Você está na página 1de 185

ESCOLA TÉCNICA DE MÚSICA E DANÇA

“IVANILDO REBOUÇAS DA SILVA”

APOSTTILA DE PERCEP
PÇÃO MUSICAL

Nom
me: ...................................................................................

Classe: ............................... Ano: 20


0
118

professor.geronimo@gmail.com
Introdução...................................................................................................................... 1

Introdução aos padrões rítmicos...................................................................................10 

As folhas do passo.........................................................................................................13 

Padrões rítmicos ‐leitura não convencional.................................................................23 

Padrões rítmicos escrita não convencional..................................................................25 

Quadro de notas..........................................................................................................27 

Desenvolvimento da Habilidade Rítmica.....................................................................28 

Padrões rítmicos..........................................................................................................33 

Solfejo móvel...............................................................................................................59 

Desenvolvimento da Habilidade Tonal........................................................................60 

Padrões tonais associação verbal................................................................................64 

Padrões tonais associação simbólica...........................................................................68 

Padrões tonais generalização.......................................................................................74 

Padrões melódicos associação verbal Maiores............................................................75  

Padrões melódicos associação verbal menores...........................................................80 

Padrões melódicos associação simbólica.....................................................................85 

Exercícios de afinação vocal Maior..............................................................................94  

Exercícios de afinação vocal menor.............................................................................98 

Exercícios melódicos....................................................................................................103 

Introdução a leituras rítmicas......................................................................................108 

Padrões de regência.....................................................................................................109 

Leituras Rítmicas..........................................................................................................110 

Leituras de notas clave de sol .....................................................................................133 

Leituras de notas clave de fá.......................................................................................144 

Semitons diatônicos e cromáticos ..............................................................................151 

Solfejos com sílabas tonais..........................................................................................157 

Leituras melódicas Maiores........................................................................................164 

Leituras melódicas menores.......................................................................................171 

Canções com baixos (I‐V) ...........................................................................................178 

Sinais de mãos............................................................................................................180 

Bibliografia..................................................................................................................182 

professor.geronimo@gmail.com
INTRODUÇÃO
Música como linguagem 

Embora a música não seja uma linguagem no sentido mais estrito, podemos nos comunicar e 
comunicar uns com os outros através da música. 

Para se comunicar, precisamos ter algo a dizer. 

Na linguagem, temos palavras, que recebem um significado contextual através das frases em 
que as colocamos. 

Na música, temos padrões, que recebem significado contextual quando os colocamos em um 
contexto tonal ou rítmico. 

Uma vez que temos padrões (palavras) e podemos dar‐lhes contexto (frases), podemos 
começar a pensar musicalmente. Pensamento em música é chamado Audiação. 

Audiação 
Da mesma forma que podemos visualizar uma imagem no nosso cérebro, podemos "ouvir" a 
música. Podemos ter pensamentos musicais. 

Mas para realmente audiar, devemos entender os pensamentos que estamos tendo. Este 
breve resumo irá ensinar‐lhe como organizar seus pensamentos musicais. 

Rompendo o Código da Música 
Acredite ou não, a música é ruído para muitas pessoas. Eles ouvem isso como uma coleção de 
sons, e eles não conseguem ouvir as partes individuais que compõem o todo. 

A música tem dois componentes abrangentes: 
• Tonalidade
• Ritmo

A tonalidade pode ser dividida em duas categorias: melodia e harmonia. 

Para quebrar o código da música, seu objetivo é aprender: 
• Padrões de ritmo
• Padrões melódicos
• Padrões harmônicos

Em outras palavras, você precisa aprender palavras musicais, que você poderá juntar para 
fazer frases musicais. 

 Música como segunda língua 

Embora não haja correlações diretas, pense em aprender música como aprender uma língua 
estrangeira. Você precisa saber: 
• Nomes ‐ você dá nomes a coisas ou objetos.

1
professor.geronimo@gmail.com
◦ Cachorro 
• Adjetivos ‐ você descreve o substantivo. 
◦ O cachorro grande. 
• Verbos ‐ você faz algo com ou para cada substantivo. 
◦ O cachorro grande saltou. 
• Advérbios ‐ como você está fazendo isso? 

◦ O cachorro grande pulou rapidamente. 

Você não pode pensar em um novo idioma, a menos que você tenha substantivos, adjetivos, 
verbos e advérbios. 

Para pensar musicalmente, você precisa saber: 

• Ritmo 
◦ A música está em que movimento em 2? 3's? Ambos? 

◦ Quais são os padrões de ritmo que estão sendo usados? 

◦ Em que métrica estamos? Dupla? Tripla? Outra? 

◦ Quanto espaço existe entre os tempos? 

• Tonalidade 
◦ O que é o tom de descanso? 

◦ Estamos em Major? Menor? Outra?  

◦ Qual é a harmonia subjacente?  I grau? V grau ? (Padrões harmônicos) 

◦ Que conjuntos de notas a melodia está usando? (Padrões melódicos) 

Ao aprender esses conceitos básicos, você poderá quebrar o código da música e entender o 
que está acontecendo "por trás de tudo". Você aprenderá a audiar, a pensar musicalmente. 

Nível 1 de musica 
Como a música é principalmente uma arte auditiva, a proficiência deve primeiro ser alcançada 
de forma auditiva. O nível 1 de música é alcançado quando se pode audiar os fundamentos 
auditivos da música: 

Métricas duplas e triplas 

Tempos, divisão1 e divisão2 

Tonalidades Maior e menor 

I e V graus, Tons de repouso, Padrões Melódicos 

PARTE 1: RITMO 

2
professor.geronimo@gmail.com
Conceitos de ritmo 

O ritmo existe em 3 níveis fundamentais: 

• Tempos

• Subdivisão(divisões)

• Padrões de Ritmo (Ritmo Melódico)

Esses níveis interagem uns com os outros no espaço musical para formar a base rítmica da 
música. 

Tempos 
Os tempos, são o pulso da música. É o que você provavelmente faria com o pé, ou a batida que 
você mudaria se estivesse dançando. 

Subdivisão 
Podemos tomar esse tempo e dividi‐lo em duas ou três partes. Chamamos essas partes de 
subdivisão. 

As subdivisões definem a métrica em que estamos e estabelecemos o contexto rítmico. 

subdivisões 

• Se dividimos cada tempo em duas subdivisões estamos em tempos duplos(binário)

Se dividimos cada tempo em três subdivisões estamos em tempos triplos(ternário) 

Movimento e Ritmo 

O ritmo requer coordenação. Certifique‐se de que pode mover‐se simultaneamente nos 
tempos e subdivisões. Coloque os tempos em seus pés e as subdivisões em suas mãos. 

Espaço como pré‐requisito para o tempo 
Então, tente mover os braços em um espaço contínuo que flua livre sem pulsação. Reconhecer 
o espaço entre as batidas é muito importante porque isso constituirá a base para um tempo
consistente. Nós superpomos o tempo musical ‐ isto é, o pulso ‐ no espaço. 

Padrões de ritmo 
Uma vez que definimos as duas primeiras camadas de ritmo tempos e subdivisão ‐ e, 
reconhecido o espaço intermediário, temos um contexto rítmico. Temos uma métrica.. 

Agora, precisamos de padrões de ritmo. Os padrões de ritmo são as palavras de ritmo. 

Os padrões de ritmo são geralmente de quatro tempos de duração. 

3
professor.geronimo@gmail.com
Aprendendo padrões de ritmo 
Auditivo / Oral 

Começamos a aprender padrões de ritmo e padrões em geral, através de um processo 
chamado Auditivo/ Oral. 

Nós escutamos o padrão (Auditivo), e então entoamos o padrão  (Oral) usando a sílaba neutra, 
"pá." Então, ouvimos novamente (Auditivo)  o som que produzimos para verificar a precisão. 

Quando somos uma criança muito pequena, aprendemos palavras da mesma maneira. Nosso 
pai nos diz o nome dos objetos ‐ Mamãe, Papai, garrafa ‐ repetidamente, encorajando‐nos a 
repetir o nome para eles. 

Portanto ouça padrões variados e repita‐os. 

Associação verbal – Tempos e Subdivisões 
Uma vez que possamos mover‐se com sucesso nos pulsos e subdivisões simultaneamente, e 
repetir os padrões no nível auditivo/oral, é hora de rotular os padrões com uma Associação 
Verbal. 

Na linguagem, não precisamos desse passo porque podemos visualizar, o objeto (mamãe, 
papai, garrafa). Na música, precisamos de um passo extra para rotular e organizar o que 
ouvimos. 

O sistema mais eficaz para rotular as camadas de ritmo é o solfejo rítmico funcional como o 
takadimi. 

 Binários(duplos) 

Tempos = tá 

Subdivisões= tá di 

Ternários(triplos)  

Tempos = tá 

Subdivisões = tá ki da 

Ouça os padrões e repita 

Improvisação 

Uma vez que você pode repetir os padrões com sucesso em Duplo e Triplo usando sílabas de 
solfejo ritmicos, é hora de colocar as sílabas no trabalho. 

Na linguagem, não seguimos repetindo as palavras que nossos pais e professores nos ensinam. 
Nós nos colocamos juntos para "improvisar" frases para comunicar idéias. 

Você pode "falar" nessa linguagem rítmica? Você pode se perguntar uma "pergunta" rítmica e 
"responder"? 

4
professor.geronimo@gmail.com
Mais funções de ritmo 
Depois de ter a base de tempos e subdivisões em métricas duplas e triplas, é hora de começar 
a audiar mais  funções rítmicas. 

Como o ritmo é tão multi‐camadas, existem muitas funções rítmicas: divisões, alongamentos, 
pausas, ligados e anacruses. Há também métricas adicionais a serem consideradas. 

Vamos evoluindo nossos estudos de forma progressiva. 

Avançando 
Se isso fosse tudo, sobre aprendizagem do rítmo, então aprender música seria uma brisa! Esta 
é apenas a ponta do iceberg. No entanto, dominar este material é a base para todas as 
audiaçoes futuras, para todo o futuro pensamento musical. 

Se você pode "falar" o idioma do ritmo, então ele se torna sua propriedade, e você pode, por 
sua vez, fazer comparações com qualquer coisa que você ouça. 

Avaliação 
 

Finalmente, faça os ditados rítmicos para avaliar‐se. Você pode audiar ritmicamente? 

PARTE 2: HARMONIA 
Contexto Tonal 

A música não existe aleatóriamente. Existem certos princípios organizacionais. 

Em linguagem, se alguém dissesse: "escola tarde estuda a criança para vai a" nós ouviríamos 
cada palavra individualmente, mas o contexto da frase não é claro, na melhor das hipóteses. 

Quando um gato caminha através de um teclado de piano e toca uma série aleatórias de 
notas, essas são realmente notas musicais, mas são desprovidos de contexto musical. Pelo 
menos para o gato. 

Na música, damos o contexto as notas relacionando‐as a uma tonalidade. 

O que é uma tonalidade? 

Uma tonalidade, para citar o Dr. Edwin E. Gordon, em sua Teoria da Aprendizagem Musical, é 
"definida pelo seu centro tonal, que é chamado de Tom de Repouso". 

Tom de repouso 
Cada tonalidade tem um tom de repouso, um lugar onde a música chega a uma conclusão 
lógica. 

5
professor.geronimo@gmail.com
Um tom de repouso tem uma força gravitacional musical. Pense, por exemplo, em " cai cai 
balão” a última frase é : “cai aqui na minha mão”, em mão é o tom de repouso. Se não 
recebemos o nosso tom de repouso, estamos insatisfeitos musicalmente. 

Organizando as Tonalidades 
A Teoria da Aprendizagem Musical classifica e organiza as tonalidades em relação ao seu tom 
de repouso. Para conseguir isso, empregamos um sistema de associação verbal usando o 
solfejo tonal. 

Dó Móvel. 

O sistema de Dó móvel, com o menor baseado em LA, é o sistema mais eficiente para 
organizar as tonalidades. 

Então, se você está ouvindo DO como o tom de repouso, você está na tonalidade  Major. Se 
você audiar lá como o tom de repouso, você está na tonalidade de lá menor. E assim por 
diante. 

Primeiros Passos na Aprendizagem das Tonalidades 

Assim como fazemos com o ritmo, precisamos aprender habilidades e padrões, e o faremos de 
forma sistemática. 

Quando estamos aprendendo a audiar harmonicamente no contexto de uma tonalidade, 
precisamos ter duas tonalidades para comparar. 

É a Aprendizagem por Discriminação, amplamente defendida pela psicologia educacional 

As duas primeiras tonalidades que aprendemos são Major e Menor. Estas constituirão a base 
para toda a compreensão musical futura. 

Auditiva/Oral 

A primeira série de lições usará uma sílaba neutra. ("pam") Usamos uma sílaba neutra antes da 
associação verbal porque o próprio som precisa ser ouvido e processado antes de lhe dar um 
rótulo. 

Tanto em Major quanto em Menor, você se envolverá com os padrões das três maneiras a 
seguir. 

1. Cante apenas o primeiro som de cada padrão. Isso força seu cérebro musical a manter 
o primeiro som em sua memória enquanto ouve os sons seguintes. 
2.  Cante o tom de repouso após cada padrão. Isso configura o aspecto da "pergunta e 
resposta" da música e reforça o contexto musical. Uma boa afinação como músico 
vem da comparação dos sons em relação ao tom de repouso. 
 

6
professor.geronimo@gmail.com
3. Cante todo o padrão. Os padrões formam a base do seu vocabulário musical.

Você aprenderá primeiro em uma ordem familiar, em uma frase musical, e mais tarde será 
capaz de usar essas palavras musicais em uma ordem diferente para criar novas idéias 
musicais. 

Nomeando o tom de repouso e a função harmônica. 
Uma vez que ouvimos, vivenciamos e cantamos o tom de repouso, as notas isoladas 
dos padrões, os padrões completos, precisamos nomear esses sons. 

Assim como no Ritmo, essa fase chama‐se Associação Verbal.(1) 

Tonalidade Maior 

As tonalidades são organizadas pelo tom de repouso. O tom de repouso na tonalidade 
maior é chamado de  DO. 

Funções harmônicas, I e V 

Uma melodia não existe por si só. É apoiado pela harmonia subjacente. Começaremos 
por aprender as duas funções harmônicas primárias em cada tonalidade. 

Na tonalidade maior, essas funções harmônicas primárias são 
Tonica (I) Dominante (V) 
Os músicos se referem a essas funções harmônicas por seus nomes numéricos 
correspondentes, I e V. 

Tônica (I) 

Quando você audiar combinações de dó, mi e sol, você está audiando a função tonal 
de tônica. Vamos chamar isso de Padrão de acorde do primeiro grau (I). Ou ainda mais 
simples ... "Um". 

Dominante (V) 

Quando você audiar combinações de sol, fá, ré si, você está audiando a função de 
Dominante. Vamos chamar isso de Padrão de acorde do quinto grau (V). Ou ainda mais 
simples ... "Cinco". 

Gagné(1)

7
professor.geronimo@gmail.com
         Tonalidade Menor 

O tom de repouso na tonalidade menor é LA. 

Funções harmônicas, i e V   

Em tonalidade menor, as duas funções harmônicas primárias são 
Tonica (i) Dominante (V) 
Tonica (i) 

Quando você audiar combinações de lá, dó, mi, você está audiando a função de tônica 
menor. Assim como fizemos na maior tonalidade, vamos chamar isso de Padrão de 
acorde do primeiro grau (I). Ou ainda mais simples ... "Um". 

Dominante (V) 

Quando você audiar combinações de mi, ré si, gi (2) , você está audiando a função de  
Dominante. Assim como fizemos na maior tonalidade, chamaremos isso de Padrão de 
acorde do quinto grau (V). Ou ainda mais simples ... "Cinco". 

PARTE 3: MELODIA 
Harmonia vs. Melodia 

Para audiar tonalmente, precisamos pensar em música organizada em duas direções: 
horizontalmente ‐ isto é, da esquerda para a direita e verticalmente, para cima e para baixo. 

A melodia se move de forma horizontal, enquanto a harmonia (nossos padrões de acordes I e 
V, por exemplo) é organizada verticalmente, para cima e para baixo, para apoiar e dar 
contexto ao conteúdo melódico. 

Eventualmente, melodia e harmonia e ritmo se misturam entre si de muitas maneiras 
interessantes, produzindo texturas musicais intrigantes e complexas. 

Mas quando estamos aprendemos a audiar ‐ para pensar musicalmente ‐ é útil estabelecer um 
fundamento simples de melodia e harmonia e isolar os elementos musicais. 

 (2)Ver sistemas de solfejos móvel. 
8
professor.geronimo@gmail.com
Isolando a melodia 

Até agora, no nosso estudo sobre a audiação tonal, fomos focados em organizar tonalidades 
por seus tons de repouso e rotulando o tom de repouso e a função harmônica. 

Então, vamos aprender alguns padrões melódicos básicos. Como em lições anteriores, nós as 
aprenderemos primeiro em uma sílaba neutra (Aural / Oral), então adicionaremos o solfejo 
(Associação Verbal). 

9
professor.geronimo@gmail.com
INTRODUÇÃO AOS PADRÕES RÍTMICOS

1. Escute sentindo a pulsação enquanto faz  movimentos de fluxo e regulares, usando os


movimentos do passo "o passo quaternário" e " o movimento do e"

2. Escute seu professor entoar padrões rítmicos (tempos), usando uma sílaba neutra ex. "Pá",
sempre executando o movimento do passo.

3. Execute as marcações usando o movimento corporal do passo,  para  cada  passo  duas  palmas


leves nas coxas, a primeira junto com o passo e a segunda logo  em seguida de forma regular.
São os tempos duplos (binário) (ver vídeo).

4. Após  ouvir  seu  professor  ou  o  cd  entoe  logo  em  seguida  o  que  ouviu.  Trabalhe  a  sua
memória musical, lembre‐se: procure audiar em vez de imitar.

5. Execute  as  marcações  usando  o  movimento  corporal  do  passo,  agora  para  cada  passo  três
palmas leves nas coxas, a primeira junto com o passo, a segunda e a terceira logo  em seguida
de forma regular.  São os tempos triplos (ternário) (ver vídeo).

6. Após  ouvir  seu  professor  ou  o  cd  entoe  logo  em  seguida  o  que  ouviu.  Trabalhe  a  sua
memória musical, lembre‐se: procure audiar em vez de imitar.

7. Temos assim ritmos formados por séries de sons de durações iguais: Os Tempos.
Podemos perceber e senti‐los de acordo com nossos movimentos do passo: duplo ou triplo.

Ritmo 

PALMAS  PALMAS  PALMAS  PALMAS  PALMAS  PALMAS  PALMAS  PALMAS 


Duplos 

Tempos  PASSO PASSO PASSO PASSO

Ritmo 

PALMAS  PALMAS  PALMAS  PALMAS  PALMAS  PALMAS  PALMAS  PALMAS  PALMAS  PALMAS  PALMAS  PALMAS 
Triplos 

Tempos  PASSO  PASSO  PASSO  PASSO 

                Concentre‐se nos tempos. Escute seu professor entoar e depois entoe sons  
                (padrões rítmicos) iguais aos tempos. 

Ritmo 

Duplos

Tempos
10
professor.geronimo@gmail.com
Duas vezes o tempo: 

Ritmo 

Duplos

Tempos

           E quatro vezes o tempo: 

Ritmo 

Duplos

Tempos

Perceba também os silêncios entre os sons:  

Ritmo 

Duplos

Tempos

Assim, você vai ter ritmos diversos. 
Ouça os padrões rítmicos (cd), Escute cada exemplo com atenção. Interiorize os padrões. 
Entoe cada padrão ouvido, repita cada padrão marcando os tempos com o “Passo”. 
Escreva os padrões usando notação não convencional. 
Escreva os padrões usando notação  convencional. 
Escreva os padrões usando notação enrítmica. 
Organize grupos de padrões conhecidos, faça a leitura em sequencia, use sílabas de solfejo e sílabas
neutras.

11
professor.geronimo@gmail.com
AS DIVISÕES DO TEMPO 

Escute  seu  professor  entoar  junto  com  a  marcação  do  movimento  do  passo(o  passo  com 
palmas  duplas)    dois  sons  de  durações  iguais  iniciando  junto  com  os  tempos,  ouça  com  atenção, 
interiorize e  entoe logo em seguida. 
Use o “passo” ao escutar e executar. 
É a subdivisão binária (ouça os exemplos no CD). 
Perceba  as  relações  entre  o  ritmo  que  ouviu  e  executou  com  os  movimentos  do  passo 
(passos e palmas). 

Ritmo 

Subdivisão

Tempos

Escute com atenção seu professor entoar junto com a marcação do movimento do passo(o 
passo com palmas triplas) séries de 3 sons de durações iguais, iniciando junto com os tempos, ouça 
com atenção, interiorize e  entoe logo em seguida. 
Use o “passo ” ao escutar e executar. 
É a subdivisão ternária (ouça os exemplos no CD). 
Perceba  as  relações  entre  o  ritmo  que  ouviu  e  executou  com  os  movimentos  do  passo  
(passos e palmas). 

Ritmo 

Subdivisão 

Tempos 

Escute cada exemplo com atenção. Interiorize os padrões. 
Entoe cada padrão ouvido. 
Escreva os padrões usando notação não convencional. 
Escreva os padrões usando notação  convencional. 
Escreva os padrões usando notação enrítmica 
Organize grupos de padrões conhecidos, faça a leitura em sequencia, use sílabas de solfejo e sílabas
neutras.

12
professor.geronimo@gmail.com
Lucas Ciavatta

INSTRUÇÕES PARA A FOLHA DOS NÚMEROS


Para trabalhar esta folha é fundamental saber fazer o passo quaternário simples.
Para vê-lo, consulte: www.opasso.com.br/pt_opasso_movimentos.htm
!
Lembre-se
– A folha sem o passo perde sua utilidade.
– A qualidade do movimento é fundamental em qualquer exercício aqui proposto.
!
Exercício de preparação para a Folha dos Números
1. Fazer o passo e falar várias vezes o 1 (quando o pé forte vai à frente).
2. Fazer o passo e falar várias vezes o 3 (quando o pé forte vai para trás).
3. Fazer o passo e falar várias vezes o 2 (quando o pé fraco vai à frente).
4. Fazer o passo e falar várias vezes o 4 (quando o pé fraco vai para trás).
5. Fazer o passo e falar uma vez o 1, uma vez o 3, uma vez o 2 e uma vez o 4. Repetir o ciclo de
quatro compassos até que se torne familiar.
!
Atenção
Fale e bata apenas o que está fora dos parênteses.
!
Falar a folha (do A ao F)
1 – Falar cada exercício várias vezes.
2 – Falar a folha inteira em uma sequência (uma vez cada um).
!
Bater a folha (do A ao F)
1 – Bater cada exercício várias vezes.
2 – Bater a folha inteira em uma sequência (uma vez cada um).
!
Fazer o E e o F
Em duplas (como um dueto em encaixe)
1 – No E, um dos dois deve bater várias vezes a primeira frase (o 1 e o 3), enquanto o outro bate
a segunda (o 2 e o 4).
2 – No F, aquele que bateu a primeira frase do E deve agora bater a segunda (o 2), enquanto o
outro, que bateu a segunda do E, deve agora bater a primeira (o 1, o 3 e o 4).
3 – A dupla deve fazer duas vezes o E (cada um na sua frase), alternar com o F (fazendo-o
também duas vezes) e repetir esse ciclo várias vezes até que se torne familiar.
Individualmente (como um solo em encaixe)
1 – Fazer o E como um dueto, onde se deve falar a primeira frase (o 1 e o 3) enquanto se bate a
segunda (o 2 e o 4).
2 – Fazer o F como um dueto, onde se deve bater a primeira frase (o 1, o 3 e o 4) enquanto se fala
a segunda (o 2).
3 – Falando uma frase e batendo a outra como nos exercícios anteriores, fazer duas vezes o E e,
sem parar, passar ao F. Fazer duas vezes o F, e sem parar, fazer novamente o E. Repetir várias
vezes até que se torne familiar.
!
!

www.opasso.com.br
13
Lucas Ciavatta

"
!
www.opasso.com.br
14
Lucas Ciavatta

INSTRUÇÕES PARA A FOLHA DO E


Para trabalhar esta folha é fundamental saber fazer o movimento do E.
Para vê-lo, consulte: www.opasso.com.br/pt_opasso_movimentos.htm
!
Lembre-se
– A folha sem o passo perde sua utilidade.
– A qualidade do movimento é fundamental em qualquer exercício aqui proposto.
Atenção
Fale e bata apenas o que está fora dos parênteses.
!
Exercício preparatório para falar a Folha do E
1 – Mantendo o movimento do E, fale todos os “números” várias vezes.
2 – Mantendo o movimento do E, fale todos os “e”s várias vezes.
3 – Alternar um compasso falando os “números” e um compasso falando os “e”s, várias vezes até
que se torne familiar.
Falar a folha
1 – Falar cada exercício várias vezes.
2 – Falar a folha inteira em uma sequência (uma vez cada exercício).
Observação: Com relação ao movimento do E, ao falar a folha mantenha sempre a batida das mãos
nas pernas, independente de haver ou não um “e” para ser falado.
Exercício preparatório para bater a Folha do E
1 – Mantendo o movimento do E, bater todos os “números” várias vezes.
2 – Mantendo o movimento do E, bater todos os “e”s várias vezes.
3 – Alternar um compasso batendo os “números” e um compasso batendo os “e”s, várias vezes até
que se torne familiar.
Bater a folha
1 – Bater cada exercício várias vezes.
2 – Bater a folha inteira em uma sequência (uma vez cada exercício).
Observação: Com relação ao movimento do E, ao bater a folha interrompa a batida das mãos nas
pernas, mas mantenha sempre a flexão dos dois joelhos.
Fazer o I e o J
Em duplas (como um dueto em encaixe)
1 – No I, um dos dois deve bater várias vezes a primeira frase, enquanto o outro bate a segunda.
2 – No J, aquele que bateu a primeira frase do I deve agora bater a segunda, enquanto o outro,
que bateu a segunda do I, deve agora bater a primeira.
3 – A dupla deve fazer duas vezes o I (cada um na sua frase), alternar com o J (fazendo-o também
duas vezes) e repetir esse ciclo várias vezes até que se torne familiar.
Individualmente(como um solo em encaixe)
1 – Fazer o I como um dueto, onde se deve falar a primeira frase enquanto se bate a segunda.
2 – Fazer o J como um dueto, onde se deve bater a primeira frase enquanto se fala a segunda.
3 – Falando uma frase e batendo a outra como nos exercícios anteriores, fazer duas vezes o I e,
sem parar, passar ao J. Fazer duas vezes o J, e sem parar, fazer novamente o I. Repetir várias
vezes até que se torne familiar.
Montanha Russa
1 – Bater a primeira frase do I.
2 – Falar todos os “números” enquanto se bate a primeira frase do I.
3 – Falar todos os “e”s enquanto se bate a primeira frase do I.
4 – Alternar, na fala, um compasso de “números” e um compasso de “e”s, enquanto se bate a
primeira frase do I.
!!
www.opasso.com.br
15
Lucas Ciavatta

"
!
www.opasso.com.br
16
Lucas Ciavatta

INSTRUÇÕES PARA A FOLHA TOCAR E CANTAR COM E


Para trabalhar esta folha é fundamental saber fazer o movimento do E.
Para vê-lo, consulte: www.opasso.com.br/pt_opasso_movimentos.htm
!
Lembre-se
– A folha sem o passo perde sua utilidade.
– A qualidade do movimento é fundamental em qualquer exercício aqui proposto.
!
Em cada ritmo realize a seguinte sequência:
1 – Falar o agogô (“números” e “e”s).
2 – Cantar o agogô (com “din” e “don”).
3 – Falar o instrumento grave (“números” e “e”s).
4 – Tocar o instrumento grave com palmas graves e agudas.
5 – Cantar o agogô enquanto se toca o instrumento grave.
!
Observação: Utilize o exercício d’O Passo “Ritmo passo a passo” para simplificar esta fase final
(tocar e cantar ao mesmo tempo). Faça apenas o que está no primeiro tempo, e mantendo o passo, vá
acrescentando um a um os elementos. Só acrescente o elemento seguinte quando você estiver
familiarizado com os anteriores.
!
Códigos
– Para os agogôs, os traços em cima dos “números” e “e”s indicam um som agudo, “din”, por
exemplo; os traços embaixo dos “números” e “e”s indicam um som grave, “don” por exemplo.
– Para os instrumentos graves, os elementos com um risco indicam uma palma leve (Xote) ou aguda
(Ijexá e Funk); os elementos sem risco indicam uma palma grave.
!
!
!
!
!
!
!
!
!
!
!
!
!
!

www.opasso.com.br
17
Lucas Ciavatta

"
!
www.opasso.com.br
18
Lucas Ciavatta

INSTRUÇÕES PARA A FOLHA DO I


Para trabalhar esta folha é fundamental saber fazer o movimento do E.
Para vê-lo, consulte: www.opasso.com.br/pt_opasso_movimentos.htm
!
Lembre-se
– A folha sem o passo perde sua utilidade.
– A qualidade do movimento é fundamental em qualquer exercício aqui proposto.
Observação: Nesta folha o traço vertical que liga dois exercícios indica que eles devem ser
trabalhados separadamente em um primeiro momento e depois dois a dois de forma alternada. A
ausência do traço significa que os exercícios em questão devem ser trabalhados apenas
separadamente.
!
Falar a primeira parte da folha (do A ao F)
1 – Falar o A várias vezes / Falar o B várias vezes / Alternar A e B, falando uma vez cada um.
2 – Falar o C várias vezes / Falar o D várias vezes / Alternar C e D, falando uma vez cada um.
3 – Falar o E várias vezes / Falar o F várias vezes.
Falar a segunda parte da folha (do G ao L)
1 – Falar o G várias vezes / Falar o H várias vezes / Alternar G e H, falando uma vez cada um.
2 – Falar o I várias vezes / Falar o J várias vezes / Alternar I e J, falando uma vez cada um.
3 – Falar o K várias vezes / Falar o L várias vezes.
Falar o M
Falar várias vezes a primeira frase do M / Falar várias vezes a segunda frase do M.
!
Bater a primeira parte da folha (do A ao F)
1 – Bater o A várias vezes / Bater o B várias vezes / Alternar A e B, batendo uma vez cada um.
2 – Bater o C várias vezes / Bater o D várias vezes / Alternar C e D, batendo uma vez cada um.
3 – Bater o E várias vezes / Bater o F várias vezes.
Bater a segunda parte da folha (do G ao L)
Importante: Quando estiver batendo esta parte, fale os “e”s que não estão escritos. Isso dará mais
precisão ao movimento e à música.
1 – Bater o G várias vezes / Bater o H várias vezes / Alternar G e H, batendo uma vez cada um.
2 – Bater o I várias vezes / Bater o J várias vezes / Alternar I e J, batendo uma vez cada um.
3 – Bater o K várias vezes / Bater o L várias vezes.
Bater o M
Bater várias vezes a primeira frase do M / Bater várias vezes a segunda frase do M.
!
Fazer o M como um solo em encaixe
Falar a primeira frase enquanto se bate a segunda.
!
Montanha Russa
1 – Bater a segunda frase do M.
2 – Falar todos os “números” enquanto se bate a segunda frase do M.
3 – Falar todos os “e”s enquanto se bate a segunda frase do M.
4 – Falar todos os segundos “i”s enquanto se bate a segunda frase do M.
5 – Falar todos os primeiros “i”s enquanto se bate a segunda frase do M.
6 – Alternar, na fala, um compasso de “números”, um compasso de “e”s, um compasso de segundos
“i”s e um compasso de primeiros “i”s, enquanto se bate a segunda frase do M.
!

www.opasso.com.br
19
Lucas Ciavatta

(Adaptado)

M
"

www.opasso.com.br
20
Lucas Ciavatta

!
(Adaptado)

M
"
!
www.opasso.com.br
21
Lucas Ciavatta

(Adaptado)

"
!
www.opasso.com.br
22
Padrões Rítmicos
(Escrita não convencional)

Leia os padrões seguintes.

