type 1

Instructions: Think about emergency cases. Write down some suggestions of what you can do, if it happens.
Use “if” or “unless”. Share with the class.

+HUHDUHVRPHH[DPSOHVRUHPHUJHQF\FDVHV
Burn, sunburn, drowning, poisoning, insect bite, etc.

40 40
40
Colegio de Bachilleres del Estado de Sonora
Inglés 3

HOMEWORK 3 Didactic sequence 3. “I might win if…”

1. Modals of possibility (may, might) and advice (should).

Oral presentation

Instructions: In teams of four, do research in a place in Mexico that you can go on vacation. What places
can you visit? Present it to class.

41 41
41
BLOCK 1 Making the right decisions
SELF-EVALUATION

0DWFKWKHWZRFROXPQVWKHQFKRRVHWKHFRUUHFWDQVZHUDQGZULWHLWLQWKHSDUHQWKHVLV SWV
BBBBBBB,I,KDYHPRQH\     DXQOHVVZHKDYHFODVV
BBBBBBB0\FODVVPDWHVDQG,SUDFWLFHVSRUWV   EZH¶OOKDYHWRVXIIHUWKHFRQVHTXHQFHV
BBBBBBB8QOHVVP\WHDFKHUDVVLJQVPHKRPHZRUN  F,DUULYHRQWLPHWRP\(QJOLVKFODVV
BBBBBBB,IZHGRQ¶WWDNHDFWLRQQRZ    G,JRWRWKHPRYLHV
BBBBBBB:KHQ,ZDNHXSHDUO\LQWKHPRUQLQJ  H,¶OOKDYHWKHHYHQLQJIRUOHLVXUHDFWLYLWLHV

DHDGEF
EGDHFE  
FGDGEH
GGDHEF
HHDGFE

'R\RXUHPHPEHUWKHVHSODFHV":KDWDUHWKHQDPHVRIWKHVHSODFHV"
,QZKLFKWRXULVWFLW\LQ6RQRUDFDQ\RX¿QGWKHP":ULWHWKHQDPHVXQGHUHDFKSLFWXUH SWV

0DWFKWKHVHQWHQFHVWRWKHLUDSSURSULDWH³WK´SKRQHWLFV\PERO³èș$UHWKH\³YRLFHG´RU³YRLFHOHVV´"
&KRRVHWKHFRUUHFWDQVZHUDQGZULWHLWLQWKHSDUHQWKHVLVSWV

1. There are thirteen thin women thHUHBBBBB Dșèèèșèș


2. Both these children’s throats are sore today, ThXUVGD\BBBBB Eèèèèșèè
3. ThDQN\RXP\GHDUHVWIDther, mother and my other three
Fșèșș
brothHUVIRULQYLWLQJPHWRWKHPRYLHtheater _____
4. That’s right! Let’s gather together for a stroll in a city that
SURYLGHVDXthentic cultural experiences since the weather will be Gèșșè
perfect for thHRFFDVLRQBBBBB
DGGED
EFGED 

42 42
42
Colegio de Bachilleres del Estado de Sonora
Inglés 3

3XWWKHVHZRUGVLQDFRUUHFWRUGHUWRIRUPFRQGLWLRQDOVHQWHQFHVSWV

WKURXJKLPSRUWDQWQHZVLIDÀLHVELUG\RXUKRXVHEULQJZLOOLW
__________________________________________________________________________________________

LWIDOO\RXRQZDONPLJKWLIXQGHU\RXXQGHUDODGGHU
__________________________________________________________________________________________

XQOHVV¿QLVKZRUNHDUO\,JRFLQHSROLVWRZRQ¶WP\DOOFDQ,
__________________________________________________________________________________________

KHWHOOVZKDWWRGRXQOHVVPHZRQ¶WDGYDQFHEHDEOHWRRQWKHSURMHFWDGYDQFH,
__________________________________________________________________________________________

IROORZLQJ,¶PWLUHGGD\ZKHQ,QRWWKHHYHU\QLJKWKRXUVHLJKWVOHHS
__________________________________________________________________________________________

7RWDOSWVBBBBBBBBBBB

43 43
43
BLOCK 1 Making the right decisions
VOCABULARY BLOCK 1
Didactic sequence 1. “When you mix water and oil…”

compass scissors radio music player


article TV horse gun
telescope mirror rope ammunition
toothbrush toothpaste comb brush
axe ERRN old type-writer frying pan
¿VKLQJSROH net lamp light source
VXQEORFN DUP\NQLIH soap QRQDOFRKROLFEHYHUDJHV
VWRYH pencils ball ODUJHFRRNLQJSRW
GHFNRIFDUGV refrigerator paper barometer
hammer nails matches candles
thermometer microscope sunglasses antiseptic
plastic cups Vitamin C tablet Tincture of iodine Hydrogen peroxide
/LTXLGODXQGU\VWDUFK Safety goggles 0HDVXULQJVSRRQV 0HDVXULQJFXS

Grammar reference
5HYLHZ

5HPHPEHU«
Add “s”, “es” or “ies” to Add the auxiliary “do / does” in Add “don’t / doesn’t” in
WKLUGSHUVRQVLQJXODUYHUEVLQ LQWHUURJDWLYHVHQWHQFHVDQGDOVR QHJDWLYHVHQWHQFHVDQGVKRUW
DI¿UPDWLYHVHQWHQFHVRQO\ LQVKRUWDQVZHUV DQVZHUV

9HUEVWKDWHQGLQ³VV´³VK´³FK´³[´RU³R´DGG³HV´
I wash - he washes
I box – she boxes
I watch– he watches
Grammar I dress – she dresses
reference I go – she goes
Third person I do –he does
singular 9HUEVWKDWHQGLQDFRQVRQDQWIROORZHGZLWKD³\´GURSWKH³\´DQGDGG³LHV´
I study - he studies
Spelling rules – I cry – she cries
3rd person singular 7KHUHVWRIWKHYHUEVDGG³V´,ZDON±VKHZDONV
KHVKHLW ([FHSWLRQV,KDYH±VKHKDV

44 44
44
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Grammar reference
&RQGLWLRQDO7\SH=HUR³´

Track #6
:HXVHWKHFRQGLWLRQDOW\SH=HUR³0” to express general truths or facts,
when the result of the condition is always trueOLNHDVFLHQWL¿FIDFW
Pronunciation
Third person singular ([DPSOH
/s/ Water and oil separate if/when you mix them together.
9LVLWYLVLWV 1RWHZHFDQXVHwhen instead of if.
Eat – eats
7DNH±WDNHV :KHQWKHVHQWHQFHVWDUWVZLWKWKH³if/when” clause, we use a comma ( , )
'ULQN±GULQNV to separate the two clausesRUSDUWV

/z/ If/when – clause (condition) (result / effect) clause


clean – cleans If/when you mix water and oil, they separate.
do – does
study –studies
play – plays

/iz/
wash – washes
dress - dresses
brush – brushes
¿QLVK±¿QLVKHV

45 45
45
BLOCK 1 Making the right decisions
:HXVHWKHsimple present formWRWDONDERXWWKHcondition and we also use the
simple present formWRWDONDERXWWKHresult or effect of that condition+RZHYHU
ZHFDQDOVRXVHWKHQHJDWLYHIRUPWRH[SUHVVJHQHUDOWUXWKVRUIDFWV certainty 7KH
main idea about the zero conditional is that the condition always has the same
result.

Example
Grammar
reference Simple Present Simple Present
If / when you heat water, it boils(+)

:DWHUdoesn’t boil if / when you don’t heat it. (-)

VOCABULARY BLOCK 1
Didactic sequence 2. If it rains today, I …

already up effects shifting impacts


far-flung all over on the move sheets
decline breeding cooler precipitation
boomed chewed up faster other
stronger out of sync droughts available
earlier rainfall source Spread
farther as well

:HXVHwillIRUSURPLVHVRIIHUVRUWKUHDWV([DPSOH
• Mom, I promise I will clean my bedroom.
• You will earn a lot of money when you sell this product.
• You won’t go to the party tonight.
:HDOVRXVHwillIRUSUHGLFWLRQVEDVHGRQZKDWZHVHHRUNQRZ([DPSOH
• I will get a better grade on English, once I study harder.
• I will give you a call if I go to Navojoa tomorrow.
Grammar :HXVHwillRQWKHVSRWGHFLVLRQ([DPSOH
reference • I’m thirsty. I’ll have some water.

:LOO
1RWH
)RUDI¿UPDWLYHVHQWHQFHVZHXVHZLOOWKHYHUELQLQ¿QLWLYHI will get a better
grade on English…
)RUQHJDWLYHZHXVHwon’t or will notYou won’t go to the party tonight.
'RQ¶WIRUJHWWKDW\RXFDQXVHFRQWUDFWLRQVI’m thirsty. I’ll have some water.

46 46
46
Colegio de Bachilleres del Estado de Sonora
Inglés 3

PRONUNCIATION PRACTICE: Th sounds:

/ ð / voiced șYRLFHOHVV
Vocal cords vibrate Vocal cords do not vibrate
the thDQN
there thLQN
they thermometer
this theory
their thought
:HDther healthy
Brother through

:HXVHFRQGLWLRQDOtype 1WRH[SUHVVIXWXUHHYHQWVWKDWDUHOLNHO\WRKDSSHQ
([DPSOH

• If global warming continues, less fresh water will be available.

• Less fresh water will be available if global warming continues.

• If we don’t stop global warming, ecosystems will change.

• Ecosystems will change if we don’t stop global warming.


Grammar
reference 1RWHZHFDQXVHunless instead of if not.([DPSOH

Conditional • 8QOHVVZHVWRSJOREDOZDUPLQJHFRV\VWHPVZLOOFKDQJH
Type 1
• (FRV\VWHPVZLOOFKDQJHXQOHVVZHVWRSJOREDOZDUPLQJ
If clause (cause / condition) Main clause (result /effect)
If – clause + simple present Will + base form of the verb
If we don’t stop global warming, ecosystems will change.

47 47
47
BLOCK 1 Making the right decisions
Didactic sequence 3. I might win, if…

GRAMMAR REFERENCE

:HXVHmay/mightWRH[SUHVVSRVVLELOLW\LQWKHIXWXUH([DPSOH

• It may/might rain this evening.


Grammar • ,PD\PLJKWDUULYHODWH,KDYHWRJRWRWKHVWRUH¿UVW
reference
5HPHPEHUZHFDQDOVRXVHQHJDWLYHIRUPV([DPSOH
0RGDOVRI
possibility • It may not /might not rain this evening.
PD\ • I may not/might not arrive late.
PLJKW

:HXVHshouldWRJLYHDQDGYLFHWRVRPHRQH([DPSOH

• You should study more for the test.

Grammar • I feel stressed, so I think I should go to San Carlos this weekend.


reference
5HPHPEHUZHFDQDOVRXVHQHJDWLYHIRUPV([DPSOH
0RGDO • You should not / shouldn’t go to that restaurant .
RIDGYLFH
VKRXOG • You shouldn’t go to San Carlos this weekend, it is very cold.

48 48
48
Colegio de Bachilleres del Estado de Sonora
Inglés 3

EVALUATION RUBRIC

SELF-EVALUATION

I can… Excellent Good Regular

Talk about cause-effect


relations of general
truths or facts

Conduct experiments

Talk about cause-effect


relations of real or
probable facts about
the present or the
future.

Use vocabulary
associated with
experiments and
science.

Use modals of
possibility (may/might)

8VH¿UVWFRQGLWLRQDOLI
modals of possibility.

Use modal : advice


(should)

49 49
49
BLOCK 1 Making the right decisions
CO-EVALUATION

$VNRQHRI\RXUFODVVPDWHVWRHYDOXDWH\RXUZRUNKDELWV

Needs
Excellent Satisfactory Unsatisfactory
POINTS Improvement Pts.
3 2 0
1

+DVRU Has 3 or 4 Has 4 or more


Attendance
Has perfect
DWWHQGDQFH Unexcused Unexcused Unexcused
and
DEVHQFHV DEVHQFHV DEVHQFHV
,VQHYHUODWH
punctuality
,VVHOGRPODWH ,VVRPHWLPHVODWH ,VXVXDOO\ODWH

)UHTXHQWO\ Often Rarely


1HYHU
Participates participates participates
Participation participates
$VNVTXHVWLRQV DVNVTXHVWLRQV DVNVTXHVWLRQV
and appears apathetic
Shows a lot of shows interest shows interest
Discussions towards class
interest in class in class in class
DFWLYLWLHV
DFWLYLWLHV DFWLYLWLHV DFWLYLWLHV
Sometimes )UHTXHQWO\
Distracting 1HYHUGLVWUDFWV Rarely distracts
distracts other distracts other
other students or other students or
students or the students or the
behavior WKHWHDFKHU WKHWHDFKHU
WHDFKHU WHDFKHU

Always turns in Usually turns in


Sometimes turns Rarely turns in
Completion DVVLJQPHQWV DVVLJQPHQWV
LQDVVLJQPHQWV DVVLJQPHQWV
of Assignments Assignments are
Assignments are Assignments
are always
sometimes well- show minimal
assignments well-done and usually clear, and
GRQH HIIRUW
FRPSOHWH FRPSOHWH

Attitude
Shows a great Shows little
Shows interest in Shows no interest
toward interest in interest in
OHDUQLQJ LQOHDUQLQJ
OHDUQLQJ OHDUQLQJ
learning
TOTAL

50 50
50
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Oral Presentation Rubric: Visiting a place in México

Teacher Name: ____________________________________________________________________________

Student Name: ____________________________________________________________________________

CATEGORY 4 3 2 1

Pitch was often used


Pitch was often Pitch was rarely used
but the emotion it
used and it or the emotion it 3LWFKZDVQRWXVHGWRFRQYH\
Pitch FRQYH\HGVRPHWLPHV
FRQYH\HGHPRWLRQV FRQYH\HGRIWHQGLG HPRWLRQ
GLGQRW¿WWKH
DSSURSULDWHO\ QRW¿WWKHFRQWHQW
FRQWHQW

Pauses were
Pauses were Pauses were
HIIHFWLYHO\XVHG
HIIHFWLYHO\XVHGRQFH intentionally used but
or more times to Pauses were not intentionally
Pauses WRLPSURYHPHDQLQJ ZHUHQRWHIIHFWLYHLQ
LPSURYHPHDQLQJ XVHG
and/or dramatic LPSURYLQJPHDQLQJ
and/or dramatic
LPSDFW RUGUDPDWLFLPSDFW
LPSDFW

Student is able to Student is able to Student is able to


accurately answer accurately answer accurately answer a Student is unable to accurately
Comprehension DOPRVWDOOTXHVWLRQV PRVWTXHVWLRQVSRVHG IHZTXHVWLRQVSRVHG DQVZHUTXHVWLRQVSRVHGE\
posed by classmates by classmates about by classmates about FODVVPDWHVDERXWWKHWRSLF
DERXWWKHWRSLF WKHWRSLF WKHWRSLF

Facial expressions Facial expressions Facial expressions


and body language and body language and body language Very little use of facial
generate a strong sometimes generate are used to try to H[SUHVVLRQVRUERG\ODQJXDJH
Enthusiasm
interest and a strong interest and generate enthusiasm, Did not generate much interest
enthusiasm about the enthusiasm about the but seem somewhat LQWRSLFEHLQJSUHVHQWHG
WRSLFLQRWKHUV WRSLFLQRWKHUV IDNHG

The student is
Student is Student seems pretty
somewhat prepared,
completely prepared prepared but might Student does not seem at all
Preparedness but it is clear that
DQGKDVREYLRXVO\ KDYHQHHGHGDFRXSOH SUHSDUHGWRSUHVHQW
rehearsal was
UHKHDUVHG PRUHUHKHDUVDOV
ODFNLQJ

Presentation is less than 3


Presentation is 5-6 Presentation is 4 Presentation is 3
Time-Limit minutes OR more than 6
PLQXWHVORQJ PLQXWHVORQJ PLQXWHVORQJ
PLQXWHV

51 51
51
BLOCK 1 Making the right decisions
6SHDNVFOHDUO\DQG 6SHDNVFOHDUO\DQG 6SHDNVFOHDUO\DQG
GLVWLQFWO\DOO  GLVWLQFWO\DOO  GLVWLQFWO\PRVW  Often mumbles or can not be
Speaks Clearly  WKHWLPHDQG  WKHWLPHEXW  RIWKHWLPH understood OR mispronounces
mispronounces no mispronounces one 0LVSURQRXQFHVQR PRUHWKDQRQHZRUG
ZRUGV ZRUG PRUHWKDQRQHZRUG

8VHVYRFDEXODU\ 8VHVYRFDEXODU\ 8VHVYRFDEXODU\


appropriate for the appropriate for the appropriate for the
DXGLHQFH([WHQGV DXGLHQFH,QFOXGHV DXGLHQFH'RHV 8VHVVHYHUDO RUPRUH 
Vocabulary DXGLHQFHYRFDEXODU\ ZRUGVWKDWPLJKW not include any words or phrases that are not
E\GH¿QLQJZRUGV be new to most of YRFDEXODU\WKDW XQGHUVWRRGE\WKHDXGLHQFH
that might be new to the audience, but might be new to the
PRVWRIWKHDXGLHQFH GRHVQRWGH¿QHWKHP DXGLHQFH

Stands up straight,
ORRNVUHOD[HG Stands up straight
DQGFRQ¿GHQW and establishes Sometimes stands
Posture and Eye Establishes eye eye contact with up straight and 6ORXFKHVDQGRUGRHVQRWORRNDW
Contact contact with HYHU\RQHLQWKH establishes eye SHRSOHGXULQJWKHSUHVHQWDWLRQ
HYHU\RQHLQWKH room during the FRQWDFW
room during the SUHVHQWDWLRQ
SUHVHQWDWLRQ

Shows a full Shows a good Shows a good


Does not seem to understand the
Content understanding of the understanding of the understanding of
WRSLFYHU\ZHOO
WRSLF WRSLF SDUWVRIWKHWRSLF

Volume is loud Volume is loud Volume is loud


enough to be heard enough to be heard enough to be heard
Volume often too soft to be
Volume by all audience by all audience by all audience
KHDUGE\DOODXGLHQFHPHPEHUV
members throughout members at least members at least
WKHSUHVHQWDWLRQ RIWKHWLPH RIWKHWLPH

Almost always Usually listens to,


Often listens to,
listens to, shares shares with, and
shares with, and Rarely listens to, shares with,
with, and supports supports the efforts
Collaboration with supports the efforts and supports the efforts of
the efforts of others of others in the
Peers of others in the group RWKHUVLQWKHJURXS2IWHQLVQRW
LQWKHJURXS7ULHVWR JURXS'RHVQRW
but sometimes is not DJRRGWHDPPHPEHU
NHHSSHRSOHZRUNLQJ FDXVH?ZDYHV?LQ
DJRRGWHDPPHPEHU
ZHOOWRJHWKHU WKHJURXS

52 52
52
Colegio de Bachilleres del Estado de Sonora
Inglés 3

58%5,&6)25:5,7,1*

TOTAL POINTS: 20

GOOD

Award 5 to 7 points if:


• :ULWLQJLVGHYHORSHGDQGGRHVQRWDSSHDUWRWDNHPXFKHIIRUW
• 7KHSXUSRVHDQGDLPRIWKHZULWLQJLVFOHDU
• 7KHZULWLQJXVXDOO\ÀRZVDWERWKWKHSDUDJUDSKDQGVHQWHQFHOHYHO
• 7KHZRUGVFKRVHQDUHXVXDOO\DSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
• 7KHYRLFHRIWKHDXWKRULVXVXDOO\FOHDUDQGXVXDOO\FRPHVWKURXJKVWURQJO\
• The organization is generally appropriate for the type of piece being written
• ,QJHQHUDOVWDQGDUGZULWLQJUXOHVDUHIROORZHGEXWWKHUHDUHDIHZHUURUVLQJUDPPDUDQGRUSXQFWXDWLRQ

VERY GOOD

Award 8 to 10 points if:


• The purpose and aim of the writing are clear
• 7KHZULWLQJÀRZVDWERWKWKHSDUDJUDSKDQGVHQWHQFHOHYHO
• 7KHYRLFHRIWKHDXWKRULVFOHDUDQGFRPHVWKURXJKVWURQJO\
• 7KHZRUGVFKRVHQDUHDSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
• 7KHFRQYHQWLRQVRIVWDQGDUGZULWLQJDUHXVXDOO\IROORZHG

EXCELLENT

Award 20 points if:


• :ULWLQJLVIXOO\GHYHORSHGDQGDSSHDUVHIIRUWOHVV
• 7KHSXUSRVHDQGDLPRIWKHZULWLQJDUHYHU\FOHDU
• 7KHZULWLQJDOZD\VÀRZVDWERWKWKHSDUDJUDSKDQGVHQWHQFHOHYHO
• 7KHYRLFHRIWKHDXWKRULVYHU\FOHDUDQGFRPHVWKURXJKVWURQJO\
• 7KHZRUGVFKRVHQDUHYHU\DSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
• 7KHRUJDQL]DWLRQLVYHU\DSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
• 7KHUXOHVRIVWDQGDUGZULWLQJDUHIROORZHG

TOTAL: _______
 

Students’ composition must have the appropriate content for the topic, and logically accurate vocabulary.

53 53
53
BLOCK 1 Making the right decisions
INTEGRATING ACTIVITY - EVALUATION RUBRIC

Rubric for Class debate: The environment. What will happen if…

CATEGORY 4 3 2 1
Statements and 0RVWVWDWHPHQWV
All statements,
responses were and responses were Statements, responses
body language,
Respect for Other respectful and used respectful and in and/or body language
and responses were
Team appropriate language, appropriate language, were consistently not
respectful and were in
but once or twice body but there was one UHVSHFWIXO
DSSURSULDWHODQJXDJH
ODQJXDJHZDVQRW VDUFDVWLFUHPDUN
0RVWLQIRUPDWLRQ
All information 0RVWLQIRUPDWLRQ
presented in the debate ,QIRUPDWLRQKDGVHYHUDO
presented in the debate presented in the debate
Information was clear and accurate, inaccuracies OR was
was clear, accurate and was clear, accurate and
but was not usually XVXDOO\QRWFOHDU
WKRURXJK WKRURXJK
WKRURXJK

0RVWFRXQWHU 0RVWFRXQWHU
All counter-arguments Counter-arguments
arguments were arguments were
Rebuttal ZHUHDFFXUDWHUHOHYDQW were not accurate and/
DFFXUDWHUHOHYDQWDQG DFFXUDWHDQGUHOHYDQW
DQGVWURQJ RUUHOHYDQW
VWURQJ EXWVHYHUDOZHUHZHDN

(YHU\PDMRUSRLQW
(YHU\PDMRUSRLQW (YHU\PDMRUSRLQWZDV
was supported with
was well supported DGHTXDWHO\VXSSRUWHG
facts, statistics and/ (YHU\SRLQWZDVQRW
Use of Facts/Statistics ZLWKVHYHUDOUHOHYDQW ZLWKUHOHYDQWIDFWV
or examples, but the VXSSRUWHG
facts, statistics and/or statistics and/or
UHOHYDQFHRIVRPHZDV
H[DPSOHV H[DPSOHV
TXHVWLRQDEOH
Team consistently used Team usually used Team sometimes used
One or more members
gestures, eye contact, gestures, eye contact, gestures, eye contact,
of the team had a
WRQHRIYRLFHDQGD WRQHRIYRLFHDQGD WRQHRIYRLFHDQGD
presentation style
Presentation Style OHYHORIHQWKXVLDVP OHYHORIHQWKXVLDVP OHYHORIHQWKXVLDVP
WKDWGLGQRWNHHS
LQDZD\WKDWNHSW LQDZD\WKDWNHSW LQDZD\WKDWNHSW
the attention of the
the attention of the the attention of the the attention of the
DXGLHQFH
DXGLHQFH DXGLHQFH DXGLHQFH
All arguments were
All arguments were 0RVWDUJXPHQWVZHUH
clearly tied to an
clearly tied to an clearly tied to an Arguments were not
LGHD SUHPLVH EXW
Organization LGHD SUHPLVH DQG LGHD SUHPLVH DQG clearly tied to an idea
the organization was
organized in a tight, organized in a tight, SUHPLVH 
sometimes not clear or
ORJLFDOIDVKLRQ ORJLFDOIDVKLRQ
ORJLFDO
The team clearly
The team clearly The team seemed to
understood the topic The team did not
understood the topic understand the main
Understanding of in-depth and presented VKRZDQDGHTXDWH
in-depth and presented points of the topic and
Topic their information understanding of the
their information with presented those with
forcefully and WRSLF
HDVH HDVH
FRQYLQFLQJO\

54 54
54
Colegio de Bachilleres del Estado de Sonora
Inglés 3

RUBRIC FOR PORTFOLIO

Rubric and Comments for Portfolio


Student name: _____________________________________________________________________________

Beginning Developing Accomplished Exemplary


Comments Score
1 2 3 4

0DQ\PHFKDQLFDO Entire portfolio


Some mechanical All or part of the
HUURUVSUHVHQW has little or no
HUURUVSUHVHQW portfolio has few
grammar, spelling, PHFKDQLFDOHUURUV
grammar, spelling, PHFKDQLFDOHUURUV
punctuation, and grammar, spelling,
Mechanics punctuation, and grammar, spelling,
other mechanics punctuation, and
other mechanics punctuation, and
demonstrate a other mechanics
need some other mechanics
VLJQL¿FDQWQHHGWR are perfect or near
LPSURYHPHQW DUHJRRGRYHUDOO
LPSURYHLQWKLVDUHD SHUIHFW

Entire portfolio Entire portfolio


Some parts Entire portfolio
demonstrates demonstrates
of portfolio demonstrates
VLJQL¿FDQWODFN VLJQL¿FDQW
Originality/ demonstrate some originality
of originality and originality and
originality DQGFUHDWLYLW\
FUHDWLYLW\([WUD FUHDWLYLW\([WUD
Creativity DQGFUHDWLYLW\ Some pieces such
pieces such as pieces such as
%DFNJURXQGV DVEDFNJURXQGV
EDFNJURXQGV EDFNJURXQGV
pictures, music may pictures, and music
pictures, and music pictures, and music
EHSUHVHQW DUHSUHVHQW
DUHDEVHQW DUHSUHVHQW

Portfolio is
3RUWIROLRODFNV Portfolio is Portfolio is neat
extremely neat and
Neatness/ neatness and somewhat neat and DQGRUJDQL]HG
RUJDQL]HG$OOOLQNV
RUJDQL]DWLRQ6RPH RUJDQL]HG)HZ /LQNVIXQFWLRQ
Organization IXQFWLRQSHUIHFWO\
OLQNVDUHEURNHQRU OLQNVDUHEURNHQRU ZHOODGHTXDWH
DPSOHOLQNV
DEVHQW DEVHQW OLQNVSUHVHQW
DYDLODEOH

55 55
55
BLOCK 1 Making the right decisions
,1)250$7,216285&(6

Electrónicas:
Rapid Color Changing Chemistry!
$GDSWHGIURPKWWSZZZVFLHQFHEREFRPH[SHULPHQWVLRGLQHBFORFNBUHDFWLRQSKS
5HWULHYHG)HEUXDU\

Effects of Global Warming

Signs Are Everywhere


7DNHQIURPKWWSHQYLURQPHQWQDWLRQDOJHRJUDSKLFFRPHQYLURQPHQWJOREDOZDUPLQJJZHIIHFWV
5HWULHYHG)HEUXDU\

Severe choking in adults and children over one year old


7DNHQDQGDGDSWHGIURPKWWSZZZQKVXNFKTSDJHVDVS["&DWHJRU\,'  6XE&DWHJRU\,' 
5HWULHYHG0DUFK

COME AND VENTURE INTO ALAMOS, SONORA….


Text A readings of Alamos are our own versions. The model was adapted from
KWWSHQZLNLSHGLDRUJZLNL&ODPRV

Text B reading of Alamos was WDNHQDQGDGDSWHGIURP


KWWSHQZLNLSHGLDRUJZLNL&ODPRV
5HWULHYHG0DUFK

56 56
56
Colegio de Bachilleres del Estado de Sonora
BLOCK 2
Memorable days

^ƚƵĚĞŶƚƐ͛ƉĞƌĨŽƌŵĂŶĐĞĂƚƚŚĞ
ĞŶĚŽĨďůŽĐŬ Competences to be developed
>ŽĐĂƚĞƐ  ƐƉĞĐŝĮĐ ŝŶĨŽƌŵĂƟŽŶ ŝŶ Ă ƚĞdžƚ͕ hƟůŝnjĞƐƚŚĞŐƌĂŵŵĂƟĐĂůĨŽƌŵ͞ƵƐĞĚƚŽ͟ƚŽ ƚŚƌŽƵŐŚŽƵƚƚŚĞƉƌĂĐƟĐĞŽĨĐŽŵƉĂƌŝŶŐƚŚĞŝƌ
ŽƌĂů Žƌ ǁƌŝƩĞŶ ƌĞŐĂƌĚŝŶŐ ŚĂďŝƚƐ ĂŶĚ ĚĞƐĐƌŝďĞŚĂďŝƚƐŝŶŝƚƐĂĸƌŵĂƟǀĞ͕ŶĞŐĂƟǀĞ habits and customs.
customs. ĂŶĚŝŶƚĞƌƌŽŐĂƟǀĞĨŽƌŵƐ͘ Produces texts based on the standard use
hŶĚĞƌƐƚĂŶĚƐƉĂƐƚƚĞŶƐĞƟŵĞĞdžƉƌĞƐƐŝŽŶƐ /Ɛ ĂďůĞ ƚŽ ŝĚĞŶƟĨLJ ĂŶĚ ƚŽ ŝŶƚĞƌƉƌĞƚ ƚŚĞ ŽĨ ƚŚĞ ůĂŶŐƵĂŐĞ ƚĂŬŝŶŐ ŝŶƚŽ ĂĐĐŽƵŶƚ ƚŚĞ
ŝŶŽƌĂůŽƌǁƌŝƩĞŶƚĞdžƚƐ͘ ŵĂŝŶŝĚĞĂĂŶĚƉŽƐƐŝďůĞĚĞǀĞůŽƉŵĞŶƚŽĨĂŶ ŝŶƚĞŶƟŽŶ͕ ĐŽŵŵƵŶŝĐĂƟǀĞ ƐŝƚƵĂƟŽŶ ĂŶĚ
Describes and compares people’s habits ŽƌĂů Žƌ ǁƌŝƩĞŶ ƚĞdžƚ ŝŶ Ă ĨŽƌĞŝŐŶ ůĂŶŐƵĂŐĞ ĨŽƌŵĂůĞůĞŵĞŶƚƐŽĨůĂŶŐƵĂŐĞǁŝƚŚƌĞŐĂƌĚƐ
ĂŶĚĐƵƐƚŽŵƐŝŶƚŚĞŝƌĐŽŵŵƵŶŝƚLJĂƐǁĞůů ŵĂŬŝŶŐ ƵƐĞ ŽĨ ŚŝƐ ͬ ŚĞƌ ďĂĐŬŐƌŽƵŶĚ ƚŽƉƵŶĐƚƵĂƟŽŶ͕ƐƉĞůůŝŶŐ͕ƐLJŶƚĂdž͕ĐŽŚĞƌĞŶĐĞ
ĂƐ ŽƚŚĞƌ ĐƵůƚƵƌĞƐ ŝŶ ŽƌĂů ĂŶĚ ǁƌŝƩĞŶ ŬŶŽǁůĞĚŐĞ ƌĞŐĂƌĚŝŶŐ ůĞŝƐƵƌĞ͕ ƐĐŚŽŽů ĂŶĚ and cohesion.
ůŝŶŐƵŝƐƟĐĨŽƌŵƐ͘ ƐƉŽƌƚ ĂĐƟǀŝƟĞƐ ŚĂǀŝŶŐ ƚĂŬĞŶ ƉůĂĐĞ ŝŶ ƚŚĞ /ĚĞŶƟĮĞƐ ĂŶĚ ŝŶƚĞƌƉƌĞƚƐ ŝŶ Ă ĨŽƌĞŝŐŶ
hƟůŝnjĞƐƚŚĞŐƌĂŵŵĂƟĐĂůƐƚƌƵĐƚƵƌĞ͞ƵƐĞĚ past. language, the main idea and possible
to” to talk about habits and customs in ŽŵŵƵŶŝĐĂƚĞƐ ŝŶ Ă ĨŽƌĞŝŐŶ ůĂŶŐƵĂŐĞ ŽƵƚĐŽŵĞƐŽĨĂŶŽƌĂůŽƌǁƌŝƩĞŶŵĞƐƐĂŐĞ͕ďLJ
the past in diverse social contexts. ƚŚƌŽƵŐŚůŽŐŝĐĂůŽƌĂůĂŶĚǁƌŝƩĞŶĚŝƐĐŽƵƌƐĞ ŵĞĂŶƐŽĨƉƌŝŽƌŬŶŽǁůĞĚŐĞĂŶĚŶŽŶͲǀĞƌďĂů
in order to describe and to compare habits elements in context.
Learning objects ĂŶĚ ĐƵƐƚŽŵƐ ŝŶ ƌĞůĂƟŽŶ ƚŽ ƉĞŽƉůĞ ĨƌŽŵ /Ɛ ƐĞŶƐŝƟǀĞ ĂŶĚ ĐŽŶƐĐŝŽƵƐ ĂďŽƵƚ ƚŚĞ
ƚŚĞŝƌƐŽĐŝĂůĐŽŶƚĞdžƚƐĂƐǁĞůůĂƐĨƌŽŵŽƚŚĞƌ ĐŽŶƐĞƋƵĞŶĐĞƐ ŽĨ ĞŶǀŝƌŽŶŵĞŶƚĂů ŚĂƌŵ
sŽĐĂďƵůĂƌLJ͗ ĐůŽƚŚŝŶŐ͕ ŵĞĂŶƐ ŽĨ cultures. ŝŶ ǁŽƌůĚͲǁŝĚĞ ĂŶĚ ŵƵƚƵĂůůLJ ĚĞƉĞŶĚĞŶƚ
ƚƌĂŶƐƉŽƌƚĂƟŽŶ͕ ĨŽŽĚ͕ ůĞŝƐƵƌĞ ĂĐƟǀŝƟĞƐ͕ Uses independent learning strategies, circumstances.
ƐĐŚŽŽůĂĐƟǀŝƟĞƐĂŶĚƐƉŽƌƚƐĂĐƟǀŝƟĞƐ͘ ŵĂŬŝŶŐ ƵƐĞ ŽĨ ŝŶĨŽƌŵĂƟŽŶ ƚĞĐŚŶŽůŽŐLJ hƐĞƐƚŚĞŝŶĨŽƌŵĂƟŽŶĂŶĚĐŽŵŵƵŶŝĐĂƟŽŶ
'ƌĂŵŵĂƟĐĂůƐƚƌƵĐƚƵƌĞ͞ƵƐĞĚƚŽ͟ƚŽĚĞƐĐƌŝďĞ ĂŶĚ ĐŽŵŵƵŶŝĐĂƟŽŶ ŝŶ ŽƌĚĞƌ ƚŽ ĂƩĂŝŶ technology to search, solve problems,
ƉĂƐƚ ŚĂďŝƚƐ ŝŶ ŝƚƐ ĂĸƌŵĂƟǀĞ͕ ŝŶƚĞƌƌŽŐĂƟǀĞ ŝŶĨŽƌŵĂƟŽŶ ŽŶ ďŽƚŚ ƚŚĞ ŐƌĂŵŵĂƟĐĂů ĐƌĞĂƚĞŵĂƚĞƌŝĂůƐĂŶĚƚŽĐŽŶǀĞLJŝŶĨŽƌŵĂƟŽŶ͘
ĂŶĚŶĞŐĂƟǀĞĨŽƌŵƐ͘ ĨŽƌŵƐŽĨ͞ƵƐĞĚƚŽ͟ĂŶĚůĞdžŝĐĂůĞdžƉƌĞƐƐŝŽŶƐ Produces texts based on the standard
YƵĞƐƟŽŶ ǁŽƌĚƐ͗ ,Žǁ͕ tŚĞŶ͕ tŚĞƌĞ͕ ĨŽƌ ĞdžƉƌĞƐƐŝŶŐ ŚĂďŝƚƐ ĂŶĚ ĐƵƐƚŽŵƐ ŝŶ ƵƐĞ ŽĨ ƚŚĞ ůĂŶŐƵĂŐĞ͕ ƚĂŬŝŶŐ ŝŶƚŽ ĂĐĐŽƵŶƚ
tŚĂƚ͕ĂŶĚtŚŽƚŽŵĂŬĞƋƵĞƐƟŽŶƐ͘ diverse social contexts. ŵĞĂŶŝŶŐ͕ ŝŶƚĞŶƟŽŶ͕ ĐŽŵŵƵŶŝĐĂƟǀĞ
dŝŵĞĞdžƉƌĞƐƐŝŽŶƐĨŽƌƚŚĞƉĂƐƚƚĞŶƐĞ͘ ^ŚŽǁƐ Ă ƌĞƐƉĞĐƞƵů ĂŶĚ ƉŽƐŝƟǀĞ ĂƫƚƵĚĞ ĐŝƌĐƵŵƐƚĂŶĐĞƐ͕ ĂŶĚ ĨŽƌŵĂů ďĂƐŝĐƐ ŽĨ ƚŚĞ
ƚŽǁĂƌĚƐŵƵůƟĐƵůƚƵƌĂůŝƐŵĂŶĚƚŚĞĚŝǀĞƌƐŝƚLJ ůĂŶŐƵĂŐĞ ƐƵĐŚ ĂƐ ƉƵŶĐƚƵĂƟŽŶ͕ ƐƉĞůůŝŶŐ͕
ůůŽƩĞĚƟŵĞ͗ 12 hours. ŽŶďĞůŝĞĨƐ͕ǀĂůƵĞƐ͕ŝĚĞĂƐĂŶĚƐŽĐŝĂůƉƌĂĐƟĐĞƐ coherence and cohesion.
Start Up Activities Didactic Sequence 1
“THOSE GOOD OLD DAYS”

DIAGNOSTIC ACTIVITY

Problems and Solutions

Activity: In teams of four discuss:

<RXDUHWKHPDQDJHPHQWVWDIIRIDODUJHUHVRUWKRWHO/DWHO\\RXKDYHKDGDORWRISUREOHPV<RXPXVWGLVFXVV
WKHVHSUREOHPVZLWKWKHRWKHUPDQDJHUVDQGWKHQFRPHXSZLWKVROXWLRQV

7KHKRWHOLVRQDQLVODQGVXUURXQGHGE\EHDXWLIXOEHDFKHVFRUDOUHHIVDQGPRXQWDLQV,WVHHPVOLNHWKHSHUIHFW
SODFHWRKDYHDKRWHOEXW

Problems:

Complaints
about the food: The hotel is
Theft: There is a Guests are 7KHJXHVWVKDYH Complaints GLI¿FXOWWRJHW
lot of theft at the bored: Guests complained that about the staff: to: There are no
KRWHO6RPHRQH KDYHFRPSODLQHG the food tastes 0DQ\JXHVWV buses coming
is stealing food that there is WHUULEOH7KH\DOVR say that the from the airport to
IURPWKHNLWFKHQ QRWKLQJWRGR complained that staff is rude and WKHKRWHO7KHWD[L
money from There are no the food is the from the airport to
XQKHOSIXO7KH
IURQWGHVNDQG DFWLYLWLHVDWQLJKW VDPHHYHU\QLJKW WKHKRWHOLVYHU\
staff members
VSRUWVHTXLSPHQW In the day, there H[SHQVLYH
6RPHYHJHWDULDQV argue with each
IURPWKHJ\P are few sports and
*XHVWVKDYHDOVR QRWKLQJWRVHH ZHUHYHU\DQJU\ RWKHU6RPHWLPHV
complained that EHFDXVHHYHU\ they swear at the
somebody stole GLQQHUKDVPHDW PDQDJHUV
WKHLUZDOOHWV

58 58
58
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Problem:

Possible Solutions: Management Recommendation:

<RXFDQXVHWKHIROORZLQJYRFDEXODU\LWHPVWRVWDUWWKHGLDORJXH

Solutions:
Problems:
One solution is to . . . (verb)
One problem is that . . .
We could . . . (verb)
(sentence)
I think we should . . . (verb)
One problem is . . . (noun)
I recommend that . . . (verb)

Agreeing: Disagreeing :
I think it’s a good idea. It’s a good idea but ___________
I agree with _______. I disagree with ______ because
I am for __________. I am against it because ________
The problem with that is . . .

59 59
59
BLOCK 2 Memorable days
Sample Dialogue:

Manager 1: 7KDQN \RX IRU Manager 2: 2QHSUREOHPLVWKHIW


FRPLQJ , ZLVK WR GLVFXVV WKH Somebody is stealing money from
SUREOHPV WKDW ZH KDYH EHHQ WKH IURQW GHVN DQG IRRG IURP WKH
KDYLQJ UHFHQWO\ $QG WKHQ LI NLWFKHQ $V ZHOO VRPHERG\ LV
anybody has some ideas, please going into the guest rooms and
VKDUHWKHP VWHDOLQJWKHLUOXJJDJH

Manager 3: One solution is


WR FKDQJH WKH ORFNV  ,I ZH Manager 4: ,GLVDJUHH7KHSUREOHP
do that the thief won’t be ZLWK WKDW LV WKDW ZH DOUHDG\ KDYH
DEOHWRJHWLQ ORFNV DQG WKH WKLHI FDQ JHW LQWR WKH
URRPV(YHQLIZHFKDQJHWKHORFNV
ZHPD\VWLOOKDYHSUREOHPV

Manager 2: :H FRXOG KLUH D


VHFXULW\ JXDUG IRU HDFK ÀRRU
7KHQ ZH ZRXOG KDYH QR
Manager 4: ,WKLQN
SUREOHPV
WKDW¶VDJRRGLGHD

Manager 3: That’s a good idea,


EXW VHFXULW\ JXDUGV DUH YHU\
H[SHQVLYH:HFDQ¶WDIIRUGRQH Manager 1: I agree
VHFXULW\ JXDUG RQ HDFK ÀRRU ZLWKLQVWDOOLQJFDPHUDV
, WKLQN ZH VKRXOG KLUH D IHZ ,W¶OOEHDORWFKHDSHU
security guards and install some
YLGHRFDPHUDV

Manager 3: *RRG 7KHQ


Manager 2: I am for why don’t we recommend
installing cameras installing cameras and hiring
WRR DIHZVHFXULW\JXDUGV

60 60
60
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Development Activities

ACTIVITY 1
6'%

1. Transportation

D  /LVWHQ DQG UHDG LQ WKH OLQN EHORZ DERXW WKH KLVWRU\ RI WUDQVSRUWDWLRQ 7U\ WR GLVFRYHU WKH PHDQLQJ RI WKH
XQGHUOLQHZRUGV8VH\RXUGLFWLRQDU\

The History of Transportation


7DNHQIURPKWWSLQYHQWRUVDERXWFRPOLEUDU\LQYHQWRUVEOBKLVWRU\BRIBWUDQVSRUWDWLRQKWP

Fixed wheels on cartsDUHLQYHQWHGWKH¿UVWZKHHOHGYHKLFOHVLQKLVWRU\2WKHUHDUO\ZKHHOHG


3500 BC
YHKLFOHVLQFOXGHWKHFKDULRW
3500 BC 5LYHUERDWVDUHLQYHQWHGVKLSVZLWKRDUV
2000 BC HorsesDUHGRPHVWLFDWHGDQGXVHGIRUWUDQVSRUWDWLRQ
181-234 The wheelbarrowLVLQYHQWHG
770 Iron horseshoesLPSURYHWUDQVSRUWDWLRQE\KRUVH
Leonardo da Vinci¿UVWWRVHULRXVO\WKHRUL]HDERXWÀ\LQJPDFKLQHVZLWKRYHUGUDZLQJV
1492
WKDWLOOXVWUDWHGKLVWKHRULHVRQÀLJKW
1620 &RUQHOLV'UHEEHOLQYHQWHGWKH¿UVWsubmarineDKXPDQRDUHGVXEPHUVLEOH
Blaise Pascal LQYHQWV WKH ¿UVW public bus - horse-drawn, regular route, schedule, and fare
1662
V\VWHP
1740 -DFTXHVGH9DXFDQVRQGHPRQVWUDWHVKLVFORFNZRUNSRZHUHGFDUULDJH
First practical steamboatGHPRQVWUDWHGE\0DUTXLV&ODXGH)UDQFRLVGH-RXIIUR\G
$EEDQVD
1783
SDGGOHZKHHOVWHDPERDW
1783 7KH0RQWJRO¿HUEURWKHUVLQYHQWWKH¿UVWhot air balloons
1787 SteamboatLQYHQWHG
1769 First self-propelled URDGYHKLFOHLQYHQWHGE\1LFRODV-RVHSK&XJQRW
1790 0RGHUQbicyclesLQYHQWHG

61 61
61
BLOCK 2 Memorable days
 5LFKDUG7UHYLWKLFNLQYHQWHGWKH¿UVWVWHDPSRZHUHGORFRPRWLYH GHVLJQHGIRUURDGV 
,VDDFGH5LYDVPDNHVDK\GURJHQJDVSRZHUHGYHKLFOH¿UVWZLWKLQWHUQDOFRPEXVWLRQSRZHU

KRZHYHUYHU\XQVXFFHVVIXOGHVLJQ
 )LUVWVWHDPERDWZLWKUHJXODUSDVVHQJHUVHUYLFHLQYHQWRU5REHUW)XOWRQ
V&OHUPRQW

 George StephensonLQYHQWVWKH¿UVWSUDFWLFDOVWHDPSRZHUHGUDLOURDGORFRPRWLYH

 -HDQ/HQRLUPDNHVDJDVROLQHHQJLQHDXWRPRELOH

 First motorcycleLQYHQWHG


*HRUJH:HVWLQJKRXVHLQYHQWVWKHFRPSUHVVHGDLUORFRPRWLYHEUDNHHQDEOHGWUDLQVWREH

VWRSSHGZLWKIDLOVDIHDFFXUDF\
 First cable carLQYHQWHG
.DUO%HQ]EXLOGVWKHZRUOG
V¿UVWSUDFWLFDODXWRPRELOHWREHSRZHUHGE\DQLQWHUQDO

FRPEXVWLRQHQJLQH
 )HUGLQDQGYRQ=HSSHOLQLQYHQWVWKH¿UVWVXFFHVVIXOGLULJLEOHWKH=HSSHOLQ

1903 The :ULJKW%URWKHUVLQYHQWDQGÀ\WKH¿UVWHQJLQHairplane

1907 9HU\¿UVWhelicopterXQVXFFHVVIXOGHVLJQ

 Henry FordLPSURYHVWKHDVVHPEO\OLQHIRUDXWRPRELOHPDQXIDFWXULQJ


Hydrofoil boatsFRLQYHQWHGE\Alexander Graham Bell &DVH\%DOGZLQERDWVWKDW

VNLPPHGZDWHU
 First OLTXLGSURSHOOHGURFNHWODXQFKHG

1940 0RGHUQhelicoptersLQYHQWHG

1947 First VXSHUVRQLFMHWÀLJKW

1956 +RYHUFUDIWLQYHQWHG

1964 Bullet trainWUDQVSRUWDWLRQLQYHQWHG

1969 )LUVWPDQQHGPLVVLRQ Apollo WRWKH0RRQ

1970 First MXPERMHW

 Space shuttleODXQFKHG

62 62
62
Colegio de Bachilleres del Estado de Sonora
Inglés 3

E 0DWFKWKHPHDQVRIWUDQVSRUWDWLRQ

 :KHHOVRQFDUWV  6XEPDULQH  +RUVHV  +RYHUFUDIW

 5LYHUERDWV  +HOLFRSWHU  %XV  6WHDPSRZHUHG


ORFRPRWLYH
 %XOOHWWUDLQ  6WHDPERDW  $LUSODQH  *DVSRZHUHG
YHKLFOHV
 :KHHOEDUURZ  +RWDLUEDOORRQV  %LF\FOH  0RWRUF\FOH

12.

6.

13.
1.

7.

14.

2.

8.
15.

3.

9.
16.

4.
10.

5. 11.

63 63
63
BLOCK 2 Memorable days
$&7,9,7<
6'%

2. Fashion throughout the years.

D 7HDPZRUN,QWHDPVRIIRXUVHDUFKKRZSHRSOHGUHVVHGWKURXJKWKH\HDUV&UHDWHDWLPHOLQHDQGSUHVHQWLWWR
FODVV6HHUXEULFVIRUWLPHOLQHSUHVHQWDWLRQ

([DPSOHRIKRZSHRSOHGUHVVHGWKURXJKWKH\HDUV

Example:
In the 1900’s women dressed with long and beautiful dresses and a big hat. Men…
In the 1920’s…

+HUHLVDQH[DPSOHRIDWLPHOLQH

1900´s 1920´s 1930´s ... Present


day

In the 1900’s In the 1920’s


women women...
dressed with Men...
long and
beautiful
dresses and
a big hat.
Men…

64 64
64
Colegio de Bachilleres del Estado de Sonora
Inglés 3

ACTIVITY 3
6'%

3. Food
D /LVWHQDQGUHDGLQWKHOLQNEHORZDERXWSRSXODU$PHULFDQIRRGVWKURXJKWKHGHFDGHV8VH\RXUGLFWLRQDU\IRU
QHZYRFDEXODU\

Popular American Foods through the Decades


KKANS
7DNHQIURPKWWSIRRGVDFURVVWKHGHFDGHVZHHEO\FRPLQGH[KWPO

1920’s

,QWKHHDUO\
VIRRGTXDQWLWLHVZHUHODUJHZKLFKPDGHIRRGFKHDSHUWREX\DQGHDVLHUWRJHWDKROGRI
)RRGVVWDUWHGWRFRPHLQ3UH3DFNDJHGRU5HDG\7R*R3UH3DFNDJHGIRRGRU5HDG\7R*RIRRGVDYHG
XSWRKRXUVRIFRRNLQJIRUWKHDYHUDJHKRXVHZLIHHYHU\ZHHNLQWKHNLWFKHQ,QZKHQWKH*UHDW
'HSUHVVLRQKLWIRRGEHFDPHPRUHH[SHQVLYHDQGKDUGHUIRUDPDMRULW\RISHRSOHWRJHWDKROGRI0HDWSULFHV
VN\URFNHWHG$VDUHSODFHPHQWWREHHIRUFKLFNHQSHRSOHZRXOGNLOOUDEELWVDQGPDNHUHFLSHVZLWKUDEELW

PHDW7KLVZDVDPXFKFKHDSHUDOWHUQDWLYHIRUWKHVHPHDWV
Foods Introduced in the 1920’s
±<RR+RR&KRFRODWH0LON&XEH6WHDN
±=XFFKLQL
±*XPP\%HDUV*LUO6FRXW&RRNLHV
±)UR]HQ)RRGV
±.RRO$LG

65 65
65
BLOCK 2 Memorable days
±7ZL]]OHUV
1930’s

,QWKH
VIRRGVWDUWHGWREHFRPHDELWHDVLHU ±&DQQHG6RGD
WRPDNH:LWKWKLQJVOLNHELVFXLWPL[DQGGU\VRXS 1940’s
PL[ SHRSOH KDG OHVV ZRUN FXW RXW IRU WKHP WR
PDNHDPHDO,QDGGLWLRQWRWKDWWKHUHVWDUWHGWR
EHPRUHSURFHVVHGIRRGVOLNHFKLSVDQGSUHW]HOV
7KHUHZDVDPXFKOHVVQHHGWRGRDORWRIZRUNE\
\RXUVHOIDQGIRRGVWDUWHGWREHFRPHOHVVKHDOWK\
:KHQ7ZLQNLHVFDPHRXWLQWKH\FRVWRQO\
FHQWVIRUWZRRIWKHVHSDVWULHV:KHQ-LII\%LVFXLW
0L[ ZDV ¿UVW PDGH LW ZDV RQO\  FHQWV D ER[
7RGD\ WKH YHU\ VDPH ELVFXLW PL[ LV  GROODUV ,Q
&KDUOHV%LUGVH\HVWDUWHGGHHSIUHH]LQJIRRG ,Q WKH 
V IRRG EHJDQ WR EH HYHQ PRUH
and that resulted in his own company forming in processed and easier for people to use without
,WZDVQDPHG%LUGVH\H6HDIRRGV,QF%\ DV PXFK HIIRUW :RPHQ GLGQ
W KDYH WR PDNH DOO
 %LUGVH\H ZDV VHOOLQJ  GLIIHUHQW IUR]HQ WKHFDNHVDQGLFLQJVIURPVFUDWFKDQ\PRUHVLQFH
YHJHWDEOHV IUXLWV ¿VK DQG PHDWV 7KLV KHOSHG FDNHPL[DQGFDQQHGIURVWLQJVVWDUWHGWREHDELJ
SURPRWHWKHUHIULJHUDWRUWKDWKDGFDPHRXWLQ WKLQJ7KHUHDOVRVWDUWHGWREHPRUHIUR]HQIRRGV
DQGSHRSOHVWDUWHGEX\LQJPRUHIUR]HQIRRGV VXFK DV RUDQJH MXLFH DQG )UHQFK IULHV 7KHVH
IRRGVPDGHFRRNLQJSURFHVVHVHDVLHUDQGTXLFNHU
Foods introduced in the 1930’s &DQG\DOVRPXFKFKHDSHULQWKH
VHYHQWKRXJK
±-LII\%LVFXLW0L[+HLQ].HWFKXS6OLFHG WKH\WRRNPXFKORQJHUWRPDNH:KHQLQWURGXFHG
%UHDG'U\6RXS0L[&KHHVH3XIIV DEDJRI0 0
VFRVWRQO\FHQWV
1931 – Tacos
±)ULWRV Foods Introduced in the 1940’s
±7ZLQNLHV&KRFRODWH&RYHUHG3UHW]HOV ±<RUN3HSSHUPLQW3DWWLHV
1934 – Hawaiian Punch ±0 0
V&KHHULRV &KHHULRDWV
±&RUQ'RJV
±)UR]HQ2UDQJH-XLFH1XWHOOD
±&DNH0L[
±)UR]HQ)UHQFK)ULHV&DQQHG)URVWLQJV
±6HHGOHVV:DWHUPHORQ-ROO\5DQFKHUV

66 66
66
Colegio de Bachilleres del Estado de Sonora
Inglés 3

,QVWDQW3XGGLQJ
1950’s ±,QVWDQW5DPRQ1RRGOHV
1960’s

'XULQJ WKH 


V WKH QXPEHU RI IDVW IRRG
FKDLQVLQWKHFRXQWU\VWDUWHGWRJURZ2QHRIWKH 7KH 
V ZDV D GHFDGH RI FRPSOLFDWHG IRRG
PRVW IDPRXV UHVWDXUDQW FKDLQV ZDV 0F'RQDOGV ZLWK )UHQFK LQÀXHQFH EDFN\DUG EDUEHFXHV 
(YHU\ WLPH \RX ZHUH WR JHW RII WKH LQWHUVWDWH YHJHWDULDQ FXULRVLW\ DQG HWKQLF IRRG IURP RWKHU
WKHUH ZDV D 0F'RQDOGV .)& RSHQHG LQ  FRXQWULHV%DE\ERRPHUNLGIDYRULWHVZHUHYHU\
,QWKH¿UVW%XUJHU.LQJ0F'RQDOGVVWDUWHG SRSXODULQWKLVWLPH$QRWKHUZRUGIRUMXQNIRRG
WRVSUHDGDWWKLVWLPHWRR,QWKH,QWHUVWDWH This type of food was meant to appeal to the many
Highway System opened up more to the places NLGV WKDW QRZ URDPHG WKH VWUHHWV 7KH\ PDLQO\
WKDWFKDQJHG$PHULFD6KRSSLQJPDOOVIDVWIRRG FRQVLVWHGRIVXJDU\GULQNVDQGFKHPLFDOO\FUHDWHG
DQG GULYHLQ HYHU\WKLQJ WKH ,QWHUVWDWH +LJKZD\ IRRG 7KLV KHOSHG PDQ\ SHRSOH EHFDXVH LW ZDV
System shaped much of American life as we TXLFN DQG HDV\ ,Q DGGLWLRQ WR WKDW LW SUHYHQWHG
NQRZ LW 3HRSOH RSWHG WR EX\ IDVW IRRG RQ WKH VSHQGLQJDORWRIWLPHLQWKHNLWFKHQ.LGVDOVRJRW
URDGDVLWZDVDTXLFNVWRSIRUEUHDNIDVWOXQFKRU DORWRIRSWLRQVWRFKRRVHIURP
GLQQHU1RZLQ$PHULFDHYHU\ZKHUH\RXJR\RX
DUHPRVWOLNHO\WRVHHDIDVWIRRGUHVWDXUDQWRQWKH Foods Introduced in the 1960’s
VLGHRIWKHURDG 1960 – Brown Rice
1961 – Life Cereal
Foods Introduced in the 1950’s ±,QVWDQW0DVKHG3RWDWRHV
±$PHULFDQ7H[0H[)UR]HQ3L]]D 1963 – Round Sandwich Bread, Brown and
±&KLFNHQIXUWHUV 6HUYH%DFRQ
±'LHW6RGD'XQFDQ+LQHV&DNH0L[ ±3RS7DUWV%XIIDOR&KLFNHQ:LQJV
±0DUVKPDOORZ3HHSV &KLFNHQ6DQGZLFK
1954 – Ranch Dressing 1965 – Gatorade, Slurpees
1955 – Frozen Pizza

Homework 1: Go to page 79

67 67
67
BLOCK 2 Memorable days
Start Up Activities Didactic Sequence 2
“I USED TO PLAY KICKBALL”

ACTIVITY 4
6'%

D $VNDQGDQVZHU$VN\RXUSDUWQHUDERXWZKDWVSRUWVRUOHLVXUHDFWLYLWLHVKHRUVKHXVHGWRGRLQKLVRUKHU
FKLOGKRRG0DNHDOLVWRI\RXUDFWLYLWLHVLQWKHIROORZLQJFKDUWEHORZ

(;$03/(
678'(17%,used to play “hide
n’seek´ZLWKWKHNLGVRQP\EORFN,W
ZDVDORWRIIXQ
678'(17$:KDW
games did you use to
play when you were a
FKLOG"

678'(17$Did you
use to play any board
JDPHV"

678'(17%,UHPHPEHU,used to enjoy
playing “Sorry” and “Monopoly” with my
IDPLO\ DQG  IULHQGV$QG ZKDW DERXW \RX"
:KDWdid you use to play when you were
\RXQJHU"

678'(17$
I used to«

68 68
68
Colegio de Bachilleres del Estado de Sonora
Inglés 3

ME MY PARTNER

3OD\6RUU\DQG0RQRSRO\

69 69
69
BLOCK 2 Memorable days
E 5HDGWKHWH[W7KHQDQVZHUWKHTXHVWLRQV

ELVIS PRESLEY

7DNHQDQGDGDSWHGIURPhttp://en.wikipedia.org/wiki/Elvis_Presley

(OYLV$DURQ 3UHVOH\ -DQXDU\   ±$XJXVW    ZDV DQ$PHULFDQ VLQJHU PXVLFLDQ DQG DFWRU
5HJDUGHGDVRQHRIWKHPRVWVLJQL¿FDQWcultural iconsRIWKHWKFHQWXU\KHLVRIWHQUHIHUUHGWRDVWKH.LQJ
RI5RFNDQG5ROORUVLPSO\WKH.LQJ

Presley is one of the most celebrated musicians


RIWKHWKFHQWXU\&RPPHUFLDOO\VXFFHVVIXOLQ
many genres, including pop, blues and gospel,
he is the best-selling solo artist in the history
of recorded music, with estimated album sales
RI DURXQG  PLOOLRQ XQLWV ZRUOGZLGH He was
nominated for 14 Grammys and won three,
UHFHLYLQJ WKH *UDPP\ /LIHWLPH $FKLHYHPHQW
Award at age 36, and has been inducted into
multiple music halls of fame

Presley's birthplace in Tupelo, Mississippi


(OYLV 3UHVOH\ ZDV ERUQ RQ -DQXDU\  
LQ 7XSHOR 0LVVLVVLSSL WKH VRQ RI 9HUQRQ
(OYLV 3UHVOH\ ±  DQG *ODG\V /RYH
3UHVOH\ QpH 6PLWK ±  LQ WKH WZR
URRP VKRWJXQ KRXVH EXLOW E\ 9HUQRQ
V IDWKHU
LQSUHSDUDWLRQIRUWKHFKLOG
VELUWK-HVVH*DURQ
3UHVOH\KLVLGHQWLFDOWZLQEURWKHUZDVGHOLYHUHG
VWLOOERUQ  PLQXWHV EHIRUH KLP $V DQ RQO\
child, Presley became close to both parents and
IRUPHGDQXQXVXDOO\FORVHERQGZLWKKLVPRWKHU
The family attended an Assembly of God church,
ZKHUHKHIRXQGKLVLQLWLDOPXVLFDOLQVSLUDWLRQ

70 70
70
Colegio de Bachilleres del Estado de Sonora
Inglés 3

,Q 6HSWHPEHU  3UHVOH\ HQWHUHG ¿UVW JUDGH DW (DVW 7XSHOR &RQVROLGDWHG
ZKHUH KLV LQVWUXFWRUV UHJDUGHG KLP DV DYHUDJH +H ZDV HQFRXUDJHG WR HQWHU
a singing contest after impressing his schoolteacher with a rendition of Red
)ROH\
VFRXQWU\VRQJ2OG6KHHSGXULQJPRUQLQJSUD\HUV7KHFRQWHVWKHOGDW
WKH0LVVLVVLSSL$ODEDPD)DLUDQG'DLU\6KRZRQ2FWREHUZDVKLV¿UVW
SXEOLF SHUIRUPDQFH GUHVVHG DV D FRZER\ WKH WHQ\HDUROG 3UHVOH\ VWRRG RQ D
FKDLU WR UHDFK WKH PLFURSKRQH DQG VDQJ 2OG 6KHS +H UHFDOOHG SODFLQJ ¿IWK
$ IHZ PRQWKV ODWHU 3UHVOH\ UHFHLYHG KLV ¿UVW JXLWDU IRU KLV ELUWKGD\ KH KDG
KRSHGIRUVRPHWKLQJHOVH²E\GLIIHUHQWDFFRXQWVHLWKHUDELF\FOHRUDULÀH2YHU
WKHIROORZLQJ\HDUKHUHFHLYHGEDVLFJXLWDUOHVVRQVIURPWZRRIKLVXQFOHVDQG
WKHQHZSDVWRUDWWKHIDPLO\
VFKXUFK3UHVOH\UHFDOOHG,WRRNWKHJXLWDUDQG,
ZDWFKHGSHRSOHDQG,OHDUQHGWRSOD\DOLWWOHELW%XW,ZRXOGQHYHUVLQJLQSXEOLF
,ZDVYHU\VK\DERXWLW´

Teenage life in Memphis


,Q1RYHPEHUWKHIDPLO\PRYHGWR0HPSKLV7HQQHVVHH$IWHUUHVLGLQJIRU
nearly a year in rooming houses, they were granted a two-bedroom apartment
LQWKHSXEOLFKRXVLQJFRPSOH[NQRZQDVWKH/DXGHUGDOH&RXUWV(QUROOHGDW
/&+XPHV+LJK6FKRRO3UHVOH\UHFHLYHGRQO\D&LQPXVLFLQHLJKWKJUDGH
:KHQKLVPXVLFWHDFKHUWROGKLPKHKDGQRDSWLWXGHIRUVLQJLQJKHEURXJKWLQ
KLVJXLWDUWKHQH[WGD\DQGVDQJDUHFHQWKLW.HHS7KHP&ROG,F\)LQJHUV2II
0HLQDQHIIRUWWRSURYHRWKHUZLVH$FODVVPDWHODWHUUHFDOOHGWKDWWKHWHDFKHU
DJUHHGWKDW(OYLVZDVULJKWZKHQKHVDLGWKDWVKHGLGQ
WDSSUHFLDWHKLVNLQG
RIVLQJLQJ+HZDVXVXDOO\WRRVK\WRSHUIRUPRSHQO\DQGZDVRFFDVLRQDOO\
EXOOLHGE\FODVVPDWHVZKRYLHZHGKLPDVDPDPD
VER\

:KRZDV(OYLV3UHVOH\DQGZKHQZDVKHERUQ"
_________________________________________________

:KDWKDSSHQHGRQ2FWREHU"
_________________________________________________

 'LG (OYLV 3UHVOH\ XVH WR UHFHLYH JXLWDU OHVVRQV LQ KLV
FKLOGKRRG"
_________________________________________________

'R\RXWKLQN(OYLV3UHVOH\XVHGWREHVK\ZKHQKHZDVD
FKLOG"
3UHVOH\ ZKR QHYHU UHFHLYHG IRUPDO
_________________________________________________
music training or learned to read
PXVLFVWXGLHGDQGSOD\HGE\HDU+H
:KHUHGLG(OYLV3UHVOH\RIWHQJRGXULQJKLVWHHQDJHOLIH"
DOVRXVHGWRJRYHU\RIWHQWRUHFRUG
_________________________________________________
VWRUHV ZLWK MXNHER[HV DQG OLVWHQLQJ
ERRWKV

71 71
71
BLOCK 2 Memorable days
Pronunciation used to ‫ޖ‬MX‫ޝ‬VWWX‫ޝ‬

F 5HDGDQGREVHUYHKRZWKHIRUPVRIXVHGWRLQWKHH[DPSOHVDUHSURQRXQFHG

Did you use toZDONWRVFKRROZKHQ\RXZHUHLQHOHPHQWDU\VFKRRO"1RP\SDUHQWVused toGULYH


PHWRVFKRRO

:KDWVRQJVGLG\RXuse toOLVWHQWRZKHQ\RXZHUHLQMXQLRUKLJK",used toOLVWHQWR(OYLV3UHVOH\


DQGWKH%HDWOHV

:KLFKSURQXQFLDWLRQGLG\RXKHDULQERWKH[DPSOHV"&LUFOHWKHDQVZHU

$\RRVWRR%\RR]GWRR

Now practice pronouncing “used to´E\VD\LQJWKHTXHVWLRQVDQGDQVZHUVDORXGLQDFWLYLW\ F 

Homework 2: Go to page 80

Grammar reference
Used to

:HXVHused to,WRWDONDERXWSDVWKDELWVDQGURXWLQHV([DPSOH

• I used to play tennis, when I was in elementary school.

• I didn’t use to eat vegetables. Now I do.

G /RRNDWWKHH[DPSOHVH[SODLQWKHGLIIHUHQFHEHWZHHQVHQWHQFHDQG:ULWHLWGRZQ
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
_________________________________________________________________________________________
_________________________________________________________________________________________
_________________________________________________________________________

72 72
72
Colegio de Bachilleres del Estado de Sonora
Inglés 3

H /RRNDWWKHIROORZLQJSLFWXUHV&LUFOHWKHDFWLYLWLHVWKDW\RXused to doZKHQ\RXZHUHDFKLOG&RPSDUH
ZLWK\RXUSDUWQHU

I :ULWHGRZQWKHDFWLYLWLHVWKDWKHRUVKHXVHGWRGR:KLFKDFWLYLWLHVDUHWKHVDPH"
__________________________________________________________________________________________
__________________________________________________________________________________________
_________________________________________________________________________________________
__________________________________________________________________________________________
_________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
_______________________________________________________________________

J 7KLQNRIthreePRUHDFWLYLWLHV\RXused toGR:ULWHWKHPGRZQ
__________________________________________________________________________________________
__________________________________________________________________________________________
_________________________________________________________________________________________
__________________________________________________________________________________________
_________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
_______________________________________________________________________

73 73
73
BLOCK 2 Memorable days
Track #7

K /LVWHQDQGUHDGWKHIROORZLQJFRQYHUVDWLRQEHWZHHQ$QD)HUQDQGDDQG6DQWLDJR

Ana Fernanda: Hi Santiago, How are you?

Santiago: Fine, and you?

Ana Fernanda: I’m O.K. I have a lot of


homework. I need to interview someone’s
childhood. Do you want to help me?

Santiago: Sure! What do I need to do?

Ana Fernanda: I’ll ask you some questions,


and you’ll answer them.

Santiago: Ok.

Ana Fernanda: Santiago, What did you use to


play when you were a child?

Santiago: mmmm, I used to play hide and seek


a lot! I think that was my favorite game.

Ana Fernanda: Oh really? Who did you use to


play hide and seek with?

Santiago: With my brother and sister, and some


cousins.

Ana Fernanda: That’s nice. What sports did


you use to play when you were in elementary?

Santiago: I used to play baseball. I was in


ITSON’s baseball team.

Ana Fernanda: Oh, really? Did your team use


to win?

Santiago: Oh yes! We won three times in a row!

Ana Fernanda: That’s awesome, so…

74 74
74
Colegio de Bachilleres del Estado de Sonora
Inglés 3

L &RPSOHWHWKHIROORZLQJFKDUW:ULWHGRZQDWOHDVWWZRDFWLYLWLHVLQHDFKFROXPQ&RPSDUHZLWK\RXUSDUWQHUV

:KDW,XVHGWRGRDQGQRZ, :KDW,XVHGWRGRDQG,VWLOO :KDW,GLGQ¶WXVHGWRGRDQG


GRQ¶W GR QRZ,GR

Grammar reference
Used do

:HXVHdidpersonal pronoun / noun phrase use toverbcomplementWRDVNTXHVWLRQVDERXWSDVW


KDELWVDQGURXWLQHV([DPSOHV

Did you use to play football when you were a child?

Did you use to watch cartoons?


1RWHZHFDQXVHZKTXHVWLRQZRUGV+RZZKHQZKHUHZK\ZKDWZKRWRDVNDVSHFL¿FTXHVWLRQ
([DPSOHV

When did you use to play football?

What cartoons did you use to watch when you were a child?

75 75
75
BLOCK 2 Memorable days
M :KDWDUHWKHLUPHDQLQJVRIWKHVHTXHVWLRQZRUGVLQ\RXUODQJXDJH"

+RZBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

:KHQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

:KHUHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

:K\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

:KDWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

:KRBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

N 3UDFWLFHPDNLQJTXHVWLRQVZLWKDSDUWQHU,QFOXGHWKHLQIRUPDWLRQ
LQDFWLYLW\ L DQGTXHVWLRQZRUGVLQDFWLYLW\ M IRU\RXUFRQYHUVDWLRQV

Example:

678'(17$What games 678'(17%I used to play chess


did you use to play when and kick ball during recess period.
you were in secondary And you? What games did you use
school? to play?

678'(17$
I used to…….

76 76
76
Colegio de Bachilleres del Estado de Sonora
Inglés 3

INTEGRATING ACTIVITY

TEAM PRESENTATION
\RX D \HDU
Instructions  7KH WHDFKHU ZLOO DVVLJQ
VWLJDWH ZKDW
H[DPSOH ¶V ,Q WHDPV RI IRXU LQYH
ZRUH PHQ
SHRSOH XVHG WR HDW LQ V ZKDW SHRSOH
DQVSRUWDWLRQ
DQGZRPHQ WKHPRVWSRSXODUPHDQVRIWU
XUHDFWLYLW\
DQGZKDWWKH\XVHGWRGRDVDVSRUWRUOHLV
JUHDOLD
3UHVHQWLWWRWKHFODVV\RXDUHDOORZHGWREULQ

77 77
77
BLOCK 2 Memorable days
5(9,(:

Complete the text with the appropriate form


of “used to” and the verbs in parenthesis.

7DONLQJ ZLWK P\ FODVVPDWHV DQG WHDFKHU


I learned something about the science
FODVVHV WKDW WKH VWXGHQWV LQ MXQLRU KLJK
BBBBBBBBBBBBBBB KDYH  ,Q WKRVH GD\V
RI WKH GHFDGH RI WKH VHYHQWLHV WKH VWXGHQWV
BBBBBBBBBBBBBBB GLVVHFW  IURJV GXULQJ WKH
FODVVVHVVLRQ7KHWHDFKHUBBBBBBBBBBBBBBB
SURYLGH  HDFK VWXGHQW ZLWK D OLYH IURJ 7KH
VWXGHQWV BBBBBBBBBBBBBBB SXW  WKH IURJV WR
VOHHS:KHQWKHIURJVZHUHDVOHHSWKHVWXGHQWV
ZRXOGEHJLQWKHGLVVHFWLRQ,WZDVKRUULEOH

,Q WKRVH GD\V SHRSOH BBBBBBBBBBBBBBB QRW  WKLQN  WKDW WKHVH NLQG RI H[SHULPHQWV ZHUH WHUULEOH DQG PDQ\
VFKRROVBBBBBBBBBBBBBBB QRWKDYH FRPSXWHUV
6FKRROVBBBBBBBBBBBBBBB EH YHU\GLIIHUHQWIURPVFKRROVWRGD\EXW,WKLQNWKDWWKLVZDVFUXHODQGXQIDLUWR
DQLPDOV)RUWXQDWHO\WKLQJVDUHYHU\GLIIHUHQWQRZDQGWKHXVHRIFRPSXWHUVPDNHVWKHVHGLVVHFWLRQVXQQHFHVVDU\

78 78
78
Colegio de Bachilleres del Estado de Sonora
Inglés 3

HOMEWORK 1 Didactic Sequence 1. Those Good Old Days.

'R\RXNQRZKRZ&RFD&RODODEHOVFKDQJHGWKURXJKWKH\HDUV"'RVRPHUHVHDUFKWR¿QGRXWKRZLWFKDQJHG
DQGGUDZWKHGLIIHUHQWODEHOVRQWKLVSDJH<RXFDQSULQWWKHLPDJHVDQGJOXHWKHPLI\RXZLVK

,QWHDPVRIIRXUFUHDWHDWLPHOLQHRIKRZ0H[LFDQIRRGKDVFKDQJHGWKURXJKRXWWKH\HDUV/RRNEDFNDWWKH
WLPHOLQHLQ³$PHULFDQIRRGVWKURXJKWKHGHFDGHV´3UHVHQWLWWRFODVV6HHUXEULFVIRUWLPHOLQHSUHVHQWDWLRQ

79 79
79
BLOCK 2 Memorable days
HOMEWORK 2 Didactic Sequence 2. I Used to Play Kickball.