Rítmo

1 Subdivisão

Tempos

Rítmo

2 Subdivisão

Tempos

Rítmo

3 Subdivisão

Tempos

Rítmo

4 Subdivisão

Tempos

Rítmo

5 Subdivisão

Tempos

Rítmo

6 Subdivisão

Tempos

23
professor.geronimo@gmail.com
Padrões Rítmicos
(Escrita não convencional)

Rítmo

7 Subdivisão

Tempos

Rítmo

8 Subdivisão

Tempos

Rítmo

9 Subdivisão

Tempos

Rítmo

10 Subdivisão

Tempos

Rítmo

11 Subdivisão

Tempos

Rítmo

12 Subdivisão

Tempos

24
professor.geronimo@gmail.com
Padrões Rítmicos

Ouça alguns padrões rítmicos e escreva de forma não convencional

Rítmo

Subdivisão

Tempos

Rítmo

Subdivisão

Tempos

Rítmo

Subdivisão

Tempos

Rítmo

Subdivisão

Tempos

Rítmo

Subdivisão

Tempos

Rítmo

Subdivisão

Tempos

25
professor.geronimo@gmail.com
Padrões Rítmicos

Ouça alguns padrões rítmicos e escreva de forma não convencional

Rítmo

Subdivisão

Tempos

Rítmo

Subdivisão

Tempos

Rítmo

Subdivisão

Tempos

Rítmo

Subdivisão

Tempos

Rítmo

Subdivisão

Tempos

Rítmo

Subdivisão

Tempos

26
professor.geronimo@gmail.com
RELAÇÃO DE PROPORÇÃO ENTRE AS FIGURAS MUSICAIS

Divisão Proporcional dos Valores - Quadro Comparativo

27
professor.geronimo@gmail.com
Desenvolvimento da Habilidade Rítmica

Os aspectos tonais e rítmicos da música são dois tipos diferentes de


informações. O ensino eficiente exige que os separemos, assim como
separamos o ensino da contagem do ensino do alfabeto. Basicamente,
separamos o tom e o ritmo ao ensinar porque a mente exige isso, e nós os
combinamos quando realizamos porque a arte exige isso.

Iniciando Habilidade de Ritmo


Este trabalho da primeira infância não pode ser ignorado. Deve acontecer,
mesmo que seja logo depois da infância cronológica passada.
1. Trabalhe movimentos de fluxo em seu corpo inteiro com (e especialmente
sem) música.
2. Ouça muitas canções em métricas variadas.
Expandindo habilidades de ritmo
Todos os músicos devem desenvolver um "vocabulário do ritmo", uma espécie
de dicionário mental de conteúdo de padrões de ritmo que foram integrados com
os sentimentos físicos do contexto métrico.
Por que desenvolver um vocabulário de ritmo? Conhecer padrões dentro da
métrica ajuda você a:
Compreender mais do conteúdo rítmico que você ouve
Melhorar seu estilo de articulação e fraseado no que você executa
Ler e escrever aspectos rítmicos da música (lemos / escrevemos por padrões)
Percorrer a exploração e a criatividade, a improvisação e a composição.

Auditiva/Oral

Atividades de padrões de ritmo. Use sílaba neutra ex. “pá”.


Estabeleça a métrica primeiro.
Esteja sentado e mova seu tronco em fluxo, seus calcanhares para os tempos e
suas mãos para as subdivisões. Embora sempre se mova conforme descrito,
ouça alguns padrões e tente essas habilidades com esses padrões:

28
professor.geronimo@gmail.com
1. Não imite. Em vez disso, responda com apenas os tempos (literalmente, siga
o que seus calcanhares estão fazendo).
2. Não imite. Em vez disso, responda com apenas as subdivisões (literalmente,
siga o que suas mãos estão fazendo).
3. Alternar entre respostas de tempos e subdivisões (movimentos de calcanhar e
mão).
4. Ouça o padrão, audie o padrão, então repita o padrão.
5. Combine # 3 e # 4. (Faça uma resposta de tempos, depois uma resposta de
subdivisões, depois repita o padrão).
6. Responda com um padrão "escolhido" independentemente do que você ouve
(ostinato).
7. Em grupos entoar os tempos enquanto outros entoam a subdivisão
8. Repetir diferentes padrões, individualmente com auxílio do professor.

9. realizar uma conversa rítmica usando sílabas neutras.

10. Entoe e repita um padrão de ritmo. Em seguida, mude o andamento e entoe


o mesmo padrão de ritmo novamente

Associação verbal
10. Repita 1-10, usando as sílabas de solfejos funcionais (takadimi).

Discriminação
1. Identifique a métrica de séries familiares de padrões rítmicos, classifique em
duplos ou triplos.(binário ou ternário).
2. Ouça seu professor entoar dois padrões um após o outro, classifique em
iguais ou diferentes.
3. Ouça seu professor entoar um padrão classifique em duplo ou triplo(binário ou
ternário).
4. Faça atividades semelhantes com os colegas da classe.
5. Ouça canções ou trechos de músicas que aprecie, encontre o movimento
correspondente, o tempo e métrica, (dupla ou tripla).

29
professor.geronimo@gmail.com
Generalização Verbal
1. Ouça um padrão entoado com sílaba neutra, entoe com sílabas de
solfejos(takadimi).
2. Ouça uma série de padrões, mova-se nos tempos e subdivisões
correspondentes, após entoe os padrões usando sílabas de solfejo.
Improvisação
1. Entoe uma sequência de padrões conhecidos enquanto move-se nos tempos
e subdivisões.
2. Trabalhe em grupos, faça variações, uns entoam os tempos outros a
subdivisão enquanto alguém entoa os padrões.

Associação simbólica
Quando os padrões estiverem familiares, você pode ler, copiar, escrever e
criar padrões. Você deve praticar o reconhecimento de padrões em peças
e execução musical

1. Estabeleça a métrica antes de começar a ler / executar / escrever os padrões.


Use sua voz e seu instrumento para executar os padrões.

2. Primeiro, leia os padrões. Use uma sílaba neutra “pá”, para entoar os padrões
usando sua voz.

3. Em seguida, leia os padrões usando sílabas de solfejo.

4. Quando você pode ler com sucesso os padrões, copie os padrões.

5. Em seguida, escreva os padrões familiares que você lembre.

6. Crie seus próprios padrões dentro do contexto e categoria dos padrões que
você pode ler.

7. Encontre padrões em música que você ouve e executa.

8. Encontre padrões em notação de música desconhecida

30
professor.geronimo@gmail.com
Estendendo habilidades de ritmo
A infinita variedade de ritmos nos desafia a expandir continuamente as nossas
habilidades de ritmo ao pressionar as dificuldades de conteúdo e contexto para
sempre. Em termos de conteúdo, combine as habilidades acima com padrões
cada vez mais difíceis. Siga A sequência de dificuldades de padrões para
resultados máximos:
1. Padrões de Tempos e Subdivisões apenas.
2. Padrões de segunda subdivisão.
3. Padrões de alongamento - Tempos e subdivisões prolongados.
4. Padrões de segunda subdivisão / alongamento (combinando # 2 e # 3)
5. Padrões de pausas - (o silêncio medido é mais difícil do que o som medido)
6. Padrões ligados (um tipo especial de alongamento "amarrando" um padrão
para outro)
7. Padrões de antecipações do tempo (padrões de anacruse).
Em termos de crescente dificuldade de contexto, continue adicionando métricas
menos familiares ao repertório cinestésico do seu corpo. Uma vez que se sente
confortável com o movimento de tempos e subdivisões de uma nova métrica,
comece a se engajar no trabalho de padrões com essas novas métricas.

Estilo e Movimento

O estilo é 90 por cento movimento. Certamente todos nós reconhecemos que


cada estilo musical tem suas métricas, tempos e ritmos específicos. Mas, de
forma mais básica, cada estilo possui suas próprias combinações características
dos sentimentos de fluxo, peso e espaço. Desenvolver um controle sofisticado
sobre cada um desses elementos, através do movimento, oferece uma gama
infinita de opções estilísticas. O exemplo mais óbvio é a variedade de
movimento que vemos em maestros expressivamente grandes. No entanto, a
arte estilística está ao alcance de todos os que aprendem a sentir, controlar,
variar e combinar cada um desses elementos de movimento.
MOVIMENTOS DE FLUXO em um continuum de totalmente livre para encadear
firmemente.

31
professor.geronimo@gmail.com
PESO - movimentos em um contínuo de ponderosamente pesados a luz de
peso pluma.
MOVIMENTOS ESPACIAIS em um continuum de linearmente direto a
indiretamente indireto.
Os especialistas de LABAN podem observar rapidamente que deixei de lado um
elemento de movimento: MOVIMENTOS DE VELOCIDADE em um contínuo do
relâmpago rápido a glacialmente lento. Isso é proposital, porque refere-se a uma
parte do estilo coberto por decisões de tempo.
Em tudo isso, se você não se lembra de mais nada, siga a versão super sucinta
de todo o aprendizado do ritmo: basta mover-se.

32
professor.geronimo@gmail.com
Padrões Rítmicos - (tempos e subdivisão)

1 2 3 4
 42                   

5 6 7 8
                       

9 10 11 12
                       

13 14 15
                    

1 2 3 4
 86                          

5 6 7 8
                              

9 10 11 12
                                  

13 14 15
                              

33
professor.geronimo@gmail.com
Padrões Rítmicos - (tempos-subdivisões-pausas)

1 2 3 4
 42                   

5 6 7 8
                      

9 10 11 12
                      

13 14 15
                  

1 2 3 4
 86                            

5 6 7 8
                                

9 10 11 12
                                   

13 14 15
                         

34
professor.geronimo@gmail.com
Padrões Rítmicos Subdivisão 2 (série 1)

1 2 3 4
 42                     

5 6 7 8
                  

9 10 11 12
                       

13 14 15 16
               

17 18 19 20
                    

21 22 23 24
                       

35
professor.geronimo@gmail.com
Padrões Rítmicos Subdivisão 2 (série 2)

1 2 3 4
 42                       

5 6 7 8
                    

9 10 11 12
                       

13 14 15 16
                     

17 18 19 20
                      

21 22 23 24
                       

36
professor.geronimo@gmail.com
Padrões Rítmicos Subdivisão 2 (série 3)

1 2 3 4
 42                       

5 6 7 8
                      

9 10 11 12
                           

13 14 15 16
                     

17 18 19 20
                        

21 22 23 24
                           

37
professor.geronimo@gmail.com
Padrões Rítmicos Subdivisão 2 (série 4)

1 2 3 4
 42                          

5 6 7 8
                        

9 10 11 12
                           

13 14 15 16
                         

17 18 19 20
                          

21 22 23 24
                         

38
professor.geronimo@gmail.com
Padrões Rítmicos Subdivisão 2 (série 5)

1 2 3 4
 42                          

5 6 7 8
                        

9 10 11 12
                           

13 14 15 16
                         

17 18 19 20
                          

21 22 23 24
                       

39
professor.geronimo@gmail.com
Padrões Rítmicos Subdivisão 2 (série 6)

1 2 3 4
 42                       

5 6 7 8
                      

9 10 11 12
                           

13 14 15 16
                     

17 18 19 20
                        

21 22 23 24
                           

40
professor.geronimo@gmail.com
Padrões Rítmicos - Mistos

1 2 3 4
 42                

5 6 7 8
                    
   

9 10 11 12
                    
   

13 14 15 16
                       
       

17 18 19 20
                        

21  22  23  24 
                  

25  26  27  28 
                      

29 30 31 32
                      

33 34 35 36
                        

41
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 1)

1 2 3
 86                                   

4 5 6
                           

7 8 9
                                 

10 11 12
                             

13 14 15
                                 

16 17 18
                      

19 20 21
                                 

22 23 24
                             

42
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 2)

1 2 3
 86                             

4 5 6
                             

7 8 9
                           

10 11 12
                             

13 14 15
                           

16 17 18
                        

19 20 21
                           

22 23 24
                             

43
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 3)

1 2 3
 86                             

4 5 6
                             

7 8 9
                           

10 11 12
                             

13 14 15
                           

16 17 18
                        

19 20 21
                           

22 23 24
                             

44
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 4)

1 2 3
 86                             

4 5 6
                             

7 8 9
                           

10 11 12
                              

13 14 15
                           

16 17 18
                        

19 20 21
                           

22 23 24
                               

45
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 5)

1 2 3
 86                                

4 5 6
                            

7 8 9
                              

10 11 12
                            

13 14 15
                              

16 17 18
                       

19 20 21
                              

22 23 24
                            

46
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 6)

1 2 3
 86                                

4 5 6
                            

7 8 9
                              

10 11 12
                           

13 14 15
                              

16 17 18
                       

19 20 21
                              

22 23 24
                              

47
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 7)

1 2 3
 86                                

4 5 6
                            

7 8 9
                              

10 11 12
                           

13 14 15
                              

16 17 18
                       

19 20 21
                              

22 23 24
                              

48
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 8)

1  2  3 
 86                       

4  5  6 
                        

7  8  9 
                     

10  11  12 
                           

13  14  15

                     

16  17  18 
                      

19  20  21 
                     

22  23  24 
                           

49
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 9)

1  2  3 
 86                       

4  5  6 
                        

7  8  9 
                     

10  11  12 
                  

13  14   15
                     

16  17  18 
                      

19  20  21 
                     

22  23  24 
                       

50
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 10)

1 2 3
 86                              

4 5 6
                                 

7 8 9
                           

10 11 12
                             

13 14 15
                           

16 17 18
                         

19 20 21
                           

22 23 24
                             

51
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 11)

1 2 3
 86                              

4 5 6
                                 

7 8 9
                           

10 11 12
                                 

13 14 15
                           

16 17 18
                         

19 20 21
                           

22 23 24
                                 

52
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 12)

1 2 3
 86                           

4 5 6
                              

7 8 9
                        

10 11 12
                              

13 14 15
                        

16 17 18
                        

19 20 21
                        

22 23 24
                              

53
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 13)

1 2 3
 86                           

4 5 6
                              

7 8 9
                        

10 11 12
                              

13 14 15
                        

16 17 18
                        

19 20 21
                        

22 23 24
                              

54
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 14)

1 2 3
 86                           

4 5 6
                              

7 8 9
                        

10 11 12
                              

13 14 15
                        

16 17 18
                        

19 20 21
                        

22 23 24
                              

55
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 15)

1 2 3
 86                          

4 5 6
                            

7 8 9
                        

10 11 12
                              

13 14 15
                        

16 17 18
                       

19 20 21
                        

22 23 24
                            

56
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 16)

1 2 3
 86                          

4 5 6
                            

7 8 9
                        

10 11 12
                            

13 14 15
                        

16 17 18
                       

19 20 21
                      

22 23 24
                            

57
professor.geronimo@gmail.com
Padrões Rítmicos Compostos Subdivisão 2 (série 17)

1 2 3
 86                             

4 5 6
                             

7 8 9
                           

10 11 12
                              

13 14 15
                           

16 17 18
                        

19 20 21
                           

22 23 24
                               

58
professor.geronimo@gmail.com
Solfejo Móvel 

Existem diversas formas de solfejos utilizadas nas práticas musicais, cada 
uma com suas particularidades. 

No Brasil, podemos destacar os trabalhos de Ian Guest, que segue a escola 
tradicional  de  ZOLTÁN  KODÁLY  (1882‐1967),  Adamo  Prince  que  aplica  o 
sistema  com  algumas  variações,  assim  como  Ricardo  Dourado  Freire  que 
usa  o  solfejo  móvel  com  algumas  variações  do  sistema  de  Sarah 
Glover.(1785‐1867).  Indico  logo  abaixo  a  forma  utilizada  por  Freire  que 
utilizarei neste trabalho pelo seu amplo valor cognitivo. 

Base dó Base lá(menor.h)

VIII  dó  VIII lá 


VII  si  #VII    gi gi 
#VI  li  bVII  se VII
    VI  lá  #VI fi
#V  gi  bVI  le VI fá 
    V  sol  V mi 
#IV  fi  bV  ge #IV ri cc   
    IV  fá  IV ré 
III  mi  bIV  fe #III di
#II  ri  bIII  me III dó 
II  ré  II si 
#I  di  bII  rá #I li
I  dó  I lá 
bI  de     ‐

59
professor.geronimo@gmail.com
DESENVOLVIMENTO DA HABILIDADE TONAL

.
Instruções para o CD de padrões tonais.

Começa com uma introdução à tonalidade, acordes iniciais e arpejo do


primeiro grau o suficiente para preparar a percepção da Tonalidade.(Maior
ou menor), dessa forma os ouvidos serão encaminhados para o "tom de
repouso", o "primeiro grau" ou a "Tônica".
Concentre-se nesse som que lhe atrai, cante este som, inicialmente com
boca "chiusa", após use uma sílaba neutra (ex. Pam).., (resumindo ouvir a
sequência e cantar apenas a tônica(a nota de repouso aquela que lhe
atraiu mais) , haverá pausas para este momento , concentrem-se , façam
um respiração e cante. A seguir aprofunde seus estudos dos padrões.
Uma vez que a tonalidade é estabelecida e a tônica (tom de repouso)
estão se tornando seguros, então podemos começar a refinar e expandir
nosso sentido (habilidade) de tonalidade e começar a construir um
"vocabulário de tons".
Todo músico grande carrega uma espécie de dicionário mental de padrões
de tom categorizados na mente por modo e função harmônica, e sempre
relacionados ao tom de repouso desse modo particular. Para uma
abreviatura, vamos chamar isso de vocabulário tonal

Por que desenvolver um vocabulário tonal?

Porque conhecer padrões dentro dos modos ajuda você:


Compreender mais do conteúdo melódico e harmônico na música que
você ouve
Melhorar o seu senso de "micro-dinâmica" que destaca o refluxo e fluxo de
melodia
Ler e escrever música sem precisar de um instrumento
Ir além da exploração e da improvisação, transcrição e composição.

Estudando os Padrões Tonais

Auditiva/Oral

1- Ouça um padrão, faça uma pausa, respire e cante usando sílaba neutra,
apenas o primeiro som do padrão.

60
professor.geronimo@gmail.com
2- Ouça um padrão, faça uma pausa, respire e cante usando sílaba neutra
o tom de repouso. (a tônica do modo apenas).

3- Ouça um padrão, faça uma pausa, respire e cante usando sílaba neutra
o padrão que você ouviu.

4- Ouça um padrão, faça uma pausa, respire e cante usando sílaba neutra,
alterne entre cantar o padrão completo ou apenas o som de
repouso(tônica).

5-Ouça um padrão, faça uma pausa, respire e cante usando sílaba neutra
o padrão seguido pelo tom de repouso. (alterne entre superior e inferior).

6- Ouça um padrão, faça uma pausa, respire e cante usando sílaba neutra
o tom de repouso seguido pelo padrão. (alterne entre superior e inferior).

7- Ouça um padrão, faça uma pausa, respire e cante usando sílaba neutra
o padrão entre dois tons de repouso. (alterne entre superior e inferior).

8- Ouça um padrão, faça uma pausa, respire e cante usando sílaba neutra
um único padrão (padrão-ostinato).como resposta ao padrão ouvido.

9- Ouça um padrão, faça uma pausa, respire e cante usando sílaba neutra
o padrão, em seguida, um padrão escolhido ( vice-versa).

10- Ouça um padrão, faça uma pausa, respire e cante usando sílaba
neutra o padrão em uma ordem diferente.

13- Cante apenas a fundamental do padrão ouvido (ex. 1 ou 5)

Associação Verbal

14- Faça todos os itens acima com as sílabas de solfejos .(Associação


Verbal)

Discriminação

1- Ouça o cd ou seu professor cantar duas séries familiares de padrões


uma após a outra, classifique em iguais ou diferentes.
2- Ouça o cd ou seu professor cantar duas séries familiares de padrões
uma após a outra, classifique-as em Maior ou menor.

61
professor.geronimo@gmail.com
Generalização

1- Ouça um padrão com sílabas neutras ou o cd, faça uma pausa, respire
e cante com sílabas de solfejos.

Improvisação
1- Cante diferentes padrões individualmente com o auxílio do professor.

2- Cante padrões de função oposta ao padrão ouvido(ex.ouvir um padrão


de tônica e cantar um padrão de dominante).

3- Trabalhe em grupos, faça variações, uns entoam o padrão completo


outros apenas a fundamental.
4- Cante os padrões em grupos cada um sustentando uma nota específica.
(Harmonia)

Associação Simbólica

Instruções gerais de leitura e escrita.

1. Estabeleça a tonalidade antes de ler/executar/escrever os padrões, use


sua voz para executar os padrões.

2. Depois que os padrões são familiares, você deve ler, copiar, escrever e
criar padrões. Você deve praticar o reconhecimento de padrões em peças
e execução musical.

Instruções específicas de leitura e escrita


1. Primeiro, leia os padrões. Use uma sílaba neutra “pam” para cantar os
padrões usando sua voz.
2. Em seguida, leia os padrões usando sílabas de solfejo.
3. Quando você ler com sucesso os padrões, copie os padrões.
4. Em seguida, escreva os padrões familiares que você lembre.

62
professor.geronimo@gmail.com
5. Crie seus próprios padrões dentro do contexto e categoria dos padrões
que você pode ler.
6. Encontre padrões em música que você ouve e executa.
7. Encontre padrões em notação de música desconhecida

63
professor.geronimo@gmail.com
Padrões Tonais - Associação Verbal

Padrões tonais maiores 01   Padrões tonais maiores 02 Padrões tonais maiores 03


1  sol mi sol  I  1 sol si ré’ V 1  dó mi  I
2  ré  si sol  V  2 sol dó’ mi I 2  sol dó  I
3  dó’ mi sol  I  3 mi’ dó’ mi  I 3  si, ré  V
4  mi dó sol  I  4 ré’ si V 4  mi dó  I
5  sol si  V  5 dó’ mi’ sol I 5  dó mi sol  I
6  sol ré si  V  6 ré’ si sol V 6  sol ré sol  V
7  si sol   V  7 mi’ sol mi’ I 7  sol mi dó  I
8  dó’ sol mi  I  8 mi dó’ sol I 8  dó sol mi  I
9  mi sol  I  9 si sol si  I 9  sol ré si,  V
10  sol dó  I  10 si ré sol V 10  si, sol  V
11  sol ré sol  V  11 ré sol si V 11  ré fá  V
12  si sol ré  V  12 dó’ dó mi I 12  mi sol dó  I
13  mi dó sol   I  13 ré si, V 13  sol fá ré  V
14  ré si sol   V  14 dó mi sol, I 14  si, ré sol  V
15  mi sol  I  15 ré si, sol, V 15  dó sol dó  I
16  dó mi sol  I  Si  si ré sol V
17  sol ré sol  V  17 ré sol si V
18  sol mi dó  I  18 dó’ dó mi I
19  ré si sol  V  19 mi sol, mi I
20  dó mi dó’  I  20 sol, dó sol, I
21  ré fá sol si  V  21 si, sol,  si,

Padrões tonais maiores 04   Padrões tonais maiores 05
1  dó sol mi  I  1 dó mi sol I
2  ré si, ré  V  2 sol ré V
3  sol fá ré  V  3 ré si, sol V
4  dó mi sol   I  4 mi dó mi I
5  mi sol dó  I  5 sol mi dó I
6  ré si, sol,  V  6 ré sol ré V
7  si, sol ré  V  7 si, ré sol V
8  sol dó  I  8 sol dó I
9  sol mi dó  I  9 dó sol mi I
10  ré si,  V  10 ré si, ré V
11  ré sol si,  V  11 sol ré si, V
12  dó sol, dó  I  12 dó mi dó I

64
professor.geronimo@gmail.com
Padrões tonais menores 01   Padrões tonais menores 02 Padrões tonais menores 03
1  mi dó mi  i  1 mi gi si’ V 1  lá dó  I
2  si gi mi  V  2 mi lá’ dó i 2  mi lá  I
3  lá’ dó mi   i  3 dó’ lá’ dó i 3  gi, si   V
4  dó lá mi  i  4 si’ gi V 4  dó lá  i
5  mi gi  V  5 lá’ dó’ mi i 5  lá dó mi   i
6  mi si gi  V  6 si’ gi mi V 6  mi si mi  V
7  gi mi  V  7 dó’ mi dó’ i 7  mi dó lá  i
8  lá’ mi dó  i  8 do lá’ mi i 8  lá mi dó  i
9  dó mi  i  9 gi mi gi V 9  mi si gi,   V
10  mi lá  i  10 gi si mi  V 10  gi, mi  V
11  mi si mi   V  11 si mi gi V 11  si ré   V
12  gi mi si  V  12 lá’ lá dó i 12  dó mi lá  i
13  dó lá mi   i  13 si gi, V 13  mi ré si  V
14  si gi mi   V  14 lá dó mi, i 14  gi, si mi   V
15  dó mi  i  15 si gi, mi, V 15  lá mi lá  i
16  lá dó mi  i  16 gi si mi V
17  mi si mi  V  17 si mi gi V
18  mi dó lá  i  18 lá’ lá dó i
19  si gi mi   V  19 dó mi, dó i
20  lá dó lá’  i  20 mi, lá mi, i
21  si ré mi gi   V  21 gi, mi, gi, V

Padrões tonais menores 04   Padrões tonais menores 05
1  lá mi dó  i  1 lá dó mi i
2  si gi,si  V  2 mi si V
3  mi ré si   V  3 si gi, mi V
4  lá dó mi   i  4 dó lá dó i
5  dó mi lá  i  5 mi dó lá i
6  si gi, mi,  V  6 si mi si  V
7  gi, mi si  V  7 gi, si mi V
8  mi lá  i  8 mi lá i
9  mi dó lá  i  9 lá mi dó i
10  si gi,  V  10 si gi, si V
11  si mi gi,  V  11 mi si gi, V
12  lá mi, lá  i  12 lá dó lá i

65
professor.geronimo@gmail.com
Padrões Tonais - Grupos Maiores

1  sol mi sol  I  22 sol si ré’  V 
2  ré  si sol  V  23 sol dó’ mi  I 
3  dó’ mi sol  I  24 mi’ dó’ mi  I 
4  mi dó sol  I  25 ré’ si V 
5  sol si  V  26 dó’ mi’ sol  I 
6  sol ré si  V  27 ré’ si sol  V 
7  si sol  V  28 mi’ sol mi’  I 
8  dó’ sol mi  I  29 mi dó’ sol  I 
9  mi sol  I  30 si sol si   V
10  sol dó  I  31 si ré sol  V 
11  sol ré sol  V  32 ré sol si  V 
12  si sol ré  V  33 dó’ dó mi  I 
13  mi dó sol   I  34 ré si, V 
14  ré si sol   V  35 dó mi sol,  I 
15  mi sol  I  36 ré si, sol,  V 
16  dó mi sol  I  37 si ré sol  V 
17  sol ré sol  V  38 ré sol si  V 
18  sol mi dó  I  39 dó’ dó mi  I 
19  ré si sol  V  40 mi sol, mi  I 
20  dó mi dó’  I  41 sol, dó sol,  I 
21  ré fá sol si  V  42 si, sol,  si,  V