'RUHVHDUFKRQZKDW\RXUIDYRULWHDUWLVWused to doLQKLVRUKHUFKLOGKRRG:ULWHLWGRZQ6HHUXEULFVIRU
ZULWLQJ

,QSDLUVFUHDWHDGLDORJXHOLNHWKHRQHLQH[HUFLVHK 5HFRUG\RXULQWHUYLHZ3UHVHQWLWWRFODVV

80 80
80
Colegio de Bachilleres del Estado de Sonora
Inglés 3

6(/)&+(&.

&KRRVHWKHDSSURSULDWHPHDQLQJRI³used to´DFFRUGLQJWRWKHVLWXDWLRQLQWKHVHQWHQFH

I used to eatDORWRI³VQLFNHUV´FKRFRODWHEDUV

D 7RVWRSHDWLQJWKHFDQG\ZDVQRWHDV\
E ,XVXDOO\HDWDERXWWZRFKRFRODWHEDUVDGD\

/RRNDWWKHSLFWXUHVDQGVROYHWKHZRUGVHDUFK

81 81
81
BLOCK 2 Memorable days
&RPSOHWHWKHTXHVWLRQVZLWKWKHZRUGVLQWKHER[7KHQDQVZHUWKHTXHVWLRQV

:KHQ:KDW'LG:K\:KHUH:KR+RZ [ 

BBBBBBBBB\RXXVHWRSOD\PDUEOHVZKHQ\RXZHUH\RXQJHU"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBERDUGJDPHVGLG\RXXVHWRSOD\"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBGLG\RXUJUDQGSDUHQWVXVHWROLYHZKHQWKH\ZHUHFKLOGUHQ"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBWDXJKW\RXWRULGHDELF\FOH"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBROGZHUH\RXZKHQ\RX¿UVWVWDUWHGVFKRRO"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBGLG\RXFKRRVHWRVWXG\DW&REDFKSUHSD"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBGLG\RXXVHWRJRVHFRQGDU\VFKRRO"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
$QGQRZBBBBBBBBBGR\RXFRPHWRVFKRRO"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBGLG\RXUSDUHQWVJHWWKHLU¿UVWMRE"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

 &RPSOHWH WKH VHQWHQFHV ZLWK WKH DI¿UPDWLYH QHJDWLYH RU LQWHUURJDWLYH IRUP RI ³XVHG WR´ DQG WKH YHUE LQ
SDUHQWKHVLV
 :KHQZHZHUHFKLOGUHQZHDOZD\VBBBBBBBBBBBBBBBBB SOD\ ´PRQRSRO\´DQG³VRUU\´ERDUGJDPHV
LQWKHDIWHUQRRQ
 0\PRPDQGGDGBBBBBBBBBBBBBBBBBBBBB FRPH WRSOD\ZLWKXVLQWKHSDUNEHFDXVHWKH\ZHUHDW
ZRUN
 BBBBBBBBBB\RXBBBBBBBBBBBBBBB ZHDU DVFKRROXQLIRUPZKHQ\RXZHUHLQVHFRQGDU\VFKRRO"
 ,BBBBBBBBBBBBBBBBBBB ZDON WRVFKRROZKHQ,ZDV\RXQJHUEHFDXVH,ZDVDOZD\VWRRWLUHGWRZDON

82 82
82
Colegio de Bachilleres del Estado de Sonora
Inglés 3

VOCABULARY BLOCK 2

Vocabulary items
Solutions:

Problems: 2QHVROXWLRQLVWR YHUE

2QHSUREOHPLVWKDW VHQWHQFH :HFRXOG YHUE

,WKLQNZHVKRXOG YHUE
2QHSUREOHPLV QRXQ

,UHFRPPHQGWKDW YHUE

Disagree:
Agreeing:
It’s a good idea but ___________
,WKLQNLW¶VDJRRGLGHD
I disagree with ______ because
,DJUHHZLWKBBBBBBB
I am against it because ________
,DPIRUBBBBBBBBBB
7KHSUREOHPZLWKWKDWLV

Didactic Sequence 1. “Those Good Old Days”

Transportation

:KHHOVRQFDUWV Horses Submarine Steamboat

5LYHUERDWV :KHHOEDUURZ Bus Hot air balloons

Steam powered
Bicycles *DVSRZHUHGYHKLFOHV 0RWRUF\FOH
ORFRPRWLYH

Airplane Helicopter +RYHUFUDIW Bullet train

83 83
83
BLOCK 2 Memorable days
Food

Foods introduced in the Foods Introduced in the Foods Introduced in the Foods Introduced in the
1930’s 1940's 1950's 1960's

-LII\%LVFXLW0L[ <RUN3HSSHUPLQW3DWWLHV $PHULFDQ7H[0H[ Brown Rice

+HLQ].HWFKXS M&M's Frozen Pizza Life Cereal

Sliced Bread Cheerios (Cheerioats) &KLFNHQIXUWHUV ,QVWDQW0DVKHG3RWDWRHV

'U\6RXS0L[ Corn Dogs Diet Soda Round Sandwich Bread

Cheese Puffs Frozen Orange Juice 'XQFDQ+LQHV&DNH0L[ %URZQDQG6HUYH%DFRQ

Tacos Nutella 0DUVKPDOORZ3HHSV Pop Tarts

Fritos Cake Mix Ranch Dressing %XIIDOR&KLFNHQ:LQJV

7ZLQNLHV Frozen French Fries Frozen Pizza &KLFNHQ6DQGZLFK


&KRFRODWH&RYHUHG
Canned Frostings Instant Ramon Noodles Gatorade
Pretzels
Hawiian Punch Seedless Watermelon Slurpees

Canned Soda Jolly Ranchers

Instant Pudding

84 84
84
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Didactic Sequence 2. “I Used to Play Kickball”

:HXVHused to,WRWDONDERXWSDVWKDELWVDQGURXWLQHV([DPSOH

• I used to play tennis, when I was in elementary school.


GRAMMAR
REFERENCE • I didn’t use to eat vegetables. Now I do.
Used to

:HXVHdidpersonal pronoun / noun phraseuse toverbcomplementWR


DVNTXHVWLRQVDERXWSDVWKDELWVDQGURXWLQHV([DPSOHV

Did you use to play football when you were a child?

Did you use to watch cartoons?


GRAMMAR 1RWHZHFDQXVHwh questions: How, when, where, why , what, who to ask an
REFERENCE VSHFL¿FTXHVWLRQ([DPSOHV

Used to When did you use to play football?

What cartoons did you use to watch when you were a child?

85 85
85
BLOCK 2 Memorable days
SELF-EVALUATION

I can… Excellent Good Regular


7DONDERXWSDVWHYHQWV
XVLQJYRFDEXODU\RI
clothes, food and means
RIWUDQVSRUWDWLRQ

Uses grammar used to in


LWVDI¿UPDWLYHQHJDWLYH
DQGLQWHUURJDWLYHIRUP

8VHVZKTXHVWLRQV

8VHYRFDEXODU\
associated with past
KDELWVRUURXWLQHV

&RQGXFWVDQGLQWHUYLHZ

86 86
86
Colegio de Bachilleres del Estado de Sonora
Inglés 3

CO-EVALUATION

$VNRQHRI\RXUFODVVPDWHVWRHYDOXDWH\RXUZRUNKDELWV

Needs
Excellent Satisfactory Unsatisfactory
POINTS Improvement Pts.
3 2 0
1

+DVRU Has 3 or 4 Has 4 or more


Attendance Has perfect
Unexcused Unexcused Unexcused
and DWWHQGDQFH
DEVHQFHV DEVHQFHV DEVHQFHV
punctuality ,VQHYHUODWH
,VVHOGRPODWH ,VVRPHWLPHVODWH ,VXVXDOO\ODWH

)UHTXHQWO\ Often Rarely


1HYHU
Participates participates participates
Participation participates
$VNVTXHVWLRQV DVNVTXHVWLRQV DVNVTXHVWLRQV
and appears apathetic
Shows a lot of shows interest shows interest
Discussions towards class
interest in class in class in class
DFWLYLWLHV
DFWLYLWLHV DFWLYLWLHV DFWLYLWLHV

Sometimes )UHTXHQWO\
1HYHUGLVWUDFWV Rarely distracts
Distracting distracts other distracts other
other students or other students or
behavior students or the students or the
WKHWHDFKHU WKHWHDFKHU
WHDFKHU WHDFKHU

Always turns in
Usually turns in Sometimes turns Rarely turns in
DVVLJQPHQWV
Completion DVVLJQPHQWV LQDVVLJQPHQWV DVVLJQPHQWV
Assignments
of Assignments are Assignments are Assignments
are always
assignments usually clear, and sometimes well- show minimal
well-done and
FRPSOHWH GRQH HIIRUW
FRPSOHWH

Attitude Shows a great Shows little


Shows interest in Shows no interest
toward interest in interest in
OHDUQLQJ LQOHDUQLQJ
learning OHDUQLQJ OHDUQLQJ

TOTAL

87 87
87
BLOCK 2 Memorable days
DIALOGUE RUBRIC

Traits Level 4 Level 3 Level 2 Level 1

:ULWLQJPRVWO\IROORZV
'LDORJXHLVYDJXH
WKHFRQYHQWLRQVRI
:ULWLQJIROORZVWKH :ULWLQJIROORZVWKH DQGRULQDSSURSULDWH
dialogue with some
FRQYHQWLRQVRIGLDORJXH FRQYHQWLRQVRIGLDORJXH Dialogue is not written
GHYLDWLRQV:ULWLQJ
ZLWKRXWH[FHSWLRQ ZLWKIHZH[FHSWLRQV LQFRQYHQWLRQDOIRUP
Writing / shows an attempt at
:ULWLQJHYLGHQFHVDFOHDU :ULWLQJHYLGHQFHVDFOHDU )UHTXHQWHUURUVLQ
Conventions VWUXFWXUHEXWODFNV
VRSKLVWLFDWHGVWUXFWXUH VWUXFWXUH)HZHUURUVLQ spelling, punctuation
FRQVLVWHQF\0DQ\
No errors in spelling, spelling, punctuation and and grammar that
errors in spelling,
SXQFWXDWLRQDQGJUDPPDU JUDPPDU interfere with meaning
punctuation and
DQGRUUHDGDELOLW\
JUDPPDU

The actions of the scene


7KHVFHQHPRYHVVPRRWKO\ The actions of the scene
7KHVFHQHPRYHV DUHXQFOHDU$FWRUVDUH
WKURXJKRXW7KHDFWRUV DUHXVXDOO\FOHDU)RFXV
VPRRWKO\WKURXJKRXW unaware of actions from
are audible and express is often lost during
Actors expand and explore PRPHQWWRPRPHQW
Fluency / HPRWLRQDQGSXUSRVH WKHVFHQH$FWRUVDUH
LGHDV$FWRUVDUHDOZD\V Actors may laugh or
Performance Actors sustain the scene, sometimes inaudible,
audible, clearly focused GLVWUDFWHDFKRWKHU
with some distraction unprepared for new
and committed to the Voices are too soft to be
FDXVHGE\PLVWDNHVRU HYHQWVLQWKHVFHQHRU
HPRWLRQDQGSXUSRVH heard and/or words are
³EUHDNLQJFKDUDFWHU´ ³EUHDNFKDUDFWHU´
VSRNHQWRRIDVW

Scene relies almost


Scene relies entirely upon Scene relies mostly upon Scene relies in part
entirely upon author-
original, student-generated original, student-generated upon author-generated
Creativity / JHQHUDWHGFLUFXPVWDQFHV
circumstances, but circumstances, but FLUFXPVWDQFHV9RLFHV
Voice Voices of the characters
SUHVHUYHVWKHYRLFHVRIWKH SUHVHUYHVWKHYRLFHVRIWKH RIWKHFKDUDFWHUVYHHU
YHHUVLJQL¿FDQWO\IURP
FKDUDFWHUV FKDUDFWHUV IURPRULJLQDOVRPHZKDW
RULJLQDO

Dialogue demonstrates
Dialogue demonstrates an Dialogue demonstrates a
Dialogue demonstrates an unclear
insightful understanding ODFNRIXQGHUVWDQGLQJRI
a solid understanding of understanding of the
RIWKHWDVNWKHFKDUDFWHUV WKHWDVNWKHFKDUDFWHUV
Meaning WKHWDVNWKHFKDUDFWHUV WDVNWKHFKDUDFWHUV
FKRVHQWKHLUPRWLYDWLRQV WKHLUPRWLYDWLRQVDQG
WKHLUPRWLYDWLRQVDQGWKHLU WKHLUPRWLYDWLRQVDQG
and their relationship in their relationship in the
UHODWLRQVKLSLQWKHQRYHO their relationship in the
WKHQRYHO QRYHO
QRYHO

88 88
88
Colegio de Bachilleres del Estado de Sonora
Inglés 3

ORAL PRESENTATION RUBRIC

7HDFKHU1DPHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

6WXGHQW1DPHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

CATEGORY 4 3 2 1

Pitch was often used


Pitch was often Pitch was rarely used
but the emotion it
used and it OR the emotion it 3LWFKZDVQRWXVHGWRFRQYH\
Pitch FRQYH\HGVRPHWLPHV
FRQYH\HGHPRWLRQV FRQYH\HGRIWHQGLG HPRWLRQ
GLGQRW¿WWKH
DSSURSULDWHO\ QRW¿WWKHFRQWHQW
FRQWHQW

Pauses were
Pauses were Pauses were
HIIHFWLYHO\XVHG
HIIHFWLYHO\XVHGRQFH intentionally used but
or more times to Pauses were not intentionally
Pauses WRLPSURYHPHDQLQJ ZHUHQRWHIIHFWLYHLQ
LPSURYHPHDQLQJ XVHG
and/or dramatic LPSURYLQJPHDQLQJ
and/or dramatic
LPSDFW RUGUDPDWLFLPSDFW
LPSDFW

Student is able to Student is able to Student is able to


accurately answer accurately answer accurately answer a Student is unable to accurately
Comprehension DOPRVWDOOTXHVWLRQV PRVWTXHVWLRQVSRVHG IHZTXHVWLRQVSRVHG DQVZHUTXHVWLRQVSRVHGE\
posed by classmates by classmates about by classmates about FODVVPDWHVDERXWWKHWRSLF
DERXWWKHWRSLF WKHWRSLF WKHWRSLF

Facial expressions Facial expressions Facial expressions


and body language and body language and body language Very little use of facial
generate a strong sometimes generate are used to try to H[SUHVVLRQVRUERG\ODQJXDJH
Enthusiasm
interest and a strong interest and generate enthusiasm, Did not generate much interest
enthusiasm about the enthusiasm about the but seem somewhat LQWRSLFEHLQJSUHVHQWHG
WRSLFLQRWKHUV WRSLFLQRWKHUV IDNHG

The student is
Student is Student seems pretty
somewhat prepared,
completely prepared prepared but might Student does not seem at all
Preparedness but it is clear that
DQGKDVREYLRXVO\ KDYHQHHGHGDFRXSOH SUHSDUHGWRSUHVHQW
rehearsal was
UHKHDUVHG PRUHUHKHDUVDOV
ODFNLQJ

Presentation is less than 3


Presentation is 5-6 Presentation is 4 Presentation is 3
Time-Limit minutes OR more than 6
PLQXWHVORQJ PLQXWHVORQJ PLQXWHVORQJ
PLQXWHV

89 89
89
BLOCK 2 Memorable days
6SHDNVFOHDUO\DQG 6SHDNVFOHDUO\DQG 6SHDNVFOHDUO\DQG
GLVWLQFWO\DOO  GLVWLQFWO\DOO  GLVWLQFWO\PRVW  Often mumbles or can not be
Speaks Clearly  WKHWLPHDQG  WKHWLPHEXW  RIWKHWLPH understood OR mispronounces
mispronounces no mispronounces one 0LVSURQRXQFHVQR PRUHWKDQRQHZRUG
ZRUGV ZRUG PRUHWKDQRQHZRUG

8VHVYRFDEXODU\ 8VHVYRFDEXODU\ 8VHVYRFDEXODU\


appropriate for the appropriate for the appropriate for the
DXGLHQFH([WHQGV DXGLHQFH,QFOXGHV DXGLHQFH'RHV 8VHVVHYHUDO RUPRUH 
Vocabulary DXGLHQFHYRFDEXODU\ ZRUGVWKDWPLJKW not include any words or phrases that are not
E\GH¿QLQJZRUGV be new to most of YRFDEXODU\WKDW XQGHUVWRRGE\WKHDXGLHQFH
that might be new to the audience, but might be new to the
PRVWRIWKHDXGLHQFH GRHVQRWGH¿QHWKHP DXGLHQFH

Stands up straight,
ORRNVUHOD[HG Stands up straight
DQGFRQ¿GHQW and establishes Sometimes stands
Posture and Eye Establishes eye eye contact with up straight and 6ORXFKHVDQGRUGRHVQRWORRNDW
Contact contact with HYHU\RQHLQWKH establishes eye SHRSOHGXULQJWKHSUHVHQWDWLRQ
HYHU\RQHLQWKH room during the FRQWDFW
room during the SUHVHQWDWLRQ
SUHVHQWDWLRQ

Shows a full Shows a good Shows a good


Does not seem to understand the
Content understanding of the understanding of the understanding of
WRSLFYHU\ZHOO
WRSLF WRSLF SDUWVRIWKHWRSLF

Volume is loud Volume is loud Volume is loud


enough to be heard enough to be heard enough to be heard
Volume often too soft to be
Volume by all audience by all audience by all audience
KHDUGE\DOODXGLHQFHPHPEHUV
members throughout members at least members at least
WKHSUHVHQWDWLRQ RIWKHWLPH RIWKHWLPH

Almost always Usually listens to,


Often listens to,
listens to, shares shares with, and
shares with, and Rarely listens to, shares with,
with, and supports supports the efforts
Collaboration with supports the efforts and supports the efforts of others
the efforts of others of others in the
Peers of others in the group LQWKHJURXS2IWHQLVQRWDJRRG
LQWKHJURXS7ULHVWR JURXS'RHVQRW
but sometimes is not WHDPPHPEHU
NHHSSHRSOHZRUNLQJ FDXVH?ZDYHV?LQ
DJRRGWHDPPHPEHU
ZHOOWRJHWKHU WKHJURXS

90 90
90
Colegio de Bachilleres del Estado de Sonora
Inglés 3

7,0(/,1(&5($7,2158%5,&

7HDFKHU1DPHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

6WXGHQW1DPHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

CATEGORY 4 3 2 1
Spelling and
Spelling and capitalization Spelling and capitalization There were many
capitalization were
Spelling and ZHUHFKHFNHGE\DQRWKHU ZHUHFKHFNHGE\DQRWKHU spelling and
mostly correct, but
Capitalization student and are correct student and were mostly capitalization
ZHUHQRWFKHFNHG
WKURXJKRXW FRUUHFW HUURUV
E\DQRWKHUVWXGHQW
Facts were accurate Facts were often
Facts were accurate for Facts were accurate for
IRUPRVW a RI inaccurate for
Content/Facts DOOHYHQWVUHSRUWHGRQWKH DOPRVWDOOHYHQWVUHSRUWHG
WKHHYHQWVUHSRUWHG HYHQWVUHSRUWHGRQ
WLPHOLQH RQWKHWLPHOLQH
RQWKHWLPHOLQH WKHWLPHOLQH
The use of font styles and
The use of font styles and The use of font The use of font
colors is consistent and
colors is consistent and styles and colors is styles and colors
Fonts and shows a logical pattern
VKRZVDORJLFDOSDWWHUQ consistent, but is is not consistent
Colors IRUWKHPRVWSDUW,WKHOSV
It helps organize the QRWXVHGHIIHFWLYHO\ OR detracts from
organize the material
PDWHULDO WRRUJDQL]H WKHRUJDQL]DWLRQ
VRPHZKDW

Some graphics are


$OOJUDSKLFVDUHHIIHFWLYH
$OOJUDSKLFVDUHHIIHFWLYH HIIHFWLYHDQGWKHLU 6HYHUDOJUDSKLFV
Graphics but there appear to be too
DQGEDODQFHGZLWKWH[WXVH use is balanced with DUHQRWHIIHFWLYH
IHZRUWRRPDQ\
WH[WXVH

7KHRYHUDOODSSHDUDQFH 7KHRYHUDOODSSHDUDQFHRI
The timeline is The timeline is
Readability of the timeline is pleasing the timeline is somewhat
UHODWLYHO\UHDGDEOH GLI¿FXOWWRUHDG
DQGHDV\WRUHDG SOHDVLQJDQGHDV\WRUHDG

The timeline has an


7KHWLPHOLQHKDVDFUHDWLYH
HIIHFWLYHWLWOHWKDW The timeline has a The title is
title that accurately
Title accurately describes the title that is easy to missing or
describes the material and
material and is easy to ORFDWH GLI¿FXOWWRORFDWH
LVHDV\WRORFDWH
ORFDWH
An accurate date Dates are
An accurate, complete date An accurate, complete
has been included inaccurate and/
Dates has been included for each date has been included for
IRUDOPRVWHYHU\ or missing for
HYHQW DOPRVWHYHU\HYHQW
HYHQW VHYHUDOHYHQWV
The student can accurately The student can The student
The student can accurately
GHVFULEH RUPRUH RI GHVFULEHDQ\HYHQW cannot use
GHVFULEHRIWKHHYHQWV
WKHHYHQWVRQWKHWLPHOLQH on the timeline if the timeline
Learning of on the timeline without
without referring to it and allowed to refer to HIIHFWLYHO\WR
Content referring to it and can
FDQTXLFNO\GHWHUPLQH it and can determine GHVFULEHHYHQWV
TXLFNO\GHWHUPLQHZKLFKRI
ZKLFKRIWZRHYHQWV ZKLFKRIWZRHYHQWV nor to compare
WZRHYHQWVRFFXUUHG¿UVW
RFFXUUHG¿UVW RFFXUUHG¿UVW HYHQWV

91 91
91
BLOCK 2 Memorable days
The student had
notes about most
The student had notes The student had notes The student had
a RIWKH
DERXWDOOWKHHYHQWVDQG DERXWDOPRVWDOOWKHHYHQWV not prepared
HYHQWVDQGGDWHV
dates s/he wished to and dates s/he wished to DGHTXDWHQRWHV
Preparation s/he wished to
include on the timeline include on the timeline before beginning
include on the
before beginning to design before beginning to design to design the
timeline before
WKHWLPHOLQH WKHWLPHOLQH WLPHOLQH
beginning to design
WKHWLPHOLQH

Classroom time was


Classroom time was used XVHGWRZRUNRQWKH Student did not
Classroom time was used
WRZRUNRQWKHSURMHFW SURMHFWWKHPDMRULW\ use classroom
WRZRUNRQWKHSURMHFW
WKHPDMRULW\RIWKHWLPH of the time, but WLPHWRZRUNRQ
Time Use &RQYHUVDWLRQVZHUHQRW
&RQYHUVDWLRQVZHUHQRW FRQYHUVDWLRQVRIWHQ WKHSURMHFWDQG
GLVUXSWLYHDQGIRFXVHGRQ
GLVUXSWLYHDQGIRFXVHGRQ ZHUHGLVUXSWLYHRU or was highly
WKHZRUN
WKHZRUN did not focus on the GLVUXSWLYH
ZRUN

The timeline
The timeline contained at The timeline contained at The timeline
contained at least 5
Resources OHDVWHYHQWVUHODWHGWR OHDVWHYHQWVUHODWHGWR contained fewer
HYHQWVUHODWHGWRWKH
WKHWRSLFEHLQJVWXGLHG WKHWRSLFEHLQJVWXGLHG WKDQHYHQWV
WRSLFEHLQJVWXGLHG

92 92
92
Colegio de Bachilleres del Estado de Sonora
Inglés 3

58%5,&6)25:5,7,1*

TOTAL POINTS: 20

GOOD
Award 5 to 7 points if:
· :ULWLQJLVGHYHORSHGDQGGRHVQRWDSSHDUWRWDNHPXFKHIIRUW
· 7KHSXUSRVHDQGDLPRIWKHZULWLQJLVFOHDU
· 7KHZULWLQJXVXDOO\ÀRZVDWERWKWKHSDUDJUDSKDQGVHQWHQFHOHYHO
· 7KHZRUGVFKRVHQDUHXVXDOO\DSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
· 7KHYRLFHRIWKHDXWKRULVXVXDOO\FOHDUDQGXVXDOO\FRPHVWKURXJKVWURQJO\
· The organization is generally appropriate for the type of piece being written
· In general, standard writing rules are followed, but there are a few errors in grammar and/or
SXQFWXDWLRQ

VERY GOOD
Award 8 to 10 points if:
· The purpose and aim of the writing are clear
· 7KHZULWLQJÀRZVDWERWKWKHSDUDJUDSKDQGVHQWHQFHOHYHO
· 7KHYRLFHRIWKHDXWKRULVFOHDUDQGFRPHVWKURXJKVWURQJO\
· 7KHZRUGVFKRVHQDUHDSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
· 7KHFRQYHQWLRQVRIVWDQGDUGZULWLQJDUHXVXDOO\IROORZHG

EXCELLENT
Award 20 points if:
· :ULWLQJLVIXOO\GHYHORSHGDQGDSSHDUVHIIRUWOHVV
· 7KHSXUSRVHDQGDLPRIWKHZULWLQJDUHYHU\FOHDU
· 7KHZULWLQJDOZD\VÀRZVDWERWKWKHSDUDJUDSKDQGVHQWHQFHOHYHO
· 7KHYRLFHRIWKHDXWKRULVYHU\FOHDUDQGFRPHVWKURXJKVWURQJO\
· 7KHZRUGVFKRVHQDUHYHU\DSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
· 7KHRUJDQL]DWLRQLVYHU\DSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
· 7KHUXOHVRIVWDQGDUGZULWLQJDUHIROORZHG

TOTAL: _______
 

Students’ composition must have the appropriate content for the topic, and logically accurate vocabulary.

93 93
93
BLOCK 2 Memorable days
58%5,&6)25:5,7,1*

CATEGORY 4 3 2 1
The student put the date of The student included
The student included The student forgot
WKHLQWHUYLHZSODFHRIWKH the date of the
the date of the to put the date of the
LQWHUYLHZIXOOQDPHRIWKH LQWHUYLHZSODFHRI
LQWHUYLHZDQGIXOO LQWHUYLHZ25WKHIXOO
SHUVRQEHLQJLQWHUYLHZHG WKHLQWHUYLHZDQGIXOO
Labeling name of the person name of the person
and the full name of the name of the person
EHLQJLQWHUYLHZHG EHLQJLQWHUYLHZHG
SHUVRQEHLQJLQWHUYLHZHG EHLQJLQWHUYLHZHG
RQWKHYLGHRWDSH RQWKHYLGHRWDSH
RQWKHYLGHRWDSH RQWKHYLGHRWDSH
DXGLRWDSHRUUHSRUW DXGLRWDSHRUUHSRUW
DXGLRWDSHRUUHSRUW DXGLRWDSHRUUHSRUW
Video has a little
9LGHRGRHVQRWURFNVKDNH 9LGHRGRHVQRWURFN 7KHYLGHRURFNV
URFNLQJRUVKDNLQJ
Videography and the focus is excellent VKDNHDQGWKHIRFXVLV VKDNHVRIWHQ25WKH
but the focus is
WKURXJKRXW DGHTXDWHWKURXJKRXW IRFXVLVQRWDGHTXDWH
H[FHOOHQWWKURXJKRXW
%RWKWKHLQWHUYLHZHU The person being
%RWKWKHLQWHUYLHZHU
and the person being LQWHUYLHZHGFDQEH 7KHVRXQGTXDOLW\LV
and the person being
LQWHUYLHZHGFDQEH KHDUGXQGHUVWRRGYHU\ SRRUPDNLQJLWKDUG
Sound LQWHUYLHZHGFDQEHKHDUG
KHDUGXQGHUVWRRGYHU\ clearly on the tape to hear/understand
Quality XQGHUVWRRGYHU\FOHDUO\RQ
clearly on the tape but EXWWKHLQWHUYLHZHU?
V the person being
the tape with no wind or
there is some wind or YRLFHLVQRWHDVLO\ LQWHUYLHZHG
EDFNJURXQGQRLVH
EDFNJURXQGQRLVH KHDUG
Student can
Student can accurately
accurately answer a
DQVZHUVHYHUDOTXHVWLRQV Student can Student cannot
IHZTXHVWLRQVDERXW
about the person who was accurately answer a accurately answer
Knowledge the person who was
LQWHUYLHZHGDQGFDQWHOO IHZTXHVWLRQVDERXW TXHVWLRQVDERXWWKH
Gained LQWHUYLHZHGDQGFDQ
KRZWKLVLQWHUYLHZUHODWHV the person who was person who was
WHOOKRZWKLVLQWHUYLHZ
to the material being LQWHUYLHZHG LQWHUYLHZHG
relates to the material
VWXGLHGLQFODVV
EHLQJVWXGLHGLQFODVV
The student 7KHVWXGHQWDVNHG
The student introduced introduced himself permission to set up a
himself, explained why DQGDVNHGSHUPLVVLRQ WLPHIRUWKHLQWHUYLHZ The student needed
Setting Up KHZDQWHGWRLQWHUYLHZ to set up a time for the but needed reminders assistance in all
the Interview WKHSHUVRQDQGDVNHG LQWHUYLHZEXWQHHGHG to introduce himself aspects of setting up
permission to set up a time a reminder to explain and to tell why he WKHLQWHUYLHZ
IRUDQLQWHUYLHZ why he wanted to do ZDQWHGWRLQWHUYLHZ
WKHLQWHUYLHZ WKHSHUVRQ

Student rarely
Student rarely 6HYHUDOWLPHVWKH
6WXGHQWQHYHULQWHUUXSWHG interrupted or hurried
interrupted or hurried student interrupted
or hurried the person being the person being
the person being or hurried the person
Politeness LQWHUYLHZHGDQGWKDQNHG LQWHUYLHZHGDQG
LQWHUYLHZHGEXW EHLQJLQWHUYLHZHG
them for being willing to WKDQNHGWKHPIRU
IRUJRWWRWKDQNWKH $1'IRUJRWWRWKDQN
EHLQWHUYLHZHG being willing to be
SHUVRQ WKHSHUVRQ
LQWHUYLHZHG

94 94
94
Colegio de Bachilleres del Estado de Sonora
Inglés 3

%HIRUHWKHLQWHUYLHZ
%HIRUHWKHLQWHUYLHZWKH the student prepared %HIRUHWKHLQWHUYLHZ
The student did not
VWXGHQWSUHSDUHGVHYHUDO a couple of in-depth the student prepared
Preparation SUHSDUHDQ\TXHVWLRQV
in-depth AND factual TXHVWLRQVDQGVHYHUDO VHYHUDOIDFWXDO
EHIRUHWKHLQWHUYLHZ
TXHVWLRQVWRDVN IDFWXDOTXHVWLRQVWR TXHVWLRQVWRDVN
DVN
The student listened
The student listened
carefully to the person 7KHVWXGHQWDVNHGD
carefully to the person The student did not
EHLQJLQWHUYLHZHG couple of follow-up
Follow-up EHLQJLQWHUYLHZHGDQG DVNDQ\IROORZXS
DQGDVNHGDFRXSOH TXHVWLRQVEDVHGRQ
Questions DVNHGVHYHUDOUHOHYDQW TXHVWLRQVEDVHGRQ
RIUHOHYDQWIROORZXS what s/he thought the
IROORZXSTXHVWLRQVEDVHG ZKDWWKHSHUVRQVDLG
TXHVWLRQVEDVHGRQ SHUVRQVDLG
RQZKDWWKHSHUVRQVDLG
ZKDWWKHSHUVRQVDLG

ORAL EXPOSITION IN TEAMS RUBRIC

(RÚBRICA PARA PROYECTO INTEGRADOR)

CATEGORY 4 3 2 1
Pitch was often Pitch was often used Pitch was rarely used
used and it but the emotion it OR the emotion it Pitch was not used to
Pitch
FRQYH\HGHPRWLRQV FRQYH\HGVRPHWLPHV FRQYH\HGRIWHQGLGQRW FRQYH\HPRWLRQ
DSSURSULDWHO\ GLGQRW¿WWKHFRQWHQW ¿WWKHFRQWHQW
Pauses were Pauses were Pauses were
HIIHFWLYHO\XVHGRU HIIHFWLYHO\XVHGRQFH intentionally used but
Pauses were not
Pauses PRUHWLPHVWRLPSURYH WRLPSURYHPHDQLQJ ZHUHQRWHIIHFWLYHLQ
LQWHQWLRQDOO\XVHG
meaning and/or and/or dramatic LPSURYLQJPHDQLQJRU
GUDPDWLFLPSDFW LPSDFW GUDPDWLFLPSDFW

Student is able to Student is able to Student is able to Student is unable to


accurately answer accurately answer accurately answer a accurately answer
Comprehension DOPRVWDOOTXHVWLRQV PRVWTXHVWLRQVSRVHG IHZTXHVWLRQVSRVHG TXHVWLRQVSRVHGE\
posed by classmates by classmates about by classmates about classmates about the
DERXWWKHWRSLF WKHWRSLF WKHWRSLF WRSLF

Facial expressions Facial expressions Very little use of


Facial expressions
and body language and body language facial expressions or
and body language are
generate a strong sometimes generate ERG\ODQJXDJH'LG
Enthusiasm used to try to generate
interest and a strong interest and not generate much
enthusiasm, but seem
enthusiasm about the enthusiasm about the interest in topic being
VRPHZKDWIDNHG
WRSLFLQRWKHUV WRSLFLQRWKHUV SUHVHQWHG

Student seems pretty The student is


Student is completely Student does not seem
prepared but might somewhat prepared,
Preparedness prepared and has at all prepared to
KDYHQHHGHGDFRXSOH but it is clear that
REYLRXVO\UHKHDUVHG SUHVHQW
PRUHUHKHDUVDOV UHKHDUVDOZDVODFNLQJ

95 95
95
BLOCK 2 Memorable days
6SHDNVFOHDUO\DQG 6SHDNVFOHDUO\DQG 6SHDNVFOHDUO\DQG
Often mumbles or can
GLVWLQFWO\DOO  GLVWLQFWO\DOO  GLVWLQFWO\PRVW 
not be understood OR
Speaks Clearly  WKHWLPHDQG  WKHWLPHEXW  RIWKHWLPH
mispronounces more
mispronounces no mispronounces one 0LVSURQRXQFHVQR
WKDQRQHZRUG
ZRUGV ZRUG PRUHWKDQRQHZRUG

Stands up straight,
ORRNVUHOD[HGDQG Stands up straight
Slouches and/or
FRQ¿GHQW(VWDEOLVKHV and establishes eye Sometimes stands up
Posture and GRHVQRWORRNDW
eye contact with FRQWDFWZLWKHYHU\RQH straight and establishes
Eye Contact people during the
HYHU\RQHLQWKH in the room during the H\HFRQWDFW
SUHVHQWDWLRQ
room during the SUHVHQWDWLRQ
SUHVHQWDWLRQ

Almost always listens Usually listens to, Often listens to, shares Rarely listens to,
to, shares with, and shares with, and with, and supports the shares with, and
Collaboration supports the efforts of supports the efforts of efforts of others in the supports the efforts of
with Peers RWKHUVLQWKHJURXS RWKHUVLQWKHJURXS group but sometimes RWKHUVLQWKHJURXS
7ULHVWRNHHSSHRSOH Does not cause is not a good team Often is not a good
ZRUNLQJZHOOWRJHWKHU ?ZDYHV?LQWKHJURXS PHPEHU WHDPPHPEHU

Volume is loud enough


Volume is loud enough Volume is loud enough
to be heard by all Volume often too soft
to be heard by all to be heard by all
Volume audience members to be heard by all
audience members at audience members at
throughout the DXGLHQFHPHPEHUV
OHDVWRIWKHWLPH OHDVWRIWKHWLPH
SUHVHQWDWLRQ

The use of font styles


The use of font styles
and colors is consistent The use of font The use of font styles
and colors is consistent
and shows a logical styles and colors is and colors is not
Creativity, and shows a logical
pattern for the most consistent, but is not consistent OR detracts
Fonts and SDWWHUQ,WKHOSV
SDUW,WKHOSVRUJDQL]H XVHGHIIHFWLYHO\WR IURPWKHRUJDQL]DWLRQ
Colors RUJDQL]HWKHPDWHULDO
WKHPDWHULDOVRPHZKDW RUJDQL]H,WVKRZV It shows regular
It shows excellent
,WVKRZVYHU\JRRG JRRGFUHDWLYLW\ FUHDWLYLW\
FUHDWLYLW\
FUHDWLYLW\

96 96
96
Colegio de Bachilleres del Estado de Sonora
Inglés 3

RUBRIC FOR PORTFOLIO

Rubric and Comments for Portfolio

Student name: _______________________________________________

Beginning Developing Accomplished Exemplary


Comments Score
1 2 3 4
0DQ\
Entire portfolio
Mechanics mechanical Some All or part of
has little or no
HUURUVSUHVHQW mechanical the portfolio has
mechanical
grammar, HUURUVSUHVHQW few mechanical
HUURUV
spelling, grammar, HUURUV
grammar,
punctuation, spelling, grammar,
spelling,
and other punctuation, spelling,
punctuation,
mechanics and other punctuation,
and other
demonstrate a mechanics and other
mechanics are
VLJQL¿FDQWQHHG need some mechanics are
perfect or near
WRLPSURYHLQ LPSURYHPHQW JRRGRYHUDOO
SHUIHFW
WKLVDUHD

Entire portfolio
Originality/ Entire portfolio Entire portfolio
demonstrates
Some parts demonstrates demonstrates
VLJQL¿FDQWODFN
Creativity of portfolio some originality VLJQL¿FDQW
of originality
demonstrate DQGFUHDWLYLW\ originality and
DQGFUHDWLYLW\
originality Some pieces FUHDWLYLW\([WUD
Extra pieces
DQGFUHDWLYLW\ such as pieces such as
such as
%DFNJURXQGV EDFNJURXQGV EDFNJURXQGV
EDFNJURXQGV
pictures, music pictures, and pictures, and
pictures, and
PD\EHSUHVHQW music are music are
music are
SUHVHQW SUHVHQW
DEVHQW

Portfolio is
3RUWIROLRODFNV Portfolio is
Portfolio is neat extremely
neatness and somewhat neat
Neatness/ RUJDQL]DWLRQ DQGRUJDQL]HG
DQGRUJDQL]HG neat and
/LQNVIXQFWLRQ RUJDQL]HG$OO
6RPHOLQNV )HZOLQNV
Organization ZHOODGHTXDWH OLQNVIXQFWLRQ
DUHEURNHQRU DUHEURNHQRU
OLQNVSUHVHQW SHUIHFWO\DPSOH
DEVHQW DEVHQW
OLQNVDYDLODEOH

97 97
97
BLOCK 2 Memorable days
,1)250$7,216285&(6

Electrónicas:
ELVIS PRESLEY
KWWSHQZLNLSHGLDRUJZLNL(OYLVB3UHVOH\

3RSXODU $PHULFDQ )RRGV WKURXJK WKH 'HFDGHV ..$16 KWWSIRRGVDFURVVWKHGHFDGHVZHHEO\FRPV


html

Problems and Solutions


ZZZERJJOHVZRUOGHVOFRP

The History of Transportation.