66
professor.geronimo@gmail.com
Padrões Tonais - Grupos menores

1  mi dó mi  i  22 mi gi si’  V
  2  si gi mi  V  23 mi lá’ dó  i 
3  lá’ dó mi   i  24 dó’ lá’ dó  i 
4  dó lá mi  i  25 si’ gi  V
5  mi gi  V  26 lá’ dó’ mi  i 
6  mi si gi  V  27 si’ gi mi  V
7  gi mi  V  28 dó’ mi dó’  i 
8  lá’ mi dó  i  29 do lá’ mi  i 
9  dó mi  i  30 gi mi gi  V
10  mi lá  i  31 gi si mi   V
11  mi si mi  V  32 si mi gi  V
12  gi mi si  V  33 lá’ lá dó  i 
13  dó lá mi  i  34 si gi,  V
14  si gi mi   V  35 lá dó mi,  i 
15  dó mi  i  36 si gi, mi,  V
16  lá dó mi  i  37 gi si mi  V
17  mi si mi  V  38 si mi gi  V
18  mi dó lá  i  39 lá’ lá dó  i 
19  si gi mi   V  40 dó mi, dó  i 
20  lá dó lá’  i  41 mi, lá mi,  i 
21  si ré mi gi   V  42 gi, mi, gi,  V

67
professor.geronimo@gmail.com
Padrões Tonais 01 (Maior)
Associação Simbólica

## 3 «« « «« « œ» «« œ» « «« « «« 2 «« œ» 3 «« « œ» 2
& 4 solˆ« «ˆ« ˆ« l «ˆ« »» ˆ« l »» «ˆ« ˆ« l «ˆ« ««ˆ« ˆ« l 4 ˆ« »» l 4 ˆ« «ˆ« »» =
l4
1 2 3 4 5 6

======================
## 2 œ» «« 3 œ» «« « 2 « «« «« 3 ««ˆ« « ««ˆ œ» ««ˆ «
& 4 » » ˆ
« » ˆ
« « « ˆ
« ˆ
« «
«ˆ« l 4 «ˆ« « l »» « «ˆ«=l
l 4 » ˆ« l 4 ˆ«
7 8 9 10 11 12

====================== l
## « ««ˆ« « œ» ««ˆ 2 « «« 3 « «« «« « «« «« «
« « l «ˆ« »» « l 4 «ˆ« ˆ« l 4 ««ˆ« «ˆ« ˆ« l ˆ« «ˆ« ˆ« l ˆ« «ˆ« ««ˆ«=l
13 14 15 16 17 18

& ˆ« «ˆ«
======================
## « œ» «« « œ
» 4 « « ««ˆ« œ»
» ˆ
« « « » «
& «ˆ« » l «ˆ« ˆ« » l 4 «ˆ« ˆ« »» l
19 20 21 22 23 24

====================== l l =”

Padrões Tonais 02 (Maior)


Associação Simbólica

## 3 «« œ» »»œ «« œ» « œ»» œ» « 2 »»œ œ» 3 œ» œ»» «« »»œ œ» ««


& 4 solˆ« »» » l ˆ« »» «ˆ« l » »» «ˆ« l 4 » »» l 4 »» » ˆ« l » »» ˆ«=ll
1 2 3 4 5 6

======================
## »œ» «« »œ» « œ» «« œ» «« œ» œ» « «« « «« »œ œ» « 2
» ˆ« » l «ˆ« »» ˆ« l »» ˆ« »» l »» «ˆ« ˆ« l «ˆ ˆ« »» l »» «« «ˆ« =
ˆ« l 4
7 8 9 10 11 12

&
====================== «
## 2 « 3 « « œ
» « « « «« œ» »œ»
« ««ˆ«
4 « « 4 « « « « « « » « ˆ
« « ˆ
« » » «
13 14 15 16 17 18

& « ˆ
«
ˆ« _««ˆ l ˆ« _«« l ˆ« _ˆ«« _«« l ˆ«
====================== » l ˆ« » «
l ˆ« =l
_«ˆ _ˆ«
## « ««
« « « «« «« l «« «« «« l
19 20 21 22 23 24

& ˆ
« «_ ˆ
« l
====================== «
__««ˆ ˆ« __ˆ«« _ˆ« __«ˆ« _ˆ« l l =”
_««ˆ

68
professor.geronimo@gmail.com
Padrões Tonais 03 (Maior)
Associação Simbólica

## 2 « ««ˆ« « « 3 « ««ˆ«
& 4 «ˆ« « « « « «
«ˆ« l _«««ˆ «ˆ« l ˆ« «ˆ« l 4 «ˆ« ˆ« =l « «
1 2 3 4 5

ˆ«
====================== l
## «« « «« «« «

ˆ
« ˆ
« ˆ
« « « « ««ˆ« « ««ˆ « 2 ««ˆ«
«ˆ« « « «ˆ« _««ˆ l 4 _««ˆ =l
6 7 8 9 10

======================
& l ˆ« «ˆ« l «ˆ« ˆ« l « «
## « « 3 « ««ˆ« ««ˆ« «« « « ««ˆ« ««ˆ«
«
«ˆ« ˆ« l 4 ˆ« « « ˆ« «ˆ« l «« «ˆ« « ««ˆ« =”
11 12 13 14 15

======================
& «ˆ« l _«ˆ l «
ˆ
«

Padrões Tonais 04 (Maior)


Associação Simbólica

## 3 ««ˆ« «« « « « «« «
« « «
«
& 4 «ˆ« « ˆ« l «ˆ« _««ˆ« «ˆ« l ˆ
« «
ˆ« «ˆ« l «ˆ« ˆ« =l « ˆ
«
1 2 3 4

======================
## « ««

ˆ « «« « 2 «« 3
« « « « « « « ˆ
« « 4 ˆ
« « 4
5 6 7 8

& ˆ« «ˆ« l ˆ« _«ˆ« _«« l _«ˆ«


====================== ˆ
« l «ˆ« = l
_ˆ«
## 3 «« « 2 « 3 « «
«
& 4 ˆ
« « «
ˆ« «ˆ« l 4 «ˆ« _««ˆ« l 4 «ˆ« ˆ
« «_«ˆ« l ««ˆ« _«« ««ˆ« =”
9 10 11 12

======================
_ˆ««

Padrões Tonais 05 (Maior)


Associação Simbólica

## 3 « «« 2 « « 3 «
« « «
« ««ˆ«
4 « « ˆ
« 4 ˆ
« « 4 « « ˆ
« « «
1 2 3 4

& « ˆ
«
======================
ˆ« l ˆ« l ˆ« _ˆ«« l ˆ
« «
ˆ« =l
## «« « «« « «« 2 ««

ˆ
« « « « ˆ
« « « ˆ
« ˆ
« « 3
« « « 4 4
5 6 7 8

& ˆ
« «
ˆ« l ˆ«
====================== ˆ« l _«ˆ« ˆ« l «
ˆ« = l
## 3 « «
« « «
« ««ˆ« ««
4 « ˆ
« « «
« « «
« ˆ
« « « «
9 10 11 12

& «
====================
ˆ« ˆ
« l ˆ« _ˆ«« ˆ« l ˆ« _«ˆ« l ˆ« « =
ˆ« =”
69
professor.geronimo@gmail.com
Padrões Tonais 01 (menor)
Associação Simbólica

b 34 ««ˆ« «« ««ˆ« « #œ»» ««ˆ« 3»œ» «« ««ˆ« «« « ««ˆ« 2 ««ˆ« #œ»» 3 ««ˆ« «#œ»» 2
l «ˆ« » l » ˆ« l ˆ« «ˆ« l 4 » l 4 «ˆ« » = l4
1 2 3 4 5 6

ˆ«
======================
&
mi

b 24 #œ»» ««ˆ« 3 œ»» ««ˆ« «« 2 «« ««ˆ« ««ˆ« « 3 ««ˆ« « ««ˆ« #œ»» ««ˆ« «
l 4 » ˆ« l 4 ˆ« «ˆ« l 4 «ˆ« l » «ˆ«=l
7 8 9 10 11 12

& »
====================== l

b « « «
« « #œ
» «
« 2 « «
« 3 « «
«
17«
« « «« «« «
«
& «ˆ« «ˆ« ˆ« l «ˆ« »» ˆ« l 4 «ˆ« ˆ« l 4 «ˆ« «ˆ« ˆ« l ˆ« «ˆ« ˆ« l ˆ« «ˆ« ««ˆ«=l
13 14 15 16 17 18
18

======================

b «« #œ»»» ««ˆ« «« ««ˆ« œ»»» 44 «« ««ˆ« ««ˆ«#œ»»»


19 20 21 22 23 24

=====
& ˆ« ===
l ˆ« ==============
l ˆ« l l l =”

Padrões Tonais 02 (menor)


Associação Simbólica

b 34 ««ˆ« #œ»» œ»»» ««ˆ« œ»» « œ»»» œ»» « 2 œ»» #œ» 3 œ»» œ»»» ««ˆ œ»» #œ» ««
l » «ˆ« l » «ˆ« l 4 » »» l 4 » « l » »» = ˆ« l
1 2 3 4 5 6

»
======================
&
mi

œ»» «« œ»» « œ» «« #œ» «« œ» #œ» «« « «« #œ» œ»» « 2


b » » » «
ˆ« l «ˆ« » ˆ« l »» ˆ« »» l »» «ˆ« ˆ« l «ˆ« ˆ« »» l » ««ˆ« «ˆ« =
l4
7 8 9 10 11 12

======================
&

b 24 « 34 « «« « #œ
» « «« « «« #œ» œ»» ««ˆ«
« « « « « « » « ˆ
« « ˆ
« » » «
13 14 15 16 17 18

«
======================
& ˆ
« »
ˆ« #_««ˆ l ˆ« _«« l ˆ« #_««ˆ _«« l ˆ« l ˆ« » «
l ˆ« =l
_«ˆ _«ˆ
b «« ««
& ˆ« _«« ˆ« l _««« ««ˆ« _««« l#_«««ˆ _««« _«««ˆ l
«
19 20 21 22 23 24

====================== l l =”
_«ˆ _«ˆ _«ˆ _«ˆ
70
professor.geronimo@gmail.com
Padrões Tonais 03 (menor)

««
Associação Simbólica

b 24 « «
« ˆ
« « « «
« « 3
« « 4
1 2 3 4

&
=============«ˆ« ˆ« l «ˆ« l===
# ««ˆ
_ ˆ« ======l ˆ« «ˆ« = l
34 « «« «««ˆ «« « «« «« « «« «

b « «
l ˆ« ==== «ˆ« ˆ« l ˆ«========= «ˆ« «ˆ« l «ˆ« «ˆ «ˆ« =l
5 6 7 8

&
=========«ˆ« ˆ«

b «« « 2 «« « «
« 3 « ««
& ˆ« «ˆ« #_«««ˆ l 4 #_«««ˆ «ˆ l «ˆ« ˆ« l 4 «ˆ« «ˆ ««ˆ«=l
9 10 11 12

======================
b ««ˆ« ««ˆ« «« « ««
«ˆ « ««
ˆ
« «« =”
l #_«««ˆ «ˆ«
13 14 15

&
================ ˆ« l «==
ˆ« ==== ˆ«
Padrões Tonais 04 (menor)
Associação Simbólica

b 34 « ««ˆ« «« « « «« «« «
« « ««
ˆ« l «ˆ« #_ˆ««« «ˆ« l ˆ« ˆ« «ˆ« l «ˆ« «ˆ« ˆ« =l
1 2 3 4

«ˆ«
======================
&
««ˆ« ««ˆ« « «« « 2 ««

b «
« « « ˆ
« 4 ˆ
« « 3
« « 4
5 6 7 8

«
======================
& ˆ« l ˆ« #_«ˆ« __«««ˆ l #_««ˆ ˆ« l «
ˆ« = l

b 34 ««ˆ« «« « 2 « « 3 « ««
ˆ« «ˆ« l 4 «ˆ« #_«ˆ« l 4 «ˆ« ˆ« #_ˆ««« l ««ˆ« _««« ««ˆ« =”
9 10 11 12

======================
&
_«ˆ
Padrões Tonais 05 (menor)
Associação Simbólica

b 34 « «« ««ˆ« 24 ««ˆ« « 43 «« « ««ˆ« «« « ««


«ˆ« l ˆ« #==
1 2 3 4

& «ˆ« ˆ«
=============== l ««ˆ =====
_ l ˆ« «ˆ« ˆ« =l
««ˆ« «« ««ˆ« « ««ˆ« 2 ««ˆ« « 3

b « « « «
«ˆ« l «ˆ« «ˆ« l #_««ˆ «ˆ« l4 l4
5 6 7 8

====
& ˆ«================= «ˆ« =

b 34 « ««ˆ« «« « « ««ˆ« « «« «
« « « « « «
9 10 11 12

& «ˆ«
==================== ˆ« l ˆ« #_««ˆ 71ˆ« l ˆ« #_««ˆ l «ˆ« ˆ« = «ˆ« =”
professor.geronimo@gmail.com
Padrões Tonais - Associação Simbólica

## w w
& dó w w w l w l w w w l w w w =l
1

======================

## w
w w w l w w w l w w w =l
2

& dó w
======================
w l
## w w w
w w w w w l w w w =l
3

w l l
======================
& dó

## w w w
w w
4

w w l _w w l
======================
& dó w w l w =l

## w w
w w _w l w l w w w =l
5

& dó w w w l
======================

## w w
w w w
6

& dó w w l w _w l
====================== w w lw =l

## w w w w
w w w w
7

& dó w w l w l
====================== l w =l

##
& dó w w w l w _w w l w _w w l w w w =l
8

======================

## w
w w l w w _w l w w w l w w w =l
9

======================
& dó

## w w w w
w w w w l w w w =”
10

w l l
======================
& dó
72
professor.geronimo@gmail.com
Padrões Tonais - Associação Simbólica

b w #w w
w l w w w l w w w =l
1

&lá w w
=======================
l

b w #w
w w l w w w l w w w =l
2

& lá w
=======================
w l

b w w w #w #w
w w w l w w w =l
3

& lá w
=======================
l l

b w w w
w w w
4

& lá w w w l # _w
=======================
w l lw =l

b w w
w w w l w w w =l
5

& lá w w w l
=======================
# _w l

b w w w w w
w
6

& lá w w
=======================
l w # _w l w lw =l

b w w #w w #w w w
w
7

& lá w w
=======================
l w l l w =l

& láb w w w l w # _w w l w # _w w l w w w =l
8

=======================

b w
w w l w w # _w l w w w l w w w =l
9

=======================
& lá

b w w w #w w
l w w w l w w w =”
10

& lá w
=======================
l
73
professor.geronimo@gmail.com
Padrões Tonais - Generalização

Ouça as séries de padrões tonais.


Compare e classifique-as, assinalando em Maior ou menor

MAIOR MENOR MAIOR MENOR


1 Série 1A Série 1B
2 Série 2A Série 2B
3 Série 3A Série 3B
4 Série 4A Série 4B
5 Série 5A Série 5B
6 Série 6A Série 6B
7 Série 7A Série 7B
8 Série 8A Série 8B
9 Série 9A Série 9B
10 Série 10A Série 10B

74
professor.geronimo@gmail.com
Padrões Melódicos

Fase 1 (Auditiva/Oral)

Ouça cada padrão, faça uma pausa, respire e cante usando


sílaba neutra, mantendo o andamento.
Repita até conseguir cantar afinado e interiorizado cada
padrão.

Fase 2 (Associação Verbal)

Ouça cada padrão, faça uma pausa, respire e cante usando


sílabas tonais correspondentes, sempre respeitando a
pulsação.

Fase 3 (Associação simbólica)

Usando sílabas tonais, ler e cantar a notação escrita dos


padrões tonais.
Estabeleça a tonalidade cantando um arpejo de tônica, se
necessário, transpor o padrão para um tom que forneça
uma região confortável.
Defina um andamento adequado, toque várias batidas
preparatórias e, em seguida cante o padrão
“Acappella” com uma pulsação para cada nota.

75
professor.geronimo@gmail.com
Padrões Melódicos A 

Padrões Melódicos: Associação Verbal 

Usando as sílabas tonais, cantar os padrões melódicos. 
Escolha uma tônica, estabeleça a tonalidade,  cante o pentacórdio, 
cante o arpejo de tônica, cante o padrão em  um tom que forneça  
uma região confortável. 
Defina um andamento adequado, toque várias batidas preparatórias 
e, em seguida cante o padrão Acappella com uma batida por nota. 

1- dó ré mi 13- dó ré mi fá mi
2- mi ré dó 14- ré mi ré dó si,
3- dó ré dó 15- si, dó ré dó ré
4- ré dó ré 16- mi mi ré dó si,

5- dó ré mi ré 17- dó ré mi fá sol
6- ré mi ré dó 18- sol fá mi ré dó
7- ré dó ré mi 19- sol fá mi fá sol
8- mi ré dó ré 20- mi fá sol fá mi

9- dó ré mi fá 21- dó si, dó ré mi
10- fá mi ré dó 22 - mi ré dó si, dó
11- fá mi ré mi 23- ré mi ré dó si,
12- mi ré mi fá 24- si, dó ré mi ré

76
professor.geronimo@gmail.com
Padrões Melódicos B 

Padrões Melódicos: Associação Verbal 

Usando as sílabas tonais, cantar os padrões melódicos. 
Escolha uma tônica, estabeleça a tonalidade,  cante o pentacórdio, 
cante o arpejo de tônica, cante o padrão em  um tom que forneça  
uma região confortável. 
Defina um andamento adequado, toque várias batidas preparatórias 
e, em seguida cante o padrão Acappella com uma batida por nota. 

1- dó mi sol 21- dó ré mi sol


2- sol mi dó 22- mi ré mi sol
3- dó mi sol mi 23- sol fá sol dó
4- sol mi sol dó 24- dó mi ré mi

5- dó mi dó sol 25- sol mi ré mi


6- sol dó sol mi 26 - mi sol mi ré
7- dó sol dó mi 27- sol mi ré dó
8- sol dó mi dó 28- mi fá mi sol

9- dó mi sol dó 29- sol fá sol mi


10- sol mi dó sol 30- sol mi fá sol
11- mi sol mi dó 31- dó sol fá mi
12- mi dó mi sol 32- sol mi sol fá

13- sol dó sol mi 33- dó mi sol fá sol


14- dó mi dó sol 34- sol mi dó ré dó
15- dó sol dó mi 35- dó sol fá mi sol
16- sol dó mi dó 36- ré mi ré dó sol

17- dó mi ré dó 37- dó mi ré mi fá
18- dó sol mi fá 38- fá sol mi ré mi
19- sol fá mi dó 39- ré mi fá mi sol
20- mi fá sol mi 40- sol mi ré mi dó

77
professor.geronimo@gmail.com
Padrões Melódicos C 

Padrões Melódicos: Associação Verbal 

Usando as sílabas tonais, cantar os padrões melódicos. 
Escolha uma tônica, estabeleça a tonalidade,  cante o pentacórdio, 
cante o arpejo de tônica, cante o padrão em  um tom que forneça  
uma região confortável. 
Defina um andamento adequado, toque várias batidas preparatórias 
e, em seguida cante o padrão Acappella com uma batida por nota. 

1- dó si, dó 13- dó si, lá, sol, fá,


2- si, dó si, 14- fá, sol, lá, sol,
3- dó ré dó si, 15- sol, lá, si, lá, si, dó
4- dó si, dó ré 16- sol, lá, sol, fá,
5- dó sí, lá, 17- fá, sol, lá, sol,
6- lá, si, dó 18- fá, sol, lá si dó'

7- dó si, lá, si, 19- dó si, dó ré mi


8- si, lá, si, dó 20- mi ré dó si, dó
9- dó si, lá, sol, 21- dó ré dó si, lá
10- sol, lá, sol, 22- lá, si, dó ré dó
11- lá, sol, lá, 23- dó ré mi ré dó si, lá,
12- lá, sol, lá, si, dó 24- lá, si, dó ré mi ré dó

78
professor.geronimo@gmail.com
Padrões Melódicos D 

Padrões Melódicos: Associação Verbal 

Usando as sílabas tonais, cantar os padrões melódicos. 
Escolha uma tônica, estabeleça a tonalidade,  cante o pentacórdio, 
cante o arpejo de tônica, cante o padrão em  um tom que forneça  
uma região confortável. 
Defina um andamento adequado, toque várias batidas preparatórias 
e, em seguida cante o padrão Acappella com uma batida por nota. 

1- dó mi sol dó' 17- dó si, lá, sol, dó


2- dó' sol mi dó 18- dó sol, lá, sol, dó mi
3- dó' sol mi sol mi 19- dó mi ré dó sol,
4- mi sol dó' mi sol 20- sol, lá, sol, dó ré

5- dó' mi dó' sol dó' 21- ré mi dó sol, mi


6- dó' do mi dó' sol 22- mi sol, mi ré dó
7- sol mi dó' mi sol 23- dó sol, dó mi sol
8- sol dó dó' mi sol 24- sol mi dó sol, sol

9- dó sol, lá, si, dó 25- dó mi ré dó sol,


10- sol, dó si, lá, sol, 26 - sol, lá, sol, mi dó
11- sol, dó sol, lá, sol, 27- mi dó sol fá mi
12- sol, dó sol, mi, dó 28- mi sol sol, lá, sol,

13- dó' sol dó' mi sol 29- dó sol, dó sol mi


14- fá mi ré mi dó' 30- mi ré dó mi sol,
15- dó' dó mi ré mi 31- fá, sol, lá, sol, dó
16- mi sol fá mi dó' 32- mi sol mi ré dó

79
professor.geronimo@gmail.com
Padrões Melódicos A(menor) 

Padrões Melódicos: Associação Verbal 

Usando as sílabas tonais, cantar os padrões melódicos. 
Escolha uma tônica, estabeleça a tonalidade,  cante o pentacórdio, 
cante o arpejo de tônica (lá‐dó‐mi‐dó‐lá) cante o padrão em  um tom 
que forneça uma região confortável. 
Defina um andamento adequado, toque várias batidas preparatórias 
e, em seguida cante o padrão Acappella com uma batida por nota. 

1- lá si dó 13- lá si dó ré dó
2- dó si lá 14- si dó si lá sol,
3- lá si lá 15- sol, lá si lá si
4- si lá si 16- dó dó si lá sol,

5- lá si dó si 17- lá si dó ré mi
6- si dó si lá 18- mi ré dó si lá
7- si lá si dó 19- mi ré dó ré mi
8- dó si lá si 20- dó ré mi ré dó

9- lá si dó ré 21- lá sol, lá si dó
10- ré dó si lá 22- dó si lá sol, lá
11- ré dó si dó 23- si dó si lá sol,
12- dó si dó ré 24- sol, lá si dó si

25- lá sol, lá sol, lá


26- lá si lá sol, lá
27- mi, fá, sol, lá sol, lá
28- lá mi, fá, sol, lá

80
professor.geronimo@gmail.com
Padrões Melódicos B(menor) 

Padrões Melódicos: Associação Verbal 

Usando as sílabas tonais, cantar os padrões melódicos. 
Escolha uma tônica, estabeleça a tonalidade,  cante o pentacórdio, 
cante o arpejo de tônica (lá‐dó‐mi‐dó‐lá) cante o padrão em  um tom 
que forneça uma região confortável. 
Defina um andamento adequado, toque várias batidas preparatórias 
e, em seguida cante o padrão Acappella com uma batida por nota. 

1- lá dó mi 21- lá si dó mi
2- mi dó lá 22- dó si dó mi
3- lá dó mi dó 23- mi ré mi lá
4- mi dó mi lá 24- lá dó si dó

5- lá dó lá mi 25- mi dó si dó
6- mi lá mi dó 26 - dó mi dó si
7- lá mi lá dó 27- mi dó si lá
8- mi lá dó lá 28- dó ré dó mi

9- lá dó mi lá 29- mi ré mi dó
10- mi dó lá mi 30- mi dó ré mi
11- dó mi dó lá 31- lá mi ré dó
12- dó lá dó mi 32- mi dó mi ré

13- mi lá mi dó 33- lá dó mi ré mi
14- lá dó lá mi 34- mi dó lá si lá
15- lá mi lá dó 35- lá mi ré dó mi
16- mi lá dó lá 36- si dó si lá mi

17- lá dó si lá 37- lá dó si dó ré
18- lá mi dó ré 38- ré mi dó si dó
19- mi ré dó lá 39- si dó ré dó mi
20- dó ré mi dó 40- mi dó si dó lá

81
professor.geronimo@gmail.com
Padrões Melódicos C(menor) 

Padrões Melódicos: Associação Verbal 

Usando as sílabas tonais, cantar os padrões melódicos. 
Escolha uma tônica, estabeleça a tonalidade,  cante o pentacórdio, 
cante o arpejo de tônica (lá‐dó‐mi‐dó‐lá) cante o padrão em  um tom 
que forneça uma região confortável. 
Defina um andamento adequado, toque várias batidas preparatórias 
e, em seguida cante o padrão Acappella com uma batida por nota. 

1- lá sol, lá 13- lá sol, fá, mi, ré,


2- sol, lá sol, 14- ré, mi, fá, mi,
3- lá si lá sol, 15- mi, fá, sol, fá, sol, lá
4- lá sol, lá si 16- mi, fá, mi, ré,
5- lá sol, fá, 17- ré, mi, fá, mi,
6- fá, sol, lá 18- ré, mi, fá, sol, lá

7- lá sol, fá, sol, 19- lá sol, lá si dó


8- sol, fá, sol, lá 20- dó si lá sol, lá
9- lá sol, fá, mi, 21- lá si lá sol, fá,
10- mi, fá, mi, 22- fá, sol, lá si lá
11- fá, mi, fá, 23- lá si dó si lá sol, fá,
12- fá, mi, fá, sol, lá 24- fá, sol, lá si dó si lá

82
professor.geronimo@gmail.com
Padrões Melódicos D(menor) 

Padrões Melódicos: Associação Verbal 

Usando as sílabas tonais, cantar os padrões melódicos. 
Escolha uma tônica, estabeleça a tonalidade,  cante o pentacórdio, 
cante o arpejo de tônica (lá‐dó‐mi‐dó‐lá) cante o padrão em  um tom 
que forneça uma região confortável. 
Defina um andamento adequado, toque várias batidas preparatórias 
e, em seguida cante o padrão Acappella com uma batida por nota. 

1- lá dó mi lá' 17- lá sol, fá, mi, lá


2- lá' mi dó lá 18- lá mi, fá, mi, lá dó
3- lá' mi dó mi dó 19- lá dó si lá mi,
4- dó mi lá' dó mi 20- mi, fá, mi, lá si

5- lá' dó lá' mi lá' 21- si dó lá mi, dó


6- lá' la dó lá' mi 22- dó mi, dó si lá
7- mi dó lá' dó mi 23- lá mi, lá dó mi
8- mi lá lá' dó mi 24- mi dó lá mi, mi

9- lá mi, fá, sol, lá 25- lá dó si lá mi,


10- mi, lá sol, fá, mi, 26 - mi, fá, mi, dó lá
11- mi, lá mi, fá, mi, 27- dó lá mi ré dó
12- mi, lá mi, dó, lá 28- dó mi mi,fá, mi,

13- lá' mi lá' dó mi 29- lá mi, lá mi dó


14- ré dó si dó lá' 30- dó si lá dó mi,
15- lá' lá dó si dó 31- ré, mi, fá, mi, lá
16- dó mi ré dó lá' 32- dó mi dó si lá

83
professor.geronimo@gmail.com
Padrões melódicos E(menor‐h) 

Padrões Melódicos: Associação Verbal 

Usando as sílabas tonais, cantar os padrões melódicos. 
Escolha uma tônica, estabeleça a tonalidade,  cante o pentacórdio, 
cante o arpejo de tônica (lá‐dó‐mi‐dó‐lá) cante o padrão em  um tom 
que forneça uma região confortável. 
Defina um andamento adequado, toque várias batidas preparatórias 
e, em seguida cante o padrão Acappella com uma batida por nota. 