KWWSLQYHQWRUVDERXWFRPOLEUDU\LQYHQWRUVEOBKLVWRU\BRIBWUDQVSRUWDWLRQKWP

98 98
98
Colegio de Bachilleres del Estado de Sonora
BLOCK 3
/ǁĂƐůŝƐƚĞŶŝŶŐƚŽŵƵƐŝĐ͙

^ƚƵĚĞŶƚƐ͛ƉĞƌĨŽƌŵĂŶĐĞĂƚƚŚĞ
ĞŶĚŽĨďůŽĐŬ Learning objects Competence to be developed
džƉƌĞƐƐĞƐ  ĂĐƟǀŝƟĞƐ ƚŚĂƚ ǁĞƌĞ ĐĂƌƌŝĞĚ sŽĐĂďƵůĂƌLJ ƌĞůĂƚĞĚ ƚŽ ĐůŽƚŚĞƐ͕ ĨŽŽĚ Žƌ ^ƵƉƉŽƌƚ Ă ƌĞƐƉĞĐƞƵů ĂƫƚƵĚĞ ƚŽǁĂƌĚƐ
out in diverse contexts in an oral or music. ŵƵůƟĐƵůƚƵƌĂůŝƐŵĂŶĚƚŚĞĚŝǀĞƌƐŝƚLJŽĨďĞůŝĞĨƐ͕
ǁƌŝƩĞŶĨŽƌŵ͘ ^ŝŵƉůĞ ƉĂƐƚ ƚŽ ŝŶĚŝĐĂƚĞ ĂĐƟŽŶƐ ƚŚĂƚ ǁĞƌĞ ǀĂůƵĞƐ͕ ŝĚĞĂƐ ĂŶĚ ƐŽĐŝĂů ƉƌĂĐƟĐĞƐ ŽĨ ƚŚĞŝƌ
/ĚĞŶƟĮĞƐƐƉĞĐŝĮĐŝŶĨŽƌŵĂƟŽŶƌĞŐĂƌĚŝŶŐ ĚŝƐĐŽŶƟŶƵĞĚďLJĂŶŽƚŚĞƌĂĐƟŽŶŝŶƉƌŽŐƌĞƐƐ͘ ŽǁŶ ĂĐƟǀŝƟĞƐ ĂŶĚ ƚŚĞ ŽŶĞƐ ĨƌŽŵ ŽƚŚĞƌ
ĂĐƟǀŝƟĞƐ ƚŚĂƚ ǁĞƌĞ ĐĂƌƌŝĞĚ ŽƵƚ ŝŶ ŚŝƐ ͬ ZĞůĂƟǀĞ ƉƌŽŶŽƵŶƐ ͞ǁŚĞŶ͟ ĂŶĚ ͞ǁŚŝůĞ͟ ƚŽ social groups.
ŚĞƌĐŽŵŵƵŶŝƚLJĂŶĚĞůƐĞǁŚĞƌĞŝŶĂŶŽƌĂů ĚĞƐĐƌŝďĞĂĐƟŽŶƐŝŶƚŚĞƉĂƐƚ͘ /ĚĞŶƟĨLJĂŶĚŝŶƚĞƌƉƌĞƚƚŚĞŐĞŶĞƌĂůŝĚĞĂĂŶĚ
ŽƌĂǁƌŝƩĞŶƚĞdžƚ͘ ŽŶŶĞĐƚŽƌƐ ŽĨ ƐĞƋƵĞŶĐĞ Žƌ ƐĞƋƵĞŶĐĞ ƉŽƐƐŝďůĞĚĞǀĞůŽƉŵĞŶƚŽĨĂŶŽƌĂůŽƌǁƌŝƩĞŶ
Uses the simple past and past progressive ǁŽƌĚƐ͗ĮƌƐƚ͕ƚŚĞŶ͕ĂŌĞƌ͕ůĂƚĞƌ͕ĂŌĞƌĂǁŚŝůĞ͘ ŵĞƐƐĂŐĞŝŶĂƐĞĐŽŶĚůĂŶŐƵĂŐĞ͕ďLJŵĞĂŶƐŽĨ
ůŝŶŐƵŝƐƟĐ ƐƚƌƵĐƚƵƌĞƐ ƚŽ ŝŶĚŝĐĂƚĞ ĂĐƟŽŶƐ ďĂĐŬŐƌŽƵŶĚŬŶŽǁůĞĚŐĞ͘
ƚŚĂƚƚŽŽŬƉůĂĐĞĂƚĂƐƉĞĐŝĮĐŵŽŵĞŶƚŝŶ ŽŵŵƵŶŝĐĂƚĞ ŝŶ Ă ĨŽƌĞŝŐŶ ůĂŶŐƵĂŐĞ
the past. ƚŚƌŽƵŐŚůŽŐŝĐĂů͕ŽƌĂůŽƌǁƌŝƩĞŶĚŝƐĐŽƵƌƐĞ͕ƚŽ
ĐŽŵƉĂƌĞĂŶĚĚĞƐĐƌŝďĞƚŚĞŝƌŽǁŶĂĐƟǀŝƟĞƐ
ĂŶĚĂĐƟǀŝƟĞƐĨƌŽŵŽƚŚĞƌƐŽĐŝĂůŐƌŽƵƉƐ͘
Use independent learning strategies,
ƚŚƌŽƵŐŚ ŝŶĨŽƌŵĂƟŽŶ ƚĞĐŚŶŽůŽŐLJ ĂŶĚ
ĐŽŵŵƵŶŝĐĂƟŽŶ ƚŽ ĂƩĂŝŶ ŝŶĨŽƌŵĂƟŽŶ ŽŶ
ƚŚĞƵƐĂŐĞŽĨŐƌĂŵŵĂƟĐĂůƐƚƌƵĐƚƵƌĞƐ͘
Produce texts based on the standard use
ŽĨ ƚŚĞ ůĂŶŐƵĂŐĞ͕ ƚĂŬŝŶŐ ŝŶƚŽ ĐŽŶƐŝĚĞƌĂƟŽŶ
ƚŚĞ ƉƵƌƉŽƐĞ͕ ĐŽŵŵƵŶŝĐĂƟǀĞ ƐŝƚƵĂƟŽŶ͕
ĂŶĚ ĨŽƌŵĂů ĞůĞŵĞŶƚƐ ŽĨ ůĂŶŐƵĂŐĞ ĂƐ
ƉƵŶĐƚƵĂƟŽŶ͕ ƐƉĞůůŝŶŐ͕ ƐLJŶƚĂdž͕ ĐŽŚĞƌĞŶĐĞ
and cohesion.

ůůŽƩĞĚƟŵĞ͗ 12 hours.
Start Up Activities Didactic Sequence 1
͞t,d/zKhKz^dZz͍͟

DIAGNOSTIC EVALUATION

&RPSOHWHWKHPLQGPDS:ULWHH[DPSOHVLQHDFKFDWHJRU\,I\RXQHHGKHOSJREDFNWREORFNSJ0HDQVRI
WUDQVSRUWDWLRQ

Air transportation

________________________
Terrestrial transportation Water transportation
________________________
________________________ ________________________

________________________ ________________________
Means of transportation

________________________

________________________

100 10
1100
00
Colegio de Bachilleres del Estado de Sonora
Inglés 3

CLOTHING

1001 101
101
BLOCK 3 I was listening to music…
Development Activities

ACTIVITY 1
SD1-B3

1. Music and more…

a) /LVWHQDQGUHDGDERXWWKHKLVWRU\RIPXVLF,QYHVWLJDWHWKHSRSXODUJHQUHVWKDW\RXGRQ¶WNQRZ

A HISTORY OF MUSIC: FROM BIG BAND TO


REGGAETON.

7DNHQIURPKWWSZZZWKHSHRSOHKLVWRU\FRPPXVLFKWPO

7KURXJKRXW WKH \HDUV PXVLFDO VW\OHV KDYH UHÀHFWHG WKH


VRFLHW\ RI WKH WLPH DQG KDYH HYROYHG ZLWK FKDQJHV LQ WKH
ZRUOG 1RW RQO\ GRHV PXVLF FKDQJH ZLWK VRFLHW\ EXW LW
FKDQJHVZLWKWHFKQRORJLFDODGYDQFHVDVZHOO$VWHFKQRORJ\
changes it can allow new styles to emerge and new ways for
SHRSOHWROLVWHQ)URPUDGLRWRWHOHYLVLRQDQGUHFRUGVWRWKH
internet, music and the way we consume it has dramatically
FKDQJHG LQ WKH SDVW VHYHQW\ \HDUV (YHQ WKH LQQRYDWLRQV
in the technology used to create musical instruments and
UHFRUGLQJHTXLSPHQWKDVHIIHFWHGZKDWVW\OHVDQGVRQJVDUH
PDGHDQGSRSXODUZLWKLQWKHPXVLFODQGVFDSH7KURXJKRXW
WKLVVHFWLRQZHZLOOWU\WREULHÀ\FRYHUWKHW\SHVRIPXVLF
WKDWZHUHSRSXODUVLQFHWKH
VXSXQWLOWKHSUHVHQWGD\
E\ SURYLGLQJ OLVWV RI JHQUHV DQG DUWLVWV DV ZHOO DV VRPH
KLVWRULFDO FRQWH[W .HHS LQ PLQG D ORW RI WKLV LQIRUPDWLRQ
LVVXEMHFWLYHDQGZHKDYHWULHGRXUEHVWWRFRYHUWKHPRVW
SRSXODUHOHPHQWVRIWKHKLVWRU\RIPXVLF

¶V0XVLF
7KHPXVLFRIWKH
VFRQVLVWHGPDLQO\RIMD]]ELJEDQGDQGVZLQJ,WUHÀHFWHGWKHSDLQ
RI:RUOG:DU,,ZKLOHDOVRWU\LQJWRUHPDLQXSEHDWDQGORRNLQJWRZDUGVDSRVLWLYHIXWXUHIXOO
RISRVVLELOLWLHV%HFDXVHPXFKRIWKHZRUOGZDVLQYROYHGLQWKHZDUGXULQJWKHGHFDGHPDQ\
artists and groups put their efforts into entertaining troops, especially in the US with the USO
8QLWHG6WDWHV6HUYLFH2UJDQL]DWLRQV 

Popular Genres:-D]]%LJ%DQG6ZLQJ&RXQWU\%HERS1RYHOW\$FWV%DQG/HDGHUV

Popular Artists:5RVHPDU\&ORRQH\)UDQN6LQDWUD*OHQQ0LOOHU$UWLH6KDZ&RXQW%DVLH
Bing Crosby, The Andrews Sisters, Dorsey Brothers, Billie Holiday, Dizzy Gillespie, Ella
Fitzgerald

102 10
1102
02
Colegio de Bachilleres del Estado de Sonora
Inglés 3

¶V0XVLF
0XVLFRIWKH
VUHÀHFWHGWKHEHJLQQLQJVRIPDMRUVRFLDO
FKDQJHVLQWKHZRUOGDQGLQWKH86HVSHFLDOO\5RFN
Q
5ROO
5 % DQG WUDGLWLRQDO SRS UXOHG WKH FKDUWV ZKLOH UDGLR DQG
WHOHYLVLRQ FRQQHFWHG WKH FRXQWU\ LQ RXU PXVLFDO WDVWHV DQG
H[SRVHGWKHQDWLRQWRDJUHDWHUYDULHW\RIDUWLVWVDQGVW\OHV
6RPH RI WKH ¿UVW PDMRU VXSHUVWDUV RI PXVLF HPHUJHG IURP
WKLV GHFDGH ZLWK SHRSOH OLNH (OYLV 3UHVOH\ GRPLQDWLQJ WKH
DLUZDYHVDQGWKHPLQGVRI\RXQJJLUOV

Popular Genres:7UDGLWLRQDO3RS5RFN
Q
5ROO5K\WKP 
%OXHV&RXQWU\-D]]%OXHV&DO\SVR9RFDO-D]]

Popular Artists:(OYLV3UHVOH\&KXFN%HUU\/LWWOH5LFKDUG
-HUU\ /HH /HZLV %XGG\ +ROO\ )DWV 'RPLQR 7KH (YHUO\
%URWKHUV 3DWWL 3DJH 'RULV 'D\ -RKQQ\ &DVK 1DW .LQJ
&ROH7RQ\%HQQHWW'HDQ0DUWLQ3DW%RRQH*HQH$XWU\
3DWV\ &OLQH 6DPH &RRNH +DQN :LOOLDPV 7HUHVD %UHZHU
Ritchie Valens, Harry Belafonte, Ray Charles

¶V0XVLF

7KH VRXQGV RI WKH 


V VWUDGGOHG D ODUJH
dichotomy between the ultimate commercialism
ZLWK FRPSOHWHO\ PDQXIDFWXUHG EDQGV OLNH 7KH
$UFKLHV DQG 7KH 0RQNHHV  DQG UHYROXWLRQDU\
DUWLVWU\ %RE '\ODQ DQG -LPL +HQGUL[  ZLWK
some of the greatest singer-songwriters and
LQVWUXPHQWDOLVWV HPHUJLQJ RQ WKH VFHQH 7KHUH
ZHUH DOVR PDQ\ EDQGV DQG DUWLVWV WKDW ZDONHG
the line between commercialism and musical
LQQRYDWLRQOLNH7KH%HDWOHV6LPRQ *DUIXQNHO
DQG 7KH 5ROOLQJ 6WRQHV 7KH %HDWOHV GRPLQDWHG
WKHFKDUWVDQGVSXUUHGRQWKH%ULWLVK,QYDVLRQWKDW
FKDUDFWHUL]HGPXFKRIWKHGHFDGH

Popular Genres: )RON 6XUI 5RFN 3V\FKHGHOLF 5RFN %OXHV5RFN 3URJUHVVLYH 5RFN *DUDJH 5RFN 3RS 6RXO
5 %&RXQWU\%ULWLVK,QYDVLRQ/DWLQ5RFN3URWHVW0XVLFZLWKD0HVVDJH

Popular Artists:7KH%HDWOHV%RE'\ODQ7KH0RQNHHV7KH5ROOLQJ6WRQHV7KH6XSUHPHV6LPRQ *DUIXQNHO


$UHWKD)UDQNOLQ7KH%HDFK%R\V7KH-LPL+HQGUL[([SHULHQFH7KH0RRG\%OXHV-DQLV-RSOLQ1HLO6HGGDND
&KXEE\&KHFNHU7KH0DPDV 7KH3DSDV&UHDP7KH7HPSWDWLRQV-DPHV%URZQ

¶V0XVLF
7KH 
V VHUYHG DV D EULGJH EHWZHHQ WKH VHULRXVQHVV RI WKH PXVLF WKDW FDPH RXW RI WKH ODWH VL[WLHV DQG WKH
H[FHVVLYHQHVVRIPXVLFIURPWKH
V'LVFREHFDPHRQHRIWKHELJJHVWDQGPRVWGHVSLVHGWUHQGVLQPXVLFGXULQJ
WKHGHFDGH,WZDVVRSHUYDVLYHWKDWPDQ\HVWDEOLVKHGVLQJHUVDQGEDQGVFDPHRXWZLWKGLVFRVRQJVWRNHHSXSZLWK

100033 103
103
BLOCK 3 I was listening to music…
WKH WUHQGV LQFOXGLQJ URFNHUV OLNH %ORQGLH DQG 5RG 6WHZDUW
+HDYLHU URFN PXVLF DQG SXQN URFN DOVR HPHUJHG GXULQJ WKH
GHFDGHVRPHRILWDVDUHWDOLDWLRQWRGLVFR

Popular Genres: 'LVFR'DQFH 3URJUHVVLYH 5RFN 3XQN


1HZ :DYH )XQN 6RXO *ODP 5RFN 6RIW 5RFN 6LQJHU
6RQJZULWHU)RON6RXWKHU5RFN&RXQWU\5RFN&RXQWU\3RS
Power Pop

Popular Artists: 7KH 'RRUV 7KH :KR 7KH -DFNVRQ 


0DUYLQ *D\H 5RG 6WHZDUW %DUU\ 0DQLORZ 'LDQD 5RVV
Paul Simon, Gloria Gaynor, The Bee Gees, The Ramones,
Sex Pistols, Electric Light Orchestra, Patti Smith, The Cars,
.RRO  7KH *DQJ 3DUOLDPHQW)XQNDGHOLF (DUWK :LQG 
)LUH .DQVDV$%%$ 'RQQD 6XPPHU 4XHHQ *UDQG )XQN
5DLOURDG%ORQGLH7KH&DUSHQWHUV(OWRQ-RKQ%LOO\-RHO

¶V0XVLF
,Q WKH 
V PXVLF ZDV GUDPDWLFDOO\ FKDQJHG
E\WKHLQWURGXFWLRQRI079 0XVLF7HOHYLVLRQ 
7KLVPHDQWWKDWPXVLFYLGHRVEHFDPHPRUHDQG
more of a necessity in order for artists to gain
SRSXODULW\ HVSHFLDOO\ ZLWK WKH \RXWK  DQG VHOO
UHFRUGV$JUHDWHULPSRUWDQFHZDVSODFHGRQWKH
DSSHDUDQFHRIPXVLFLDQVDQGJLPPLFNVEHFDPH
FRPPRQSODFH0LFKDHO-DFNVRQHPHUJHGDVRQH
of the most dominant artists of the decade and
ZDVKHOSHGE\KLVFUHDWLYHPXVLFYLGHRVDQGSXUH
WDOHQWZLWKKLV7KULOOHUDOEXPDQGYLGHRVHWWLQJ
SRS PXVLF VWDQGDUGV 1HZ :DYH DQG 6\QWK
Pop were popular genres and their electronic
VRXQGV ¿W SHUIHFWO\ ZLWK WKH EHJLQQLQJV RI WKH
FRPSXWHU DJH +DLU 0HWDO EDQGV DOVR EHFDPH
popular during the decade with their theatrical
DQGRXWUDJHRXVPXVLFYLGHRVDQGSHUIRUPDQFHV
Hip-Hop also came into the mainstream during
WKHGHFDGH

Popular Genres: 1HZ:DYH 6\QWK3RS +DLU 0HWDO +LS+RS *RWKLF 5RFN +HDY\ 0HWDO 3RS$OWHUQDWLYH
5RFN+DUGFRUH3XQN&RQWHPSRUDU\5 %&RXQWU\

Popular Artists:'ROO\3DUWRQ0LFKDHO-DFNVRQ/LRQHO5LWFKLH2OLYLD1HZWRQ-RKQ'DYLG%RZLH%LOO\-RHO
'XUDQ 'XUDQ7KH 3ROLFH 89DQ +DOHQ 'HI /HSSDUG 3RLVRQ7ZLVWHG 6LVWHU:KLWQH\ +RXVWRQ 0DGRQQD
3KLO&ROOLQV&\QGL/DXSHU%RQ-RYL%UXFH6SULQJVWHHQ0RWOH\&UXH3ULQFH3DXOD$EGXO7KH&XUH'HSHFKH
0RGH7KH*R*RV7KH%DQJOHV5DQG\7UDYLV*DUWK%URRNV5HED0F(QWLUH3XEOLF(QHP\5XQ'0&0&
+DPPHU%HDVWLH%R\V//&RRO-%REE\%URZQ1HZ.LGVRQWKH%ORFN-DQHW-DFNVRQ7RP3HWW\-RXUQH\
Tina Turner

104 10
1104
04
Colegio de Bachilleres del Estado de Sonora
Inglés 3

¶V0XVLF
/LNH WKH VL[WLHV WKH 
V ZDV D GHFDGH
of extremes with under-produced, anti-
establishment grunge bands and gangster
UDSSHUVHQMR\LQJMXVWDVPXFKVXFFHVVDVWKH
RYHUO\SURGXFHGDQGVWXGLRPDQXIDFWXUHGSRS
JURXSV 7KH GHFDGH ZDV UXOHG E\ SRZHUIXO
VLQJHUVZLWK0DULDK&DUH\&HOLQH'LRQDQG
:KLWQH\ +RXVWRQ WRSSLQJ WKH FKDUWV 0DQ\
DUWLVWV
 SHUVRQDO SUREOHPV LQFOXGLQJ GUXJ
DEXVH DQG UDS IHXGV RYHUVKDGRZHG D ORW RI
the talent during the decade as well, with
the death of many popular musicians due to
GUXJRYHUGRVHDQGWKHPXUGHUVRIUDSSHUVOLNH
1RWRULRXV%,*DQG7XSDF6KDNXU

Popular Genres: *UXQJH$OWHUQDWLYH&ROOHJH 5RFN7HFKQRWURQLF +LS+RS *DQJVWHU 5DS %XEEOHJXP 3RS


%R\%DQGV*LUO*URXSV3RS3XQN0HWDO6ND&RQWHPSRUDU\5 %&RXQWU\3RS%ULWSRS1HZ-DFN6ZLQJ
6LQJHU6RQJZULWHU+DUG5RFN+DSS\5RFN

Popular Artists:1LUYDQD3HDUO-DP0&+DPPHU%ULWQH\6SHDUV%DFNVWUHHW%R\V1
6\QF6RXQGJDUGHQ5HG
+RW&KLOL3HSSHUV6DOW
Q3HSSD9DQLOOD,FH7RQH/RF3DF1RWRULRXV%,*6QRRS'RJJ,FH&XEH*ORULD
(VWHIDQ0DGRQQD:KLWQH\+RXVWRQ7KH2IIVSULQJ*UHHQ'D\1R'RXEW5LFN\0DUWLQ*DUWK%URRNV6KDQLD
7ZDLQ)DLWK+LOO%R\],,0HQ-DQHW-DFNVRQ5(0:HH]HU*XQV 5RVHV+RRWLH WKH%ORZ¿VK&KULVWLQD
$JXLOHUD$ODQLV0RULVHWWH-HZHO2DVLV0DULDK&DUH\1DWDOLH0HUFKDQW6KHU\O&URZ0HOLVVD(WKHULGJH'DYH
0DWWKHZV%DQG0HWDOOLFD1LQH,QFK1DLOV&\SUHVV+LOO)RR)LJKWHUV7KH6PDVKLQJ3XPSNLQV

0XVLFIURPWKHQHZ0LOOHQQLXP

7KHPXVLFRIWKH
VVKRZFDVHGDYDULHW\RIJHQUHVDQGLWUHÀHFWHGDJUHDWGHDORIWKHSRSPXVLFWKDWFDPHIURP
WKHQLQHWLHVZLWKPDQ\RIWKHVDPHDUWLVWVDQGEDQGVUHPDLQLQJSRSXODUEHWZHHQWKHWZRGHFDGHV)RUDGHFDGH¿OOHG
ZLWKPXFKVXIIHULQJLQWHUPVRIWKH6HSWHPEHUWKDWWDFNVWZRZDUVLQWKH0LGGOH(DVWDQGDQHFRQRPLFGRZQWXUQ
DORWRIWKHPXVLFKDGWRVWULNHD¿QHEDODQFHEHWZHHQXSEHDWDQGRSWLPLVWLFZKLOHVWLOOUHÀHFWLQJWKHSDLQWKDWPDQ\
H[SHULHQFHG6RPHRIWKHPRUHSRSXODUJHQUHVRIWKHGHFDGHLQFOXGHG'DQFH3RS,QGLH5RFNDQG(PR

100055 105
105
BLOCK 3 I was listening to music…
Popular Genres:'DQFH3RS,QGLH5RFN(PR3RS3XQN&RQWHPSRUDU\5 %+LS+RS5HJJDHWRQ(OHFWURQLFD
+DUG 5RFN$OWHUQDWLYH 0HWDO 1HZ :DYH 5HYLYDO 7HHQ 3RS %R\ %DQGV ,QWHUQHW 6WDUV 'LVQH\$UWLVWV$GXOW
Contemporary, Country, Country-Pop, British Soul, Latin Pop

Popular Artists:(PLQHP6HDQ3DXO5LKDQQD0LOH\&\UXV-HVVLFD6LPSVRQ-HQQLIHU/RSH].DQ\H:HVW-D\=
%H\RQFH7D\ORU6ZLIW%ODNH6KHOWRQ0LUDQGD/DPEHUW.HOO\&ODUNVRQ/LQNLQ3DUN7KH.LOOHUV0DURRQ$OLFLD
.H\V2XWNDVW/DG\*DJD-XVWLQ7LPEHUODNH%ULWQH\6SHDUV&DUULH8QGHUZRRG&KULVWLQD$JXLOHUD3LQN1RUDK
-RQHV&ROGSOD\6KDNLUD0RGHVW0RXVH7KH:KLWH6WULSHV'HDWK&DEIRU&XWLH)DOO2XW%R\3DUDPRUH3DQLF
$WWKH'LVFR$P\:LQHKRXVH-RVV6WRQH7RE\.HLWK.LG5RFN'L[LH&KLFNV'HVWLQ\
V&KLOG/HRQD/HZLV
)OR5LGD7KH-RQDV%URWKHUV-XVWLQ%LHEHU/DG\*DJD.DW\3HUU\$YULO/DYLJQH0LFKHOOH%UDQFK7KH6KLQV
%OLQN6WDLQG6\VWHPRID'RZQ.RUQ

b) Use the verbs to complete the sentences.

UHÀHFWHGHPHUJHGFKDQJHGZHUH

0XVLFBBBBBBBBBBBBBBBBBBGUDPDWLFDOO\VLQFHWKHV
0XVLFRIWKH
VBBBBBBBBBBBBBBBBWKHEHJLQQLQJVRIPDMRUVRFLDOFKDQJHV
7KHSRSXODUJHQUHVRIWKH¶VBBBBBBBBBBBBBBBIRONJDUDJHURFNSRSHWF
7KHGHFDGHRIWKH¶VKHDYLHUURFNPXVLFDQGSXQNURFNBBBBBBBBBBBBBBBB

c) In teams of two, think of the type of music you listened when you were in elementary, junior high and
now that you are in high school. What type of genre you listened? What was the most popular artist in
those years? Write it down.

_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________

106 10
1106
06
Colegio de Bachilleres del Estado de Sonora
Inglés 3

$&7,9,7<
SD1-B3

2.- Simple past

a) Team work: In teams of four, search of how your life was when you were in elementary and junior high
school. Think about, your house, how you dressed, what you ate, what you did in your free-time etc. Present
it to class. See rubrics for oral presentation.

Grammar reference
Simple past

:HXVHWKHVLPSOHSDVWWRWDONDERXWDFWLRQVWKDWKDSSHQHGDWDFHUWDLQWLPHLQWKHSDVW
Example
1. Music was dramatically changed by the introduction of MTV in 1980´s.
2. I worked as a school teacher last year.

b) Look at the examples, explain the difference between the verbs in sentence 1 and 2. Write it down.
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
_________________________________________________________________________________________
_________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
______________________________________________________________________

100077 107
107
BLOCK 3 I was listening to music…
Rules to form the past tense.

)RUHYHU\YHUEWKHUHLVRQHIRUPRILWLQWKHSDVWWHQVH([FHSWIRUWKHYHUEWREHZKLFKKDVWZRIRUPV was
and were([DPSOH

ORRN±
,ORRNed
<RXORRNed
+HORRNed
6KHORRNed
,WORRNed
:HORRNed
<RXORRNed
7KH\ORRNed

Rule 1
7RFKDQJHDUHJXODUYHUELQWKHSDVWIRUPMXVWDGG±('DWWKHHQGRIWKHYHUE
([DPSOH
Play – played
:RUN±ZRUNHG
Listen – listened

Rule 2
,IWKHYHUEHQGVLQconsonant + y, drop the –y and add –ied
Cry – Cried

Rule 3
,IWKHYHUEHQGVLQ–eMXVWDGG–d.
Practice – practiced

Rule 4
,IWKHYHUEVHQGVLQFRQVRQDQWYRZHOFRQVRQDQWGRXEOHWKHODVWFRQVRQDQW
Hug – hugged
Rub – rubbed

7KHUHDUHVRPHH[FHSWLRQVOLNHRSHQ±RSHQHG

F ,QYHVWLJDWHZK\VRPHYHUEKDYHWKLVH[FHSWLRQOLNHRSHQ±RSHQHG:ULWHLWGRZQ
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
____________________________________________________________________________

108 10
1108
08
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Rule 5
)RULUUHJXODUYHUEVWKHUHDUHQRUXOHV
([DPSOH
Grow – grew
/HIW±OHDYH
Eat – ate
Be – was/were
Do – did
/RRNDWWKHYRFDEXODU\VHFWLRQIRUWKHOLVWRILUUHJXODUYHUEV

Negative form
)RUWKH1HJDWLYHIRUPDGGGLG DX[LOLDU\ QRW
Example

I did not work as a teacher or I


didn’t workDVDWHDFKHU
You did not do\RXUKRPHZRUNor
You didn’t do\RXUKRPHZRUN

G :KDWKDSSHQVWRWKHYHUE"([SODLQDQGZULWHLWGRZQ
______________________________________________________________________
______________________________________________________________________
______________________________________________________________________
______________________________________________________________________
_____________________________________________________

Interrogative form

)RUWKH,QWHUURJDWLYHIRUPDGGGLG DX[LOLDU\ ([DPSOH

Did you work DVDWHDFKHU"


Did you do\RXUKRPHZRUN"

H :KDWKDSSHQVWRWKHYHUE"([SODLQDQGZULWHLWGRZQ,QYHVWLJDWHWKHSRVVLEOHVKRUW
DQVZHUV
______________________________________________________________________
______________________________________________________________________
______________________________________________________________________
______________________________________________________________________
______________________________________________________________________
_____________________________________________________

100099 109
109
BLOCK 3 I was listening to music…
3URQXQFLDWLRQ¿QDO–edVRXQGHQGLQJV

7KHUHDUHWKUHHGLIIHUHQWSURQXQFLDWLRQVRXQGVIRUUHJXODUYHUEVLQWKHVLPSOHSDVWWHQVH

 :KHQWKHbase formRIWKHYHUEVHQGZLWKvoiced soundsOPQEYJZY\]UZHSURQRXQFH–


ed as “d´
study- studied [d]

 :KHQWKHbase formRIWKHYHUEVHQGZLWKvoiceless soundsS±INVVKFK[ZHSURQRXQFH–ed


as “t”.
decide – decided [Id]

 :KHQWKHbase formRIWKHYHUEVHQGZLWK“t” or “d” sounds, we prounce –ed as “id”

ORRNORRNHG[t]

/LVWHQDQGUHSHDW2EVHUYHWKHSURQXQFLDWLRQRIWKHregular verbs in the


Track #8 SDVWWHQVH

[t] [d] [Id]


Dress dressed rain rained decide decided
:DWFK ZDWFKHG  VWXG\ VWXGLHG   FHOHEUDWHFHOHEUDWHG
)L[ ¿[HG   SUHSDUHSUHSDUHG  GHPDQGGHPDQGHG
+HOS KHOSHG   HQMR\ HQMR\HG  YLVLWYLVLWHG
Laugh laughed page paged land landed

want > wanted [Id]


ZRUN !ZRUNHG [t] warn > warned [d]
land > landed [Id]

J :ULWHWKHSKRQHWLFV\PEROIRUHDFKHGYHUEHQGLQJ3D\FORVHDWWHQWLRQWRWKH¿UVWWKUHHH[DPSOHV8VH
the chart for reference.

Started [Id] Continued [d] Reached [t]

Permitted ____ Stopped ____ /RFNed ____ Needed ____ /RRNed ____ 'LVFRYHUed
Cried ____ Paged ____ Realized ____ Hesitated ____ :DVKed ____ ____

painted ____ ZRUNed ____ noticed ____ REVHUYHd ____ closed ____ Examined ____

110 11
1110
10
Colegio de Bachilleres del Estado de Sonora
Inglés 3

s. Write the
sen ten ce . Th en, listen to the sentence
h) Underline the verb in ea ch done for you.
th e ve rb on th e sp ac e. Number 1 is already
number of syllables in

rmitte dXVWROHDYHFODVVHDUO\
 _____The teacher pe

WKHI RRGVWDQGHDUO\WRGD\
 BBBBB0D\WHFORVHG

\
UVFK RROXQLIRUPVRQ6DWXUGD
 BBBBB:HZDVKHGRX

RRP WZRZHHNVDJR
 BBBBB,SDLQWHGP\U

WREX\D
 BBBBB,VWRSSHGDW

HDQGKXUWKLVDQ NOH
ORWZKHQKHIHOORIIKLVELN
 BBBBB$QGUHFULHGD

\MRNHV
PXFKZKH Q0U&DUULORWROGXVIXQQ
 BBBBB:HODXJKHGVR

ZGD\VDJR
K\VLF VDQG%LRORJ\SURMHFWDIH
 BBBBB,VWDUWHGP\3

W
DOO\L QWHUHVWLQJPRYLHODVWQLJK
 BBBBB,ZDWFKHGDUH

U
DPLO\ DQGIULHQGVODVW'HFHPEH
\thELUWKGD\ZLWKP\I
 BBBBB,FHOHEUDWHGP

1111 111
111
BLOCK 3 I was listening to music…
Homework 1: Go to page 126

i) Use the card from homework 1, so you can play bingo.

Let’s play Bingo!

,QVWUXFWLRQV
 7KHWHDFKHUZLOOKDYHDGHFNRIFDUGVZLWKWKHLUUHJXODUIRUPRIWKH
YHUEVLQVLPSOHSDVW
 :KHQ\RXKHDUGWKHSDVWWHQVHRIWKHYHUEWKDW\RXKDYHRQWKHFDUG
\RXFDQSXWDWRNHQ
 Full card wins!

j) Team work: In teams of four search of how your life was when you were in elementary and junior high
school. Think about, your house, how you dressed, what you ate, what you did in your free-time etc. Present
it to class. See rubrics for oral presentation.

k) Pair work: In teams of two say what you know about these famous people. What are they famous for?
Write the information on the lines.

_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
____________________________________________________________

112 11
1112
12
Colegio de Bachilleres del Estado de Sonora
Inglés 3

_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
____________________________________________________________

_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
____________________________________________________________

_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
____________________________________________________________

Homework 1: Go to page 126

111133 113
113
BLOCK 3 I was listening to music…
Start Up Activities Didactic Sequence 2
͞t,dtZd,zK/E'͍͟

ACTIVITY 3 Track #9
6'%

a) Listen and read the following letters that were written to Santiago. Underline the words that you don’t
know. Look them up in the dictionary.

May 28th

'HDU6DQWLDJR

/HW PH WHOO \RX DQ HPEDUUDVVLQJ VWRU\ WKDW KDSSHQHG D PRQWK DJR 0\ IULHQGV DQG , ZHQW WR D SDUW\ ODVW
ZHHNHQG:HZHUHKDYLQJIXQ:HZHUHSOD\LQJGDQFLQJDQGVLQJLQJ6XGGHQO\DJLUODUULYHVDQGVDLGWR
ORZHUGRZQWKHPXVLF:HGHFLGHGWRLJQRUHKHUVRVKHZHQWGLUHFWO\ZHUHWKHPXVLFZDVDQGWXUQLWRII7KHQ
VKHVDLGWKDWVKHFRXOGQ¶WVOHHS,WZDVP\IULHQGVPRP+RZHPEDUUDVVLQJ

June 1st.