1- si dó si lá gi, 15- lá gi, lá


2- gi, lá si lá si 16- gi, lá gi,
3- dó dó si lá gi, 17- lá si lá gi,
4- lá gi, fá, mi, ré, 18- lá gi, lá si
5- mi, fá, gi, fá, gi, lá, 19- lá gi, fá,
6- ré, mi, fá, gi, lá, 20- fá, gi, lá

7- lá gi, lá si dó 21- lá gi, fá, gi,


8- dó si lá gi, lá 22- sol, fá, gi, lá
9- si dó si lá gi, 23- lá gi, fá, mi,
10- gi, lá si dó si 24- fá, mi, fá, gi, lá

11- lá sol, lá gi, lá 25- lá gi, lá si dó


12- lá si lá gi, lá 26- lá si lá gi, fá,
13- mi, fá, s ol, lá gi, lá 27- fá, gi, lá si lá
14- lá mi, fá, gi, lá 28- lá si dó si lá gi, lá,

84
professor.geronimo@gmail.com
Padrões Melódicos Maiores -A
(Associação Simbólica)

## 3 « ««
2
«« «« «
3
«
4
« « 44
4 « « « « « « « «
& (dó) «ˆ« ˆ« ˆ« l ˆ« ˆ« «ˆ« l «ˆ« ˆ« «ˆ« l ˆ« «ˆ« ˆ« =
===================== l

5
## 4 ««ˆ« «« «« ««ˆ «« « «« « «« «« «« «« « ««
6 7 8

4 «
« «
« ˆ« l ˆ« « ˆ« «ˆ« l ˆ« «ˆ« ˆ« ˆ« l ˆ« ˆ« «ˆ« ˆ«=l
=====================
& ˆ« ˆ«

9
## « «« ««ˆ« ««ˆ« «« «« « ««ˆ« «« «« «« «« «« «« ««ˆ« 45
10 11 12

« «
«ˆ« ˆ« ˆ«
=====================
& l ˆ« ˆ« «ˆ« l ˆ« ˆ« ˆ« l ˆ« ˆ« ˆ« = l

13
## 5 « « « « 14 « 15
««ˆ« ««ˆ «« « «
16

4 «
« « «
ˆ
« «
ˆ
« «
ˆ
« «
« «
ˆ
« «
« «
« « « «
« «
« «
« «
«
& ˆ« ˆ« l ˆ« ˆ« ˆ« _««ˆ l _««ˆ ˆ« ˆ« ˆ« ˆ« l « ˆ« «ˆ« =
===================== _««ˆ l

##
17
« «« ««ˆ« œ» œ» ««ˆ« «« «« « œ» ««ˆ« «« ««ˆ« œ» «« ««ˆ« œ» ««ˆ« ««
18 19 20

« «
& «ˆ« ˆ« ˆ« »» l »»
===================== ˆ« ˆ« «ˆ« l »» ˆ« »» l ˆ« »» =ˆ« l

##
21
««ˆ« ««ˆ «« « « « «« «« «« « « « « «« «« ««
22 23 24

«
« « «
« «
«
& ˆ« _«ˆ« ˆ« ˆ« l « ˆ« «ˆ« _««ˆ «ˆ« l ˆ« ˆ« ˆ« «ˆ« _««ˆ l _««ˆ «ˆ« ˆ« ˆ« ˆ«=”
=====================
85
professor.geronimo@gmail.com
Padrões Melódicos menores -A
(Associação Simbólica)

3 « « «« ««ˆ« «« « 44
2 3 4
b 4 « « ˆ
« « «
« «
« «
« «
« «
« «
«
=====================
& (lá) ˆ« ˆ« l ˆ« ˆ« l ˆ« ˆ« ˆ« l ˆ« ˆ« ˆ« =
l

44 « « «« « « «« « « « « « «« «« « « «
5 6 7 8
b «ˆ« «ˆ« ˆ« «ˆ« l «ˆ« ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« «ˆ« ˆ« l ˆ« «ˆ« «ˆ« «ˆ«=l
=====================
&

«« ««ˆ« ««ˆ« «« «« « ««ˆ« «« «« «« «« «« «« ««ˆ« 45


9 10 11 12
b « «
«
& «ˆ« ˆ« ˆ«
=====================
l ˆ« ˆ« «ˆ« l ˆ« ˆ« ˆ« l ˆ« ˆ« ˆ« = l

5 « « «« «« «« « «« « « «« «« «« ««ˆ« ««ˆ« «« «« «
13 14 15 16
b 4 « « ˆ
« ˆ
« ˆ
« « ˆ
« « « « « «
«
=====================
& ˆ« ˆ« l ˆ« ˆ« ˆ« _««ˆ l _««ˆ ˆ« ˆ« ˆ« ˆ« l ˆ« ˆ« _=
««ˆ l

« « «« «« «« « « «« «« « «« «« « «« «« «« «
17 18 19 20
b « « « «
& «ˆ« «ˆ« «ˆ« ˆ« ˆ« l ˆ« ˆ« «ˆ« «ˆ« «ˆ« l ˆ« ˆ« «ˆ« ˆ« ˆ« l «ˆ« ˆ« ˆ« ˆ« =
===================== «ˆ« l

«« «« «« « « « «« «« «« « « « « «« «« ««
21 22 23 24
b « « « «
«
& «ˆ« _««ˆ «ˆ« ˆ« ˆ« l ˆ« ˆ« «ˆ« _««ˆ «ˆ« l ˆ« ˆ« ˆ« «ˆ« _««ˆ l _««ˆ «ˆ« ˆ« ˆ« =
===================== ˆ« l

6 5 «
25 26 27 28
b « « « « « « «
« « « « 4 « « « « 4 ««ˆ« ”
& «ˆ« _««ˆ «ˆ« _««ˆ «ˆ« l «ˆ« ˆ« «ˆ« _««ˆ «ˆ« l __««ˆ _««ˆ _««ˆ «ˆ« _««ˆ «ˆ« l «ˆ« _««« _«««ˆ _«««ˆ =
===================== « «
« _«ˆ
86
professor.geronimo@gmail.com
Padrões Melódicos Maiores -B
(Associação Simbólica)

## 3 « «
«
2
«
« « 4
3
« «
« «
4
«« « ««
« « «
& 4(dó) «ˆ« «ˆ« ˆ« l ˆ« «ˆ« «ˆ« l 4 «ˆ« «ˆ« ˆ« «ˆ« l ˆ« «ˆ« ˆ« ««ˆ«=l
=====================
5
## « «
«
6
«
« «
« «
7
«
« «
8
«« ««ˆ« «
«
« «
ˆ
« «
« ˆ
« ˆ
« «
«
=====================
& l ˆ« ˆ
« «
ˆ
« «
«
l ˆ« ˆ
« «
« «
ˆ
« l ˆ
« «
« «ˆ«=l
ˆ« ˆ« ˆ« ˆ«
9
## « «
«
10
«
« « «
«
11
« «
« «
12
« « ««
« «
=====================
& « « «
«ˆ« «ˆ« ˆ« «ˆ« l ˆ« «ˆ« «ˆ« ˆ« l «ˆ« ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« «ˆ« ˆ«=l
13
## «« «
« «
14
« «
«
15
«
« « ««
16
««ˆ «
ˆ
« «
« ˆ
« «
ˆ
« «
« «
ˆ
« «
« ˆ
« «
« ˆ
« «
« «
ˆ
« ˆ
« «
«
=====================
& ˆ« l ˆ« ˆ« l ˆ« ˆ« l ˆ« « «ˆ«=l
17
## «
18
«
« « «
19
«
« « «
20
« « «« «
« « « « « « « «
«ˆ« «ˆ« «ˆ« «ˆ« l «ˆ« ˆ« «ˆ« ˆ« l ˆ« ˆ« «ˆ« «ˆ« l «ˆ« ˆ« ˆ« «ˆ«=l
=====================
&
21
## « «
«
22
« « «
« «
«
23
«
«« «ˆ« « « «« « ««
24

« « «
«ˆ« «ˆ« ˆ« ˆ
« « « « ˆ
« ˆ
«
l ˆ« «ˆ« ˆ«
=====================
& l ˆ« «ˆ« l «ˆ« ˆ« «ˆ« ˆ«=l
25
## «« « «
26
« «
« «
27
«
« «
28
« « « ««
«
=====================
& « « « «
ˆ« «ˆ« «ˆ« «ˆ« l «ˆ« ˆ« «ˆ« «ˆ« l ˆ« «ˆ« «ˆ« « l «ˆ« ˆ« «ˆ« ˆ«=l
ˆ«
29
## «« « «« « 30«« « « «« 31 «« « « 32«« « «« « 5
ˆ« «ˆ« ˆ« «ˆ« l ˆ« «ˆ« «ˆ« ˆ« l «« ˆ« «ˆ« «ˆ« l ˆ« «ˆ« ˆ« «ˆ« =
=====================
& l4
ˆ«
## 5 « «« « «« 34«« «
33 35
«
« « « «
«
36
« ««
« «
===================== « « « « « « « «
& 4 «ˆ« «ˆ« ˆ« ˆ« ˆ« l ˆ« «ˆ« «ˆ« «ˆ« «ˆ« l «ˆ« ˆ« ˆ« «ˆ« ˆ« l «ˆ« «ˆ« «ˆ« «ˆ« =ˆ« l

##
37
« « «
38
« «
« « «
39
« « « «
«
40
«« « « «
« « « « « « «
& «ˆ« «ˆ« «ˆ« «ˆ« ˆ« l ˆ« ˆ« «ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« ˆ« «ˆ« ˆ« l ˆ« «ˆ« «ˆ« «ˆ« ««ˆ«=”
=====================
87
professor.geronimo@gmail.com
Padrões Melódicos menores -B
(Associação Simbólica)

34 « «« ««ˆ« «« « 4 « «« « «« « ««
2 3 4
b « «
& (lá) «ˆ« ˆ« l ˆ« «ˆ« «ˆ« l 4 «ˆ« «ˆ« ˆ« «ˆ« l ˆ« «ˆ« ˆ« ««ˆ«=l
=====================

« «« «« «« « «« « «« ««ˆ« «
5 6 7 8
b «
« «
ˆ
« «
« ˆ
« ˆ
« «
« ˆ
« «
ˆ
« «
« ˆ
« «
« «
ˆ
« ˆ
« «
« «ˆ«=l
=====================
& ˆ« ˆ« l ˆ« l ˆ« ˆ« l ˆ«

« «« «« « «« « «« « « « ««
9 10 11 12
b « « « « «
& «ˆ« «ˆ« ˆ« «ˆ« l ˆ« «ˆ« «ˆ« ˆ« l «ˆ« ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« «ˆ« ˆ«=l
=====================

«« «« « « «« «« « «« ««ˆ «
13 14 15 16
b ˆ
« «
« ˆ
« «
ˆ
« «
« «
ˆ
« «
« ˆ
« «
« ˆ
« «
« «
ˆ
« ˆ
« «
«
=====================
& ˆ« l ˆ« ˆ« l ˆ« ˆ« l ˆ« « «ˆ«=l

« «« « «« «« «« « « « «« «
17 18 19 20
b « « « « « «
& «ˆ« «ˆ« «ˆ« «ˆ« l «ˆ« ˆ« «ˆ« ˆ« l ˆ« ˆ« «ˆ« «ˆ« l «ˆ« ˆ« ˆ« «ˆ«=l
=====================

« «« « « « «« «« «« «« ««ˆ« «« ««ˆ
21 22 23 24
b «
« «
« «
ˆ
« ˆ
« «
ˆ
« « «
ˆ
« ˆ
« ˆ
« ˆ
« ˆ
« «
« «
«
=====================
& ˆ« ˆ« l ˆ« l ˆ« l ˆ« ˆ« «=l

«« « « « « «« « « «« « « « « « ««
25 26 27 28
b « «
& ˆ« «ˆ« «ˆ« «ˆ« l «ˆ« ˆ« «ˆ« «ˆ« l ˆ« «ˆ« «ˆ« «ˆ« l «ˆ« ˆ« «ˆ« ˆ«=l
=====================

«« «« «« « «« « «« «« «« «« « «« « «« «« 5
29 30 31 32
b «
& ˆ« ˆ« ˆ« «ˆ« l ˆ« «ˆ« ˆ« ˆ« l «ˆ« ˆ« ˆ« «ˆ« l ˆ« «ˆ« ˆ« ˆ« =
===================== l4

54 « «« ««ˆ« «« ««ˆ« ««ˆ« «« « « « « ««ˆ« «« «« ««ˆ« « «« « « ««ˆ«


33 34 35 36
b «ˆ« ˆ« ˆ« l ˆ« «ˆ« «ˆ« «ˆ« l «ˆ« ˆ« ˆ« l «ˆ« ˆ« «ˆ« «ˆ« =l
=====================
&

« « « « «« « « « « « «« « «« «« « « «
37 38 39 40
b « « « «
& «ˆ« «ˆ« «ˆ« «ˆ« ˆ« l ˆ« ˆ« «ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« ˆ« «ˆ« ˆ« l ˆ« «ˆ« «ˆ« «ˆ« ««ˆ«=”
=====================
88
professor.geronimo@gmail.com
Padrões Melódicos Maiores -C
(Associação Simbólica)

## 3 2
44 « « «
3 4
« 3
4 « « « « « « « « « « « «
& (dó)«ˆ« _««ˆ «ˆ« l _««ˆ «ˆ« _««ˆ l «ˆ« ˆ« «ˆ« _««ˆ l «ˆ« _««ˆ «ˆ« ˆ« =
===================== l 4

5
## 3 6
44 « « « «
7 8

4 « «
=====================
& « «
«ˆ« _««ˆ _«ˆ l _«ˆ _««ˆ «ˆ« l «ˆ« _««ˆ _«« _««ˆ l _««ˆ _«« _«««ˆ ««ˆ«=l
« «
« « «ˆ «ˆ

9
## 3
10 11
5
12

«
« « «
=====================
& « «
« l 4 «
« « «
« l « «
« « l 4 « «
« « «
« =«« l
ˆ« _«ˆ _««ˆ __««ˆ __««ˆ _««ˆ __««ˆ _««ˆ __««ˆ _««ˆ _««ˆ __««ˆ _««ˆ _«ˆ ˆ«

##
13
44
14
6
15
44
16

« « « 4 « « «
& «ˆ« _««ˆ _««ˆ _««« _««« l _««« _««« _«««ˆ _««« l _««« _«««ˆ _««ˆ _«««ˆ _««ˆ «ˆ« l _««« _«««ˆ _««« _=
===================== ««« l
_«ˆ _«ˆ _«ˆ _«ˆ _«ˆ _«ˆ _«ˆ _«ˆ _«ˆ

##
17
5
18 19
« «« «« «« « « «
20

« « « « 4 « « « « « « « « «
& __«« _«« _««ˆ _«« l _«« _«« _««ˆ _««ˆ «ˆ« l «ˆ« _««ˆ «ˆ« ˆ« ˆ« l ˆ« ˆ« «ˆ« _««ˆ =
===================== «ˆ« l
«ˆ _«ˆ _«ˆ _«ˆ _«ˆ

##
21 22
74 « « «« « « «
23 24
«« «« «
« «
« « « « « « « «
« « « « « « « « «
«
& «ˆ« ˆ« «ˆ« _««ˆ _««ˆ l _««ˆ _««ˆ «ˆ« ˆ« «ˆ« l «ˆ« ˆ« ˆ« ˆ« «ˆ« _««ˆ _««ˆ l _««ˆ _««ˆ «ˆ« ˆ« ˆ« ˆ« =
===================== «ˆ« ”
89
professor.geronimo@gmail.com
Padrões Melódicos menores -C
(Associação Simbólica)

3 « « « 44 « « « « « « « « 3
2 3 4
b 4 « « «
& (lá) ˆ« _««ˆ ˆ« l _««ˆ ˆ« _««ˆ l «ˆ« «ˆ« «ˆ« _««ˆ l «ˆ« _««ˆ «ˆ« «ˆ« =
« «
===================== « l4

3 « « 44 « « « «
5 6 7 8
b 4 « « « « «
« « « « « ««=l
=====================
& «
ˆ« _«ˆ _««ˆ l «
_««ˆ _«ˆ ˆ« l « « l « «
ˆ« _«ˆ _««ˆ _«ˆ _«ˆ _««ˆ _«ˆ ˆ«

3 5
9 10 11 12
b « « «« l
& ˆ« _««ˆ _««ˆ _«« l _«« _««ˆ _«« l _««ˆ _«« _««ˆ l _«««ˆ _««« _«««ˆ _«««ˆ =
« « « 4
===================== « « « « « « 4 ˆ«
_«ˆ _«ˆ _«ˆ _«ˆ _«ˆ

44 6 44
13 14 15 16
b « « « « « 4 « « « «
& ˆ« _««ˆ _««ˆ _«« _«« l _«« _«« _««ˆ _«« l _«« _««ˆ _««ˆ _««ˆ _««ˆ ˆ« l _««« _«««ˆ _««« _=
« «
=====================« « « « « « ««« l
_«ˆ _«ˆ _«ˆ _«ˆ _«ˆ _«ˆ _«ˆ _«ˆ _«ˆ

5 ««ˆ« ««ˆ «« « « «
17 18 19 20
b « « « « 4 « « « « «
« «
« « «
« «
«
& __«« _«« _««ˆ _«« l _«« _«« _««ˆ _««ˆ ˆ« l ˆ« _««ˆ ˆ« ˆ« l « ˆ« «ˆ« _««ˆ =
===================== «ˆ« l
«ˆ _«ˆ _«ˆ _«ˆ _«ˆ

«« «« « « « « «« «« «« 74 «« «« ««ˆ« «« «« « « « « «« «« ««ˆ« «« ««
21 22 23 24
b «
«
=====================
& ˆ« ˆ« ˆ« _««ˆ _««ˆ l _««ˆ _««ˆ ˆ« ˆ« ˆ« l ˆ« ˆ« ˆ« ˆ« _««ˆ _««ˆ l _««ˆ _««ˆ ˆ« ˆ« ˆ« =
ˆ« ”
90
professor.geronimo@gmail.com
Padrões Melódicos Maiores -D
(Associação Simbólica)

## 4 « «
« œ
»
2
œ
» «
« « 5
3
œ
» «
« « «
« «
4
« «« œ»» « ««
« »
===================== » « »
& 4(dó)«ˆ« «ˆ« ˆ« » l » ˆ« «ˆ« «ˆ« l 4 » ˆ« «ˆ« ˆ« «ˆ« l «ˆ« ˆ« » «ˆ« = ˆ« l

5
## œ» « œ» «« œ» 6œ» « œ
» «
«
7
«
« « œ
» « «
«
8
«« œ
» « ««
» » » » « » » « »
& » «ˆ« » ˆ« » l » «ˆ« «ˆ« » ˆ« l ˆ« «ˆ« » «ˆ« ˆ« l ˆ« «ˆ« » «ˆ« =
===================== ˆ« l

9
## 10 11 12

& ««ˆ« _««« _«««ˆ _«««ˆ ««ˆ« l _««« ««ˆ« _«««ˆ _«««ˆ _««« l _««« ««ˆ« _««« _«««ˆ _««« l _««« ««ˆ« _««« _««« =
===================== ««ˆ« l
_ˆ« _«ˆ _«ˆ _«ˆ _«ˆ _«ˆ _«ˆ _«ˆ __««ˆ

## œ» «« œ» « «« 14« « « œ» 15œ»
13
« «
16
« ««ˆ« «« « œ»»
& » » ˆ
« » « ˆ
« « « « « » » « « « « «
» ˆ« l ˆ« ˆ« «ˆ« ˆ« » l » «ˆ« ˆ« «ˆ« ˆ« l ˆ«
===================== ˆ« «ˆ« =
» l

##
17
6 «
18
««ˆ« 45 « ««ˆ «« « « «
19 20

«
« « «
«
===================== « « « « «
« ««ˆ« l
& ˆ« _««ˆ _««ˆ _«« ˆ« l ˆ« _«« _««ˆ _«« ˆ« l «ˆ« « ˆ« «ˆ« _«« l _«« _«««ˆ _««« ««ˆ« =
« « 4
_«ˆ _«ˆ _«ˆ _«ˆ _«ˆ _«ˆ

## « «
21
«
22
« « «
23
« «
«
24
«« « ««
«
===================== « « « «
& «ˆ« «ˆ« «ˆ« _««« «ˆ« l «ˆ« _««« «ˆ« «ˆ« «ˆ« l «ˆ« _««« «ˆ« «ˆ« ˆ« l ˆ« «ˆ« «ˆ« _««« =ˆ« l
_«ˆ _«ˆ _«ˆ _«ˆ

##
25
«« «« «
26
«
27
« «
« ««ˆ« «« «« ««ˆ«
28

«
===================== « « « «
& «ˆ« ˆ« ˆ« «ˆ« _««« l _««« _«««ˆ _««« ˆ« «ˆ« l ˆ« «ˆ« ˆ
« ˆ« l ˆ« _««« _«« = ««« l
_«ˆ _«ˆ _«ˆ _
_«ˆ «ˆ _«ˆ

##
29
««ˆ« « « « «
30 31 32
« ««ˆ« « «
« « «
===================== « « « « «
& «ˆ« _««« «ˆ« ˆ« l ˆ« «ˆ« «ˆ« ˆ« __«««ˆ l __««« __«««ˆ _««ˆ« __«««ˆ «ˆ« l ˆ« «ˆ« «ˆ« ««ˆ«=”
_«ˆ « «ˆ « «
91
professor.geronimo@gmail.com
Padrões Melódicos menores -D
(Associação Simbólica)

 44         45          
2 3 4

 (lá)    
           

                    
5 6 7 8

   
              

                        
 
9 10 11 12


         

                    
13 14 15 16

                 


     

   6    45          
17 18 19 20

   
  4     
                      
 
     

                    


21 22 23 24


               
  

         
   
25 26 27 28

                       
  
    

           
29 30 31 32

 
   
  
                 
     
92
professor.geronimo@gmail.com
Padrões Melódicos menores -E
(Associação Simbólica)

5 « «« « « « « « « « « «« «« « « « « « 6
2 3 4
b 4 « ˆ
« « « « « « « ˆ
« ˆ
« « « « « « « 4
=====================
& (lá) ˆ« ˆ« ˆ« #_««ˆ #l _««ˆ ˆ« ˆ« ˆ« ˆ« l ˆ« ˆ« #_««ˆ l ˆ« #_ˆ«« _««ˆ _«« _«« =l
(lá) _ ˆ
« _ «ˆ

6 5 ««ˆ« ««ˆ «« « « «
5 6 7 8
b 4 « « « « « «
« 4 « « « « «
« «
« « «
« «
«
__«««ˆ _««ˆ #_««ˆ _««ˆ _««ˆ ˆ« l __«««ˆ __«««ˆ _««ˆ #_««ˆ ˆ« l ˆ« #_««ˆ ˆ« ˆ« l « ˆ« «ˆ« #_ˆ«« =
=====================
& «ˆ« l

«« ««ˆ« «« «« « « «« «« ««ˆ« «« «« « «« « «« «« «« «« « «« 46
9 10 11 12
b
=====================
& ˆ« ˆ« ˆ« #_««ˆ #l _««ˆ ˆ« ˆ« ˆ« l ˆ« _««ˆ ˆ« #_ˆ«« ˆ« l ˆ« ˆ« ˆ« #_ˆ«« ˆ« =
l

6 5 « 3 « « « « « « 4
13 14 15 16
b 4 « « « « 4 « « 4
« « « « « « « « l4
__«««ˆ _««ˆ _««ˆ ˆ« #_««ˆ ˆ« l ˆ« __«««ˆ _««ˆ #_««ˆ ˆ« l «ˆ« #_««ˆ «ˆ« l #_ˆ«« «ˆ« _««ˆ =
=====================
&

44 « « « « « « « « 3 « « 44
17 18 19 20
b « « « « « « 4 « « « « «
«
=====================
& ˆ« ˆ« ˆ« #_««ˆ l ˆ« #_««ˆ ˆ« ˆ« l ˆ« #_ˆ«« _««ˆ l _««ˆ #_ˆ«« ˆ« =
l

44 « « 5
21 22 23 24
b « « « « « « «
« «
« « « « 4 « « « « «« l
=====================
& « « l « « l « «
ˆ« #_ˆ« _««ˆ _«ˆ _«ˆ _««ˆ #_ˆ« ˆ« ˆ« #_ˆ« _««ˆ __««ˆ l « « =
_««ˆ __««ˆ _««ˆ #_ˆ« ˆ«

« 74 « « «« « « « «
25 26 27 28
b « « « « « « « « « « « « «
& «ˆ« #_««ˆ «ˆ« «ˆ« ˆ« l «ˆ« «ˆ« «ˆ« #_«ˆ« _«««ˆ l _«««ˆ #_«ˆ« «ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« ˆ« «ˆ« «ˆ«#_«ˆ«=
===================== «ˆ« ”
93
professor.geronimo@gmail.com
Exercícios de Afinação Vocal 1
(Maior)

Exercícios de Afinação Vocal


Construindo Habilidades Vocais e Auditivas: Graus Conjuntos e Saltos
no Acorde Fundamental
Cante os exercícios de afinação, repita em alturas diferentes mantendo
a pulsação. 
1. dó ré mi fá sol fá mi ré dó
2. dó ré mi fá sol / sol fá mi ré dó
3. dó ré dó
4. dó ré mi ré dó
5. dó ré mi fá mi ré dó
6. dó ré mi fá sol fá mi ré dó
7. dó ré mi fá sol
8. sol fá sol
9. sol fá mi fá sol
10.sol fá mi ré mi fá sol
11.sol fá mi ré dó ré mi fá sol
12.dó ré dó ré
13.dó ré mi dó mi
14.dó ré mi fá dó fá
15.dó ré mi fá sol dó sol
16.sol fá sol fá
17.sol fá mi sol mi
18.sol fá mi ré sol ré
19.sol fá mi ré dó sol dó
20.dó ré mi fá sol lá si do' / do' si lá sol fá mi ré dó
21.dó mi sol mi dó
22.dó mi sol mi dó mi
23.dó mi sol mi dó sol
24.dó' sol mi sol dó'
25.dó' sol mi sol dó' sol dó'
26.dó' sol mi sol dó' mi dó'

94
professor.geronimo@gmail.com
Exercícios de Afinação Vocal 2
(Maior)
Exercícios de Afinação Vocal
Construindo Habilidades Vocais e Auditivas: Graus Conjuntos e Saltos
no Acorde Fundamental
Cante os exercícios de afinação, repita em alturas diferentes mantendo a
pulsação. 

1- dó ré mi fá sol lá si dó' si lá sol fá mi ré dó


2- dó ré mi fá sol lá si dó' ré' dó' si lá sol fá mi ré dó si, lá, sol, lá, si, dó
3- dó ré dó
4- dó ré mi ré dó
5- dó ré mi fá mi ré dó
6- dó ré mi fá sol fá mi ré dó
7- dó ré mi fá sol lá sol fá mi ré dó
8- dó ré mi fá sol lá si lá sol fá mi ré dó
9- dó ré mi fá sol lá si dó' si lá sol fá mi ré dó
10- dó' si dó'
11- dó' si lá si dó'
12- dó' si lá sol lá si dó'
13- dó' si lá sol fá sol lá si dó'
14- dó' si lá sol fá mi fá sol lá si dó'
15- dó' si lá sol fá mi ré mi fá sol lá si dó'
16- dó' si lá sol fá mi ré dó ré mi fá sol lá si dó'
17- dó ré mi fá sol fá mi ré dó
18- ré mi fá sol lá sol fá mi ré
19- mi fá sol lá si lá sol fá mi
20- fá sol lá si dó' si lá sol fá
21- sol lá si dó' ré' dó' si lá sol
22- lá si dó' ré' mi' ré' dó' si lá
23- si dó' ré' mi' fá' mi' ré' dó' si dó'
24- dó mi sol mi dó
25- dó mi sol dó' sol mi dó sol, dó

95
professor.geronimo@gmail.com
Exercícios de Afinação Vocal 3
(Maior)

Exercícios de Afinação Vocal


Construindo Habilidades Vocais e Auditivas: Graus Conjuntos e Saltos
entre os Graus da Escala.
Cante os exercícios de afinação, repita em alturas diferentes mantendo a
pulsação.

1- dó dó
2- dó ré
3- dó mi
4- dó fá
5- dó sol
6- dó lá
7- dó si
8- dó dó'
9- dó' dó'
10- dó' si
11- dó' lá
12- dó' sol
13- dó' fá
14- dó' mi
15- dó' ré
16- dó' dó
17- dó ré mi dó mi
18- ré mi fá ré fá
19- mi fá sol mi sol
20- fá sol lá fá lá
21- sol lá si sol si
22- lá si dó' lá dó'
23- si dó' ré' si ré'- dó'
24- dó' si lá dó' lá
25- si lá sol si sol
26- lá sol fá lá fá
27- sol fá mi sol mi
28- fá mi ré fá ré
29- mi ré dó mi dó
30- ré dó si, ré si, - dó

96
professor.geronimo@gmail.com
Exercícios de Afinação Vocal 4
(Maior)

Exercícios de Afinação Vocal


Construindo Habilidades Vocais e Auditivas: Graus Conjuntos e Saltos
entre os Graus da Escala.
Cante os exercícios de afinação, repita em alturas diferentes mantendo a
pulsação.
1- dó mi
2- ré fá
3- mi sol
4- fá lá
5- sol si
6- lá dó'
7- si ré' - dó'
8- dó' lá
9- si sol
10- lá fá
11- sol mi
12- fá ré
13- mi dó
14- ré si, - dó
15- dó mi sol mi dó
16- mi sol dó' sol mi
17- sol dó' mí' dó' sol
18- dó fá
19- ré sol
20- mi lá
21- fá si
22- sol dó'
23- lá ré'
24- si mi' -dó'
25- dó' sol
26- si fá
27- lá mi
28- sol ré
29- fá dó
30- mi si,
31- ré lá, -dó

97
professor.geronimo@gmail.com
Exercícios de Afinação Vocal 1
(menor)

Construindo Habilidades Vocais e Auditivas: Graus Conjuntos e Saltos


no Acorde Fundamental.
Cante os exercícios de afinação, repita em alturas diferentes mantendo a
pulsação. 

1. lá si dó ré mi ré dó si lá
2. lá si dó ré mi / mi ré dó si lá
3. lá si lá
4. lá si dó si lá
5. lá si dó ré dó si lá
6. lá si dó ré mi ré dó si lá
7. lá si dó ré mi
8. mi ré mi
9. mi ré dó ré mi
10. mi ré dó si dó ré mi
11. mi ré dó si lá si dó ré mi
12. lá si lá si
13. lá si dó lá dó
14. lá si dó ré lá ré
15. lá si dó ré mi lá mi
16. mi ré mi ré
17. mi ré dó mi dó
18. mi ré dó si mi si
19. mi ré dó si lá mi lá
20. lá si dó ré mi fá sol lá' / lá' sol fá mi ré dó si lá
21. lá dó mi dó lá
22. lá dó mi dó lá dó
23. lá dó mi dó lá mi
24. lá' mi dó mi lá'
25. lá' mi dó mi lá mi lá'
26. lá' mi dó mi lá' dó lá'

98
professor.geronimo@gmail.com
Exercícios de Afinação Vocal 2
(menor)

Construindo Habilidades Vocais e Auditivas: Graus Conjuntos e Saltos no Acorde


Fundamental.
Cante os exercícios de afinação, repita em alturas diferentes mantendo a pulsação.

1- lá si dó ré mi fá sol lá' sol fá mi ré dó si lá


2- lá si dó ré mi fá sol lá' si' lá' sol fá mi ré dó si lá sol, fá, mi, fá, sol, lá
3- lá si lá
4- lá si dó si lá
5- lá si dó ré dó si lá
6- lá si dó ré mi ré dó si lá
7- lá si dó ré mi fá mi ré dó si lá
8- lá si dó ré mi fá sol fá mi ré dó si lá
9- lá si dó ré mi fá sol lá' sol fá mi ré dó si lá
10- lá' sol lá'
11- lá' sol fá sol lá'
12- lá' sol fá mi fá sol lá'
13- lá' sol fá mi ré mi fá sol lá'
14- lá' sol fá mi ré dó ré mi fá sol lá'
15- lá' sol fá mi ré dó si dó ré mi fá sol lá'
16- lá' sol fá mi ré dó si lá si dó ré mi fá sol lá'
17- lá si dó ré mi ré dó si lá
18- si dó ré mi fá mi ré dó si
19- dó ré mi fá sol fá mi ré dó
20- ré mi fá sol lá' sol fá mi ré
21- mi fá sol lá' si' lá' sol fá mi
22- fá sol lá' si' dó' si' lá' sol fá
23- sol lá' si' dó' ré' dó' si' lá' sol lá'
24- lá dó mi dó lá
25- dó mi lá' mi dó
26- mi lá' dó' lá' mi
27- lá dó mi lá' mi dó lá mi, lá

99
professor.geronimo@gmail.com
Exercícios de Afinação Vocal 3
(menor)

Construindo Habilidades Vocais e Auditivas: Graus Conjuntos e Saltos


entre os Graus da Escala.
Cante os exercícios de afinação, repita em alturas diferentes mantendo a
pulsação.

1- lá lá
2- lá si
3- lá dó
4- lá ré
5- lá mi
6- lá fá
7- lá sol
8- lá lá'
9- lá' lá'
10- lá' sol
11- lá' fá
12- lá' mi
13- lá' ré
14- lá' dó
15- lá' si
16- lá' lá
17- lá si dó lá dó
18- si dó ré si ré
19- dó ré mi dó mi
20- ré mi fá ré fá
21- mi fá sol mi sol
22- fá sol lá' fá lá'
23- sol lá' si' sol si'- lá
24- lá' sol fá lá' fá
25- sol fá mi sol mi
26- fá mi ré fá re
27- mi ré dó mi dó
28- ré dó si ré si
29- dó si lá dó lá
30- si lá sol, si sol, - lá

100
professor.geronimo@gmail.com
Exercícios de Afinação Vocal 4
(menor)

Construindo Habilidades Vocais e Auditivas: Graus Conjuntos e Saltos


entre os Graus da Escala.
Cante os exercícios de afinação, repita em alturas diferentes mantendo a
pulsação.

1- lá dó
2- si ré
3- dó mi
4- ré fá
5- mi sol
6- fá lá'
7- sol si - lá'
8- lá' fá
9- sol mi
10- fá ré
11- mi dó
12- ré si
13- dó lá
14- si sol, - lá
15- lá dó mi dó lá
16- dó mi lá' mi dó
17- mi lá' dó' lá' mi
18-lá ré
19- si mi
20- dó fá
21- ré sol
22- mi lá'
23- fá si
24- sol dó' -lá'
25- lá' mi
26- sol ré
27- fá dó
28- mi si
29- ré lá
30- dó sol,
31- si fá, -lá

101
professor.geronimo@gmail.com
Exercícios de Afinação Vocal 5
(menor.h)
Construindo Habilidades Vocais e Auditivas: Graus Conjuntos e Saltos
entre os Graus da Escala.
Cante os exercícios de afinação, repita em alturas diferentes mantendo
a pulsação

1- lá si dó ré mi fá gi lá gi fá mi ré dó si lá
2- lá si dó ré mi ré dó si lá
3- si dó ré mi fá mi ré dó si
4- dó ré mi fá gi fá mi ré dó
5- re mi fá gi lá' gi fá mi ré
6- mi fá gi lá' si' lá' gi fá mi
7- fá gi lá' si' dó' si' lá' gi fá
8- gi lá' si' dó' ré' dó' si' lá' gi lá'
9- lá si dó ré mi dó lá
10- si dó ré mi fá ré si
11- dó ré mi fá gi mi dó
12- re mi fá gi lá' fá ré
13- mi fá gi lá' si' gi mi
14- fá gi lá' si' dó' lá' fá
15- gi lá' si' dó' ré' si' gi lá'
16- mi ré dó si lá dó mi
17- fá mi ré dó si ré fá
18- gi fá mi ré dó mi gi
19- lá' gi fá mi ré fá lá'
20- si' lá' gi fá mi gi si'
21- dó' si' lá' gi fá lá' dó'
22- ré' dó' si' lá' gi si' ré' -dó' lá'

102
professor.geronimo@gmail.com
Exercícios 0HOyGLFRV
Cada um dos exercícios será precedido com uma breve introdução.

Aqui está o que você vai ouvir:

A afinação para o primeiro grau "dó" é tocada.

O Arpejo dó-mi-sol-mi-dó ou dó-sol-mi-sol-dó' é cantado.

A primeira nota do exercício é cantada.

Ouvimos duas batidas de marcação.

O exercício começa.

Obtendo o máximo de benefícios dos exercícios Melódicos.

Além de cantar junto com as vozes na gravação, você pode ganhar um


benefício ainda maior dos exercícios melódicos. praticando-os das seguintes
maneiras:

1. Cante junto com a gravação "mentalmente." Em outras palavras, em vez de


cantar em voz alta, tente "ouvir" cada som em sua mente pouco antes das
vozes na gravação cantá-los. Isto irá desenvolver seu "ouvido interno, musical."

2. Quando se sentir pronto, parar a gravação logo após a introdução, e cantar


o exercício, por você mesmo. Isso vai reforçar a sua independência.

3. Tal como no número 2, cantar o exercício sem a gravação, mas fazê-lo em


um ritmo mais rápido. Isso vai melhorar a rapidez de sua mente.

103
professor.geronimo@gmail.com
104
professor.geronimo@gmail.com
105
professor.geronimo@gmail.com
Exercício 

Exercício 

Exercício 

Exercício 

Exercício 

Exercício 8

([HUFtFLR

([HUFtFLR

([HUFtFLR

106
professor.geronimo@gmail.com
([HUFtFLR

([HUFtFLR

([HUFtFLR

([HUFtFLR

([HUFtFLR

([HUFtFLR

([HUFtFLR

([HUFtFLR

([HUFtFLR

([HUFtFLR

([HUFtFLR

107
professor.geronimo@gmail.com
Leituras Rítmicas Tempos Inteiros Unidades 2, 4, 8 e 16

Formas de Leituras

1-Entoar o ritmo e marcar os tempos com os calcanhares e as subdivisões com as palmas

nas coxas.

2-Entoar o ritmo fazendo os movimentos do passo.

3-Entoar o ritmo com a marcação dos tempos, usando os movimentos de regência.

4-Bater com palmas o ritmo fazendo os movimentos do passo.

5-Marcar os tempos, entoar a (subdivisão) e bater com palmas o ritmo.

6-Marcar os tempos, bater com palmas a subdivisão e entoar o ritmo.

7-Bater o ritmo com a sensação física interior dos tempos

8- Improvisar melódicamente sobre os motivos rítmicos.

108
professor.geronimo@gmail.com
Padrões de Regência

Pratique os Vamos começar com um simples padrão de dois pulsos (ex. 1). O exemplo à esquerda (1a)
padrões de
regência enquanto
Mostra o padrão condutor em dois, enquanto o exemplo à direita (1b) é uma versão mais
escuta realista e fluente que provavelmente ocorrerá na prática. Certifique-se de que em ambos os
músicas de sua padrões os pulsos são colocados com precisão dentro do fluxo do padrão
preferência

Em breve, os
Padrões se
tornarão naturais

plano imaginário
execução mais realista
padrão em dois

Ao praticar, tente colocar os pulos consistentemente toda vez ao longo do padrão. Em todos os padrões,
há um plano imaginário onde todos os pulsos exceto o último são colocados. Observe o plano comum
para a localização dos pulsos 1 e 2 no padrão 3/4 (ex. 2). Enquanto o pulso 3 é clocado acima do plano
comum para os pulsos 1 e 2, caindo na mesma linha descendente do pulso 1. Observe também que os
pulos (1, 2 e 3) são todos alcançados através de um movimento descendente
Enquanto as subdivisões (+) são todas alcançados através de um movimento ascendente.

plano imaginário
execução mais realista
padrão em 3

O padrão para 4/4 é semelhante ao padrão três, exceto que o pulso 2 é colocado à esquerda do
pulso 1 (ex. 3).
Agora, os pulsos 1, 2 e 3 estão no plano imaginário e o pulso 4 é mais alto do que o pulso 1, mas na
mesma linha descendente . O compasso 4/4 é talvez a fórmula de compasso mais popular
E, portanto, também é anotado como "tempo comum" (C).

plano imaginário
execução mais realista
padrão em 4

109
professor.geronimo@gmail.com
Leituras Rítmicas-Unidade 2

        4
1

22  
      

          2

42                           23
2


         

32                    
3


         

                 
4



         

       
5

  
 
 
 
  
      
   42

         

42                      23


6


         

32           
7

 
 
  
 
 
   
   42

         

42                        
8


         

110
professor.geronimo@gmail.com
                       
9

 

        

           
10

                           


                  
11

 

         

          22
12

 
   
 
  
  
 
   
  
  
  
   
      

22            3


13

  2

         

32             42


14

  
 
 
 

         

42               


15

  

         

     
16

     
       

        

111
professor.geronimo@gmail.com
                 
17

  

         

                       2
18

 
                           

 2

22                  42
19


         

42                               23
20

  
       

32                       
21


         

                  
22

   
            

          

                   


23



         

     
24

     
      

         

112
professor.geronimo@gmail.com
                    
25



         

        4
26

      
     

         2

42                      


27


         

                
28

  
                 
      

                      


29

 

         

             
30

      
       

              

                        
31



         

                       2
32

 
      
         
      2

113
professor.geronimo@gmail.com
22                3
33


          2

32                     42
34


         

42                       2
35



        2

22            3


36

   
   
      2

32                  4


37



         2

42                      


38


         


         

114
professor.geronimo@gmail.com
Leituras Rítmicas -Unidade 4

39

24              4

         4
40

44                           43

         
41

34                    

         
42

                  

         

                 4
43

 

          4
44

44        


           3


         4

34                   4
45


          4

44                      
46


          

                       
47



         

                   
48

 

         
115
professor.geronimo@gmail.com
49

                    


         
50

                       2

        4
 
51

24              3

         4

34          


52

       4


 

       4

44                 
53



         
54

               

         
55

                    

         

                                   24
56


 
57

24                  44

         

44                               43
58


         

116
professor.geronimo@gmail.com
59

34                       

         
60

                      
     
          

            
61

                    

         

                          
62


 
                       
63

         

          

                              44


64


 

44                          
65


         
                       
66

                     

       

                                 
67


 
                      
68

 
                      


117
professor.geronimo@gmail.com
                        
69

         

          

                       2
70

 
     

             4

24                3
71

 

                 4
72

34                     44

         

44                      2


73


                      
4

24              3
74

   

            4
75

34                      4

         4

44                       


76


          
118
professor.geronimo@gmail.com
Leituras Rítmicas- Unidade 8

            4
77

28 
                    

 8

48                           38
78


         
79

38                    
      
   

        
  
    
    
 

                 
80

 
 
  
 
 
 


         

               4
81

           

      
   
  
     
8

48                   3
82


           8

               4
83
38           

   
        
  
     
8

48                      
84


            

119
professor.geronimo@gmail.com
                       
85

   
  
  
    
  

         

                   
86

          

   
     
      
  
   

                   
87

    
 
     


         

                  2
88

       
  

   
    
 
        
  
   
8

28            3
89

 

          
8
90

38                4
      
  

               
8
91

48         


  
        


           
92

                        

 

120
professor.geronimo@gmail.com
                 
93

  
 
  

         

                        2
94

 
                           

 8

28                
95


 
 
 
   48

         

48                             3
96

 
     
   

  
      
 
      
   
 
 8
97

38                       

     
     
   
  
98

                      


 

              
      

99

                    

         

                    


100


       
        

121
professor.geronimo@gmail.com
                 
101

  



    
  
  
  
 
  
    

               4
102

    
      

        
  
8

48                         
103


    
  
     
   
104

                        
         

       
           


105

      


   
   
   
     
  
   

                

                       
106

       
          
  
    

 
107

 
   
  
       
 
    
   
    
     
            

                          2
108

    

   
           8

122
professor.geronimo@gmail.com
109

28     



 

 

 
  
     
   
  38

         

                   4
110

38       
   

    
             
8

111

48                      2


   

      
 
       
      
    
8

28          


112


 
   
 
   
 
  38

         

113

38                     48
  


       
 
   
 

114

48                       
 


    
          
  


         

123
professor.geronimo@gmail.com
Leituras Rítmicas - Unidade 16
115

2  
 
 
 
 
 
 
 
 
 
 
 
 16   

                 
116

4  
 
 
  
 
  
  
 
  
 
  
 
  
 
 
 16   

                              
117

3  
  
 
 
 
 
  
 
 
  
 
 
 
 
 16   

                        
118

 
 
 
 
 
  
 
 
 
 
 
 
 
 
 
 
   

                       
119

 
 
 
   
 
 
 
 
 
 
 
 
   

                  
120

4              
 16  
 
  
  

      
  
  
 
   
 
   
121

3  
 
  
 
 
  
  
 
 
 
 
 16  

                   
122

4  
 
  
  
  
  
 
  
 
  
  
 
 16   

                        
124
professor.geronimo@gmail.com
                       
123

  
 
  
 
 
  

  
  
 
 
  
 
  
 
 
  
 
  
 
 
 

                   
124

  
 
 
 
  

  
 
    
 
   
 
 
  
 
 
   
125

                  
 
 
   
  

  
    
 
   
   
 
 
   

                 
126

      


  

  
 
   
  
   
 
  
 
 
   
127

2             
 16     
 
   
  
 
    
   
128

3               
 16  
 
  
 
  
  
      
 
    

               
129

4  
 16     
   
 
 
  
 
 
 
  
 
130

               
 
 
  

   
      
 
 
125
professor.geronimo@gmail.com
131

                    
 
 
    


  
 
  
 
   
 
 
 
 
 

 
                      
132

      
 
  
 

  
   
 
    
 
 
  
 
  
 
 
133

2            
 16   
  
   
     
     
    
  
  
134

4                 
 16  
 
  
  
  
  
 
  
 
 
  
  
  
   
 
  
135

3                 
 16  
 
   
 
 
  
  
 
   
 
 
  
  
 
  
 
 

              
136

   
 
 
  
  

  
   
 
   
 
 
  
  
 
  

              
137

 
  
    

   
 
   
 
 
      
 
  
138

           
   
    

   
    
   
 
     
126
professor.geronimo@gmail.com
139

          
      
   

             
         

       
140

    
    

     
          
   

             
141

4  
 16  
 
     
    
 
      
  
 
    

                
142

  
 
      

  
 

 
 
  
 
        
 
 
 

                 
143

 
 
  
 
  

   
   
 
  
 
   
  
   
    
144

              
  
  
 
   

  
         
  
  
  
 
      

                 
145


   
 
  
 
  
  
   
      
  


146

             
  
 
      

   
              
127
professor.geronimo@gmail.com
147

2              
 16   
  
  
    
 
  
     
 
  
  
148

3                
 16   
  

  
   
 
   
 
  
 
   
  
  

               
149

4  
 16   
  
 
 
    
  
 
   
 
  
    
    
150

2         
 16    
  
    
      
  
151

3           
 16    
     
  
    
  
       
152

4                
 16     
 

   
   
  
  
  
  


         


         
128
professor.geronimo@gmail.com
Leituras 1ª Subdivisão
Unidade 2
153

22 ∑ ««˙« ««˙« ««ˆ« ««ˆ« ««˙« ««˙« ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««˙« ««˙« ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««˙« ««˙« ««ˆ« ««ˆ« ««˙« Ó
======================
& l l l l l l l l =”

32 ∑ ««˙« ««ˆ« ««ˆ« ««˙« ««ˆ« ««ˆ« ««˙« ««ˆ« ««ˆ« ««˙« Ó ««ˆ« ««ˆ« ««ˆ« ««ˆ« w «««ˆ ««ˆ« ««˙« ««ˆ« ««ˆ« ««˙« Ó ««˙« ««ˆ« ««ˆ« ««˙« ««ˆ« ««ˆ« w.
154

======================
& l l l l l l l l =”
155

42 ∑ ««ˆ« ««ˆ« Ó ««˙« ««ˆ« ««ˆ« Ó ««˙« ««ˆ« ««ˆ« Ó ««˙« ««ˆ« ««ˆ« Ó ««˙« ««ˆ« ««ˆ« Ó ««˙« ««ˆ« ««ˆ« w ˆ««« ««ˆ« ««˙« ««ˆ« ««ˆ«w «««˙ ««ˆ« ««ˆ«w ˆ««« ««ˆ« ««˙« ««ˆ« ««ˆ«w
======================
& l l l l l l l l =”

22 ∑ Ó ««ˆ« ««ˆ« w «« Ó «« «« «« «« «« «« «« ««
156

˙ w Ó ˆ

======================
& l l l ˆ« ˆ« ˙« l l « ˆ« l w l ˆ« ˆ« ˙« =”
157

42 ∑ ««˙« ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««˙« w ˆ««« ««ˆ« ««ˆ« ««ˆ« w. «««ˆ ««ˆ« ««ˆ« ««ˆ« w. Ó ««˙« ««ˆ« ««ˆ« ««ˆ« ««ˆ« w. ˆ««« ««ˆ« ««ˆ« ««ˆ« w. ««ˆ« ««ˆ« ««ˆ« ««ˆ« w
======================
& l l l l l l l l =”

22 ∑ ««˙« ««ˆ« ««ˆ« ««ˆ« ««ˆ« Ó ««ˆ« ««ˆ« ««˙« ««˙« ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««˙« ««˙« ««˙« Ó w
158

l
======================
& l l l l l l l =”

32 ∑ Ó ««ˆ« ««ˆ« ««˙« ««˙« w «««ˆ ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««ˆ« w «««ˆ ««ˆ« ««ˆ« ««ˆ« ««˙« ««ˆ« ««ˆ« Ó ««ˆ« ««ˆ« Ó ««ˆ« ««ˆ« Ó ««ˆ« ««ˆ« w.
159

======================
& l l l l l l l l =”

22 ∑ ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««˙« ««ˆ« ««ˆ« ««˙« ««˙« ««˙« ««ˆ« ««ˆ« Ó Ó ««˙« ««˙« ««˙« ««ˆ« ««ˆ« ««ˆ« ««ˆ« Ó
160

l
======================
& l l l l l l l =”

129
professor.geronimo@gmail.com
Leituras 1ª Subdivisão
Unidade 4
161

24 ∑ ««ˆ« ««ˆ« ««ˆ« «««ˆ «««ˆ ««ˆ« ˆ««« ««ˆ« ««ˆ« ˆ««« «««ˆ ««ˆ« «««ˆ ««ˆ« ««ˆ« «««ˆ «««ˆ ««ˆ« ˆ««« ««ˆ« «««˙
======================
& l l l l l l l l =”

34 ∑ ««ˆ« ˆ««« ««ˆ« ˆ««« «««ˆ ««ˆˆ


«« «« «« «« Œ «« «« «« «« «« «« «« «« «« «« «« Œ «« «« «« «« «« «« ««
162

======================
& l l « « ˆ« ˆ« l ˆ« «ˆ ˆ« l ˆ« «ˆ «˙ l ˆ« ˆˆ« « ˆ« ˆ« l ˆ« ˆ« l «ˆ ˆˆ
« « ˆ« ˆ« l ˙« . =”

163

44 ∑ ˆ««« ««ˆ« Œ ««ˆ« ««ˆ« ««ˆ« Œ ««ˆ« ««ˆ« ««ˆ« Œ ««ˆ« «««ˆ ««ˆ« Œ ««ˆ« «««ˆ ««ˆ«Œ ««ˆ« ««ˆ« ««ˆ« ««˙« «««ˆ ««ˆˆ
« ««« ««ˆˆ˙
« ««« «« «« ««« ««ˆ˙
« ˆ
« ˆ « ««« «««ˆ ««ˆ« ««ˆ« ˆ««« ««ˆ« «««˙
l
======================
& l l l l l l l =”

24 ∑ Œ ˆ««« ««ˆ« ««˙« «« Œ «« «« «« «« «« «« «« «« «« ««


164

Œ
l l
======================
& l ˆ« l «ˆ ˆ« «ˆ l ˙« l «ˆ ˆ« l «˙ l ˆ« ˆ« ˆ«=”

165

44 ∑ ««ˆ« ««ˆ« ««ˆ« ««ˆ« ˆ««« «««ˆ ««˙« «««ˆ ««ˆˆˆ


« ««« ««« ««˙ ««« ««ˆ« ««ˆ« «««ˆ ˙«« Œ «« ««« ««ˆˆˆ
. ˆ . ˆ « ««« ««« ««˙ ««« ««ˆ« ««ˆˆ˙
. ˆ « ««« «« ««ˆ« «««ˆ ««ˆ« «««ˆ ««˙
======================
& l l l « l « l « ˆ l « l «. l «=”

24 ∑ ««ˆ« ˆ««« ««ˆ« ««ˆ« ˆ««« Œ ««ˆ« ««ˆ« ˆ««« ««ˆ« «««ˆ ««ˆ« ««ˆ« «««ˆ «««ˆ «««ˆ ˆ««« ««ˆ« ««ˆ« Œ ««˙«
166

======================
& l l l l l l l l =”

34 ∑ Œ ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««˙« ««ˆ« ««ˆ«««ˆˆˆ


««« ««« ««ˆ« ˙«« ««« ««ˆ« ««ˆ« ««ˆˆ««« ˆ««« ««ˆ« Œ ««ˆ« ««ˆ« Œ ˆ««« ««ˆ« Œ ««ˆ« ««ˆ« «««˙ .
167

l
======================
& l l « l « ˆ l « l l l =”

24 ∑ ««ˆ« «««ˆ «««ˆ «««ˆ «««ˆ «««ˆ ««ˆ« ˆ««« ««ˆ« ««ˆ« ««ˆ« ««ˆ« Œ Œ ««ˆ« ««ˆ« ««ˆ« «««ˆ ˆ««« ««ˆ« ˆ««« Œ
168

======================
& l l l l l l l l =”
130
professor.geronimo@gmail.com
Leituras 1ª Subdivisão
Unidade 8
169

28 ««j ««j ««ˆ« ˆ««« ««ˆ «« ««« ««ˆ« ««ˆ« ««ˆ« ««ˆ «« ««« ««ˆ« ««ˆ« ««ˆ« ««ˆ «« ««« ««ˆ« ««ˆ
& ˆ
« ˆ
«
=======================
l j ˆ« ˆ l
« l j j ˆ« ˆ l
« l j j ˆ« ˆ l « ”
« l j

38 ««j «« «« «« «« «« «« «« «« «« ‰ «« «« «« «« «« «« «« «« «« «« «« ‰ «« «« «« «« «« «« ««
170

& ˆ« ˆ« «ˆ ˆj « l ˆ« «ˆ j
======================= «ˆ ˆ« ˆ« l ˆj
« ˆ« «ˆ l ˆˆ
« « «ˆ l ˆ« ˆ« j
«ˆ ˆ« ˆ« l j
«ˆ j
ˆ« l ˆ« ˆˆ
«j
« ˆ« ˆ« l ˆ« . ”

171

48 «««ˆ ««ˆ« ‰ ««jˆ


ˆ
«
««« ««ˆ« ‰ ««ˆ ««« ««ˆ«‰ ««ˆ ««« ««ˆ« ‰ ««ˆ ««« ««ˆ«‰ ««ˆ ««« ««ˆ« ˆ«« ««« ««ˆˆ

« jˆ
« j
« ˆ jˆ
« « ˆ « ««j
«
««ˆˆˆ
« ««««« «« «««««ˆˆ
« ˆ
j
« ˆ « ««« ˆ«««««ˆ« ««j
ˆ
«
««« ««ˆˆ
ˆ « «««
=======================
& l l l l l l l ”

28 ‰ ˆ««« ««ˆ« ««ˆ« «« ‰ «« «« «« «« «« «« «« «« «« ««


172


l l j
=======================
& ˆ« l ˆ« ˆ« j
«ˆ l ˆ« l ˆ« ˆ« l «ˆ l ˆ« ˆ« ˆj« ”

48 ««jˆ««« ««ˆ«««ˆˆˆ
««« «« ««ˆ ««« ««ˆ« «««ˆ ««ˆ« ««ˆ ««« ««ˆ« ««ˆˆˆ
««« «« ‰ «« ««« ««ˆˆ««« ««ˆ« ««ˆ «««««ˆ« ««ˆˆˆ
««« «« ««« ««ˆ« ˆ««« ««ˆ« ««ˆ
173

ˆ
« «
=======================
& j
« l « ˆ l « . ˆ l « « . l ˆ

« « l « . ˆ «
l «. l ˆ « ”

28 ««j «« «« «« «« ‰ «« «« «« «« «« «« «« «« «« «« «« «« «« ‰ ««
174

ˆ« «ˆ ˆ« l ˆ« ˆ« l ˆ« ˆ« j
=======================
& ˆ« l j
ˆ« ˆ« ˆ« l ˆ« ˆ« ˆ« ˆ« l j
«ˆ ˆj ˆ«
« l j l ˆ« ”

38 ‰ ««ˆ« ««ˆ« ««j ««j ««ˆ« ««ˆˆ««« ««ˆ« «««ˆ ««ˆˆ««« ««ˆ ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««ˆ ««ˆ« «««ˆ ‰ ««ˆ« «««ˆ ‰ ««ˆˆ««« ‰ ««ˆ« ««ˆ« ««ˆ
175

ˆ
« l
=======================
& ˆ
« l « « l « l j
« l l « l «. ”

28 «««ˆ ««ˆ« ««ˆ« ««ˆ« ««j «« «« «« «« «« «« «« ‰ ‰ «« «« «« «« «« «« «« ‰


176

=======================
& l ˆ« ˆ« ˆ« l j
«ˆ j ˆ« ˆ« ˆ« l
ˆ« l j ˆ« j
l j ˆ« ˆ« ˆ« l ˆ« ˆ« ”
ˆ« l j
131
professor.geronimo@gmail.com
Leituras 1ª Subdivisão
Unidade 16
177

2 ««k «
« ««« ««« «« «« ««« ««« ««« ««« «« «« ««« ««« ««« ««« «« «« ««« ««« ««

& 16 l ˆ« k «ˆ l ˆ« ˆ« ˆk
====================== «ˆ ˆ« ˆ« l ˆ« ˆ« k
« l k «ˆ l k
«ˆ ˆ« ˆ« l ˆ« «ˆ ˆk «ˆ ˆ« ˆ« l j
« l k ˆ« =”

«« ««« ««« «« ««« ««« «« ««« ««« «« ««« ««« ««« ««« «« ««« ««« «« ««« ««« «« «« ««« ««« «« ««« ««« ««
178
3 ˆ« ˆ ˆ« k ˆ« l ˆ« «ˆ k«
«ˆ ˆ ˆ« l ˆk≈
« ˆ« ˆ« l ˆ« «ˆ j «ˆ l ˆ« ˆ« ˆk«
« ˆ ˆ« l k≈
ˆ« k
ˆ« l ˆ« ˆ« k«
«ˆ ˆ ˆ« l j.ˆ« =”
& 16 k«
======================

4 ««« ««« «« ««« ««« «« ««« ««« «« ««« ««« «« ««« ««« «« ««« ««« «« ««« ««« «« ««« ««« «« «« ««« ««« «« ««« ««« «« ««« ««« ««
179

& 16 «ˆ ˆ≈ˆ« kˆ
« « ˆ« l ≈ˆkˆ
====================== « « ˆ« ≈ l kˆ
ˆ« « ˆ≈ˆ« k« l «ˆ ˆ≈ˆ
« kˆ
« « ˆ« l jˆˆ« « ˆˆ «k « l ˆˆˆ
« « jˆ «k « l ˆ« ˆˆ
« jˆ
« « ˆ«l ˆk « «ˆ ˆ« j ˆ«=”