'HDU6DQWLDJR

,QHHG\RXUKHOS,GRQ¶WNQRZZKDWWRGR,KDGDYHU\GLI¿FXOWH[DPODVWZHHNRI+LVWRU\6RLQP\KRXVH,
GHFLGHGWRPDNHDVXPPDU\RIWKHLPSRUWDQWIDFWVVR,ZRXOGQ¶WIRUJHW,ZHQWWRVFKRROWKHQH[WGD\WRWDNH
WKHWHVWVREHIRUHWKHWHDFKHUDUULYHG,ZDVVWXG\LQJIURPWKHVXPPDU\WKDW,FUHDWHG7KHWHDFKHUDUULYHGVR,
SXWDOOP\QRWHVDQGERRNVGRZQP\GHVN7KHWHDFKHUJDYHXVWKHWHVWDQGDERXWPLQXWHVODWHUVKHFDPH
WRZDUGVPHDQGDVNPHLI,ZDVFRS\LQJ,VDLGQRVRVKHOHDQGRZQDQGJDYHPHWKHVXPPDU\,GLGQ¶WUHDOL]H
WKDWWKHVXPPDU\ZDVQH[WWRPHEHFDXVHLWIHOOGRZQIURPWKHGHVN,WU\WRH[SODLQKHUEXWVKHWKRXJKW,ZDV
FRS\LQJ+HOSPH:KDWVKRXOG,GR"

b) Complete the sentences with the correct verb. Fill with: dancing, arrived, playing, studying, singing and
copying.
:HZHUHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBDQGBBBBBBBBBBBBBBBBBBBBB
%HIRUHWKHWHDFKHUDUULYHG,ZDVBBBBBBBBBBBBBBIURPWKHVXPPDU\
,WU\WRH[SODLQEXWWKHWHDFKHUWKRXJKW,ZDVBBBBBBBBBBBBBBBBBB

114 11
1114
14
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Grammar reference
3DVWSURJUHVVLYH

:HXVHWKHSDVWSURJUHVVLYHWRWDONDERXWDFWLRQVWKDWZHUHLQSURJUHVVDWDFHUWDLQWLPHLQWKH
SDVW
For short, completed actions in the past
7RWDONDERXWSUHGLFWLRQV

)RUPPersonal pronoun + simple past of the verb to be (was/were) + main verb +


-ing
Example
1.- I was listening WRPXVLF
2.- They were running IURPWKHGRJ

c) Look at the examples. How do you think the negative form is done? Write it down.
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
____________________________________________________

Negative form

)RUWKH1HJDWLYHIRUPZHXVH

Personal pronoun +simple past of the verb to be (was/were) +not + main verb + -ing
I was not GUDZLQJor I wasn’tGUDZLQJ
You were notZRUNLQJor You weren’tZRUNLQJ

Interrogative form

)RUWKH,QWHUURJDWLYHIRUPZHXVH

simple past of the verb to be (was/were) + personal pronoun + main verb + -ing
Was KHUXQQLQJIURPWKHGRJ"

Were \RXZRUNLQJ"
d) Investigate and write down the possible short answers.
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
___________________________________________________

111155 115
115
BLOCK 3 I was listening to music…
Spelling rules for the past progressive.
Rule 1
)RUHYHU\YHUEZHDGG±LQJ
([DPSOH
Play – playing
:RUN±ZRUNing
Listen – listening

Rule 2
,IWKHYHUEHQGVLQe, drop the e and add –ing
Dance – Dancing

Rule 3
2QHV\OODEOHYHUEVHQGLQJLQvowel + consonant double consonant and add ing.
Sit – Sitting

Rule 4
,IWKHUHLVDVWUHVVHGYRZHOEHWZHHQtwo consonants double the consonant and add ing
Begin – beginning
7KHUHDUHVRPHH[FHSWLRQVOLNHWUDYHO±WUDYHOLQJ

e) Investigate if there are more exceptions like travel – traveling. Write it down.
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
_____________________________________________________________________

of the verb.
correct – ing form
f) Write down the

VHH
PDNH
VZLP
SXW
WDON

116 11
1116
16
Colegio de Bachilleres del Estado de Sonora
Inglés 3

g) Make a sentence for each verb in the past progressive.

BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

h) Look at the picture. Write down as many sentences in the past progressive as possible. Use the following
verbs.

PLAY READ CATCH BUY TALK LAUGH LOOK HOLD SWIM

_______________________________________________
_______________________________________________
_______________________________________________
_______________________________________________
_______________________________________________
_______________________________________________
_______________________________________________
_______________________________________________
_______________________________________________
_______________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
________________________________________________________________________

Homework 2: Go to page 127

111177 117
117
BLOCK 3 I was listening to music…
Start Up Activities Didactic Sequence 3
͞/t^td,/E'DKs/t,E͙͟

ACTIVITY 4 Track #10


SD3-B3

a) Listen and read the following story.

THE THREE DOLLS


by Stephen on March 18, 2014
Taken from: http://academictips.org/blogs/the-three-dolls

$VDJHSUHVHQWHGDSULQFHZLWKDVHWRIWKUHHVPDOOGROOV7KHSULQFHZDVQRWDPXVHG
³$P,DJLUOWKDW\RXJLYHPHGROOV"´±+HDVNHG
³7KLVLVDJLIWIRUDIXWXUHNLQJ´6DLGWKHVDJH³,I\RXORRNFDUHIXOO\\RX¶OOVHHDKROHLQWKHHDURIHDFK
GROO´
7KHVDJHKDQGHGKLPDSLHFHRIVWULQJ³3DVVLWWKURXJKHDFKGROO´±+HVDLG
,QWULJXHGWKHSULQFHSLFNHGXSWKH¿UVWGROODQGSXWWKHVWULQJLQWRWKHHDU,WFDPHRXWIURPWKHRWKHU
HDU³7KLVLVRQHW\SHRISHUVRQ´VDLGWKHVDJH³ZKDWHYHU\RXWHOOKLPFRPHVRXWIURPWKHRWKHUHDU+H
GRHVQ¶WUHWDLQDQ\WKLQJ´
7KHSULQFHSXWWKHVWULQJLQWRWKHVHFRQGGROO,WFDPHRXWIURPWKHPRXWK³7KLVLVWKHVHFRQGW\SHRI
SHUVRQ´VDLGWKHVDJH³ZKDWHYHU\RXWHOOKLPKHWHOOVHYHU\ERG\HOVH´
7KHSULQFHSLFNHGXSWKHWKLUGGROODQGUHSHDWHGWKHSURFHVV7KHVWULQJGLGQRWFRPHRXW³7KLVLVWKH
WKLUGW\SHRISHUVRQ´VDLGWKHVDJH³ZKDWHYHU\RXWHOOKLPLVORFNHGXSZLWKLQKLP,WQHYHUFRPHVRXW´
³:KDWLVWKHEHVWW\SHRISHUVRQ"´±$VNHGWKHSULQFH
7KHVDJHKDQGHGKLPDIRXUWKGROOLQDQVZHU:KHQWKHSULQFHSXWWKHVWULQJLQWRWKHGROOLWFDPHRXW
IURPWKHRWKHUHDU
³'RLWDJDLQ´±6DLGWKHVDJH
7KHSULQFHUHSHDWHGWKHSURFHVV7KLVWLPHWKHVWULQJFDPHRXWIURPWKHPRXWK:KHQKHSXWWKHVWULQJLQ
DWKLUGWLPHLWGLGQRWFRPHRXWDWDOO
³7KLVLVWKHEHVWW\SHRISHUVRQ´VDLGWKHVDJH³7REHWUXVWZRUWK\DPDQPXVWNQRZZKHQQRWWROLVWHQ
ZKHQWRUHPDLQVLOHQWDQGZKHQWRVSHDNRXW´
$XWKRU8QNQRZQ

118 11
1118
18
Colegio de Bachilleres del Estado de Sonora
Inglés 3

b) Exercises:

/RRNIRUQHZZRUGLQ³WKHWKUHHGROOV´
:ULWHWKHPGRZQDQGORRNLQWKHGLFWLRQDU\IRUWKHLUPHDQLQJ
_______________________________________________________________________
_______________________________________________________________________
_______________________________________________________________________
_______________________________________________________________________
_______________________________________________________________________
_______________________________________________________________________
_____________________________________________

:KDWNLQGRISHUVRQDUH\RX":KDWGR\RXWKLQNDERXWWKHVWRU\"
_______________________________________________________________________
_______________________________________________________________________
_______________________________________________________________________
_______________________________________________________________________
_______________________________________________________________________
_______________________________________________________________________
_______________________________________________________________________
___________________________________________

/RRNIRUDOOWKHYHUEVLQSDVWWHQVH&KDQJHWKHPLQWRLWVLQ¿QLWLYH
_______________________________________________________________________
_______________________________________________________________________
_______________________________________________________________________
_______________________________________________________________________
_______________________________________________________________________
_______________________________________________________________________
_____________________________________________

111199 119
119
BLOCK 3 I was listening to music…
Grammar reference

5HPHPEHUWKDW

:HXVHWKHVLPSOHSDVWWRWDONDERXWDFWLRQVWKDWKDSSHQHGDWDFHUWDLQWLPHLQWKHSDVWDQGSDVWSURJUHVVLYH
WRWDONDERXWDFWLRQVWKDWZHUHLQSURJUHVVDWDFHUWDLQWLPHLQWKHSDVW

:HDOVRXVHVLPSOHSDVWWRWDONDERXWDFWLYLWLHVWKDWLQWHUUXSWHGDQGDFWLRQWKDWZDVLQSURJUHVV

([DPSOH

I was listening to music when my mom arrived.

:HXVHUHODWLYHSURQRXQV³ZKHQ´DQG³ZKLOH´WRGHVFULEHDFWLRQVWKDWKDSSHQHGLQWKHSDVW

,was listening to music when my mom arrived or

when I was listening to music my mom arrived.

,was listening to music while my mom was cleaning or

While I was listening to music my mom was cleaning

c) What is the difference between sentence 1 and 2.

120 12
1120
20
Colegio de Bachilleres del Estado de Sonora
Inglés 3

6LPSOHSDVWYV3DVWSURJUHVVLYH

d) Complete the sentences using the verb in parenthesis with the correct tense (simple past and past
progressive). Compare answers with your partner
'LDQDBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB FRRN ZKHQWKH\BBBBBBBBBBBBBBBB NQRFN WKHGRRU
7KHFKLOGUHQBBBBBBBBBBBBBBBBBBBBBBBBB SOD\ ZKLOHWKHPRWKHUBBBBBBBBBBBBBBBBBBB FOHDQ 
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBB \RXPRS ZKHQ,BBBBBBBBBBBBBBBB DUULYH "
 6DQWLDJR DQG , BBBBBBBBBBBBBBBBBB KDYH  GLQQHU DW &KLOWHSLQR¶V ZKHQ WKH DFFLGHQW BBBBBBBBBBBBBBBB
RFFXU 
:KLOH,BBBBBBBBBBBBBBBBBBBBB ZDLW IRU\RXP\PRPBBBBBBBBBBBBBBBBB FDOO 

Track #11

e) Listen and read the following short story.

It was September 3rdZKHQP\SDUHQWVZHQWIRUDYDFDWLRQ,ZDVYHU\H[FLWHGWREHDORQHQRUXOHVQRGR


WKLVGRWKDW

0\PRPDQGGDGOHIWVR,GHFLGHGWRFDOODOOP\IULHQGV'DOLD'LDQD/RXUGHV9LDQH\DQG*LVHOD:HUHQWHG
VRPHPRYLHVERXJKWVRPHSRSFRUQDQGVRGD:HZHUHZDWFKLQJDPRYLHZKHQDOORIDVXGGHQZHKHDUG
DVWUDQJHQRLVHIURPWKHRWKHUURRP,GHFLGHGWRJRORRNZKDWZDVKDSSHQLQJEXWWKHUHZDVQRWKLQJWKH
ZLQGRZZDVRSHQVR,¿JXUHRXWLWZDVWKHZLQGthen,FORVHGWKHZLQGRZDQGZHQWEDFNWRWKHIDPLO\URRP

:HFRQWLQXHGZDWFKLQJWKHPRYLHDQGafter a whileZHKHDUGDVTXHDNLQJQRLVHFRPLQJIURPWKHNLWFKHQ
¿UVWZHWKRXJKWLWZDV*LVHODPDNLQJSRSFRUQEXWVKHZDVULJKWQH[WWRPH'DOLDGHFLGHGWRJRDQGFKHFN
ZKDWZDVKDSSHQLQJ

6KHZHQWWRWKHNLWFKHQZKHQVXGGHQO\«

1221 121
121
BLOCK 3 I was listening to music…
f) Complete the following Exercises.

,GHQWLI\ZKHQDQGZKLOHLQWKHVWRU\8QGHUOLQHLQUHGWKHSDVWSURJUHVVLYHDQGZLWKEOXHWKHVLPSOHSDVW

 :KDW GR \RX WKLQN KDSSHQV QH[W" :ULWH DQ HQGLQJ IRU WKH VWRU\ 'RQ¶W IRUJHW WR XVH VLPSOH SDVW DQG SDVW
SURJUHVVLYH

__________________________________________________________________________________________
__________________________________________________________________________________________
_________________________________________________________________________________________
_________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
_____________________________________________________________

/RRNDWWKHZRUGVLQEROG:KDWGR\RXWKLQNWKH\DUH":ULWHWKHLUPHDQLQJLQ\RXUODQJXDJH

__________________________________________________________________________________________
__________________________________________________________________________________________
_________________________________________________________________________________________
_________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
_____________________________________________________________

122 12
1122
22
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Grammar reference
/LQNLQJZRUGV

:HXVHWKHZRUGV¿UVWWKHQDIWHUODWHUDIWHUDZKLOHWROLQNWZRRUPRUHLGHDV

Example:

First,GRP\KRPHZRUNthen,FOHDQXS

After ZHVDZWKHPRYLHZHZHQWIRUDQLFHFUHDP

Later WKDWDIWHUQRRQP\PRPDUULYHG

After a whileRIQRWGRLQJH[HUFLVHZHZHQWIRUDZDON

g) Are there more linking words in english? Look for more in the Internet and write them down. Write the
meaning in spanish and an example for each one.

__________________________________________________________________________________________
__________________________________________________________________________________________
_________________________________________________________________________________________
_________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________

122233 123
123
BLOCK 3 I was listening to music…
INTEGRATING ACTIVITY

Create a story

,QVWUXFWLRQV,QWHDPVRIIRXUEULQJWRWKHFODVV

0DJD]LQHVQHZVSDSHUHWFDVPDQ\DV\RXFDQ
6FLVVRUV
*OXH
7DSH
0DUNHUVFRORUSHQFLOVFUD\RQVHWF
&RQVWUXFWLRQSDSHURUZDOOFKDUW

&UHDWHDVWRU\ VHHUXEULFV XVLQJWKHVLPSOHSDVWDQGSDVWSDUWLFLSOH'RQ¶WIRUJHWWRXVHWKHOLQNLQJZRUGVZKHQ


DQGZKLOH&XWLPDJHVSDVWHDQGZULWHGRZQWKHVWRU\LQ\RXUZDOOFKDUWRUFRQVWUXFWLRQSDSHU3UHVHQWLWWRFODVV

124 12
1124
24
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Read the text. UnderlineWKHYHUEVLQWKHVLPSOHSDVWWHQVH&LUFOHWKHYHUEVLQ


WKHSDVWSURJUHVVLYHWHQVH

2Q -DQXDU\   WKH &ROXPELD VSDFH VKXWWOH OHIW RQ D VFLHQFH PLVVLRQ
RUELWLQJWKH(DUWKZLWKVHYHQFUHZPHPEHUVDERDUG,WVWD\HGLQVSDFHIRU
GD\V2Q)HEUXDU\LWZDVWUDYHOLQJEDFNWRHDUWKDIWHUFRPSOHWLQJ
LWV PLVVLRQ 1$6$ UHFHLYHG LWV ODVW FRPPXQLFDWLRQ IURP WKH &RORPELD RQ
)HEUXDU\DWDP:KLOHWKH&RORPELDZDVÀ\LQJRYHUHDVW7H[DVMXVW
PLQXWHVIURPLWVODQGLQJLQ)ORULGDLWGLVLQWHJUDWHG)DPLOLHVZKRZHUH
KDSSLO\ZDLWLQJIRUWKHUHWXUQRIWKHLUUHODWLYHVDWWKH.HQQHG\6SDFH&HQWHULQ
)ORULGDUHFHLYHGWKHWUDJLFQHZV3HRSOHIURPDOORYHUWKHZRUOGZHUHVKRFNHG
DQGVDGGHQHGE\WKLVWUDJLFORVVRIOLYHV

2Q-DQXDU\WKH&ROXPELDVSDFHVKXWWOHBBBBBBBBBBBBBRQDVFLHQFHPLVVLRQ
D ZDVLQLWLDWLQJ  E GHSDUWHG  F DUULYHG  G EHJDQ

7KHVSDFHVKXWWOHBBBBBBBBBBBBBBWKH(DUWKGXULQJVL[WHHQGD\V
D RUELWHG   E DEDQGRQHG  F ODQGHG  G OHIW

7KHVSDFHVKXWWOHBBBBBBBBBBBBBBBBBBBEDFNWR(DUWKDIWHUBBBBBBBBBBBBBBBBBBBBBLWVPLVVLRQ
D ZDVGHSDUWLQJ«««««LQLWLDWLQJ
E ZDVDUULYLQJ««««««EHJLQQLQJ
F ZDVUHWXUQLQJ«««««¿QLVKLQJ
G ZDVODQGLQJ««««««FRQWLQXLQJ

BBBBBBBBBBBBBBBBWKH&RORPELDBBBBBBBBBBBBBBBBRYHUHDVW7H[DVLWBBBBBBBBBBBBBBB
D %HIRUH«««««ZDVDVFHQGLQJ«««««IHOOLQWRSLHFHV
E $IWHU««««««ZDVFLUFOLQJ«««««««IUDJPHQWHG
F :KHQ««««««ZDVURFNHWLQJ««««««FROODSVHG
G $WWKHVDPHWLPH««««ZDVVRDULQJ«««««IHOODSDUW

7KHIDPLOLHVRIWKHFUHZPHPEHUVBBBBBBBBBBBBBBBBBBBDERXWWKHBBBBBBBBBBBBBBBBQHZVDQGWKH\ZHUH
BBBBBBBBBBBBBBBBBBBBE\WKHWUDJLFORVVRIWKHLUOLYHV
D LQIRUPHG««««GLVDVWURXV««««««VDG
E ZHUHQRWL¿HG««FDWDVWURSKLF««««KHDUWEURNHQ
F QRWLFHG«««WHUULEOH««««GLVFRQVRODWH
G EHFDPHDZDUHRI«««DZIXO«««««EURNHQKHDUWHG

Circle the correct answer.


7KHSDVWFRQWLQXRXVLVXVHG«
7RGHVFULEHDFWLRQVWKDWZHUHLQSURJUHVVDWDVSHFL¿FWLPHLQWKHSDVW
)RUVKRUWFRPSOHWHGDFWLRQVLQWKHSDVW
7RWDONDERXWSUHGLFWLRQV

122255 125
125
BLOCK 3 I was listening to music…
HOMEWORK 1 Didactic sequence 1. “What did you do yesterday?”

&XWWKHIROORZLQJFDUGVR\RXFDQSOD\ELQJR¿OOLQWKHEODQNVZLWKLUUHJXODUYHUEVLQLQ¿QLWLYH

Be Tell Read Win

Go Run Say Wear

Break Put Drink Teach

Take it to class and don’t forget to take tokens.

2. Oral exposition. ,QGLYLGXDOO\WDONDERXWDVKRUWELRJUDSK\RIDIDPRXVSHUVRQWKLQNDERXWZK\DUH


WKH\IDPRXVIRUDQGH[SODLQZK\\RXFKRRVHWKDWSHUVRQ3UHVHQWLWWRFODVVDQGJLYHWR\RXUWHDFKHU
WKHZULWWHQELRJUDSK\6HHUXEULFVIRURUDOSUHVHQWDWLRQDQGZULWWHQWH[W

126 12
1126
26
Colegio de Bachilleres del Estado de Sonora
Inglés 3

HOMEWORK 2 Didactic sequence 2. What were they doing?

7KLQNDERXWDVSHFLDOPRPHQWWKDW\RXH[SHULHQFHWKLV\HDU:KDWKDSSHQHG":ULWHLWGRZQDQGDGGDSLFWXUH
'RQ¶WIRUJHWWRXVHSDVWSURJUHVVLYH6HHUXEULFVIRUZULWLQJ

__________________________________________________________________________________________
__________________________________________________________________________________________
_________________________________________________________________________________________
__________________________________________________________________________________________
_________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
______________________________________________________________________

122277 127
127
BLOCK 3 I was listening to music…
6(/)&+(&.

:ULWHVHQWHQFHVXVLQJWKHSDVWSURJUHVVLYHDQGVLPSOHSDVWWRGHVFULEHWKHVLWXDWLRQEHORZ7KH¿UVWRQH
is done for you.
Situation: Two days ago, the students at Cobach were all actively working very hard when suddenly a
tremor shook the city.
Ex.
5thVHPHVWHUVWXGHQWVSOD\VRFFHULQWKHIRRWEDOO¿HOG
7KH¿IWKVHPHVWHUVWXGHQWVwere playingVRFFHULQWKHIRRWEDOO¿HOGZKHQWKHWUHPRUshook the city.

7KHIRXUWKVHPHVWHUVWXGHQWVUHKHDUVHWKHLUSOD\VLQWKHDXGLWRULXP

__________________________________________________________________________________________

2QHJURXSUHYLHZSDVWSURJUHVVLYHDQGVLPSOHSDVWLQWKHFODVVURRP

__________________________________________________________________________________________

7KHWXWRUVDQGWKHSULQFLSDOWDONZLWKDJURXSRISDUHQWVLQWKHRI¿FH
__________________________________________________________________________________________

7KHKLVWRU\WHDFKHUDVVHVVVWXGHQWVLQWKHROGOLEUDU\EXLOGLQJ

__________________________________________________________________________________________

2QHRIWKHMDQLWRUVFOHDQWKHUHVWURRPV

__________________________________________________________________________________________

6RPHVWXGHQWVSOD\YROOH\EDOORQWKHVFKRROJURXQGV

__________________________________________________________________________________________

7KHVFKRROGHDQGRWKHLUGDLO\URXQGVLQWKHVFKRRO

__________________________________________________________________________________________

128 12
1128
28
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Match the pictures to their corresponding verbs. Then complete the sentences with appropriate forms of
simple past and past progressive forms. Use negatives where necessary. There are two extra verbs.

5HDG   :DWFK79   6HQGDQHPDLO

7DNHDEDWK    5HOD[   /LVWHQWRPXVLF

 0\PRPBBBBBBBBBBBBBBBFRRNLQJGLQQHU\HVWHUGD\HYHQLQJ6KHBBBBBBBBBBBBBBBBBBBBB
 (OHQDBBBBBBBBBBBBBBBBBBBBDEDWKDWDERXWSPLQWKHHYHQLQJEHFDXVHVKHBBBBBBBBBBBBB KDYH D
ELUWKGD\FHOHEUDWLRQ
 $UWXURBBBBBBBBBBBBBBBBB PLVV KLVUHKHDUVDOSUDFWLFH\HVWHUGD\EHFDXVHKHBBBBBBBBBBBBBBBBBBBBBB
DERRN
 0\XQFOHBBBBBBBBBBBBBBBBBBBBBBBBRQWKHDUPFKDLUEHFDXVHKH
 BBBBBBBBBBBBB ZRUN YHU\KDUGLQKLVVKRS

Read the text and choose the best answer.

&DVVLXV &OD\ ZDV WZHOYH \HDUV ROG DQG OLYHG


LQ /RXLVYLOOH .HQWXFN\ 2QH GD\ KLV EUDQG
QHZ ELNH ZDV VWROHQ ,Q WHDUV KH WROG RI¿FHU
-RH0DUWLQ³,¶PJRLQJWREHDWWKHSHUVRQZKR
VWROH P\ ELNH´ -RH VDLG ³ZHOO WKHQ , ZLOO
WHDFK \RX KRZ WR ¿JKW´ -RH 0DUWLQ ZDV WKH
ER[LQJFRDFKDWWKH&ROXPELDJ\P&DVVLXV
ZHQW WR WKH &ROXPELD J\P DQG WUDLQHG YHU\
KDUG:KHQKHZDVKHZRUHKHDY\ERRWV
DQGKHVKDGRZER[HGRQWKHVWUHHW+HXVHGWR
UDFHVFKRROEXVHVDQGKHGUDQNUDZHJJVLQKLV
PLON+HDFWXDOO\ORYHGER[LQJDQGKHZDQWHG
WRJRWRWKH2O\PSLFV+HZDVDOVRYHU\SROLWH 5RPH &DVVLXV ZRQ WKH JROG PHGDO ,Q  KH EHFDPH
DQG UHOLJLRXV$IWHU VFKRRO KH XVHG WR ZRUN WKHZRUOGKHDY\ZHLJKWFKDPSLRQ+HFKDQJHGKLVQDPHWR
LQ WKH 1D]DUHWK &ROOHJH /LEUDU\ :KHQ WKH 0RKDPPHG$OLDQGMRLQHGWKH0XVOLPV$OLUHIXVHGWRJR
boxing team went to other towns, Cassius WRZDULQ9LHWQDPDQGWKH\WRRNKLVWLWOHDZD\+HZRQKLV
always stayed in his hotel room and read his WLWOHEDFNDJDLQLQZKHQKHIRXJKW*HRUJH)RUHPDQ
ELEOH,QKHZHQWWRWKH2O\PSLFWULDOV LQ=DLUH$IULFD
LQ6DQ)UDQFLVFR&DOLIRUQLD%XWWKHUHZDVD
PDMRUSUREOHP&DVVLXVZDVDIUDLGWRÀ\VRKH 7DNHQDQGDGDSWHGIURP(6/OLEUDU\FRP0LQLELRJUDSKLHV
bought a parachute, wore it on the plane and
SUD\HG LQ WKH DLVOH$W WKH  2O\PSLFV LQ

122299 129
129
BLOCK 3 I was listening to music…
&DVVLXVZDVYHU\DQJU\ZKHQVRPHRQHVWROHKLVQHZELNHVRKH   
D went running for help
E he was crying
F he told the boxing coach at the Olympic gym
G KHERXJKWDQHZELNHWRWUDLQDWWKHJ\P

-RH0DUWLQVDLG³7KHQ,ZLOOWHDFK\RXKRZWR¿JKW³EHFDXVH   
D +HNQHZKHZRXOGEHFRPHULFKE\WUDLQLQJ&DVVLXVWR¿JKWZHOO
E &DVVLXVZDVYHU\VDGDQGZDQWHGWRKLWWKHSHUVRQZKRVWROHKLVELNH
F &DVVLXVDVNHG2I¿FHU-RHWRWUDLQKLPWR¿JKW
G &DVVLXV¶SDUHQWVDVNHG-RHWRWUDLQWKHLUVRQWR¿JKW

:K\GLGKHEX\DSDUDFKXWHWRZHDURQWKHSODQH"    
D %HFDXVHKHZDQWHGWRVKRZDOOWKHSDVVHQJHUVWKDWKHKDGDSDUDFKXWH
E %HFDXVHKHZDVUHDG\WRÀ\RIIWKHSODQH
F %HFDXVHKHZDVSUDFWLFLQJVN\GLYLQJ
G %HFDXVHKHZDVWHUUL¿HGRISODQHV

&DVVLXVZDVDYHU\BBBBBBBBBBBBBBBBBSHUVRQDQGKHZDVBBBBBBBBBBBBB 
D UHVSHFWIXO««««GHYRXW
E GLVUHVSHFWIXO«««XQFRPPLWWHG
F LPSROLWH««««UHOLJLRXV
G SROLWH««««QRQUHOLJLRXV

:KDWGLGKHXVHWRFKDVHZKHQKHZDV\HDUVROG"     
D +LVIULHQGVLQWKH&ROXPELDJ\P
E +LVFRDFK-RH0DUWLQ
F +LVGRJ
G 6FKRROEXVHV

Past tense pronunciation: Choose the correct answer.

Read these sentences aloud and then choose the correct answer and write it in the parenthesis.

7KHpast tenseVRXQGVRIWKHYHUEV“¿QLVKHG”, “watched”, “talked” and “worked´LV 

D [Id] E [d] F  [t]

2QHRIWKHVHpast tenseYHUEVKDYHWKH“[d]”VRXQGDWWKHHQG:KLFKRQHLVLW" 

D YLVLWHGE GHFLGHGF SUDFWLFHGG OLVWHQHG

:KLFKRQHRIWKHVHYHUEVKDYHWKHpast tense pronunciation of “[Id]”" 

D VWXGLHGE VWRSSHGF QHHGHGG FDOOHG

130 13
1130
30
Colegio de Bachilleres del Estado de Sonora
Inglés 3

VOCABULARY BLOCK 3
Didactic sequence 1.
“What did you do yesterday?”

Grammar reference
Simple past

:HXVHWKHVLPSOHSDVWWRWDONDERXWDFWLRQVWKDWKDSSHQHGDWDFHUWDLQWLPHLQWKHSDVW

Example

1.- Music was dramatically change by the introduction of MTV in 1980´s.

2.- I worked as a school teacher last year.

Rules to form the past tense.

)RUHYHU\YHUEWKHUHLVRQHIRUPRILWLQWKHSDVWWHQVH([FHSWIRUWKHYHUEWREHZKLFKKDVWZRIRUPV was and


were([DPSOH
ORRN±
,ORRNed
<RXORRNed
+HORRNed
6KHORRNed
,WORRNed
:HORRNed
<RXORRNed
7KH\ORRNed
Rule 1
7RFKDQJHDUHJXODUYHUELQWKHSDVWIRUPMXVWDGG±('DWWKHHQGRIWKHYHUE
([DPSOH
Play – played
:RUN±ZRUNHG
Listen – listened

Rule 2
,IWKHYHUEHQGVLQconsonant + y, drop the –y and add –ied
Cry – Cried

Rule 3
,IWKHYHUEHQGVLQ–eMXVWDGG–d.
Practice – practiced

Rule 4
,IWKHYHUEVHQGVLQFRQVRQDQWYRZHOFRQVRQDQWGRXEOHWKHODVWFRQVRQDQW
Hug – hugged
Rub – rubbed
7KHUHDUHVRPHH[FHSWLRQVOLNHRSHQ±RSHQHG

1331 131
131
BLOCK 3 I was listening to music…
Rule 5
)RULUUHJXODUYHUEVWKHUHDUHQRUXOHV
([DPSOH
Grow – grew
/HDYH±OHIW
Eat – ate
Be – was/were
Do – did

Negative form
)RUWKH1HJDWLYHIRUPDGGGLG DX[LOLDU\ QRW([DPSOH
I did not work as a teacher or I didn’t workDVDWHDFKHU
You did not do\RXUKRPHZRUNor You didn’t do\RXUKRPHZRUN

Interrogative form
)RUWKH,QWHUURJDWLYHIRUPDGGGLG DX[LOLDU\ ([DPSOH
Did you work DVDWHDFKHU"
Did you do\RXUKRPHZRUN"

LIST OF IRREGULAR VERBS


7DNHQIURPKWWSZZZVDEHULQJOHVFRPDUOLVWVLUUHJXODUYHUEVKWPO

,Q¿QLWLYH Simple Past Past Participle Spanish


arise arose arisen surgir
be was / were been ser
beat beat beaten golpear
become became become FRQYHUWLUVH
begin began begun comenzar
bet bet/betted bet/betted apostar
bite bit bitten morder
bleed bled bled sangrar
blow blew blown soplar
EUHDN EURNH EURNHQ romper
bring brought brought traer
build built built construir
buy bought bought comprar
catch caught caught atrapar
choose chose chosen elegir
come came come YHQLU
cost cost cost costar
creep crept crept arrastrarse
cut cut cut cortar
deal dealt dealt dar, repartir
do did done hacer
draw drew drawn GLEXMDU
dream dreamt/dreamed dreamt/dreamed soñar
GULQN GUDQN GUXQN beber
GULYH GURYH GULYHQ conducir
eat ate eaten comer
fall fell fallen caer

132 13
1132
32
Colegio de Bachilleres del Estado de Sonora
Inglés 3

feed fed fed alimentar


feel felt felt sentir
¿JKW fought fought pelear
¿QG found found encontrar
ÀHH ÀHG ÀHG huir
À\ ÀHZ ÀRZQ YRODU
forget forgot forgotten ROYLGDU
IRUJLYH IRUJDYH IRUJLYHQ perdonar
IRUVDNH IRUVRRN IRUVDNHQ abandonar
freeze froze frozen congelar
get got got tener, obtener
JLYH JDYH JLYHQ dar
go went gone ir
grind ground ground moler
grow grew grown crecer
hang hung hung colgar
KDYH had had tener
hear heard heard oír
hide hid hidden esconderse
hit hit hit golpear
hold held held tener, mantener
hurt hurt hurt herir, doler
NHHS NHSW NHSW guardar
NQHHO NQHOW NQHOW arrodillarse
NQRZ NQHZ NQRZQ saber
lead led led encabezar
learn learnt/learned learnt/learned aprender
OHDYH left left GHMDU
lend lent lent prestar
let let let GHMDU
lie lay lain yacer
lose lost lost perder
PDNH made made hacer
mean meant meant VLJQL¿FDU
meet met met conocer, encontrar
pay paid paid pagar
put put put poner
TXLW TXLWTXLWWHG TXLWTXLWWHG abandonar
read read read leer
ride rode ridden montar, ir
ring rang rung llamar por teléfono
rise rose risen HOHYDU
run ran run correr
say said said decir
see saw seen YHU
sell sold sold YHQGHU
send sent sent HQYLDU
set set set ¿MDU
sew sewed sewn/sewed coser
VKDNH VKRRN VKDNHQ sacudir
shine shone shone brillar
shoot shot shot disparar
show showed shown/showed mostrar
VKULQN VKUDQNVKUXQN VKUXQN encoger

133333 133
133
BLOCK 3 I was listening to music…
shut shut shut cerrar
sing sang sung cantar
VLQN VDQN VXQN hundir
sit sat sat sentarse
sleep slept slept dormir
slide slid slid deslizar
sow sowed sown/sowed sembrar
VSHDN VSRNH VSRNHQ hablar
spell spelt/spelled spelt/spelled deletrear
spend spent spent gastar
spill spilt/spilled spilt/spilled derramar
split split split partir
spoil spoilt/spoiled spoilt/spoiled estropear
spread spread spread extenderse
stand stood stood estar de pie
steal stole stolen robar
sting stung stung picar
VWLQN VWDQNVWXQN VWXQN apestar
VWULNH VWUXFN VWUXFN golpear
swear swore sworn MXUDU
sweep swept swept barrer
swim swam swum nadar
WDNH WRRN WDNHQ tomar
teach taught taught enseñar
tear tore torn romper
tell told told decir
WKLQN thought thought pensar
throw threw thrown lanzar
tread trode trodden/trod pisar
understand understood understood entender
ZDNH ZRNH ZRNHQ despertarse
wear wore worn OOHYDUSXHVWR
ZHDYH ZRYH ZRYHQ WHMHU
weep wept wept llorar
win won won ganar
wring wrung wrung retorcer
write wrote written escribir

3URQXQFLDWLRQ¿QDO–edVRXQGHQGLQJV

7KHUHDUHWKUHHGLIIHUHQWSURQXQFLDWLRQVRXQGVIRUUHJXODUYHUEVLQWKHVLPSOHSDVWWHQVH

:KHQWKHbase formRIWKHYHUEVHQGZLWKvoiced soundsOPQEYJZY\]UZHSURQRXQFH–ed as “d´

study- studied [d]

:KHQWKHbase formRIWKHYHUEVHQGZLWKvoiceless soundsS±INVVKFK[ZHSURQRXQFH–ed as “t”.

ORRNORRNHG[t]
:KHQWKHbase formRIWKHYHUEVHQGZLWK“t” or “d” sounds, we prounce –ed as “id”

decide – decided [Id]

134 13
1134
34
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Didactic sequence 2. “What were they doing?”

:HXVHWKHSDVWSURJUHVVLYHWRWDONDERXWDFWLRQVWKDWZHUHLQSURJUHVVDWDFHUWDLQ
WLPHLQWKHSDVW

For short, completed actions in the past

7RWDONDERXWSUHGLFWLRQV

GRAMMAR
REFERENCE )RUPPersonal pronoun + simple past of the verb to be (was/were) + main
verb + -ing
Past
SURJUHVVLYH Example

1.- I was listening WRPXVLF

2.- They were running IURPWKHGRJ

Negative form
RUPZHXVH
• )RUWKH1HJDWLYHI as/were) +not + mai
n verb +
th e ve rb to be (w
imple past of
Personal pronoun +s
-ing
or I wasn’tGUDZLQJ
I was not GUDZLQJ

RU NL QJ  or You weren’tZRUNLQJ
You we re no tZ

Interrogative form
HIRUPZHXVH
• )RUWKH,QWHUURJDWLY al pronoun + main ve
rb + -ing
/w ere) + pe rs on
rb to be (was
simple past of the ve
PWK HGRJ"
Was KHUXQQLQJIUR

Were \RXZRUNLQJ"

133355 135
135
BLOCK 3 I was listening to music…
Spelling rules for the past progressive.

Rule 1 Rule 3
)RUHYHU\YHUEZHDGG±LQJ 2QHV\OODEOHYHUEVHQGLQJLQvowel + consonant
([DPSOH double consonant and add ing.
Play – playing Sit – Sitting
:RUN±ZRUNing
Listen – listening Rule 4
,IWKHUHLVDVWUHVVHGYRZHOEHWZHHQtwo consonants
Rule 2 double the consonant and add ing
,IWKHYHUEHQGVLQe, drop the e and add –ing Begin – beginning
Dance – Dancing
7KHUHDUHVRPHH[FHSWLRQVOLNHWUDYHO±WUDYHOLQJ

Didactic sequence 3.
“I was watching a movie when…”

5HPHPEHUWKDW

:HXVHWKHVLPSOHSDVWWRWDONDERXWDFWLRQVWKDWKDSSHQHGDWDFHUWDLQWLPHLQWKH
SDVWDQGSDVWSURJUHVVLYHWRWDONDERXWDFWLRQVWKDWZHUHLQSURJUHVVDWDFHUWDLQWLPH
GRAMMAR LQWKHSDVW
REFERENCE :HDOVRXVHVLPSOHSDVWWRWDONDERXWDFWLYLWLHVWKDWLQWHUUXSWHGDQGDFWLRQWKDWZDV
LQSURJUHVV
([DPSOH
I was listening to music when my mom arrived.

:HXVHUHODWLYHSURQRXQV³ZKHQ´DQG³ZKLOH´WRGHVFULEHDFWLRQVWKDW
KDSSHQHGLQWKHSDVW
,was listening to music when my mom arrived or
when I was listening to music my mom arrived.
,was listening to music while my mom was cleaning or
While I was listening to music my mom was cleaning

:HXVHWKHZRUGV¿UVWWKHQDIWHUODWHUDIWHUDZKLOHWROLQNWZRRUPRUHLGHDV
Example:

First,GRP\KRPHZRUNthen,FOHDQXS
GRAMMAR
REFERENCE After ZHVDZWKHPRYLHZHZHQWIRUDQLFHFUHDP

Later WKDWDIWHUQRRQP\PRPDUULYHG

After a whileRIQRWGRLQJH[HUFLVHZHZHQWIRUDZDON

136 13
1136
36
Colegio de Bachilleres del Estado de Sonora
Inglés 3

SELF-EVALUATION

,FDQ« Excellent Good Regular

Talk about past events


using vocabulary of
clothes, food and means
of transportation.

Uses grammar simple


SDVWLQLWVDI¿UPDWLYH
negative and
interrogative form.

Uses grammar past


progressive in its
DI¿UPDWLYHQHJDWLYH
and interrogative form.

Use regular verbs in


past tense.

Uses irregular verbs in


past tense.

Uses simple past and


past progressive in
short stories.

Uses simple past and


past progressive in
sentences.

133377 137
137
BLOCK 3 I was listening to music…
CO-EVALUATION

$VNRQHRI\RXUFODVVPDWHVWRHYDOXDWH\RXUZRUNKDELWV

Needs
Excellent Satisfactory Unsatisfactory
POINTS Improvement Pts.
3 2 0
1

+DVRU Has 3 or 4 Has 4 or more


Attendance Has perfect
Unexcused Unexcused Unexcused
and DWWHQGDQFH
DEVHQFHV DEVHQFHV DEVHQFHV
punctuality ,VQHYHUODWH
,VVHOGRPODWH ,VVRPHWLPHVODWH ,VXVXDOO\ODWH

)UHTXHQWO\ Often Rarely


1HYHU
Participates participates participates
Participation participates
$VNVTXHVWLRQV DVNVTXHVWLRQV DVNVTXHVWLRQV
and appears apathetic
Shows a lot of shows interest shows interest
Discussions towards class
interest in class in class in class
DFWLYLWLHV
DFWLYLWLHV DFWLYLWLHV DFWLYLWLHV

Sometimes )UHTXHQWO\
1HYHUGLVWUDFWV Rarely distracts
Distracting distracts other distracts other
other students or other students or
behavior students or the students or the
WKHWHDFKHU WKHWHDFKHU
WHDFKHU WHDFKHU

Always turns in
Usually turns in Sometimes turns Rarely turns in
DVVLJQPHQWV
Completion DVVLJQPHQWV LQDVVLJQPHQWV DVVLJQPHQWV
Assignments
of Assignments are Assignments are Assignments
are always
assignments usually clear, and sometimes well- show minimal
well-done and
FRPSOHWH GRQH HIIRUW
FRPSOHWH

Attitude Shows a great Shows little


Shows interest in Shows no interest
toward interest in interest in
OHDUQLQJ LQOHDUQLQJ
learning OHDUQLQJ OHDUQLQJ

TOTAL

138 13
1138
38
Colegio de Bachilleres del Estado de Sonora
Inglés 3

ORAL PRESENTATION RUBRIC

7HDFKHU1DPHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

6WXGHQW1DPHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

CATEGORY 4 3 2 1

Pitch was often Pitch was often used Pitch was rarely used
used and it but the emotion it OR the emotion it Pitch was not used to
Pitch
FRQYH\HGHPRWLRQV FRQYH\HGVRPHWLPHV FRQYH\HGRIWHQGLG FRQYH\HPRWLRQ
DSSURSULDWHO\ GLGQRW¿WWKHFRQWHQW QRW¿WWKHFRQWHQW

Pauses were Pauses were Pauses were


HIIHFWLYHO\XVHG HIIHFWLYHO\XVHGRQFH intentionally used but
Pauses were not
Pauses or more times to WRLPSURYHPHDQLQJ ZHUHQRWHIIHFWLYHLQ
LQWHQWLRQDOO\XVHG
LPSURYHPHDQLQJDQG and/or dramatic LPSURYLQJPHDQLQJRU
RUGUDPDWLFLPSDFW LPSDFW GUDPDWLFLPSDFW

Student is able to Student is able to Student is able to Student is unable to


accurately answer accurately answer accurately answer a accurately answer
Comprehension DOPRVWDOOTXHVWLRQV PRVWTXHVWLRQVSRVHG IHZTXHVWLRQVSRVHG TXHVWLRQVSRVHGE\
posed by classmates by classmates about by classmates about classmates about the
DERXWWKHWRSLF WKHWRSLF WKHWRSLF WRSLF

Facial expressions Facial expressions Very little use of


Facial expressions
and body language and body language facial expressions or
and body language are
generate a strong sometimes generate ERG\ODQJXDJH'LG
Enthusiasm used to try to generate
interest and a strong interest and not generate much
enthusiasm, but seem
enthusiasm about the enthusiasm about the interest in topic being
VRPHZKDWIDNHG
WRSLFLQRWKHUV WRSLFLQRWKHUV SUHVHQWHG

Student seems pretty The student is


Student is completely Student does not seem
prepared but might somewhat prepared,
Preparedness prepared and has at all prepared to
KDYHQHHGHGDFRXSOH but it is clear that
REYLRXVO\UHKHDUVHG SUHVHQW
PRUHUHKHDUVDOV UHKHDUVDOZDVODFNLQJ

Presentation is less
Presentation is 5-6 Presentation is 4 Presentation is 3
Time-Limit than 3 minutes OR
PLQXWHVORQJ PLQXWHVORQJ PLQXWHVORQJ
PRUHWKDQPLQXWHV

6SHDNVFOHDUO\DQG 6SHDNVFOHDUO\DQG 6SHDNVFOHDUO\DQG


Often mumbles or can
GLVWLQFWO\DOO  GLVWLQFWO\DOO  GLVWLQFWO\PRVW 
not be understood OR
Speaks Clearly  WKHWLPHDQG  WKHWLPHEXW  RIWKHWLPH
mispronounces more
mispronounces no mispronounces one 0LVSURQRXQFHVQR
WKDQRQHZRUG
ZRUGV ZRUG PRUHWKDQRQHZRUG

133399 139
139
BLOCK 3 I was listening to music…
8VHVYRFDEXODU\ 8VHVYRFDEXODU\ 8VHVYRFDEXODU\
appropriate for the appropriate for the appropriate for the 8VHVVHYHUDO RU
DXGLHQFH([WHQGV DXGLHQFH,QFOXGHV DXGLHQFH'RHV PRUH ZRUGVRU
Vocabulary DXGLHQFHYRFDEXODU\ ZRUGVWKDWPLJKW not include any phrases that are not
E\GH¿QLQJZRUGVWKDW be new to most of the YRFDEXODU\WKDW understood by the
might be new to most audience, but does not might be new to the DXGLHQFH
RIWKHDXGLHQFH GH¿QHWKHP DXGLHQFH

Stands up straight,
ORRNVUHOD[HGDQG Stands up straight
Sometimes stands Slouches and/or
FRQ¿GHQW(VWDEOLVKHV and establishes eye
Posture and Eye up straight and GRHVQRWORRNDW
eye contact with FRQWDFWZLWKHYHU\RQH
Contact establishes eye people during the
HYHU\RQHLQWKH in the room during the
FRQWDFW SUHVHQWDWLRQ
room during the SUHVHQWDWLRQ
SUHVHQWDWLRQ

Shows a full Shows a good Shows a good Does not seem to


Content understanding of the understanding of the understanding of parts understand the topic
WRSLF WRSLF RIWKHWRSLF YHU\ZHOO

Volume is loud Volume is loud Volume is loud


enough to be heard by enough to be heard by enough to be heard by Volume often too soft
Volume all audience members all audience members all audience members to be heard by all
throughout the DWOHDVWRIWKH DWOHDVWRIWKH DXGLHQFHPHPEHUV
SUHVHQWDWLRQ WLPH WLPH

Usually listens to,


Almost always listens Often listens to, Rarely listens to,
shares with, and
to, shares with, and shares with, and shares with, and
supports the efforts of
Collaboration with supports the efforts of supports the efforts supports the efforts of
RWKHUVLQWKHJURXS
Peers RWKHUVLQWKHJURXS of others in the group RWKHUVLQWKHJURXS
Does not cause
7ULHVWRNHHSSHRSOH but sometimes is not a Often is not a good
?ZDYHV?LQWKH
ZRUNLQJZHOOWRJHWKHU JRRGWHDPPHPEHU WHDPPHPEHU
JURXS

140 14
1140
40
Colegio de Bachilleres del Estado de Sonora
Inglés 3

58%5,&6)25:5,7,1*

GOOD

Award 5 to 7 points if:


• :ULWLQJLVGHYHORSHGDQGGRHVQRWDSSHDUWRWDNHPXFKHIIRUW
• 7KHSXUSRVHDQGDLPRIWKHZULWLQJLVFOHDU
• 7KHZULWLQJXVXDOO\ÀRZVDWERWKWKHSDUDJUDSKDQGVHQWHQFHOHYHO
• 7KHZRUGVFKRVHQDUHXVXDOO\DSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
• 7KHYRLFHRIWKHDXWKRULVXVXDOO\FOHDUDQGXVXDOO\FRPHVWKURXJKVWURQJO\
• The organization is generally appropriate for the type of piece being written
• ,QJHQHUDOVWDQGDUGZULWLQJUXOHVDUHIROORZHGEXWWKHUHDUHDIHZHUURUVLQJUDPPDUDQGRUSXQFWXDWLRQ

VERY GOOD

Award 8 to 10 points if:


• The purpose and aim of the writing are clear
• 7KHZULWLQJÀRZVDWERWKWKHSDUDJUDSKDQGVHQWHQFHOHYHO
• 7KHYRLFHRIWKHDXWKRULVFOHDUDQGFRPHVWKURXJKVWURQJO\
• 7KHZRUGVFKRVHQDUHDSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
• 7KHFRQYHQWLRQVRIVWDQGDUGZULWLQJDUHXVXDOO\IROORZHG

EXCELLENT

Award 20 points if:


• :ULWLQJLVIXOO\GHYHORSHGDQGDSSHDUVHIIRUWOHVV
• 7KHSXUSRVHDQGDLPRIWKHZULWLQJDUHYHU\FOHDU
• 7KHZULWLQJDOZD\VÀRZVDWERWKWKHSDUDJUDSKDQGVHQWHQFHOHYHO
• 7KHYRLFHRIWKHDXWKRULVYHU\FOHDUDQGFRPHVWKURXJKVWURQJO\
• 7KHZRUGVFKRVHQDUHYHU\DSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
• 7KHRUJDQL]DWLRQLVYHU\DSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
• 7KHUXOHVRIVWDQGDUGZULWLQJDUHIROORZHG

TOTAL: _______
  

Students’ composition must have the appropriate content for the topic, and logically accurate vocabulary.

1441 141
141
BLOCK 3 I was listening to music…
RUBRIC CREATION OF A STORY

CATEGORY 4 3 2 1

0RVWIDFWVSUHVHQWHG
Almost all facts 7KHUHDUHVHYHUDO
All facts presented in in the story are
Accuracy of Facts presented in the story factual errors in the
WKHVWRU\DUHDFFXUDWH DFFXUDWH DWOHDVW
DUHDFFXUDWH VWRU\
 

The story contains The story contains a The story contains a


There is little
PDQ\FUHDWLYHGHWDLOV IHZFUHDWLYHGHWDLOV IHZFUHDWLYHGHWDLOV
HYLGHQFHRIFUHDWLYLW\
and/or descriptions and/or descriptions and/or descriptions,
LQWKHVWRU\7KH
Creativity that contribute to the that contribute to the but they distract from
author does not seem
UHDGHU?
VHQMR\PHQW UHDGHU?
VHQMR\PHQW WKHVWRU\7KHDXWKRU
WRKDYHXVHGPXFK
The author has really The author has used has tried to use his
LPDJLQDWLRQ
XVHGKLVLPDJLQDWLRQ KLVLPDJLQDWLRQ LPDJLQDWLRQ

Original illustrations Original illustrations


are detailed, are somewhat Original illustrations Illustrations are not
Illustrations DWWUDFWLYHFUHDWLYH GHWDLOHGDWWUDFWLYH relate to the text on present OR they are
and relate to the text and relate to the text WKHSDJH QRWRULJLQDO
RQWKHSDJH RQWKHSDJH

The story contains The story contains The story contains The story contains no
Use of linking words PDQ\OLQNLQJZRUGV VRPHOLQNLQJZRUGV DIHZOLQNLQJZRUGV OLQNLQJZRUGVDQGWKH
and when and while and the use of when and the use of when and the use of when no use of when and
DQGZKLOH DQGZKLOH DQGZKLOH ZKLOH

There is the use of There is the use of


Use of simple There is the use of There is almost no
simple past and past simple past and past
past and past simple past and past use of the simple past
SURJUHVVLYHZLWK SURJUHVVLYHZLWKDORW
progressive. SURJUHVVLYH DQGSDVWSURJUHVVLYH
VRPHPLVWDNHV RIPLVWDNHV

142 14
1142
42
Colegio de Bachilleres del Estado de Sonora
Inglés 3

RUBRIC FOR PORTFOLIO

Beginning Developing Accomplished Exemplary


Comments Score
1 2 3 4

0DQ\PHFKDQLFDO
Entire portfolio
HUURUVSUHVHQW Some mechanical All or part of
has little or no
grammar, HUURUVSUHVHQW the portfolio has
mechanical
spelling, grammar, few mechanical
HUURUVJUDPPDU
punctuation, and spelling, HUURUVJUDPPDU
0HFKDQLFV spelling,
other mechanics punctuation, and spelling,
punctuation, and
demonstrate a other mechanics punctuation, and
other mechanics
VLJQL¿FDQWQHHG need some other mechanics
are perfect or
WRLPSURYHLQWKLV LPSURYHPHQW DUHJRRGRYHUDOO
QHDUSHUIHFW
DUHD

Entire portfolio
Entire portfolio Entire portfolio
Some parts demonstrates
demonstrates demonstrates
of portfolio VLJQL¿FDQW
VLJQL¿FDQWODFN some originality
demonstrate originality and
of originality and DQGFUHDWLYLW\
Originality/ originality FUHDWLYLW\([WUD
FUHDWLYLW\([WUD Some pieces such
&UHDWLYLW\ DQGFUHDWLYLW\ pieces such as
pieces such as DVEDFNJURXQGV
%DFNJURXQGV EDFNJURXQGV
EDFNJURXQGV pictures, and
pictures, music pictures, and
pictures, and music are
PD\EHSUHVHQW music are
PXVLFDUHDEVHQW SUHVHQW
SUHVHQW

Portfolio is
3RUWIROLRODFNV Portfolio is Portfolio is neat
extremely neat
neatness and somewhat neat DQGRUJDQL]HG
Neatness/ DQGRUJDQL]HG
RUJDQL]DWLRQ DQGRUJDQL]HG /LQNVIXQFWLRQ
Organization $OOOLQNVIXQFWLRQ
6RPHOLQNVDUH )HZOLQNVDUH ZHOODGHTXDWH
SHUIHFWO\DPSOH
EURNHQRUDEVHQW EURNHQRUDEVHQW OLQNVSUHVHQW
OLQNVDYDLODEOH

144433 143
143
BLOCK 3 I was listening to music…
,1)250$7,216285&(6

Electrónicas:
A HISTORY OF MUSIC: FROM BIG BAND TO REGGAETON

KWWSZZZWKHSHRSOHKLVWRU\FRPPXVLFKWPO

LIST OF IRREGULAR VERBS


KWWSZZZVDEHULQJOHVFRPDUOLVWVLUUHJXODUYHUEVKWPO

THE THREE DOLLS


KWWSDFDGHPLFWLSVRUJEORJVWKHWKUHHGROOV

144 14
1144
44
Colegio de Bachilleres del Estado de Sonora
BLOCK 4
DĂLJ/ďŽƌƌŽǁ͙

^ƚƵĚĞŶƚƐ͛ƉĞƌĨŽƌŵĂŶĐĞĂƚƚŚĞ
ĞŶĚŽĨďůŽĐŬ Competence to be developed Learning objects
Makes requests and interacts in diverse ^ƵƉƉŽƌƚ Ă ƌĞƐƉĞĐƞƵů ĂƫƚƵĚĞ ƚŽǁĂƌĚƐ ,ŽƵƐĞŚŽůĚĐŚŽƌĞƐ
ƐŽĐŝĂů ĐŽŶƚĞdžƚƐ ƵƟůŝnjŝŶŐ ǀŽĐĂďƵůĂƌLJ ŵƵůƟĐƵůƚƵƌĂůŝƐŵĂŶĚƚŚĞĚŝǀĞƌƐŝƚLJŽĨďĞůŝĞĨƐ͕ Phrasal verbs
related to household chores and school ǀĂůƵĞƐ͕ ŝĚĞĂƐ ĂŶĚ ƐŽĐŝĂů ƉƌĂĐƟĐĞƐ ŽĨ ƚŚĞŝƌ DŽĚĂůƐ ĨŽƌ ŵĂŬŝŶŐ ƌĞƋƵĞƐƚƐ͗ ŵĂLJ͕ ĐĂŶ͕
ĂĐƟǀŝƟĞƐǁŝƚŚƉĞŽƉůĞŽĨŚŝƐŽƌŚĞƌĂŐĞŝŶ ŽǁŶ ĂĐƟǀŝƟĞƐ ĂŶĚ ƚŚĞ ŽŶĞƐ ĨƌŽŵ ŽƚŚĞƌ could
ĂŶŽƌĂůĂŶĚĂǁƌŝƩĞŶĨŽƌŵ͘ social groups. Object pronouns: me, you, him, her, them,
Makes requests and gives orders in /ĚĞŶƟĨLJĂŶĚŝŶƚĞƌƉƌĞƚƚŚĞŐĞŶĞƌĂůŝĚĞĂĂŶĚ us, it
ĨĂŵŝůLJ ĐŽŶƚĞdžƚƐ ĂŶĚ ŝƐ ĂďůĞ ƚŽ ƚĞůů ƚŚĞ ƉŽƐƐŝďůĞĚĞǀĞůŽƉŵĞŶƚŽĨĂŶŽƌĂůŽƌǁƌŝƩĞŶ
ĚŝīĞƌĞŶĐĞďĞƚǁĞĞŶŵĂŬŝŶŐƌĞƋƵĞƐƚƐĂŶĚ ŵĞƐƐĂŐĞŝŶĂƐĞĐŽŶĚůĂŶŐƵĂŐĞ͕ďLJŵĞĂŶƐŽĨ
ŐŝǀŝŶŐŝŶƐƚƌƵĐƟŽŶƐ͘ ďĂĐŬŐƌŽƵŶĚŬŶŽǁůĞĚŐĞ͘
ZĞĐŽŐŶŝnjĞƐ ĂŶĚ ƵŶĚĞƌƐƚĂŶĚƐ ƐƉĞĐŝĮĐ ŽŵŵƵŶŝĐĂƚĞ ŝŶ Ă ĨŽƌĞŝŐŶ ůĂŶŐƵĂŐĞ
ŝŶĨŽƌŵĂƟŽŶ ŝŶ ĂŶ ŽƌĂů ĂŶĚ Ă ǁƌŝƩĞŶ ƚŚƌŽƵŐŚůŽŐŝĐĂů͕ŽƌĂůŽƌǁƌŝƩĞŶĚŝƐĐŽƵƌƐĞ͕ƚŽ
text regarding household chores that ĐŽŵƉĂƌĞĂŶĚĚĞƐĐƌŝďĞƚŚĞŝƌŽǁŶĂĐƟǀŝƟĞƐ
ƚĞĞŶĂŐĞƌƐ ĐĂƌƌLJ ŽƵƚ ǁŝƚŚŝŶ ĚŝīĞƌĞŶƚ ĂŶĚĂĐƟǀŝƟĞƐĨƌŽŵŽƚŚĞƌƐŽĐŝĂůŐƌŽƵƉƐ͘
cultures. Use independent learning strategies,
Uses phrasal verbs and modals to make ƚŚƌŽƵŐŚ ŝŶĨŽƌŵĂƟŽŶ ƚĞĐŚŶŽůŽŐLJ ĂŶĚ
requests and give orders. ĐŽŵŵƵŶŝĐĂƟŽŶ ƚŽ ĂƩĂŝŶ ŝŶĨŽƌŵĂƟŽŶ ŽŶ
ƚŚĞƵƐĂŐĞŽĨŐƌĂŵŵĂƟĐĂůƐƚƌƵĐƚƵƌĞƐ͘
Produce texts based on the standard use
ŽĨ ƚŚĞ ůĂŶŐƵĂŐĞ͕ ƚĂŬŝŶŐ ŝŶƚŽ ĐŽŶƐŝĚĞƌĂƟŽŶ
ƚŚĞ ƉƵƌƉŽƐĞ͕ ĐŽŵŵƵŶŝĐĂƟǀĞ ƐŝƚƵĂƟŽŶ͕
ĂŶĚ ĨŽƌŵĂů ĞůĞŵĞŶƚƐ ŽĨ ůĂŶŐƵĂŐĞ ĂƐ
ƉƵŶĐƚƵĂƟŽŶ͕ ƐƉĞůůŝŶŐ͕ ƐLJŶƚĂdž͕ ĐŽŚĞƌĞŶĐĞ
and cohesion.

ůůŽƩĞĚƟŵĞ͗ 12 hours.
DIAGNOSTIC EVALUATION

a) Listening Track #12

THE LAST KISS


DION AND THE BELMONTS

b) CROSS OUT THE WORDS THAT ARE WRONG IN THE CHORUS. LISTEN AGAIN AND
WRITE THE CORRECT WORDS ON THE SPACES.
2KZKHQRKZKHQFDQP\EDE\EH"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7KH/RUGORRNKHUDZD\IURPVKHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
6KH¶VJRQHIRUHYHUVR,JRWWREH\RXBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
6R,FDQEHP\EDE\ZKHQ,OHDYHWKLVMREBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

c) NUMBER THE SENTENCES IN THE ORDER YOU HEAR THEM.


BBBBBBBBB,¶OOQHYHUIRUJHWWKHVRXQGWKDWQLJKW
BBBBBBBBB7KHSDLQIXOVFUHDPWKDW,KHDUGODVW
BBBBBBBBB:HKDGQ¶WGULYHQYHU\IDU
BBBBBBBBB:HZHUHRXWRQDGDWHLQP\GDGG\¶VFDU
BBBBBBBBB$FDUZDVVWDOOHGWKHHQJLQHZDVGHDG
BBBBBBBBB,FRXOGQ¶WVWRSVR,VZHUYHGWRWKHULJKW
_________ The crying tires the busting glass,
_________ There in the road, straight ahead,

CHORUS
:HOOZKHUHRKZKHUHFDQP\EDE\EH"««««««««««

146 14
1146
46
Colegio de Bachilleres del Estado de Sonora
Inglés 3

G Write the past tense of the verbs in the blanks.


:HOOZKHQ,BBBBBBBBBBBBBBBBBBBWKHUDLQZDVSRXULQJGRZQ  ZDNHXS 
7KHUHBBBBBBBBBBBBBBBBBBBSHRSOHVWDQGLQJDOODURXQG EH
Something warm running in my eyes,
%XW,BBBBBBBBBBBBBBBBBBBP\EDE\VRPHKRZWKDWQLJKW ¿QG
,UDLVHGKHUKHDGDQGWKHQVKHBBBBBBBBBBBBBBBBDQGBBBBBBBBBBBBBBBB  VPLOHVD\
³+ROGPHGDUOLQJMXVWIRUDOLWWOHZKLOH´
,BBBBBBBBBBBBBBBBBBBKHUFORVH,BBBBBBBBBBBBBBBBBBBKHURXUODVWNLVV KROGNLVV
,BBBBBBBBBBBBBBBBBBBWKHORYHWKDW,BBBBBBBBBBBBBBBBBBB,ZRXOGPLVV ¿QGNQRZ
%XWQRZVKH¶VJRQHHYHQWKRXJK,KROGKHUWLJKW
,BBBBBBBBBBBBBBBBBBBP\ORYHP\OLIHWKDWQLJKW ORVH

e) COMPLETE THE CHORUS.

:HOOZKHUHRKZKHUHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB"

The Lord _________________________________________________________________________________

She’s _________________________________________________, so I got ____________________________,

So I ______________________________________________________________________________________

Hmmmmmmmmmm Hmmmmmmmmmmmm

Group activity:1RZVLQJWKHVRQJLQFODVV
Group activity:/LVWHQWRWKHVRQJDJDLQDQGPLPLFWKHO\ULFVLQFODVV

$QVZHUV
Part 4: same as Part 1
Part 3: ZRNHXSZHUHIRXQGVPLOHGVDLGKHOGNLVVHGIRXQGNQHZORVW
6R,FDQVHHP\EDE\ZKHQ,OHDYHWKLVZRUOGPart 2: 6, 8,2,1,4,5,7,3
6KH¶VJRQHWRKHDYHQVR,JRWWREHJRRG
7KH/RUGWRRNKHUDZD\IURPPH
2KZKHUHRKZKHUHFDQP\EDE\EH"
Part 1:

144477 147
147
BLOCK 4 Could I borrow…
Start Up Activities Didactic Sequence 1
͞dhZE/dK&&͊͟

ACTIVITY 1
SD1-B4

1.- House Chores!

D  0DWFKWKHSLFWXUHVZLWKWKHSKUDVHV

clean up your room

turn off the lights

SLFNXSWKHWUDVK

KDQJXSWKHFORWKHV

WXUQRQWKHPXVLF

EULQJGRZQWKHIRRGIURPWKHFDU

¿OORXWZLWKZDWHU

GURSE\\RXUJUDQGPRWKHU¶VKRXVH

148 14
1148
48
Colegio de Bachilleres del Estado de Sonora
Inglés 3

E 8VHWKHSKUDVDOYHUEVLQH[HUFLVHD &UHDWH\RXURZQVHQWHQFHV

BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

Grammar reference
3KUDVDOYHUEV

$3KUDVDOYHUEFRQVLVWVRIWZRZRUGSKUDVHVFRQVLVWLQJRIverb / adverb + preposition.


Example:
Turn up. Turn up the music, I can’t hear it!
Slow down.6ORZLWGRZQ7KHUHLVDGRJ
• /RRNDWWKHOLVWRISKUDVDOYHUEVLQWKHYRFDEXODU\VHFWLRQ

F &DQ\RXWHOODGLIIHUHQFH":KDWDUHWKHGLIIHUHQFHVEHWZHHQHDFKSKUDVDOYHUE",QYHVWLJDWH
look after
set this blouse apart
__________________________________________________________________________________________
__________________________________________________________________________________________
_________________________________________________________________________________________
__________________________________________________________________________________________
_________________________________________________________________________________________
______________________________________________________________________

144499 149
149
BLOCK 4 Could I borrow…
Track #13

G /LVWHQDQGUHDGWKHGLDORJXHWKHQFRPSOHWHWKH
TXHVWLRQV

0RP $QD , QHHG \RXU KHOS ZLWK WKH KRXVH


chores!
$QD6XUHPRP:KDWGR\RXQHHGPHWRGR"
0RP:HOO,QHHG\RXWRclean upWKHNLWFKHQ
PRSWKHÀRRUpick up the trash and hang out the
FORWKHV
$QD2.PRP'R\RXQHHGPHWRpick up my
OLWWOHEURWKHUIURPVFKRRO"
0RP1RGRQ¶WZRUU\,¶OOGRWKDW2K,IRUJRW
we ran out of eggs, I need you to go to the store
for a dozen of egg!
$QD2.PRP'RQ¶WZRUU\,¶OOJR

:KDWDFWLYLWLHV$QDKDVWRGR"
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________
__________________________________________________________________________________________

'R\RXKHOS\RXUSDUHQWVZLWKWKHKRXVHFKRUHV" $VN\RXUSDUWQHUZKDWKRXVHFKRUHVKHRVKHGRHV
:KDWGR\RXGRWRKHOSWKHP" :ULWHWKHPGRZQ

0( 0<3$571(5

150 15
1150
50
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Grammar reference
3KUDVDOYHUEVWHQVHV

6LPSOHSUHVHQWVLPSOHSDVWDQGVLPSOHIXWXUHXVH

6XEMHFWSKUDVDOYHUEFRPSOHPHQW

Examples:
• I’m looking forward toW\SHP\HVVD\
• 0RQLFDbroke up with her boyfriend again!
• 0DULD(QULTXHWDwill take care ofWKHNLGV

H :KDWDUHWKHPHDQLQJVRI
/RRN IRUZDUG WR BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
%UHDN XS BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7DNHFDUHRIBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

I 0DWFKHDFKSKUDVDOYHUELQWKHVHVHQWHQFHVZLWKLWVPHDQLQJ8VH\RXUGLFWLRQDU\&KHFN\RXUDQVZHUV

PHRASAL VERBS MEANINGS


0RQLFDbroke up with her boyfriend again! DWROHUDWHVRPHWKLQJ\RXGRQ¶WOLNH
5HQDQcame up with a great idea for our class
EUHGXFHWKHTXDQWLW\RIVRPHWKLQJ
SURMHFW

,¶PQRWlooking forward to typing my


HVVD\3HUKDSV,¶OOKDYHVRPHRQHKHOSPHGRLW FNHHSSDFHZLWKVRPHRQHRUVRPHWKLQJ
SURIHVVLRQDOO\

0\GRFWRUVD\VWKDW,PRYHUZHLJKW,VKRXOGcut
GHQGDURPDQWLFUHODWLRQVKLS
down onIDWW\IRRGV

5REHUWRFDQ¶Wkeep up with his classmates in


(QJOLVKFODVV+HVKRXOGJRWRWKH³DFDGHPLFWXWRULQJ HKDYHDJRRGUHODWLRQVKLSZLWKVRPHRQH
VHVVLRQV´IRUVRPHKHOS

,FDQ¶Wput up withWKHQRLVHRQP\VWUHHW,¶OOKDYH
IEHUHVSRQVLEOHIRUVRPHWKLQJ
WRPRYHWRDQRWKHUQHLJKERUKRRG
0V)LPEUHVGRHVQ¶Wget along withKHUFODVVPDWH
JWRDQWLFLSHVRPHWKLQJH[SHFWWRKDSSHQ
7KH\¶UHDOZD\V¿JKWLQJ
6DQWLDJRFDQ¶Wtake care ofKLVRZQ¿QDQFHV+LV
KWKLQNRIVRPHWKLQJFRPHXSZLWKDQLGHD
DFFRXQWDQWPDQDJHVKLVPRQH\

1551 151
151
BLOCK 4 Could I borrow…
J 5HDGWKLVFRQYHUVDWLRQDQGWKHQSUDFWLFHVD\LQJLW

Jacobo: This is so depressing! I haven’t had a date since Margarita broke up with me. What can I do?