««« ««« «« «« ««« ««« «« «« ««« ««« «« ««« ««« ««


180
2
& 16 ≈ ˆ« ˆ« l j ˆ« l k
====================== ˆ« ≈ l ˆ« «ˆ k ˆ« l j
«ˆ l ≈ ˆ« ˆ« l j ˆ« l ˆ« «ˆ k «ˆ =”

««« ««« ««« ««« «« «« ««« ««« ««« ««« «« ««« ««« ««« ««« «« «« ««« ««« ««« ««« «« ««« ««« ««« ««« «« ««« ««« ««« ««« ««
181

4 ««kˆ
& 16 ˆ« « ˆˆ « « ˆˆ
====================== «k ˆ« ˆ« ˆ« ˆ« ˆ« l j.ˆ« ˆ« ˆ« l ˆ« ˆ« j.«ˆ l ≈ˆkˆ
«l j « « ˆˆ
« « ˆ« l j.ˆ« ˆ« ˆ« l ˆ« ˆˆ« j.« l «ˆ ˆ« ˆ« ˆ« j «ˆ=”

«« ««« ««« ««« ««« ««« ««« «« «« ««« ««« ««« ««« ««« ««« «« «« «« ««
182

2 ˆ« ˆ« ˆ« l ˆ« ˆ« ≈ l ˆ« «ˆ k
ˆ« l k
ˆ« «ˆ ˆ« l ˆ« ˆ« «ˆ ˆ« l k
«ˆ k
ˆ« l ˆk
« ≈ l ˆj
& 16 k
====================== « =”

««« ««« «« «« «« ««« ««« ««« ««« ««« ««« «« ««« ««« ««« ««« «« ««« ««« ««« ««« ««« ««« ««« ««« ««
183

3
& 16 ≈ ˆ« ˆ« k ˆ« l kˆ
====================== « l ˆ« «ˆ ˆ« ˆ«
«ˆ j « ˆ ˆ« l j «ˆ ˆ« ˆ« l ˆ« ˆ« ˆk«
« ˆ ˆ« l ≈ ˆ« «ˆ ≈ l ˆ« «ˆ ≈ ˆˆ
« « l k.«ˆ =”

««« ««« ««« ««« «« ««« ««« «« «« «« ««« ««« «« «« «« ««« ««« ««« «««
184

2
& 16 ˆ« ˆ« «ˆ ˆ« l k
====================== «ˆ ˆ« ˆ« l k
«ˆ k
ˆ« l k
ˆ« ˆ« ˆ« l ≈ ≈ l kˆ« k ˆ« ˆ« ˆ« l ˆ« ˆ« =
«ˆ l k ≈”
132
professor.geronimo@gmail.com
Leituras de Notas Clave de Sol

####
1

======================
& ___ ___w __w ___w l ___ ___ ___w __w l __w __w _w __w =l
w w w
####
__w __w __w _w l _w w w w l w w w w =l l
======================
&
2

& b __ __ __ __ l__ __ __w __w l_w __w __ __w l_w _w _w w l_w w w w=l l
======================
_
w w _w _w _w w w
bbb b
3

b
& b _ _ _ _ l _ _ _ _ l _ _ _ _ =l
======================
_w _w _w _w __w __w __w __w __w __w __w _w

b bbb b
& b _
======================
_w __w _w _w l w w w _w l_w __w __w ___w l __w __w ___w __w =l l
bbb
4

b
__w __w __w __w l_w __w _w _w l_w _w __w __w l___w ___ ___w __w l__w _w _w __w=l l
======================
&
w
bb
5

======================
& _w _w _w _w l_w _w w _w l w _w _w _w l_w _w _w w l_w _w w _w lw _w _w _w=l l
6

& _w w w w l w w _w _w l w w w w l w _w _w w l w w _w _w=l l
======================

##
7

& w w w w l w w w w l w w w w l w w w w l w w w w lw w w w=l l
======================
Leituras de Notas Clave de Sol

133
professor.geronimo@gmail.com
bb
8

b w w w w l w w w w l w w w w l w w w w l w w w w=l l
======================
&

#### #
9

# w w w w w w w w w w w www wwww wwww


w w
======================
& l l l l l =l l

# w w lw w w w lw w w w lw w w w lw w w w l l
10

w w
======================
& =

### w w w w w w w w w w w w w w w
11

w w w w w
l l
======================
& l l =l l

b w ww w w ww w w ww w w ww w w ww w ww w w wwww
12

b
======================
& l l l l l l =l l

w www wwww wwww wwww wwww www w ww ww www w


13

l l l
======================
& l l l l =l l

## w w w w _w _w w w w w w w w w w w w w w w w w w w _w _w w w w w w
14

l
======================
& l l l l l l =l l
Leituras de Notas Clave de Sol

134
professor.geronimo@gmail.com
#### w w w _w _w _w w w w w w w w w w w w _w _w _w w w w
15

======================
& l l l l l =l l

w w _w _w w _w w w _w _w _w _w __w __w _w _w w _w w w
16

&b
======================
l l l l =l l

_w _w _w _w _w _w _w
# w _w _w _w _w _ _ _ _ _w _w _w _w _w _ _ _ _w _w _w _w w _w _w
17

l
======================
& l l l l =l l

_
w w _w _w w _w _w __w __w __w ___w __w __w __w __w ___w ___w __w __w _w _w _w w _w
_
bbb
18

b l l l l l
======================
& =l l

_
w w
_ _
w _
w w
_ _
w
_ _
w
_ w __w _w _w w _w w
_
_
19
w w w w
w _w _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _w w w w
&b
======================
l l l l l =l l

w _
w w w _
w w
_ w
_ ___w ___w ___w __w ___w
bb b w w w w w w w w w w _
w _ _ _ _
w _ _ _ _
20

l
======================
& l l l l =l l

bb b b w w w w w w w w w w w w w w w w w w w w w w w w
21

& b l
====================== l l l l =”
Leituras de Notas Clave de Sol

135
professor.geronimo@gmail.com
####
22

======================
& ___ ___w ___ _w l __w ___ ___w __w l __w _w _w __w =l
w w w
####
======================
& __w _w __w ___w l ___ _w __w ___w l ___ ___w __w ___ =l l
w w w
23

& b __ __w __ __w l _w __w _w __ l __w __ __ __ l __ __ __w __=l


======================
_w w _w w _w w w w _w

& b __w _w _w __w l _w __w _w __w l __ __ _


====================== _ =l l
_ _
w w _w _w
#
24

======================
& __ _w w w l _w w _w __w l __ __w _w _w l _w __ _w w=l
w w w
#
======================
& w _w _w w l _w __w _w _w l __ _w __w __ =l l
w w
###
25

& __w _w w _w l _w _w __w _w l _w w _w w l w _w _w __w =l l


======================
26

b b
======================
& _w _w w w l w w _w w l_w _w _w _w l w w w w l_w _w _w _w=l l
136
Leituras de Notas Clave de Sol
professor.geronimo@gmail.com
27

& _w w w w l_w w w w l w w w w l w w w w l_w _w w w l_w w w w=l l


======================

##
28

& w w w w l w w w w l w w w w l w w w w l w w w w=l l
======================
29

bb
& w w w w l w w w w l w w w w l w w w w l w w w w=l l
b
======================
30

b w w w w w w w w w w w w w w w
w
======================
& l l l =l l

bbb b w w w w w w
31

b w w wwww wwww wwww


& b w
======================
l w l w w l l l =l l

bbb w w w w w w w w w w w w w w w w w w w w w w w w w w w w
32

b
======================
& l l l l l l =l l

bb w w w w w w w w w w w w _w w _w _w w w w w w w w w
33

======================
& l l l l l =l l

w w w w _ w w w __w w
ww w w ww wwww wwww ww www
34

l l l
======================
& l l l =l l
137
Leituras de Notas Clave de Sol
professor.geronimo@gmail.com
## w w w w w
35

w w w w w w w w w w w w
======================
& l l l l w w w=l l
w _
w w ___w ___w __w __w _w __w _w w __w _w _w _w w w
# w _
w _ _ _ w _
w _
36

## # w w w w w ww
======================
& l l l l l l =l l
w w w w w ___w _w ___w _w _w
#### w w w w _ _ w w ww _ _ _ w w wwww
37

======================
& l l l l l =l l

#### w w w w _w _w w w w w w _w w w w w w _w w w
38

======================
& l l l l =l l

bb b b w w w w w w w w w w w _w w w _w w w w w w
39

& b
======================
l l l l =l l

w w w w w w w w w w w w w w w w w w w w
40

======================
& l l l l =l l

#### w w w w w w w w w w www
41

w w w w w w w w w w w w w w
& # l w w w lw
====================== l w l l l l =l l
42

### w wwww wwww wwww wwww ww


& w w w l l
====================== l l l w w lw w w w=l l
138
Leituras de Notas Clave de Sol
professor.geronimo@gmail.com
# www wwww w ww ww w w
43

w l w lw w w lw w =
& w l w w w lw
======================
l w w ll

ww www
44

b w w w w w w w w w w w w www
& w w w _lw w
======================l l l w l w _lw =l l

bb w w w w w w w w w w
45

b
======================
& l l w w l w w w w l w _w w w lw _w w w=l l
46

b bbb w www w
b w w w w w
======================
& w w
l wwl wwl w w w l w l w w w lw __w __w =
w w ll
47

w w w w w w w
w _w l w w
======================
& _w w l l w _w w l__ _w __ _w=l l
w w
48

b bww w w wwww wwww w www


& w
======================
w lw _w l l lw w w w l w w w w l =l l
49

b bbb w w w
======================
& __w _w w w l w _w l __w _w _w l w w w _w l_w __w _w __w=l l

#
50

======================
& _ _w _ _ l_ _ _w _ l_w _ _ _ l_w w _w _w l_w w _w w _lw _ _ _=l l
_w _w _w _w _w _w _w _w _w _w _w _w
139
Leituras de Notas Clave de Sol
professor.geronimo@gmail.com
51

& b __ __ __ __w l__w __ __w __ l__ __ __w __w l_w _w __w _w l__w __ __w __=l l
======================
_w _w w _w w w _w w _w

bb
52

b
& __ __ _w __ l __w _w __ __ l __ __w _w __ l __ __ _w __=l
======================
_w w w w _w w w _w _w w

b bb
======================
& _w __ __ __ l __ __w _w __ l __ __ __ __w l _w __ __ __ =l l
w _w _w w w _w _w w w _w _w
53

& b __ __w _w _w l_w w _w w l_w __w __w _w l_w _w w _w l w _w __ __=l


======================
_w _w w

& b __w _
======================
_w __w ___w l __w __w ___w ___w l __w __w __w __w l ___w __w ___w ___w =l l
54

& _w w w w l w w w w l w _w w w l _w _w _w _w=l
======================

w w w w w w
======================
& w w l l w w _w _w =”
140
Leituras de Notas Clave de Sol
professor.geronimo@gmail.com
55

& __w _w _w _w l__w __w _w _w l_w w w w l_w w w w l w w w w lw w w w=l l


======================

##
56

& _w _w _w __w l_w _w w w l w w _w w l w w w w l w w w w=l l


======================

####
57

w
& _w _w w _w l_w __w _w __w l_w __w _w _w _lw w w w lw w w lw w _w _w _lw _w _w _=
====================== w ll
58

& b w w _w w l w w w w l w w w _w l_w __w _w _w l w w w w=l l


======================

#
59

& w w w w l w w w w l w w w w l w w w w l w w w w lw w w w=l l
======================

60

b bbb
w w w w l w w w w l w w w w l w w w w l w w w w=l l
======================
&

61

b
& w w w w lw w w w lw w w w lw w w w lw w w w lw w w w=l l
b
======================
141
Leituras de Notas Clave de Sol
professor.geronimo@gmail.com
62

w w w w w w w w w w w w w w w w w w w w
======================
& l l l l =l l

63

b bbb w w w w w w w w w w w w w w w w w w w w w w w w
& b
======================
l l l l l =l l

bb b w w w w w w w w w w w w w w w w w w w w
64

======================
& l l l l =l l

w w w w w w w _w w w w w w w w w w w w
65
w
&b
======================
l l l l =l l

bb b w w w w w w w w w w w w w w w w w w w w w w w w w w w w
66

======================
& l l l l l l =l l

bbb w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w
67

b
& b
======================
l l l l l l l =l l

68

w w ww wwww wwww wwww wwww wwww wwww www


======================
& l l l l l l l =l l
142
Leituras de Notas Clave de Sol
professor.geronimo@gmail.com
69

b b www w www w w www www


w w w
======================
& l l w w l w w w l l =l l

###
70

w w w w w w w w w w w w w w w w w w w
& w
======================
l l l l =l l

#
71

& w w w w l w w w w l w w w w l w w w w l w w w w lw w w w=l l
======================

72

b w w w w w w wwww
& w w w w l_w w w w l w
====================== w w lw w w l l =l l

73

b bb w w www wwww
w w w w w l w
======================
& _w w w l w w l l lw w _w _w=l l

74

## w wwww
====================== w
& _w __w __ __w _lw _w w w _lw w w l w w w
w l w w w l =l l
w
75

======================
& __w __w _w _w l_w _w __w __w l_w __w _w _w l_w _w _w _w l_w __w _w _w _lw _w _w __w=”
143
Leituras de Notas Clave de Sol
professor.geronimo@gmail.com
Leituras de Notas Clave de Fá

108

b
? b __ __w _w __w l __ __w __ __ l __w __w _w _w l __w _w _
====================== _ =l l
w w w w _
w _
w
109

======================
? __w __w _w _w l _w _w _w _w l _w _w __w _w l _w _w _w _w=l

======================
? _w _w __w __w l _w _w _w _w l _w __w _w _w =l l

##
110

? _w _w _w _w _lw _w _w w _lw _w _w _w lw w w w lw w w _w _lw _w _w _w=l l


======================

####
111

_w w w w l w w w w l w w w w l w _w w _w =l l
======================
?

? b w w w w l w w w w l w w w w l w w w w l w w w w lw w w w=l l
112

======================

# ww w w
? w w w w l w lw w w w lw w w w lw w w w lw w w w lw w w wl w w=
113

====================== w ll

b w w w w w w w w
? b bb w w w w l
114

====================== l =l l

# w w w w l w w w w ll
115

? w w w w l
====================== =
144
Leituras de Notas Clave de Fá
professor.geronimo@gmail.com
### w w w w w w w w w w w w
116

? w
======================
l l l w w w l w w w w=l l

#### w w w w w w w w w w w w w w w w w w w w
117

? # l
======================l l l =l l

w w w w wwww wwww wwww wwww wwww wwww


118

======================
? l l l l l l =l l

bb b b w w w w w w w w w w w w w w w w w w w w
119

l
======================
? b l l l =l l

w w w _w w w w w w w w w _w w w w w
bb w w w
120

b l
======================
? l l l =l l
w w
#### # w w w w w w w _w _ _w _w w w w w w _w _w _ _w w w w w
121

? #
======================
l l l l l =l l

w w _
w w
_ w
_ __w _w _w w w _w w w
122
bbb b w w w w w w w
b l
======================
? b l l l =l l

w w w w w w _w _w _w _w __w _w __w __w _w _w w _w w w w w w w


bbb
123

b l
======================
? l l l l =l l
w _
w w w _
w w
_ ___w __w __w _w _w
_
w _
w _ _ _ _
w _ _ _
bb w w w w
124 w w
======================
? l l l l =”
145
Leituras de Notas Clave de Fá
professor.geronimo@gmail.com
125

======================
? __w _w w __w l__w w _w __w l w w _w w l__w _w _w _w l__w w __w __w=l

w w w w w w w w w w w w w w w w w w w w
======================
? l l l l =l l

bb b b w w w w w w w w w w w w w w w w
126

l
======================
? b l l =l l

w w w w w w w w w w w w
bb b w w w w
127

l
======================
? l l =l l

w w _w w w w w _w w w w w w _w w w w _w w w
128

?b l l
====================== l l =l l

w w _w _w w w w w w w w _w _w w w w w w
_
# w
129

======================
? l l l l =l l

w w _
w _
w w _
w w __w __w _w _w _w _w w __w _w __w _w _w w w w w w
_
###
130

l
======================
? l l l l =l l

w w __w _w _w _w w _w _w w _w _w w __w __w __w _w _w _w _w _w w w w


_
####
131

? # l
====================== l l l l =l l
146
Leituras de Notas Clave de Fá
professor.geronimo@gmail.com
_w __w ___w __w __w __w _w _w _w ___w ___w __w _w ___w ___w __w
132

======================
? l l l =l

_w ___w __w ___w __w _w _w __w __w ___w __w _w _w __w _w _w


======================
? l l l =l l

w __w _w __w __w _w _w _w _w _w __w __w __w __w _w _w w _w _w w


b
133

b l
======================
? l l l =l l

_
w __w _w w w __w _w __w _w _w w w
w
bb b b w w w
134
w w w w
l
======================
? l l l =l l

w w
_ w
_ __w __w _w _w __w __w _w _w w _w _w
# w w
135

l
======================
? l l =l

# w w w w w w w _w w w w w w w w w
======================
? l l l =l l

w _
w _
w w
_ _
w __w _w _w _w
136
w w w w w w w
b l l
======================
? l =l l

__w w _w _w w w w w w w
#### w w wwww wwww wwww
137

l
======================
? l l l l =l l
147
Leituras de Notas Clave de Fá
professor.geronimo@gmail.com
w _w w w w _w w w
_
138

w
## w w w w w w w w www wwww
======================
? l l l l l =l l

w w _w w w w w _w w w w w w w w w w _w w _w
w w w w lw w w w
139

l
======================
? l l l l =l l

b wwww wwww wwww wwww wwww wwww wwww


140

? b
======================
l l l l l l =l l

bb b b w ww w w w w w w w w w w w w w w w
141

l
======================
? l l l _w w lw w w w lw w w w _lw w w =
w ll

b w w lw w w w lw w w w lw w w w lw w w w lw w w w lw w l l
? b bbbb w w
142

====================== ww=

w w _w w w _w w _w w w w w w _w w _w w w _w w
143

?b l
======================l l l =l l

w
bb b w w w w w w w w w w w w w w w w w w w w w w w w w w w
144

l
======================
? l l l l l =l l

bb b b w w w w w w w w w w w w w w w w w w w w w w w w w w w
145

l
======================
? b l l l wl l =l l
148
Leituras de Notas Clave de Fá
professor.geronimo@gmail.com
w w w w w _w _w w w w _w
w
w w www w w w www ww w
146

? w
======================
l l l l l l w =l l

b w w w w w w w w w w w w w w w w
147

b l
======================
? l l =l l

b w w w w w w w w w w w w w w w w w w
148

? b bb w w
======================
l l l l =l l

bbb b w w w w w w w w w w w w w w w w w w w w w
149

b
? b w wl l w l
====================== l l lw w w =
w ll

150

? b w w w w l w w w w l w w w w l w w w w l w w w w lw w w w=l l
======================

bb
151

? _w w _w w l w w w w l w w w _w =l l
b
======================

##
152

? _w w _w _w l __w _w _w w l w w w w =l
======================

##
? w w w _w l _w _w w w l w w w w l _w w _w _w =l l
======================
149
Leituras de Notas Clave de Fá
professor.geronimo@gmail.com
153

? __w _w w _w l w w w w l_w w w _w l w w __w _w l w _w _w w=l l


======================

####
154

? # __ _w __w __w __l w _w _w _lw w w w lw w w w lw w w w lw w w w=l l


======================
w w

####
155

======================
? _w w w _w l_w _w __w __w l__w __w ___w ___ l__w w w w l_w w w _w=l l
w
##
156

? _w _w _w _w __lw __ __ _w lw _w _w w lw w w w _lw _w __ w _lw _w _w _w=l l


======================
w _w _w

####
157

_w _w w _w l w _w _w _w l__w __w _w __w l_w _w _w __w l__w _w __w _w=l l


======================
?

158

? b w __w w _w l_w _w w w l w __w w w l w w w w l w w w _w lw __w _w w=l l


======================

# w w w w l w w w w l w w w l w w w lw w w l l
158

? _w w w w l
====================== _w w _w =

### w www w
160

w
? _w w w l l w w w lw w _w _w lw w w w lw w w w lw w w w wl w w =
====================== w”
150
Leituras de Notas Clave de Fá
professor.geronimo@gmail.com
Semitons Diatônicos e Cromáticos

Observe que alguns sons ocupam o mesmo espaço porém com nomes
diferentes.
Sons iguais - Nomes diferentes.
Vamos poder praticar e perceber mais, cantando e tocando em nossos
instrumentos.
Vamos também construir escalas.
E praticar em atividades

151
professor.geronimo@gmail.com
&RPSOHWHRPRYLPHQWRDVFHQGHQWHGRVVRQVPXVLFDLVSRUVHPLWRQVXVDQGRRVXVWHQLGR 
dó
si

sol

fá
mi

&RPSOHWHRPRYLPHQWRGHVFHQGHQWHGRVVRQVPXVLFDLVSRUVHPLWRQVXVDQGRREHPRO E
dó
si

sol

fá
mi

152
professor.geronimo@gmail.com
5HVXPRGRV6RQV$VFHQGHQWHVH'HVFHQGHQWHVXVDQGRR6XVWHQLGR  HREHPRO E 
si#dó
si/dób
lá#/sib

sol#/láb
sol
fá#/solb
mi#/fá
mi/fáb
ré#/mib

dó#/réb

si/dób

2EVHUYHTXHDOJXQVVRQVRFXSDPRPHVPRHVSDoRSRUpPFRPQRPHVGLIHUHQWHV
6RQVLJXDLV1RPHVGLIHUHQWHV
9DPRVSRGHUSUDWLFDUHSHUFHEHUPDLVFDQWDQGRHWRFDQGRHPQRVVRVLQVWUXPHQWRV
9DPRVWDPEpPFRQVWUXLUHVFDODV
(SUDWLFDUHPDWLYLGDGHV
2EVHUYHRH[HPSORDVHJXLUHSUDWLTXHEDVWDQWHQDVDWLYLGDGHVGHWRQVHVHPLWRQV

153
professor.geronimo@gmail.com
0RYLPHQWRVDVFHQGHQWHVHGHVFHQGHQWHVSRUVHPLWRQV([HPSORFRPSDXWDPXVLFDO

si#dó
si/dób
lá#/sib

sol#/láb
sol
fá#/solb
mi#/fá
mi/fáb
ré#/mib

dó#/réb

si/dób
i/dób

154
professor.geronimo@gmail.com
Complete como no exemplo com uma nota um semitom diatônico acima.

& w w lw l #w l #w
2 3 4 5 6 7 8

l #w
=======================
l# _w l #w l #w =l

& #w lw lw l bw
9 10 11 12 13 14 15 16

lw l _w lw
======================= l bw =l

Complete como no exemplo com uma nota um tom acima.

lw lw lw
17 18 19 20 21 22 23 24

lw
=======================
& _w w l w lw l #w =l

l #w l #w l bw l bw
25 26 27 28 29 30 31 32

=======================
& # _w l #w l bw l
bw =l

& bw l b _w l bw l
33 34 35 36 37 38 39 40

=======================
l l l l =”

155
professor.geronimo@gmail.com
Complete como no exemplo com uma nota um semitom diatônico acima.

w w w #w #w #w #w #w
? l l l #w
=======================
l 2
l l 3
l =l 4 5 6 7 8

#w w w w bw
w bw
?
9
l l l lw
=======================
l
10
l l 11
=l 12 13 14 15 16

Complete como no exemplo com uma nota um tom acima.

w w w w #w
w w w w
=======================
?
17
l l l l 18
l l l19
=l 20 21 22 23 24

#w #w bw bw
#w bw
? #w
=======================
25
l l l l
26
l l27
l bw =l 28 29 30 31 32

bw bw
? l bw
=======================
l l l l l l =”
33 34 35 36 37 38 39 40

156
professor.geronimo@gmail.com
Solfejos com sílabas tonais

• Determine a sílaba tonal inicial e, em seguida visualize se encontra padrões tonais e rítmicos.
• Estabeleça a tonalidade, cante o arpejo de tônica.
• Se necessário, faça a transposição do exercício para um tom que forneça uma tessitura confortável
• Defina um andamento adequado, toque algumas batidas preparatórias e, em seguida cante o exercício do começo ao
fim, sem quebrar o ritmo.
• Após a leitura inicial, isolar os compassos problemáticos e praticá-los mais lentamente.
• Certifique-se de que cada nota é mantida para a sua duração total. Cante o exercício novamente.
• Após ter cantado o exercício com precisão, repetir o exercício em um andamento mais rápido.
e, em seguida, cantando com uma sílaba neutra. Todos os exercícios devem ser cantados a cappella.
• Não escreva as sílabas tonais ou de ritmo na pauta musical.
• Sílabas Tonais e ritmicas nunca devem ser escritas e lidas como símbolos.
• Lembre-se de praticar suas habilidades de ditado.

157
professor.geronimo@gmail.com
 com Sílabas Tonais

1                                  
                               

2                  

               

3                           
                         

4 
                         
                       

5                
             

6
                       
                     

7                               
                             

8            
          

9                 

         

10
                      
                  

158
professor.geronimo@gmail.com
 com Sílabas Tonais

11
                          
       

         

12
                             
       

              

13                           
       
 
       

14
                        

      

     
      

15
                          
      
   
       

16
                   
        


           

17
                           

       

        

18
                    
 
       
      

19                   
 


            

159
professor.geronimo@gmail.com
 com Sílabas Tonais

20                          
                           

21
                           
                         

22
                 
               

23                         
                    

24                     
                  

25
                  
               

26
                           
               

27                     
                   

28
                       

                    

29
                              
                           

160
professor.geronimo@gmail.com
 com Sílabas Tonais

1
                                  
                               

2                  

               

3                           
                         

4                         
               
       

5                
     

      

6                       
             

      

7                               
   

 
                 
    

8            
   

   



9                 
   

    

10                      
     



         

161
professor.geronimo@gmail.com
 com Sílabas Tonais

11                          
                   

12                             
                        

13                           
                   

14                        
                       

15
                            
                    

16                               
                       

17                           
     
             

18                    
                  

19                   
                 

162
professor.geronimo@gmail.com
 com Sílabas Tonais

20                       


                           

21                           
                         

22                 
               

23                         
                    

24                     
                  

25                  
               

26                           
               

27                     
                   

28                       

     
              

29                              
                           

163
professor.geronimo@gmail.com
Leituras melódicas - Modo Maior
(Associação Simbólica)

## 4
1

4 «
« «
« «
« «
« ««ˆ« ««ˆ «« ««ˆ «« « « « «« « «« «« «« «« «« «« « « «« « «« «« «« «« « « « «
ˆ« ˆ« ˆ« ˆ« l « ˆ« « l ˆ« «ˆ« «ˆ« «ˆ« l ˆ« «ˆ« ˆ« ˆ« l ˆ« ˆ« ˆ« ˆ« l «ˆ« «ˆ« ˆ« «ˆ« l ˆ« ˆ« ˆ« ˆ« l «ˆ« «ˆ« «ˆ«=
======================
&
(dó)
«ˆ« l l

## 3 «« ««ˆ« «« «« «« «« «« «« «« ««ˆ« ««˙« «« ««ˆ« «« ««


«
2

& 4 «
======================
˙« ˆ« l ˆ« ˆ« l ˙« ˆ« l ˙« . l ˙« ˆ« l l ˆ« ˆ« l ˙« . =l l
(dó)

## 4 « « «« «« «« «« «« «« « «« «« «« «« «« «« «« « « «« «« «« «« «« «
« «
3
4 « «
«ˆ« «ˆ« ˆ« ˆ« l ˙« ˆ« ˆ« l ˙« ˆ« ˆ« l «ˆ« ˆ« ˆ« ˆ« l ˆ« ˆ« ˆ« ˆ« l «ˆ« «ˆ« ˙« l ˆ« ˆ« ˙« l ˙« «˙«=l l
======================
&
(dó)

## « « « «« «« ««˙« «« «« « « « « «
« « « « « « « « « « « « « «
4

& «˙« «˙« l «ˆ« «ˆ« «˙« l «ˆ« «ˆ« ˆ« «ˆ« l «ˆ« «ˆ« «˙« l ˙« ˙« l ˆ« ˆ« l ˆ« ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« «˙«=l l
======================
(dó)

## 3 « « « « «
« «« «« «« « «« «« « «
«
5
«
& 4 «˙« «ˆ« l ˙« . «
l «ˆ« ˆ« ˆ« l
====================== ˙
« . l ˙« «
ˆ« l ˙« . l ˆ« ˆ« «ˆ« l «˙« . =l l
(dó)

## 4 « « « «
« «
« « « « « « « « «« «« «« « « « «
« « «
& 4 «˙« «ˆ« «ˆ« l «˙« «˙« l ˙« ˆ« «ˆ« l «˙« «˙« l «ˆ« «ˆ« «ˆ« ˆ« l ˙« ˙« l ˆ« «ˆ« «ˆ« «ˆ« l «˙« ««˙«=l l
6

======================
(dó)

## « « «« «« «« «« «« «« « « « « « « « « « « « « ««ˆ« «« « «
« « ˆ
« ˆ
« ˆ
« « « « « « « « « « «
& «ˆ« «ˆ« ˆ« ˆ« l ˆ« l ˆ« ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« «˙« l «ˆ« ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« ˆ« ˆ« l ˆ« ˆ« ˆ« l «ˆ« «ˆ« ««˙«=l l
7

======================
(dó)

## 2 « «« ««˙« ««ˆ« «« « «« «« ««˙«


«
& 4 «˙« « « « ˙
«
8

l «˙« l ˆ« ˆ« l
====================== l ˆ« l ˆ« ˆ« l l =l l
(dó)

## Œ Œ « « Œ «
« «« «« Œ Œ «« « Œ «
« l «ˆ« l «ˆ« l ˆ« ˆ« l ˆ« l ˆ« l «ˆ« l «ˆ« ««ˆ«=l l
9

«ˆ«
======================
&
(dó)

## 3 «« q q q q q q q Œ q h q «« q q
« « q l h Œ=”
10
4 «
˙« ˆ« l l
======================
& l l «
l q ˆ« ˆ« l
(dó)

164
professor.geronimo@gmail.com
## 3 « « «
11

« « Œ « « «
« «
« ««ˆ« Œ ««ˆ «« « « « Œ « « « Œ
« l ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« l «ˆ« «« «ˆ« l «« =
& 4 «ˆ« «ˆ« ˆ« l «ˆ« «ˆ« l «ˆ« ˆ« ˆ« l
======================
(dó)
ˆ« ˆ« ««ˆ« l l

## « « « « ««˙« Œ ««ˆ «« « «« « « Œ « « « « Œ « « «
12

c « « « « « « « «
«ˆ« «ˆ« «ˆ« ˆ« l ˆ« «ˆ« ˆ« ˆ« l « l ˆ« «ˆ« ˆ« «ˆ« l «˙« «ˆ« l «ˆ« «« «ˆ« «« l «˙« «ˆ« l «ˆ« «ˆ« ««=l l
======================
& ˆ« ˆ« ˙«
(dó)

## 4
13
« « « « « « ««ˆ« Œ «« Œ «« ««ˆ «« « «« « « Œ «
« Œ « Œ « Œ Œ « «
& 4 «ˆ« «ˆ« ˆ« l «ˆ« «ˆ« l «ˆ« ˆ« ˆ« l ˆ« l ˆ« « ˙« l «ˆ« ˆ« «˙« l «ˆ« «ˆ« ««ˆ« l w =l l
======================
(dó)

## «« «« « « « « « «« «« «« «« « « « « «« «« « « « « « «
14

& ˆ« ˆ« «ˆ« «ˆ« l «˙« «˙« l «ˆ« ˆ« ˆ« ˆ« l ˙« «˙« l «ˆ« «ˆ« «ˆ« ˆ« l ˙« «˙« l «ˆ« «ˆ« «ˆ« «ˆ« l «˙« ««˙«=l l
======================
(sol)

## « Œ « « Œ « « Œ «« «« «« Œ « « «« Œ «« «« « Œ « « Œ «
15

& «ˆ« «ˆ« ««ˆ« l «ˆ« «˙« l «ˆ« ˆ« ˆ« l ˆ« «˙« l «ˆ« ˆ« ˆ« l ˆ« «ˆ« «ˆ« l «ˆ« ««ˆ« «ˆ« l ««˙« ««˙«=l l
======================
(mi)

## « « Œ « « « « ««ˆ« ««ˆ Œ ««ˆ «« «« Œ « « « Œ « « « Œ «


16

« « « « Œ « « « Œ «
& ˆ« ˆ« «ˆ« l «ˆ« «ˆ« «ˆ« l ˆ« ˆ« ˆ« l « « l ˆ« ˆ« «ˆ« l «ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« «ˆ« l ««ˆ« ««ˆ« ««˙«=l l
======================
(mi)

## «« « « « «
17
« « « ««˙« ««ˆ «« Œ « « Œ « «« Œ « «
˙
« Œ « « Œ «
======================
& « Œ « «
ˆ« l ˆ« ˆ« «ˆ« l «˙« «ˆ« l ˆ« ˆ« l « ˆ« «ˆ« l «˙« «ˆ« l ˙« «ˆ« l «ˆ« ««ˆ« ««˙«=l l
(sol)

## 3 « «« «« «« « « « « « «« «« «« « « « «
18

& 4 «˙« ˆ« l ˙« ˆ« l «ˆ« «ˆ« ««ˆ« l «˙« «ˆ« l «ˆ« ˆ« ˆ« l ˙« «ˆ« l «ˆ« ««ˆ« «ˆ« l «ˆ« ««˙« =l l
======================
(mi)

## « «« «« «« «« «« « « « « « « « « « «
19

& «˙« ˆ« l ˙« ˆ« l ˙« ˆ« l «˙« «ˆ« l «ˆ« ««ˆ« «ˆ« l «˙« «ˆ« l «ˆ« «ˆ« «ˆ« l «ˆ« ««˙« =”
======================
(mi)

165
professor.geronimo@gmail.com
#### 3 « « « «« «« «« Œ «« « Œ «« «« « « Œ «
20

« Œ « Œ œ
» Œ œ
» ˙
»
4 ˆ« «ˆ« l ˆ« ˆ« l »» »» l »» ˆ« l ˆ« ˆ« l «ˆ« ˆ« l ˙« «ˆ« l «ˆ« =
======================
& «ˆ« l
(mi)

#### « « « «« «« «« Œ «« « Œ « « Œ « « Œ
« Œ « Œ
======================
& œ
» Œ œ
» ˙
»
ˆ« «ˆ« l ˆ« ˆ« l »» »» l »» ˆ« l ˆ« ˆ« l «ˆ« «ˆ« l «ˆ« «ˆ« l «˙« =l l

#### 2 « « « « « ««ˆ« œ» ««ˆ Œ «« Œ


21

« « « « Œ « Œ «
4 ˙« l ˆ« «ˆ« l ˆ«
======================
& l ˆ«
(mi)
l ˙« l »» l « l ˆ« =l
#### « « «« ««ˆ« Œ ««ˆ« Œ «« «« «« « Œ « Œ
« « «
ˆ« «ˆ« l ˆ« ˆ« l
======================
& l l ˙« l ˆ« ˆ« l «ˆ« l «ˆ« =l l
#### c « « «« «« ˙» ˙» ˙» ˙» «« «« « «« «« ˙» ˙» œ» «« «« «
22

«ˆ« «ˆ« ˆ« ˆ« l »» »» l »» »» l ˆ« ˆ« «ˆ« ˆ« l ˙« »» l »» »» ˆ« l ˙« «˙« l w =l l


======================
& (dó)

23
#### « « «« «« «« «« «« œ» œ» œ» ˙» «« «« « « «« œ ˙ œ» œ «« « « «
«˙« «ˆ« ˆ« l ˆ« ˆ« ˙« l ˆ« »» »» »» l »» ˆ« ˆ« l «˙« «˙« l ˆ« »»» »»» l »» »»» ˆ« «ˆ« l «˙« «˙«=l l
======================
& (dó)

# «« «« ««ˆ« «« «« «« «« ««ˆ« ««˙« ˙»» ˙»» ˙»» œ»» ««ˆ« ««˙« ««ˆ« ««ˆ« ««˙« ««
24

? ˙« ˆ« l ˙« ˆ« ˆ« l ˆ«
======================
(dó)
l» » l» » l l ˙« l w =l l
#### 4 « « « « « «« «« «« «« œ» «« ˙» œ» «« «« « « «
25

4 «˙« «ˆ« «ˆ« l ««˙« «ˆ« «ˆ« l ˆ« ˆ« ˙« l ˆ« »» ˙« l »» »» ˆ« l ˆ« «ˆ« «˙« l «ˆ« ««ˆ« ««˙« l ««˙« ««˙«=l l
======================
&
__»˙» _»œ» _œ» œ» œ
(dó)

œ ˙ œ
» _
œ
» œ
» œ œ
» _œ
» œ
»
_
»
26
# 43 »˙»» »œ»» œ»»» »œ»» »» »» »» » »» »» »» » » »» » »» »» »»» »˙»» .
» » » » »
l
======================
? (dó)
l l l l l l =l l
#### 4 « « « « « « « « «« «« « «« «« œ» œ» ˙» œ»» œ»» ˙»» ˙»»
27

4 «˙« «ˆ« «ˆ« l «˙« ««ˆ« «ˆ« l «˙« «ˆ« «ˆ« l ˆ« œ»»» ˙« l «˙« ˆ« ˆ« l ˙»»» »» »» l »» » » l » » =l l
======================
&
(dó)

166
professor.geronimo@gmail.com
#### 3 « « « « « «« «« « «« «« «« ˙» Œ œ» œ» œ» œ»» ˙»»
« « « « «
4 «ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« «ˆ« l ˙« ˆ« l ˆ« ˆ« «ˆ« l ˆ« ˆ« ˆ« l »» l »» »» »» l » » =l l
28

======================
& (dó)

29
# ˙»»» œ»»» œ»»» Œ œ»»» œ»» œ»» œ»» œ»» Œ œ»» ««ˆ« ««ˆ« «« ««ˆ« Œ «« «« «« « ««
? (dó)
l
====================== l» » » l» » l ˆ« l ˆ« l ˆ« ˆ« «ˆ« l ˙« . =l l

#### 4 « « « « « « « « ««˙« ˙» œ» œ» ««ˆ «« « « «


« « « Œ « «
4 «ˆ« «ˆ« ˆ« «ˆ« l «ˆ« _«««ˆ _«« l _««ˆ _«« _««ˆ «ˆ« l «˙« «ˆ« l ˆ« ˆ« l »» »» »» l « ˆ« «˙« l «ˆ« ««ˆ« «˙«=l l
30

======================
& (dó) «˙ « «ˆ «
31
# ˙»»» œ»» œ»»» ˙»»» œ»»» œ»» ˙»» œ» œ»» ˙» Œ ««ˆ« «« ««ˆ« œ» œ»» ˙» ««ˆ« «« «« « « « «
» l
======================
? (dó)
» l » »» » l »» l ˆ« »» » l »» ˆ« l ˙« «ˆ« «ˆ« l « «˙«=l l
_«˙
#### c œ»» œ»»» œ»» œ»» œ» œ» ˙» œ» «« «« « « «« «« «« «« « «
» » » l »» »» »» l »» ˆ« ˆ« «ˆ« l «ˆ« ˆ« ˙« l ˆ« ˆ« «ˆ« «ˆ« l ««ˆ« «« «« l «« « «« «« l «« ««˙«=l l
32

======================
& (dó) ˆ« ˙« _«ˆ _««ˆ _«ˆ ˆ« ˙«
#### 3 « « « « « « « « « « «« .
4 « « « « « « « «
33
« «
======================
& « «
˙« ˆ« l ˆ« ˆ« l ˙« ˆ
« « ˆ
« l ˙
« ˆ
« ˆ
« « « « « « «
l ˆ« ˆ« l _««˙ _««ˆ l _««˙ ˆ« l ˙« =l ?l
(dó)

# ˙»»» œ»»» œ»»» œ»»» œ»»» ˙»»» œ»»» ˙»»» . ˙»» œ»»» œ»» œ»» »œ œ» »œ œ»» ˙»» .
l» l » » »» l »» »» » l » =l &l
34

l
======================
? (mi)
l l
#### 4 œ»» œ»» ˙»» ˙» œ» œ» ˙» . œ» w «« «« «« «« « « « «
» »
4 » » » l » » »» l »» »» l l ˆ« ˆ« ˙« l ˙« «ˆ« «ˆ« l «˙« . ««ˆ l w =l ?l
35

======================
& (dó)

# « «« «« ««ˆ« ˙» ˙» œ» œ»» œ»» œ»»» ˙»»» Ó œ»»» œ»»» œ»» œ»» ˙» ˙» œ» ««ˆ« «« «« « Œ
36

? «ˆ« ˆ« ˆ« l »» »» l »» » » l
======================
(dó)
l » » l »» »» l »» ˆ« ˆ« l «˙« . =l l

# 43 «« «« «« «« «« «« ««ˆ «« «« «« «« «« « « «« «« «« «« «« «« «« «« «« «
37

ˆ« ˆ« ˆ« l ˆ« ˆ« ˆ« l « ˆ« ˆ« l ˆ« ˆ« ˆ« l «ˆ« «ˆ« ˆ« l ˆ« ˆ« ˆ« l ˆ« ˆ« ˆ« l ˆ« ˆ« =
======================
? (dó)
«ˆ« ”
167
professor.geronimo@gmail.com
bb b b 44 ««˙ ««˙« ««˙« ««˙« ««˙« ««˙« «« ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««ˆ« «« «« ««˙« ««˙« ««˙« ««
38

«
======================
? l l lw l ˆ« l ˆ« ˆ« l l ˙«=? ll
(dó)

bb b b c ««ˆ «« ««˙« ««ˆ« ««ˆ« ««˙« «« «« ««ˆ« «« ««ˆ« ««ˆ« ««˙« ««˙« ««ˆ« ««ˆ« ««ˆ« «« ««ˆ« ««ˆ« ««˙« ««ˆ« ««ˆ« ««
39

« ˆ« l
======================
? (dó)
l ˙« ˙« l ˆ« l l ˆ« l l ˙«=l l
40
bb b b 43 ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««˙« ««ˆ« ««˙« ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««˙« ««ˆ« ««˙« ««ˆ« ««˙« ««ˆ«
======================
? (dó)
l l l l l l l =l l
41
bb b b 24 ««˙« «« «« œ» ˙» œ
» œ
» «« œ» ˙» ˙»»
l ˙
«
======================
? ˆ
«
l » l» »
» »
» » ˆ
«
l » l » l» »
» l » =l l
(dó)

bb b b 44 ««ˆ« ««ˆ« ««˙« œ»» ««ˆ« ««ˆ« «« ««˙« Œ ««ˆ« ««ˆ« œ»» ˙»» œ»» ««ˆ« ««ˆ« «« ««˙« Œ ««ˆ« ««˙« ««ˆ« «« «« ««
42

======================
? (dó)
l» ˆ« l l » » l» ˆ« l l ˆ« l ˙« ˙«=l l

bb b b 43 ««˙« ««ˆ« ««˙« ««ˆ« ««ˆ« ««ˆ« ««ˆ« ˙»» ««ˆ« ˙»» œ»»» œ»» ««ˆ« ««ˆ« ««˙« ««ˆ« ««˙« .
43

======================
? l
(dó)
l l» l» l» l l =l l

bb b b 44 ««˙« ««ˆ« ««ˆ« ˙»» ««˙« ««˙« ««ˆ« œ»» ˙»»» ˙»» ««˙« œ»» ««ˆ« ««˙« ««ˆ« ««ˆ« ««˙ ««ˆ« ««ˆ« ««˙« ««
44

======================
? (dó)
l» l » l » l » l l« l ˙«=l &l

b ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««ˆ« œ»» œ»» Œ ˙»» œ»» ««ˆ« œ»» ««ˆ« ««ˆ« Œ ««˙« ««ˆ« ««ˆ« ««ˆ« œ»» œ»» Œ œ»» œ»» ««ˆ« ««ˆ« ««ˆ« ««ˆ« ««
45

======================
& (dó)
l » » l» » l» l l » » l» » l ˙«=l l

«« ««ˆ« ««ˆ« œ»» œ»» œ»» œ»» œ»» œ»» ««ˆ« ««ˆ« «« «« «« ««˙« ««ˆ« ««ˆ« ««ˆ« «« ««ˆ« ««ˆ« ««ˆ« œ»» ««ˆ« œ»» œ»» œ»» ««ˆ« ««ˆ« ««
46
b
& ˆ« » l » » » » l »
======================
(dó)
ˆ« l ˆ« ˆ« l ˆ« l » l » » » l ˙«=l l

««ˆ« ««ˆ« ««ˆ« ««ˆ« ««ˆ« œ»» œ»» œ»» œ»» ««ˆ« œ»» ««ˆ« ««ˆ« ««ˆ« ««˙« œ»» ««ˆ« ««ˆ« «« ««ˆ« ««ˆ« ««ˆ« œ»» œ»» œ»» œ»» ««ˆ« ««˙« ««
47
b
======================
& (dó)
l » » » l» » l l» ˆ« l » l » » » l ˙«=”
168
professor.geronimo@gmail.com
48
# c « «« œ» œ» œ» œ» «« « « «« «« «« «« «« «« «« «« œ» œ» œ»» œ»» œ» œ» œ» «« ««
« œ
» » » œ
» « « œ
» œ
» œ
»
ˆ« ˆ« »» »» l » » »» »» l ˆ« ˆ« ˆ« ˆ« l »» ˆ« ˆ« »» l »» ˆ« ˆ« ˆ« l ˆ« ˆ« »» »» l » » »» »» l »» ˆ« ˙«=
======================
& (dó)

49
# « «« œ» ˙» ˙» «« «« «« «« «« «« «« ˙» «« œ» œ» œ»» ˙» œ» «« ««
« œ
» » ˙
»
& ˆ« ˆ« »» »» l » »» l »» ˙« l ˙« ˆ« ˆ« l ˙« ˆ« ˆ« l »» ˆ« »» l »» » »» l »» ˆ« ˙«=l l
======================
(dó)

50
# «« «« ˙» ˙» «« ˙» «« œ» ˙» œ» œ» ˙»» ˙»» œ» œ» «« œ» «« ««
˙
& ˙« « l »» »» l ˙« »» l w
====================== l ˆ« »» »» l »» »» » l » »» »» l ˆ« »» ˆ«=ˆ« l l
(dó)

# «« «« ˙» «« œ» ˙» ˙»» Œ œ»» ˙» œ» «« «« ˙ œ œ» œ» œ» ˙ Œ «« œ» «« ««
» l »» »» ˆ« l ˙« »»» l »»» »» »» »» l »»»
51

& ˆ« ˆ« »» l ˆ« »» »» l »
====================== ˆ« l »» ˆ« ˙«=l
(dó)

52
bb ««ˆ« ««ˆ« ««˙« œ»» œ»» ««˙« œ»» œ»» œ»»» œ»»» ˙»»» œ»»» œ»» ˙»» œ»»» œ»»» œ»»» œ»» ˙»» ««ˆ« ««ˆ« ˙»» ««˙« ««˙«
======================
? (dó)
l» » l» » l » l» l » » l » l =l l

bb 44 ««ˆ« ««ˆ« œ»» œ»»» œ»»» œ»»» ˙»»» œ»»» œ»»» ˙»»» w œ»» œ»» œ»» œ»» œ» œ» ««˙« œ» œ» ««˙« w
53

» l
======================
? l l l » » » » l »» »» l »» »» l =l &l
œ
» _»œ» ˙»» ˙»»
(dó)

# « «« «« « « « «« œ
» œ
» ˙
» œ
» œ
» ˙
» œ
»
» œ
»
» ˙
»
» »
» » » »
« ˆ
« ˆ
« « « « ˙
« œ
» œ
» » » » ˙
» » » » » » »
54
˙
« ˙
« ˆ
« »
======================
& » » »
l ˆ« l » » l » » l » » » l » l l =l l
(dó)

55
# «« «« œ» ˙» œ» œ»» œ»» œ»» ˙» ˙»» Œ œ»» œ»»» œ»»» ˙»»» œ»»» œ»» œ»» œ» ˙»» Œ œ» œ» «« ««
& ˙« ˆ« »» l »» »» » l » » »» l »
======================
(dó)
» l l » » »» l » »» l »» ˆ« ˙«=l ?l

bb ««˙« ««ˆ« œ»» œ»» œ»» ˙»»» œ»» œ»» ««ˆ« ««ˆ« «« «« «« « « «« «« ««˙« ««ˆ« œ»» ««ˆ« ««ˆ« «« «« ««˙«
56

» l» »
======================
? (dó)
l» » l ˆ« ˆ« ˙« l «˙« «˙« l ˆ« ˆ« l » l ˆ« ˆ« =l l

bb 43 ««ˆ« ««ˆ« ««ˆ« ««˙« ««ˆ« ««˙« ««ˆ« œ»» œ»»» œ»» ««ˆ« ««ˆ« ««ˆ« ««˙« ««ˆ« «« «« «« ««ˆ« ««˙«
57

======================
? (dó)
l l l» » l l l ˆ« ˆ« ˆ« l =
169
professor.geronimo@gmail.com
#4 «« « « œ
» œ
» œ
» œ
»
» _»œ» ˙»» ˙»»
« « « « « « « œ
» ˙
» ˙
»
» œ
»
» » œ
»
» œ
» ˙
» œ
» œ
»
» » »
» » » » »
58

& 4 ˆ
« « « « « « « « ˆ
« ˆ
« »
ˆ« ˆ« «ˆ« l ˙« «ˆ« ˆ« l ˆ« » l »
====================== » » l » » » » » » »
» l» » l » l =l ? l
(dó)

bb c ««˙« ««ˆ« ««ˆ« «« ««ˆ« «« «« « «« «« ««˙« ««˙« ««ˆ« œ»» ˙»» ˙»» œ»» œ»»» ˙»»» ˙»»» ˙»»»
59

======================
? (dó)
l ˙« ˆ« l ˙« «˙« l ˆ« ˆ« l » l» » l» l =l &l
# 4 « « « « «« œ» «« œ» œ» ˙»» œ» œ» ˙» œ»» œ»» ˙»» œ»»» _»œ»» w
& 4 «˙« «ˆ« ««ˆ« l «˙« «ˆ« ˆ« l œ»»» »» œ»»» ˆ« l ˙»»» »» »» l » »» »» l »» » » l »
60

======================
(dó)
l =l l

======================
& l l l l l l l =l

======================
& l l l l l l l =l

======================
& l l l l l l l =l

l l l l l l l =l
======================
&

======================
& l l l l l l l =l

======================
& l l l l l l l =l

======================
& l l l170 l l l =”
professor.geronimo@gmail.com
Leituras melódicas - modo menor
I II bIII IV V bVI bVII VIII (Associação Simbólica)
lá si dó ré mi fá sol lá

b 44 « « « « «« «« « «« « « « « « « « «« «« « «« « « « « « « «« «« « « « « «
1

«ˆ« «ˆ« «ˆ« «ˆ« l ˆ« ˆ« «ˆ« ˆ« l «ˆ« «ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« «ˆ« ˆ« l ˆ« «ˆ« ˆ« «ˆ« l «ˆ« «ˆ« «ˆ« «ˆ« l «ˆ« ˆ« ˆ« «ˆ« l «ˆ« «ˆ« «ˆ«=
======================
& «ˆ« l l
(lá)

2
b 3 « «« «« «« « «« « « «« «« ««ˆ« ««˙« «« ««ˆ« «« ««
4 « ˆ
« «
======================
& « «
˙« ˆ« l ˆ« ˆ« l ˙« ˆ« l ˙« . l ˙« ˆ« l l ˆ« ˆ« l ˙« . =l l
(lá)

b 44 « « «« «« «« «« «« «« «« «« « «« «« «« «« «« « « « « « «« « « « «
«ˆ« «ˆ« ˆ« ˆ« l ˙« ˆ« ˆ« l ˙« ˆ« ˆ« l «ˆ« ˆ« ˆ« ˆ« l ˆ« ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« «˙« l ˆ« «ˆ« «˙« l «˙« «˙«=l l
3

======================
& (lá)

b « « « « « « « « « « « «« «« ««˙« «« «« « « « « «
4

« « « « « «
& «˙« «˙« l «ˆ« «ˆ« «˙« l «ˆ« «ˆ« ˆ« «ˆ« l «ˆ« «ˆ« «˙« l ˙« ˙« l ˆ« ˆ« l ˆ« ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« «˙«=l l
4

======================
(lá)

34 « «« «« « «« «« «« « «« «« « «
5

b « «
« « ˙
« . ˙
« «
l «ˆ« ˆ« ˆ« l ˆ« l ˙« . l ˆ« ˆ« «ˆ« l «˙« . =l l
5

«˙« ˆ« l ˙« .
======================
& l
(lá)

b 44 « « «« «« «« ««˙« ««ˆ« «« «« «« «« «« «« ««ˆ ««˙« ««˙« «« «« « «« « «


ˆ« l ˙« ˙« l ˆ« ˆ« ˆ« « l l ˆ« ˆ« «ˆ« ˆ« l «˙« «˙«=l l
6

«˙« «ˆ« ˆ« l ˙« ˙« l
======================
& (lá)

b « « «
« «
« ««ˆ« ««ˆ «« ««ˆ «« « « « « « « « « « «
« « «
« ««ˆ« «« « «
« « « « « « « « « «
& «ˆ« «ˆ« ˆ« ˆ« l ˆ« l ˆ« ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« «˙« l «ˆ« ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« ˆ« ˆ« l ˆ« ˆ« ˆ« l «ˆ« «ˆ« ««˙«=l l
7

======================
(lá)

24 « « «« ««˙« ««ˆ« «« « «« «« ««˙«


8

b « « « ˙
«
l «˙« l ˆ« ˆ« l l ˆ« l ˆ« ˆ« l
8
«˙«
======================
& l =l l
(lá)

« «« «« Œ Œ «« « Œ «
9

b « Œ Œ « « Œ «
l «ˆ« l «ˆ« l ˆ« ˆ« l ˆ« l ˆ« l «ˆ« l «ˆ« ««ˆ«=l l
9

& «ˆ«
======================
(lá)

b 34 « «« «« ««ˆ« «« ««ˆ« ««ˆ« ««ˆ« ««ˆ« Œ ««ˆ« ««˙ «« « « « «« «« « « Œ


10

& «˙« ˆ« l ˆ« ˆ« l
====================== (lá)
l l « ˆ« l «ˆ« «ˆ« «ˆ« l ˆ« ˆ« «ˆ« l «˙« =”
171
Leituras melódicas (menor natural)
professor.geronimo@gmail.com
I II bIII IV V bVI bVII VIII
lá si dó ré mi fá sol lá

b 34 « « «« « Œ « « «« «« ««ˆ« Œ ««ˆ« «« «« « «« Œ «« « « « « Œ «
«ˆ« «ˆ« ˆ« l «ˆ« «ˆ« l «ˆ« ˆ« ˆ« l l ˆ« ˆ« «ˆ« l ˆ« ˆ« l «ˆ« «ˆ« «ˆ« l «ˆ« =
11

======================
& «ˆ« l l
(lá)

b c « « « «
« «
« « «
« «
« ««˙« Œ ««ˆ «« « «« « « Œ « « « « Œ « « «
«ˆ« «ˆ« «ˆ« ˆ« l ˆ« «ˆ« ˆ« ˆ« l « l ˆ« «ˆ« ˆ« «ˆ« l «˙« «ˆ« l «ˆ« «« «ˆ« «« l «˙« «ˆ« l «ˆ« «ˆ« ««=l l
12

======================
& (lá)
ˆ« ˆ« ˙«

b 44 « Œ « «« « Œ « Œ « Œ «« «« ««ˆ« Œ «« Œ «« ««ˆ« «« «« «« «« «« Œ « «
«ˆ« «ˆ« ˆ« l «ˆ« «ˆ« l «ˆ« ˆ« ˆ« l ˆ« l ˆ« ˙« l ˆ« ˆ« ˙« l ˆ« «ˆ« «ˆ« l w =l l
13

======================
&
(lá)

b ««ˆ« «« « « « « « «« «« «« «« « « « « «« «« «« « «« « « «
ˆ« «ˆ« «ˆ« l «˙« «˙« l «ˆ« ˆ« ˆ« ˆ« l ˙« «˙« l «ˆ« «ˆ« «ˆ« ˆ« l ˙« ˙« l «ˆ« ˆ« «ˆ« «ˆ« l «˙« ««˙«=l l
14

======================
& (mi)

b «« Œ «« « «« Œ «« «« Œ ««ˆ« ««ˆ« ««ˆ« Œ «« «« ««ˆ« Œ ««ˆ« ««ˆ« «« Œ «« «« « Œ «« « «


& ˆ« ˆ« «ˆ« l ˆ« ˙« l ˆ« ˙« l ˆ« l ˆ« ˆ« l ˆ« «ˆ« ˆ« l «˙« «˙«=l l
15

======================
(dó)
l

b «« «« Œ «« « « Œ «« «« «« Œ ««ˆ« ««ˆ« ««ˆ« Œ ««ˆ« ««ˆ« ««ˆ« Œ «« «« «« Œ «« «« «« Œ «« « « «


& ˆ« ˆ« ˆ« l «ˆ« «ˆ« ˆ« l ˆ« ˆ« l ˆ« l ˆ« ˆ« ˆ« l ˆ« ˆ« ˆ« l «ˆ« «ˆ« «˙«=l l
16

======================
(dó)
l

b ««˙« Œ «« « Œ « « Œ « « «« «« «« «« Œ « « Œ « «« Œ « «
ˆ« l «ˆ« «ˆ« «ˆ« l ««˙« «ˆ« l «ˆ« ˆ« ˙« l ˆ« ˆ« «ˆ« l «˙« «ˆ« l ˙« «ˆ« l «ˆ« ««ˆ« ««˙«=l l
17

======================
& (mi)

18
b 34 «« ««ˆ« ««˙« ««ˆ« «« «« « «« «« «« ««ˆ« ««ˆ« ««˙« «« «« « «« «« «
˙« l
======================
& l ˆ« ˆ« «ˆ« l ˙« ˆ« l ˆ«
(dó)
l ˆ« l ˆ« «ˆ« ˆ« l ˆ« «˙« =l l

b
19
«« ««ˆ« ««˙« ««ˆ« ««˙« ««ˆ« «« «« «« « «« «« «« «« «« «« «« «
& ˙« l l
======================
(dó)
l ˙« ˆ« l ˆ« «ˆ« ˆ« l ˙« ˆ« l ˆ« ˆ« ˆ« l ˆ« «˙« =”
172
Leituras melódicas (menor natural)
professor.geronimo@gmail.com
I II bIII IV V bVI bVII VIII
lá si dó ré mi fá sol lá