$OH[:KDWDERXWORRNLQJWKURXJKWKHSHUVRQDODGVRQWKH,QWHUQHW"7KDW¶VKRZ,PHW5RPLQD
Jacobo: Actually, I already tried that. But the people you meet are always different from what you expect.
$OH[:HOOZK\GRQ¶W\RXMRLQDQRQOLQHGDWLQJVHUYLFH"$IULHQGRIPLQHPHWKLVZLIHWKDWZD\
Jacobo: That’s not a bad idea.
$OH[$OVRLWPLJKWEHDJRRGLGHDWRFKHFNRXWWKRVHGLVFXVVLRQJURXSVDWWKHERRNVWRUH
-DFRER5LJKW,I,GRQ¶WPHHWVRPHRQHDWOHDVW,PLJKW¿QGDJRRGERRN

K &KRRVHWKHFRUUHFWWKUHHZRUGSKUDVDOYHUEIRUHDFKVHQWHQFH

I can’t ________________________________ that loud music anymore! I can’t stand rap and I’m going to tell
P\QHLJKERUULJKWQRZ cut down on / put up with / take care of

0\ FRXVLQ GLGQ¶W NQRZ ZKDW WR GR IRU KHU PRWKHU¶V th birthday, but she
¿QDOO\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBWKHLGHDRIDVXUSULVHSLFQLFZLWKWKHZKROHIDPLO\ came up
with / got along with / looked forward to

'LDQDGLGLWDJDLQ6KHRQO\PHW0DQXHOWZRPRQWKVDJRDQGVKHDOUHDG\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
KLP7KH\MXVWGLGQ¶WVHHPWRDJUHHRQDQ\WKLQJ broke up with / got along with / kept up with

$IWHU$QD)HUQDQGDVDZKHUGRFWRUVKHGHFLGHGWRBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBHDWLQJIDVWIRRGV
6KHZDQWVWRORVHVRPHZHLJKWDQGVWDUWH[HUFLVLQJDJDLQLQRUGHUWRNHHS¿W cut down on / look forward to
/ take care of

Homework 1: Go to page 160

152 15
1152
52
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Start Up Activities Didactic Sequence 2


͞Kh>zKhW>^͍͟

$&7,9,7<
6'%

D 0DNHDOLVWRIWKLQJV\RXUPRPDVNV\RXWRGR"

([DPSOH

• 3LFNXS\RXUFORWKHV ________________________________________________________________
• :DVK\RXUXQLIRUP ________________________________________________________________
• 7DNHRXWWKHJDUEDJH
________________________________________________________________
________________________________________________________________
________________________________________________________________
____________________________________________

0RGDOYHUEVWRPDNHUHTXHVWV

E /RRNDWWKHIROORZLQJVHQWHQFHV:KDWGR\RXWKLQNZHXVHLWIRU"([SODLQWKHGLIIHUHQFHWKLQNDERXWWKH
IRUPDOLW\

Can \RXSLFNXS\RXUFORWKHVIURPWKHODXQGU\VKRS"

 May,JRWRWKHUHVWURRP"

Could\RXWXUQRIIWKH79"

_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________
_______________________________________________________________________________________
_____________________________________________________________________

155533 153
153
BLOCK 4 Could I borrow…
F /RRNDWWKHSLFWXUHVDQGZULWHGRZQDSROLWHUHTXHVWIRUHDFK/RRNDWWKHH[DPSOH

<RXZDQWDVDQGZLFK

Can/may/could

<RXUUHTXHVW
&DQ,KDYHDVDQGZLFK"

<RXZDQWWRWDNHRXWWKHWUDVK You want to use the computer You want to use the restroom

You want to use the


<RXZDQWWRGULQNZDWHU
WHOHSKRQH

154 15
1154
54
Colegio de Bachilleres del Estado de Sonora
Inglés 3

G 2UGHUWKHIROORZLQJVHQWHQFHV

SDUW\"JRFDQ0RPWR,WKH
__________________________________________________________________________________________
0LVVSOHDVHUHVWURRP"JRPD\WKH,WR
__________________________________________________________________________________________
FORVHWKHZLQGRZ"\RXFRXOG
__________________________________________________________________________________________
"ZKHQ\RX0DULDQDWXUQRIIWKHOHDYHFDQOLJKWV\RX
__________________________________________________________________________________________
RSHQWKLVERWWOH"\RXFRXOG6DPXHO
__________________________________________________________________________________________

Track #14

H /LVWHQDQGUHDGWKHGLDORJXH$QVZHUWUXHRUIDOVH&KDQJHWKHIDOVHVHQWHQFHVLQWRWUXHVHQWHQFHV
6HFUHWDU\JRRGPRUQLQJ+RZPD\,KHOS\RX" -HVVLFD2K,VHH+RZPXFKLVLWIRUDQHYHU\GD\
-HVVLFD+LZHOO,ZRXOGOLNHVRPHLQIRUPDWLRQDERXW FODVV"
WKHVZLPPLQJFODVVHV 6HFUHWDU\ LW¶V  PRQWKO\ DQG D WXLWLRQ RI 
6HFUHWDU\ 6XUH :HOO WKH VZLPPLQJ FODVVHV VWDUW SHVRV7KHWKUHHGD\FRXUVHLVPRQWKO\DQGWKH
QH[W0RQGD\ZHKDYHGLIIHUHQWFODVVHVGHSHQGLQJRQ VDPHWXLWLRQ
WKHDJHDQGOHYHO,VLWIRU\RX" -HVVLFD 2. VR ,¶OO FKHFN DQG FRPH ODWHU RQ WR
-HVVLFD1RLVIRUP\VRQ+HLVWKUHH\HDUVROG HQUROOHGKLP
6HFUHWDU\2K:HOOZHKDYHPRUQLQJDQGDIWHUQRRQ 6HFUHWDU\ZRXOG\RXOLNHPRUHLQIRUPDWLRQ"
:HKDYHDHYHU\GD\FODVVIURPWRDPDQG -HVVLFD1RLW¶V¿QH&DQ,KDYHWKHSKRQHQXPEHU"
IURPWRSPRU0RQGD\:HGQHVGD\VDQG 6HFUHWDU\RIFRXUVH,WV
)ULGD\V RQ WKH VDPH VFKHGXOH$OO WKLV FRXUVHV DUH -HVVLFDWKDQNV
EHJLQQHUV
-HVVLFDZDQWVWRWDNHVZLPPLQJFODVVHV
_______________________________________________________________________________________
7KHVZLPPLQJFODVVHVVWDUWQH[WPRQWK
_______________________________________________________________________________________
7KHUHLVRQO\DQHYHU\GD\FODVVIURPWRDP
_______________________________________________________________________________________
7KHFRVWIRUDQHYHU\GD\FODVVLVLW¶VPRQWKO\DQGDWXLWLRQRISHVRV
_______________________________________________________________________________________
,I\RXJRWRWKHWKUHHGD\FODVV\RX¶OOSD\WKHVDPHWXLWLRQ
_______________________________________________________________________________________

155555 155
155
BLOCK 4 Could I borrow…
Homework 2: Go to page 161

I 5HDGWKHIROORZLQJLQIRUPDWLRQRIWKHREMHFWSURQRXQV

Grammar reference
2EMHFWSURQRXQV

7KHREMHFWSURQRXQWDNHVWKHSODFHRIDQRXQ

([DPSOH
-HVVLFDVDZ him
HimLVWKHGLUHFWREMHFW
*LYHme WKHERRN
MeLVWKHLQGLUHFWREMHFW7KHGLUHFWREMHFWLVWKHERRN

Personal pronouns 2EMHFWSURQRXQV


I 0(
YOU YOU
HE +,0
SHE HER
IT IT
:( US
YOU YOU
THEY 7+(0

156 15
1156
56
Colegio de Bachilleres del Estado de Sonora
Inglés 3

J )LOOLQWKHVSDFHVZLWKWKHFRUUHFWSHUVRQDOSURQRXQRUREMHFWSURQRXQ

-RKQLVKHUH$UHBBBBBJRLQJWRSLFNBBBBBBBBXS"

$UHBBBBBJRLQJWR6DQ&DUORV"<HVBBBBDPJRLQJZLWKP\PRPDQGGDG'RBBBBZDQWWRJR"

,W¶VDW.DUOD¶VKRXVHBBBBBBKRXVHLVQH[WWRKRPHGHSRW

&DQBBBFRPHZLWKBBBBBBBBSOHDVH"

'RBBBBBNQRZ0U5XL]"1R,GRQ¶WNQRZBBBBBBB

Grammar reference
0RGDOYHUEV

0RGDOYHUEVWRPDNHRIIHUV
:HXVHCan, May and Could, WRGRWKLQJVIRUSHRSOHRUWRLQYLWHWKHPWRGRVRPHWKLQJ

([DPSOH
Can ,JHW\RXVRPHWKLQJWRGULQN"
Could ,KHOS\RXZLWKWKLVKRPHZRUN"
How May ,KHOS\RX"

3RVVLEOHDFFHSWLQJDQVZHUVIRURIIHURUUHTXHVWUHIXVLQJDQVZHUV
<HVRIFRXUVH1RWKDQNV
Sure! I’d rather not
<HVWKDWQLFHRI\RX1RWKDQNV,¶P¿QH

K /RRNDWWKHVHQWHQFHV:ULWHQH[WWRWKHPLIWKH\DUHUHTXHVWRURIIHU

+LJRRGPRUQLQJFDQ,JHW\RXVRPHWKLQJWRGULQN"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

&DQ,JRWRWKHPRYLHV"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

+RZPD\,KHOS\RX"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

&RXOG,KHOS\RXZLWKWKHPDWKKRPHZRUN"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

7HDFKHU0D\,JRWRWKHUHVWURRP"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

155577 157
157
BLOCK 4 Could I borrow…
INTEGRATING ACTIVITY

3DLUZRUN5ROHSOD\

:LWK\RXUSDUWQHUFUHDWHDGLDORJXHDERXWDQ\VLWXDWLRQSUHVHQWLWWRWKHFODVV,QWKLVUROHSOD\\RXVKRXOGXVH
• 0RGDOYHUEVIRURIIHUDQGUHTXHVW
• $FFHSWLQJRUGHFOLQLQJRIIHUVDQGRUUHTXHVW
• $WOHDVWSKUDVDOYHUEV
• 9RFDEXODU\IURPWKHEORFN

6HHUXEULFVIRUGLDORJXHFUHDWLRQDQGRUDOH[SRVLWLRQ

158 15
1158
58
Colegio de Bachilleres del Estado de Sonora
Inglés 3

CLOSING REAGENTS

:ULWHSROLWHUHTXHVWVIRUWKHVHVLWXDWLRQV8VHPD\FDQRUFRXOGLQRXUUHTXHVWV7KH¿UVWRQHLVGRQHIRU\RX

<RXGLGQ¶WXQGHUVWDQGZKDW\RXUWHDFKHUVDLG IRUPDO
7HDFKHU&HF\FRXOG\RXSOHDVHH[SODLQWKDWWRPHDJDLQ"

<RXGLGQ¶WXQGHUVWDQGWKHSURMHFWLQVWUXFWLRQV IRUPDO
__________________________________________________________________________________________

<RXQHHG\RXUFODVVPDWHVWRKHOS\RXZLWKWKH(QJOLVKDVVLJQPHQW LQIRUPDO
__________________________________________________________________________________________

<RXGRQ¶WXQGHUVWDQGZKDWDZRUGPHDQV IRUPDO
__________________________________________________________________________________________

5. You forgot to bring your dictionary and you need to ask for one.(informal)
__________________________________________________________________________________________

155599 159
159
BLOCK 4 Could I borrow…
HOMEWORK 1 Didactic sequence 1. “Turn it off!”

1. Team work: ,Q WHDPV RI IRXU GHVLJQ VRPH PLQG PDSV WR H[SODLQ IRXU GLIIHUHQW SKUDVDO YHUEV ZLWK DOO WKH
GLIIHUHQWSUHSRVLWLRQV8VHSLFWXUHVWRH[SODLQWKHPHDQLQJ

([DPSOH
OFF

DOWN BACK
Turn

IN ON

2. Think about things you want to do or stop doing for this year. Use the following phrasal verbs. Think
about two more phrasal verbs.

Look at the example. I’m going to hang outPRUHZLWKP\IULHQGV


• Cut down on
• .HHSRQ
• Start in
• Hang out

160 16
1160
60
Colegio de Bachilleres del Estado de Sonora
Inglés 3

HOMEWORK 2 Didactic sequence 2. “Could you please?”

1. Act it out. ,QSDLUVDFWRXWDGLDORJXHVLPLODUOLNHLQH[HUFLVHH $FWLWRXWLQFODVV6HHUXEULFVIRU


GLDORJXH

1661 161
161
BLOCK 4 Could I borrow…
6(/)&+(&.

Complete each sentence with a word from the box.

on away in (2x ) up (2x) out

 Did you hand _________ WKHSKUDVDOYHUEDVVLJQPHQWLQFODVV"


 ,GRQ¶WUHPHPEHUZKDWWKHSKUDVDOYHUE³FKHFNRXW´PHDQV,¶OOKDYHWRORRNLWBBBBBBBBBBBLQP\
GLFWLRQDU\
 $VWULGKDVDYHU\WLJKWVFKHGXOHWRGD\EXWVKHVDLGVKHFDQ¿WPHBBBBBBBBBBBBDWWKHVDORQDWSP
 3OHDVHGRQ¶WWKURZBBBBBBBBBBBWKRVHQRWHV:HPD\QHHGWKHPIRUFODVVWRPRUURZ
 ,WLVYHU\KRWLQWKHFODVVURRP&DQ\RXSOHDVHWXUQBBBBBBBBBBWKHDLUFRQGLWLRQHU"
 /HW¶VJRBBBBBBBBBBBBBBBBBBBBBWRQLJKW,GRQ¶WZDQWWRVWD\KRPH
 6WXGHQWVORRNDWDOOWKHWUDVKRQWKHÀRRU&RXOG\RXNLQGO\SLFNLWBBBBBBBBBBBBBBBBDQGWKURZLWLQWKH
ZDVWHEDVNHW"

Read each sentence and choose the option with the appropriate object pronoun that substitutes each
noun in bold. Pay close attention to the phrasal verb.

 'RQWIRUJHWWRJLYHEDFNthe book


D 'RQ¶WIRUJHWWRJLYH LWEDFN
E 'RQ¶WIRUJHWWRJLYHKHUEDFN
F 'RQ¶WIRUJHWWRJLYHKLPEDFN
G 'RQ¶WIRUJHWWRJLYHWKHPEDFN

 :HUHSLFNLQJXSAndre DW&REDFKDWSP


D :H¶UHSLFNLQJKHUXSDW&REDFKDWSP
E :H¶UHSLFNLQJKLPXSDW&REDFKDWSP
F :H¶UHSLFNLQJXSKLPDW&REDFKDWSP
G :H¶UHSLFNLQJXSKHUDW&REDFKDWSP

 I’m going to drop Jessica and Ana CeRIIDWWKHDLUSRUWWKLVHYHQLQJ


D ,¶PJRLQJWRGURSKHURIIDWWKHDLUSRUWWKLVHYHQLQJ
E ,¶PJRLQJWRGURSWKHLURIIDWWKHDLUSRUWWKLVHYHQLQJ
F ,¶PJRLQJWRGURSWKHPRIIDWWKHDLUSRUWWKLVHYHQLQJ
G ,¶PJRLQJWRGURSRIIWKHPDWWKHDLUSRUWWKLVHYHQLQJ

162 16
1162
62
Colegio de Bachilleres del Estado de Sonora
Inglés 3

 Could you please turn the volumeXSDOLWWOH",FDQ¶WKHDU


D &RXOG\RXSOHDVHWXUQ\RXXSDOLWWOH",FDQ¶WKHDU
E &RXOG\RXSOHDVHWXUQLWXSDOLWWOH",FDQ¶WKHDU
F &RXOG\RXSOHDVHWXUQKHUXSDOLWWOH",FDQ¶WKHDU
G &RXOG\RXSOHDVHWXUQWKHPXSDOLWWOH",FDQ¶WKHDU

 ,ZRQ¶WEHLQWKHRI¿FHWRPRUURZ&RXOG\RXSOHDVHSXWRIIthe meetingXQWLO:HGQHVGD\"


D ,ZRQ¶WEHLQWKHRI¿FHWRPRUURZ&RXOG\RXSOHDVHSXWWKHPRIIXQWLO:HGQHVGD\"
E ,ZRQ¶WEHLQWKHRI¿FHWRPRUURZ&RXOG\RXSOHDVHSXWKHURIIXQWLO:HGQHVGD\"
F ,ZRQ¶WEHLQWKHRI¿FHWRPRUURZ&RXOG\RXSOHDVHSXWKLPRIIXQWLO:HGQHVGD\"
G ,ZRQ¶WEHLQWKHRI¿FHWRPRUURZ&RXOG\RXSOHDVHSXWLWRIIXQWLO:HGQHVGD\"

Complete the conversation with words to make polite requests and appropriate short answers.
$UQROG*DE\BBBBBBBBBBBBBBBBBBBBEULQJPHDFRXSOHRIFRSLHVRIWKLVEULHI"
*DE\<HVVLU
$UQROG$QGBBBBBBBBBBBBBBBBBBBBBJHWPHWKHDUFKLYHRQWKHQHZKLJKZD\SURMHFWIRU6RQRUD"
*DE\BBBBBBBBBBBBBBBBBBBBBBB
$UQROG$QGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBFRQWDFWWKH6HFUHWDU\RI+HDOWKDQGWHOOKHUWRFDOOPH
$6$3" DVVRRQDVSRVVLEOH
*DE\BBBBBBBBBBBBBBBBBBBBBBBBB6KHLVDWWKH*HQHUDO+RVSLWDOLQDQXUJHQWVXUJHU\DWWKLVPRPHQW
$UQROG2KGHDU:HOOBBBBBBBBBBBBBBBBBBBBBBBBEULQJPHDFXSRIFRIIHHEHIRUH\RXOHDYH"
*DE\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

Complete the text with the words and phrases from the box.
make mistakes imitate corrects translate look up have an accent
PHDQV¿JXUHRXWFRPPXQLFDWHWKLQNDERXW

Advice for language learners


,WPD\VRPHWLPHVEHDOLWWOHGLI¿FXOWWROHDUQDIRUHLJQ
ODQJXDJHÀXHQWO\%XWWKHUHDUHPDQ\WKLQJV\RXFDQGRWR
PDNH\RXUOHDUQLQJPRUHVXFFHVVIXO

:KHQ\RXVSHDNDIRUHLJQODQJXDJHLW¶VQRUPDOWR
BBBBBBBBBBBBBBBBBBBBBBBB7KDW¶V2.±RWKHUSHRSOH
FDQXVXDOO\XQGHUVWDQG,W¶VDJRRGLGHDWROLVWHQWR&'V
and try to BBBBBBBBBBBBBBBBBBBBBBRWKHUVSHDNHUVWR
PDNH\RXUSURQXQFLDWLRQEHWWHU
,I\RXVHHDQHZZRUGDQG\RXGRQ¶WNQRZZKDWLW__________________, you can sometimes ___________
WKHPHDQLQJIURPZRUGV\RXNQRZRU\RXFDQBBBBBBBBBBBBBBBBBBBBBWKHZRUGLQDGLFWLRQDU\

A lot of good language learners try not to BBBBBBBBBBBBBBBBBBBBBZRUGVIURPWKHLUODQJXDJH7UDQVODWLRQLV

166633 163
163
BLOCK 4 Could I borrow…
VRPHWLPHVDJRRGLGHDEXWFKDOOHQJH\RXUVHOIDQGWU\WRWKLQNLQWKHIRUHLJQODQJXDJHLI\RXFDQ

It’s also normal to BBBBBBBBBBBBBBBBBBBBB:KHQ\RXUWHDFKHUBBBBBBBBBBBBBBDPLVWDNHLQ\RXUZULWLQJ


RUVSHDNLQJBBBBBBBBBBBBBBBBBBBBBLWDQGWU\WRVHHZK\LWVZURQJ%XWUHPHPEHULW¶VPRUHLPSRUWDQWWR

BBBBBBBBBBBBBBBBBBBBBVRGRQ¶WEHDIUDLGWRVSHDN

Taken and adapted from English in Mind Student’s book second edition

164 16
1164
64
Colegio de Bachilleres del Estado de Sonora
Inglés 3

VOCABULARY BLOCK 4

Didactic sequence 1. “Turn it off!”

LIST OF PHRASAL VERBS


7DNHQIURPKWWSZZZHQJOLVKFOXEFRPYRFDEXODU\SKUDVDOYHUEVOLVWKWP

Verb Meaning Example


Brian asked-XG\out to dinner and a
ask someone out LQYLWHRQDGDWH
PRYLH
I asked around but nobody has seen my
ask around DVNPDQ\SHRSOHWKHVDPHTXHVWLRQ
ZDOOHW
add up to something HTXDO Your purchases add up to
<RX
OOKDYHWRback up your car so that I
back something up UHYHUVH
FDQJHWRXW
0\ZLIHbacked me upRYHUP\GHFLVLRQ
back someone up support
WRTXLWP\MRE
The racing car blew up after it crashed
blow up explode
LQWRWKHIHQFH
:HKDYHWRblow 50 balloons up for the
blow something up add air
SDUW\
Our car broke down at the side of the
break down VWRSIXQFWLRQLQJ YHKLFOHPDFKLQH
KLJKZD\LQWKHVQRZVWRUP
The woman broke down when the police
break down get upset
WROGKHUWKDWKHUVRQKDGGLHG
Our teacher brokeWKH¿QDOSURMHFWdown
break something down GLYLGHLQWRVPDOOHUSDUWV
LQWRWKUHHVHSDUDWHSDUWV
Somebody broke in last night and stole
break in force entry to a building
RXUVWHUHR
7KH¿UHPHQKDGWRbreak into the room to
break into something enter forcibly
UHVFXHWKHFKLOGUHQ
wear something a few times so that I need to break these shoes in before we
break something in
LWGRHVQ
WORRNIHHOQHZ UXQQH[WZHHN
The TV station broke in to report the
break in interrupt
QHZVRIWKHSUHVLGHQW
VGHDWK
0\ER\IULHQGDQG,broke up before I
break up end a relationship
PRYHGWR$PHULFD
7KHNLGVMXVWbroke up as soon as the
break up VWDUWODXJKLQJ LQIRUPDO
FORZQVWDUWHGWDONLQJ

166655 165
165
BLOCK 4 Could I borrow…
The prisoners broke outRIMDLOZKHQWKH
break out escape
JXDUGVZHUHQ
WORRNLQJ
I broke out in a rash after our camping
break out in something GHYHORSDVNLQFRQGLWLRQ
WULS
bring someone down PDNHXQKDSS\ This sad music is bringing me down
0\JUDQGSDUHQWVbrought me up after my
bring someone up raise a child
SDUHQWVGLHG
0\PRWKHUZDONVRXWRIWKHURRPZKHQ
bring something up VWDUWWDONLQJDERXWDVXEMHFW
my father brings upVSRUWV
+HGUDQNVRPXFKWKDWKHbrought his
bring something up YRPLW
dinner upLQWKHWRLOHW
:Hcalled aroundEXWZHZHUHQ
WDEOHWR
call around phone many different places/people
¿QGWKHFDUSDUWZHQHHGHG
I called the company backEXWWKHRI¿FHV
call someone back return a phone call
ZHUHFORVHGIRUWKHZHHNHQG
-DVRQcalled the wedding off because he
call something off cancel
ZDVQ
WLQORYHZLWKKLV¿DQFp
call on someone DVNIRUDQDQVZHURURSLQLRQ The professor called onPHIRUTXHVWLRQ
:Hcalled on you last night but you
call on someone YLVLWVRPHRQH
ZHUHQ
WKRPH
*LYHPH\RXUSKRQHQXPEHUDQG,ZLOO
call someone up phone
call you upZKHQZHDUHLQWRZQ
<RXDUHVWLOOPDG<RXQHHGWRcalm down
calm down relax after being angry
EHIRUH\RXGULYHWKHFDU
not care for someone/
QRWOLNH IRUPDO ,GRQ
Wcare forKLVEHKDYLRXU
something
get to the same point as someone <RX
OOKDYHWRUXQIDVWHUWKDQWKDWLI\RX
catch up
else want to catch upZLWK0DUW\

DUULYHDQGUHJLVWHUDWDKRWHORU :HZLOOJHWWKHKRWHONH\VZKHQZHcheck
check in
airport in
<RXKDYHWRcheck out of the hotel before
check out OHDYHDKRWHO
$0
check someone/something The company checks out all new
ORRNDWFDUHIXOO\LQYHVWLJDWH
out HPSOR\HHV
check out someone/
ORRNDW LQIRUPDO Check out the crazy hair on that guy!
something
She cheered up when she heard the good
cheer up become happier
QHZV

166 16
1166
66
Colegio de Bachilleres del Estado de Sonora
Inglés 3

,EURXJKW\RXVRPHÀRZHUVWRcheer you
cheer someone up PDNHKDSSLHU
up
,IHYHU\RQHchips in we can get the
chip in help
NLWFKHQSDLQWHGE\QRRQ
Please clean up your bedroom before you
clean something up tidy, clean
JRRXWVLGH
I came across these old photos when I
come across something ¿QGXQH[SHFWHGO\
ZDVWLG\LQJWKHFORVHW
The top and bottom come apart if you
come apart separate
SXOOKDUGHQRXJK
come down with 0\QHSKHZcame down withFKLFNHQSR[
EHFRPHVLFN
something WKLVZHHNHQG
YROXQWHHUIRUDWDVNRUWRJLYH The woman came forward with her
come forward
HYLGHQFH KXVEDQG
V¿QJHUSULQWV
come from somewhere originate in The art of origami comes from$VLD
count on someone/ I am counting on\RXWRPDNHGLQQHU
rely on
something ZKLOH,DPRXW
Please cross out your old address and
cross something out draw a line through
ZULWH\RXUQHZRQH
0\GRFWRUZDQWVPHWRcut back on
cut back on something consume less
VZHHWVDQGIDWW\IRRGV
:HKDGWRcut the old tree in our yard
cut something down PDNHVRPHWKLQJIDOOWRWKHJURXQG
downDIWHUWKHVWRUP
Your father cut in while I was dancing
cut in interrupt
ZLWK\RXUXQFOH
pull in too closely in front of 7KHEXVGULYHUJRWDQJU\ZKHQWKDWFDU
cut in
DQRWKHUYHKLFOH cut in
VWDUWRSHUDWLQJ RIDQHQJLQHRU The air conditioner cuts in when the
cut in
HOHFWULFDOGHYLFH WHPSHUDWXUHJHWVWRƒ&
The doctors cut off his leg because it was
cut something off UHPRYHZLWKVRPHWKLQJVKDUS
VHYHUHO\LQMXUHG
The phone company cut off our phone
cut something off VWRSSURYLGLQJ
EHFDXVHZHGLGQ
WSD\WKHELOO
0\JUDQGSDUHQWVcut my father off when
cut someone off WDNHRXWRIDZLOO
KHUHPDUULHG
UHPRYHSDUWRIVRPHWKLQJ XVXDOO\
cut something out I cut this ad outRIWKHQHZVSDSHU
ZLWKVFLVVRUVDQGSDSHU
do someone/something +H
VOXFN\WREHDOLYH+LVVKRSZDVdone
EHDWXSUDQVDFN %U(LQIRUPDO
over overE\DVWUHHWJDQJ

166677 167
167
BLOCK 4 Could I borrow…
0\WHDFKHUZDQWVPHWRdo my essay over
do something over GRDJDLQ 1$PHU
EHFDXVHVKHGRHVQ
WOLNHP\WRSLF
,W
VWLPHWRdo away with all of these old
do away with something discard
WD[UHFRUGV
Do your coat upEHIRUH\RXJRRXWVLGH
do something up fasten, close
,W
VVQRZLQJ
,W
VDIDQF\UHVWDXUDQWVRZHKDYHWRdress
dress up wear nice clothing
up
Andrea dropped back to third place when
drop back PRYHEDFNLQDSRVLWLRQJURXS
VKHIHOORIIKHUELNH
I might drop in/by/over for tea sometime
drop in/by/over come without an appointment
WKLVZHHN
drop someone/something WDNHVRPHRQHVRPHWKLQJ ,KDYHWRdrop my sister offDWZRUN
off VRPHZKHUHDQGOHDYHWKHPLWWKHUH EHIRUH,FRPHRYHU
I dropped out of Science because it was
drop out TXLWDFODVVVFKRROHWF
WRRGLI¿FXOW
,GRQ
WIHHOOLNHFRRNLQJWRQLJKW/HW
Veat
eat out eat at a restaurant
out
:Hended upUHQWLQJDPRYLHLQVWHDGRI
end up HYHQWXDOO\UHDFKGRGHFLGH
JRLQJWRWKHWKHDWUH
0\QHZGUHVVfell apart in the washing
fall apart EUHDNLQWRSLHFHV
PDFKLQH
The picture that you hung up last night
fall down fall to the ground
fell downWKLVPRUQLQJ
7KHPRQH\PXVWKDYHfallen out of my
fall out separate from an interior
SRFNHW
RIKDLUWHHWK EHFRPHORRVHDQG His hair started to fall out when he was
fall out
unattached RQO\
I need to ¿JXUHRXWKRZWR¿WWKHSLDQR
¿JXUH something out XQGHUVWDQG¿QGWKHDQVZHU
DQGWKHERRNVKHOILQWKLVURRP
WRZULWHLQIRUPDWLRQLQEODQNV Please ¿OOLQ the form with your name,
¿OO something in
%U( DGGUHVVDQGSKRQHQXPEHU

WRZULWHLQIRUPDWLRQLQEODQNV The form must be ¿OOHGRXW in capital


¿OO something out
1$PHU OHWWHUV
I always ¿OOWKHZDWHUMXJup when it is
¿OO something up ¿OOWRWKHWRS
HPSW\
:HGRQ
WNQRZZKHUHKHOLYHV+RZFDQ
¿QGRXW GLVFRYHU
we ¿QGRXW"

168 16
1168
68
Colegio de Bachilleres del Estado de Sonora
Inglés 3

:HWULHGWRNHHSWKHWLPHRIWKHSDUW\D
¿QG something out GLVFRYHU
secret, but Samantha found it out
get something across/ I tried to get my point across/over to the
FRPPXQLFDWHPDNHXQGHUVWDQGDEOH
over MXGJHEXWVKHZRXOGQ
WOLVWHQ
I was surprised how well my new
get along/on OLNHHDFKRWKHU
girlfriend and my sister got along/on
0\JUDQGIDWKHUFDQget around¿QHLQKLV
get around KDYHPRELOLW\
QHZZKHHOFKDLU
:HZRUNHGVRKDUGWKLV\HDUWKDWZHKDG
get away JRRQDYDFDWLRQ
to get awayIRUDZHHN
do without being noticed or -DVRQDOZD\Vgets away with cheating in
get away with something
punished KLVPDWKVWHVWV
get back return :Hgot backIURPRXUYDFDWLRQODVWZHHN
/L]¿QDOO\got her Science notes back
get something back UHFHLYHVRPHWKLQJ\RXKDGEHIRUH
IURPP\URRPPDWH
0\VLVWHUgot back at me for stealing her
get back at someone UHWDOLDWHWDNHUHYHQJH
VKRHV6KHVWROHP\IDYRXULWHKDW
become interested in something ,¿QDOO\got back intoP\QRYHODQG
get back into something
again ¿QLVKHGLW
:H
UHJRLQJWRIUHH]HRXWKHUHLI\RXGRQ
W
get on something VWHSRQWRDYHKLFOH
let us get onWKHEXV
UHFRYHUIURPDQLOOQHVVORVV ,MXVWgot overWKHÀXDQGQRZP\VLVWHU
get over something
GLI¿FXOW\ KDVLW
7KHFRPSDQ\ZLOOKDYHWRFORVHLILWFDQ
W
get over something RYHUFRPHDSUREOHP
get overWKHQHZUHJXODWLRQV
¿QDOO\¿QGWLPHWRGR 1$PHU ,GRQ
WNQRZZKHQ,DPJRLQJWRget
get round to something
get around to something round toZULWLQJWKHWKDQN\RXFDUGV
/HW
Vget together for a BBQ this
get together PHHW XVXDOO\IRUVRFLDOUHDVRQV
ZHHNHQG
get up get out of bed I got upHDUO\WRGD\WRVWXG\IRUP\H[DP
You should get upDQGJLYHWKHHOGHUO\
get up stand
PDQ\RXUVHDW
UHYHDOKLGGHQLQIRUPDWLRQDERXW
give someone away His wife gave him awayWRWKHSROLFH
someone
give someone away WDNHWKHEULGHWRWKHDOWDU 0\IDWKHUgave me awayDWP\ZHGGLQJ
0\OLWWOHVLVWHUgave the surprise party
give something away ruin a secret
awayE\DFFLGHQW
The library was giving awayROGERRNVRQ
give something away JLYHVRPHWKLQJWRVRPHRQHIRUIUHH
)ULGD\

166699 169
169
BLOCK 4 Could I borrow…
,KDYHWRgiveWKHVHVNDWHVback to Franz
give something back return a borrowed item
EHIRUHKLVKRFNH\JDPH
0\ER\IULHQGGLGQ
WZDQWWRJRWRWKH
give in UHOXFWDQWO\VWRS¿JKWLQJRUDUJXLQJ
EDOOHWEXWKH¿QDOO\gave in
JLYHWRPDQ\SHRSOH XVXDOO\DWQR They were giving out free perfume
give something out
FRVW VDPSOHVDWWKHGHSDUWPHQWVWRUH
give something up TXLWDKDELW I am giving upVPRNLQJDVRI-DQXDU\VW
0\PDWKVKRPHZRUNZDVWRRGLI¿FXOWVR
give up stop trying
I gave up
0\EURWKHUWULHGWRgo after the thief in
go after someone follow someone
KLVFDU
I went after my dream and now I am a
go after something WU\WRDFKLHYHVRPHWKLQJ
SXEOLVKHGZULWHU
:HDUHgoing against the best soccer team
go against someone compete, oppose
LQWKHFLW\WRQLJKW
Please go ahead and eat before the food
go ahead start, proceed
JHWVFROG
go back return to a place ,KDYHWRgo backKRPHDQGJHWP\OXQFK
go out OHDYHKRPHWRJRRQDVRFLDOHYHQW :H
UHgoing outIRUGLQQHUWRQLJKW
-HVVHKDVEHHQgoing out with/XNHVLQFH
go out with someone date
WKH\PHWODVWZLQWHU
Please go over your answers before you
go over something UHYLHZ
VXEPLW\RXUWHVW
,KDYHQ
WVHHQ7LQDIRUDORQJWLPH,WKLQN
go over YLVLWVRPHRQHQHDUE\
,
OOgo overIRUDQKRXURUWZR
:KHQ,ZDV\RXQJZHwent without
go without something VXIIHUODFNRUGHSULYDWLRQ
ZLQWHUERRWV
0\EHVWIULHQGDQG,grew apart after she
grow apart VWRSEHLQJIULHQGVRYHUWLPH
FKDQJHGVFKRROV
grow back regrow 0\URVHVgrew backWKLVVXPPHU
:KHQ-DFNgrows up he wants to be a
grow up become an adult
¿UHPDQ
Elizabeth needs a new pair of shoes
grow out of something get too big for because she has grown out of her old
RQHV
7KLVELNHLVWRRELJIRUKLPQRZEXWKH
grow into something JURZELJHQRXJKWR¿W
should grow intoLWE\QH[W\HDU
JLYHVRPHWKLQJXVHGWRVRPHRQH I handedP\ROGFRPLFERRNVdown to
hand something down
else P\OLWWOHFRXVLQ

170 17
1170
70
Colegio de Bachilleres del Estado de Sonora
Inglés 3

hand something in submit ,KDYHWRhand inP\HVVD\E\)ULGD\


:HZLOOhand outWKHLQYLWDWLRQVDWWKH
hand something out to distribute to a group of people
GRRU
7KHSROLFHDVNHGWKHPDQWRhand over
hand something over JLYH XVXDOO\XQZLOOLQJO\
KLVZDOOHWDQGKLVZHDSRQV
Hang inWKHUH,
PVXUH\RX
OO¿QGDMRE
hang in VWD\SRVLWLYH 1$PHULQIRUPDO
YHU\VRRQ
hang on ZDLWDVKRUWWLPH LQIRUPDO Hang on while I grab my coat and shoes!
,QVWHDGRIJRLQJWRWKHSDUW\ZHDUHMXVW
hang out VSHQGWLPHUHOD[LQJ LQIRUPDO
going to hang outDWP\SODFH
hang up end a phone call +HGLGQ
WVD\JRRGE\HEHIRUHKHhung up
hold someone/something I had to hold my dog back because there
SUHYHQWIURPGRLQJJRLQJ
back ZDVDFDWLQWKHSDUN
-DPLHheld back his tears at his
hold something back hide an emotion
JUDQGIDWKHU
VIXQHUDO
Please hold on while I transfer you to the
hold on wait a short time
6DOHV'HSDUWPHQW
hold onto someone/ KROG¿UPO\XVLQJ\RXUKDQGVRU Hold onto\RXUKDWEHFDXVHLW
VYHU\
something arms ZLQG\RXWVLGH
hold someone/ $PDQLQDEODFNPDVNheldWKHEDQNup
rob
somethingup WKLVPRUQLQJ
Keep onVWLUULQJXQWLOWKHOLTXLGFRPHVWR
keep on doing something continue doing
DERLO
keep something from :Hkept our relationship from our parents
not tell
someone IRUWZR\HDUV
keep someone/something Try to keep the wet dog outRIWKHOLYLQJ
stop from entering
out URRP
If you keep those results up you will get
keep something up continue at the same rate
LQWRDJUHDWFROOHJH
,QHHG\RXWREHRQWLPH'RQ
Wlet me
let someone down fail to support or help, disappoint
downWKLVWLPH
Can you let the cat in before you go to
let someone in allow to enter
VFKRRO"
,FDQ
Wlog inWR)DFHERRNEHFDXVH,
YH
log in RUon VLJQLQ WRDZHEVLWHGDWDEDVHHWF
IRUJRWWHQP\SDVVZRUG
,I\RXGRQ
Wlog off somebody could get
log out RUoff VLJQRXW RIDZHEVLWHGDWDEDVHHWF
LQWR\RXUDFFRXQW
look after someone/
WDNHFDUHRI ,KDYHWRlook afterP\VLFNJUDQGPRWKHU
something

1771 171
171
BLOCK 4 Could I borrow…
(YHUVLQFHZHVWROHWKDWFKRFRODWHEDU
look down on someone WKLQNOHVVRIFRQVLGHULQIHULRU
your dad has looked down onPH
look for someone/ ,
Plooking for a red dress for the
WU\WR¿QG
something ZHGGLQJ
look forward to ,
Plooking forward to the Christmas
be excited about the future
something EUHDN
:HDUHJRLQJWRlook into the price of
look into something LQYHVWLJDWH
VQRZERDUGVWRGD\
look out EHFDUHIXOYLJLODQWDQGWDNHQRWLFH /RRNRXW7KDWFDU
VJRLQJWRKLW\RX
look out for someone/ 'RQ
WIRUJHWWRlook out forVQDNHVRQWKH
EHHVSHFLDOO\YLJLODQWIRU
something KLNLQJWUDLO
Can you look over my essay for spelling
look something over FKHFNH[DPLQH
PLVWDNHV"
VHDUFKDQG¿QGLQIRUPDWLRQLQD :HFDQlook her phone number up on the
look something up
UHIHUHQFHERRNRUGDWDEDVH ,QWHUQHW
0\OLWWOHVLVWHUKDVDOZD\Vlooked up to
look up to someone KDYHDORWRIUHVSHFWIRU
PH
-RVLHmade up a story about why we were
make something up LQYHQWOLHDERXWVRPHWKLQJ
ODWH
:HZHUHDQJU\ODVWQLJKWEXWZHmade
make up IRUJLYHHDFKRWKHU
upDWEUHDNIDVW
0\VLVWHUVmade me up for my graduation
make someone up apply cosmetics to
SDUW\
mix something up confuse two or more things I mixed upWKHWZLQV
QDPHVDJDLQ
His uncle passed away last night after a
pass away die
ORQJLOOQHVV
It was so hot in the church that an elderly
pass out faint
lady passed out
The professor passedWKHWH[WERRNVout
pass something out JLYHWKHVDPHWKLQJWRPDQ\SHRSOH
EHIRUHFODVV
I passed upWKHMREEHFDXVH,DPDIUDLGRI
pass something up GHFOLQH XVXDOO\VRPHWKLQJJRRG
FKDQJH
7KDQNVIRUEX\LQJP\WLFNHW,
OOpay you
pay someone back return owed money
backRQ)ULGD\

be punished for doing something That bully will pay for being mean to my
pay for something
bad OLWWOHEURWKHU