# 3 « « « «« ««ˆ« ««ˆ Œ «« « Œ «« «« « « Œ «
« Œ « « Œ ˆ
« œ
» Œ œ
» ˙
»
& 4 ˆ« ˆ« l ˆ« l »» »» l »» l « ˆ« l «ˆ« ˆ« l ˙« «ˆ« l «ˆ« =
«ˆ« l
20

======================(dó)

# « « « «« ««ˆ« ««ˆ Œ «« « Œ « « Œ « « Œ
« Œ « « Œ ˆ
« œ
» Œ œ
» ˙
»
& ˆ« ˆ« l ˆ« l »» »» l »»
====================== l « ˆ« l «ˆ« «ˆ« l «ˆ« «ˆ« l «˙« =l l
# 2 «« « « « Œ « Œ «
« «« œ» «« Œ «« Œ
& 4 ˙« l «ˆ« «ˆ« l «ˆ« l «ˆ« l ˙« l ˆ« »» l ˆ« l ˆ« =l l
21

====================== (dó)

# « « « « «« «« Œ «« ««ˆ« «« « Œ « Œ
« « « «
ˆ
« ˆ
« Œ ˆ
« ˙
«
& ˆ« ˆ« l ˆ«
======================
l l l l ˆ« l «ˆ« l «ˆ« =l l
# c « « «« «« ˙» ˙» ˙» ˙» «« «« « «« «« ˙» ˙» œ» «« «« «
«ˆ« «ˆ« ˆ« ˆ« l »» »» l »» »» l ˆ« ˆ« «ˆ« ˆ« l ˙« »» l »» »» ˆ« l ˙« «˙« l w =l l
22

======================
& (lá)

# « « «« «« «« «« «« œ» œ» œ» ˙» «« «« « « «« œ ˙ œ» œ «« « «
& «˙« «ˆ« ˆ« l ˆ« ˆ« ˙« l ˆ« »» »» »» l »» ˆ« ˆ« l «˙« «˙« l ˆ« »»» »»» l »» »»» ˆ« «ˆ« l «˙« ««˙«=l l
23

======================
(lá)

bb «« ««ˆ« ««ˆ« ««˙« «« «« ««ˆ« ««ˆ« ««˙« ˙»» ˙»» ˙»»» œ»» ««ˆ« ««˙« ««ˆ« ««ˆ« ««˙« ««˙
l « l w =l l
24

? ˙« l ˆ« ˆ« l
======================
(lá)
l» » l » l
# 4 « « « « « «« «« «« «« œ» «« ˙» œ» «« «« « « « « « ««
4 « «
ˆ
« « «
« « «
ˆ
« ˆ
« ˆ
« ˙
« ˆ
« » ˙
« » » ˆ
« ˆ
« «
ˆ
« «
˙
« «
ˆ
« « « «
«
25

˙« ˆ« l ˙« ˆ« l
======================
& l » l» » l l ˆ« ˙« l ˙« ˙«=l l

» _
œ
» œ
»
_ __˙»» _»œ» _»œ œ» œ
(lá)

œ ˙ œ
» œ
» œ œ
» »
26
bb 43 ˙»»» œ»»» œ»»» œ»»» »»» »»» »» »» »» »»» »» »» » »» » »» »» »»» »˙»» .
l
======================
? l l l l l l =l l
(lá)

#4 « « « « « «
« «
« « «
« «
« œ
» œ
» ˙
» œ
»
» œ»» ˙»» ˙»»
« « « « « œ
» « ˙
& 4 «˙« «ˆ« «ˆ« l «˙« ««ˆ« «ˆ« l «˙« ˆ« ˆ« l ˆ« »» ˙« l ˙« ˆ« ˆ« l »» »» » l » » » l » » =l l
» » »
27

======================
(lá)
173
Leituras melódicas (menor natural)
professor.geronimo@gmail.com
I II bIII IV V bVI bVII VIII
lá si dó ré mi fá sol lá

#3 « « « « « «« «« « «« «« «« ˙» Œ œ» œ» œ» œ»» ˙»»
28

« « « « «
& 4 «ˆ« «ˆ« «ˆ« l «ˆ« «ˆ« «ˆ« l ˙« ˆ« l ˆ« ˆ« «ˆ« l ˆ« ˆ« ˆ« l »»
====================== l »» »» »» l » » =l ?l
(lá)

bb ˙»»» œ»»» œ»»» Œ œ»»» œ»» œ»» œ»» œ»» Œ œ»» ««ˆ« ««ˆ« «« ««ˆ« Œ «« «« «« « ««
29

======================
? l(lá)
l» » » l» » l ˆ« l ˆ« l ˆ« ˆ« «ˆ« l ˙« . =l &l

#4 «««« « « « « ««˙« ˙» œ» œ» ««ˆ «« « « «


Œ «
30
« « « «
& 4 «ˆ« «ˆ« ˆ« «ˆ« l «ˆ« _«««ˆ _«««˙ l _«««ˆ _«««ˆ _«««ˆ «ˆ« l «˙« «ˆ« l ˆ« ˆ« l »» »» »» l « ˆ« «˙« l «ˆ« ««ˆ« «˙«=l l
======================
(lá)

bb ˙»»» œ»»» œ»»» ˙»»» œ»»» œ»»» ˙»» œ»» œ»» ˙»» Œ ««ˆ« ««ˆ« ««ˆ« œ»» œ»» ˙»» ««ˆ« ««ˆ« «« «« « «« ««
31

======================
? (lá)
l l» » » l» l » » l» l ˙« ˆ« «ˆ« l ˙« ˙«=l l
# c œ»» œ»»» œ»» œ»» œ» œ» ˙» œ» «« «« « « «« «« «« «« « «
» » » l »» »» »» l »» ˆ« ˆ« «ˆ« l «ˆ« ˆ« ˙« l ˆ« ˆ« «ˆ« «ˆ« l ««ˆ« «« «« l «« « «« «« l «« ««˙«=l l
32

======================
& ˆ« ˙« _«ˆ _««ˆ _«ˆ ˆ« ˙«
(lá)

#3 « « « « « « ««˙« ««ˆ «« « « «« .
« « « «
33
4 « « «
======================
& «
˙« ˆ« l ˆ« ˆ« l ˙«ˆ
« « ˆ
« l « ˆ
« « « « « « «
l ˆ« ˆ« l _««˙ _««ˆ l _««˙ ˆ« l ˙« =l ?l
(lá)

˙ œ œ œ .
bb »»» »»» »»» œ»»» œ»»» ˙»»» »»» ˙»»» ˙»» œ»»» œ»» œ»» »œ œ» »œ œ»» ˙»» .
l» l » » »» l »» »» » l » =l &l
34

l
======================
? (dó)
l l
# 4 œ»» œ»» ˙»» ˙» œ» œ» ˙» . œ» w «« «« «« «« « « « «
» »
& 4 » » » l » » »» l »» »» l l ˆ« ˆ« ˙« l ˙« «ˆ« «ˆ« l «˙« . ˆ«« l w =l ?l
35

======================
(lá)

bb «« «« ««ˆ« ««ˆ« ˙»» ˙»» œ»» œ»» œ»»» œ»»» ˙»»» Ó œ»»» œ»»» œ»»» œ»» ˙»» ˙»» œ»» ««ˆ« ««ˆ« «« «« Œ
36

? ˆ« ˆ« l » » l » »
======================
(lá)
l l » l » » l» ˆ« l ˙« . =l l
œ» œ» œ» œ» œ»
bb 43 œ»»» œ»»» œ»»» œ»»» œ»»» œ»»» »» œ»»» »» œ»»» œ»»» œ»»» œ»»» œ»»» œ»»» »» œ»»» œ»»» »» œ»»» »» œ»»» œ»»» œ»»»
37

======================
? l(lá)
l l l l l l =”
174
Leituras melódicas (menor natural)
professor.geronimo@gmail.com
I II bIII IV V bVI bVII VIII
lá si dó ré mi fá sol lá

44 ˙» ˙»» ˙»» ˙»» ˙»» ˙»» w œ


» œ»» œ»»» œ»»» œ»» œ»» œ»» œ»» ˙»» ˙»»» ˙»» ˙»» ?
b » »
» » l » l » l » »
l» » l» » » » l » l » » =l l
38

======================
?
(lá)

c œ
» œ
» ˙
»
» œ»» œ»» ˙»» ˙» ˙» œ»» œ» œ»» œ»» ˙»» ˙»» œ»» œ»» œ»» œ» œ»» œ»» ˙»» œ»» œ»» ˙»
? b »» »» » l » » » l »» »» l » »» » » l » » l » » » »» l » » » l » » »» =l l
39

======================
(lá)

3 œ» œ» œ»» œ»» œ»» œ»» ˙»» œ»» ˙»» œ»» œ»» œ» œ»» ˙»» œ»» ˙»» œ»» ˙» œ»
b 4 »» »» » l » » » l » » l » » l » »» » l » » l » » l »» »»=l l
40

======================
?
(lá)

2 ˙
» œ
» œ»» ˙»» œ»» œ»» œ» œ»» ˙»» ˙»»
˙
» » » » » »
? b 4 »» l »» l» » l l » l» » l l » =l l
41

======================
(lá)

4 œ
» ˙
» œ
»
» œ
» œ
» ˙
» œ
» œ
» œ
»
» ˙»» œ»» œ» œ» œ ˙» Œ œ» ˙» œ» œ ˙ ˙
œ œ Œ
? b 4 »»» »» »» l » »» »» »»» l »» »» l »» » » l » »» »» »»» l »» »» l »» »» »»» l »»» »»» =l l
42

======================
(lá)

3 ˙
» œ
» ˙
»
» œ
» œ
» œ
» œ
»
» ˙»» œ»» ˙»» œ»»» œ»» œ»» œ» ˙» œ» ˙» .
? b 4 »» »» l » »» l »» »» » l » » l » l » » »» l »» »» l »» =l l
43

======================
(lá)

4 œ
» œ
» ˙
»
» ˙
» ˙
» œ
» œ
»
» ˙»» ˙»» ˙» œ»» œ» ˙» œ» œ» ˙ œ» œ» ˙» ˙
˙
? b 4 »»» »» »» l » »» l »» »» » l » » l »» » »» l »» »» »» l »»» »» »» l »» »»» =l &l
44

======================
(lá)

## ««ˆ« Œ ««˙ «« « «« « « Œ « « « « «« «« Œ «« «« « « « «
« « «
« « «
« «
«
& _««ˆ _««ˆ ˆ« _««ˆ l ˆ« ˆ« l « ˆ« «ˆ« l ˆ« «ˆ« _««ˆ l _««˙ «ˆ« _««ˆ l «ˆ« ˆ« ˆ« l ˆ« ˆ« «ˆ« _««ˆ l «ˆ« _««ˆ _«««˙=l l
45

======================
##
(lá)

« « « «
« «« «« «« «« «« « « « « « « « « « «
« « «
« «« «« « «
« « « «
& _««ˆ _««ˆ «ˆ« ˆ« l ˆ« ˆ« ˆ« ˆ« l ˆ« «ˆ« _««ˆ _««ˆ l _««ˆ _««ˆ _««˙ l _««ˆ «ˆ« _««ˆ _««ˆ l _««ˆ _««ˆ «ˆ« ˆ« l «ˆ« ˆ« ˆ« ˆ« l «ˆ« _««ˆ _«««˙=l l
46

======================
(lá)

## ««ˆ« ««ˆ «« « «« « « « « «« « « « « « «« «« «« «« « «
« « « « «
«
47

« « «
& _««ˆ _««ˆ ˆ« _««ˆ l ˆ« ˆ« « l ˆ« «ˆ« ˆ« «ˆ« l _««ˆ _««ˆ «˙« l ˆ« «ˆ« _««ˆ _«««ˆ l _««ˆ _««ˆ «ˆ« ˆ« l ˆ« ˆ« ˆ« «ˆ« l _««˙ _«««˙=”
======================
(lá)

175
Leituras melódicas (menor natural)
professor.geronimo@gmail.com
I II bIII IV V bVI bVII VIII
lá si dó ré mi fá sol lá

b b c «« «« œ» œ» œ»» œ»» œ» œ» «« «« «« «« œ» «« «« œ» œ» «« «« «« «« «« œ» œ» œ»» œ»» œ» œ» œ» «« ««


48

ˆ« ˆ« »» »» l » » »» »» l ˆ« ˆ« ˆ« ˆ« l »» ˆ« ˆ« »» l »» ˆ« ˆ« ˆ« l ˆ« ˆ« »» »» l » » »» »» l »» ˆ« ˙«=l l
======================
& (lá)

b b «« «« œ» œ» ˙»» ˙» ˙» «« «« «« «« «« «« «« ˙» «« œ» œ» œ»» ˙» œ» «« ««
& ˆ« ˆ« »» »» l » »» l »» ˙« l ˙« ˆ« ˆ« l ˙« ˆ« ˆ« l »» ˆ« »» l »» » »» l »» ˆ« ˙«=l l
49

======================
(lá)

b b «« ««˙« ˙» ˙» ««˙« ˙» w «« œ» ˙» œ» œ» ˙»» ˙»» œ» œ» «« œ» «« ««


l ˆ« »» »» l »» »» » l » »» »» l ˆ« »» ˆ«=
50

& ˙« l »» »» l »» l
======================
(lá)
ˆ« l l

b b «« ««ˆ« ˙» ««ˆ« œ» ˙»» ˙»» Œ œ»» ˙»» œ» ««ˆ« ««˙« ˙» œ» œ» œ»» œ» ˙» Œ ««ˆ œ» ««ˆ« ««
& ˆ« »» l »» » l » » l » »» l »» l »» »» » »» l »» « l »» ˙«=l ?l
51

======================
(lá)

bb «« «« ««˙ ««ˆ« ««ˆ« «« ««ˆ« ««ˆ« œ»» œ»» ˙»» œ»» ««ˆ« ««˙« œ»» œ»» œ»» ««ˆ« ««˙« «« «« ««˙« «« ««
52

? ˆ« ˆ« « l
======================
(lá)
˙« l » » l » » l » » l » l ˆ« ˆ« l ˙« ˙«=l l

bb 44 «« ««ˆ« ««ˆ« ««ˆ« œ»» œ»» ˙»» ««ˆ« œ»» ˙»»» w œ» œ


» ««ˆ« ««ˆ «« «« « «« «« «
l »» »» « l ˆ« ˆ« «˙« l ˆ« ˆ« «˙« l w =l &l
53

ˆ«
======================
? l» » » l » l

bb «« «« «« «« « «« «« œ» œ» œ» œ»» ˙» ˙» œ» œ» ˙»» œ»» œ»»» ˙»»» œ»»» _»œ»» ˙»»» ˙»»»


(lá)

& ˙« ˆ« ˆ« l ˙« «ˆ« ˆ« l ˙« »» »» l »» » »» l »» »» »» l » » l
54

====================== l =l l

b «« ««ˆ« œ» ˙»» œ»» œ»» œ»»» œ»» ˙»» ˙»» Œ œ»»» œ»»» œ»»» ˙»»» œ»»» œ»»» œ»» œ»» ˙»» Œ œ»» œ» ««ˆ« ««
(lá)

b
55

& ˙« »» l » » » l » » l »
====================== l l » » l» » l »» ˙«=l ?l
_
œ
» _
œ
» _˙»» _»œ» œ» œ» œ
bb »»» »» »» » » » » »» »» »»» œ»»» œ»»» ˙»» ˙»» ˙»» œ»» œ»»» ˙»»» œ»»» œ»»» œ»»» œ»»» œ»»» œ»»» ˙»»»
œ
»
(lá)

56
˙ œ
» » »
======================
? l l l » l» » l» l l =l l
(lá)

_»œ
bb 43 œ»»» œ»»» œ»»» ˙»»» œ»»» ˙»»» œ»»» œ»»» »» œ»»» œ»»» œ»»» œ»»» ˙»»» œ»»» œ»» œ»» œ»» œ»»» ˙»»»
57

======================
? l
(lá)
l l l l l» » » l =&l l
176
Leituras melódicas (menor natural)
professor.geronimo@gmail.com
I II bIII IV V bVI bVII VIII
lá si dó ré mi fá sol lá

bb 4 «« « « « « « « « «« «« œ» ˙» ˙»» œ»» œ»» œ»» œ» ˙» œ» œ»» œ»» œ»»» œ»»» _»œ»» ˙»»» ˙»»»
58

& 4 ˆ« «ˆ« «ˆ« «ˆ« l «˙« «ˆ« «ˆ« l «ˆ« ˆ« ˆ« »» l »» » l » » » »» l »» »» » l »


====================== l =l ?
l
(lá)

bb c «« «« «« « «« « « « « « «« «« «« ««ˆ« ««˙« ««˙« ««ˆ« œ»» ˙»» ˙»»» ˙»»»


59

˙« ˆ« ˆ« l «˙« ˆ« «ˆ« l _««˙ _««˙ l _««ˆ «ˆ« ˙« l ˙« ˆ« l


======================
? l » » l =l &l

bb 4 «« « « « «« «« œ» »œ œ» «« ˙» »œ œ»» ˙»» œ»» »œ ˙»» œ»» œ»»» ˙»»» œ»»» _»œ»» w


(lá)

60

& 4 ˙« «ˆ« «ˆ« l «˙« ˆ« ˆ« l »» »» »» ˆ« l »» »» » l » » »» l » » l


====================== l =l l
(lá)

======================
& l l l l l l l =l

======================
& l l l l l l l =l

======================
& l l l l l l l =l

l l l l l l l =l
======================
&

======================
& l l l l l l l =l

======================
& l l l l l l l =l

======================
& l l l177 l l l =”
Leituras melódicas (menor natural)
professor.geronimo@gmail.com
Aprendendo Canções Musicalmente

1-Ouça a preparação que define a tonalidade


2- concentre-se na tônica, a nota de repouso, entoe com boca "chiusa" , ou sílaba neutra"pam"
3-Ao ouvir a canção use os movimentos do passo, ou movimente-se, simplesmente subindo e
descendo os calcanhares, ou erguendo os pés alternadamente bilateralmente, também pode-se usar
movimentos de regência, junto com a pulsação, lembre-se ritmo é movimento.
4-Ouça a canção mais uma vez, acrescente movimentos relativos a subdivisão.ex. movimentos com
as mãos, palmas leves nas coxas.
5-Ouça a canção mais uma vez, movam-se em fluxo, braços, ombros, quadris etc..improvise
movimentos.(ritmo é movimento)
6- Cante a melodia, use sílaba neutra, concentre-se apenas nos sons da melodia, deixe a letra para o
final.
7-Cante o baixo (com sílabas neutras)
8-Cante o baixo, no início trabalharemos com baixos simples (Tônica e Dominante) em modo Maior
e menor, quando estiver na tônica sinalize com o dedo "um", na dominante sinalize com "cinco"
dedos, ou use os sinais de mão:dó e sol ou lá e mi.
9-Ao cantar o baixo com mais consciência, use as sílabas de solfejo: Dó ou lá (1) e Sol ou mi(5)
10- ao fim da canção cante a tônica, a nota de repouso
11-Cante a canção com letra
12-Faça a audiação da canção e ao terminar levante a mão ou use uma palma leve.
13-Faça a audiação da canção em grupos.

Bons Estudos.

178
professor.geronimo@gmail.com
Canções com Baixos

24 ««ˆ ««« . «« «« ««ˆ« «««ˆ . «« «« ««ˆ« ««ˆ« ««« «« ««« « « «« «« «« «« «« «« «« «« «««ˆ . ««ˆ« ««« «« «« «« «
Cai cai balão

l& j « l ˆ ˆ« ˆ« l ˆ« ˆ« l ˆ ˆ« ˆ« l «ˆ« . ««ˆ ˆ« l «ˆ «ˆ« ˆ« «ˆ «ˆ« ˆ« l ˆ«


====================== l ˆ ˆ« ˆ« «ˆ« l _««ˆ . =l
l l l l l l l l l l
l 2 l «« «« l «« «« l «« «« l « « l « « l « « l « « l «« l
l? 4 l ˆ« ˆ« l ˆ« ˆ« l ˆ« ˆ« l «ˆ« «ˆ« l «ˆ« «ˆ« l «ˆ« «ˆ« l «ˆ« «ˆ« l ˆ« . =l
======================

«« «« « « « « «« «« « « « « «« «« « « «« «« ««ˆ« «« «« « ««
Marcha soldado

ˆ ˆ« « « «
ˆ «
ˆ «
ˆ « ˆ « «
ˆ « « b 68
« ˆ« l _««ˆ _««ˆ ˆ« l
l======================
& «
ˆ« l ˆ« ˆ« ˆ« «ˆ« l
«ˆ l «ˆ« . j « ˆ l ˆ« «ˆ «ˆ« l _««˙ l l =
l l l l l l l l ll
l «« «« l «« «« l «« «« l « « l « « l « « l « « l «« l l 6
l ? ˆ« ˆ« l ˆ« ˆ« l ˆ« ˆ« l «ˆ« «ˆ« l «ˆ« «ˆ« l «ˆ« «ˆ« l «ˆ« «ˆ« l ˙« l l b=
====================== 8

6
Mulberry-Bush
« ««« ««« «« ««ˆ« «««ˆ «««ˆ ˆ«« «« «« «« «« «
b «
« «
« «
« «
« «
ˆ
j
« ˆ ˆ «
ˆ «
« «
« « j
l & 8 ˆ« ˆ« «ˆ ˆ« l
====================== ˆ« jˆ« l ˆ« l ˆ« ˆ« «ˆ« _«ˆ« . =l
l l l l l
l 6 œ
»
» . œ
»
» . l œ»» . œ
»
» . l ««ˆ ««« . l «« ««« . l
l? b 8 » » l»
====================== » l « . ˆ l ˆ
« . ˆ =l

« «« «« « ## 4
b «
« «
« «
« «
« «
ˆ
j
« «
ˆ «
ˆ «
«
ˆ «« «« ««ˆ« ««j «
« «
«
ˆ« «« «« l ˆ« . ˆ« . l l = 4
l & ˆ« «ˆ ˆ« «ˆ
======================
l ˆ« j ˆ« l _«ˆ _j «ˆ
l l l l ll
l œ
»
» . œ
»
» . l œ»» . œ
»
» . l «« «« l œ»» . œ»» . l l # 4
l? b » » l»
====================== » l ˆ
« . ˆ« . l» » l l #= 4

## 4 « « « « « « ««« «« «« «« « ««« «« «« «« «
Frere-Jacques

« « « « « « « « «ˆ « «ˆ «
& 4 ««ˆ« «ˆ« «ˆ« ««ˆ« l ««ˆ« «ˆ« «ˆ« ««ˆ« l «ˆ« ˆ« ˙« l «ˆ« ˆ« ˙« l «ˆ «ˆ «ˆ «ˆ« ««ˆ« l «ˆ «ˆ «ˆ «ˆ« ««ˆ« l ««ˆ« __««««ˆ ««˙« l ««ˆ« __««««ˆ ««˙«=”
l======================
l l l l l l l l ”
l # 4 ««ˆ« « ««˙« l ««ˆ« « ««˙« l ««ˆ« « ««˙« l ««ˆ« « ««˙« l ««ˆ« « ««˙« l ««ˆ« « ««˙« l ««ˆ« « ««˙« l ««ˆ« « ««˙« ”
l ? # 4 «ˆ« l «ˆ« l «ˆ« l «ˆ« l «ˆ« l «ˆ« l «ˆ« l «ˆ« =”
======================
179
professor.geronimo@gmail.com
'y
%Øh'BÎBVNQVOIPDPNBQBMNBWJSBEBQBSBCBJYP FNVNB
BMUVSBTVQFSJPSBP%ØJOJDJBM BMUVSBEBDBCFÎB

4J'BÎBVNQVOIPTPMUP NBTBQPOUBSPEFEPJOEJDBEPSQBSBDJNB
6L FNVNÉOHVMPEFHSBVTDPNPUFUP

-È$VSWFBNÍPTVBWFNFOUF DPNBQBMNBFPTEFEPTWPMUBEPTQBSBP
DIÍP
/i

4PM&TUJRVFPTEFEPTQBSBRVFBNÍPUFNBNFTNBGPSNBRVFFNNJ 
6RO NBTJODMJOÈMPQBSBRVFBQBMNBEBNÍPGJRVFEJSFUBNFOUFWPMUBEPQBSB
WPDÐ

'B'BÎBVNQVOIPTPMUPDPNRVBUSPEFEPT QBMNBWPMUBEBQBSB
)i
CBJYP
FTUFOEFSPQPMFHBSFBQPOUÈMPQBSBCBJYP RVBTF
QFSQFOEJDVMBSDPNPSFTUPEBNÍP

.J.BOUFOIBBNFTNBGPSNBEBNÍP NBTNPWFSTVBNÍPQBSBRVF
0L
GJRVFQBSBMFMPBPTPMP

5p 3Ï&TUJRVFPTEFEPT NBOUÐMPTKVOUPT
FUSB[FSBTVBNÍPQBSB
GB[FSVNÉOHVMPEFHSBVTDPNPTPMP

'y %Ø'BÎBVNQVOIPDPNBQBMNBWJSBEBQBSBCBJYP QSØYJNPB


DJOUVSB

180
professor.geronimo@gmail.com
^ŝŶĂŝƐĚĞŵĆŽ

Ěſ

Ɛŝ

ƐĞ ůŝ

ůĄ

ůĞ Őŝ

ƐŽů

ŐĞ Ĩŝ

ĨĄ

ŵŝ

ŵĞ
ƌŝ

ƌĠ

Ěŝ
ƌĄ

Ěſ

181
professor.geronimo@gmail.com
Bibliografia
Percepção musical : prática auditiva para músicos Bruce Benward, Thimothy
Kolosick; tradução da 7ª. edição Adriana Lopes da Cunha Moreira. - São Paulo :
Editora da Universidade
de São Paulo Editora da Unicamp, 2009.
http://www.mhhe.com/socscience/music/benward7/site/

Sight Singing Made Simple


An Audio Course for Group or Self Study
By David Bauguess
HAL LEONARD Corporation

Progressive Sight Singing


Second Edition
Carol Krueger
http://global.oup.com/us/companion.websites/9780195386042/

Zoltan Kodaly 333 Elementary Exercises


Editora Boosey and Hawkes
http://www.sheetmusicplus.com/title/333-elementary-exercises-in-sight-singing-sheetmusic/4093600

Método Prince : Leitura e Percepção - Ritmo


Adamo Prince
Lumiar Editora

Solfejo - Curso Elementar


Edgar Willems
Editora Fermata

O Passo: música e educação / Lucas Ciavatta. - Rio de Janeiro : L. Ciavatta, 2009.


Ciavatta, Lucas
www.opasso.com.br

THE RHYTHM BOOK


2nd edition
RICHARD HOFFMAN
Belmont University
Harpeth River Publishing
Franklin, Tennessee, USA 2009
www.takadimi.net

GORDON, Edwin E. Teoria de Aprendizagem Musical – Competências, Conteúdos e Padrões.


Lisboa: Fundação Calouste Gulbenkian, 2000.

GORDON, Edwin E. Teoria de Aprendizagem Musical Para Recém Nascidos e Crianças em Idade Pré-
escolar – Lisboa: Fundação Calouste Gulbenkian, 2015.

GORDON, Edwin E. Tonal and Rhythm Patterns: An Objective Analysis Hardcover – June 30, 1976

Prosser, Steve - Essential Ear Training - for Today's Musician -Berklee Press - Hal . Leonard Corporation,
2000.

Schachnik, Gilson - Beginning Ear Training - Berklee Press - Hal . Leonard Corporation , 2007.

FREIRE, Ricardo Dourado. Sistema de solfejo fixo-ampliado: Uma nota para cada sílaba e uma
sílaba para cada nota. Opus, Goiânia, v. 14, n. 1, p. 113-126, jun. 2008.
http://www.anppom.com.br/revista/index.php/opus/article/viewFile/239/219
acessado em 23/02/2017

Marilyn Lowe - Rhythm and Tonal Patterns


GIA Publications , Inc. 2015 . www.giamusic.com
www.musicmovesforpiano.com

Larson, Steve. The Value of Cognitive Models in Evaluating Solfege Systems.


https://scholarworks.iu.edu/dspace/bitstream/handle/2022/3822/LarsonTheValueV14.pdf?sequence=1
acessado em 23/02/2017.

182
professor.geronimo@gmail.com
Lev Semenovich Vygotsky. Pensamento e Linguagem – Edição Digital
https://edisciplinas.usp.br/pluginfile.php/2477794/mod_resource/content/1/A%20construcao%20do%20pe
nsamento%20e%20da%20linguagem.pdf a acessado em 11/02/2018.

GAGNÉ, Robert. Como se realiza a aprendizagem. Rio de Janeiro: Livros Técnicos e


Científicos, 1971.

Teresa Mateiro, Beatriz Ilari, (Org.). – Curitiba: InterSaberes, 2012. – (Série Educação Musical).
Pedagogias em educação musical [livro eletrônico] .

183
professor.geronimo@gmail.com

Você também pode gostar