I picked out three sweaters for you to try


pick something out choose
RQ

172 17
1172
72
Colegio de Bachilleres del Estado de Sonora
Inglés 3

point someone/something ,
OOpoint my boyfriend out when he runs
LQGLFDWHZLWK\RXU¿QJHU
out E\
put what you are holding on a You can put the groceries down on the
put something down
VXUIDFHRUÀRRU NLWFKHQFRXQWHU
The students put the substitute teacher
put someone down LQVXOWPDNHVRPHRQHIHHOVWXSLG
downEHFDXVHKLVSDQWVZHUHWRRVKRUW
:HDUHputting offRXUWULSXQWLO-DQXDU\
put something off postpone
EHFDXVHRIWKHKXUULFDQH
The neighbours putWKH¿UHout before the
put something out extinguish
¿UHPHQDUULYHG
,KDYHWRput the crib together before the
put something together assemble
EDE\DUULYHV
put up with someone/ ,GRQ
WWKLQN,FDQput up with three small
tolerate
something FKLOGUHQLQWKHFDU
put clothing/accessories on your 'RQ
WIRUJHWWRput on your new earrings
put something on
body IRUWKHSDUW\
run into someone/
meet unexpectedly I ran intoDQROGVFKRROIULHQGDWWKHPDOO
something
run over someone/ GULYHDYHKLFOHRYHUDSHUVRQRU I accidentally ran over your bicycle in the
something thing GULYHZD\
run over/through /HW
Vrun over/through these lines one
UHKHDUVHUHYLHZ
something PRUHWLPHEHIRUHWKHVKRZ
The child ran away from home and has
run away OHDYHXQH[SHFWHGO\HVFDSH
EHHQPLVVLQJIRUWKUHHGD\V
:Hran out of shampoo so I had to wash
run out KDYHQRQHOHIW
P\KDLUZLWKVRDS
0\OHWWHUJRWsent back to me because I
send something back UHWXUQ XVXDOO\E\PDLO
XVHGWKHZURQJVWDPS
Our boss set a meeting up with the
set something up arrange, organize
SUHVLGHQWRIWKHFRPSDQ\
The police set up the car thief by using a
set someone up WULFNWUDS
KLGGHQFDPHUD
I want to shop around a little before I
shop around compare prices
GHFLGHRQWKHVHERRWV

act extra special for people


show off He always shows offRQKLVVNDWHERDUG
ZDWFKLQJ XVXDOO\ERDVWIXOO\

stay somewhere for the night You should sleep over tonight if the
sleep over
LQIRUPDO ZHDWKHULVWRREDGWRGULYHKRPH

177733 173
173
BLOCK 4 Could I borrow…
:HQHHGWRsort the bills out before the
sort something out RUJDQL]HUHVROYHDSUREOHP
¿UVWRIWKHPRQWK
continue doing something, limit You will lose weight if you stick to the
stick to something
yourself to one particular thing GLHW
7KHOLJKW
VWRREULJKW&RXOG\RXswitch
switch something off VWRSWKHHQHUJ\ÀRZWXUQRII
it off
:HKHDUGWKHQHZVDVVRRQDVZH
switch something on VWDUWWKHHQHUJ\ÀRZWXUQRQ
switched onWKHFDUUDGLR
I take afterP\PRWKHU:HDUHERWK
take after someone resemble a family member
LPSDWLHQW
He tookWKHFDUEUDNHVapart and found
take something apart SXUSRVHO\EUHDNLQWRSLHFHV
WKHSUREOHP
,KDYHWRtake our new TV back because
take something back return an item
LWGRHVQ
WZRUN
take off VWDUWWRÀ\ 0\SODQHtakes offLQ¿YHPLQXWHV
UHPRYHVRPHWKLQJ XVXDOO\ Take off\RXUVRFNVDQGVKRHVDQGFRPH
take something off
FORWKLQJ LQWKHODNH
Can you take the garbage out to the street
take something out UHPRYHIURPDSODFHRUWKLQJ
IRUPH"
pay for someone to go somewhere 0\JUDQGSDUHQWVtook us out for dinner
take someone out
with you DQGDPRYLH
I tore upP\H[ER\IULHQG
VOHWWHUVDQG
tear something up rip into pieces
JDYHWKHPEDFNWRKLP
UHPHPEHU RIWHQWRVRPHWLPHV :KHQ,think back on my youth, I wish I
think back
RQ KDGVWXGLHGKDUGHU
,
OOKDYHWRthinkWKLVMRERIIHUover before
think something over consider
,PDNHP\¿QDOGHFLVLRQ
:Hthrew our old furniture away when
throw something away dispose of
ZHZRQWKHORWWHU\
GHFUHDVHWKHYROXPHRUVWUHQJWK Please turn the TV down while the guests
turn something down
KHDWOLJKWHWF DUHKHUH
I turnedWKHMREdownEHFDXVH,GRQ
W
turn something down refuse
ZDQWWRPRYH
Your mother wants you to turn the TV off
turn something off VWRSWKHHQHUJ\ÀRZVZLWFKRII
DQGFRPHIRUGLQQHU
,W
VWRRGDUNLQKHUH/HW
Vturn some
turn something on start the energy, switch on
lights on
LQFUHDVHWKHYROXPHRUVWUHQJWK Can you turn the music up"7KLVLVP\
turn something up
KHDWOLJKWHWF IDYRXULWHVRQJ

174 17
1174
74
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Our cat turned up after we put posters up


turn up appear suddenly
DOORYHUWKHQHLJKERXUKRRG
,
PJRLQJWRtryWKHVHMHDQVonEXW,GRQ
W
try something on sample clothing
WKLQNWKH\ZLOO¿W
I am going to try this new brand of
try something out test
detergent out
7KHNLGVused all of the toothpaste up so
use something up ¿QLVKWKHVXSSO\
ZHQHHGWREX\VRPHPRUH
:HKDYHWRwake upHDUO\IRUZRUNRQ
wake up stop sleeping
0RQGD\
warm someone/something You can warm your feet up in front of the
increase the temperature
up ¿UHSODFH
I always warm up by doing sit-ups before
warm up prepare body for exercise
,JRIRUDUXQ
0RVWRIP\PDNHXSwore off before I got
wear off fade away
WRWKHSDUW\
work out exercise I work outDWWKHJ\PWKUHHWLPHVDZHHN
work out be successful Our plan worked out¿QH
:HKDYHWRwork out the total cost before
work something out PDNHDFDOFXODWLRQ
ZHEX\WKHKRXVH

Grammar reference
3KUDVDOYHUEVWHQVHV

6LPSOHSUHVHQWVLPSOHSDVWDQGVLPSOHIXWXUHXVH

6XEMHFWSKUDVDOYHUEFRPSOHPHQW
Examples:
I’m looking forward toW\SHP\HVVD\
0RQLFDbroke up with her boyfriend again!
0DULD(QULTXHWDwill take care ofWKHNLGV

Grammar reference
3KUDVDOYHUEV

$3KUDVDOYHUEFRQVLVWVRIWZRZRUGSKUDVHVFRQVLVWLQJRIverb + adverb or verb + preposition


Example:
Turn on . Turn on the music, I can’t hear it!
Slow down.6ORZLWGRZQ7KHUHLVDGRJ

177755 175
175
BLOCK 4 Could I borrow…
Didactic sequence 2. “Could you please?”

Grammar reference
0RGDOYHUEV

0RGDOYHUEVDUHXVHGWRPDNHUHTXHVW
7RPDNHSROLWHUHTXHVWZHXVHPRGDOYHUEVOLNHFDQFRXOGDQGPD\
Can Can ,JRWRWKHUHVWURRP" It’s direct and informal
Could Could ,JRWRWKHUHVWURRP" Polite and more formal.
May May ,JRWRWKHUHVWURRP" Polite and very formal.

Grammar reference
0RGDOYHUEV

0RGDOYHUEVWRPDNHRIIHUV
:HXVHCan, May and Could, WRGRWKLQJVIRUSHRSOHRUWRLQYLWHWKHPWRGRVRPHWKLQJ
([DPSOH
Can ,JHW\RXVRPHWKLQJWRGULQN"
Could ,KHOS\RXZLWKWKLVKRPHZRUN"
How May ,KHOS\RX"

Grammar reference
2EMHFWSURQRXQV

7KHREMHFWSURQRXQWDNHVWKHSODFHRIDQRXQ
([DPSOH
-HVVLFDVDZ him
HimLVWKHGLUHFWREMHFW
*LYHme WKHERRN
MeLVWKHLQGLUHFWREMHFW7KHGLUHFWREMHFWLVWKHERRN

Personal pronouns 2EMHFWSURQRXQV


I 0(
YOU YOU
HE +,0
SHE HER
IT IT
:( US
YOU YOU
THEY 7+(0

176 17
1176
76
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Grammar reference
0RGDOYHUEV

0RGDOYHUEVWRPDNHRIIHUV
:HXVHCan, May and Could, WRGRWKLQJVIRUSHRSOHRUWRLQYLWHWKHPWRGRVRPHWKLQJ
([DPSOH
Can ,JHW\RXVRPHWKLQJWRGULQN"
Could ,KHOS\RXZLWKWKLVKRPHZRUN"
How May ,KHOS\RX"
3RVVLEOHDFFHSWLQJDQVZHUVIRURIIHURUUHTXHVWUHIXVLQJDQVZHUV

<HVRIFRXUVH1RWKDQNV
Sure! I’d rather not
<HVWKDWQLFHRI\RX1RWKDQNV,¶P¿QH

177777 177
177
BLOCK 4 Could I borrow…
SELF-EVALUATION

I can… Excellent Good Regular


8VHVSKUDVDOYHUEVLQ
UHJXODUFRQYHUVDWLRQ
8VHVPRGDOYHUEVQR
PDNHUHTXHVWDQGRIIHUV
0D\FDQDQGFRXOG
8VHVWKHREMHFWLYH
SURQRXQVPH\RXKLP
KHUWKHPXVLW
8VHVYRFDEXODU\RIKRXVH
FKRUHV

CO-EVALUATION

Needs
Excellent Satisfactory Unsatisfactory
POINTS Improvement Pts.
3 2 0
1

Attendance Has perfect +DVRU Has 3 or 4 Has 4 or more


and DWWHQGDQFH 8QH[FXVHGDEVHQFHV 8QH[FXVHGDEVHQFHV 8QH[FXVHGDEVHQFHV
punctuality ,VQHYHUODWH ,VVHOGRPODWH ,VVRPHWLPHVODWH ,VXVXDOO\ODWH

)UHTXHQWO\ Often Rarely


1HYHU
Participates participates participates
Participation participates
$VNVTXHVWLRQV DVNVTXHVWLRQV DVNVTXHVWLRQV
and appears apathetic
Shows a lot of shows interest shows interest
Discussions towards class
interest in class in class in class
DFWLYLWLHV
DFWLYLWLHV DFWLYLWLHV DFWLYLWLHV

1HYHUGLVWUDFWVRWKHU Rarely distracts Sometimes distracts )UHTXHQWO\GLVWUDFWV


Distracting
students or the other students or the other students or the other students or the
behavior
WHDFKHU WHDFKHU WHDFKHU WHDFKHU

Always turns in Usually turns in Sometimes turns in


Rarely turns in
Completion DVVLJQPHQWV DVVLJQPHQWV DVVLJQPHQWV
DVVLJQPHQWV
of Assignments are Assignments are Assignments are
Assignments show
assignments always well-done usually clear, and sometimes well-
PLQLPDOHIIRUW
DQGFRPSOHWH FRPSOHWH GRQH
Attitude
Shows a great Shows interest in Shows little interest Shows no interest in
toward
LQWHUHVWLQOHDUQLQJ OHDUQLQJ LQOHDUQLQJ OHDUQLQJ
learning
TOTAL

178 17
1178
78
Colegio de Bachilleres del Estado de Sonora
Inglés 3

ORAL PRESENTATION RUBRIC

7HDFKHU1DPH

6WXGHQW1DPHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

CATEGORY 4 3 2 1
Pitch was often used but
Pitch was often used and Pitch was rarely used OR the
WKHHPRWLRQLWFRQYH\HG 3LWFKZDVQRWXVHGWRFRQYH\
Pitch LWFRQYH\HGHPRWLRQV HPRWLRQLWFRQYH\HGRIWHQGLG
VRPHWLPHVGLGQRW¿WWKH HPRWLRQ
DSSURSULDWHO\ QRW¿WWKHFRQWHQW
FRQWHQW

3DXVHVZHUHHIIHFWLYHO\XVHG Pauses were intentionally


3DXVHVZHUHHIIHFWLYHO\XVHG
RUPRUHWLPHVWRLPSURYH XVHGEXWZHUHQRWHIIHFWLYH Pauses were not intentionally
Pauses RQFHWRLPSURYHPHDQLQJ
meaning and/or dramatic LQLPSURYLQJPHDQLQJRU XVHG
DQGRUGUDPDWLFLPSDFW
LPSDFW GUDPDWLFLPSDFW

Student is able to accurately Student is unable to


Student is able to accurately Student is able to accurately
DQVZHUDOPRVWDOOTXHVWLRQV DFFXUDWHO\DQVZHUTXHVWLRQV
Comprehension DQVZHUPRVWTXHVWLRQVSRVHG DQVZHUDIHZTXHVWLRQVSRVHG
posed by classmates about posed by classmates about
E\FODVVPDWHVDERXWWKHWRSLF E\FODVVPDWHVDERXWWKHWRSLF
WKHWRSLF WKHWRSLF

Facial expressions and Very little use of facial


Facial expressions and body Facial expressions and body
body language sometimes expressions or body
language generate a strong language are used to try to
Enthusiasm generate a strong interest and ODQJXDJH'LGQRWJHQHUDWH
interest and enthusiasm about generate enthusiasm, but
enthusiasm about the topic much interest in topic being
WKHWRSLFLQRWKHUV VHHPVRPHZKDWIDNHG
LQRWKHUV SUHVHQWHG

Student seems pretty


Student is completely The student is somewhat
SUHSDUHGEXWPLJKWKDYH Student does not seem at all
Preparedness SUHSDUHGDQGKDVREYLRXVO\ prepared, but it is clear that
needed a couple more SUHSDUHGWRSUHVHQW
UHKHDUVHG UHKHDUVDOZDVODFNLQJ
UHKHDUVDOV
Presentation is less than 3
Presentation is 5-6 minutes Presentation is 4 minutes Presentation is 3 minutes
Time-Limit minutes OR more than 6
ORQJ ORQJ ORQJ
PLQXWHV
6SHDNVFOHDUO\DQGGLVWLQFWO\ Often mumbles or can
6SHDNVFOHDUO\DQGGLVWLQFWO\ 6SHDNVFOHDUO\DQGGLVWLQFWO\
PRVW  RIWKHWLPH not be understood OR
Speaks Clearly DOO  WKHWLPHDQG DOO  WKHWLPHEXW
0LVSURQRXQFHVQRPRUHWKDQ mispronounces more than
PLVSURQRXQFHVQRZRUGV PLVSURQRXQFHVRQHZRUG
RQHZRUG RQHZRUG

8VHVYRFDEXODU\DSSURSULDWH 8VHVYRFDEXODU\DSSURSULDWH
8VHVYRFDEXODU\DSSURSULDWH
IRUWKHDXGLHQFH([WHQGV IRUWKHDXGLHQFH,QFOXGHV 8VHVVHYHUDO RUPRUH 
IRUWKHDXGLHQFH'RHVQRW
Vocabulary DXGLHQFHYRFDEXODU\E\ ZRUGVWKDWPLJKWEHQHZ words or phrases that are not
LQFOXGHDQ\YRFDEXODU\WKDW
GH¿QLQJZRUGVWKDWPLJKWEH to most of the audience, but XQGHUVWRRGE\WKHDXGLHQFH
PLJKWEHQHZWRWKHDXGLHQFH
QHZWRPRVWRIWKHDXGLHQFH GRHVQRWGH¿QHWKHP

6WDQGVXSVWUDLJKWORRNV
Stands up straight and
UHOD[HGDQGFRQ¿GHQW Slouches and/or does not
Posture and Eye establishes eye contact with Sometimes stands up straight
Establishes eye contact with ORRNDWSHRSOHGXULQJWKH
Contact HYHU\RQHLQWKHURRPGXULQJ DQGHVWDEOLVKHVH\HFRQWDFW
HYHU\RQHLQWKHURRPGXULQJ SUHVHQWDWLRQ
WKHSUHVHQWDWLRQ
WKHSUHVHQWDWLRQ

Shows a full understanding of Shows a good understanding Shows a good understanding Does not seem to understand
Content
WKHWRSLF RIWKHWRSLF RISDUWVRIWKHWRSLF WKHWRSLFYHU\ZHOO

Volume is loud enough to Volume is loud enough to Volume is loud enough to


Volume often too soft to
be heard by all audience be heard by all audience be heard by all audience
Volume be heard by all audience
members throughout the PHPEHUVDWOHDVWRIWKH PHPEHUVDWOHDVWRIWKH
PHPEHUV
SUHVHQWDWLRQ WLPH WLPH
Almost always listens to, Usually listens to, shares Often listens to, shares with,
Rarely listens to, shares with,
shares with, and supports the with, and supports the efforts and supports the efforts
Collaboration and supports the efforts of
HIIRUWVRIRWKHUVLQWKHJURXS RIRWKHUVLQWKHJURXS'RHV of others in the group but
with Peers RWKHUVLQWKHJURXS2IWHQLV
7ULHVWRNHHSSHRSOHZRUNLQJ QRWFDXVH?ZDYHV?LQWKH sometimes is not a good team
QRWDJRRGWHDPPHPEHU
ZHOOWRJHWKHU JURXS PHPEHU

177799 179
179
BLOCK 4 Could I borrow…
58%5,&6)25:5,7,1*

GOOD

Award 5 to 7 points if:


• :ULWLQJLVGHYHORSHGDQGGRHVQRWDSSHDUWRWDNHPXFKHIIRUW
• 7KHSXUSRVHDQGDLPRIWKHZULWLQJLVFOHDU
• 7KHZULWLQJXVXDOO\ÀRZVDWERWKWKHSDUDJUDSKDQGVHQWHQFHOHYHO
• 7KHZRUGVFKRVHQDUHXVXDOO\DSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
• 7KHYRLFHRIWKHDXWKRULVXVXDOO\FOHDUDQGXVXDOO\FRPHVWKURXJKVWURQJO\
• The organization is generally appropriate for the type of piece being written
• ,QJHQHUDOVWDQGDUGZULWLQJUXOHVDUHIROORZHGEXWWKHUHDUHDIHZHUURUVLQJUDPPDUDQGRUSXQFWXDWLRQ

VERY GOOD

Award 8 to 10 points if:


• The purpose and aim of the writing are clear
• 7KHZULWLQJÀRZVDWERWKWKHSDUDJUDSKDQGVHQWHQFHOHYHO
• 7KHYRLFHRIWKHDXWKRULVFOHDUDQGFRPHVWKURXJKVWURQJO\
• 7KHZRUGVFKRVHQDUHDSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
• 7KHFRQYHQWLRQVRIVWDQGDUGZULWLQJDUHXVXDOO\IROORZHG

EXCELLENT

Award 20 points if:


• :ULWLQJLVIXOO\GHYHORSHGDQGDSSHDUVHIIRUWOHVV
• 7KHSXUSRVHDQGDLPRIWKHZULWLQJDUHYHU\FOHDU
• 7KHZULWLQJDOZD\VÀRZVDWERWKWKHSDUDJUDSKDQGVHQWHQFHOHYHO
• 7KHYRLFHRIWKHDXWKRULVYHU\FOHDUDQGFRPHVWKURXJKVWURQJO\
• 7KHZRUGVFKRVHQDUHYHU\DSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
• 7KHRUJDQL]DWLRQLVYHU\DSSURSULDWHIRUWKHW\SHRISLHFHEHLQJZULWWHQ
• 7KHUXOHVRIVWDQGDUGZULWLQJDUHIROORZHG

TOTAL: _______
  

Students’ composition must have the appropriate content for the topic, and logically accurate
vocabulary.

180 18
1180
80
Colegio de Bachilleres del Estado de Sonora
Inglés 3

DIALOGUE RUBRIC

Traits Level 4 Level 3 Level 2 Level 1

:ULWLQJPRVWO\ 'LDORJXHLVYDJXH
:ULWLQJIROORZV
:ULWLQJIROORZV follows the DQGRULQDSSURSULDWH
WKHFRQYHQWLRQVRI
WKHFRQYHQWLRQVRI FRQYHQWLRQVRI Dialogue is
dialogue without
dialogue with few dialogue with some not written in
H[FHSWLRQ:ULWLQJ
H[FHSWLRQV:ULWLQJ GHYLDWLRQV:ULWLQJ FRQYHQWLRQDOIRUP
HYLGHQFHVDFOHDU
Writing/Conventions HYLGHQFHVDFOHDU shows an attempt at )UHTXHQWHUURUVLQ
sophisticated
VWUXFWXUH)HZ VWUXFWXUHEXWODFNV spelling, punctuation
VWUXFWXUH1R
errors in spelling, FRQVLVWHQF\0DQ\ and grammar that
errors in spelling,
punctuation and errors in spelling, interfere with
punctuation and
JUDPPDU punctuation and meaning and/or
JUDPPDU
JUDPPDU UHDGDELOLW\

The actions of the


7KHVFHQHPRYHV
The actions of the VFHQHDUHXQFOHDU
7KHVFHQHPRYHV VPRRWKO\WKURXJKRXW
scene are usually Actors are unaware
VPRRWKO\WKURXJKRXW The actors are
FOHDU)RFXVLVRIWHQ of actions from
Actors expand and audible and express
lost during the PRPHQWWRPRPHQW
H[SORUHLGHDV$FWRUV HPRWLRQDQGSXUSRVH
Fluency/Performance VFHQH$FWRUVDUH Actors may laugh or
are always audible, Actors sustain the
sometimes inaudible, GLVWUDFWHDFKRWKHU
clearly focused and scene, with some
unprepared for new Voices are too soft
committed to the distraction caused
HYHQWVLQWKHVFHQHRU to be heard and/or
HPRWLRQDQGSXUSRVH E\PLVWDNHVRU
³EUHDNFKDUDFWHU´ ZRUGVDUHVSRNHQWRR
³EUHDNLQJFKDUDFWHU´
IDVW

Scene relies almost


Scene relies
Scene relies entirely Scene relies mostly entirely upon
in part upon
upon original, upon original, author-generated
author-generated
student-generated student-generated FLUFXPVWDQFHV
Creativity/Voice FLUFXPVWDQFHV
circumstances, but circumstances, but Voices of the
Voices of the
SUHVHUYHVWKHYRLFHV SUHVHUYHVWKHYRLFHV FKDUDFWHUVYHHU
FKDUDFWHUVYHHUIURP
RIWKHFKDUDFWHUV RIWKHFKDUDFWHUV VLJQL¿FDQWO\IURP
RULJLQDOVRPHZKDW
RULJLQDO
Dialogue
Dialogue Dialogue
demonstrates Dialogue
demonstrates GHPRQVWUDWHVDODFN
an insightful demonstrates a solid
an unclear of understanding
understanding of the understanding of the
understanding of the RIWKHWDVNWKH
Meaning WDVNWKHFKDUDFWHUV WDVNWKHFKDUDFWHUV
WDVNWKHFKDUDFWHUV characters, their
chosen, their WKHLUPRWLYDWLRQVDQG
WKHLUPRWLYDWLRQVDQG PRWLYDWLRQVDQGWKHLU
PRWLYDWLRQVDQGWKHLU their relationship in
their relationship in relationship in the
relationship in the WKHQRYHO
WKHQRYHO QRYHO
QRYHO

1881 181
181
BLOCK 4 Could I borrow…
ORAL PRESENTATION RUBRIC

7HDFKHU1DPH

6WXGHQWV1DPHVBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

CATEGORY 4 3 2 1
Pitch was often used but
Pitch was often used and Pitch was rarely used OR the
WKHHPRWLRQLWFRQYH\HG 3LWFKZDVQRWXVHGWRFRQYH\
Pitch LWFRQYH\HGHPRWLRQV HPRWLRQLWFRQYH\HGRIWHQGLG
VRPHWLPHVGLGQRW¿WWKH HPRWLRQ
DSSURSULDWHO\ QRW¿WWKHFRQWHQW
FRQWHQW

3DXVHVZHUHHIIHFWLYHO\XVHG Pauses were intentionally


3DXVHVZHUHHIIHFWLYHO\XVHG
RUPRUHWLPHVWRLPSURYH XVHGEXWZHUHQRWHIIHFWLYH Pauses were not intentionally
Pauses RQFHWRLPSURYHPHDQLQJDQG
meaning and/or dramatic LQLPSURYLQJPHDQLQJRU XVHG
RUGUDPDWLFLPSDFW
LPSDFW GUDPDWLFLPSDFW

Student is able to accurately


Student is able to accurately Student is able to accurately Student is unable to accurately
DQVZHUDOPRVWDOOTXHVWLRQV
Comprehension DQVZHUPRVWTXHVWLRQVSRVHG DQVZHUDIHZTXHVWLRQVSRVHG DQVZHUTXHVWLRQVSRVHGE\
posed by classmates about the
E\FODVVPDWHVDERXWWKHWRSLF E\FODVVPDWHVDERXWWKHWRSLF FODVVPDWHVDERXWWKHWRSLF
WRSLF

Facial expressions and body Facial expressions and body Facial expressions and body Very little use of facial
language generate a strong language sometimes generate a language are used to try to H[SUHVVLRQVRUERG\ODQJXDJH
Enthusiasm
interest and enthusiasm about strong interest and enthusiasm generate enthusiasm, but seem Did not generate much interest
WKHWRSLFLQRWKHUV DERXWWKHWRSLFLQRWKHUV VRPHZKDWIDNHG LQWRSLFEHLQJSUHVHQWHG

Student seems pretty prepared The student is somewhat


Student is completely prepared Student does not seem at all
Preparedness EXWPLJKWKDYHQHHGHGD prepared, but it is clear that
DQGKDVREYLRXVO\UHKHDUVHG SUHSDUHGWRSUHVHQW
FRXSOHPRUHUHKHDUVDOV UHKHDUVDOZDVODFNLQJ

Presentation is less than 3


Presentation is 5-6 minutes
Time-Limit 3UHVHQWDWLRQLVPLQXWHVORQJ 3UHVHQWDWLRQLVPLQXWHVORQJ minutes OR more than 6
ORQJ
PLQXWHV

6SHDNVFOHDUO\DQGGLVWLQFWO\
6SHDNVFOHDUO\DQGGLVWLQFWO\ 6SHDNVFOHDUO\DQGGLVWLQFWO\ Often mumbles or can not be
PRVW  RIWKHWLPH
Speaks Clearly DOO  WKHWLPHDQG DOO  WKHWLPHEXW understood OR mispronounces
0LVSURQRXQFHVQRPRUHWKDQ
PLVSURQRXQFHVQRZRUGV PLVSURQRXQFHVRQHZRUG PRUHWKDQRQHZRUG
RQHZRUG

8VHVYRFDEXODU\DSSURSULDWH 8VHVYRFDEXODU\DSSURSULDWH
8VHVYRFDEXODU\DSSURSULDWH
IRUWKHDXGLHQFH([WHQGV IRUWKHDXGLHQFH,QFOXGHV 8VHVVHYHUDO RUPRUH 
IRUWKHDXGLHQFH'RHVQRW
Vocabulary DXGLHQFHYRFDEXODU\E\ words that might be new to words or phrases that are not
LQFOXGHDQ\YRFDEXODU\WKDW
GH¿QLQJZRUGVWKDWPLJKWEH most of the audience, but does XQGHUVWRRGE\WKHDXGLHQFH
PLJKWEHQHZWRWKHDXGLHQFH
QHZWRPRVWRIWKHDXGLHQFH QRWGH¿QHWKHP
6WDQGVXSVWUDLJKWORRNV
Stands up straight and
UHOD[HGDQGFRQ¿GHQW Slouches and/or does not
Posture and Eye establishes eye contact with Sometimes stands up straight
Establishes eye contact with ORRNDWSHRSOHGXULQJWKH
Contact HYHU\RQHLQWKHURRPGXULQJ DQGHVWDEOLVKHVH\HFRQWDFW
HYHU\RQHLQWKHURRPGXULQJ SUHVHQWDWLRQ
WKHSUHVHQWDWLRQ
WKHSUHVHQWDWLRQ
Shows a full understanding of Shows a good understanding of Shows a good understanding of Does not seem to understand
Content
WKHWRSLF WKHWRSLF SDUWVRIWKHWRSLF WKHWRSLFYHU\ZHOO

Volume is loud enough to be Volume is loud enough to be Volume is loud enough to be Volume often too soft to
Volume heard by all audience members heard by all audience members heard by all audience members be heard by all audience
WKURXJKRXWWKHSUHVHQWDWLRQ DWOHDVWRIWKHWLPH DWOHDVWRIWKHWLPH PHPEHUV
Almost always listens to, Often listens to, shares with,
Usually listens to, shares with, Rarely listens to, shares with,
shares with, and supports the and supports the efforts
Collaboration with and supports the efforts of and supports the efforts of
HIIRUWVRIRWKHUVLQWKHJURXS of others in the group but
Peers RWKHUVLQWKHJURXS'RHVQRW RWKHUVLQWKHJURXS2IWHQLV
7ULHVWRNHHSSHRSOHZRUNLQJ sometimes is not a good team
FDXVH?ZDYHV?LQWKHJURXS QRWDJRRGWHDPPHPEHU
ZHOOWRJHWKHU PHPEHU

182 18
1182
82
Colegio de Bachilleres del Estado de Sonora
Inglés 3

DIALOGUE RUBRIC

Traits Level 4 Level 3 Level 2 Level 1

:ULWLQJPRVWO\ 'LDORJXHLVYDJXH
:ULWLQJIROORZV
:ULWLQJIROORZV follows the DQGRULQDSSURSULDWH
WKHFRQYHQWLRQVRI
WKHFRQYHQWLRQVRI FRQYHQWLRQVRI Dialogue is
dialogue without
dialogue with few dialogue with some not written in
H[FHSWLRQ:ULWLQJ
H[FHSWLRQV:ULWLQJ GHYLDWLRQV:ULWLQJ FRQYHQWLRQDOIRUP
HYLGHQFHVDFOHDU
Writing/Conventions HYLGHQFHVDFOHDU shows an attempt at )UHTXHQWHUURUVLQ
sophisticated
VWUXFWXUH)HZ VWUXFWXUHEXWODFNV spelling, punctuation
VWUXFWXUH1R
errors in spelling, FRQVLVWHQF\0DQ\ and grammar that
errors in spelling,
punctuation and errors in spelling, interfere with
punctuation and
JUDPPDU punctuation and meaning and/or
JUDPPDU
JUDPPDU UHDGDELOLW\

The actions of the


7KHVFHQHPRYHV
The actions of the VFHQHDUHXQFOHDU
7KHVFHQHPRYHV VPRRWKO\WKURXJKRXW
scene are usually Actors are unaware
VPRRWKO\WKURXJKRXW The actors are
FOHDU)RFXVLVRIWHQ of actions from
Actors expand and audible and express
lost during the PRPHQWWRPRPHQW
H[SORUHLGHDV$FWRUV HPRWLRQDQGSXUSRVH
Fluency/Performance VFHQH$FWRUVDUH Actors may laugh or
are always audible, Actors sustain the
sometimes inaudible, GLVWUDFWHDFKRWKHU
clearly focused and scene, with some
unprepared for new Voices are too soft
committed to the distraction caused
HYHQWVLQWKHVFHQHRU to be heard and/or
HPRWLRQDQGSXUSRVH E\PLVWDNHVRU
³EUHDNFKDUDFWHU´ ZRUGVDUHVSRNHQWRR
³EUHDNLQJFKDUDFWHU´
IDVW

Scene relies almost


Scene relies
Scene relies entirely Scene relies mostly entirely upon
in part upon
upon original, upon original, author-generated
author-generated
student-generated student-generated FLUFXPVWDQFHV
Creativity/Voice FLUFXPVWDQFHV
circumstances, but circumstances, but Voices of the
Voices of the
SUHVHUYHVWKHYRLFHV SUHVHUYHVWKHYRLFHV FKDUDFWHUVYHHU
FKDUDFWHUVYHHUIURP
RIWKHFKDUDFWHUV RIWKHFKDUDFWHUV VLJQL¿FDQWO\IURP
RULJLQDOVRPHZKDW
RULJLQDO

Dialogue
Dialogue Dialogue
demonstrates Dialogue
demonstrates GHPRQVWUDWHVDODFN
an insightful demonstrates a solid
an unclear of understanding
understanding of the understanding of the
understanding of the RIWKHWDVNWKH
Meaning WDVNWKHFKDUDFWHUV WDVNWKHFKDUDFWHUV
WDVNWKHFKDUDFWHUV characters, their
chosen, their WKHLUPRWLYDWLRQVDQG
WKHLUPRWLYDWLRQVDQG PRWLYDWLRQVDQGWKHLU
PRWLYDWLRQVDQGWKHLU their relationship in
their relationship in relationship in the
relationship in the WKHQRYHO
WKHQRYHO QRYHO
QRYHO

188833 183
183
BLOCK 4 Could I borrow…
RUBRIC FOR PORTFOLIO

Beginning Developing Accomplished Exemplary


Comments Score
1 2 3 4

Entire portfolio
0DQ\PHFKDQLFDO has little or no
Some mechanical All or part of
HUURUVSUHVHQW mechanical
HUURUVSUHVHQW the portfolio has
grammar, spelling, HUURUV
grammar, few mechanical
punctuation, and grammar,
spelling, HUURUVJUDPPDU
0HFKDQLFV other mechanics spelling,
punctuation, and spelling,
demonstrate a punctuation,
other mechanics punctuation, and
VLJQL¿FDQWQHHG and other
need some other mechanics
WRLPSURYHLQWKLV mechanics are
LPSURYHPHQW DUHJRRGRYHUDOO
DUHD perfect or near
SHUIHFW

Entire portfolio Entire portfolio


Entire portfolio Some parts demonstrates demonstrates
demonstrates of portfolio some originality VLJQL¿FDQW
VLJQL¿FDQWODFN
Originality/ demonstrate DQGFUHDWLYLW\ originality and
of originality and originality Some pieces FUHDWLYLW\([WUD
FUHDWLYLW\([WUD
&UHDWLYLW\ DQGFUHDWLYLW\ such as pieces such as
pieces such as %DFNJURXQGV EDFNJURXQGV EDFNJURXQGV
EDFNJURXQGV pictures, music pictures, and pictures, and
pictures, and PD\EHSUHVHQW music are music are
PXVLFDUHDEVHQW SUHVHQW SUHVHQW
Portfolio is
3RUWIROLRODFNV Portfolio is Portfolio is neat extremely
Neatness/ neatness and somewhat neat DQGRUJDQL]HG neat and
RUJDQL]DWLRQ DQGRUJDQL]HG /LQNVIXQFWLRQ RUJDQL]HG$OO
Organization 6RPHOLQNVDUH )HZOLQNVDUH ZHOODGHTXDWH OLQNVIXQFWLRQ
EURNHQRUDEVHQW EURNHQRUDEVHQW OLQNVSUHVHQW SHUIHFWO\DPSOH
OLQNVDYDLODEOH

,1)250$7,216285&(6

Electronics:

LIST OF PHRASAL VERBS


KWWSZZZHQJOLVKFOXEFRPYRFDEXODU\SKUDVDOYHUEVOLVWKWP
KWWSZZZFRQVWUX\HWRUJP[OHFFLRQHV

184 18
1184
84
Colegio de Bachilleres del Estado de Sonora
Inglés 3

Lecciones
CONSTRUYE T

188855 185
185
Lecciones Construye T 185
1

186 18
1186
86
Colegio de Bachilleres del Estado de Sonora
Inglés 3
Lo que nos mueve

188877 187
187
Lecciones Construye T
2

188 18
1188
88
Colegio de Bachilleres del Estado de Sonora
Inglés 3
ŵƉĂơĂ͗ƵŶĂƉƵĞƌƚĂĂůĂŝŶĐůƵƐŝſŶ

188899 189
189
Lecciones Construye T
ŵƉĂơĂ͗ƵŶĂƉƵĞƌƚĂĂůĂŝŶĐůƵƐŝſŶ

190 19
1190
90
Colegio de Bachilleres del Estado de Sonora
3 Inglés 3

1991 191
191
Lecciones Construye T
DŝƉĞƌƐƉĞĐƟǀĂƐĞŶƵƚƌĞĚĞŵŝĞdžƉĞƌŝĞŶĐŝĂ

192 19
1192
92
Colegio de Bachilleres del Estado de Sonora
4 Inglés 3

199933 193
193
Lecciones Construye T
DŝƐƌĞĂĐĐŝŽŶĞƐĂŶƚĞƉĞƌƐŽŶĂƐƋƵĞŵĞƉĂƌĞĐĞŶĚŝİĐŝůĞƐ

194 19
1194
94
Colegio de Bachilleres del Estado de Sonora
5 Inglés 3

199955 195
195
Lecciones Construye T
Si te caes, te levanto

196 19
1196
96
Colegio de Bachilleres del Estado de Sonora
5 Inglés 3

199977 197
197
Lecciones Construye T
WƌĞǀĞŶŝƌƐŝƚƵĂĐŝŽŶĞƐĚĞĞdžĐůƵƐŝſŶ

198 19
1198
98
Colegio de Bachilleres del Estado de Sonora
Inglés 3

MIS NOTAS

199999 199
199
MIS NOTAS

200 20
2200
00
Colegio de Bachilleres del Estado de Sonora

Você também pode gostar